4KK5C

Structure of the clc-ec1 deltanc construct in 20mm fluoride and 20mm bromide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fluoride-dependent interruption of the transport cycle of a CLC Cl(-)/H(+) antiporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords H(+)/Cl(-) exchange transporter ClcA
total genus 42
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kk5C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kk5C01
5J9PA 3VXUA 1BFTA 4MAUH 1G7QB 2R69H 3HI1B 4ONFL 4XPFH 4YWGL 2VLRB 2BC4B 2HJFA 4PJIA 4HWUA 2H2SD 2YR3A 2MMXA 1CIDA 3S37H 2AXHA 5GZOC 2Z92A 5T1LD 3QCVL 1OOAA 3NZ8B 4XNYH 1MH5A 1HCFX 2WWMC 3FQWB 1AR2A 1A22B 2VTFA 3AXLB 1YJDL 1NKRA 3DV4A 1UWXK 3HE7C 1HWGB 3SDCD 4PBVC 4U1KB 4DCQA 5C0CD 4L1HA 3QFJB 1T5XA 1F4HA 1UH3A 2CMRH 3DXAB 4N8VB 3T3PE 4JAMB 3VGAB 4HV8B 3C2AL 1AQKL 3BUTA 1UM5H 4PJAF 4DVRL 3DX7A 5C1MB 3G5VB 4U6YA 2XTLA 1QPXA 1K8IB 3LQAL 4ODVL 3LS5H 1GIGH 4GAJL 1LO2L 3PQYD 4GBXA 1F2QA 3KPSD 1KCKA 4NJ9L 2VQ1A 1JFQH 1JTOA 3HI6L 3BISA 5F7EL 5JQ6H 1CFTB 2R2BB 4Z0XA 1L7TL 5C07A 4WFFE 2AJ3A 1JPGB 1PX4A 3GMPB 3LH2L 4PRPB 5GISL 3VW3H 5BZDB 4J2XA 4F9PC 5I9QB 1XCTA 1NLBH 5KZCB 3TA3A 4HXAL 5LCVL 3RBGA 1JPFA 4MCYB 1YNLH 5E6IA 4K9EL 2Z93B 4CGTA 3OJ2C 3KXFA 4R0LB 3LPFA 4NQSA 1HQRB 2X4OA 3HC3H 3MO1A 3WNMA 2QKIA 3QUYC 2NLJA 5EFIA 4JQXC 1N8ZB 2HT3D 1QBBA 2DYPB 2EYSB 3PQYE 5FA3B 5GJSL 2H2PC 3CVHA 4XBGA 1CI5A 1RJYB 1CXKA 2WIIB 3KPQB 2V17H 4PS4H 4OKVA 3LEVL 1JZ3A 1PZUB 1KXQE 1OGAE 1I7TB 5E1HB 4Z5RA 2XKNA 3MFFA 4QT5A 2H2PD 3GSOA 1OWRM 2I07B 1EO8L 4EOWH 2BRQA 4YHOL 2ZCLH 5EBMB 3F5WB 2XN9E 3UMTA 5D7KD 3TZVA 1MFEL 1NANH 3S96A 4ELMF 4JR9L 4WTXA 4HQQH 1UENA 3RZCB 2P48B 4H5SB 1R24B 4K8RD 1KGCD 2FJHA 3O4LE 4MNQE 4IM8A 2FSEB 2MPAL 3W5NA 5IFJB 4I3RH 1ZHLB 3VFRA 2GHWB 2R2CA 4PGCB 4FZ8L 1P4IH 3C8KA 4PY7B 1CTNA 2X09A 3UEZA 4ZOEA 3WUWB 1T5WB 2FATL 3QQ4A 5MERA 4P3DB 2DQEH 3PWJA 4JQIH 2UYLB 5I16A 3TCLB 1CG9B 3WEXB 1IM9B 2VYRE 5I15H 1RMFH 4L3CA 3VGGA 1KUMA 2CDFB 1QRKA 2EC9T 2G2RA 3B8SA 2MCG1 3BVNA 3WNKA 5J6HA 3O45B 4WHCA 1AGDA 4HJJL 2X4RB 4M4RA 4RQQA 2OTWA 2EKSB 4QOKB 4A6YH 3CMOL 3G5ZB 1QRNE 5GRJH 4TVPE 4QXUL 2VITA 1I7UB 4LGSB 6FABL 1AKJA 5I73B 3L3DB 3NIFF 1VCAA 2W59A 3T4YA 3PL6C 1EA9C 5SWZE 2XFXB 4WDIA 3ARWA 1X6NA 2E9BA 5CGYD 3MPCA 3AU1B 5B3NA 5I1IH 4XP9L 4PJ8C 3ARZA 3VFWA 2XN9D 1NPUA 1L6XA 4Y16B 5EO0B 3QEQE 1HI6A 4PJFA 1EJ6A 1AE6L 2X89A 5JQ6L 3EO1B 5L2KB 2F53B 4NO0D 5MI0B 1R3IL 4M8VA 5DEZA 4EXKA 1DANU 4D9QD 4DGYH 4X6EA 3Q5OA 4RGNC 4S11A 3VXNB 5DJYB 4OZGB 2PXYC 5TPWH 2BSRA 5DMGD 5TF0A 5JW4M 4XNXH 5IB3A 3FB8A 3LKSA 5HSFA 4TTDC 1X5AA 3QEUB 2OL3L 4HIHB 2EE3A 4PRAB 4TNVK 1JPGA 4KDVA 1ZTXL 1SBBA 2VRAA 3QXDB 3HPLA 4WEBH 5FHBL 4Z18A 3IDYC 4X6DB 1AFVL 3T77A 1T3FB 3SDAD 2B7DT 1U93B 1J0JA 4Y4FB 2RJMA 5D7SL 4HGWA 1DBKH 1QLEL 3X11B 3E6FB 5GGRA 1ZWIB 5JLZB 2FCBA 4RAUB 2FJFA 5D2LA 4RGMC 2J5LC 4F7EB 1DQJB 1HWHB 1J0HA 3MRRA 5F7NC 5F6HJ 2Y7QB 4RFNB 1S9XA 2BY2A 3RHWK 4HFUL 2LAGB 2VC2H 5D7SH 1KJMB 1XGTA 3UPRA 4K7PY 4GKOA 2AEIT 4OLXH 5DQDL 4XHJC 4YDKH 3K7UA 2ATKA 4MAUL 4ONFH 3OXSB 4ZAKC 3E8UH 2CUIA 1AI1H 1J9CT 1OP5K 1EFQA 5SWSD 3MRGB 1EAPA 3RFZC 2X4UB 1U8IA 3QPQD 1DL7H 4IHOB 3KPRA 2ERJC 1K3ZA 1F4YH 1MPAL 4KTEH 5JIPA 3C6LD 4M62H 2Q20A 5E5UB 5DK0B 5KN5B 2CRMA 4YHOH 1T6VN 5HPMB 3BGMB 2VMFA 4WW1B 1T0NA 3VFRB 4DKEL 4G8GE 3BMWA 2GJ6D 4YXKH 2FEDD 3ARRA 3Q5TA 1WZKA 4GG6E 4J3VA 3MUHL 4ODTL 3BESR 5FYLH 2Y72A 1FL6B 2DJUA 3BGAA 1HINL 1B6UA 1SJHA 3VXRB 3NA9L 5E00A 5F9WB 1HSAA 1TTUA 3IU4H 1YNLL 4F33A 4I2XB 5DVMA 5DD3H 1S9WA 1BD2A 2R2HB 2DBLL 5M94B 4HWZB 4MJIA 1IQDB 3SGKA 2A0LD 4HCRL 4CDHA 1NMAL 4N5UA 4XNZB 5HHXL 2YD9A 4FXKA 2HVJA 1HKFA 1F58H 1RZFL 5HGHA 1CGUA 3FQTB 2NX5A 1TIUA 1YMMA 2X4PB 4LGPB 5EDXA 5E2TL 4LPUA 2NYYD 4PRBA 1LNUA 2I07A 3JSSA 5KJRL 3OG6B 3TT3L 3L95B 3OKLB 5H35B 2XWTA 2I5YL 4WW2C 1VPOL 4XMPL 1N6UA 4OFKA 4I5BA 4LLUB 1EO8H 5DHYB 4EOWL 1VFAB 5MEPA 2GJ6E 1DUZA 5A2IH 1P9MC 4CW1A 2YSSA 3C9NB 1LDPH 4DZ8B 5BS0E 1P7QB 4G8IA 4F7TB 3X3GL 3MCKA 4N8PA 1G9ML 2AJSH 2XN9B 2JK5B 2JJTA 2Q6WB 1IGIH 5E6IB 5H94B 2HJLB 3I6LE 1J5OL 4JHBA 2IH1B 3P4MB 5D1ZA 1JHKH 4CMMA 3AREA 4XBPB 5D2LB 4PP2A 4FOMA 2GAZA 1WIPA 3THMH 5ISZE 5I1LB 3MRNB 5FDYA 4FQLL 4K3JH 3DROA 1L9NA 2EIDA 5TE7H 3AAZB 2C1PA 3JWDC 4MJ6A 3CDGA 1KBGL 3O4OC 1SY6H 3GSUB 1QR1B 1R5VA 1PDKA 5C08D 4ZD3L 3PV7A 1QFWL 4YHLL 4XBEL 5ERWA 4EEEA 1FVCA 5KVFL 2A77H 1RUAL 1EUTA 4R26H 4Y4HA 5FGBA 4KGJA 2YC1A 4IJ3C 1OTSD 3RVXC 1N6VA 4UOJA 4ZAKB 3TGXA 4D3CH 3U2SA 1SVCP 3SDXA 1RULH 4Y2DB 5DJZB 1EJOL 2WZPD 5EU7C 2Y5TA 3MLVL 4FG6D 5CJOL 4N0YL 2XZAH 1JHTA 4EDXB 1QLRA 5F9DC 4PFEA 4UIMB 5I18H 1UB5A 3ARDB 2GJZB 1RHHA 4J3WA 2WQRA 2A83A 4XAWH 4V1DA 3WLBB 4H25B 3QUXA 3U0PA 1IMHC 5KSUA 3WDHA 1IEAA 4WTZA 3B2UD 5CILL 3P77B 4LIQL 2V2TB 1OAYH 1RZ8B 3CVIL 3HCVA 1S7WB 5T3ZL 4H8WC 1QSEA 4Y19D 2OP4L 1FLRH 4ODUA 3FQUB 4R8WH 4Z7UE 3I6LD 32C2B 1ONQA 3VMOA 5JR1L 4WHYH 2VLKE 3EYQC 1V3MA 3T65A 4K3HA 3KPPB 3D0LA 1HEZB 2A0LC 3Q48A 4RBPH 1T2XA 3P9MA 4PJ7B 4U6VL 1D5IH 2DKSA 3QEHA 3REWB 1QFWM 3OKNA 1M7DB 5T3ZH 3N1FC 2WUCH 2EDFA 1U8IB 4GUPA 3VXMD 4PJ8D 4M4PA 3OX8B 5B8CB 5E6ID 3QDMB 3SDAB 1LEGA 3I84A 4X7SL 3QP3A 5JPNA 4FRWA 5TH2B 3ZO0A 1CT8B 3JZ7A 2F74A 4AL8H 1M4KA 2W0FB 5K9KA 3MR9A 4JFZL 5I18L 1X5IA 4TPRH 2QR0A 1ZEAL 2E6PA 1S7UB 3B9DA 2HLFD 2DWEA 3P73A 1JPFB 2WBJD 4XCCH 1KG0B 2QSCH 4O2EA 4B7IA 4XVUD 2AEPL 3FB8B 4IHOA 4WV1C 5KSBF 3QRGL 4NQDE 4X4YA 2CSPA 4XXCA 1S3KL 1TQBB 4PLKD 1EHAA 3MROB 3ZE1F 4JVUA 1C7SA 4DN4H 1CFTA 4ZOAA 3U4EB 3PL6D 3RWDA 4X9GA 1INDH 1ZK9A 5L8JB 4GG6B 5F7WC 1B9ZA 2CPCA 1YY9D 1RZKH 4BQBA 5DD6B 4AEIL 4ODHH 2ZJSH 1KBGH 5I30H 3RGVC 2J7LA 4PJ8A 3NACH 5JMOC 3MLUL 1JV5A 3VGDA 4AMKL 4U3XA 1KN4L 1QHOA 4M8QB 1S8DA 5JW5B 1KTDB 3I2CH 5HYJD 1U92B 4MAYA 4X4XA 2H2SC 1KELL 3GJEB 3NCFB 1KV3A 1IGIL 4A2LA 3QISA 3EOBB 4TUOB 4EQ3A 1CK0H 4JFXA 4KRPC 3U36A 1J18A 1QYGL 1BWWA 4NQEA 4NQXB 3WL9A 2OZ4L 3QPXH 5DVKA 5IIEB 3QDJB 3VXSD 4L4VA 3NIGE 1BQSA 2DTML 4QHMB 3RI5F 1QQDA 3QR2A 3BP7B 3IF1A 3GDBA 1JJUA 2X7LB 4PJXA 4FP8L 5FCSH 3BEVA 2BSTB 4LSPL 5D1XD 2DLIA 4P9HC 4R7DB 3GSNH 3BX7C 3IS0X 4R9HA 1SYVA 3VGHA 3KLHD 4JY6B 3MOAL 2GIYA 1ZHNA 3ZKSD 2VH5H 2DIJA 5C6TH 3TVMC 2JCCF 4V2BA 2ENYA 5BV7H 5FECB 1AHWC 1RZGA 1YA5A 4HZLA 1OCWL 2UWEA 2A9ML 4TNVF 2W65B 4AIZA 5KS9B 2NR6D 5T33H 1VACB 5BVPL 4HZLB 4QRRE 1DTUA 1WEJH 3V0AC 4CNIA 1U41A 2A73B 1OWWA 4PGJA 5GS1B 1FLRL 4KROB 4TSBH 4OLZL 4Z7UF 1MCHA 3MNZB 4NQED 1ERNA 3GSRA 4AH2B 1OHQA 1UH2A 3NA9H 1VFOA 2H3NB 4NO3B 3O8XC 1SHMA 3ZT6A 1OVZA 4WWKD 3C08H 1HQ4A 3QDHA 4GSDH 1MOEA 1G6RA 3R0MA 4MB3A 4MS8C 3U9PL 4JHWL 4LCWD 2DDQL 5LGJB 5EFIB 5F44A 3I75B 4P3CH 1CGSH 4DKEH 4DEPC 4WGVB 2W9EH 3C5JA 1DUYB 3A67H 1ZLUK 1PLGH 1A14H 1V05A 2IAND 2W9DH 1GH7A 3KYKH 5DJCB 2QADD 5KVFH 1I3VA 1AGCA 3Q1SH 1M05A 3D85A 4M6OH 4KKCC 3F5WA 4X9BA 4G9FA 3BHBA 2ADGA 4XWOC 4I13B 4LFHG 4XPAH 1FNSL 1IC5H 5A3ID 1QSFA 4ONGH 1J0IA 1RHFA 2EE6A 3NZHL 4C4KT 4NNYB 5KSVA 1LO5B 5TFSL 4JG1H 4OCXL 1X7QA 2EIEA 5BZWA 4PJGA 2VDPL 2XWBB 5DF0A 3BPNB 4LF3B 4Y4HC 5FGBC 5F8RC 3S3JA 3QIBD 4P46D 3P2TA 1G9MH 1IGJB 2AJSL 2VXTH 5CJ8A 4P5TA 2QKIB 1NBZB 1A1OB 3ARBB 3RL2B 5BQ7A 4LOUC 1DQLL 3S36H 1TMCB 1J1PH 5I2IB 1BLNA 1I7RA 2HRLA 3F7PC 2NZ9C 2YN5A 1OAXL 4LDOB 1QFHA 4OV5A 4NJAH 2E7CA 4GXVH 4OFVA 5INDB 1Z9LA 2E5EA 2JLLA 3ZHDA 2HVKA 4PRPA 1BX2B 2YXFA 1IC4H 1UXSA 1XEDA 4S2SA 3MACH 3ELAT 1GL4B 3Q6GH 1RZJC 3P0YL 4LLYB 3UTQA 3CFIC 1CGTA 4LSSL 4HK3J 4X4YB 5HDQL 3TVMA 3FHAA 3KJ6L 3NPZB 5IFHH 2VERN 5IG7A 3AC0A 1JPTH 3QUML 1UYWL 4M7KH 2Q87A 4JRWA 1FFQA 1NMAH 4GXUM 5DUBA 2VLRA 1DQQB 1AR1C 3ROLA 3S5LB 4DFHA 3EBAA 2XZZA 4PGCA 3SCMC 3GI8H 3UZQA 4JFFD 4CBPA 4AYFA 5T1KB 1AQDB 4PIRF 4I18B 1YPZE 5T1DL 2UZIH 2D7NA 1EHLL 1WISA 4I0PB 1YN6B 2WANA 4GRLB 5A2JH 5GGVH 1MSPA 2VDKH 2W1NA 3FQWA 3QEQB 3DPBA 2BMKB 3OJVC 4KK8D 5GGVY 5FYJL 4OLUH 2WW8A 4PY8J 3JV5A 3S96B 1UCBL 2PNDA 3RWIB 1MJ7L 2EECA 5DA4A 3O11A 1ZT7A 1N0XH 3OR6A 4X4ZA 2HLAA 4OIIL 1IGML 2PO6A 3B9VA 4XP5L 5KS9E 4PJHB 1E28B 3BRDA 3K8KA 5IB4A 3N06B 3BQUD 2YEZA 3BKCH 3MRBA 2VDLL 1EVTC 1N64H 4N8CL 1A6AB 4G8EA 2ATPA 4I0KA 4YDIL 5D70L 5MHSD 1FJ1A 1L7TH 1TETL 4HFWB 1OCWH 5GRXG 1UZ6F 3WO4C 4MXVE 2F8VA 3DBXA 1JPTL 3QUMH 5F7FA 1JRHH 1OARL 5IT2L 1BLNB 4NOBA 3D18A 5DVOA 1FO0B 3DURB 1OAQH 4H88L 1WQVT 1WZLA 3QI9A 4C83A 2FSEA 3Q5YA 3QG6A 4AZ8A 3GSQB 3PIQB 1HILA 4ZS6C 4CDGC 4NQCD 2HFEA 4JG0H 3W0WB 4POZD 3WO4B 2CMRL 1JZ7A 2JELL 4KZEH 1MF2H 2VLRE 4LKCB 2J1KA 4S1SL 4NZRL 4I5BB 4LLUA 5JZ7D 4HKZB 4PJXB 3OPZH 1KNOA 4DZBB 2EH8H 1CYGA 3ARFD 2R56H 4PRAA 3L3JB 5C0GA 5FA3A 5IOPA 4OZIA 4UQ2A 1MCOH 4AEHL 5HYSG 4WWKB 5ESAB 5IGXL 1AIFA 4S1DC 3RL1A 4XNUH 5JPMB 3ECBA 1OM3H 2PKDA 1E6JL 5F3HA 2ZUQC 5C0AB 5BO1L 3S37L 4HJ0C 1S5IL 3IXTA 2BY3A 5D2NC 5E70A 2GTZA 3DIFA 4N9GB 4PRPE 4TRPL 3OZ9H 3WHE0 4XAKD 3JTSA 4PJIE 4JFDB 2J6EL 1PFCA 3GMRA 4RBPK 4J3SA 4ONGL 4HXAH 1JNNL 2J8UE 2Y06H 4M1CD 4P4RB 3IXAB 5B38G 4QHNB 4HIHA 3GHBH 3JTTB 3IFOA 4POZC 3QCTH 4J3UA 4PJDA 4QHKI 3L6FB 1RZ7L 5GS2D 1N5AA 1T1YA 2DWEB 2QQNH 5TE6L 4NCC1 3WV0A 4ZNCD 3FB6B 4X6EB 1VEPA 5DHYA 3TV3H 5EU5A 2HT2C 3SE8L 2W9EL 3FFDB 5FF6B 5JUEL 3UYRH 3VD7A 1CXFA 5CZVL 4PGEB 3DMMD 4UAOC 4OBRA 4OFDA 5T5NG 2BSSA 4QRRB 1KEGL 3MLWH 2NY5H 5JHLL 1KIPB 3PQYB 4XMLL 4MQSB 1GCFA 3L3DA 5CINH 1NEZB 1U8PB 2AGJH 4PGDB 3L3GB 4OGZA 4F7CB 1XR9A 1MUJB 4YHNA 2J5LB 1L7IH 5E2WL 3VXOA 3AXLA 4UTBH 2OK0L 3WJLC 3F65A 1XGQA 5DRNB 4U6VH 4GAGH 3EIFA 1AD0B 4IOFD 4OD2A 1NUGA 4G6AD 3GUTA 3U30B 4P23A 5AD0A 5BS0D 2VLJB 4XPGH 4Y4HB 2GCYB 3M17A 3HNSH 5HI4D 3GSOB 1CFQA 4OI9A 3QIUA 1K4CB 3EO0A 1MCBA 3VXQA 4JM4L 3U9UB 3TIEA 1N6QL 4C56B 3TBVB 3ZE0F 1KPRA 4L8SB 4QTHA 5IF0B 4KUZH 4BH8A 4EVNA 3FQNB 4HQQL 3TFKD 5J4MA 3NTCH 4JFDA 2KQMA 1G7PA 5DHVA 4M1DL 4I0PD 5FYKH 1KJ3L 4YO0A 5D5MF 4U6XB 1DLFL 5ADPL 3OKOA 5TQ2L 2C26A 3I3DA 4I9WE 4XH2B 5FCUH 5EWIH 3BZ4B 1NC4D 1JIBA 1UVQB 3GIVA 4L4VD 2OSLA 3ARDD 1TZGH 2EKJA 4U49A 5ABDE 4Z7WA 1J1OL 3ULUE 1X5JA 3VGAC 3BQUB 3HN3A 5T5FH 3OGCB 4P99A 4KZDH 2AK1H 4KQ4L 4XCYA 4LOUD 3NACL 4X8JB 3AREB 3L3OB 4HBQA 4P4KC 2VO5A 3U4BH 4HPYL 5C2UB 4LCIL 4OSUL 1UACL 3W2DL 4K3DH 4WDIB 4F58L 1S7TA 1RD6A 3FT4B 5C0AE 1OLLA 4R4BA 4B53A 2ARJA 3VXTA 3MLRL 3C5JB 2GK0A 1T1ZA 2RGSA 2X5PA 3ZDZF 4L9LB 5ACZB 3GMOB 3CCHA 3OKEB 1A9EA 3GGWA 4W6XB 3SKNB 2YRLA 3QSKB 4OT1H 2JIXB 5DS8A 1CGXA 2WIMA 3C6LC 4RGNE 2CXKA 5HYSA 4LSQL 4FXLA 3OBAA 4UNUA 4L8BB 4F15C 2PYFB 2BSRB 4UNTA 5CFHA 2CXGA 2APBA 3QO1A 2Z35A 5HHNB 2WUBL 1G0DA 4UDTA 3MOBH 1PKQB 3ULVL 2R29L 4LNVA 5AZ2L 2W0FA 1IEBA 5E2TH 4JRYD 1XCQB 2FH8A 2X41A 1ZHNB 2FX8L 4P2QD 4HKXB 4YBHA 3CDYA 4XX1E 5DTFA 1GC1C 1CE1H 3WMSA 3HZMB 3IRZA 3SE4C 4XGZB 1BM3L 3FONA 3G6DL 1HZHL 5ICZA 4YDIH 5D70H 2E9JA 2R2EB 3HZMA 1M7IA 2E8ZA 1MI5E 1JNLL 2VSCA 3BKCL 5DUPL 4G8GA 2PF6A 1Z0NA 5FOBB 1T7VA 1VKXB 1G1YA 1CR9L 2IAMB 1A7RL 5IBLC 1RUQH 2YEZB 4S1QL 2LFGA 4FQ1H 1GHFH 5GHWH 1JCKA 4M6ML 3QUMB 1TVBA 4G7YH 5HDBE 1BAFL 1J88A 1MFAL 5L2JA 2ZOKA 4HH9A 5I1CH 4PJFE 1EERB 3WUWA 1WC7A 1HSBB 3WFBH 3W9DB 1NCDH 4LVOC 5IG7B 2E7MA 3T2NH 5EU6A 4YQXL 2FRGP 4OZ4B 3O41A 1NLDL 2CR3A 2X1XR 4IIQA 3U1SL 1P2CB 3IFLH 2W0LA 1E4JA 3CK0H 5DDHB 2EDQA 1DVFA 1EH9A 2FBJH 4NFBA 3MC0A 4EI5A 1UKSA 4N1EA 2VDNL 1BFVH 4PJEE 5IFHL 5KOMC 4XP1L 2NY2C 2NTFA 3EYQD 3UZEA 2FYYA 3O4LA 1GGIL 2NX5E 3AB0B 4G6JH 3A6BL 5FO8A 2CJUL 5L0QB 3CMGA 3KLHC 1D9KD 2ICEB 3TO2B 1MJUH 2Y06L 5ETUB 1YPZB 5TE7L 1JGEA 3G08B 5J1TC 4PJEA 4K8RL 4M02A 1MHEA 4NO5B 3P4NB 4R4FL 1CIUA 4YFLF 3EDKA 1JWSB 1G6RL 1RK0A 3B3IA 5I1EH 4M5YH 4O02L 2YPLB 4UMGA 4S0SD 5E2VH 1J1PL 4KROD 2V9TA 5MEOB 2QSVA 5HYIA 1E27A 4TN9A 4CN1A 2I27N 5IF0A 1GAFL 4OZFB 5HYFA 3L5WA 4XCNB 4X6DF 3C5ZC 2FR4B 4OZFG 5DMIL 4X6CE 5E8OB 4QRRD 4JPIA 1FV1B 4ODXA 2Z31A 5HDOA 1Y6NR 3S37X 5JOPE 1AFVH 5TFSH 2BNRA 1JI2A 2DB8A 2F74B 4LNRA 5FUCE 1Q9LB 5HHOE 4HDIA 1JP5A 2QQKH 1LDSA 3NIDF 1LO3H 1PJ9A 5E03A 5IROA 1KGCE 3TNNA 7FABL 1RZIB 1KYOK 4ODWA 1HKLL 1KLGB 1QD0A 2A6IA 1XAUA 4AT6B 2YK1L 4XNXL 4XXCC 5KZCD 3OKLA 2HFEB 1A1MA 1KPRB 4L8SA 4QNPF 1XF3B 1TJHH 3OKKA 4Q7DA 4QRPA 4IIQC 5CP3A 5DRXA 5GZND 4HZAA 2EEDA 2VZVA 4EI6B 5BMFH 4I8DA 4KHXL 2HJFB 3GJFB 1FZJB 5GIRB 3FAXA 4NM8H 1Q0YH 1TPXC 1CLOH 1QP1A 5GS1C 3VMPA 5GQBA 3L3HA 3VXUB 4XCEA 2OJZH 4DUVA 4O58L 2IQAA 4X98A 1KB5A 4WNQA 1CBVL 5SV4A 4F7CA 4QF1A 1QBAA 5EUOA 5CKGA 3ALPA 1N0XL 4MQ7B 3NFPB 4ZFOL 4E41A 1ZANL 3T0EB 3NZ8A 8FABB 3KXFD 4G8GB 3VG9B 2GFBB 2E27L 4L3CB 4S1RH 4QXTA 3PDDA 3O6KL 4DN3L 1H3XA 2VLJA 3HI5H 4HS8L 3MLXL 2FWOB 3T3PF 3QQ3B 3GO1H 5HDLA 5DC9B 1Y6MR 5DUMH 4NQXA 3PWLB 2J12B 4NQEB 4YIQB 3SE4A 4DGVH 3V52H 3ULVE 5I71C 3MGOA 1MCEA 4IMLB 4JQIL 3O2VH 5ANMB 4F9PA 1FPTH 3I50L 1P4IL 1ZLVK 5KSAA 3QYCA 3C8HA 3QQ9C 4KRPB 2OYPA 5DUBB 3LV3A 4UIKL 4LSRL 1YEGH 4WFFD 1G7HA 1VFMA 4MWFA 1VEMA 4ZPTA 2OR9H 2HT2D 4M7ZC 5C08A 3QAZB 3Q6GL 3P0YH 5F7HA 3E8UL 4FFWD 2AP2A 3WIIH 4XNQB 3WXVH 3GMNB 3PV6A 4N0RA 4MA8H 4CMMB 1ITBB 4QGYA 3GI9H 4GXUN 1Q0XH 3GZKA 2EYTB 3ULUH 3G08A 5GRWA 1U9KA 1MELA 5EZIH 3VXSB 1I3RB 4G3YL 5CEZL 1V7MH 1GAFH 3MA7B 2OR7A 4CKVX 3UPRB 4POYA 2WQ8A 3HE7A 1KTLB 2YD6A 4DW2L 1QEWB 3C5SB 4OCRH 1Y18A 4MVBC 1RVFH 3KPQA 1ORQB 1NBZA 2J8UA 1H8NA 1QBML 5HBBA 4LARL 1S78C 1CFNA 4RAUA 4V1DD 3MJ8A 4APQA 4U1SB 1KT2A 5IVNA 5TDOB 1LEGB 2AJXL 5I74B 1KCSL 3DV4B 1NGPH 1G7JB 2VZ3A 3B2VH 3FO0H 4DEPB 1WLHA 3EOTL 5ECJE 3FO2A 5L9DL 1VERA 4X6CB 2CLRB 3P73B 2HMID 1IAMA 3TJEL 5DURB 4I3GA 2W9DL 5IESL 1A9BA 3ALWA 3HAEG 3QIWD 4HUXB 4G7VH 5F7LB 3MYJA 2C4FT 3IDMA 2EC9U 4LSTL 1P1ZA 4BZ2H 3WN5B 2AVGA 5F21B 2KUTA 1P2CA 3BWUC 3PHQB 4K94C 4NQUA 4K71B 4CVZB 3KJ4C 3QJFB 4IRJD 3T08A 1IGFL 1WIOA 4YXLH 2CKNA 1OP3K 2VIRB 5KTEH 1FSKB 4GSDL 4P57A 1GPOL 1X9QA 2GCYA 3G04A 3KLDA 4M6MH 5DK3A 4RMUA 4NDMB 4LIQE 1YNTB 4F7PB 1RZGB 2VLKA 3BPNC 3G04B 1ZT4A 3QH3A 4G6KH 3RWJB 3NGBC 3G5ZA 3LZFH 4F57L 4KVNH 1YZZA 4X6CF 2G60H 4XPBL 3I9GL 4QTIL 3RIFK 3V0VA 2V2XB 4Z78A 5GJTL 3VFSB 1JYXA 4PY8I 1EEYA 2WP3O 5FGRA 5T3XL 5E2UH 5FO7A 5IB4B 5D6DA 4HUUB 5DQ9A 4IDJH 3HZKB 3RY6C 3ROLB 3S5LA 4Z7VE 4U0RB 3I6KA 1G7MB 1D5XA 1CVSC 2CK0L 4KJYB 4O2CB 3VFPA 4Z8FH 3HNTL 4J23A 1JGLL 4DKAA 1CDHA 4OF6A 5CD3A 2FR4A 3TA3D 5J3HC 3H6JA 3SCMD 4LLMB 5IVZB 3VDAA 1ES0B 4JFYA 5GSVB 4AENA 4FP8H 4PGEA 3BZEB 2V2TA 2BVQA 1EAJA 5T3ZD 4M61A 4TULL 2DQDH 2AXGB 3MMEA 4HS3B 3HG1B 3ARXA 2W91A 1WZ1H 4NO2A 4Q9BA 2VE6B 3QFJD 4OT1L 4UB0L 4IRSA 4YHML 4CN6A 3TO2A 1LP9F 2CIKB 1IAIM 3MQIA 2FB4L 1VEOA 3DHMA 5EC2A 4G9FB 5IKCB 3MLSH 3R06B 1AR1D 2EYTA 4YHZH 5IEKB 1AP2B 1IAKB 4QCIA 5J8OA 3CX5J 1RK1B 5ICXB 4NO5A 3TZVD 1I9RL 1N7MH 3CVHB 4XBGB 1XZ0A 4Y1AE 4ZDHB 5BRZA 4WO4C 5IVOA 4UDUB 5D1XA 1RK1A 2NY1B 2R0LH 1IVLA 3QDME 2JK5A 4CVUA 1TZIA 3G5VA 5IFAL 3GFUA 4HIIA 2ADIB 3LPWA 4GRMA 4U0QB 1YUHA 4KZDL 4Y1AB 3QEGL 3ARBA 3RL2A 1FVDB 2G9HB 3NOIA 1A7NH 3BWAA 2X2YA 2IFFH 3W39A 1TZHB 5CHNA 4WO4B 3LV3B 4HFWA 3DO7B 3AS3A 1BVLB 4PLNC 2X4SB 5FO9B 2AJ3B 3GMPA 5J89A 2AJZA 5JPNB 1N3NA 3MX0A 3QXAB 3QCUL 1RURL 3T3MF 4LLAA 5EBLA 4OAWA 4WFHE 5FCUL 3QG7L 4NUGL 4RNRA 5C09A 1TJGH 4OI7A 4BFGA 2OQJB 5ID1A 2HWZL 1C5DB 2BK8A 5E9DB 3RNQA 5F1NA 3QI9C 3U9UA 1IQWL 4QY8A 3RNKB 1BHGA 4LGRB 4JFZH 4JHZA 2X1PA 5L88H 2ENSA 2CKBL 3FFCB 4ALAH 5C0JA 3D69B 1A2YB 2JJUA 1IAII 1U6AL 4DTGH 2NY3C 1TNMA 3F7QA 3BAEL 1H9VA 2R2HA 1IM3B 4NC1C 1T22A 1P7KB 3DMMB 1RZFH 3PHSA 2OLDA 1LVEA 2IAMC 4P9HL 3TF7C 3MSPA 4XPGL 2F58H 2R1XA 2OTUA 2FLBT 2VZOA 2X9XA 2YHGA 4YHYC 1NCBH 2R1XB 3BFOA 4JJ5A 4POUB 3DETC 3NGBB 4BQCA 5F7DA 1OL0A 4WI3A 3VRLF 3JV4A 5E6YA 2FEEI 2NTSP 4MNGA 1A7OL 3LY6A 3BIKA 3CH1B 4GKSA 4N0FA 2ARJQ 4NHCL 4L5FL 2JJVA 4J6RH 1PW3A 3ARBC 1T03H 3SEPA 1S7TB 4HKBB 4RFNC 4F37F 2YPVL 5KS9A 1FFOA 2XZAL 3CSBA 4OM1L 1JGVL 3TN0C 1N2RA 1JF1A 1SEQH 4RGMB 1BOGB 4LASH 1A6WH 3QDGB 4NO0B 4AG4H 1T1ZB 1BJ1J 1W0VA 5E7BA 3K2UH 4X0KA 5AUMA 5BOZG 5SWQB 2PCPA 4O9HL 4Q9QL 3QXAA 5E5MB 1KJVA 4UILH 2GAZB 1CDIA 5ENWB 4X5XB 1PG7H 4DKDC 3IB4A 2O26U 2BVOA 2RCSL 3B9KC 4R96A 1YDPA 1YY9C 5IKCA 3NABH 3JWOC 3BP6B 2K7PA 5D8JL 5ACLA 3BYTA 2QL1A 3HE7B 2FHBA 3F6LA 5CZXD 3SGJA 1FH5H 3ZTJH 5C0GB 4OZIB 4D0CA 4Y5XA 5E99L 3CDGB 5E8DH 1N4XL 2WV3A 2JB5L 3LHPL 2V5YA 2DQFB 4JDZB 1T2QL 1ND0B 4JRXA 2YD8A 2LABA 1BBDH 1CFSB 1NGYA 4JKPL 1HN1A 2Q86B 1HHIA 2LTQC 5HI5C 4M8QA 5I8EB 3VFUA 5FKAA 3UC0L 3TT1H 1KFAH 3OR7B 2ZP0T 3PUCA 4JO3H 2XQBL 4LEXH 1BQLH 2MOVA 4N8VA 4OCYL 4DUXA 3PP4H 4JFOB 1EXUB 2EICA 2HVJB 2VDQH 5GRUL 4IEFB 4BELD 4XI5C 3HG1A 2I5YH 1ZTXH 5CZKA 4PJIB 3NN8A 1C1EL 1ZXQA 2MTPA 3GM0A 3MLZH 4MA3A 1G7LB 3N1MC 5C0CA 4QRQB 3SKMA 5EORH 4MYWB 4RAVA 43C9B 4ZFGL 2A1WL 5JQHC 5I8OL 3SQOL 1NEZA 2AK4A 4KHTL 3EW3B 1S9VB 4Z0BL 1XR9B 4KMTH 1U8MB 3KJ4B 4I0PC 4NYLB 1F58L 2F53E 3N1PC 2NY0B 3L7FA 3D0LB 3GJFA 2BOCA 3HAEB 1TETH 3CFJB 1WCQA 5B3JF 2IPKB 1OT2A 4OF3A 1DR9A 1DJSA 4GRWH 5EZOL 3RIAK 3JVGC 1I1AA 2PTTB 3DRQB 4Q58C 4F8TA 1JL8A 3UO1H 1UEYA 4E41E 4QF1B 4WUKL 5B38B 2C1OA 4M43H 2OL3A 3X3FH 3F58L 3DVNA 4Q9RH 4U6TA 1MRFL 4MXQC 4OLUL 3NPSC 3EYFA 5FYLL 1ZVSB 4HJGA 3AVEA 2VL4A 1UA6L 1RUKL 2PR4H 1S7VB 1QUNA 4MA7L 3VI3E 3CFDA 1AXIB 3B43A 3LKRA 3BDXA 5E1AB 1IKFL 1E0OB 2JIXA 1RV6X 4KV5F 1FNHA 4FXGA 5MEND 5DTFB 2UY6A 3F6IA 1GJIA 5A2KH 4R7NA 4APQC 2J8OA 1JYWA 4NRXA 4Y5YC 4C54A 3FB7A 3ARED 4PJHE 5DK2B 4KPHH 3UJIL 2AS5M 3DO7A 5GZOD 1QZ1A 2HTKC 3C60C 3LQAC 2YKLH 1N8ZA 1KIUA 4G6ML 4HK0B 4JQVC 2Q8AL 1KPVA 2WBJC 2HKFL 1SEBB 1SJXA 1MEXL 3GBML 1S78D 4AY0A 2BNRB 2VJXA 5JOPD 2ZOLB 2P5WD 5E99H 5EA0L 1FL3A 4PRNB 4KJPC 1C5DA 1P7QA 4G8IB 4I48A 3WS3A 1WWAX 4BSVA 1A3LH 3O9WC 4MHHI 3IJYB 2BVOB 3N9GL 3CVHH 4KK9C 2VAAA 3Q6FB 2N7AA 4YDKL 4EIZC 2XZQH 5DMYA 1R3HB 5I74C 4Q6IC 1YMHA 4KVCL 4LVEA 4OGXL 1VENA 2VAAB 3Q6FA 1XZ0B 2VC2L 3RGVD 3X17A 4PJEB 4MSWA 1DSFL 4WW2F 5KVMC 4CUCA 1WV7T 5HHPB 4MD5A 3UJIH 4Q9QH 4Y4KC 5M95B 5FHAL 4PRBB 4LLVB 4GLRH 3K46A 3CFBA 1R0AL 2VN7A 3DHJA 4XCYB 1DCLA 5HYEA 4KU1A 4IOIB 3NIFE 4NWTL 4LHQB 5ITBL 3QUMA 2K3TA 2NY6C 4UNVA 2AABL 5GRZA 1AY1H 1DFBH 4RMWA 4LL9A 5LG1A 3PWNA 1OAKL 4KJQC 3VFWB 1TITA 2P5WA 3BZFA 4X0KB 3HC4H 4OZ4A 2AK4E 1P7QD 2VDOH 2Z8SA 2ERJB 4YC2B 4ZPTB 2QHRL 2VDML 4R4NC 2R4RH 5HD8D 1ZVSA 4HJGB 3U0TA 3SO3C 3FT3B 3WKMH 5CBEB 3T0DA 3MUY1 3FZUC 3UO1L 3ESUF 3OKOB 4JFEA 5DFVD 5DVLA 4RISL 1FSKC 4XHJD 1P5UA 5D7LB 5EZOH 4GRWE 1YN6A 3D39E 3SDDB 5GS0H 2GUOA 3N85L 4RMSA 3L1OL 3WN5A 5IB5B 5I1AB 2BOBB 4HAFA 4YHNB 1FC2D 5FYLE 4JFQB 3SDDA 1IFHH 5BJTB 5HXMA 2FX8H 2IANE 5GS1A 5HJ3A 2XACC 2HLAB 2IG2L 1CE6B 1HYSD 3AM8C 1H5BB 5C0DA 1PKQE 5D7IF 1TFHA 3TWCL 1F4XL 4XCFH 3HUJE 5CUSH 1NFDF 4LDLB 4U1IA 1HE7A 3BPLB 4DVBA 1GOGA 4IRSD 5SWSE 3PWPA 5CP3H 1W8NA 3GMLB 3QCVH 3H7LA 3S6CA 1R24A 1U8NA 1IZKA 3L5XH 1GYAA 2R0WL 5T1LB 3O8XB 1DQDH 5FUZL 1DN2A 1ZSDA 3K4ZA 3HE6B 3WDIA 3UTTA 1FNGB 4UUJB 4V1DB 3WLBA 4NCDA 4HUVB 1Y18B 2K7QA 3DJ9A 3QUXC 3CFBB 3ZTNL 1X5HA 4F2MA 7CGTA 2MQCA 1JTTA 4RFEA 1KCVH 3VFUB 1U8JA 4OUUB 5JHDB 1F6FB 4HF5L 1F3JB 1QG3A 1REIA 5CGMA 4LCUA 4ZO7A 1NDMB 3IVKB 2FNBA 5FK9B 3K4DA 4LAJH 1Z3GL 2ICWB 1AD9B 5C0BA 3MV7A 5I1GL 4MA3B 2HKHH 2NY7H 1P4BH 3IJYA 4R3SB 5C6PB 4XXDA 3U0TB 4RIRB 4KJWD 5DD0L 2DLFL 4HXBH 2VKXA 1FGVH 2F5BH 4KAQL 1CDCA 1NAMA 1IGJA 2WBJA 1I3RA 5KVDH 2MNUA 5F89B 4LCWE 5CBAA 4KXZI 5GXBB 4WFEE 4TUOA 4PJFB 5I1GH 1T7YA 4FQXB 4FQCH 5BW7A 2P8MB 5LCVH 2F9BT 1L0QA 5K9JH 3VD3A 3MBXL 1KLUB 3K1KC 4HF5H 1RZKL 4FQHB 1FZMB 4OLVH 1OQXA 3BQUC 4HKBA 2ICES 1JGLH 2BDNH 5F9OL 5BVJB 5CJXC 4PJAB 1TTGA 4PJHF 3GHEH 1CT8A 4MD0B 1ROWA 5E08H 3FHQA 2DIAA 3FMGL 1RY7B 2GYSA 3FQNA 1NFDB 3U0WH 3LEYH 2IH3B 2Z8VC 1HI6B 4OD3L 1D9KC 3MGTB 3TH3T 3SKUD 3IYLW 5DMGC 1BP3B 3L95A 4I0CC 1INEL 4YDVB 4PJ5A 1KIPA 3WHXB 5DFWH 3L3IB 4P2QB 2OTUB 1D7FA 1XFPA 4CVWA 4IRZH 4LPTA 4H0IA 3DRTB 1XGPB 3TWCH 8FABA 1ONQB 1NAKL 5DRXB 2NW2A 1W72A 2HG5A 1SJVA 2AJUH 4C56D 4YXLL 3MNZA 4MNGB 4MS8D 4OGYL 2MCPL 5IB2A 3PGCA 3TO4A 5EOCH 3LDBB 4UINL 5F9AC 4JFHE 1BQUA 2ZSWB 4U1JA 3HUJF 3QH3B 3NCEB 3RWJA 4QHMA 5GS0L 2Q8BL 3AY4C 1RSFA 1PQZA 1K2DB 5MHSE 5DRWB 3PWUA 1X5GA 2PYFA 1QVOA 5I1KL 3FMGH 3IFNH 4PJIF 1A64A 4D2NA 3GHEL 3P4OB 1S7QA 1BVKA 3ET9F 2IFFL 4ZG1A 1U2CA 5D4QA 1G9EA 4OLVL 3MBEB 3FT2A 4JPKL 3IDJA 4FZEL 3B9AA 4B41A 1JGDA 1KLGA 2ORBH 5GGSB 4RAVB 3BE1L 4BYHA 4OZFH 1ZGLA 2XRAH 5F96H 4M7LH 2EDOA 3IF1B 2X44D 4K3EH 3ZHKA 1T5WA 1BVZA 5F6HI 5DEGA 4QRPB 4XP6L 1MNUH 3S9DB 1BPVA 4NN7C 2GJZA 3H9SB 4FQJL 3PG2A 2WWMD 4HWEH 2XXCB 1XIWB 3BKYH 1GGCL 3F7YA 5F8QC 1ED3B 4WY7L 5J1AB 3WJJC 4X5XA 2DQIH 1Q9KB 3PGDA 5D1ZB 2EH8L 1ED3A 5IEHB 1A0QL 5F72S 2NCMA 4ZAKA 4DK6A 2IPUK 2C3GA 1QPPA 2GSGB 1OD7A 4KRPD 1MF2L 1FAIL 2WLZA 3WIIL 2M1KA 2RQ8A 3X12A 1XGTB 5KVGL 5TF1L 1CD9B 2ADFH 3OB0K 4W6WB 1EEZB 4TSCH 3GBNL 1RJYA 3AMLA 3TN0D 4DGIL 2XPGB 5DQ9B 5JXEC 5AWNH 4L8CA 1WBYA 1AGCB 2WAHA 3OX8A 3SJVE 4OLYH 5JHDA 4E0RB 5TDNA 2VKWA 5I19H 1UWGH 3RRQA 5K9OB 1MJ8L 1YJDC 2R0WH 1PSKL 4PV8B 5DJ0B 4Z7VB 1QRND 1MWAA 2JF1A 3QIBA 4DOHE 5IB3B 5DRWA 4FTVB 4LRNH 4NOFA 5EU6B 3HE6A 2C9AA 2RIKA 2L0DA 2VXQH 5DZLA 3DXAA 3CH8A 3D39B 3H3KA 2AXGA 2VIRA 3O6KH 2ICCA 2GY7B 4HKXA 1XR8A 4RRPA 2NMSA 1TXKA 5IBUG 2XWTB 4YBLB 4YK4C 5D7JA 1NSNH 1QFPA 1R5WA 1MH5B 4PJBE 2NW2B 5INCB 1CBVH 3WEXA 1G9NC 3DECA 1W0YT 5HHNA 1QKZL 1NCCH 4EJ1C 3L1OH 3HAEA 4NWUL 1LO0H 3RWIA 5DR5L 1C5BL 1OTUD 1RJCA 5LXGL 3KPPA 2ESVB 3PL6A 3IETA 3KNBB 3DNKA 1A6ZB 4OD2B 4RISH 1A6UL 4MLIA 2A6JB 2V2WB 4XMKH 5ID1B 1DN0A 3MUZ1 4OQ1A 5L9DH 4ODWB 5CWSB 3IDNB 3NCMA 1MRCL 4NGHH 2H8PB 4IRJC 4P5MA 3SQOH 1T0MB 5C2BL 1AO7B 1RPQA 1T83C 4GLRI 5TE4L 5FA4A 3D69A 4NM4L 1FIGL 1OP9A 1SQ2N 2VXQL 2X9YA 3MUJA 3WIFA 1JGUH 3VRJB 3ZSSA 4NJAL 1YYML 4RWYL 1ZHLA 1K85A 4TTGA 3MXWH 4PJ5B 1RVFL 2VLMD 3HE7D 3K4AA 4TUJB 4EUPA 2KPNA 3EDJA 4NNXB 3OWEA 3PHOA 3TVMB 4KDWA 5D1XC 3U2SB 2OS7A 1WBYB 2PTVA 4Z95H 4NZUL 3IDMB 2G75A 2DQHL 4HCRA 5HHQA 1V7ML 4OLYL 1B3JA 3SE9H 4YHIB 5KSVB 5EO1B 3ARQA 1GGYA 1KJMA 2JB5H 1G6RH 3LHPH 5D71L 2D4FA 1PEWA 4FFZL 1UADC 4OFYA 4JN1H 1NFIB 4CADB 4WI2A 1MFNA 3E0GA 3OAZH 1YMMD 3OJDA 1JRHI 5IIEA 5IEHA 3TJHC 2DMBA 3MCLL 1MAML 2FD6H 2NY0D 3BSZH 5MEOA 3QNXA 5EO9A 1GGIH 4G6JL 1QO3A 1CFNB 4GW1B 1TZHA 4YNYB 5HVHB 2JE8A 4WI6A 2IC2A 3BUYA 4D0BB 1D6EA 5CEZE 4R90L 3BGFB 1J8KA 3O0RL 4XVSH 4BQ8A 3QZWG 3U82B 2AXJA 2B4CH 1O5DT 4U3CA 5ANME 3NFNA 4J4PD 3KYOB 5T3XD 3RUGF 3I6KB 3ZT7A 4QRUA 3ARYA 4FTVE 1S9KC 1FORL 1NCAL 4YZFF 2ATPB 5ALBH 1C7TA 2NXZD 1T7XA 3H0TB 4HIEB 4M7LL 5DSCB 3LB6D 3U7AA 5ANMA 4R97C 3VWJC 3AS2A 4JLRA 4OBSA 1RZKC 2DQCL 3CFKA 4I3SL 3ZDYE 4TSAL 1IE5A 4FZEH 4HIJB 4QOKD 2BSED 2H32B 3SBWC 1U8LB 3QUZA 4Z7QF 1P4LA 5C0IB 4OM0L 3GEWB 3HPJA 3VE0B 3T0EE 5HHVL 3WFCH 1W0WB 4OLZH 2KL6A 4YX2L 1NJ9B 1RI8A 4OZIE 3V7AE 4HULB 4GAYB 1KCRH 3WS6A 3QNZB 5IM7B 4ZO8A 5DK2A 1U8MA 1H3TA 1M6OB 1KN2H 4N1CA 1VFBB 2YUZA 1QKZH 5I1AA 4TNWK 4U4BA 4KWUA 4LP4A 1M6OA 3V6OE 1I1YA 1D9KA 5EUOE 3RKDD 1SJHB 3VXRA 3PWVA 1YN7B 3EHBC 1HIMH 1HSAB 1EBPA 1T1YB 1BZ9A 5GRJL 4K07A 4XWGL 4HIXL 4X8XA 3HZKA 5JW3H 3P9WB 3ZKMC 1A02N 4HJJH 1T0MA 4Z7VA 3G6JB 4H8WL 3R8QA 3O2WH 4H20H 4HEME 1WUNT 5F6IC 3JXAA 4JFXB 1BX2A 1PSKH 3SGEH 4JKPH 4OUOA 4H5SA 1FIGH 3VI3F 1A5FH 2BFVH 4ZUWB 3RGVB 1N5AB 1CK0L 3RWCB 1JYNA 3S36X 2Z0BA 3BH8A 1RAMA 2B1AH 1TENA 2AW2A 2BDNL 3CSYA 5F9OH 4LFHD 5DD5H 4MXWH 1DLHA 3QUYB 3QEGH 1YEFL 1FYTB 5I9QC 2ZG1A 5IOPB 5IB5A 1HXMB 1U3HC 2X4NA 2J4WL 2YUXA 4HT1L 1MJUL 2R1YA 2EYSA 3SJVB 4QRPD 5J1AA 1OT1A 2VUYA 1JGEB 3VFMA 5DR5H 4DN4L 2Q6WA 1MIEL 3VFOB 5I17A 1S8DB 2D3VA 4FQHA 3BT2H 5E8OA 2FB4H 2V17L 4PS4L 4R96B 2FGZA 1DDHB 1TCRB 4OZGA 3WUWG 3B5GA 4ZS6D 3DROB 5TDOA 5D5MB 5CEXB 4MJ6B 1F00I 3FL7A 2BVQB 1KJ3H 1Q1JL 3S35X 3QEUA 3RWEB 5F96L 4K9EH 1ZLWH 4QHKJ 4TUJA 1N5YL 3FQRA 1A47A 1DEEB 1WICA 3MJGX 2CR6A 3RVWD 2DMKA 1OP3H 1OAUH 4MNGE 5L2JB 4MXVF 4ZXBA 3VXNA 5K93A 4P9MH 5FYKE 4FXKB 2GSIA 4Y5VB 1DBML 3HNVH 2NY1C 4UBDC 1CDYA 5I1KH 3D3VB 4A6YA 3F7VB 1BGXL 4YGVA 4NSKA 3PIQA 1ODAA 1EDQA 2H1PH 4P2CG 3OJDB 1J1XH 4NQDB 5GZNC 1FQ9C 2FX9L 4D0DA 2V7HB 4NNXA 5EOCL 2PUQT 1RUMH 4RFEB 1OSPL 1VACA 1MRDL 1D5BB 2AKRA 5HGDA 4YHKH 4XNZC 2E7LC 3EFDL 3FONB 4MDIA 5CINL 3TNMA 1TLKA 2Z9TA 5HGDB 2UWEE 3KHQA 3LD8C 1SM3H 4XHQA 4WU7B 4ZYKA 2C3XA 1D9KB 2F54B 25C8L 5EPMB 3E2HB 3ARFA 3ORJA 3V7MA 3TPUB 2F54A 3K8LA 3KLAB 1PKOA 3O45A 4OAWB 4NUJB 5C09B 3LKRB 5CZVH 4WW1A 5CMAA 3UYRL 4PRDB 5HGGS 4JFEB 2DIBA 3EJYC 1NAML 1F6AB 4U3HA 3SGDH 2VLKB 3V0WL 2CUMA 1KOAA 3GMQA 3MRCA 1UJ3A 2APFA 3MJ7B 1M1SA 3TJHD 3C5ZA 1B2WL 4JM2C 4L4TE 3GMOA 3MV9B 4X9IA 5BJTA 3BI9X 5IVXB 1DBAH 1UGNA 4ZS7H 3LQMA 4IS6A 3MBXH 3HC4L 4EDWH 2FH6A 5HPMA 1BQHG 1XIWC 3IXTB 2X4OB 3MO1B 5IM7A 5D6CB 4OTXH 4OQTA 5DO2D 1OAZL 4LSVH 1A6TB 2YPKA 43CAA 2EEAA 2ESVD 4NYLA 2F19H 3FO1A 5HYQA 1U3HA 2OMNA 4OKVB 4Y2DD 2EDEA 4FFYH 3GMMB 3QAZC 1SMAA 5E2JA 1RIHH 1GC1L 4AEHH 4LEOB 1K5NA 2XWBA 2UUDK 2YMXH 2XZCL 5JDSB 1MI5A 5D7KE 3EUUA 3C60A 1E4KC 3T1WA 5FUOH 4NZRH 3UJJL 4UTAH 4LCYA 2IANB 2CDEB 1X44A 3ULVC 1CXEA 1J87A 2WINA 3PJSB 1QFWI 4W4NA 3OAUH 1OSPH 4JPIB 3O41B 1MWAB 1R3KA 1Z3GH 2X40A 1W72H 1R3LB 4H1LG 3ZE1E 3TYGH 1A3LL 3RTQA 3STLA 2WINB 1S7XA 4YDJB 2R1WA 1A4KB 3RPIB 4HPOH 3MUGA 1R3KB 4MD5B 4Y4FC 1CZ8L 5ISZB 1KCVL 2YD7A 2AJVH 3V79C 1JGDB 1VESA 5D1QC 4JKWA 2FHFA 2XY1A 4LKCA 4KPHL 4KK5D 4BH8B 2EE9A 2DICA 1RUPH 2OZ4A 1T1XA 3H9SA 4ZSOB 1HHJB 5F1SA 3OKMA 3JV0A 3GRWH 1FG2A 4PLOB 2CKBA 3GUTB 3LZFL 1FYTE 2PR4L 3VFMB 4OIIH 1MFDL 4BSWB 4F57H 1G7QA 4HK3N 1RU9L 3MV01 3SGDI 2BC4A 1NMCB 1CFVH 1YEEH 5JW3L 4ZOBA 2E27H 3UPAA 4I0PA 4S10A 1S9WB 1ZMYA 1VFBA 1MUJA 2CO6B 1YNTA 3IAQA 4F7PA 5SWZD 4O51B 1XIWD 5T3ZE 2A73A 2LTQB 1UZ8A 3IU3B 2AV1B 3B6SB 4MQXD 4LSTH 4BZ2L 1VGKB 1YNKL 3BDBA 1YEIL 4GMSL 3QUYD 4QXTB 1Q0YL 2OXGA 4JM2F 4UIMA 5SX5K 2HN7B 4LCCA 1UB6A 3UTQB 1J0ZA 2IBZX 3D2UA 4XC3L 3V5DA 1NGXB 4Z7UA 2OX5A 5DJXB 4LCCB 4PBWD 3RJQB 5EBGA 4AQOA 2A1WH 5DMJB 3MJ8B 4FQ2H 5BVJA 3ARBD 4RZCA 5FM4A 1AXTH 3KPNA 1EZVX 1IC4L 5HYJB 5DQJA 3ILQD 5K33A 3CFJA 4LARH 4PJCB 4L8BA 3PGCB 1NGWA 4N0UA 4QKXB 3QDJA 2HT3C 3CXHK 3MJ9A 3IFPB 1F90H 3S98A 3DX6A 1YMME 1KNOB 2HH0L 3WLWD 1EFXA 3LRHA 5CCKH 1IT9L 3DO3A 2Y5EA 2NLJB 1SM3L 2JJTC 4KK5C 3RUGB 5LXGH 5KANI 3JBG7 4X4XB 3HS0A 3D5OF 4NQCB 2IPUG 3LSOA 1J8HD 4GBXD 3BSZL 5CD5D 4GS7B 2ZSVB 5I1JL 4Z7OF 2V5TA 4ORZC 4BH7A 4PLKC 1TJIL 1GGBL 1K6QH 3AGVA 4WUUE 3IGAB 1IARB 3GMRB 4NT6A 4D9RD 3IJHA 5DJDB 4KQ3H 4X7EC 2ESVE 5D1QA 2EE2A 5CEXA 3H42L 3RP1A 4DGYL 4JHAH 3FOLA 4YX2H 3BKJH 3WUZA 1T1WB 4O9HH 4BZ1L 2V5RA 2EIZB 4M5ZH 3RTQC 1WFNA 1DEEA 2P7TA 1FO0A 1ZA3B 1AO7E 3V4VH 3F12B 1S9YB 3QQNA 2P45B 1BFSA 4O00A 5D6CA 5IV2B 4JFPB 3KPRD 2P8PB 2KBGA 5L2KA 5HDBF 1AY1L 1RUKH 2Z4QA 1E4KA 3W0WD 3ES6B 3WFHB 4HG4J 4NM4H 3WJLA 2ZG2A 1V3JA 2DQTL 4JM2B 3KDMB 3TBTA 2BVUA 3CMOH 3IDUA 3MRQB 4ELKA 3OTTA 4BUGA 1UKQA 5E8NB 4W68A 1HHGA 5CJ5A 1EEUA 1KIQB 4R3SA 2EH7L 1CVRA 2IBBA 3LS4L 1NUNB 1A1NA 4LAQL 1JNLH 2FX7L 1J0KA 4JO1H 5FV1L 5BVPH 5IVXF 5I75C 3BZDA 5HHQB 4FMFA 3ZKXC 3HMWH 2R0ZL 1U8HB 2H26A 4HWZA 1NCCL 5JTWA 2MFNA 4YC2C 1ZV5A 2FJHB 2JCCB 4NZJA 5IMOB 3PGFH 4I4WB 4ZQKA 4AM0A 3QJHA 3DYPA 1WWBX 5FYJE 3GKWL 2V6HA 1U3YA 3AS1A 2PO6B 4NP4H 3MV7D 3BH8B 4ZFGH 2V7NA 2PW1B 1Z0MA 3UTTB 3FO9A 4XC1H 2YRPA 3MLZL 5HGBB 1FFPA 2BVPA 2B0SH 5EUKA 2OL3B 3PP4L 3QUXD 4JLRB 3IAGC 1UJTA 2SEBB 1PVHA 2VLKD 1FNEB 4LEXL 4N90E 2XI9A 5FDWB 2ARJB 3VXTB 1MCFA 2FO4A 2QEJA 3P11L 4WO4A 1OGAA 1GC1H 4QHLB 3BH9B 2EDHA 2HVKB 3LIZH 3MJ6A 5KN5A 1CDBA 2Z93A 2P7TB 2VNCA 2F19L 4G5ZL 2XN9A 3GIZL 1BJ8A 5BS0A 2C4FU 4MNQB 4NKMB 1MRCH 4C57C 5EN2B 4GMTH 5D93B 4K8RH 4H1LB 4LKXB 1M7XA 2AXFB 3QULA 3PGFL 4P5TB 5A16A 4Q9CA 1KJ2L 1AC0A 5I1LA 2WIIA 5GGTA 3GJFK 4FQXC 2DJSA 2GITB 4JO1L 5AEAA 4K94L 4GG6F 2C3WA 2WNGA 5JIIA 2VR4A 3NBNA 3QZWB 1NSNL 2BNQE 4HLZH 4HWEL 1WC7B 4LLDA 3MLYH 3S8WA 5DLML 2I25N 2QSCL 3HRPA 4KRMB 4LQ1A 1IEHA 3O3DA 1AQKH 3WSQH 1B0RA 1NCTA 3BJ91 2ZNXA 1KENH 1NDMA 3UTSB 1MVUA 3NPSB 3WNOA 4MXQD 4QRUB 3CGTA 3SKJL 5B4MD 1NFIA 3SKOB 2XNAB 3TBYB 3DSNA 3HRZB 5KG9B 3P0VL 3RWFA 2CIKA 1T4KB 1XF4A 1AGEB 1HDMB 4S1QH 5EULV 4PUBL 1EIBA 3CFEB 1A7RH 1N6QH 1BBJA 2DMCA 1OW0C 4EBQL 1DE4B 4EN3C 1U58A 3O0RH 4XVSL 4PB0H 4FQIL 3NFSL 3GM8A 1F45A 1NCWL 3QEQA 2FX9H 3MRPB 2P44B 3DGGA 3RDTD 1S7WA 1AD9A 3UCRA 2DJ4A 1DVFB 1UKTA 1CZ8H 3F7YB 3KLAA 5K59F 1IL1B 2NX5D 2Q8BH 1HZHH 1DBBH 1J8HE 5J11B 2IQAB 2OP4H 3LQZA 3SPVA 3EOAB 3S88L 3O9WB 5FXCH 3BKMH 1JNHB 4NFCA 3DVFA 4JQVA 4FFWC 4BK5A 4PJGE 3W9EA 2P5EB 5L8LB 3WO3B 3EGSA 4YXHH 5HY9A 3ZE2E 5T1LA 4G80B 3TN0B 1WIUA 4AIOA 1T21B 1I85A 2P5EA 1I3GL 3O6FA 3GSRB 4AH2A 1A3RL 3OKEA 2AEQH 4DKFL 1OPGH 3MREB 5E6ZA 4S2SB 4NPYA 2AQ2A 4OCSL 3QQ9D 1RULL 3J8F7 4LSVL 3H3BC 4CVXB 4LPVA 4L4TA 3W39B 3GMQB 3EYOA 3WD5H 1T03L 3RA7L 1A7QL 4ODXB 3QIBB 2OM5A 5E9DE 4R26L 1QNZL 4FQ2L 5CIPA 2HRPH 4ORGB 2C4XA 3CFKB 4WJ5B 5EBLB 3INUL 5AYUH 5IBUB 5E8EA 4K3DL 3X11A 1Q9OB 3MLTA 3NCJH 4G8GD 2ZKHH 1WAAA 3EO9H 5CEYA 5IFAH 1JNJA 5BZWB 2A6IB 2P8LA 4WHTA 2X6MA 5FYKD 3HMXL 3E1F1 4GMTL 3OSKA 4GAYA 2ZCHL 3L7EA 1YEIH 2X4TA 4OCNC 1UVQA 4KY1H 4XP4L 5INCA 1S7SB 3CFEA 5E5RB 5FGCE 3QO0B 2DLTA 3NH7H 3O6FD 4P59L 5T5NF 3K2MC 3QWRA 3WL9B 4EIGB 4HXBL 3DWTA 3DX8A 5CBAB 2BNQB 3CCHB 3T8XA 5CEZH 1FRGL 2QSQA 4OJFH 4OCSH 5HI5D 4TTDD 1Z5LA 1JUFB 4LRIC 2IEPA 5FEBA 3T8XB 5GGUB 1DDHA 4H20L 4J4PC 4FS0A 3R1GH 5CLTA 1J11A 4LLDB 2YA2A 1FV1A 1CS6A 3ARPA 3OR7A 3WIHL 3N0PB 3CZFB 1KB9J 2GKIA 5I8EA 3W9DA 3K1DA 1GOFA 1I8LC 4UT6H 2XFXA 5SWZA 1SYSB 4ZTPL 1RZJL 5JW4Q 1FFNB 3VFVB 1RQ5A 3QG7H 4NUGH 4OQTH 5BZDA 1JN6B 1SVZA 1OSZA 5T1MB 3HNTH 4PJXE 5K9KB 2ZUSA 1XF2A 4PJAE 3HNSL 2XXMB 5FIEA 4LLMA 3U4AA 1Q9KA 4HH8A 2AXFA 1CXLA 1UG9A 4GKZA 2CH8A 1FYTA 2VDLH 3M1BB 1NCWH 3DSFL 4WRLA 5C0CE 5JXED 1W72L 3LS4H 3O3UN 2X70A 4JB9L 3BH9A 2EDNA 4Z7NF 3UPCA 4FQQA 4G9FE 4DN3H 2B5IC 3T65B 1A0QH 4TSAH 1MJ7H 4J8RB 1ZANH 1II4E 3ULSB 3VFTB 2YMXL 4PD4J 3JWDH 2WMPA 5D93C 4HUMB 2H26B 2ZCKH 2PW2B 2FEEL 2G5BB 2J3SA 4M3KB 3B4NA 1WF5A 4N0YH 1EK3A 1E4XH 1NBVL 1NC4A 3DRTA 2YD5A 4PYHA 5JO5B 3CSGA 4LVHB 3BPOB 3P4OA 3TVMD 4XP6H 1CTOA 4XP4H 5ITFB 4M93B 5DLMH 3ARDA 5JXAH 1ZT7B 2CRZA 4KROC 1FVCB 4YFLI 3DI3B 1YN7A 2DQUH 1KB5H 3QXWA 5EOTA 5HHOD 3TO4B 3WDJA 4X6BA 1FZKB 4OFYD 1HNGA 3WNLA 3H42H 4X80L 3SDXB 3D2UB 2CO7B 3V5DB 1R5IA 3P9LB 2M2DA 5HDQH 2X4SA 4CMHC 1IM9A 4P46B 1MQKL 1GSMA 2Y23A 3PWUB 1IC7H 4U1MB 4WU7A 1PZ5B 1LEKA 2X89D 1FG9C 2BY1A 1LO3L 1BWMA 2RHEA 1XGUB 3DUUB 4PRIA 5FUZH 5E8NA 4GXVL 3KR3H 3ECBB 4CN4A 5EBWB 2O61A 1QSFE 5HVFB 2F5AL 3O9WA 3QXUA 4HFUH 1UT9A 4WHYG 1AGEA 1XF1A 3PABB 4KTYA 1ZWIA 5DMIH 2AK4B 5L6YL 4QHUA 2B0SL 1FN4B 4WCYH 1F3DH 2DQHH 3VD5A 3IDXH 3BGFC 4G3YH 4PJ5D 2P47B 5F1KC 4OLWL 1IAKA 2EDYA 4X5LA 4ELME 3CU7A 3GSWA 1ULVA 4U31A 1DVFC 1YPZA 4X4MA 3VRIB 3UTPD 5HHPA 2JELH 3NZHH 1XCTB 4JZJA 5C9JA 2C3VA 4MCYA 4R0LC 4FQXA 1NGYB 2Q86A 1DBBL 3HMWL 5JNYB 4NHUB 2PYEE 2P8MA 1FFRA 2GI7A 5KSUB 1A21A 4K7FA 1YEGL 5D1QB 4Z77A 1BD2E 1NDGA 5GRVK 1OARH 3BZEA 2AJYH 1Z2KA 4PJGF 5B4MC 1OP5H 1D5MB 2E3VA 5ISZA 4Y0GA 4PRNA 5GRVL 2GW5A 4UI2A 1V7NH 3LDBC 4PUBH 3B2UC 2E9IA 5F97E 2P4AB 2VE6A 2AQ1A 1KJ2B 1FNGA 4UUJA 3GSNA 3JVGA 2BNRE 3NIGF 5HYJE 5MI0C 5D2NA 4YJZL 5I1CL 3PHOB 5C7XL 1EGJA 9CGTA 1E6OL 1IC1A 4MQ7A 3KVQA 3HFMH 4X6DE 1AP2A 4QCIB 3WJJA 4WU5A 1C12B 3L9RA 5ITBH 2OSLB 1IGCH 4WJ5A 5SWQA 3QA3A 1LE5B 1E28A 3LN4B 4MZ2A 2ITDB 1KTRL 2IADA 2GJ6A 2VDKL 4EXPX 4NRZA 5FHAH 5DO2C 1JMZA 2JB6A 2A6KA 4AJ0A 4JO2L 4NDMA 1NGZB 1H5BA 3GRWL 3LEXB 4HV8A 4LPWA 5C0DB 4XZUA 3BKJL 3MGAA 3JUZA 5FKPA 1Y0LA 4J3XA 2Z92B 2W0KA 4ZFFB 1HHHB 4OGXH 4TVPD 1MQ8A 2PW2A 2DQEL 3RZCD 4YR6B 4O51A 2G5BA 1GGBH 3LN5B 4KHXH 1LHZA 5HY9B 5IHLB 1MFCL 1U8NB 2PYED 3V5HB 5ADOH 3VXOB 2A74B 5CJBA 5KBNC 2DQJH 3T04D 3GBNH 1OF2A 3BGMA 3VJ6A 4D9LH 5F1OB 2VL5B 1ZLVH 1K6QL 2YK1H 4WI7A 4D8PA 4GW5A 1P6AB 3OV6A 2NY1D 3TYGL 3BP5A 3FO9B 5M7QA 5KG9A 5A1AA 1FVEB 4GKZB 5JMRA 1EAPB 1A1MB 2NY5C 4W4OA 3FOMA 2ID5A 4WI5A 3QHTC 3L5WB 5FUOL 5DJ8A 2BOBA 4H1LH 4KKBC 2C5DC 4PTUB 2PO6C 3O3EB 1L0YA 1NDGB 3S35H 5CCKL 1QRNA 1ZVHA 3BP4A 4ODBD 4YGVB 3BW9B 3NIDE 2P42B 1MHPL 3MLXH 4HX1A 1OD9A 2L4OA 4JCMA 4L3AA 3MRHB 5B39B 2AAVA 2D31A 4KKLD 2NZIA 5LQBH 4OF5A 4P57B 1AH1A 1RHHB 2F5AH 3JV6A 3TFKC 2NY4B 4QRSA 3VMNA 5C2BH 3X12B 4HAGA 4LCYB 1XF3A 3WFDH 2XRAL 1LE9A 35C8H 2FLRT 1SBSL 3TBTB 2HJKB 3HMXH 1NLBL 5C92A 1MFCH 4PJBF 1FNSH 2ZJSL 3VH8G 4Y5XB 4N9OB 5I1HH 2CGRL 1MLBA 1HXYA 3BD5A 1VDGA 2C3VB 2CRIA 4M6NL 4CADA 1MCNA 1GRWA 1CLZH 3DX7B 4FQPA 1EBAA 2XKUA 3ISWA 4JO2H 1MAKA 1KB5L 1FZMA 1F3RB 4Y1AA 3TH4T 4JANA 4UT9H 2XKSA 4PRHD 4KKAC 2R4SL 1JWUA 1LD9B 1QO3B 2O5YH 4YQXH 3IDYB 1OLZA 1VGEL 2QHLA 4U1KA 1I9EA 1E6OH 2QQKL 1X7QB 5E8EB 3SJVA 3G6JF 2I9TA 4NIKB 3VD4A 3VDBA 3HPLB 2X4RA 4JFHD 3PABA 1CWVA 3C08L 3RIAF 3QT2A 4W4OC 4A6YL 1Z9MA 5BXFB 5J57B 4MNQA 4NKMA 1A7PH 1YEHL 2YZ1A 4P2OB 3OB0H 1BF8A 3CSYB 4RA3A 4TUKH 1A6TA 1BBDL 2C7UB 2R2EA 1DUZB 1FL6A 2VN4A 4H0GA 2FO4B 1MWAH 1MCKA 3GNML 5A2LH 4QHLA 4DGIH 4R4FH 4ZFOA 4U1NB 1AGDB 2BZDA 1G9MC 2HT4C 4Q97A 3ARFB 1ORSB 1CE1L 4U1NA 2DKMA 5DEFB 3R8BB 2O93L 3KG5A 3PL6B 5C6TL 3OAUL 1PQZB 3MOAH 4LIQH 5I1DA 1AXSB 4OQTL 2D0HA 1I75A 4PRDA 1U3ZA 4I77L 1GXEA 5KSAC 1ZA6B 3ARGA 1BOYA 3S34L 1PG7L 4AM0B 4ENED 1BJ1H 3EYFB 3DYOA 4JR9H 4U33A 4FNLL 2YD2A 2A6DA 5FYJU 3U7YH 4X6BB 3GGWB 1KENL 4NSKB 4LLYA 5E1AA 3ZKQD 3VXMA 1J86A 5D2NB 2PXYB 3ARFC 1NFDE 2PO6D 4JFPA 1BBJB 1Q9WA 3D3VE 3SDCA 5EBMA 3BN3B 3QDMD 4OTXL 3BT2L 1K8DA 5GSRB 1MCJA 1AXTL 3FB5A 3M1BA 3CC5B 1KELH 2BOCB 4R97B 3VWJB 4QRTA 2IH3A 2FGWL 2HMIC 1KF9B 3D3VA 2DD8L 4WUKH 2PXYD 3HLAB 1K4DB 3O3AB 3U4BL 5CSZA 1RK0B 3B3IB 43C9A 2J4WH 1MCPH 4LVNB 1FGNL 1KC5L 1YYLH 1Z9SA 1A9BB 4NZDA 1MCIA 3VH8A 3WFDL 4R4ND 5HD8C 1NAMB 2WBJB 2XICA 1LP9E 3GSVA 1AHWA 3VDCA 4HC1L 3KPSB 2F58L 4P2OA 3MRIB 3VRIA 1HH6A 4NJ9H 3O6MH 1TZGL 5F1IA 5IMLA 5DS8B 2NR6C 3FTGA 1QBLH 4Z0XB 1HXYB 2NY6D 3ZYOA 4DVRH 1RJLA 3OXSA 1ND0A 5D9SB 1F6LL 1L0XA 4BH7B 2YPLA 4Z7WF 1RJLB 4N8VG 3IGAA 4IRZL 5BS0B 5LGKA 2DQDL 4YGAB 5FM8A 1MRDH 4HLJA 4FNLH 3KXFB 3QNYA 2VQUA 4NQVA 4ZAKD 1DANT 3QWOA 5ESAA 4I77H 1ZHBA 3FO1B 1ZHKA 5E8PB 3V4UL 3VXSA 2D31B 4ZUUB 1QBLL 2NY0C 1XF5B 2LE9A 3PP3K 4ETYA 1OTTC 5DFTA 1K5NB 3R4DA 1FBIL 4FABL 2QQLH 2Q7YB 4U6HA 2ARWA 2XQYK 2IBZY 4D9RE 3ZE0E 1G0YR 2ZUXA 4DVBB 1ETZA 1LO4L 4OFPA 4FFVC 4OLEA 4UTBL 2OK0H 2DM2A 5TF1H 3SCMA 4JVPA 5E9DD 5ITFA 3OHXB 2AV1A 1IGMH 4LPYA 1QFUL 3HI1A 4QXGH 4HS3A 1LK2A 5EOQH 2ZOKB 3FJTA 3P0VH 5DEFA 5CSGA 3DMMA 4NUJA 1CQYA 1MCWM 4OZHF 2VITB 5IFJA 1HYRC 4LSUH 3HG1D 4Y5YA 5CMAB 3L3KA 4P48A 4OJFL 1DN0B 4PRPD 2UVEA 5B8CA 2B1HH 2P49B 5I8CA 4LU5L 4MHHG 4UB0H 4YHMH 2BNQD 1OGTB 3WYRA 2B2XL 3VCLB 2O5YL 1F2XK 2E6JA 4ZYKB 4PYGA 2BY0A 3MLYL 4HUNB 2FL5B 4D8PB 1OQOA 5H8DA 4LHJB 4M1DH 4PJ9B 1WFUA 1QSED 4P4KB 3MREA 3TJEH 2I60L 2Q1EA 3BIKB 4RMVA 4J6RL 4RQQB 2UWEB 1NUFA 5GGQL 1LGVA 3SKNA 3NCJL 4BQ6A 5A3IC 4LCWB 2N1KA 5IK3A 4YHLH 4PV9B 4CRPA 4LVHC 3WFHA 5DD5L 3CVHL 3MRNA 1ZT4B 4F15B 1MJJA 1FP5A 5CHNB 2IAMD 3U30C 2UYLA 3M45A 4U1LB 2CDGB 4K3JL 2G5RA 2A9NH 1T1XB 2VAJA 4RDQF 1NMBH 4GRWB 2MHAA 4MXWL 3ZDXF 15C8H 1U8QB 3MRJB 4G5ZH 5F9WC 3NCCB 1E27B 5CZXC 4WI9A 4UINH 3TPKA 5LQBL 3MFFB 4DW2H 3JTSB 1QTYT 1T0PB 5IMKB 3X3GH 1PY9A 1YEHH 1JZ4A 4YXHL 5EO9B 3FFCA 1QACA 4U7KA 4KTDH 3S35L 1QLEH 4J3TA 4MZ3A 4Y88A 2IGFL 4HDIB 1KXVC 2DYPA 3RTQB 3STLB 3B8YA 3O2WL 5INDA 3EFDH 1P84K 4YPJA 1MAJA 4J1UA 4BM7A 5C07D 1IC7L 3G6AB 3T09A 3C60B 3VXSE 3WBDA 2Z31D 4Y2DC 5HPOA 5JLZA 3C09C 3V6FA 1LEIA 1X5FA 3VXUE 1WK0A 4RAHA 3FRPA 4APQB 3EYVA 4LCUB 3HNVL 1QA9B 3R06A 5IVZA 2AV7A 4TOYH 2DQGH 4M48H 1BREA 3VXPA 3MROA 2R0ZH 1INQA 3QUKB 3A0OA 1XGUA 3DUUA 1KYOJ 4OM0H 5E24E 4BFBD 3O2VL 4K3GA 3G6JE 3RWGA 3MCKB 1FDLL 5HYJA 2FIKB 4Y19B 1ZKAA 1YNKH 3L3OA 3VI4E 5EZLB 1ZGLB 1GGUA 5DUML 3GSVB 4NO2B 3S4SA 2R0LL 4RA0C 2DDQH 5D1ZC 3GK8H 4OCWH 4TRPH 3JWDL 1OTUC 3DVGB 1XGQB 5DRNA 5A16B 1JF6A 3C09B 5EC2B 1EZVY 3MJ9H 5TH2A 2FWOA 5FYJH 4JPWH 2ESVA 4JFFA 3OQ3B 5E00B 1KCUL 1A6ZA 1CF8L 3OB8A 3LCYA 5ILTH 4NBYB 2LAAA 2YD3A 1GZQA 3IKCA 3T0AA 3EDFA 5L7XL 1CICC 3H9ZA 4NN6C 2B8OT 5J56B 2JCCE 1MIEH 4HW6A 1G7MA 3H3PL 3MV7E 2PW1A 1AO7A 3V6OA 1TQCB 4ZODA 5IJVB 5SV3A 2NY3B 3MNVB 2X4UA 3EZJB 4FZ8H 4IMLA 4KTEL 5DI8A 1F97A 5L2KE 1PAMA 3V0VB 3QIWA 5EUKB 3TH2T 5B3JE 3MV8B 1TJHL 5DI8B 4D9LL 5F70A 5C0EB 4EN3A 3HR5A 4K71C 1KIRA 4PG9B 5ADOL 3ZTNH 1Q94A 3FT3A 4YDVA 5H37H 3WHXA 5J6GB 1T4KA 4UU9A 5BXFA 5E4IA 3RQ3A 4NQCE 4PY7A 2EDXA 3W11C 5JORA 4AT6A 5HI4C 3MODL 5T3XH 3IS1X 1I1YB 2IGFH 2GUOB 3Q3GB 4Z9KB 4WV1B 4OLWH 1IEBB 4YPGB 5L7XH 4H8WH 1JGUL 5LKNA 2F15A 1RIHL 1TQBC 3NN8B 1I1RA 1ORQA 4FQQB 4NKOA 2CD0A 5KW9H 3K0WA 2A83B 4S1RL 3QHFH 1KIQA 4HIXH 4EI5C 2Z91B 4HIIB 5BQ7B 4U1HB 3UTTD 1ETZB 2HFTA 5C7XH 4JM2D 2AQ3A 5EOCJ 4C58B 2W60B 4RMQA 4G9DB 1IFHL 4LLWB 2KDGA 5F89A 1O7VA 3EO9L 1IC5L 1KT2B 4F9LC 2VLLA 2AJZB 1FDLH 1UXSB 3HC0A 5TGBB 4KJQD 3W81A 4X80H 3L6FA 3QG6B 4F7MB 3FCTB 1ZA3A 5BMFL 4NHUA 3U83A 4M7KL 5AG8A 1S3KH 1R3JA 3A6CH 4FN0A 3RVUC 2EH7H 3WKML 4KMTL 5H94A 3QFDA 2DQUL 2IALA 3RA7H 2FBJL 3KPOB 1R3JB 3VG9C 4X99B 3K80A 2EDDA 4GFTB 5F88B 4J3OC 2DQCH 2IPTL 4P46A 4UQ2B 2AJXH 2D7OA 5GS3A 3V4PH 2R23A 4E9LA 2BRRH 4MD4B 5C0BB 4ZFZB 5BV7C 4GT7A 5C0AA 3GRWA 5F9JA 3GB7B 4JO4L 2ADJA 3TYFA 1CFVL 1YEEL 1XMWA 3G5YA 4GS7C 5GPRA 1IGYA 4OI8A 4IRSB 1F4AA 3EDEA 4DAGL 2B4CL 3ZKNC 5MENA 1AHWB 4IRJA 5L6YH 4PRHB 1O7SA 1DP0A 5JOFB 1IILE 4PJ5E 3HHRB 4O02H 1UZ6E 3ULUL 3HA0A 5J1SC 2FJGB 3BW9A 4KKAD 4KVCH 3PDOB 1EO7A 3TP4A 3C6LB 4E42B 4ZXBD 2X4QA 3I02A 2X1QA 1IKNA 4XPFL 3JV4B 3WXVL 1TJIH 4H0HB 3C6LA 4E42A 4GG8B 4Y8DC 2JJWA 5E7FA 4EUPB 4PB0L 1FZKA 4I2XA 4JN1L 1K4CA 3EO0B 1HSBA 3KGRA 3MRCB 4O2CA 5LGJA 3BPOC 3DBXB 3IJSB 2RCSH 4EI6A 1H8OA 5DFVC 4LBEA 4X5WA 2Q8AH 3QA3B 3V6BR 5JOEA 2BVYA 3LKOB 2Y5TB 4P2QE 5D7IA 1LE5A 1HK6A 5ICYB 4I4WA 4ZQKB 1NFDA 1KB5B 4WNQB 4F3FB 3OMZA 2FIRT 4O5LL 3S4SB 1G7LA 5C0CB 2VLJD 2Y07H 3NCYS 3GO1L 1NCDL 3G5XB 1FLTX 3QO1B 4KAQH 5J11C 1KJ2A 2EDJA 3EHBD 2YXMA 4QY8B 3RNKA 3L3IA 4P2QA 1IJ9A 3IDGA 3MLPA 3U9PH 5DD0H 1BAFH 5CD5C 5I2IA 4WIQA 3QUKA 3QIWC 1WZ1L 4HG4K 2Z8WC 3F58H 2NY7L 2ED8A 3TIDA 4NQDA 4GKNB 5KSAD 5DGQA 3V6OC 1IBGL 3O3BA 1MCPL 3MRDA 2DLGA 4W81A 1RIUH 1I1FA 5CGTA 5IP4A 3ZLQC 1FVDA 3RY5A 2P5EE 2E9WA 4L8DA 3H0TA 3IRPX 1WZMA 1ADQA 2AEWA 2NXYC 4GMSH 4Q0XL 3DXAE 1I8IA 4YBQD 2QQLL 2E8YA 5EN2A 1R3LA 1BF2A 4Z8FL 3NVQA 3VG0L 2DQGL 4M48L 4M00A 3MCG1 1KEML 1L4IA 2VH5L 4XT1C 5ESVA 1MLBB 2OQJA 3LIZL 5CJQL 3BAEH 1LWRA 1RZJH 1GGTA 4PB9H 1XH3B 3B9KB 5LBSL 3SOBL 5KVEL 1HKLH 4NRYB 3V6FB 1L6ZA 4ENEC 5C0FA 4GW4B 1K8IA 4P5KB 1DVFD 1LD9A 3WKNA 3P40A 3R1GL 4PJ7F 4NQVB 2D7QA 2VLJE 1BQLL 2W38A 4QYOB 3GMMA 5DEGB 4OB5L 2CLZB 1KFAL 3LPGA 4M6AA 4P5TC 3V6ZB 1KPVB 3LKSB 4B7LA 1UM6H 3C9NA 4K7PX 4MJ5A 2FBOJ 3ZMRA 1ZVYA 2XQYG 1KEMH 4PJGB 4P59H 1KJVB 4MJIB 1U8OB 3H9YA 3RKPA 2EKSA 3EJZD 4M5YL 1JK8A 5DDHA 1TVHA 3H9SE 4KY1L 5HHOA 2AJVL 4QO1A 3ULUC 4BK4A 5DURD 1WBXB 3GIVB 2ZCHH 3HG1E 2D2OA 1YYLL 4S1DD 1MHHB 2B4CC 1MWAL 3BD4A 3OKDA 4WFGD 1W8OA 3U79A 1YEKH 5ALCL 2AK1L 4KQ4H 1NC4B 2V7NB 1BD2D 2DD8H 4NKOB 2BJMH 5FO7B 4QRRA 4XB7A 5HGHB 4GJTB 3MR9B 2O5XH 3INUH 5GGTL 2OJEA 5AYUL 4HUUA 3BMVA 4MJID 3RU8H 4GG8A 3AFLA 2LVCA 2VXVL 2EEBA 5KVDL 1G7IB 2EC8A 2N56A 4Y5YB 5IJVA 5C0ND 1MY5A 4Z7UB 3CH1A 4GKSB 2OTPA 5D7LA 3FN0L 3ZT5A 4RWHA 5I66B 2YA1A 5CJOH 4YXKL 2Y07L 2DBJA 4LASL 3O8XD 2AK4D 2DM4A 2F5BL 2GT9A 3QUZB 5BCAA 4LU5H 3U7YL 1QLRB 1AKJD 4N5EC 1ZGLM 3MRKA 2FIKA 4Y19A 4KK6D 4PP1C 5FGCB 2EIZA 1S7RA 2ORBL 3C8KB 4XGZA 4NKDA 4KI5C 4L29A 3V2AR 4GRLA 3RU8L 2EXWD 4JPKH 3AAZA 3VFTA 5LJYH 1QFUH 2FD6L 3L3GA 4UDTB 1XGPA 4PJAA 3STBA 1JPST 4UOW1 2EO9A 3QIUD 3D2UD 3L3HB 1ZHBB 2ED9A 2YBRA 3V95A 4I1NB 4E5XA 3CNKA 2APXA 3PNWA 4P2RA 1M71B 2X70B 3HPJB 2B39A 2A6KB 4NC0B 3V0WH 3VE0A 5I71B 3MZTA 3RAJH 3L5XL 1BM3H 2D0FA 4JZNB 1S5IH 3RVVC 1IGYB 5D7LD 5IR1B 4L8SC 4K23L 3I50H 4XNUL 6CGTA 5JOFA 4FTVD 2B20A 5EIQA 1MVUB 1CU4L 1UH4A 4RFOH 3MOBL 3WCYA 5IMLB 5ESVB 3ULUF 3KS0H 4YHYB 4N1HB 3UTZA 4M7ZB 4PGZA 4Y4HD 1SYSA 1IGFH 3HRZA 2OR8A 2Z31C 5HI3C 4LLVA 1Z6JT 1BZ7A 1WBZB 2JJSA 4K55A 4PBXA 1T89C 4Q74A 5KAQF 4LHUD 1IGTB 4Y4KA 4GO6B 3KHOA 3X13A 1EFXB 4KI5F 1LEIB 1MREL 1BGXH 3MFGB 2ILLA 1JRHL 1CLZL 4ETQA 2CLVB 5J12C 1CL7I 1Q72H 4GBXB 2R4RL 3G9AB 2H9GB 3P3YA 4PJCA 3C5ZD 4Q0XH 4M7JL 4NO0A 1G84A 1MLCA 4NM8L 4ELMA 4GAFB 1F5WA 1FNAA 1NGPL 3D6GA 4LAQH 5DD3L 4TQEH 5DA0B 1J05A 3ARDC 2HAZA 1OAKH 3B83A 1HEZA 4PGBA 35C8L 3MV8E 4HMEA 3EYUH 5CWSA 1G6VK 3THML 1CICA 1NQBA 3NFPA 1EEYB 5IHUH 1TCMA 4NWTH 4LLWA 2W0PA 4K9EC 1VKXA 2HLFC 1L9MA 4Z6AT 3TIDB 4JJ5B 3PF2A 3SDAA 5HGAA 5F7DB 5IGXH 1A6VH 4KJYA 1AJ7L 4LHUA 5J3HD 4LQFH 2E7LA 4YH6A 4G42B 2DAVA 5GGRY 4GOSA 3TZVC 3JUYA 4HH9B 1F6AA 2DL9A 2NW3A 3LMJH 2OXHA 2XZQL 4HMDA 3O6LL 2H8PA 4P5MB 1BMGA 1IQDA 3MRQA 4ELKB 4QTHB 4HT1H 2EIBA 4WU5B 1I9IH 4A6YB 5IQ7H 4L3EE 1QSVA 1PKQA 3HUJB 1Q38A 3D0VB 1D6VL 2NXYD 3OHXA 3MRKB 4TSCL 1F4WL 4XCEB 3ZYJA 2J8HA 2BNUB 1EXUA 1MAMH 2ADFL 4HPOL 2ICWJ 3OGOE 1RFDH 3SDCC 5CBEA 3PDGA 5F3BA 1W0WA 5SWSA 3KPLA 3PQYA 2YKLL 3TYFB 4QEGA 4WFHD 2XNAA 4HCRH 4WWID 2Y7QA 5DQDH 4U6HB 3BIAX 1R5WB 3TESA 4MA1B 4AEFA 1WT5C 4U1GC 4KMQA 2H6PA 5E94B 3MOQA 3QJFA