4KK5C

Structure of the clc-ec1 deltanc construct in 20mm fluoride and 20mm bromide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title Fluoride-dependent interruption of the transport cycle of a CLC Cl(-)/H(+) antiporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 42
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kk5C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kk5C01
3QEQE 5CHNA 1N3NA 2MWCA 1J5OH 1IJ9A 2Q76B 1MVUA 1F4XL 2G60H 4UINL 1ADQA 1Z0MA 3A0OA 4F2MA 2W0FA 2O5XH 3TN0B 3VGBA 3F58H 3TBWA 3VA6A 5AZEL 4HF5H 3UO1H 4JY5H 1CTNA 5I8KH 2DTSA 5EOCL 1QTYT 4IRJC 5F93C 3O2VH 1MJ7L 5B3NA 1JRHI 4IIQC 2A74B 5HHVL 3BW9A 4HJGA 1P7HL 1OVZA 2LVCA 4ZODA 3PV6A 3L3JA 4L8BB 3D39A 1MLBA 4LSUH 2XQYG 4UT7H 3JV6B 5DC9B 4OUUB 1AJ7L 5TH2A 4YR6B 5BVJB 4OKVB 3UTTB 5GZOD 3UAJD 4NDMA 3UBXI 3S96A 1BFTA 4P2RE 4AM0A 5F9JA 3EYQC 4F9PC 1W72H 5DFWH 4HGWA 1CFVH 4JLRA 5IFHL 4HJJL 2OXGA 4CL7A 4NBXB 2AV7A 4PJEA 4GAJH 5JOEA 1VKXA 3A6OA 5C0DA 1SM3H 3QUMB 1JZ2A 3WKMH 1KLGB 5D4QA 4N9GA 1CXHA 3LKPB 1XEDA 5ACMA 5D2NE 4CW1B 3ARED 4GXUN 5DJZA 1MHHA 3SDCB 4JRWA 3VJ6B 3TYFA 1RZFH 2R0WH 1LEGA 4PRNA 4YDJB 1KPRA 1U2CA 2Y5TB 3MYZA 1IT9L 3QI9B 3O8XA 3JWOC 1WC7A 3VRLF 5KANG 4PJAA 4XPAL 4LPUA 4LMQI 4DCQA 3Q6FA 1FFOA 2P24B 3BQUC 4X6BB 1RUKL 2AK4A 2GSIB 5FYLL 2CK2A 5IROC 4RMUA 4Y5VA 4XHQA 2BNRE 4MNQA 2V5RA 3MLWH 1KCUL 4KMTH 4LCWB 3B6SA 1A7NL 2YD1A 3TV3L 5FO8B 1EEZB 5DEFA 3EYUL 3S88L 2CJUH 2PO6D 5I1JL 1BEYH 2I5YL 2JB6A 1INEH 3QFJE 1BPVA 3AAZB 3MV8D 3G04B 5E6IC 5I1DB 5IQ7L 5IEHB 4CADB 2VZUA 1SEBB 2WP3T 4QNPF 2C4FT 1GL4B 3RUGA 4RRPA 2ITCA 3GSOB 5C86A 1RQ5A 4ODSL 5B39G 1LO5A 2FATH 1A21A 4HBCL 3TBSA 1EO7A 1U8NA 3BKCH 3GIZL 5LQBH 5F1OB 4Y2OA 2QLVB 4OI9A 4IS6A 4WU5A 4X6CF 5CS7A 1BM3L 4LSSH 1KB5B 3MRPA 5JXAL 3FN3A 3H7BA 3HMWH 3CZFB 1KT2A 4GAYA 5JHLH 4NRZB 5D5MA 3HNVH 1BREA 4UB0L 1RURL 2QQLL 2ESVE 3OQ3B 3DI3B 3WNMA 4YWGH 4NN5C 4JKLA 2Q3ZA 3P9LA 2PF6A 5SX5H 3IFNH 3HMXL 5IVOA 4C58B 1OW0A 1TDQA 4E0RB 4TNVF 1DUYA 5DI8A 4GG6B 3RA7H 2CDFB 3WS3B 4JY4B 1D7FA 4NRYA 4L8SC 2VSDA 1FNEA 1CGYA 4G9DB 35C8H 1DQJB 4ZO9A 1J0JA 3DX6A 4MJ4A 4Y19E 5I1AA 5GS2D 2YEZB 5ABDE 4S2SA 3EYOB 3OGCB 4WFFD 5D7IF 4HD9A 1JGUL 4F80A 2OTWA 3MV01 3U48A 2BVOA 1ZVYA 3OB8A 4MD0B 5F9WB 4LP4A 3PWLA 4Y4FD 2EDRA 1H8OA 3EGSA 4N0UB 1II4E 2ZSWA 4OF7A 1R3IH 4KU1A 3LHPL 3EFDH 4NWTL 1ZHNB 2CSPA 2WBJC 3MJ8A 4RBPK 4LLQB 5HXMA 3GMRA 4Z0BH 1E4XI 5DMKA 2EE9A 3QUKB 3RPIA 1H3XA 1OCWH 4XCCL 3PL6B 3NCCB 1ZXQA 4X6DF 1G7LB 1H3PL 4PJFB 2NTFB 1KGCE 4IRZL 4JM2F 2P5WD 5IF0B 3T3PE 4D2NA 1UZ6E 5CP7B 5T3XH 1WVZA 2ZJSH 4HDIB 3LPFA 5C7XH 1KJVA 4Y4KB 4F7MA 4QCIB 1UWEL 5IHUL 4RIRB 5DMJB 3O6MH 1F11A 3W5NA 5EBWB 4WCYH 4O58L 3LKQA 3SGDI 3PABA 5E08H 3MACH 5LJYH 2VAJA 3JTTB 1BD2E 2XQBH 4QRPA 4M4RA 3NFNA 4JB9H 5L8LB 3MLVH 2P45B 5SWZD 1QLFB 3MRFA 1PYWA 3QXWA 5FGBC 2J6EA 4PV9A 3ULUD 4MQSB 3DX8A 1N6UA 3NABL 1U6AL 1LNUB 5DLMH 3OKOB 5KN5B 4JE4B 4HC1L 1SVCP 4IIQA 1M05B 1AE6H 4Q6IA 1MCLA 2J12B 2Q20A 2EDTA 3W39B 4MWFA 4XCFH 2FZ3B 5ENWB 5B3JF 1OARH 5DRWA 5I1GL 1TVDA 4O02H 4LKCB 5B38B 2FL5A 2E7MA 4XPHH 2Z31C 2D2OA 2FHCA 5KS9F 3KWWB 1X5HA 4HFWA 3VH8A 1YY8B 5C0AB 4F9PA 3I2CL 5DR5L 4MNGE 1DEDA 1EEYB 4OTXH 1A7QH 4G8FA 3L3IB 4PRIE 4JRYA 3A6BH 3VMOA 3BVNA 5DD3L 4LOUD 1FYTA 4ZFZB 3QDJD 3RTQB 1XIWB 3QEQB 4KK6D 4L5FH 1UGNA 4ONHB 3WFCH 3MFFA 3QQNA 4N8VG 2VQ1B 1NCWL 4LBEA 3ZHDA 3MUY1 5FM8A 3GHEH 4PJXA 5I8EA 4HKBB 1X5IA 4GBXD 1R3KB 5F3HB 3PDOB 5H94A 4X7CC 3CVHL 4HKXA 1GGUA 4NNPH 4P57B 1T0NA 4X99A 1MQ8A 4LLUB 3WUWB 4FQJL 5KJRH 1HSBB 1OTSC 4OB5H 3PV7A 4OV5A 1CLOL 2BNQE 3BJ91 4GAGH 3WSQH 5IQ9A 5FYJD 5IROA 2YPLD 1TQBC 3KPOB 5I74B 1CICD 4K3GA 4RGNE 1XH3A 4MA7L 1BIIB 1JGVH 4NRXA 3QQ9C 4CVZA 1O5DT 5L9DH 3ZTNH 2HLAA 2B4CH 1A47A 4P2RB 2HFEA 1RFDH 3PE9A 5E6IA 4ORGB 4KKLC 4YFLF 1IGCL 3F62A 3DVFA 3OJVC 1AH1A 4K9EL 1SY6L 3GUTB 3C08H 4DZ8A 4YBLC 4HGKC 2CK0L 5D1QC 1HINH 3SDAC 4JQXA 3E6FA 4NSKB 1EERB 4AEEA 3W82A 1U8QB 3CFEB 1R3LA 3L3HA 43C9B 3DGGA 5EC2B 1G7MA 1B2WH 4K7PY 5DQDL 4RMTA 5D2NB 1KUMA 2C5DC 4Y88A 4LLYA 3L3DB 2EYRB 2OMNA 2VDLL 4JANA 4FFWC 4EEEA 5GXBB 4K8RH 1JI1A 2BSED 3HZYA 2ZCHL 5ADOH 3WXVH 1DDHA 3MO1B 5JW3L 1NCUA 2JCCF 4HH9B 2W9LA 2DOCA 1MRCL 1TTGA 5J9PA 2BNRB 5IESL 5ALBH 2BP3A 4YGVA 1I8IB 1VFBA 3ARFC 4HIEB 3BISA 3TP4A 2PYED 4G8GA 1LP9A 4R3SB 4L8SA 2VNCA 4M1CD 2P43B 1ZVSB 5HY9A 4J6RL 1FYHB 1FC1A 2ZUYA 1EZVY 5I9QC 2IBGA 3QFJB 1NAMH 2D7TH 3SKNB 3BH9A 1HQ4A 4O4YH 2ICWB 1FJ1A 5BMFH 3V5DB 5JHDD 3EUUA 4FQXC 5DQ9A 3ROLA 1OAXH 1MJUL 4ODXA 1IGML 3BKML 4JFYB 4YHZL 1QO3B 1MCKA 2IFFL 5F88B 2FX8L 3C5ZB 1GGCL 2DQGL 4N8VA 5B38G 4UBDC 4UT9L 5GGRY 2NY2B 3ARBD 5FYKD 4Z7UA 1BQLH 3BIKA 2WBJA 4K94H 4RISH 3CC5A 3FQWB 5T33H 2Z93A 1B90A 2X10A 4NHCL 4P4KC 4WO4D 3QXDB 1CDCA 2X4NA 1MRDH 4KHTH 3J7HA 4O2EA 4FN0A 1MRFL 1ZS8B 3FB5B 2ESVB 4M03A 5CP3H 4FQ2H 4XVSH 3JV4A 1RZJL 5HI4D 2XTJC 5IVXE 3DHJA 3IXTB 3KPLA 1UZ8A 4JDVB 3GEWB 3MRHA 4OCWL 3FT2B 4QF1B 3VRJB 3O2DH 4LSTH 4O2FB 2MCPH 3BD4A 3QIWB 3KPNA 3VXQA 3V7AE 1YA5A 3MGOB 4ZO8A 2HT4C 4Y19B 3GBNL 3UTZA 4QXGL 3O3AA 5K59E 4NZUH 3WUWG 3QH3A 2MTPA 3U0WL 3V6FA 4JO3H 3GSNL 3GSXA 3QNYB 4PJBE 3IFPB 5FGBA 1Q9LA 1ERNA 1YPZF 1GVIA 4CNIB 5JXED 5HGBB 4MHHG 5DVNA 3HR6A 6CGTA 2H32B 3B9KD 4FQHA 2ZOKA 1CVRA 1T20A 4U1SA 1A22B 2M8XA 5MEQB 5CUSL 4I0KA 2BRQA 3HCVB 2E9WA 3ZDXF 3C60C 3CCHB 3ILPA 1CE6A 1S7SB 4P99A 4YNYB 1RZ8A 3FOLB 2BVYA 2NNAA 3G5XB 1HHIA 2DQIL 2ORBH 1KC5L 3DXAD 3IYLW 4RGOL 1DBBL 4NFDA 1CYGA 1UXSA 1WAAA 3QSKB 2Q8AH 5MP6H 2JJVA 2AKRA 3MA7B 3IDNA 3KYNB 4Y8AA 2R9HD 3DJ9A 1FZMA 1U42A 4ODHL 5D7JD 1XF3A 1NLDL 2VDMH 5D1XC 3B8SA 5EO0A 1CDYA 3NVQA 3IVKA 3SKUD 5CGYD 3V0WH 3FQRB 1AO7A 4V1DD 3QUZC 5CD5D 1BD2B 3IJSB 2CMRH 5DO2C 2JIXA 1C5BL 4LAQL 2R1YB 3S5LB 2VE6B 2F5AL 3MV7D 1I7ZB 3QA3B 4H1LH 5FGCE 4UQ2B 1A9BB 1IKFH 3QJFA 5T3ZE 2CDEB 3I6GA 1DEEB 1LO0L 1KN4H 1IGFL 1A6UL 3FN0H 2VDRH 3LKNA 1JF5A 4PLKC 1FSKB 3GSWA 4Z77B 1DQML 4HWBA 4M43H 2KQMA 3MRRA 2UUDH 2RR3A 3CSGA 1IGTB 2VB5A 3W0WD 3QYCA 4MVBC 4YJZL 4OZGF 4GAFB 4PRPD 1X5ZA 3D69B 4W4NA 3D2UB 3FOMB 4HUXA 4ZUWA 5A16A 4NO5B 5I75B 4Q6YA 1R3JB 4GSDL 4MJ5A 5C0CE 4MNGB 5E4EB 1I7RB 4PRIB 1PKOA 2NXZC 1BLNA 2DTMH 2VDQL 1YDPB 2V7HA 5D1QA 2NYYD 3T2QA 3SDAA 2A6KB 3FAXA 5D7SL 5KSBA 1CZ8H 5J7CC 3FTGB 4JFFA 1JNNH 3T2NH 2R0KL 25C8L 2AQ2A 2WBKA 1PVHA 1B3JA 2X9XA 3FO1A 3HFMH 2CLRB 3VI3E 4KAQH 1RZKC 2R4RL 1J1OH 2Q1EA 5TQ2L 3O4OC 1ODAA 3P0YL 1DBJL 1T7ZA 2BNQB 3ZDYF 1JHTB 5D6CA 1D6VH 5BW7C 1BBJB 4GLRI 2NY3C 2IMNA 2NW3A 5EB9A 5KAQF 5FKAA 3C6SA 3D3VA 5E2WH 4OGAC 5IBLD 4RGNB 4QOKA 4G43B 2DQEH 3ARFA 4K7PX 4O51B 3GRWH 4FP8H 4ZXBD 1TCRA 1K5NA 3BPOC 4NFCA 4BSVA 5CSZB 4XTRC 1HDMB 5E56A 3HAEA 4HWUA 5EZJA 3GJFA 4PTTA 3QCVL 5BJTB 1P4IH 4OFPA 1MFNA 2CGRH 1VADA 1S78C 2FYYA 3CFDA 4XGZB 1XF2A 4KTDL 4FQXA 4D9LH 4MQ7A 1U8LA 4I3SH 2A9MH 1A9EA 4KJWD 4PTUB 4JPIA 1OM3L 5B8CC 1TJIL 4M48H 5IEKA 4UUJB 1FL6B 4G8EA 4LDOB 1N4XL 3RNKA 4A6YH 5I1CL 4JZJC 4X6FA 1O7VA 1T5XA 1EZVX 5E9DA 1OTUD 4AK1A 1MEXH 2WQ8A 5C2BL 4F3FB 4UOW0 2WUCH 4RGMB 3FQUB 1G6VK 4P4KA 3VFTA 2IH3A 4TVPH 5JIPA 3S35X 4MX7A 4H26B 2OS7A 1RIUL 3NN8A 1J05B 1KCSH 3DVNB 3F5WB 4PJCA 3MXWH 3VWKC 2VZVA 2AXJA 3G9VA 5I18L 2NY6D 1BHGA 5EWIH 2IADB 4YE4H 2XKNB 2VLJE 2EICA 1P84J 3MV9A 4PJEF 4HUMB 4XHJC 4QT5A 3K0WA 5EN2B 4ELME 3DUHA 5AD0A 3EOTL 2W0KA 4PJDA 2B5IB 4OZIA 3W9DA 1MFCH 2EDJA 4DKDC 1YJDC 5IIEA 1CL7H 5C07A 4MS8C 1D5MA 3RGVC 3RRQA 3SQOH 1ZT1A 2J2ZA 1NAKL 3NAAH 1OP5K 5C0IB 5C0EB 5HTSA 2B1AL 4JY6A 1AXTH 3MBED 4DGIL 4YK4B 1DQTA 4MXWL 2VZOA 3G5ZB 2BMKA 2DD8H 4OD3L 3C2SA 1I75A 2EKJA 3HC4H 4KRLB 2FJFB 3C60A 3NMEA 3QHFH 4PGBB 3MQIA 2HA1A 4X7DC 5EZLA 3EOBA 1VFAA 4XP5L 2VXQL 3BD3A 4HK0A 1CFSB 1OGAD 2R2EB 1UC6A 4DQOH 1MCJA 3VGGA 5C6TL 1C5CL 4HIHB 2DB8A 3HC3H 5F9OL 3RUGF 5BZWB 5KZCD 1B0RA 2V2WA 2M2DA 5IVXB 5EO1B 4LHUG 2ZSVB 2DM2A 3SDXE 4FTVA 4XNUL 2Z4QB 5D1XA 2E9BA 1KXQE 1NGWB 5LGKA 4TTDD 4DTGH 5HYJA 1SYVA 1G9MH 3KNBB 4NOFA 3HZKA 5IOPB 1D5XA 1YY9D 1RUMH 2GK2A 1P4LA 4PD4J 3QUZA 3RWGB 5ICYB 1FBIL 5HBBA 4Z7WF 5D5MF 4ZTPL 2A1WL 5FF6B 4PJBB 5ACZB 4FHBD 1I9IL 3LSOB 1XGQB 1P1ZA 1RHHA 5FGRA 5HYFA 3KYKH 2X44D 3AB0B 9CGTA 1HNGA 3FB7B 1P5VA 2A6DA 4I48B 4NKIL 5I1LA 5CGTA 1WSST 2GY7B 3MZTA 3P4MB 4PJ5A 2R56L 3EYVB 1MVFA 5SV4A 2P5EE 4ZQKB 2CLZB 5GGSB 1HKLH 3QIUD 1EXUB 1H3GA 4FXGB 4I0PB 3L5XH 2P5WE 4M6NL 3OKKA 1L0XA 5E7BA 1RK1B 2W60A 3DI2B 5CMAA 4U6HA 4UIMA 4O2CA 3T0AA 5FA4B 3UDWC 5CEXB 2EYSB 3RZCB 2ZKHH 5JUEL 2DI8A 1C1EH 1MI5D 2K7PA 4C59B 5HDQL 4MA3A 3G5YA 4NQSB 4FZ8L 2ITDB 2EDHA 3LCYA 3FRUA 3O6LH 3HNSL 5SWZE 4X4XB 3O6KH 5KBNC 1SMOA 3C6LD 3HS0A 3ULUE 1KPUB 5A40E 4HLJA 3FFCA 1NSNL 1OGTA 5FGCB 2P7TA 3EDJA 3H0TB 3CUPB 5BW7A 2BSTA 3NZHL 1T2JA 3BPLC 4U1MB 4X5WB 3MRMA 2GITB 2XZQH 1HHJB 4WI3A 1AGCA 5SWSD 1KYOJ 1KNOB 1WLHA 3CSBA 3T2OA 4IOSD 1R24B 1FO0B 3QG6A 1IAIL 2AP2A 3QIBB 2IH1A 5AZ2L 4TUJA 4WUKH 2AQ1A 3P9MA 1WT5C 1K9TA 2ZOLA 3K2UL 4PP1C 3TO2A 4ELKB 4PJ8D 3U0PA 1S8DB 1HEZA 5LGJB 2O93L 4XP9L 3MLTA 5AUMA 2HP4A 4FG6C 1T21A 4QHKI 5C0CB 3MGAA 5E5MB 3TA3B 5D8JH 2HH0H 2D31A 1PY9A 5B8CA 1MCNA 3QZWB 5IP4A 1E6JL 5GPRA 3WV0A 4R6UA 1B4RA 4G7VH 4XNMB 3Q5OA 4JZJA 2VDKL 2AK1L 4XPTH 3RU8L 1WIOA 4Q7DA 2FWOA 4DAGH 2YS4A 1KIRA 4G80B 5KSVB 4X4YA 4JG1H 1UFUA 4R0LC 3VWKA 1AXSA 2EDFA 1X5JA 1C12A 4NNYB 4TSCL 1MNUL 5FYJE 2EC9U 4NQCD 3RWEA 2YPLE 4DGVL 3BESR 3DO7A 3TWCL 1EFXD 5SX4I 4EBQH 3DYPA 4KRPD 1EEUA 1I1AD 3L6FB 1N5AA 5ISZD 5HD8C 1AD9B 4MAUH 4PJXF 1F6AA 3BGMA 3IKCB 3W2DL 2V7NB 5H35B 5KVEH 3RGVA 5EC1A 3O41B 5DURD 1DANT 1OAKL 3U6RB 5EO9B 3QRGH 1NANH 1F4AA 4LU5L 4QHLA 1RIVL 1U8OB 2XXMB 1QRNA 5JTWA 2AQ3A 5D2LF 1XR9A 1PZ5A 1YEFH 1A1NB 3SY0A 3EHBC 1NFIA 5DEGA 2IAND 2VH5L 4WUUE 1WF5A 4WW1B 2QSCH 4G9FE 3IAGC 3HB3C 4U3XA 5C09A 1S7VB 1AHWB 3D87B 3DTXA 3NCYS 4PJ9C 2R8SL 4LF3B 2VLLA 4H20L 4RNRB 3RKPA 5DS8B 1PKQA 5JQ6H 1T22A 3BXNA 1UXWB 5JZ7D 4WHYG 5T3XD 4NP4H 2A77L 3DYMA 3H42H 4JREB 4OLEA 5GS1B 2ZUUA 3VXSD 4NQXB 2VLJB 2G5RA 3V6BR 3VWJB 3D0VA 4P0DA 3OR7B 4NZRL 4NUJB 2PYEE 1PLGH 4BSWB 3GMQA 2Q6WA 4ELMB 2E5EA 2YK1L 3AXLB 3WCYA 1NL0H 2X4TB 4L3ED 1JF6A 3GSRB 5J6GB 4ODVL 4FOMA 4FRWA 3MODL 3SN6N 3SHSA 5DZOA 3VDCA 3PIQB 4ZO6A 4XAWH 1KFAH 4LLMB 1QVOA 5K9OA 4N8PA 3HZVA 2HT3D 3BDBA 5KVDH 4L9LB 2PXYC 4KK9C 1JPTH 1D5BB 5DUBA 4TYUA 4YFDB 1H3WM 1DLFH 1U8IB 3NFSL 2QKIA 4ZSOE 3X12B 3I6LE 1X9QA 1NFDF 4FFVD 4E5XB 2GTZB 3RHWK 4YGAB 4Z8FL 2D7QA 1LP9F 5I2IA 3HRZA 4WNQA 1P4BL 1CXFA 2DRUA 1CFNA 4D9QD 1IAIM 2YXMA 1JPST 1JNHA 3R0NA 2OR8A 2F53E 4RWYL 1Y0LA 1QLEH 3QZWG 5EA0L 3UYRH 4KVCH 1R0AL 3HRPA 4QLRA 4MJID 5E24E 2BVEA 1YEKH 4OM1H 4S1QL 5LCVL 3SDXB 3UDWA 1F6FB 1A7PH 3NTCH 3LN9A 1MF2H 3VCLA 3ZE2E 2EDYA 4IDLA 5BOPA 1K2DB 1WV7T 5EZOH 1N5YH 1MH5B 4JKPH 5GS3A 5C2UB 1P5UA 1JE6A 4Z7UF 3EYFB 4N0YH 3KPQB 3WHXB 2XZZA 3TEUA 3JWOH 5GHWH 1ZA3B 4HS8H 5BRZD 2QQNL 3BP6B 1XGRB 5MI0C 4OBRA 2H2SD 2Q8BL 1CGXA 3O6FB 5IHBA 2YC1A 5LGHL 2Z8SA 4QWWC 1T1WA 3CU1A 5TFSH 3JTSB 4ZAKB 1CGUA 3L5WA 4W81A 1IQDB 1A2YA 4LK4A 3V5KA 2P5EB 4M7LH 1YYLL 3U7WL 4BUHA 1TQCB 1NMBL 1U36A 1WT5A 4OFIA 2P5WB 3AU1A 2RCSH 2ZUVA 1JPFA 1HZHL 5T1LA 2FGWH 4X7FC 1FIGL 5CSGA 3T04D 1ZANH 3OF6D 3JSSA 2NR6C 1CK0H 1IAII 3GSQA 4V1DE 3UZEA 4MCYB 3VFRB 4MSWB 3GMNB 3WE6A 3REWB 5SWZB 3LQAL 3QO1A 4QYOB 4N9OB 3MV7E 4K8RD 4KKBD 3B4NA 1KEML 1ZLSL 2AVGA 4R0LA 2WZPD 1BWMA 3EJZC 2IAMD 1ITBB 1A7RL 5I1EL 1CGWA 4OD1H 1HH6A 3GBLA 5C0FB 2DN7A 2W9EL 4XXDA 5HJ3A 1EEQA 4FA8A 2EIBA 1NGYA 2CD0A 2VXTL 2R29H 1DN0B 5EU7C 2IWGA 2SEBA 2YA0A 1FQ9C 1IGJB 1QZ1A 5FCUH 4PRPE 5HHOD 5JOFB 1CE1L 2PN5A 5I1IH 4L4VD 1P7QA 4HMDA 4A2LA 1D9KB 1AGBA 5BVPL 1BX2B 3MLSL 3QPXH 3S36H 4R4FH 4GT7A 4EJ1C 1G7IB 4NO0D 5LWYL 2X5PA 4Q9QH 2DKUA 1JZ7A 3V6OC 1E0OB 4KI1A 1JGDB 3BEWB 3WFZA 1TLKA 2FSEB 3MLYL 4Y2DC 4HFUH 4JJ5A 4K7PL 5DZNA 3OKDA 4PV8B 4NHUA 5EORH 5SWQA 3MLUH 5FDYA 5KSAC 3M1BA 5EFIB 43CAA 1RPQA 3R06A 5D1ZC 1TTFA 1QLRB 2R2BA 4NC1C 1Q9OB 3P40A 5MEOA 4EN3B 4PJ9A 2G75B 3MRCA 1ZT4A 4HV8B 1F42A 2FHFA 3OKLB 3X17A 4XPFL 3CD4A 1GAFH 1VENA 5FM5O 2WUBH 3OXRB 5IW6B 2GY5A 3DSFL 5TQ0L 3TJHD 3F7VA 4ZFOA 3JV0A 1PQZB 5J3HD 3SE8H 5FAAA 3UJJH 5KSBF 5DK0B 4M9OA 3D85B 5JR1H 1KSRA 4Y4HD 5C3LD 2A83A 5JO5A 3OHXB 3V52L 1RZ7H 1MCEA 5HHME 3IJYB 4XNXH 3S35L 4M6OL 1RIHL 4HUWA 1FVCB 1MFBH 2P44B 4WY7L 3NGBB 1U8HB 2OM5A 4K3DL 1ZA6A 2GJ6A 1S5HB 2PXYA 4ETYA 5TGBA 3VXPA 3CSYA 2UWEE 3VXRD 5F8RC 1KIQA 2G9HB 4JFOA 4OZHB 4UTAH 5DMIL 3UJTH 4KH2A 3OXSB 2KBGA 3T0EC 4WUUB 1KPVA 3BOVA 3F6IA 4G9FB 3CDCA 4WDIA 1RY7B 4NGHH 3VGHA 3QCUH 1J86A 3FQTB 3ARGD 2BOCB 5IB4A 4I0CC 4Z7NF 1KIUA 3O0RH 1BZ9B 1MCSA 4ZUUB 2PYEB 1I8MA 4XP6H 4RBPH 2VXVH 2JJSC 1C7SA 3ZHLA 1M7IA 4WWKD 3QEUB 4CN4A 3MUJA 4N1CA 3HC0B 2AI0H 5KG9A 1ZLWK 4EIZC 4G6AC 3N9GL 1IAOB 3GGWA 2DQDH 4KI5C 5DC4B 1MLCB 5C0ND 4PJCF 4I8DA 3RX8A 4PY8I 4GH7B 4U1LB 4GRLD 2AJSL 3TBYA 3MMEB 1A6ZB 1I3GH 2WIIB 3QWOA 3QUYD 3ZKMC 1JWUB 5DD6B 1FAIL 3KGRA 1NC2D 3MX0A 1FGVL 3LPGA 5HHQA 3UPRA 1YYML 3QNXB 1UACH 4HJ0D 4OZIF 1Q0YL 4YDLC 4YIQB 4APQD 4GRMB 4NQTA 1FH5L 5I1KH 2ZCKH 1JPGB 1OGAE 1WFOA 5BZDB 2NXYD 4XI5D 4TOYL 5J13C 3B9EA 2F53B 4R2GC 4S1DD 4UV7L 4Y1AD 2BY2A 5E94B 2BXYA 2YUXA 1DZBA 1IM3A 4FZEH 3RQ3A 1S3KH 2Y6SD 3RL1B 2Q76A 3EDFA 3DROB 4RMSA 3TH4T 4DGYH 4CUCA 4N0FB 4IDJH 1KTDA 4U33A 5I17B 4KJPD 3RVVC 1TJHH 2KPNA 4NPYB 4P23D 1B9ZA 4POZC 5IMLA 3AS3A 3QUXB 1S7WB 1N8ZB 4PR5B 2XZCL 4XNQA 1KENH 2PW1B 1KJ3H 2ICEA 4HT1H 4U7KA 2XZAH 4OIBA 2VLKA 4IMLB 5GRYA 4X9GA 1E27A 5ANME 4LSQL 1ND0B 5DJCA 3TNMB 4OF3A 5DJYB 1CI5A 1EMTH 3B9KB 2EE2A 1LO2L 2ZCLL 3CZJA 3GSNB 3JV6A 2DIBA 4P46C 5DJDB 4HUVB 3N06B 4G6JH 1Y18A 4G8IA 1J12A 3HE7D 3UMTA 1WZ1L 3GJFH 1CT8A 1MJJB 3H3PH 4ZUVA 5FOBA 1C16B 3K2MC 4XMKL 2CUHA 1M6OB 2XKUA 3OKMA 5DRNA 3BPCB 4ZD3L 1GPOH 3DX7B 2IQ9L 1UM6L 3GMPB 3PWUB 2E8YA 4HXAL 4EI5D 3KS0H 1KTLB 1RZJC 2OP4H 3QUMA 1HYSC 4MCZB 2GCYB 5E8NB 2DQJH 3JV5A 3RVWD 3VFUB 3LKPA 5CINL 2F8VA 2BFVH 1MSPA 3ULVC 5FUOL 4PGDA 4OFDA 1W8OA 2FJGB 2IQAB 4V1DB 4EUPA 4QXUH 4YDJA 1QNZL 1MCQA 4ISVA 3H9ZA 2CR6A 3CLFL 2X42A 5KSAA 4TVPD 1HXYB 2HMIC 1TVHA 5D1ZA 1GIGL 1OTTD 2BVQA 3MV7B 3MLZH 5DQJA 3DO3A 1F90L 1VGKA 4XBEL 2OSLA 2R4SH 4MMXC 2OL3L 1ACYH 1NGXA 4FMKA 2HJKA 1FG2B 4LCCB 2VZSA 3O3DA 4MAYB 4YZFF 4MZ3A 1KCVL 2X4RA 3CXDL 3G04A 3SO3B 4PRPB 1IC7L 2AERT 4OJFL 3QO0B 1N64L 5FO9A 3KS0J 3BN3B 3KPRA 4DKEL 4P5MB 3ZL4H 2JB5H 2P49B 3GFUA 4YXHH 1RUQL 3MUGA 4PRDA 3WFDH 3K8MA 5EIIA 1DVFC 2WIMA 3PGCA 3SKOB 3DIFB 2DL9A 4NOBA 1U3ZA 4JDTL 2X89D 4OT1L 2ADJA 1QFUH 5FGSA 1T83C 3O3EA 4XPGL 3U4EA 5JOPE 3CZFA 1FL5B 3QHTC 4XAKD 3IDMB 3T0EA 4KJQD 3SKJL 2EDXA 1UJTA 3IRZA 2O5ZL 4Y7MA 1H0DA 5AWNL 2H1PL 4GW5B 3RWFA 3JWDH 4X0KB 6FABL 5DSCB 3VFWB 3U36B 5MEPA 1JPSL 2YMXH 1ADQL 3FO0L 1LEKB 1JWSB 3UTSD 4JPKL 1NGZB 4IMKC 1RJLA 1C08B 1QKZH 4X80H 3BAEH 4LRNH 4OF0A 3V8CA 4TULL 1W0YT 4G9DA 3LQZA 3REVB 4ETQA 4X98A 2EO1A 3LQMA 3FJTA 5ISZE 2HTKD 3LDBB 1PG7X 5DJ8A 2JJSA 3MJ9L 2VQUA 4D0DB 3QDME 2J5LC 3MFGB 2WLYA 1K6QH 1S7TA 3TNNB 5F7NC 1G6RB 3D1MC 3ZO0A 4LSPH 4EQ2A 5HHMB 3ARDC 4NJ9H 1DLHA 4PGJA 1YMME 2FO4B 3RY4A 1S9XB 3IGAA 5T1KB 1S5IH 4M8QB 2X4UB 3PP4H 5MERA 1NBQA 3DMMB 1ZHNA 4JN2A 1BQSA 4MDIB 1FNSH 2UWEB 2ZUTA 3U7AA 4LLQA 4D8PA 3G5VA 2ERJB 3EAKA 2NMSA 2BNUB 3RDTD 3VRLE 1SBSL 2DQCH 4QRSB 1TETL 3EO9H 5BV7C 4HSQA 1HHKA 3PDGA 5GRUH 1G7LA 3RZWA 4LSRH 5ICZB 2CLVB 2FBJH 3TO4D 5CJQL 3HR5B 2X4QA 3JXAA 3RAJL 5T3XE 4HDIA 3B2UC 1FN4A 3VXSE 5JDSB 1I9EA 2MQCA 5DUPL 4QCIA 4Z5RA 1JNLL 3OGOE 1DUZA 5L6YL 5IBTH 4NZTL 2V17H 2IFGA 3CDYA 3CFKA 2HRPL 3ZKND 1N6QL 4OLYL 3JTTA 3Q3GB 4DW2L 3T4AA 2RGSA 4QNPE 1R5WB 3HPJB 4N5EC 4LLWB 3TVMC 5I8OL 3O8XD 1RZKH 2CIIB 2B2XL 3LMJL 1FFRA 3JWNC 1NKOA 1IC4L 2VLMD 3QDGD 4JJHA 5IG7A 3L3OA 4X7TA 4R97B 2C3XA 4U6XA 4X6CE 4KRNA 3SO5A 3VG0L 5HVHB 2DBLL 1GGBH 3BDYL 4S0SD 3LD8B 5E99L 2V5TA 2LTQC 3BP4A 4RDQG 1U3HB 4JFQB 3MOAH 4P46A 3V4UH 4H8WL 4HX1B 3BSZL 3KWWA 3FMGL 4ZS6C 4LPWA 4GQ9H 1T66C 2XA8H 1XR8B 1YN7B 5C0AA 3T65B 2E3VA 2H3NA 4H0HB 1ZHBA 2I9TA 2ATPB 1IGYA 3L3IA 4NNXB 2WWMC 2XKSA 4WHDA 1IM9D 1OSZB 1MFEL 3O3BA 4NBYB 4PREA 1Z2KA 3ZMRA 3GNML 1UA6H 4LRIC 2C7UA 5D7IE 4HKBA 2P8MB 3R4DA 1DBAL 3JUZA 4XPBL 2XNAB 3PDOA 5HI5D 2X7LB 3UJIL 1T04B 1BZQK 2EKSB 4P57A 1QSED 1J8HD 2FX9L 4P5TC 4TUKH 1HSBA 2DLGA 2JELH 4NQDE 2EXYC 3B2VH 5C9KA 2ZZUT 3AS1A 3LVEA 1CFBA 2EH7H 2NX5D 5DJAA 5F44A 4CKVX 1I1YB 1Z3GH 4QTHB 3CPLB 4PB0H 3O4LA 1BECA 5FHAH 3MRLB 1SJHB 3B3IA 1BIIA 1IILE 5JIHA 3TZVC 1S7UA 4LFHG 2R69H 1X5GA 1N6VA 3ARVA 4KROD 1QBML 3LS4H 4X6DE 2PTTA 3RJDA 4P2RA 3NZ8A 2FIKB 2CRZA 4YDVB 5JPMB 4R7NB 3QIUB 3MCLH 4N0CC 2C4XA 1W72B 4U05A 1IGIH 2LAAA 3QXAA 4GRWF 3N1QC 2IPUK 1OP3K 1JZ8A 4LEXH 4WW2C 4OLXH 3QG7H 3GUTA 5C0JA 1WCBB 2VDNL 4KQ3L 4RX4D 4MD4B 3GHBH 3KLAB 2QQKL 4OIAA 3SE3C 5IGXL 1DVFA 4QXWA 4YHYC 4OM0L 1LE5A 1L7TH 1NMAH 1I7TA 4D0BB 1T83A 3SOBL 3DRQA 2DLIA 1HXMA 3L3DA 2Y4SA 5BS0A 1HYRC 5DYOB 7FABL 3BRDA 2P8PB 3MLPA 3C6LB 2GT9B 1OF2A 4PYHA 5T5NF 1D6EA 3BZEA 3EDEA 3LS5H 3DBXA 2EXWC 4XC1L 1V7MH 4ZYKA 4HH9A 1BFVH 2H9GB 5C3TA 5B3JE 3EOYG 1ONQA 4E9LA 5CJXC 4P48A 4RFEA 2JJTC 2ADFL 4GW1B 1FLRL 1MJ8H 2EZ0C 1LHZA 1X5LA 4IMKA 1I8IA 5AYUH 3WFEL 2W9DL 2ZUWA 3C87A 3CH1B 2J6EL 5TF1H 1GHFH 5FHBL 4QTIL 4M1DH 5KS9E 5EPMB 3IU3A 5HSFA 5GIRB 3VXMD 4L4VE 4R7DA 3MREB 1Z5LA 1M7DA 4EQ3A 1WBXB 4YX2L 4EDXB 4IRJD 3ZDZF 4JPWH 4Z18A 3U9PH 3ARDA 3BKYL 1UCBH 5D93B 4R8WL 3KYMB 3RL2B 1IKNA 5E8PA 4BH7A 3HG1D 1BQHG 4NQEE 1CDUA 1DSFH 5FM4A 4BH8A 2YKLL 3P11L 3WYRA 4YHLH 3WO4C 3FQWA 1P6FA 3MCKA 4P9HH 1BF2A 3WIHH 3L5JA 5DUML 1Z9MA 1MAKA 1A6WL 3VFVB 2HN7A 3THML 3LEYL 1ZS8A 5JPNA 3CK0H 2C1PA 1OP5H 5L2JB 2HKFL 3DV6A 1VSCA 3MROB 4S1SL 2DQHL 3J8F7 2YPVL 2MOVA 4LKXB 2MPAL 3B5TA 4M6MH 3GJEB 1UQSB 3HE6C 3FT2A 3FL7A 4QF1A 4KTEL 4OCXL 1P53A 1FRGL 2EEAA 4FXLA 1GC1H 4AJ0A 2X9YA 1EFXB 3TN0D 5E2UL 4C56A 2B5IC 1NKRA 4M7JH 3PXJA 3KJ4B 1TZHB 1MPAH 4Y19A 4LCIL 5ISZB 3QXTA 2DMKA 4GRWH 1QBBA 4FABL 4ERSH 5IV2B 5CCKH 3QDMB 1ZT7A 5D96C 1QP1A 3TVMA 1AGDB 1MCWW 1XF4B 5E2TH 4BQCA 3D6GA 5HGBA 2H2PC 3IF1B 4Z0XB 3FB8B 3I3DA 1SJVA 5E1HB 1YMMB 2H32A 1E28B 3K80A 1YEJL 4XP1H 1U95A 3U30C 3BQUD 5EU6E 2V9RA 1HIMH 2E9IA 4ZFGH 2Q87A 2Z0BA 3UTTD 1HN1A 4WTWA 5CFHA 1GH7A 3G08A 4PG9B 3CJJA 4P5KA 2IPTL 3VXUD 3E2HB 4NKMA 4WHTA 1RK0A 4XWOC 1CDJA 3VFPB 3GBML 4R4BA 4YO0A 3G5XA 5F21B 2FD6H 3WL9B 1CLZL 2IF7A 5IW1B 4FFZH 4EOWH 1GGYA 5E6ID 3BUYB 4YFEA 2JCCE 3BRFA 3VD9A 3ZYZA 4P2QA 3PGDB 1MIEH 3KYNA 1NCCL 3FRPG 1ZHKB 3RVTC 3QAZB 4Z7QF 2PR4H 2OJZH 3VXSB 3L3KA 1S9VA 3SDCD 1FL3A 5E70A 1FDLH 3BYTA 5HDBF 2I25N 3FQRA 4LRIA 3QI9D 1U8JA 3SJVA 1KJ2A 3ROOA 2DYPA 1J1PH 1RJZB 1E6OL 4QKXB 4AMKH 2HJFB 1MUJB 4TNVK 5DJ6A 5JIIA 5EBLB 3VD3A 2DAVA 1GYAA 5JW5B 2R1YA 3S5LA 5F96H 2O61A 4PB9L 4PJGA 3IDGB 4P5TA 4I2XE 4UMGA 3MOBH 2Y36H 4LCWD 2W07A 2CDEA 2FB4L 4JO2H 5GISH 2IPUG 1M71A 4BFEA 4X6CB 1RZIB 5C0RL 3MLRH 1Q72H 3BGFB 4OZ4A 1JN6B 1XGYH 5TE7L 1PD6A 3U9UA 1CR9L 5DHYA 1U8PA 2WBWB 4CN1A 4M5ZL 3TZVA 1JHLH 1F8TL 4Y5YC 1T7XA 4J3XA 4CU6A 3E0GA 5ADPH 1MY5A 4PS4H 3DV4A 3A67L 4Q9BA 1YEHL 1R3JA 4HIJA 4KK5C 5HPOA 2Y72A 3O2WH 1OQOA 4ALAH 3EDDA 4TVSa 4WW2A 1YDPA 1A4KA 4EVNB 1Q9WA 2FECI 5KSUB 3LRGA 1P2CB 2Q86B 2FLBT 3SE3A 3BRGC 2CUMA 3FTGA 3OV6A 1YQVL 4U1KA 5D7IB 1AKJD 1F4XH 3JZ7A 4UINH 1YPZE 4K7FA 5LXGL 5AZEH 1YEDB 4AH2A 1G9NC 4IJ3B 4JO4L 5EOCH 4NQDB 4KUCD 3O9WC 3Q5YA 1BBJA 1AFVL 1MJ7H 3TF7C 5IB2A 5F7MC 4EKXA 1IEHA 1VFMA 5HHVH 3BDXA 3FT3B 3L5HA 5HHNB 3RX7A 3ZDXE 5CJXA 5KVFL 2JJTA 3PWJA 3RI5K 1JTTA 4OF8A 8FABA 4PRAA 5JLZA 4F7CA 4LCYB 4U1NA 4XCNA 3L3GA 1AJ7H 3BEVB 4Z76A 5CSZA 3G6AB 4C83B 4X6DB 3QFDA 2XN9B 4JFDA 2VIRA 4JM2B 8CGTA 5DJ2B 2YBRB 1QSZA 1IC1A 5BQ7A 4ODUB 4I5BA 2ZWLT 3FRPA 5IFHH 4HJJH 3DUUA 4I18B 3JUYA 3MNVB 4LVHC 3SDDB 1FL6A 1JUFA 4OQTA 1SYSB 4N5UA 1WTGT 4K2UL 4ZFFA 4F8TA 1K3ZA 3DGCR 4MB4A 1QHPA 4QHUB 5EOCJ 4F3FA 3ECBA 3FQUA 4UDTB 2FJHA 5T1DL 2B39A 2Z31D 2DIAA 4PRBB 4TVPE 4KDVA 1WBZB 3BP5A 1JMZA 4OUOA 1IT9H 4HAGA 4E41A 4Y4KD 5F7WC 1YN6A 3TPUA 3GK8L 3S4SA 1RVFL 3NFPB 4XPAH 5F3BB 1ORQB 2IAMB 3PHQA 3IKKA 1RUKH 2QEJA 3MJ6A 4LSDA 3F7QA 5FYLH 3HE6A 1XZ0A 2HVKB 4HWZA 5EN2A 1S7QA 5GZOC 1KCUH 2R2CA 2FR4B 2KQNA 4OZGE 3UAJC 2NLJA 5EU3B 5EOTA 5KS9B 1A7NH 1LDPL 4JHZA 3TV3H 1O7SA 3S88H 3EYUH 5EH1A 5I1JH 4KVNL 4L4VB 1HCVA 2I5YH 4U1GC 3PJSA 1UJ3B 4JFPA 1BVLB 5IQ7H 2Y5EA 4P2CG 4HWBL 1T4KB 5F7LB 2G2RB 3DYOA 4LEOA 1OTSD 4LAJH 4EXKA 4ODSH 4F7EA 4HBCH 1HHGA 3GIZH 1NBYA 2I07B 3ALXA 2VQTA 2DWDA 4NQEB 3AREC 2IJ0C 1U2HA 2PNDA 4OD2B 5HI3D 4OGZA 1OPGL 5CBAB 1BM3H 1EJOL 5JXAH 4OLZL 2C3WA 3MR9A 5E2VL 4JZOA 4PRHE 2W0PA 1ORSB 1PG7L 1WWCA 4HUUB 3MYJB 1SVZA 1YNTB 3ZDYE 5D9SB 1A1MB 2ZUQB 2EH8L 4UB0H 1RURH 2QQLH 5HHPB 2XWTB 3RTQD 1XIWD 5JDJA 3QEQD 4HIHA 2C3VB 5BZWA 3HMXH 2D0HA 1BFOB 5FUCC 3N0PB 4LVOB 2PO6C 2UYLB 4MXVF 5FV1L 1CLYL 2OXHA 4L1HA 2OQJB 3IXAB 4LSVL 5ICYA 4HQQL 5KJRL 3VGAC 3TESA 1BOGA 5FB8B 1NDMB 4PJBA 1GXEA 3ISWA 4UILL 1JGUH 4POUB 4JVPA 2OR7A 3RWJB 4UDUB 4BFIA 1XGQA 15C8L 3MSPA 1ETZA 4WV1C 4HIIA 5EU6B 4GXVL 1VCAA 4IOIA 3STLB 3UTOA 2Y23A 4L4TA 4KGLA 3SKMB 2ADIB 4I48A 1ZGLB 5I8CA 3LHPH 1QQDB 4MD5B 1I7UA 2V5MA 4NWTH 1F97A 5IKCA 4XX1G 4P2OC 1NEZB 5GGSA 2EEBA 1QFWL 4CU7A 3D48R 4Y5YA 5GGRB 4UU9B 1FZJB 2JCCB 1CF8L 4XZUA 4XCCH 3GSUA 3CFJA 3V2AR 1A4JB 1H3PH 3ZHKA 3D25A 5CEZL 4IRZH 4QRRA 2EIDA 5HHXL 4HS3A 1XGTA 5CEXA 2L4OA 1OHQA 4KI5F 3RZCA 3GMOA 1UWEH 5IHUH 4JO1L 1OWWA 1H5BB 2JK5A 3S98A 2RJMA 3RIAF 4O58H 3EIFA 2Y07L 4P4KD 3KLHD 5DD1L 4KWUA 5E8EB 4TQEL 1AC6A 4HUNB 4Y4FC 3SCMC 1X3DA 2OR9L 2BNRD 2AK4E 5F72S 3SPVB 4QRTB 3IJHA 3QNZA 1OB1A 4G5ZL 3O9WA 3NABH 4MNQE 3CUPA 1L9MA 4YEFA 1U6AH 4U1MA 5C0BD 4HC1H 4GRLB 5CJOL 1Y6MR 4X5WA 4PYGA 3QFJD 4PJ7A 1OAUL 3TIDB 2C1OB 2HJLB 3RWIA 4XNYL 5I1GH 1UB5A 3BZFB 1U91B 2X1XR 5HGDA 2AXFB 3DOSA 2OJEA 4KUZL 4APQB 3RUGE 3N85L 5GRXG 5LGJA 3C5ZD 3T08A 3VFGL 4CMMA 3I2CH 1BZ7B 2J8OA 2MQ0A 5E5MA 5DR5H 2NY2D 1LE9B 3V79C 1L9NA 4LHJB 2GJZB 3G9AB 5DD3H 2OZ4A 1P84K 5TE6L 4F8QA 5MHSD 4XNMA 1K4DA 3ULSB 4GJTB 4Y89A 2YD8A 3MNZA 1NCWH 4Z7WE 1ZLVK 3C60D 1FFNA 4HK3J 3MUZ1 3S3PA 2ESVD 5D5ME 1A6AA 1FNGB 1MCPL 2BOBB 3FCTB 1Z9LA 1J0ZA 1YPZB 3HUJF 1IL1A 3UYOD 3ULUC 1A3LL 4R4ND 4MA1C 2R2HB 3CVHH 5DT1L 1U92B 5IFAL 4P59L 3MRDA 2YUZA 3MRGA 1HCFX 1OLLA 4FQJH 3X3FL 1CLOH 3RNQA 4M1GL 3QIWD 4YPJA 1DE4B 2IPKA 3STBA 3GKWL 4AEHL 4FTVD 3DECA 5FM5M 1G7PA 2DQFA 5JQHC 1MHCB 2RFXB 1IARB 2FLRT 2J88L 1J9CT 1FVDA 1QACA 2YWYA 5L2KA 4MA7H 2VTFA 5H35A 5HYQB 3ULVF 3O41A 2BVPB 3PWVA 5EO9A 5DZLA 1X5AA 3DHMA 1IGCH 1LO3L 4LOUC 2I27N 5FYKU 4K9EH 4KK6C 5F1NA 1SY6H 3IU4L 2CK0H 4ZUSB 4GW4B 1NCBL 1LO4L 4MA8L 3CLEL 3AREA 4GBXC 2VWEE 5J56B 4RA3A 1I1FA 4A6YB 1NEZG 1HE7A 4X4MA 1WISA 1RJYA 5DQDH 1AHWA 4AENA 4EDWL 4P9ML 1KGCD 2Z92A 4IHOB 5DJXA 4L3CB 4JZNA 4PD4K 3VXOB 4XCYB 4F15C 2VDLH 2BHUA 5DK2B 4Q2ZB 3WDIA 3BWUC 1QFWM 2NW2A 2ZCHH 3V6ZB 4Z7VA 3KR3L 3BPNC 4DVBA 1KBGL 1KG0B 1CICC 5JW3H 3BO8B 3QJHA 4NUJA 4NQVB 1H15B 2X4OA 4BSWA 1MRCH 3QEHB 2YHGA 3KPPA 1VERA 5IESH 1YUHA 2PO6A 4OZGB 1CBVL 4LNVA 3U7YL 3VXME 4RAUA 1KEGL 3WJLC 1Q38A 2OL3B 3MV8A 4J6RH 1UB6A 5IVZB 3CFCL 4HS6B 1EO8L 1TTUA 3FQNA 2BSRB 4L9LA 2WM0A 3RBSA 2YZ1A 3ES6A 2VO5A 2VXSL 2CKBA 2K1MA 1MJUH 4JRXD 1IGMH 1LD9B 1TZGL 3IFOB 2NY3D 4WV1A 3BKMH 4YHZH 4J4PD 2IFFH 4ZNEA 3VFSB 2FX8H 1GGCH 2DQGH 1IAKA 3X12A 2E27L 3D2UD 4UT9H 1XGUA 4RDQF 4UOJA 4ESKA 4HIXL 4L29A 3T4YB 4J1UB 3MRQB 1EHAA 2WP3O 4PRHB 1NCAL 4NHCH 2VABB 3WNPA 1U8MB 4P2OA 1ZLWH 2N56A 2Y7QB 4PRID 4JM4L 2OTUA 5ILTL 4G6ML 1VPOL 1MRFH 4TUOB 3NCEB 5KTEL 4NYLA 1FYTE 4LHUD 3RY5A 2QJDA 1RZJH 4NFBA 4XC3L 5CHNB 1N3NB 3SDXA 4OCWH 2MQ3A 1MVUB 4PJXE 1SEQL 4NZJA 3EYSL 2W0FB 4F2MB 4PJHA 1QYGL 3TBWB 2N7AA 4Y16C 3BH8A 2BNQD 3GBNH 1W0VB 4QXGH 5EU4A 2YUVA 4FQPA 3U0WH 1ZA3A 5D2LE 4K3EL 3Q1SL 4DEPC 1XGRA 3GSNH 4Y4FA 5D71L 3SCMA 3D0LA 1KACB 3BW9B 4HJGB 3CXHJ 2PCPA 4RGND 3GMLB 4ZTOL 3PV6B 4OCNC 3UTTE 2IC2A 3ARBC 5EU5A 1YJDL 1MLBB 4XHJD 5TH2B 3S34L 3VXUE 4WO4C 5CUSH 4G6FD 1ZOXA 4M7LT 2FGZA 3VD7A 4AG4L 4NDMB 4U3CA 3S96B 4AM0B 1XGPB 5F9JB 5MENA 2V2XA 5LKNA 5I0DA 3QQ4A 4HGWB 2DQIH 1JRHL 4JLRB 1KC5H 2P5WA 3S37X 5HI4C 4RGOH 1DBBH 3RWCA 4QRQB 2AV7B 4YXKL 4ZMAT 4PJEB 2F58L 2IALA 1VKXB 3VI4F 5C0DB 5DMGD 1OY3B 3MGTA 4ZOBA 5IMMA 4ODHH 1CFTA 2CXGA 5J89A 1NLDH 5DC0A 1Z9OA 5F7HA 3AROA 3F7RA 5DJZB 1MHHB 5M94B 3RVXD 3TYFB 1LEGB 4PRNB 5JW4R 3K81A 1KPRB 3BFOA 4NC2B 3REWA 2GSGB 5SWZA 3O8XB 4QYOA 5JXEC 2A9NL 1WC7B 1C5BH 2BY0A 3LEXA 1WZMA 2RBLA 3TH3T 4LAQH 3O45B 3Q6FB 1FFOB 4TRPL 2AK4B 2F5AH 3STZA 1DR9A 3MLXL 4MNQB 2QTEA 1NFDE 5C0FA 1IEBA 1LO0H 1IGFH 2BERA 1A6UH 2D7OA 2XYCA 4G8GE 4PJIA 4POYA 4ZNCD 5DEFB 1FZOA 1DQMH 1IGJA 1HQRA 5JOFA 2JB6B 1JGEA 3MBXL 4LIQL 2VUYA 4JFZL 2FEDD 5J1AA 4ZPVA 3RUGB 2R9HC 2ITCB 2R0LL 2Z8VC 5D7JC 1LO5B 4XMLL 4PJGF 4GSDH 3TBSB 1U8NB 3ZT6A 1IM9B 3QDJA 5E8DL 4YFLI 2VDQH 3WLWD 1EUUA 1JGDA 2UY7A 4IS6B 5CGYC 2GAZA 4WU5B 3LV3A 3P2TA 4FXKA 4Z7UE 3MRPB 4L8CB 5CD5C 5HDLA 5D7SH 3H7BB 1ZHLA 4GBXA 1KT2B 1AP2A 4Z7WB 2R0KH 4GAYB 25C8H 2JJUA 4KXZH 3EO1B 5D5MB 1FG9C 5IVNA 1QLRA 4IEFB 2D7NA 3LAFA 4Y5VC 5KAQG 3P73A 2E6PA 4HV8A 3P9LB 2R4RH 3WBDA 5TQ2H 2V2TA 5ECJE 3P0YH 1DBJH 4JAMA 5DI8B 2YPLA 1ZK9A 1CICA 1J0KA 4WW2F 4NRYB 2J8HA 1FNEB 3EDKA 4RFNB 3DX6B 2GHWB 5I1AB 3I84A 3WJLA 4S2SB 3BYYA 3OHXA 3IJYA 3TT1L 2OTWB 5I6XC 3QCVH 4LVNC 5D72L 5DGQA 3VW3L 4TPRL 3PWLB 5DHXB 2DMBA 3HN3A 5GGUA 3X14A 2NYYC 4KJYA 5EIQA 3EGSB 5CSBA 4OLVL 4KTDH 2ZSWB 1WFUA 1OM3H 1TJIH 4PG2C 4YBQD 3JVGA 3MJ8B 1OT2A 2Q3AA 1EVUA 4DN4L 1LQSR 2RQ8A 1N4XH 5I1CH 3GMRB 4I0PD 5DMKB 1L7IL 4M02A 3OWEA 2XFXA 2MKLC 5C2BH 4LLAA 3RPIB 2BOCA 3U4BL 4QHKJ 2R15A 3NPSB 5INCA 1RIUH 2ZUSA 2VN7A 2DJUA 3W11D 3T1FA 5C8JA 1URLA 1KJVB 4WTZA 5I18H 5CAYB 4F7MB 1BZ9A 3Q5TA 4ZUUA 2K7QA 1F11B 4ZXBC 4H5SA 2L7UA 3LKQB 1E4XL 5E2JA 3EOTH 1LK2A 3NFNB 3EBAA 3WXWL 3NIFF 3MRFB 1QG3A 1PYWB 5TDNA 1PGRB 4U1JA 4PV9B 3WEXA 5JHDA 4IRJB 1NAKH 3DX8B 2D4DA 5CKAA 3VG9B 3FO2A 4I9WE 4U31A 2P4AB 1OD9A 1ZKAA 3U83A 2B1AH 4IIQB 2YD4A 4U7SA 4U1LA 2VZTA 5CBEA 4NN7B 1NBZA 1A6ZA 4DGIH 3ARBA 4KZDL 5DRWB 3P3YA 5DRZA 1MWAA 4MXWH 4ZSOA 2FL5B 1QEWA 3NCYP 4M7ZC 4WO4A 5GRVL 2CRYA 2IBBA 4OD3H 3P4LA 3AFLA 1KN2L 3CNKA 4HFWB 5C0CD 3VH8B 4GRMA 4RRPG 4CRPA 3TA3D 3C5SA 4XP5H 2VXQH 2NY6C 5T5FL 3N1GC 1RU9L 4G8FB 5E94A 4GUPA 3BVNB 4FQLL 2WW8A 5C6TH 4JFXA 1FYTB 1C5CH 1TFHA 3RL1A 5F9OH 3CU7A 1GSMA 5KSBE 3MFFB 1BBDL 4R26L 3BKJL 4JGMA 3INUL 4XNUH 3TIEA 4YHOL 5I17A 4PJXB 5I8EB 1OAQL 4KKAD 4U0RC 1S7WA 3HB3D 4HKXB 2AABL 1UCTA 2DICA 1T0NB 3MJ9A 4UIKL 3DVIA 4Q6IC 4Z95L 4ENED 1FBIH 2X1QA 3U46A 4ZFOL 3PQYD 5JXEA 1DQQB 5D2LB 4OV5B 4L1DA 3ZYOA 3MBEC 1GGTA 4ZTPH 5TDPB 2A1WH 5IQ9B 3B9KA 3BQUB 1FV1A 5J4MA 1I9IH 2BX5A 3C8KB 3QQ3A 2VL4A 3VFNA 3D3VE 5L88L 1DQLL 3K4ZA 5DJDA 1CDBA 1JTOA 2B7DT 3ZYJA 3VXUB 4NRXB 3SGKC 2ENSA 4CVZB 4NKIH 5D7LD 1D3CA 3SE4C 2HLAB 4LQ1A 4XVTL 3DXAA 2EECA 2HFEB 2R56H 5FEBA 5E6IB 2A6JA 1DQDL 4C54A 1M6OA 3WUZA 4XVJL 3OZ9L 4Z7NE 5F6IC 4MJ6A 3PWUA 1UM5L 4HEPG 2Z9TA 3I9GL 3KXFD 5HGAA 4M6NH 2JF1A 3V95A 4DZ8B 5D7JA 1INQB 4QXTA 3NA9L 4HPOL 2VLRD 3TYGL 4TTDC 1CL7I 4K3JL 1R3LB 5HPMA 3WIIL 3L3HB 3T09A 2YUWA 3DGGB 1YY9C 3PWPD 1G7MB 5E9DE 2FJGA 2IQAA 5JUEH 2QSVA 4LLYB 4LQFL 5HDQH 1ZEAL 2ARJA 4JANB 5I19L 5CD3A 4FZ8H 1EAPA 1YECL 2A6IA 2DM4A 3HNSH 4PJCE 3HZYB 3MV7A 3PP3K 2XWBA 3KJ6L 1OP3H 1DDHB 2VLJD 2HG5A 3D18B 3VWJD 4NN5B 5BXFA 3LKRA 2R1XB 5J0BA 1NSNH 3MV9E 5C0BE 5J9PB 1NFDB 4R96A 1VFBB 3NZHH 3TCLB 5C71A 4JPVL 4G8GB 1LP9B 1U3JA 4L8SB 3U79A 4OZIE 5HY9B 3W0WA 1TXKA 1CFQA 1QR1A 4LARL 4F57L 4PRPA 5C07E 4DUWA 4U1IA 5BO1L 3V0VA 4P5MA 3OR6B 1CD0A 1IAIH 2APBA 4QY8A 5ESAA 1HQ4B 2FCBA 5AZ2H 4JQXC 1FJ1B 1OAZL 4LHQB 5DQ9B 3ROLB 5F7EL 3K2UH 3GIVA 3FONA 5K93A 3WDJA 5F1SA 1MAML 4ODXB 2W92A 4OSUL 4XP9H 5GGSY 1BAFL 1F02I 5DD5L 4N8VB 1WCQA 4NCDA 1MQKL 4PBWD 5MHSE 3TBTB 2D7PA 4PG2A 4Z7UB 3ALPA 1E6JH 4YUEL 3BIKB 5IHZA 2WBJB 2BC4A 1HK6A 1VEMA 3CC5B 1AKJB 4PJ7F 2Z93B 5IB1B 1OOAA 3VH8G 5CEYB 2X4NB 1WGOA 5B22A 5TE4L 3C6LC 4GKZA 3EOAB 4OKDA 3VFMB 2VDKH 3HZMB 4GW5A 1IEAA 4O2EB 2AK1H 4X0KA 3RU8H 2CUIA 1V3KA 3PG2A 5BCAA 1LEKA 2P8LB 1J0YA 1PX4A 3JV4B 1NGZA 4D9RE 4F58L 2UZXB 3KPLB 2CO7B 1UZ8B 3HLAB 2Z91A 3MRHB 3ARWA 4FTVE 2HRLA 4TSCH 1MNUH 1HILA 1EGJA 4ODWA 5HYJE 1TNMA 4DGVH 5F7UA 3H2WA 3KPNB 3VXQB 3TWCH 3V7MA 4ZXBA 1VEOA 3UTZB 3O3AB 1YQ2A 3QH3B 1GCFA 4M3JA 3V6FB 4PJ8C 3KHQA 3GSXB 3W2DH 1DL7L 1V7NL 3ZSSA 3O6FD 3HPLA 1NH6A 1BF8A 1OAKH 2UVEA 5DFVD 4LU5H 3ZSTA 4FQHB 1RIVH 4ZAKD 5AEAA 4U1SB 1T20B 4BUGA 4Z78B 5ITFA 2WNGA 1TJGL 3ME0A 3HI1A 1BVZA 3VU2A 2P5ED 3ILPB 5GZND 4U1HB 1CE6B 3MPCA 2O26U 1RZ8B 4QRSA 2D3VA 2VH5H 2RB8A 1HHIB 2DDQL 3QUML 2Z31B 4FNLL 4JQIL 5GRWA 1UXSB 4GKNA 3HR5A 2R8SH 2Q7YA 1MELA 3VDBA 4RWHA 4WFED 4H20H 1CS6A 1FCGA 1F2XK 4Q58C 3IDNB 1TZIA 3P4NB 3DLQR 4UV4L 1S9WA 1FZMB 4HMCA 1XF3B 1T3FA 4M5YL 4YZFE 4AZ8A 4NCC2 2A77H 4KRPC 2BDNL 5EO0B 3MC0A 1I1AC 4UTBL 4NZRH 3IVKB 3W5MA 4RZCB 5IK3A 3RVUD 2AJXL 5IM7B 1PG7W 2ARJQ 3SGJC 4Y2DD 2YK1H 3RI5F 1EJ6A 4NM8L 4ODVH 2BCKA 3MODH 2XV6B 4X9IA 2XY2A 4NCC1 2WK2A 4NT6A 2AXGA 5K9QG 3IDIA 1T7VA 4TSBL 4YLQT 1NUGA 4IBLT 1A6PA 3QJFB 4JDZA 4XXCC 2E7HA 3MBEA 1CDIA 3I6GB 4JRXE 2PETA 5IT2L 2GK0A 4Z7VF 5F1IA 4JFED 3F12A 4YHPA 4HHAA 1TQBB 3GSWB 3MCG1 3LZFL 3MRRB 1EHLL 1J1XL 4J8RA 3NFSH 3QHZL 3SGKA 1D9KD 4G7YL 4Z8FH 4HUXB 3SE4A 5K9KB 1BVKB 3T2PA 1A14L 3FB6B 5A16B 3V4PL 3OL2A 5JZ7C 1BP3B 1KB5L 1P4BH 1EBAA 5L0QC 1OGAA 4MJ5B 2W65A 1EO5A 2LFGA 4G6KL 2FHBA 1QPPA 1BLNB 2OI9C 4YBLB 3K4DA 4RWYH 2DS4A 5D1QB 3SDAB 5EA0H 4K07A 1R0AH 5KSBB 3GJFK 5HYSA 2HFGL 4KV5F 4HUKB 3ARYA 3ZE1F 3OPZL 4NC0B 4S1QH 5LCVH 2XNAA 2B1HL 5GSVA 4EN3D 4NKOB 1NANI 1KXTB 2HT3C 3KLDA 2YPKA 1AC0A 5ANMA 3S37L 5D6CB 4KHXL 2QQNH 2HTLC 4OGXL 4ZOEA 1A3RL 1F3JA 2NW3B 1I1YA 5FKAB 2Q8BH 3C6SB 3BIBX 4M93C 2VR5A 3D3VB 4K3HA 1LILA 4FFVC 3VGDA 5KANI 2BVTA 3D85D 5LGHH 3ARFB 3H3KA 3NIGF 1TCRB 1K5NB 3HI6L 4RAVA 5IW3A 4I4WB 2FIKA 3EO0A 5EZJB 3HAEB 4YDVA 4R7NA 3GJFB 3M8OL 3QIUA 3C2AL 4PTTB 4PJHF 1W72A 2J1KA 4NWUL 4NUGL 2UZIL 1YYLH 1VADB 2MHAB 2FYYB 3OJ2C 3Q2CA 4G6AD 4LLVB 3U7WH 1XF2B 1NMBH 4FQXB 4BZ2L 4MQ7B 4HZLA 4MD4A 5F7DA 1A9EB 1PEWA 4JPIB 1CGSL 1S7XA 5IEKB 1HZHH 5CILL 4G8EB 4AY0A 1FIGH 2XOTA 4WUUD 1T1XA 1UG9A 1MI5A 4G9FD 1RJCA 3RNKB 5IBUB 1T5XB 5E9DB 5INDB 4F7PA 4UOW1 4OCSL 5C09E 5C0GA 4P4KB 2LABA 3VFTB 2IH3B 4IJ3C 4MX7B 5JA8B 3C6LA 5KVMC 4C57C 3NN8B 1PKQE 1N0XL 2DKSA 2LE9A 4PJCB 3LQAH 2H2SC 3PNWA 3ZZ1A 5JMOC 1JBJA 4GW1A 5HYEA 1KEMH 2XTJB 4LNRA 1ZLSH 3W9EB 1F45A 3MV9B 5C0BB 4N68A 4QT5B 1A7RH 2HYMA 1UH3A 1JZ4A 5I1EH 1INDL 5SWSA 5AD0B 5GIRA 2W9EH 3IDXL 4XNZC 4OZIB 2NZIA 1W0WA 2B4CC 3MREA 2H8PA 2VXTH 5D7KD 5C07B 5IUSA 3ARPA 1I1CA 4U7MA 1CE1H 1ZT1B 4YDKL 5HYIA 1JGLL 4M61A 3W81A 4PJ8A 5KOMC 3VXTA 4XP4L 4JY6B 5BVPH 2JE8A 3MLSH 4LIQE 4OIIL 2NY4C 1KIPA 3I6LD 5GS0L 3TT3L 1QFPA 5LWYH 2G5BA 1KELL 2BMKB 3PGFL 5LAXA 5FA3A 1UVQA 3FHQA 3OB0H 3D9AL 1JV5A 4OLWL 4P3WA 4PJIF 4WVRA 1L4IA 3C60B 2EIEA 3O3UN 3MLYH 5EZLB 4K7PH 1VFAB 4GS7C 3ELAT 4HK0B 4K8RC 2OYPA 3M45A 4KKBC 2F53D 4Z7OF 2AJVL 3DPBA 5GGVY 3ULVL 1UQSA 4NQCA 4HKJA 1B0RB 3GI9L 4XPFH 2V2WB 1VACA 3MRBB 2ZNWA 2VISA 2WAHA 1EFXA 1HYSD 4FTVB 4NM4L 5D1XB 3DSFH 3ARXA 5TQ0H 3LKSA 2DQTL 5HYJB 1SYVB 1TZHA 1JNJA 1I1AA 2ADGA 3HZKB 3QUXD 1A6TA 5ISZA 4FQQA 1D5XB 1T80A 4GRWE 3SGJA 3QUZB 2BZDA 4HK3N 4QEGA 2QADC 4Z0XA 2VXUL 3T3MF 1KCKA 3V52H 2F74A 3S35H 4M6OH 1RIHH 1MIML 1IAMA 4WY7H 3X11A 1P1ZB 2NZ9C 4XXCA 3OG4B 1AIFA 4K3DH 3EFFB 1YNKL 5CZXC 4IOFC 2A6DB 2ENYA 4ONFL 4ZOAA 2V9QA 1B4JL 2IANA 4K94C 5I1LB 3HAEG 5DMIH 2EO9A 3OTTA 1NBVL 1DJSA 4I3RL 2QSQA 3PGDA 1CD1A 4EZMA 1F4WL 3SE9L 3OKKB 2W60B 5CMAB 1I3UA 1RULL 4U6HB 4UIMB 4XH2A 4O2CB 3TJHC 2V6HA 1X4ZA 1DVFD 3K3QA 4WI5A 4UQ3A 5IBUG 3L95A 5E8OB 5J3HC 1SJEB 4GQPH 3MNWB 3OX8A 1RJZA 4L3EA 3G5YB 4Y4HC 2OX5A 3FRUB 3ZDZE 5BS0D 4XCEA 2VUOA 5JW5A 4U6TA 3HS0B 4Y5XC 1JWMA 3P9WB 4RFOL 3HI5L 3O4OB 4PGZA 3RJQB 1OGTB 1CQYA 1V8HA 4J3UA 3N9GH 2P7TB 1RZIA 3ETBF 4G3YL 4JRXB 4MAYD 2NY3B 2VR4A 5ID0B 2WINB 3GI8L 2HWZL 2AJSH 3QEGL 4N90E 4DK6A 3PHSA 1LMKA 1PFCA 2YD3A 3BPOB 1FAIH 3ARGC 4TUJB 1FGVH 1Q0XL 1CGVA 1YYMH 3P9MB 2LQRA 2F19L 3TO2B 4HEME 3G6JA 1Q0YH 3U0PB 5FECA 1HEZB 1FH5H 1T21B 5IMKA 4F33B 1FIEA 4EVNA 1D5ZA 3I50L 4LHUB 5KSUA 4TOYH 5AYQA 4MJIA 2D31B 4UV7H 4QRUA 5B8CB 3U2SB 5BV7L 3QXVA 4YBHA 4WWKC 5I30L 4JZJB 4Q0XL 1EDQA 2GW5A 3WD5L 5IB3B 3WNKA 4RMWA 2FWOB 4TSAL 2XA3A 3PQYE 1AQDA 1KIRB 5BRZA 1E4WL 2AJZA 4X4YB 2XZCH 4YXLL 5C0NC 2HKHL 4H25A 3FHAA 4NIKB 4X5XA 1NEUA 1ZMYA 3VWKB 1C12B 4LSQH 1MCOL 5E0QA 5F6HJ 5HHNA 1G7QB 5CIPH 3RWEB 2X4PB 5EUOA 1T1YA 3DO7B 4WI7A 4C56D 3QUYC 1LO2H 2ZCLH 4LFHD 5FDWA 3RWDA 2NY5L 5EBMA 3WFHB 4G6FB 4PGEA 4K71C 1I1RA 1N5AB 5D7LE 4LLDA 1ZLVH 4L8DA 4YPGA 2X4SB 5HHMD 5CZKA 5H37G 1F6AB 3BGMB 5A2KH 1QSFD 1WZ1H 4LPVA 3A6CL 2EC8A 2NXYC 3I3EA 5EC1B 5T1KD 4XI5C 1JF1B 4Z7QE 2ARWA 4XMKH 4AT6A 4S1DC 1PSKL 3KXFE 3DMMD 4ZD3H 2GJ6E 2IQ9H 1UM6H 3VXNA 2Y6SC 3S7GA 1XR9B 5DDHA 4HXAH 5HDBE 1PZ5B 2VLRE 5JA9A 3OF6A 1FCCA 3UCRA 2VSCA 1K8DA 3SY0B 1WBYA 3PWPE 1NFIB 5DEGB 4KJPC 4P23C 5CINH 4UDTA 5FUOH 2CH8A 5DRXB 5C09B 3I75A 3DTXB 1QNZH 2VLLB 3CLFH 3N1MC 1PKQB 3BN9D 3H9SD 5EDXA 1T22B 3BXNB 4QO1A 1GIGH 1OSPL 1FNFA 1ORQA 1KJ2L 2IAMA 2WWMD 4PBVC 4WFGD 4WWID 1F90H 2EYTA 4S1RL 4XBEH 3D0VB 1T89C 5FYLE 3ZLQC 2OL3H 3KPSD 2PW2A 3GMQB 3HE7C 1Q94A 4PLOB 2Q6WB 5FUZL 2Z35A 2QSTA 4M62L 5HHOA 4W6XB 1RHFA 4L4VA 5BOZG 4H0IA 3GO1L 1NAMA 1KCVH 3CXDH 1WIUA 5I76A 3OSKA 4OF6A 4ZO7A 1IC7H 2E8ZA 4OFYD 4OJFH 5EBGA 4PJAF 1QVOB 3UTQB 1N64H 1T4KA 4HAFA 4DKEH 4JKMA 1G1YA 4NN6B 4LVEA 2W0LA 4EI5C 4HULB 4NO0A 5GRJL 2CIKA 2E7CA 1RUQH 1U3HD 2VL5A 4OCLC 4OFVA 4Q97A 2F54D 5DUBB 3RVWC 5C92A 3VFOB 3L7FA 4OD2A 2APTA 3QCTL 4JDTH 2QKIB 4OT1H 4MHHI 4LP5A 3TBVA 1NDGA 4XPGH 4CGTA 1A6VL 5I2IB 1QOKA 4HUUA 1CWVA 3HRZB 1YNTA 4WNQB 3TC9A 1KCRL 1CFNB 3SKJH 2YD5A 2O5ZH 4YQXL 5E6YA 5AWNH 2H1PH 2HFFA 4GKSA 5CGMA 6FABH 1MHEA 5J11C 4R9HA 1JPSH 4MQXD 1ADQH 3FO0H 2KH2B 4JPKH 5IB5A 3VE0A 1LEIA 1WZKA 1PX3A 1U58A 5F89A 4TULH 3VCLB 5C9JA 2CO6B 1I3RA 2AGJL 4Y4HA 5F97E 3MJ9H 1NJ9A 4GRWB 5GSRA 1NDMA 2EIZA 5I15L 2VLKE 3QT2A 1IC5L 2P42B 4Y5XA 4HPYL 5EULV 2FH6A 1SJXA 3L9RA 4GG8A 1S9YA 1CQKA 5F1KC 5DWUL 4ZS7L 3SKMA 2YC1B 2FNBA 3FO9A 3VXRA 1T1WB 3BPLB 1B6DA 1QQDA 12E8L 3L5WB 5EU7E 1A2YB 3TCXA 5E1AA 3V5KB 4X8XA 5GGTL 1SBSH 3ARGA 4OQTL 1U8KA 2VDOL 1TETH 4WFEE 5ID1A 1YEGL 3KDMA 5ESQA 5CJQH 1PZUB 5T1LB 1HI6A 3RAJH 2ICWI 1H8SA 3MOQA 3V6OE 4YHNA 5DUPH 1JNLH 2HTKC 1G9MC 5DVLA 5L6YH 4NZTH 4OZFA 2A73A 3WMSA 1ES0A 2HVJB 3GSQB 4WWKA 3IAQA 5L8JB 2HRPH 1HOCA 4M7KL 1N6QH 4OLYH 2DWEA 2N4IA 3IB4A 5GRVK 4DW2H 5E8EA 5JW4M 3WE6B 4MJ2A 4WFHE 1J8KA 1NC4D 5T1MA 3UBXG 3QO1B 1MY7A 2FEEI 1DCLA 4NC1E 5I8OH 5KVGL 4I2XA 4HLZG 2B2XH 3LMJH 1JI2A 4H1LA 1IC4H 4R0LB 2XTLA 4GRLA 3GZKA 1I9RL 4JFEE 1HH6B 1FC2D 1VA9A 2L7JA 3VG0H 1WEJL 2DBLH 4XXDB 4ZPTA 5JNYA 3BDYH 3QUYA 1NGYB 5E99H 3RDTC 5E00B 2D4FA 1NC2A 4YC2C 5J12C 3KPRE 4H8WH 4OGYL 4KZEL 3TO4C 4APQA 3LIZL 3BSZH 3FMGH 4CVXA 1P7QB 1Z0NA 1CIUA 5GJTL 2F5BL 2YSSA 1XCQA 3PWNA 3LPWA 4Y1AA 5H2BA 1VDGA 4QHNA 4MXVE 2AJYL 4CVWA 4D3CL 2EDNA 4R90L 5DFTA 3ZKNC 5JOPD 1KOAA 1MFEH 4QHMA 3GNMH 4JJ5B 3OKDB 5CZVL 4NHUB 4P23A 5SWQB 3T0EE 2IG2L 4XWOD 4JHWL 1DBAH 4XPBH 3M1BB 43CAB 3UJIH 1MCIA 3EKCA 2R2BB 3Q0HA 5MEOB 4PJ9B 5E7FA 3DETC 3MRCB 2MNUA 3PQYB 4MYWB 5M7QA 1ZT4B 3MXVL 2FX9H 2B20A 4AEIL 1T03L 1HSAA 1U93A 1I9JL 3KYOA 2QL1A 4HW6A 3SGEH 2MFNA 3RVTD 2I26N 3BZ4A 4X7SL 5DA4A 4HXBL 3IDYC 1T89A 1CTOA 1MHCA 4ZFOB 3TM6A 5K33A 1Q9KA 2APWA 3GRWA 3HE7A 3QDMD 4F9LC 2X70B 5D7LB 1QBMH 2A83B 5JO5B 1YMMD 1GZPA 3GMMB 3CDGA 1FE8L 1HH9A 3ILQD 2J4WL 3IAPA 2PYFA 2O5YL 2GJJA 4KI5E 3KXFB 4EI5A 3H9HA 5I16A 4OZHE 4JR9L 1ZA6B 1YZZA 2GJ6B 1YMHA 3E6HA 3KPMA 5DJ0B 4B0MM 1UYWL 2PXYB 2VDNH 3DUSA 2YRLA 4KQ3H 5TGBB 2VLRB 4U2YA 1NCDL 3VXPB 3BE1L 3CSYB 2QQKH 2YA2A 5IGXH 4JFOB 5HI5C 2BRRL 4A6YA 3PWPB 4JCLA 4OM0H 3LRSA 5T5NG 1ZWIB 5IR1A 1KPVB 3SOBH 1HHHB 3RX5A 1QFOA 4WDIB 1WTLA 3OJDA 3UBXA 3VXOA 1FGNL 7FABH 1QA9A 1A5FL 4OI8A 5IB4B 1P9MC 2IEPA 4JEGB 2D03L 4XVUC 3FT4A 2EDQA 4UT6L 5LBSL 1AY1L 4XC1H 3V5HA 1C5DB 4PUBL 3LKOA 1H15A 3ARSA 4FMFA 2XPGA 2ADFH 1FLRH 1P7KB 4OZGA 4DOHE 4U4BA 1I8MB 4KROC 3WFEH 2W9DH 4XMPL 1AD0A 3VDAA 2J6EH 2DL2A 4B5EA 1B0WA 1G9NL 1X4XA 4QTIH 5FHBH 4CJ1A 2LVEA 5D7KE 5T3ZL 3SDYL 5KG9B 2ILLA 4RMRA 1I4FB 5GGQL 2BSRA 4ODTL 5DD0L 2H26A 4YX2H 3GGWB 3BP7A 2JTDA 4LDEB 1FO0L 5MI0B 3C09C 5DVMA 3BKYH 2X6MA 3WN5C 4R8WH 2X89A 3P4OA 4MNHA 3VFSA 1GZQA 3TBYB 1NMCC 3WHE0 3QWOB 2WV3A 3HUJE 4AL8L 7CGTA 2YKLH 3P11H 1KLUA 5EUKA 2CDGA 1RUPL 3LEVL 3UPRB 1WICA 1A0QL 1AXIB 1UKTA 4XBPA 5DUMH 4U6YA 2BSSA 1A6WH 2OZ4L 3THMH 1AGFA 3LEYH 3FQXB 5L7XL 2HKFH 5IJVA 4S1SH 3UTSA 2VITA 2DQHH 2YPVH 2MPAH 1IM3B 3MRJA 4QGTA 1R5IB 4CMHC 4JG0L 4EI6A 4KTEH 4OCXH 5HVFB 1FRGH 1D5IL 4KRMB 4UAOB 4WJ5A 1O0VA 3E3QE 4GXUM 5E2UH 1KTDB 3ULVE 4LCIH 5IMLB 2DJSA 1W0VA 4NQDD 4XNQB 4FABH 1IBGL 3VG9C 2ICEB 3PHOA 2RAMA 3LRHA 4PGCA 2VLKB 2QR0A 1E27B 4XBGA 1REIA 5DJCB 3GMLA 5E4IA 4NN7C 1JHKL 1YEJH 3EZ8A 5ESVB 3O4LE 5AAWA 4F37F 2XN9D 4MLIA 1Y18B 4G8IB 4JM2D 2AJ3A 3DURA 2IPTH 3RDTA 5L2KD 3U0TA 1XGPA 3LN5B 1CT8B 1CXLA 1CDHA 1BGXL 3IDJA 5F7FA 4ZUVB 1MCRA 4HKZA 3GBMH 5FOBB 4OCRL 1J0HA 3F7PC 3TJEL 1CG9A 4NO2A 1CLZH 4L4JA 3TO4A 3QWRD 3OKMB 5CWSB 3DX9B 3MV11 5DRNB 4QRQA 3SDDD 3MA9L 4WU7A 1UWXH 4U6VL 3OAUL 3PDDA 3SEPA 2VRAA 1NCCH 3TN0C 3OG6B 1G0XA 3U1SL 2B0SL 3T0DA 3B5HA 3N50A 2NY7L 1DN2A 4PY7B 1TCMA 1BIHA 1LWRA 4PGDB 2Y9RT 3V4VL 2NY1D 1ZE3C 4EUPB 2VN4A 4Y2DB 5BS0E 2GSGA 4ISVB 1T6VN 3DVGB 1E6OH 4ZOCA 5C08D 4FFYL 5KSAB 3NACL 3I02B 1TVHB 5D1ZB 1WAAF 2AEQL 3CMOL 5DTFA 2BVQB 3O45A 3QDGA 5DQJB 4S11A 1VGKB 4PB9H 2OSLB 5A3ID 2I60L 1T2QL 4YHIA 1L0YA 1NGXB 2FB4H 3CH8A 1T0MB 2HJKB 4JFEB 4ONGL 5C0RH 1JP5A 2NTSP 4N0RA 4D0CA 3O3DB 3VRIA 5TE7H 2XACC 1CR9H 1QBLL 2CKBL 2X4RB 3F7YA 5FKPA 4F9LA 2B8OT 4M5ZH 4U49A 1T5WA 5FO9B 1F8TH 3KPRB 3FFDB 3PP3H 3A67H 1YEHH 4PRDB 3MUGB 3T8XA 3ESVF 4NQED 2J8UA 4OAWB 2VDPL 1IM9A 5EIIB 3OAZK 3PGCB 5E5UB 3SDCC 4W68A 4OFKA 1H9VA 2ADJB 5HVWA 4L8CA 3QI9C 3Q6GL 1NGQL 5HVGB 1EVTC 2BJML 3O3EB 3U4EB 4X83A 4Z7WA 2L0DA 5KW9L 1YQVH 1BQUA 3EO1A 3M17B 3T0EB 1QSEA 1J8HA 1X7QA 2ZPKL 3AS0A 4P2OD 4DKFL 1H0DB 5FK9A 3RWFB 1S7RA 4F7TA 1JZ6A 5LXGH 1A3QA 3CVHB 2GFBA 5MEPB 2VR9A 4K23L 1P9MA 3RIAK 4JO4H 2AJUL 3G6JF 3UPCA 2NX5A 4BSJA 1RJLB 1AFVH 1YNLL 5DF0A 4C56E 4ETQB 3LQZB 4X98B 5KVFH 4DZBA 4P3CL 1G7JB 4BZ1L 5DJ8B 3P0VL 3AM8C 1JYWA 3UC0L 1QSFE 4X8JA 1TVBA 3OKEA 1S7TB 5HGHA 3VMPA 5B4MD 1ZAGA 5EU6D 4JN1L 3VI4E 1DLHB 1IFHL 2H6PA 1H8NA 3SCMD 3IGAB 5C70A 4RX4A 1K4CA 32C2A 3ZTJG 4OCYL 4XRCB 5MERB 1A1OA 3MRNB 3WN5A 4JN2B 1ZSDA 5F7YC 5EUOF 2GI7A 4K2UH 5DHVA 4D8PB 1NPUA 3G5VB 4AIZA 4P4RA 2CRMA 2VAAA 4JFHD 4WGWB 3O11A 5DMYA 1XF5A 5MEND 5I1HL 5I73B 4N1EA 4UNUA 3X13A 1HHKB 2ZG3A 5T1DH 1DBKL 2ATKA 3H9SE 4P2QE 1N2RA 5IHLB 4YDLB 5ERWA 2X4QB 2E6JA 4WFGE 3MJ7A 1FFPA 2D7MA 2XWJA 4DFIA 1FN4B 3GK8H 5GGVL 1RVFH 5J13B 4R2GB 4Z5RB 3CXHK 1DUZB 1RZGB 2E6QA 3KPSE 3OKNA 3QB7C 3ULUL 1I8KA 3Q48A 3CFKB 1ZLUK 4JHAL 4EUPG 3AUVA 4DOHB 3SJVE 5I66A 3VXMA 2X40A 2MJWA 5F9WC 3T4AB 4NQUA 5KOVC 1LDPH 1H3VA 3ET9F 5TDOA 5K9JL 4MDJA 4KVNH 1UM4L 4TNWF 4CN6A 5J6HA 1GGIL 4PJGE 4IRJA 2GKIA 5B39A 5IG7B 3PXHA 3IETA 3L3OB 4HWBH 4X7TB 3SQBA 4U6XB 2F54E 4JCMA 3HG1A 3LB6C 3LH2L 1YEIL 4ZDHB 1CU4L 3MJGX 3L1OL 4HGMA 3BP4B 3PL6C 1YEEL 2C9AA 4PJDF 4P46B 3HUJB 1OPGH 3BWAA 1EJOH 4BQ8A 4OLZH 2GTWB 4X6EA 5E2VH 4L3AA 2DJ4A 4LCUB 4Y4KC 1KJMB 1PG7H 2H3NB 3B8YA 1ZHBB 2I9TB 5A2JH 1IGYB 5TPWL 3NCJL 1B0GB 2EH8H 4WI4A 3VD5A 3EZJB 3O3BB 3TN0A 4PREB 2C7UB 1T7WA 4M4PA 2I24N 1A7OL 1XAUA 5C1MB 5B21A 1CLYH 4J3WA 5FYJL 2A74A 1RMFL 4LSVH 4HQQH 2PKDA 1R5VB 3ZE0F 1DQQA 3NIDF 5D2LA 1X5YA 2WLZA 4L8BA 4ZUTB 4LASL 5TDPA 4UILH 1GOHA 1SBBA 3BQUA 2NY0D 4OUUA 3C8KA 5DJAB 4YR6A 4OKVA 5BVJA 15C8H 3UTTA 2R23B 3RIFK 5HI3C 3O4LB 1CXEA 4GXVH 3GB7B 3HAEH 3FKUS 3B3IB 1HWHB 3VXUA 5GS0C 1S7UB 4RSVA 5IMOB 2AEPL 1MCBA 2PTTB 2A2QT 2OK0L 4JFDE 3NZ8B 4NJAL 3CVIL 2XRAL 1QFWH 3RTQC 1XIWC 3QXAB 4XB8A 1AQKL 1J10A 3QBTB 1CF8H 1KLGA 5FFLA 3NPZB 1NGPL 5C0JB 1V3MA 1INQA 1VGEL 4CW1A 1IQWL 5CEZH 1C8PA 1DVFB 3SDCA 3VJ6A 1ROWA 2RHEA 1EHNA 5HHXH 1LE5B 4IRSD 2P47B 2Y5TA 1I7TB 1LK3L 1MFDL 3QI9A 3NIFE 3DRQB 1HXMB 4JO1H 5BS0B 2HLFC 1VB9A 2P24A 4X6BA 2VC2L 2GSIA 2Y07H 4E41E 5DD1H 1OF2B 1D6EB 5I74C 5AG9A 3BZEB 1DBML 3D18A 3DBXB 4TQEH 2WWKO 4LCWA 4ZYKB 2R1XA 1TENA 1V3LA 2OR9H 1ONQB 5FO8A 1EEZA 2JLLA 4RFEB 3HNTL 4G5ZH 1NFDA 1YC8A 3ARUA 3ESUF 3AAZA 3TCLA 2OBGA 5I1DA 4O9HL 5CJOH 5IEHA 1QBAA 4CADA 1KB9J 3IU3B 4OLUL 1SEBA 1OAUH 4YHKL 4R7DB 4XNYH 1NLBL 3QPQD 1Z5LB 4NZDA 3OR6A 3GSOA 1M7DB 3AM8A 3L7EB 2JKXA 3P30L 4Y16D 2J5LB 2A0LD 2DLFL 2X1OA 5FYKL 1F3RB 1MWAL 4LGRB 3E8UL 4KUZH 2W91A 3ARDB 3N85H 1IZKA 3VFGH 1KB5A 5D2NC 5E8PB 5E6ZA 4BH7B 4GMSL 3BGAA 3TBTA 3RKDC 4BH8B 1UH2A 4NRZA 5ITBL 5IFJB 4PRHD 1G7HB 3MCKB 1AKJA 2FH8A 5TE6H 4P3DB 5IB1A