4KKCD

Structure of the e148a mutant of clc-ec1 deltanc construct in 20mm bromide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title Fluoride-dependent interruption of the transport cycle of a CLC Cl(-)/H(+) antiporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 46
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkcD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkcD01
2PW1A 3PJSA 4H26B 4JKPL 4YFEA 1GC1L 5KSVA 4FG6D 3DROA 4N0RA 5CWSA 1WZLA 4WI9A 3QUYB 3S4SA 3W82A 4DKAA 2PTVA 3LY6A 3VWJC 1NMBH 3FTGB 1O5DT 1OF2B 3WIFA 3OF6D 1QPPA 2H26A 4P59H 3VD5A 3QI9A 3HB3C 3VCLB 1AXTH 4XCNB 5D7JD 3RX8A 1JNHB 1VCAA 1JRHI 1RPQA 1FDLL 2BX5A 4Q9CA 3MV01 3RKDC 1YEDA 1A3RL 2BNQB 4KI1A 1FGVH 3QNYA 3H9SE 2V9TA 4OCRL 5IW3A 2PYFA 3TEUA 4Y5YA 3QEQB 4PUBL 3EIFA 5DJ0B 3ARFB 1LNUB 1N6UA 1OQXA 2VO5A 2XI9A 4LCCB 1YNKH 3C6LC 2EDOA 4P2RE 4WTZA 4O2EB 4ZYKA 5F3HA 3ULUC 3BRGC 3TFKD 3RI5K 4NO5B 3CU7A 5E8OB 3OWEA 5HYJA 4KZEL 1KSRA 4HX1A 2JTDA 2DDQL 1YEKH 1I1YA 2YN3A 2B1HH 4MA7H 4TSCL 5C0DA 4QXUH 4HKXB 1ZGLM 4HFUH 4OFYD 5IEKA 3VXSD 4PREA 4RMTA 2Z31D 2RCSL 5E99L 3MBXH 1GZQB 5JO5B 15C8L 5FYJD 3LV3A 4KKCD 4N5EC 5IUSA 1YPZB 3LEYH 3BPOC 5DJZA 4FZEH 1G6RL 4HV8A 3WFHB 5F8QC 5CSBA 1OT2A 3UO1L 5B4MC 2X4RA 4JY5L 3WDJA 1FIGL 5F1OB 2MQCA 4JFEE 5JXAL 3CXDH 3MGTB 3MBEC 1I85C 5SWZA 3LS4H 3C5SB 4QRTB 5DRWA 4F3FA 3ZYZA 4MNQB 1DUZA 4QKXB 1KEMH 4AM0B 2XTJC 2AI0L 4YXLL 3LKQB 1MCBA 3VD3A 1U8QB 4M6OH 4F15B 2EDQA 4G7VH 1DL7L 1W72A 3AUVA 3IJHB 1C5DB 1A0QH 1AGBA 3TBVB 3JV6B 5JIPA 3IDYB 4Q58C 4I3RL 4CNIB 3UAJD 4MXQD 2DL9A 4TUOB 3PHSA 4V1DD 4N0UB 1HCVA 4YDKL 3O0RH 4OZFB 5D6CA 4NQSB 4D0BA 1MREL 4XPGL 5HY9B 2VZVA 3A67H 3IAGC 3D3VA 3TYGL 5ESVB 5JIHA 1FE8H 3VU2A 2HLFD 5EULV 3ARBD 4KI5D 4TRPL 1CIUA 4XBGB 1UADC 2D31A 3BAEL 3QWRA 5GRVK 2A0LC 2BXZA 1G9MC 1S9WA 2DM4A 5E5UB 1NPUA 3VGDA 5CD3A 4EDWH 4YDIL 2FX9L 1INEL 4XP1L 5IQ7L 5E08H 4KRPC 3PWVA 1OAZH 5HGBB 1TJIL 4IS6B 4DEPC 4HHAB 2AEQL 4TSAH 4NQDA 1DVFD 5DRNA 5E00A 3PWNB 3T3PE 4X6DB 1UQSA 2PYEB 5IB5B 1DQML 1Q8MA 3GJFB 1SMAA 4NP4L 1DLHA 2DI8A 1F90L 2XG5A 4K8RH 4IRJA 3CPLA 1RU9L 2R56L 3GKZA 1CDHA 3K8LA 5EU7E 3TIEA 5ISZA 1D5MB 2O5ZL 2ADIB 1S3KL 3IU4L 1SYVB 4JFFB 5JIIA 4JFHD 1MI5D 3SO5A 4QXGH 2ATKA 2WWMD 3RJDA 5F9JB 5DURB 4RNRB 2FO4B 4LFHG 4M6AA 2Y5TB 5CBEB 3FO2A 1QLFB 4R0LB 3ZTJG 4FTVB 3TBTA 4ELMF 2N1KA 1IKNA 4BSJA 1EO8H 1A3LH 2CRYA 3ARQA 3KPRB 4UDUB 3UXFA 3U0PB 2Y25A 5F9OL 4R4NC 2DQUH 5D6DC 2NR6C 5L2KD 2CDEA 4ETQB 2YZ8A 1ADQH 1R3KB 3ZO0A 1CF8L 4Y89A 3S96A 4PG2C 1IILE 4XP9H 4CVZB 3OHXB 4KRLB 5K59E 1FVDB 1NSNH 4G8EA 3KPQB 3HE6B 5I66B 1ZLSL 3M1BA 3R06B 4MCZA 5H35A 1YEFH 4LVHB 4X6CB 5A3ID 1S9YA 4LCWA 2BHYA 4LARH 1QBML 5EU6B 3ZYIA 2E9BA 5HGDB 4RISH 4FQQA 4WUUD 1BWWA 2HJLB 1Y0LA 1OCWL 3GSRA 4L8CB 1BZ7B 3SBWC 1IGIH 3BJLA 3QUYC 3VXUB 1NKRA 2DQJH 1A22B 1AFVH 5F7FA 3STZA 3VFWA 4HS8H 4NT6B 5D1ZD 4HIJB 4QHMA 3QUXC 3TM6A 2Z9TA 2JIXB 3BWAA 4DZ8A 1R6VA 5J1SC 2H2SC 4XRCA 3WO4B 5J13C 5IHZA 4LHJB 2DYPD 1W72L 3ARFC 2YEZA 2ZUTA 4R3SA 4YQXH 3SDAB 1EEYB 5CBAA 5IESL 3MCLH 5IF0A 3SJVB 1N6QL 2ORBH 4UTAL 1MCWM 1NC2B 5CP3H 4ODUA 5DJXB 1PY4A 4WY7H 1T1ZA 2O5YH 1MF2L 2VITA 1JI1A 1S7RA 5CS7A 4XVSH 3VG9C 1D5ZB 3WN5C 3BQUA 2YD6A 1B0WA 1ZAGA 1XF2B 2YA1A 5MEQA 1PDKA 4WJ5B 4PB0H 3TT1H 1LDSA 4OM1L 5JLZB 2DQEL 1Q72L 2XA8H 4FQHB 5TDOA 4WDIB 4PJFA 3AFLA 1DANT 4IRSD 4O2FB 2N4IA 3MRKA 1EPFA 1HH9B 2YKLL 1L7TL 2VR4A 1CL7I 4K7PX 5KOVC 1KGCE 4YFLI 5FA4B 4ZOAA 5CLWA 3T3MF 4G5ZH 1LE5A 3KXFD 5HVWA 2CDFA 3FQUB 4XWGL 1HHIA 4ZSOB 4RRPG 3EO0B 3ZE2E 3IDYC 4PLJD 4XTRC 4JQIL 4WGVB 4PJHE 1MNUL 2YSSA 3IFPA 1R0AH 1OGAE 1WBZA 5ALCH 3QDHA 2XN9E 2X4PB 2E7LC 2A6IB 5E0QA 2O26U 2AK4B 3T04D 5LCVH 2R29H 4JHAL 3S37X 3AB0B 5T33L 4X0KB 1I9IL 1N59A 1CFQA 2HG5A 3H9ZA 4OCNC 4BKLA 1CFTA 4U6YA 5L2JB 1NEZG 3QP3A 3CMGA 1AKJA 5DD1L 5K9QI 3MJGX 1LO2H 4YBQD 2EYRA 5KG9B 4RX4D 5GGSY 5TQ2L 1AXSB 3FTGA 3GO1L 5EZLB 4GXUM 1F3DH 1I1AC 4UIKL 5C0ND 4WFFE 5DWUH 4PJ8B 1VEOA 5IM7A 4HUMB 2EEDA 3GSQB 2EEBA 1Y6MR 3MROA 2H8PB 5T3ZL 4JJ5B 5GSRB 6FABH 5IFHL 3RWEB 2GCYB 3DTXB 4ZUTA 4P5KA 4ZPTA 4NWTH 2DJSA 1IQDA 4GAJL 1KG0A 1NBYB 1S9VB 2ZCLH 1CR9H 4Z0XB 2BY1A 1I9JH 2YBRA 2ICES 1SM3H 4P2RA 4FMKA 3OZ9L 2XKUA 4XCEB 4TQEL 5DMKA 2YWYA 4YHLH 4DTGL 4WFGE 4HCRA 3G08B 5EO9B 3GMMA 4OCSL 4KKLD 4RMRA 5CEYB 4PLKC 3V0VB 5KSAC 3MJ7A 4R97B 2NX5D 3L3KB 3I3DA 3LKRA 4RGNC 2DKMA 4Z7UF 3O11B 3MXWH 5C0EB 3PHQA 4XMLH 3BKYH 3NFPA 4XNMA 5ACZB 3VG0H 1YNTA 1QR1A 2VZOA 4Z7QE 4WWKB 2JELH 3TWCL 2IPKB 4LCYA 3V5HB 2MFNA 5JXEA 4HWEL 4LVOC 1RULH 4H88H 1KPUB 1WICA 1A7OH 3L9RA 2NY4C 5FK9A 9CGTA 2D9QB 3HE6C 1IEHA 3JUZA 3U46A 1H5BB 3TJHC 1XCQA 3OTTA 5JDSA 1NLDL 4DZBB 3VI4E 5KVFH 5IVXE 2WBJA 3CVHH 1MFEL 4E0RA 1P4IL 1T04B 2X4UA 4H1LH 1YN7A 3B2UC 4JLRB 1IKFH 2J6EA 3BP6B 3C9NB 1CGSH 1JGDA 4JZJC 2LE9A 3AREB 3QIWA 1MRCH 2R2BB 5C1MB 4JO2L 4N0CC 1FJ1A 3DWTA 32C2B 3MLUH 5ESVA 2A6DA 2YK1L 3RFZC 1I1RA 1FNEA 1NCAH 3WO4C 4Y2DB 1KJVA 3G6JE 3WFCL 3EYOB 3RP1A 1UA6L 2JJTA 4PR5B 5EC1B 1V7NH 3O3EB 4P2CG 4NSKA 4PRHE 2W9EH 4IMLB 1SVZA 4HEPG 3V4VH 3TA3D 2D7MA 4O4YL 2YR3A 3G5ZB 2OTWA 3GHEH 4HWZA 1C12A 4XH2B 2D4DA 5E9DB 4NPYB 2YPLD 3VD7A 3MO1A 1T1YA 2PYEA 5DUBA 1TITA 5BVJA 4QRRE 3ME0A 3NN8B 4P57A 4FFVD 1T0NB 2F54B 3FQTB 2AAVA 1IAIH 3LN4B 4GMSH 1AGEB 4I2XE 4QT5B 1PKQB 5D7LA 3MTRA 1BX2B 3WNPA 2NY0C 5KAQG 2CH8A 3IVKB 3T0EB 1KCUH 2NY3B 3J7HA 4CMMB 5IBLD 4LVNC 5EBMB 3ILPA 2X1PA 3SKNB 4OGYL 4RZCB 5E2TH 3WKNA 1A4JB 4H5SB 4C56B 2YD1A 4DWHA 4RIRB 4O58H 4TUKL 2BSRA 4JO1L 5ADOH 1XGRA 5TH2A 3P9MB 3STLA 1J8HB 4BH8A 1FIEA 2IPUK 3MMEB 2BVOA 3BP7B 4MA3A 4R4FL 4ETQA 4Z7WF 4W70A 5JPMA 4NQCE 2HTKC 3QJHB 2P45B 4EQ3A 4K23L 2CJUH 1KF9B 4J6RL 1Y18A 5D7SH 2AJXL 5H94A 1U3HB 3AB0C 1UZ8A 1H8OA 4LQFH 3O45B 3FHAA 5LGJB 3IXAA 3UTQB 1BVZA 4ZG1A 4P2QD 3OX8B 1KB5B 4XMKH 3RGVC 4L3EE 2BZDA 4P9HL 1R3IL 1S78C 1QBLL 2VZ3A 4ORGA 3SDDB 5I1IH 3IGAA 2E9IA 2E8YA 3HZKB 4M3KB 5ITFB 2FYYB 4K94H 5H2BB 5C0AB 1F2XK 5F71A 1DE4A 2IJ0C 3NACL 3BUYA 5L8LB 3QPQC 1QYGH 3HG1B 2YXMA 2R0ZL 3D5OF 2E5EA 4ZFGH 3MJ6A 3NIFF 4G6ML 1L6ZA 2YD3A 5TE6L 3EOBA 4NC0B 5D5MA 4PV9A 5D1QC 4IDJH 5F9WB 3DRQA 3ZYOA 1N5YH 3OGOE 5ITBH 5FCSH 4JRYE 2BNRE 5CLTA 5JIKA 3QWQB 1JPGA 4NCDA 5F88A 4QO1A 3AMLA 1UB5B 3FT3B 2J6EL 1UJ3C 5IMMB 4S1SL 3VRLE 1T83A 1DANU 1M05B 4OLZH 4G8FA 2V6HA 3OKNB 4HS6B 3PG2A 1CLZH 3W2DH 2ZPKH 2A9MH 2IH3A 3OR6A 2QR0A 4U1GB 4YWGL 4NZUH 3NIGE 3VD9A 2FCBA 4KU1A 2JJSA 4NO2A 2F19H 2VC2H 3LKSA 1DQQA 3B6SA 1WBXA 5GZNC 3FAWA 5IQ9A 2EDBA 2RFXA 4PGBB 5IB1A 1Y6NR 4MX7A 3T1FA 4FQ1L 4WWKC 3WNMA 4JDTL 3P30H 3IS0X 1E27A 5C0GA 1AY1H 1RIHH 1F6FB 4XNYH 2NY5H 3RDTC 5ECJE 1CBVL 2H1PH 2W9DL 1IGMH 5AZEL 4OLVL 2EDJA 4JDVA 1TIUA 1H5BC 3GSXA 2I5YH 5E2UL 4KDVA 2AGJH 4LLVA 4NGHL 4QHUA 3VFRB 5L6YL 5LAXA 5DA4A 3MRLA 1QZ1A 3ULVL 1ZK9A 3TN0C 4U7SA 1I7UB 3H42L 4J23A 1SYSB 3LSOA 1S7UA 2APBA 2XN9A 4ALAL 3HNSH 4HUVB 3IDIB 1AI1H 3IDNB 5FUCC 1FH5H 4NNYA 1QFHA 3RIFK 3AREC 3V7AG 4NQED 2C1PB 1CDJA 2ILLA 2ITDB 3CFCL 1XR9B 3CIQA 1QO3A 2I27N 3KWWA 5D7JB 4ZNEA 2JJWA 4Y2DC 4MNHA 4X4YA 5I71B 5ALBH 1A7QH 3FO9B 4GG8A 2Q8BL 2PTUA 1AD9B 1W0WA 2GY5A 4OLWH 3H9HA 4DGYH 1JZ8A 1J0HA 3UJTH 4HWUA 5E8NB 4K3JH 2HFEA 3KYMA 3T2PA 3TBWB 1JHTA 1KCLA 4JY4B 5J0BA 3T0VA 3TZVC 4R8WL 4N0FA 1TDQA 2R2CA 2I9TA 5LGHH 3PF2A 2GCYA 3VJ6B 1JGLH 1NDGA 4P5MA 1RZGA 4XBEH 4HMEA 1D6EB 1N4XH 3T2QA 3TNMA 4TVPD 1BAFH 3ZT5A 3UTPE 4CGTA 1XF4B 4JREB 1SJEA 4PRDB 4PTTB 3NCBB 1HSAB 2VUOA 3UBXA 5LWYH 3VXSB 1NCCL 3T0EC 2Z31B 4KKAD 3QG6A 1LP9E 2DM7A 2EH8L 4PJEB 4KHXL 3P11H 1TQCC 5DHVH 4I0PD 5J1TC 3VW3H 3P4LA 4NJAH 1AR1C 1G9NH 3MRQA 1ACZA 1TFHA 4K3EH 2F15A 3IDMA 2G60L 2QSCL 4M61A 4YPGA 1U41A 4QHNA 3ARSA 4Y4HD 1FFOB 1ZT7B 3DVNB 4ZFFB 1JCKA 5TPWH 4PJFF 1H3TA 1G7JA 4HPYL 3P4MB 3SDXB 5HJ3B 3NCFB 3B9KB 4ISVA 5IJKC 2X4TA 3KG5A 4JFZH 1BPVA 4YHML 1T03L 4EI5B 1OW0C 4S11A 3VXMD 1MFDH 4PRPA 1K3IA 2ICWJ 4G6JH 4LHUD 3SGDH 1IGTB 3OR7B 3ILQC 3SE3A 1H3PL 2X6MA 3HLAA 3NTCH 3PUCA 4X7CC 1MJ7L 1RUMH 1RZIB 3L3IA 4V1DB 1B4JH 1LEGB 3GKWH 4JQXA 4NHCH 3OV6A 4ZXBD 5GS1A 2AK1L 3LPGA 3O6LH 1SJVA 3C8HA 5KVDH 3VFVA 1P2CB 1KIRA 5IVXA 2AXHA 3S34H 1AE6L 3UPRA 1XCTA 1WCBA 2V2WA 2VWEC 2EKSA 4FXGB 2GSGB 4TTGA 3M8OL 3X12A 2FWOB 3R0MA 2ZKHH 1C1EH 4GBXB 2C3VB 3GNML 3JUYA 4LHUG 1A6TB 3QEHA 2VZ1A 4GRMB 1DBMH 1I7ZA 1A5FH 3BUTA 2Q76B 4F80A 4JE4B 3SKMA 1S7TB 4LSUL 4B7IA 3MA7A 1HHHA 3E6FA 5C7XL 4LLDB 1X3DA 1BJ1H 1DVFB 2AXFA 5F1KC 3DUSA 2EXYD 3I75B 4PR5A 5C2BL 4TNWF 1CT8B 3FFCE 1PG7X 4M6MH 1MPAL 3GEWB 1IT9L 2ESVE 3IKKA 2AXGA 1BFVH 2LVEA 1UH4A 5C09D 5GS0H 5BV7B 3D39E 4F57L 5IVZA 3VRIB 3AXLA 2MHAA 4KQ3H 3HKFA 3L3GA 3QUKB 4QOKA 4QRRA 4Z5RA 1TCRB 1T7XA 4F37F 4AY0A 1MI5B 3BH9A 3NCJH 5B8CA 2AS5M 1KJMA 4U1GC 3DV6A 1BX2A 1MFCL 1XH3A 5F7LB 1ONQB 3JTSB 3V2AR 2AJ3A 1B0RA 1ZWIB 2HRLA 3ECBB 3OKDB 4L4VD 1BQHA 1F02I 3FN0H 5E8EB 4R90L 4UOW0 1YEJH 3VE0A 1I4FA 1HHKB 3TH2T 5IFAH 5L2KB 3D1MC 4DGVH 4JGMA 3RU8H 1SEBB 5FO7B 3ULUE 4PJIA 3MLPA 3T2NH 3QEGL 5F6IC 1XF5A 3V5DB 1F4YL 4FXKB 3T65A 1NAMB 4POYA 3QG7H 1KIQA 2XPGA 4HFWA 3GRWL 2VLJE 4JM4L 4PJBB 4WFEE 4QRPE 2IGFH 5CSGA 3DETD 1CFSA 1M71B 3P0VL 4GKOA 1JZ3A 1QRNE 4NQCA 4WUUB 3WEXA 2XZQH 3PGDA 4WHCA 1WBYA 4M62L 1S5IL 1A6AA 5HHPB 4G9FE 1XIWB 3QRFM 1TTFA 4NO0A 4DVRL 4JANA 3NBNA 3NZ8A 3L3JB 5D1ZB 2AQ2A 2A73A 1FZMA 1UACH 4KJYA 4UILL 1BHGA 3OAYK 4HK3J 5EBGA 4L3EA 3JBG7 4LMQE 5GJSH 2CUMA 3QDGD 4DUVA 5ILTL 1XAUA 1OTUD 3O9WA 5EU5B 5KN5A 4XC3H 2P8PA 2XTJE 5HHMB 1NQBA 4LOUC 3FZUD 3QDJA 3WHE0 2FL5B 1OB1A 2F5BL 5DUPL 1DEDA 3OXSA 5DJ2A 5TF0A 2B5IC 2AQ1A 4MDJB 2ZOLB 3DUHA 3O8XD 4KUZH 3U36A 4G9DA 5F3BB 1F13A 1TENA 5JHDE 4Y4FC 4CN4A 3IB4A 1CXKA 3GI9L 5DR5H 1JNNH 1SJHA 3KPMB 1F58H 4FFWC 5DFVC 5I1HH 3BMWA 2B1AL 1ZVYA 3I3BA 2XWTA 2GAZB 3WXVL 3W5MA 4PGCB 3QCTL 4N9GB 1ZXQA 5EU4A 4YE4H 2CKBB 4XHQA 3QCUH 3L3DA 1CK0L 2W0FB 5IMOA 1VKXB 1HOCB 3TPUB 1T21B 3F5WB 3RL2B 3ZKMC 3NABH 1A6ZB 3L95B 1IRAY 4MD4B 2F74B 1J9CT 1LEKA 4GMTH 2QADB 2XWBB 1RUQH 3SGJC 3CU1A 5I1AB 1KULA 5CMAB 5I15L 4XCYA 5K93A 4HUWA 1NGWA 3B9KC 3VXRB 4PTUB 4EI5C 2BSTB 35C8L 5CHNB 3BI9X 4FZ8L 5DK3A 3CLEL 3MV8E 2DOCA 4WWID 4YHPA 2NY7H 1I7RB 3D87B 3HZYA 2V9QA 1CICD 4H25B 3BP4A 4PP1D 1PX3A 2HWZH 3CLFH 1TTGA 2ITCA 4OZ4A 5I1LA 2WV3A 1CXLA 5MEPA 2YRLA 5K59F 1NFDB 3P4OA 2KBGA 4JR9H 3TVMA 2XZCL 3HC4L 1N0XL 2DQGH 4HUVA 2QQKH 4Q9QH 2CPCA 2WIIB 4GBXC 3HAEB 5D72H 4XPAL 3FRUA 3G5VB 3ZDZE 1RIVL 3OF6A 3L3HA 1N26A 5CIPA 1ZA3B 3U4EA 3HMWH 3C5ZD 5F72S 1DBBH 4ZUSB 3HR5B 4XX1G 4P9ML 3G5YA 2CO6B 1RJLB 1KNOA 4EI6B 1TLKA 2QTEA 1CI5A 4WHDA 3HCVA 4KGJA 3VWKA 3MV7D 3NCYS 4HZLA 2ARJB 3WS6C 3QCVH 4OI8A 5C6WH 3PDDA 5IHUH 4MCYA 3T2OA 1AGFA 2VXUH 4OCLC 4HWBH 1CFNA 2W38A 3TBWA 1FG2A 3B9VA 3HRZA 1VFUA 3W9EA 2FD6H 3C8KB 1P4LB 4BQ8A 3IDJB 2B4CC 3UJIH 2J7LA 2VLRB 3LPWA 5C08D 1KB5L 4L8DA 3GSNA 4HEME 4OFYA 1T7YA 5KSBB 2JLLA 3KVQA 5J6GA 1F4WH 2BNQE 2FBJH 2Q3ZA 4XMPH 5DT1H 3KPPA 3QAZB 1YEHH 4DGIH 4X6EB 1CTNA 1S7VA 2AW2A 3MLYH 1LP9A 4JG0L 2VZTA 3U4BH 5CGMA 2I07A 3GBNH 1ZS8B 5MEND 2Z35A 4GLRH 4R4BB 1HI6A 3GFUA 4NKOA 4OI7A 1W8OA 4OGAC 3MUY1 3PWJA 5CGYD 1K4CA 4HAFA 2Y7QA 3P77B 4KVCH 4YHIA 4GRWB 1EJOH 4PJ5B 2AEPH 3PDOA 2Q6WA 1CQYA 1LD9B 5A3IC 2XQBH 3IJYA 5B38G 2FECI 1HILB 5GHWH 4GAYB 4YGVA 5DRXA 2H32B 5BO1H 4U6XA 5EN2B 3SDYL 3HMXA 4KPHL 4XVUD 1XIWC 1YPZE 1EMTL 5GGQH 2IMNA 3RTQD 1YJDH 2BMKB 2DJUA 3ZE2F 1A6WH 1FZJB 4WU7B 4I8DA 4PJHF 3OQ3B 1V7ML 4CU6A 2R2HB 4PS4H 4I3SH 5EWIL 3CNKA 3BD4A 5GGTH 4F7PB 3TPKA 4TSBH 3ARBA 4OLXH 4JFDE 5EFIB 3V7MA 4LBEB 1AJ7H 4GQPH 2F9BT 2IFFL 4KK8D 2CRIA 2OR7A 4FABH 4M5YL 1BQLL 4MNQE 5FM4A 3QQ9D 4M48L 5IEHB 1CD8A 3MJ9A 3LEVH 3GB7B 5LBSL 4MWFA 5KS9B 1G1CA 3TA3B 3K81A 4HC1A 3VMOA 2HT3D 4LIQL 4QY8B 3RNQB 4Z78B 1FNSH 4ODSH 1DDHB 2P46B 4YDJA 5HGAA 3EJYD 1ZHKA 1R3LB 5AAWA 2YPLB 4X4XA 1U8KA 4F2MA 1QQDB 1IC5H 3ARPA 5F1SA 3FFCA 2E8ZA 3RUGE 5CEZD 2EE6A 4RMUA 3BXNA 4OF3A 5AG8A 3QIUA 5ETUB 1D5XA 4U49A 3QFJD 4DJMA 1AC6A 4M7JL 1TNMA 3MGOB 3MOAH 5DJAA 4XVJL 5TDPB 2HAZA 2XT1B 3LCYA 3JWDL 2EE9A 4I3GA 4M5ZH 1ZT1B 5KOMC 1OLLA 3O4LD 3P9LB 2GJJA 3VWJA 3VDBA 5ESAA 3LOWA 1IAOB 5SWSD 2O5XH 4PG9A 4MAYD 2QADC 3L1OH 4NN5B 1QVOA 1F6LL 2ZSVB 4M1GL 1GGCL 3FOLB 1D5IH 5T1DH 3BP5B 4L8BA 4I0CC 4X6DE 4D8PA 5IW6A 3HNTH 2NLJB 4CADB 1PZUB 4KQ4L 4MQXD 5DUMH 3ZDYE 3IF1A 1ETZB 4XP4L 3IJSA 1TQBB 3MV9D 4XAWL 3C6LA 4QGYA 5F7YC 2R2EA 1VFBB 5D2NA 1U92A 5HYQB 4HKJA 5HVHB 1RFDH 3QQ3B 3DX7B 4XGZA 3ARDD 3LQAL 1F11A 2AJUH 4JFFE 4Z7QF 5HHXL 3DXAD 1A47A 1TZIB 1IAKB 4P2QB 5T3XD 5FECB 4K8RC 2CDGB 5I76A 1MELA 2H41A 4Y5XB 5FYJL 1T1WB 5C6TL 3TBYA 2ATPB 3VI4F 2GT9B 4RGNE 4G9FA 5IVXF 2NYYD 3MRBB 2VXTH 2XICA 3R0NA 2IANB 3PWUA 1LE9A 2GJZB 1OM3H 2ED8A 3O3DB 3PIQA 4LLAA 2X4NB 1F4XH 5HD8D 3O2WH 4LEXL 4DUWA 3DX9B 2DMCA 5I8CB 1M6OB 1G0DA 2ADGB 3NIDE 2DYPA 1U95B 3GMRB 2Q7YA 5AWNH 3BZEA 5EU6E 2C4XA 1WVZA 2A2QT 1UM5L 1YZZA 2R69L 3G6JF 2FIKA 3HMXL 4DN4H 1X5XA 4MDJA 1T3FB 1N3NB 4FFYH 4CDHA 4L1HA 4L9LA 2GK0A 5JHDA 1J12A 5DVMA 1EFXD 1S7QB 1JPFA 4UQ3B 1LDPL 3B8YA 4LSRL 1U8JA 4KHTL 2VIRA 3T4AB 1NFIA 4OQ1A 2IQAB 1GSMA 2I26N 3QH3A 5BQ7A 1CE6B 4UT7H 3QAZC 1NCUA 3IFOB 1R5WA 1E28B 5JNYB 4RRPA 4N90D 7CGTA 4OZIB 4Z7NE 1KYOJ 3QQ4A 4EN3D 2V5SA 1A6ZA 2FEDC 1PQZA 1MUJA 4HC1L 3MFGB 4MB4A 4C83B 1WEJH 4IRSA 4OAWA 2MMXA 3SJVE 5F7EL 2NXZD 3O2VL 1GC1H 1MRFH 4OZHE 1BD2D 3FKUS 3HFML 3G9AB 1N5AB 2B2XL 5FYKU 1NEZA 1JNLL 4KK5D 3PQYD 4HLJA 4P5TC 3KXFA 4U1KA 1I3RA 1RK0A 2H6PB 3SDCC 5BV7L 1U8HA 2VDRL 5FFLA 4L29B 5EC2B 1U8PB 3I6GB 1RUAL 5E6ID 1NEUA 3G5XA 2ZSWA 1XGYL 4H8WC 1BLNA 1MCEA 1A3RH 4BZ1L 4HG4J 4HKZA 4JRXD 1S8DB 4N1HB 4UAOB 3K2UL 4NQEB 4PUBH 5DRZB 3W39B 1JHLH 2VDOL 4RA0C 1HINL 5GGSB 5I19L 4HQQL 3OKKB 3P73B 5FCUH 3X17A 4FQLL 4Q6IC 3U9UB 2KDGA 5EZIH 4FQXC 2YD9A 1P69B 4RX4A 4KZEH 4P4KD 4OBRA 4MJ5A 5JOPE 4EDXA 2F53D 1TETL 1NMCC 1FO0H 4XXCC 4P23B 4TSCH 4ZSOE 3TA3C 1CCZA 2VLME 2W65A 3U2SB 5DLML 4ORZC 1I75A 4TVSa 3RVUC 4CJ0A 1R3JA 2D7PA 4WO4D 1J1OH 2YMXL 1MCKA 2AK4E 1NAML 5E99H 1KLFA 2AEIT 15C8H 4QHLB 3F8UB 4PGDB 1DBKL 3OG6B 1RVFL 1I1FB 1OGTA 1PEWA 1MJJA 5HYSG 1KBGH 3UO1H 4J1UB 1CXFA 5DC4B 3DVIA 1CDGA 3F6IA 4LLYA 2X05A 4ODHL 5JXAH 5BXFB 1MCSA 3LIZL 4GKNB 4RAVB 3WFBH 1YQVL 1OARL 2J88L 3QJFB 2ZUYA 1UH2A 4YXLH 2BOCA 4WFHE 4I0PB 3A6CL 4UU9B 3S3JA 1DL7H 4NN5C 3X3GH 3RWHA 4YX2L 4BELD 4LLQB 2NXYD 4HIEB 4AH2B 3FQWB 4F7EB 3QUXA 1FSKB 3TIDB 3VRLF 3O6MH 3HPJB 5JQ6H 1F42A 2BRRL 1X5KA 1MVFA 5C6PB 5GGVY 3R8BB 2NX5A 3SKUD 1XR8A 4L4TD 2DQTH 4YDKH 4LASH 3RIAF 3PV6B 2MWCA 3E0GA 1HEZA 3VXMB 3NIGF 5F7WC 1N6VA 1PX4A 4U2ZA 4F7MB 1NANH 3NA9L 4K71B 3EJZC 4YHYB 3VXOA 4QYOB 1A9EB 1JWUA 3VXTA 3MQIA 3N9GH 3MNWA 2CK2A 1PG7H 3MPCA 4G7YL 4JZNB 2PO6C 4WW2B 4X9HA 1MCNA 1P9MA 1PSKL 4HH8A 4U1MA 4XNUL 1YMMD 5EZJA 3SKJH 3RRQA 1CZ8H 5IQ7H 1EH9A 2CKBL 3WN5A 5IW1A 2FX7L 1FZKB 1TVHA 4Y5XC 4U7KA 1SVCP 2MOVA 4HJGB 1GL4B 1X4ZA 2H3NB 3IDGB 1E6JL 4Q0XH 3PGFL 3HUJA 4ZQKA 1GZPB 5BCAA 3SKOA 1Q9KA 1BIHA 1I3GL 1AO7E 4BQ6A 3UROR 2DLEA 3H8NA 4R26L 4BZYA 4Y5VA 1S7XA 3B5HA 2GUOA 5J11B 5EFIA 4JFDA 1L9MA 2AJYH 1JGEA 2APVA 3C08L 3L6FA 2O5ZH 1EZVY 4WI6A 2A83B 4X5XB 1R3HA 1ORQB 5I1GL 5E4IA 4JM2B 3GSNH 4PPTA 5MI0C 5KTEL 2QHLA 4MJID 1YC7A 4PJDE 5DQ9A 5ANME 1ZHBA 4Y4KC 3DMMD 3CX5K 4KMQA 2VZSA 3MUGB 4M1CD 3EYFB 3SE9H 5FUCE 2NY6D 2H9GA 3DSFL 2QLVB 1JN6B 1O7SA 3RUGA 4OLUH 5F9OH 1RMFL 4HUXB 4Y16B 3B83A 1EERB 2KQNA 3OKLB 4KTDL 4ZO6A 4L5FL 1ZKAA 3GIVB 2A77L 3C2AH 5A16A 4I48A 5EZOL 3VGHA 1BOGA 5DHXB 3EYVB 1I1AA 3MLRL 1QBMH 2KQMA 3REVB 4ENEC 4LRIC 4N5UA 1FNLA 3B9AA 1LP9F 4W4OA 3L5WB 5AYUH 1OCWH 4JZOB 1RI8A 1DSFL 3KPSB 2R0WH 2WW8A 1G7QA 1OAXL 1DFBH 3BW9A 2R0KL 1HH6A 2ICWA 2A6JB 1AP2B 1ORSB 1AGDB 3FQXB 3RX5A 1U8MB 3RVTC 4U1LA 2VDLL 2K7QA 5ID1B 1BF8A 1PKQE 4LCUB 2YD4A 5FGBA 3L5HA 5FYLE 5IFJB 4APQD 5ID0B 1F6AB 3DV4A 3T0EE 4X7EC 3UTZA 3WS3B 4HUUA 1EEUA 1KTLB 1WIOA 4UAOC 1QUNA 3RVVD 2D7TL 5F1NA 1MWAH 5GIRB 1QBAA 1MFAL 3NFSH 4NKDB 4QF1A 3IDXL 4JAMA 1ED3B 1IAKA 5FOJA 3WHXB 1CG9B 2HYMA 4AMKH 3MRCA 4P2OD 5IESH 2DMBA 1P7QD 1EBPA 3D2UD 4U1IB 5IMLB 3MNZA 1QSFE 5KSAA 4IHOA 3QDGB 2P5WE 3IU3A 2ATPA 3WIHA 1UEYA 2UUDK 3V52H 1J8HE 2WBKA 3LH2H 4P23C 1K5NB 2EDDA 4PGEA 3UJJH 4AIZB 5AZ2H 4Z95L 4LEOB 2HN7B 3PGCB 1CLCA 3WJJC 1RSFA 4WNQA 2X7LB 1IEAB 3OJVC 1UXWA 3O8XB 2BFVH 3QUMB 1QEWB 2CLVA 3DX9A 3SCMD 4U1JA 5CJBA 3H9YA 3QIBC 3K80A 4AL8H 2V5TA 1KEGL 3MRDB 5JZ7D 4NFCA 1UKSA 4CVXA 4E42B 2CIIB 3JWOL 4X6BB 5D70L 5EO0B 5B21A 4AT6A 2E7MA 5DK2A 1LHZA 2VWEE 4CDGC 4YHOH 2OSLA 4LLMB 5C0AE 4NNXB 1KN4L 4HLZH 3VA6A 3HG1E 1BREA 1KLUA 4JZJA 2IH1B 1FSKC 4GXUN 3WKML 4MMZC 5MP6H 3CJJA 4JQVC 3I6KA 3U7YL 1KPVA 1MNUH 1T1XB 5GZOC 3E6HB 1EHNA 2DWEA 1T66D 2JB5H 1C16A 2X2YA 4ONGL 1AQKH 5DK0A 4X5WB 1NH6A 1FL5A 4K94C 5E94B 2FR4A 2IAMB 4UV7L 5CJQH 3BDYL 4PJAB 5I75B 3SY0A 5BOPA 2LVCA 2X5PA 3NPZB 4PRBA 2WANA 5CFHA 4K71C 4C57C 4YHYC 1NLBL 1UWXH 4GKZA 1WUNT 4OZHA 4HK0A 3UBXI 2BVPB 4N8VG 1MJUH 4B41A 1IBGL 2UUDH 2EIBA 3GO1H 5FOBB 3O6KL 1X5GA 3ULUF 1MEXH 4OFDA 4PRID 1U3YA 1NL0H 5E56A 2Q86A 2GITA 3BO8A 4X7TA 4J3WA 3BGFC 5JHLL 3GSOB 2FJFA 4OQTA 1AC0A 3FO0L 4OJFL 1ZGLP 1QKZL 5DQJA 4KUCF 4MD5B 1C08A 2DI7A 2DWDB 4U6VL 3EKCA 4Y1AA 3MNVB 5D1XA 2Y06L 1DEEB 5J11C 3GIZH 3MOQA 1SMOA 3F58H 3IKCA 2R8SL 3LPFA 5IIEB 5IR1B 1AIFA 1OTTC 4TQEH 3DRTA 3TO4D 4E5XB 4WCYH 2DTML 4JM2C 4HF5L 5JA8B 1K6QL 4HIXL 3DBXB 4H1LG 1MHHA 4QWWD 3BZ4B 5I8EA 4YIQB 2HJKB 2NY5C 1PFCA 2BY0A 2Y1VA 3DHMA 3MA9L 1BVLA 3NAAH 1EGJL 1VPOH 4OZGE 4P46A 4WTZG 3TC9A 1ZTXH 4NQXA 5C08B 4XB8A 5C92A 4LSVL 3HN3A 4P0DA 4Y16C 1EEZA 4IIQC 1CDIA 2J4WH 1YYLH 4I4WB 4WHTB 4DVBB 4Q2ZB 3RGVA 2E6QA 1RUKL 3WIHL 4HWEH 4NRXB 3DGCR 4S1QL 4MLSA 5SWZD 2EDXA 2OI9C 2X41A 4E41D 1JWSA 4L9DA 2E9JA 1ZT4B 4OFPA 2X70A 1U8NA 4RMQA 5C0FB 4TTDC 3JTTA 1MFEH 1T5XB 2FJGB 5ESQA 4AEHH 3L7EB 4Y4HA 3TGXA 5FDWA 1HYRC 3HI5H 4DKFH 3QPXL 5D1QA 3RWCB 5D7KE 4M9OA 2D0FA 3FB7B 3VXMA 4EUPB 1FGNL 4Z8FL 4JHBA 3KYKH 3H7BA 4HJ0C 3NCCB 4LHUA 1IC1A 3N85L 1IQWH 4QCIA 3KJ4C 1UJ3A 2BOBB 4PJEE 1UA6H 3BE1L 1PZ5A 5HHNB 2OJEA 3L7FB 3RTQB 3MUHL 5IVOA 1AD0A 5KVGH 4ZXBA 4JB9H 2ZCKH 1WWBX 4PD4K 1U3JA 2XXMB 3TCLA 4O4YH 1KJ2B 3HE7C 4NQDD 4W6WB 3GHBL 1UC6A 2J8UE 3SDXE 3WD5H 4LNRA 2R23A 3GMNB 4JFPB 3HZMB 3FZUC 4ODWA 1FNAA 4PJ9D 3BEWB 1ZLWK 4YNYA 4UV4L 4MB3A 4IRJD 5CJ8A 3CFJB 2EXWD 1KPRA 4NZRH 5FO8B 3RDTA 3ROOB 5ISZD 4GUPB 3ZDZF 4G6KH 4MAUL 4FFZL 1IEBB 3SQOL 4V1DE 4XAKE 2GIYA 4GS7B 1U58A 3FFDB 3RZCB 5EOCJ 4K7PY 4XPTL 3E3QC 4CU8A 3SE8L 4OQTL 5ANMA 5C09A 3TN0A 4JFQB 1MQ8A 3EYQC 3GM8A 4JPIB 2BNUB 3CK0L 4JO1H 3ZSSA 5C3TA 1KC5H 2J8OA 1G7IA 2CUIA 5CINL 5K9KB 1ULVA 5SWSB 3FT4B 2R0LL 4MAYB 5JPNB 2MTPA 1G7PB 5C0BD 2QL1A 5HHVH 4K23H 1ND0B 1I8LC 5IJVB 4J6RH 3L5JA 1F8TL 3E8UL 5AD0B 4L4VA 5E2VH 5I1CL 4DFHA 3DI3B 5LQBL 1NGZB 3QA3A 4OM0L 4PYGA 1ZANH 2IAMC 5J12B 1NCWL 1RUPL 4LCWD 1BVKB 1WITA 4HMDA 4GOSA 3TZVA 3LHPL 3EOTH 2Z8SA 5CAYB 2FGZA 2YUVA 2NY2B 3CFBA 2C3HA 3GJFK 5KANI 1LO5A 2HVKA 3ARDB 2HT4C 2IPUG 2A6JA 1IGYB 3G6AB 3FO1B 3KLAB 3NACH 3DXAB 3FQXA 4QLRA 4IOSD 4TVPL 2OK0H 1JV5A 4HPOL 4NJ9L 1U42A 4Y8DC 2XNAB 1KT2B 4JG1L 2R0ZH 3KPNB 4CN1A 4G6MH 4EIGB 3P9WB 5GS0C 5JW5A 3K4AA 5HPMA 4HH9B 5HI4D 1I8IB 4HWNA 1MLCA 2CIKA 5IB2A 4PRNA 3K4ZA 2AV7B 1JRHL 4FNLH 3D0VB 4WU5A 4BH7B 1MHCA 4O5LL 5HHOB 2QQLH 1YPZF 3TH3T 3OGCB 1QSFA 2P5WA 5I74B 2WAHA 2PCPA 3M17A 4BSVA 1IL1B 1OSZA 1XFPA 4U1SB 43CAB 5IJKA 3P0YL 1EK3A 2P43B 4XI5D 3FHQA 3BQUD 1I9RL 2P47B 1VFAB 4HXAH 3CFKB 5FUOL 3EYUH 5FEBA 3QHZL 1FBIL 1GGBL 3MLSH 3ZKND 5KAQF 4LDOB 2VKXA 5J3HD 4F7TB 3S98A 3GSWA 3O3AA 4OB5H 1J05A 1A9BB 4JDTH 4XB7A 1WLHA 1UWEL 2UY7A 1H0DA 2ICEA 1MIEH 5AZEH 4OLVH 4FP8L 3RUGF 1GPOH 8FABA 3CFEB 5DJ8A 3D69A 5HHME 3GJFH 4WIQA 1RZFH 4EN3B 4NGHH 2ZJSL 4HDIB 2IADB 5DMIL 3TNNA 2UY6A 3GSUA 3H42H 4Z6AT 2NXZB 2D0GA 3FB6B 5AAMA 5K9OA 2OL3A 1BD2B 4AEIL 2ED7A 1CGUA 5DVKA 2BSSB 2Z91B 2P5EB 3CFCH 2P8LB 5DTFA 3BRDA 2ICCA 3CUPB 4X6DF 3HC0B 5GSVB 2ADFL 4GH7B 1VFMA 4MZ3A 1JF1B 3ZDYF 3KLHD 1CICA 5FKAB 2FX8L 2Q8BH 2EE3A 4PFEA 3RTQC 2M2DA 4R7NA 4GW1B 3VFTA 1J88A 4JRXB 5CCKH 1G7MB 25C8H 3QO1A 2ARWA 3LEXB 43C9A 1VGEH 1EEQA 4ACPA 4KGLA 1EA9C 2CO7B 5ADPH 3DVGB 2PTTB 2HJFA 1RIUL 5ICXA 5HYSB 1T89A 4P4KB 3VXRE 2VDQL 1QFWH 2F53B 2DWDA 4NZTL 2G5BA 5DMJB 1OVZA 3C5ZA 4OF8A 3GJEB 2R9HC 3QEUA 4P2RD 4U6HA 2NW3B 4O51B 4S2SB 4XCCL 1YYML 4WO4B 4KKNA 4NKIL 3BZFB 5A2KH 3F12A 2PXYB 2X4SA 3CSPA 2OTUA 4G8GB 3GM0A 4F33A 3MV7A 2EH8H 4GS7C 3RZCC 1VFOA 4YDVB 4D9QE 4Z0BH 5HPOA 2DLFL 1W0YT 3GSVA 2W9LA 3ARGC 4EZMA 3BH8A 2P24B 2JK5A 1CTOA 5TDNA 3QFDB 1CXHA 3INUL 1MCPL 2UZIL 3I6LE 3NIDF 1LK2B 5INDA 3BN3B 2N56A 4JFXA 1KLGA 1E6OL 1DR9A 1UYWL 4OZGA 4HPYH 3K1KC 2FHCA 4H0IA 4ZPVA 5FB8B 3VGEA 5HDQL 5C08A 3FB5A 5E7BA 4JN1L 4JPKL 3RWGB 1RK1A 1T03H 1FYTA 4I4WA 1NGPH 2VQ1B 3X14B 1CLOL 5D71L 4JFED 5B38A 2G75A 1PG7W 3VGAC 4KJPD 1IE5A 3MLTA 1MJ7H 1RY7B 5IWLA 1T22B 1C5CL 4YHZL 2AK1H 3T8XA 1JF5A 2V2XB 1Q1JL 5MENA 1YEEH 3ZL4L 3Q6GL 1I3VA 3VXQA 1A4KB 4Z7NF 1NDMB 1OOAA 2NY2C 4X4ME 2VE6B 3ARDC 1Z0NA 1HDMA 2FLRT 3JVGC 2VLRE 3V6ZB 3OKMB 1SEQH 3QIWD 4Y4FA 3RHWK 3BRFA 3B2VL 1B9ZA 5HHQB 1YMMB 1KIPA 4OZHF 4Z7VB 2VRAA 4QRQA 1YNLH 1VGKB 4R7DA 1IZJA 3HS0B 1SBSL 1JIBA 2AV1B 3EYSL 5DJYB 4ZFZB 2Q1EA 5C2BH 1KCVH 2UWEB 1II4E 1MPAH 1Z2KA 1D6VL 4LSSH 1KFAH 4ZUUA 4N8CH 4ONFL 2P8MB 2YOCA 3QUZD 1JGVL 3SGJA 5JR1L 3CMOL 2BVTA 5FO9B 3FT2A 5KVEL 1Z3GL 4FQIL 1NBZA 4F9LC 2J8UA 1RJZB 4GRWE 4PJ5E 5FGRA 3GBLA 4EJ1C 4QRSA 3TCXA 4NZJA 5EBLA 5F96H 3VFSA 4KDTC 4PV8A 2OXGA 4YEFA 1B90A 1RZJC 4MJIB 5DEGB 3RPKA 5CD5C 1EAPA 4LKXA 5EA0L 2VL4A 5D2LE 5EU3A 1MFCH 3DMMB 2O93L 2VH5H 1FFNB 4MNGB 2A1WL 4Y2OA 5D7IA 3WFEH 2FSEA 1D5BA 1JJUA 2NW2A 4MQ7B 3JV0A 4V2BA 3SO3B 4R90H 1T2JA 4NKMB 5L9DH 3CCHB 4KH2A 3WLBA 4HIIB 3QFJA 5CZXC 3RY6A 3F65A 1MHPL 1RZ8A 2AJZB 4XP6H 4XVTL 2LU4A 3QEGH 3RA7L 4M7LL 3LN9A 3O4LA 1F4YH 4EN3C 3UEZA 3O41A 3EJJX 1YJDC 3GRWH 4I13B 4JM4H 5DQDH 2ZCHL 5KS9E 3MCG1 2BDNL 4A6YA 4YXKL 4LLWA 1CL7L 4EEEA 1DLFH 1JK8B 1FV1B 2V7HA 3P0VH 3P3YA 4Q9RL 1JGUL 5H37H 4ZDHA 1IC4H 2EZ0C 2O61B 3THML 4U1HB 5E5MB 1P4BH 1XGQB 2VLKB 3U4AA 3BD5A 4K3DL 1NGZA 2R1XA 5JW4M 1A1OB 1FZOB 3Q48A 1LO0L 3VFNB 3MRJB 5IGXL 4GQ9L 1JWMB 4BUGA 4J3UA 3CVIL 4HIHA 3MV9A 2EYSB 2NZ9D 3MREB 5EH1A 1UCBL 1MLBB 4F58L 4DAGL 2AKRA 5TGBA 4APQB 5C0CB 5DDHA 5KZCD 3ZHKA 1P84K 1AQDA 4O2CA 3RWIB 3V79C 5T1LA 3RHWF 4PJXE 4GG6B 1IGJB 4HT1L 2VXVL 3GMPA 5FM5M 1KT2A 3OJDB 4PY7A 3STBA 1G6RB 4BM7A 1K4DA 2PKDA 4P2OB 5I1JL 5I73B 1P7QB 3D2UB 5DD3L 3L5IA 4P4KC 2Y5EA 3BISA 3EDEA 1BBDH 3QSKB 2VDML 3RNKB 4R96B 1Z9OA 4UTBL 1J18A 4M00A 4OD3L 2YZ1A 3T4YA 2QQQA 1XGPB 2B0SL 3GI9H 1U9KA 2EC8A 2G9HB 4R2GC 2C4FT 1ZSDB 4U31A 4JO4H 3F7PC 3WXVH 1JUFA 2DQCH 3QO0A 2PXYC 5I17A 1T6WA 1T0MA 4GW4A 3UC0L 4LK4A 1UWGH 1S9XB 2W0KA 1A02N 4P2QE 3TYFA 1BJ1J 4Z7UE 2A74B 1CFVL 1W0VA 5EUOB 3S36L 4XPFH 1YEGL 1WAAE 1UJTA 1S7SB 3ROLB 1JZ2A 4LF3B 4Z7OE 4XPHH 3X11B 3U7WL 5T1KA 3FQRA 1OP5K 5I18L 3K8KA 3D25A 2FNBA 4LLUA 4PJDF 1DQDL 1KTRL 2IANE 1E4WH 4UUJA 1VSCA 1KJ2L 1YA5A 2OXHA 5HI3D 3SEPA 1EFXA 35C8H 1DBAL 3B4NA 3CLEH 1J1PL 4XC1H 1DQJA 2QKIB 5HDLA 3PNWA 3KJ6L 2WUBH 1KXTB 1KGCD 2E3VA 3O4OB 1NJ9B 4X83A 4XXDA 3T1WA 5E7FA 3VFOB 5GJTL 2PW1B 3PJSB 2I60L 1NKOA 1R5IA 1FG9C 1OGAD 3SGEH 2XN9D 5KSVB 3DROB 5CWSB 1NUFA 2XWJA 1N0XH 2VTFA 2XZCH 3HC4H 3S4SB 5CEZL 1A8JH 4XPAH 5E8PA 3WIFB 3PQYA 2H26B 2HT2C 1RIVH 2ENSA 2IBGA 1IC7L 3VXNB 5IMKA 1ZMYA 1BGXL 3QI9B 3MLWH 2Q8AL 4MD0A 5E6IA 1OTSD 5I1DA 4OLYL 1YEDB 1NAKL 3T0XA 4OZIE 5FDYA 3QNYB 2VABA 2PYFB 5EB9A 4A6YL 4Y5YB 5I6XC 2JJVA 2PR4L 3BX7C 3U0WH 4WFFD 4NNPH 1DQLL 1IAIM 5ENWA 4ZYKB 3QDME 5F3HB 4HUKB 1TXKA 4QTIH 2W91A 4PGJA 3BMVA 5HYJB 4HX1B 5L88L 3CSYA 1A1NA 3CDCA 1I1YB 1LO3L 1OP5H 2XACC 5HI5C 1J10A 3IFLL 4NCC1 4NN6B 1KB5H 5C0DB 4M7ZB 1Q9WB 4K9EL 2MCPL 2OR9L 4IJ3C 2MKWA 3CGTA 4MMXC 4ZS6C 4X80H 3O6FD 4PREB 3S35L 1GC1C 4XHJC 4M1CC 5EPMA 4KKBC 1A7RL 3LZFL 3LV3B 3SO3C 2YC1A 4WFGD 3RL1A 2L0DA 4WTWA 5DJZB 3PL6D 5T3XL 4ELMA 4HV8B 4WI8A 5E4EC 5DGQA 4J8RA 2X4RB 4NM4H 1AHWA 1VB9A 1Z9SA 3UYRH 4OF7A 2F5AL 3LKNA 2DICA 2C3WA 5SWZB 1G0YR 5DRWB 4F3FB 3BSZH 4RCAA 1DUZB 4P59L 2PW2A 4TUJA 2K7PA 1W72B 4NO3A 1AXTL 1AGBB 3O2DH 3N1GC 4YGAB 2HTLD 1FNGA 4F9PC 3SDYH 3AAZA 3W11D 4L4TA 1EMTH 2BCKA 5MHSD 5CGTA 5D6CB 2ZOKA 4D0BB 4CW1A 3S5LG 1AR2A 1RZJL 1Q94B 3PDGA 2FEEI 3D3VB 1GAFH 1ADQA 5EIIA 2D31B 4APQC 3NA4A 1C7TA 1NC4A 1S9WB 2HVJA 1YEKL 3NIFE 2IFFH 5F7NC 4OD1L 5CD3B 2B1HL 5FV2A 4POZD 4M48H 2UVEA 2VR9A 4P3DA 4AJ0A 5HHQA 3PWVB 3N1QC 4HFUL 4P2OC 5I73C 1SJXA 1VGKA 2NTFA 4NQDB 1QSEE 1PYWA 3BHBA 4WI7A 4BUHA 4LRNH 5DRNB 5E00B 3WJLC 3LEYL 1UQSB 3Q5TA 4FZEL 4U7MA 5F7UA 4PRHD 3TO2A 2ICWI 5DJ6A 4E9LA 5IKCA 1KTDA 1DLHB 4XNQA 4IRJB 3CPLB 1YUHA 5ICZA 3TIEB 3JWDH 3KHOA 3LS4L 5ISZB 1DN0A 1QLRA 1KEML 2UZXB 4YH6A 1OSPL 1MCOL 4G7VL 4QRRD 3RX7A 1A0QL 1EX0A 3CFDA 4P5TA 3SDCA 5DO2D 2ATKB 2EICA 3FN9A 4G6AC 1WQVT 2BVQA 4K2UL 4TNVF 3FO2B 4D0DA 3TBTB 2BC4A 4NUJA 5CP3A 2KPNA 4JDZA 1KCKA 1J1XH 4HD9A 3A67L 3IETA 3W0WA 2CDEB 4XAWH 1AXIB 3S96B 4WI2A 4OZGF 4BQ9A 1B2WH 3FMGL 2JB6A 1FP5A 1BEYH 4Q6IA 4QRUA 4EOWH 4FQXA 4PLOB 2IALA 3QDAA 5CKAA 3O4OC 4Z77A 4GRLD 3LQAH 4G8EB 3DX8A 3M1BB 2GI7A 4MCZB 5H35B 5E08L 1FVCA 1S9YB 1XF3A 2WNGA 4LCWB 1CGVA 1H15A 1OAZL 4UBDD 3QXDA 4FQQB 4NQCD 1HSBA 1Y0LB 2HA1A 4H20L 2VN7A 3GSRB 1S5HA 2PUQT 1UKTA 4Q74A 4RWYH 4L8SC 3STZB 3LKOA 3T77A 3VFWB 5C71A 3QI9C 4QHMB 1FQ9C 1KIUA 4L3ED 4X7SH 1FAKT 3BWAB 5L0QB 4H0HB 4J7RA 5GRWA 3WXWL 4DZ8B 4XRCB 3O9WD 2Y07L 2BHZA 5IHZB 4OGXL 1HNGA 2C4FU 2JCCE 4PJXA 1ZHLA 1RJYB 2YEZB 2WINA 4HK3N 4R3SB 5HXMA 3ZE1E 2R69H 4LSQL 5CBAB 2FLBT 3BD3A 3OL2A 4PJEF 5IF0B 1P7QA 2VQUA 3WV0A 1HXMA 4ZS7H 1G6VK 1T2QH 3KPSE 4NFDA 1ZLUK 4ODUB 1D9KC 1EO8L 1ZEAL 1T1ZB 2FIRT 4NN6C 5EIVA 3RBSA 2VITB 1ZHNA 2MKLC 5ICYA 2DQUL 1NUDA 2OQJA 4LP5A 4U1NA 3VI3F 4KAQL 3BQUB 1F3JA 2J8UF 5EUKA 4KHTH 3SDXF 3U6RA 1HHJA 3VXPA 5MEQB 5GRVL 1TZGH 2J8HA 2EH7H 1FL6A 1M7IA 1WZKA 3PV7A 4YAQA 1JPSL 3SCMA 3UYPA 4DKEH 3WL9A 2OTPA 5TDOB 4DN3L 2PO6A 4LARL 4PJFB 4ZOCA 1N8ZA 3FCTA 4RISL 4Z7UA 2NY1D 1HK6A 4NRYA 3MRKB 5F7EH 1DP0A 1WAAA 3QDGE 1GIGH 3O2VH 3K74B 1IGIL 2OJZH 3BVNA 3HFMH 4KK6C 4K7FA 1G7LA 2HMIC 2VJXA 3KPTA 4M8QA 1AFVL 3BPLC 1JNLH 4HS8L 2BRQA 5DJCA 1LE5B 1MJ8L 5I8KL 1HNFA 2CDFB 4NHUA 1CXIA 5FA3A 4BSWA 1HHIB 2HKFL 2EDRA 2VKWA 2ADJA 3KS0H 5IB4A 4N8VA 2HLAA 2YSSB 4FN0A 4KZDH 1WBZB 2QKIA 3D85A 1RUAH 4G6FB 3C60C 4ZAKD 1O0VA 2E27L 4NBZB 1N59B 2HG5B 1U93A 4BKLB 1CFTB 2VDOH 4U6YB 2VMFA 2VYRE 2VL5A 3E3QE 1HINH 2B39A 1ROWA 1AKJB 2Y36L 4HS3A 2ORBL 2EYRB 3V95A 3TVMD 3RPIA 4WY7L 4I18A 4UT9H 1ZLUH 1TETH 1DBJH 4XVSL 3MRRA 2Z92A 3D18A 3VXNA 3F7YA 4OD2A 5IM7B 2XY1A 3MRNA 4PRIA 1V8HA 3CVHA 3MROB 1QFPA 5DVLA 2YMXH 3TT1L 1GJIA 1NAMH 1UXSA 2DQFA 3VWKD 2VAAA 4H1LA 4ZUTB 4P5KB 1OQOA 4ZPTB 3QT2A 2XA8L 1IQDB 5E1AA 1KG0B 3MLZL 4PJAE 3CFIC 3I2CH 4OCYH 2DM3A 4YHNB 1FN4A 2DD8H 2YBRB 3UTSE 4P2RB 4LRIA 3SN6N 3LQZA 3QDMA 1CS6A 4KXZI 3WUWG 1IM9A 5DMKB 3TO4A 3LB6D 4ONHA 3LIZH 2J88H 4TYUA 3FB8A 4BQCA 2ZG1A 1Q9WA 2C1OA 1VADA 1X4XA 3DYMA 1WC7A 5KW9L 5GRJL 4NWUH 3GMMB 3UTPD 5LKNA 1R0AL 5ALCL 4XNZC 5JMOC 1MCDA 3MJ7B 4LL9A 2BRRH 5LCVL 3H6JA 3NCMA 2AQ3A 3HC3H 3LKRB 1RZKL 2P44B 4OFKA 3HHRB 1V3JA 3PHQB 5I2IA 4XNMB 3NFPB 3NZHH 3WSQH 5C9JA 5F7DA 1E4XH 1YNTB 1QR1B 4NOBA 5FYJU 5CJXC 4LCYB 4JPVH 5E8DH 1TCMA 4JFEB 3I84A 4Z7WA 5FK9B 3L9RB 4DFIA 4E41A 3U46B 1XCQB 5JDSB 4G7YH 4GW5A 5DWUL 4Q7DA 4XWOD 3VDAA 2QSVA 2AJVH 2NQCA 2WBJB 4GXVL 1CGTA 1B6DA 1U6AH 2CKBH 3WJJA 3WIIL 4E0RB 4GSDL 2X4UB 6FABL 1QA9A 1YN7B 2D0HA 3PGFH 1L7IH 1JGDB 2EYTA 4J3SA 3QIWB 2ZCLL 4KK9C 1CR9L 3QIBA 1UM6L 2J3SA 1FJ1B 2D7QA 1EXUA 1Q94A 1U8OA 5JTWA 4U4BA 1HWGB 2A6DB 4ERSL 1MIML 1JZ5A 1IFHH 1FNEB 1WISA 1KJVB 3C08H 4U05A 4YHLL 4FQPA 4PY8I 3BYTA 4NSKB 4YFDB 2C7UA 4NM8L 2OTWB 4HWZB 5ACLA 1V3LA 1C12B 2UV3A 3L5XH 4UOJA 4KJQC 1QSEA 1XGTA 3MO1B 1T1YB 2DLHA 3DSFH 4LFHD 3BKYL 5DUBB 3FFCD 5BVJB 2ESVD 3MR9A 4NN7B 4P57B 4PJ9A 1A7BA 3QIUD 2JELL 1VACA 3PWLA 5HBBA 2AEWA 3TH4T 4NFBA 3RI5F 5D7LB 4ESKA 4ZNCD 4WV1A 2XXCB 4H88L 3D39D 1BFOA 4KTDH 1YY8A 4L5FH 1A7OL 2J5LB 3HAEH 3OSKA 1P7HL 4WTXA 1N64L 3SGEI 4M4RA 3VWJD 2XFXA 4N0YL 5EZOH 3ILPB 1KXQE 3CVHL 3HB3D 5F9AC 5AYQA 5T5FL 3MXVL 4QXTA 2DAVA 3RKDD 3U79A 2BSED 3B3IA 1CGSL 2BSRB 1XGRB 5TH2B 3STLB 2GK2A 2R0KH 1MRCL 4BH8B 1J8KA 4WEBH 2BVOB 3T0BA 4MA3B 3C6LD 5JPMB 3S3PA 5C0BA 1YECL 3MOBL 3ULUD 4NQTA 3U0TA 1Y18B 3TLRA 5H94B 1A7PL 3R1GH 1V7NL 1UZ8B 4LGRB 4AQOA 1MVUA 2D7TH 2VLJD 3H3BC 2W9EL 3IXAB 4KUCD 1JZ7A 4WFED 3IDXH 4QRPD 3KLSA 3V4VL 3K8MA 3MRGA 3RVWC 1AGCA 3GHEL 1ZA6A 1UVQA 5D93B 1PW3A 1JI2A 2EDYA 1QRND 5CP7A 4ORGB 4O9HL 2FZ3A 1DZBA 3IGAB 3RVXC 4NC1C 1Z5LA 2EIEA 5KZCB 4G9FD 4N5ED 4IRZL 4L4JA 2J12B 1DE4B 2VUYA 3BUYB 3N1MC 4OTXH 5SWSE 1OPGH 4Z95H 3QZWG 5FHBH 4IIQA 1EHAA 3M45A 5B4MD 2XTLA 4UMGA 3TV3L 1G1YA 1P6FA 2IEPA 3WYRA 1F45A 4RDQF 2W60A 4GRWH 5TFSL 3EOBB 5D5MB 4PV9B 1N0LA 3ZE0F 1RJYA 2XTJD 2JCCA 5IT2H 3DRQB 3LS5L 5GGVL 4LCCC 1KEGH 1PD6A 3PP3K 1W8NA 1DCLA 5B39G 3B9DA 1NGXA 2H32H 3WNNA 5F7KC 3Q3GA 3QISA 1JPGB 3JWOH 5D70H 5F88B 3EHBC 3ZKXB 3BGAA 1T0PB 4H8WH 4GFTB 4UIMA 4MSWA 5JHDD 4MZ2A 2QBWA 3DXAE 4UT6H 4GJTB 5IBUG 4G8FB 1FRGL 4NYLA 2FATH 4IOFC 4RFEA 4OBSA 4ZFOA 4P9HC 3U7YH 1E4KA 4GRWF 2CJUL 2IH3B 3OR6B 1FHGA 2QR0B 4Y8AA 2FGWL 2A0LD 5DZNA 3N0PB 4ONGH 4LQFL 4NO2B 3LKSB 1DQQB 3B6SB 1WBXB 2VDPH 3WMSA 1QLEH 5GISL 5IQ9B 2RFXB 2XRAL 4UI2A 4ZTOL 4MX7B 5IB1B 3T1FB 1YC8A 5D2LF 4KRPD 4XMKL 5EIQA 4WUKH 1E27B 5C0GB 3CH8A 5HHOE 1K8IA 4YDLB 4BJLA 5JXEC 2ERJB 3QXUA 3VFPA 3HE7A 5I1IL 1NLBH 3UTTE 1QSVA 4JDVB 4Y19E 1T6VN 2EIZB 3FQNA 1EHXA 1HYSC 2YPKA 3GSXB 2XKNA 5F44A 5FHAL 4F15C 3FOMB 2Q3AA 4LLVB 1IBGH 2OX5A 4H0GA 4QHUB 1QYGL 2WBJC 5DHVA 5LAXB 2VNCA 4LSPH 4ZFGL 3MRLB 3MV8D 4CVWA 4PB9H 4Z18A 2F8VA 3LSOB 1S7UB 5JHLH 5D8JL 2XN9B 1I8MA 5KS9F 2FECL 4NNYB 4NOFA 4TOYL 3RKPA 5DFWH 2CD0A 4ODBD 5I30H 4WGWB 3SPVA 2Y06H 4OFVA 1QO3B 3AROA 1BM3L 3KWWB 4OLEA 5IBTH 4MNHB 4X4YB 3L3OA 2F8XC 1MFBL 4GG8B 2JJTC 3MRPA 1V5JA 1W0WB 3OG4B 3H9HB 5SX4I 4OLZL 3QXVA 3D6GA 2HFEB 4HF5H 3KYMB 2NR6D 5FYKE 4HIXH 1JHTB 3W2DL 2ZPKL 2BJMH 4N0FB 2DBLL 4NZUL 3ZHLA 5EOCH 1BD2E 2I9TB 4PJXF 5E95B 2XKSA 1A6UH 3BIKA 4M3JA 3MA9H 5TQ0L 1I8LA 3CZFA 5ERWA 4I0KA 1NDGB 4ODVH 4P5MB 1EGJH 1EHLL 1RZGB 1OL0A 3H9SA 3ZZ1A 3TNMB 2P5EE 2Z8VC 4OCWL 3P30L 4LAQH 5BRZE 1RIHL 4XNYL 4YHNA 3CX5J 3ULVC 1SJEB 1T2XA 2H1PL 4GKSA 3UTSA 1IGML 2H2PC 2J5LC 3UBXB 2IBZX 3PP4H 4S1QH 1P1ZA 2I5YL 3QUYD 1REIA 3QG6B 2AGJL 1OWWA 1KB9K 3PE9A 4JN2A 3C5JA 1P7KA 3MRQB 4WEUD 1T7ZA 3QUXD 3IDMB 4M61B 4R0LC 3BPNB 4YPGB 4WW1A 4QHNB 1MSPA 2H2SD 3HNSL 2BNQD 1AI1L 1H3UA 2F53E 1G7JB 3CH1A 4KROB 3QPXH 1L9NA 4ISVB 3ARFD 2X4TB 3C87A 1WAAF 3ULSA 1NCBH 5A43C 4Z7OF 1FGNH 4PRPB 5K9JH 4Z8FH 4A2MA 1WT5C 4JFEA 4G8GE 3HLAB 4OLWL 4DGYL 4LP4A 3SE4A 4XPBL 3L3IB 1A6VH 3I02A 3MC0A 4LVHC 4K3JL 4MQSB 5GS1B 2Y9RT 3VFVB 5IG7A 3DX6A 4M1DL 1FPTH 2GFBA 5D93C 1KIRB 1R5VA 5IVXB 3VRJA 1ZGLA 4YO0A 3PWPE 5LGHL 3UPRB 1XCTB 1WCBB 1TPXB 2V2WB 3U30B 2EKSB 4MXWL 1BECA 3MRMB 1LK3L 3ALWA 3X12B 4I9WE 3ARRA 2X89D 3QEHB 5IVNA 1IMHC 1I7ZB 4D9RE 3SKMB 1X7QA 1DUYA 3A0OA 3MA7B 3UDWC 1HHHB 3E6FB 4JFDD 5AUMA 2HP4A 1FL3A 3T08A 2AXFB 4FFZH 3LN5A 3DUSB 3KYOA 4JRWA 3BESR 4MNQD 3P11L 5CILL 3RWDA 1D3CA 3VW3L 5DC9B 4NJAL 1FVEA 4RGOH 1G9NL 3SDAC 1BOYA 4PJCE 2AXGB 4K3EL 3AS0A 3SE8H 4XTRD 3H2WA 4OZIF 4EXKA 3BYYA 3QUZA 2AABH 5IVZB 4OGZA 3AXLB 2MHAB 5GGUA 3L3GB 4JFZL 3FAXA 4QOKB 4QRRB 4Z5RB 3AU1A 1MFDL 3BH9B 5LVEA 5B8CB 1KJMB 2R0LH 4NBXB 4G6JL 5DMYA 5BW7A 3DV6B 1XH3B 3OBAA 2JJSC 1UM4L 1RUML 2AJ3B 1B0RB 1F8TH 5I1CH 1BQHB 3GKWL 3K4DA 2UWEE 4NHCL 4J4PA 3O6LL 5KVDL 3VE0B 1I4FB 2MJWA 1I1AD 3DURA 3S34L 1U91A 4ONOA 1Q9LA 4PJIB 5JORA 1DQTA 1Q0XH 4JKMA 2ZKHL 1XF5B 4NDMA 3T65B 3GUTA 1KIQB 2XPGB 4HFWB 2QQNH 4DW2H 1DBML 4PJGE 4K07A 4P3CH 4BZ2L 5C07E 1CFSB 4D2NA 1ZOXA 3EFDH 3OAZK 4NQCB 4CU7A 3WEXB 5C9KA 3PGDB 4X8JA 1WBYB 3UX9B 1A6AB 3BPCA 4B7LA 4FHBD 4MQTB 1BMGA 3QNZA 3DIFA 4HCRL 4JFFD 4NO0B 4BFIA 2CR6A 4M6ML 4JANB 1JRHH 2X4QA 3OAUH 3ARGA 3NZ8B 1BFVL 2A73B 1UB6A 1FZMB 4KJYB 4XP5L 5DURD 3PHOA 4O5LH 4L3EB 2R4SH 1FC1A 4PLKD 5KSAD 4UNUA 3O9WB 4CJ1A 4KQ3L 1U8IA 4RGND 5C0IB 5KN5B 2P8PB 1LEIA 4PJ8C 3VFMA 2VLLA 3QDJB 3NCJL 1OB1B 4UNTA 4M43L 1I9RH 2FJHA 3OXSB 5DJ2B 2VOTA 2G2RA 4P49A 2IF7A 4OKVA 2VLKE 1PGRB 1HXYA 3G04A 3U36B 1FBIH 1GGBH 4G9DB 5KVMC 2SEBA 3HPLA 2NY4D 3R4DA 3FONA 1YY9C 3KDMA 5E6ZA 1G0XA 3TJHD 5D9SA 4JGUA 5IFAL 1U8LA 1SJHB 5EU6D 1T5WA 1Q9OA 4DGVL 1RHHA 1JBJA 4HJJH 2XWTB 2OZ4H 5EU4B 3T2NL 5C0CE 1CE1H 4HBCL 1SBBA 3L3DB 5IMOB 3B2UD 3KAAA 4GG6E 5JUEL 1WFTA 2IGFL 1IM3A 1LO4H 5EBWA 1ZVSA 5F97E 2D3VA 3CZJA 4DQOH 1LEKB 2JIXD 1URLA 4HWBA 2NY1B 1A2YA 4R97C 3OAZH 5CEXA 3GGWA 4UQ2A 3UPAA 4M6NH 4XCYB 5GRUL 1EV2E 5HGHA 4HUWB 4KROC 1NGWB 3GI8L 2R39A 3LRSA 4AEFA 1UACL 2FHFA 2GJ6E 3P4NA 4YHPB 3SJVD 1X6LA 5GJSL 2GTZA 3HZYB 3SE3C 3WFDH 2EIZA 3BP4B 3UTTA 2FX8H 4Y19A 2X4OA 4OUOA 4XNXH 4JQXC 4XC3L 5GS1C 2ITCB 3FOMA 4OZ4B 5I1LB 1HKLH 5TF1H 2Z93A 5MEPB 4HXBH 5EUOE 1BJ8A 4TN9A 1TPXC 4PJHA 3OJ2C 3P4OB 4K7PL 4D9LH 1OGAA 5MEOA 2NY0D 2F58H 4JM2F 3JZ7A 3TVMB 3P0GB 1OAKH 5DS8A 2DLGA 4FQJL 1O7VA 3FRUB 4PD4J 2WQRA 5DR5L 4Y1AD 5DYOA 4YBLB 3L3HB 5CIPB 2UYLA 5D1XD 3U4EB 2LTQB 1F58L 5BJTB 5I1HL 3GMQA 4HKBA 4XZUA 4U2YA 3GK8L 3G5YB 2HFGH 1KNOB 3QCUL 1YYMH 5IV2A 4NKIH 3S37L 1MRDH 5GRYA 4FXLA 3HCVB 5JOPD 3VWKB 4CVUA 1CLYL 1INQA 4HZLB 4MA1B 4P4RA 2DLFH 4MCYB 5DEFA 1AGFB 2VLMD 1CFNB 1FG2B 4GMTL 5T1MA 2R1YA 5I16A 1RUQL 3HRZB 2HTKD 5GGTA 1CYGA 3D48R 3W9EB 1CDBA 1MCPH 1WWWX 2JCCF 2AK4D 2FB4L 3MUZ1 3Q2CA 3BGMA 4M7LT 3BZDA 4P46D 3S8WA 2VERN 3ZE1F 5HDQH 3SHSA 1OAYH 2NCMA 3H0TA 4JN1H 4JPKH 4L8DB 4WI5A 5B8CC 2PETA 3GSNB 1VENA 5BRZA 3RGVD 3IAQA 5BZWA 2NY7L 3D9AL 5CJOH 1CLOH 5J6GB 1S78D 3O6FA 2DL2A 1PKOA 3GMOA 3RJQB 2NY3C 3KPPB 5FF6A 1S7VB 2HWZL 4OUUA 1LP9B 3CLFL 4TPRH 4DKDC 2VB5A 3LMJL 4MJ4A 4WFHD 1INDH 2R1WA 2I07B 4YHZH 3PL6A 1JZ4A 2OS7A 3GMLA 3WBDA 2Z35B 5EDXA 4TULL 1Q1JH 2EDLA 4NUGH 5MERA 1HI6B 5DMGC 3KLDA 4NKOB 2BVUA 2EO1A 3ZL4H 3QUMH 3MYJA 4JR9L 3PWJB 5HYJE 1K4CB 2DQGL 2Y7QB 3S5LA 2QQKL 4ZO8A 4Q9QL 4FA8A 5D72L 1EIBA 1UFUA 3VFGL 5J6HA 1HQ4A 4YHIB 3BKJH 3PDOB 2Q6WB 5D1QD 2WK2A 3IJYB 3V4UL 2MCG1 2QSTA 3BFOA 3WLWD 3MX0A 5EO1A 4YGVB 4S1DC 5CZKA 5DRXB 4UDTA 4U6XB 4OT1L 1U3HC 4AG4H 2X10A 4X9FA 1N7ML 1SBSH 3DLQR 1WWCA 1VHPA 2CRZA 3NOIA 1MAKA 3H7LA 4KV5E 4PP2A 5IHUL 1KCRL 2VXUL 1QD0A 2PF6A 3WDHA 3SDDC 3ARBB 2FD6L 5F89A 1UT9A 3PWPA 1JGVH 1JP5A 3TESA 1A1MA 3CMOH 3MRMA 3RIFF 4FQIH 3UJIL 2MQ3A 2ED9A 1QNZH 5GZND 3ES6A 1AO7D 2ZNXA 4WWKD 4MWFB 1FFPA 3WE6A 4PJ7E 3V5KA 3RDTD 1F4WL 3HI1A 4XMPL 1CDUA 2FBJL 1WF5A 3D0LA 4YDJB 5HGAB 4G43A 1YEHL 4DGIL 1ZHKB 3G6JA 2DKSA 3LDBB 4X4XB 5F9WC 1U8KB 3U4BL 2V5RA 2H45A 4F2MB 4CRPA 3FFCB 3KR3H 1DN2A 1LGVA 5BZDA 4PRHA 5JW4N 3D3VE 3BXNB 3K3QA 3G6DL 3QIUB 4PJCA 1D5XB 3MACL 3TN0D 4KRMB 5DJAB 3AC0A 4AIXA 2XZAH 1MQKH 4XVTH 4NQVB 4PJAF 4KVCL 3V6FA 1AH1A 4KMTL 12E8H 3GBML 1EJOL 2C3GA 2AEPL 3VWJB 2XQBL 5ESAB 5HDOA 1I7TA 4PG9B 2BDNH 5EOTA 4YXKH 3DO7A 1CL7H 2NY1C 5B3JE 1QVOB 4I2XA 4C54A 4Q9RH 1G7HA 4I5BA 1JGUH 4Y2DD 4L3CA 3THMH 4RWHA 4J2XA 5L7XL 3ZYJA 4L8BB 1B0GA 4D8PB 5IW6B 2HFFA 1CVRA 1A6WL 4MVBC 1KOAA 2FRGP 3ETBF 5K33A 3TT3H 3IF1B 2Y72A 1FLRH 1QFOA 3IJSB 4PS4L 4ODTH 4TSBL 3C6LB 4OLXL 3TZVD 3B5TA 2V17H 2R2EB 2V7NA 4S10A 5D2NB 1U92B 4FABL 4HKJB 3QQNA 2M1KA 1T4KB 1SY6H 3TJEH 4XGZB 1F11B 4GRLA 2APWA 4ZUWA 2NTSP 2RQ8A 3EOYG 5I1EL 3EGSA 4YFLF 4HT1H 4PJGA 3ZLQC 5C07A 3GZKA 4ODSL 5I76B 5BS0E 4FG6C 5FYLD 4JO3H 3JWDC 4YR6A 3TBYB 1IGCH 2I9LA 1IC5L 4G9FB 3X3FL 4YBLC 1NGYA 1TNNA 2B0SH 2HFTA 5D7JC 3X13A 3PWUB 1LE9B 2J2ZA 3Q6FA 5I71C 3PIQB 3DUUA 3MOAL 3VH8A 5IBUB 1QSFD 5T3ZE 2P5WD 4DUXA 3I9GH 1TJHH 1PLGH 1XT5A 4MA1C 1J8HD 5LG1A 5C0IA 3EBAA 4D0CA 2DYPB 4HGWA 5IROA 4EBQL 2KZ1B 2Q7YB 2DTSA 4EUPH 3BZEB 2Q7NA 5SV3A 3DSNA 5J89A 3IAPA 5F70A 3L1OL 4OF6A 1TVBA 2HH0L 2VXQL 3TFKC 2FIKB 1D5IL 5T1DL 3ILQD 4F9PA 3LB6C 3ESUF 3HNTL 5I18H 1WCQA 4L9LB 2GK0B 3LQAC 3RWJA 5JHDB 4ETYA 3MUJA 5IOPA 2CLRA 2RBLA 5DZOA 1FO0A 3J8F7 1J0IA 1KJ2H 5F1IA 4HGKC 2DIBA 4BFBD 4JREC 4JRYA 1JPFB 3V0WH 2BNRA 1U8JB 2VIRB 1VESA 5BOZG 1NFIB 5INCA 2Z31C 3QH3B 3ZTNL 5BQ7B 3CDGA 1GGIL 4ZOEA 1R5WB 3MRFA 4KKCC 3SGKA 5C0AD 2EIDA 3QQ4B 3WUZA 1PQZB 1MUJB 1QP1A 1KN2L 4MLIA 4KRPB 3AVEA 4IRSB 1A7NH 4G3YL 4OAWB 5GJTH 5HSFA 3OPZL 5E2WL 3EO1A 4OCXH 4DEPB 4XCFH 4LKCA 1KXVC 4L3AA 4PBWD 4EVNA 1FORL 4W6XB 1NEZB 2QHRL 5CEZH 1MH5A 2RJMA 2VXTL 4X7DC 3AM8A 3KXFB 4U1KB 2P7TA 1I3RB 1RK0B 2EDEA 2JKXA 1IC7H 3LAFA 5CZVH 2GJ6A 3KPLA 1IZKA 1U8HB 4JPWH 3VDCA 3UAJC 1F4XL 4MXQC 3OAYH 2D03H 3G5XB 2ZSWB 2VDKH 4OLYH 4AQ1B 1BLNB 2IQ9H 2VAJA 4M8VA 2NNAA 4HKZB 3R8QA 4ZAKA 5AWNL 1GHFL 1MAJA 2R4RH 1GVIA 2PR4H 1EUUA 1A14H 3PXJA 2HLFC 4X98A 1K2DA 3ARBC 3ZHDA 3BEVA 4KI5C 2Z8RA 2RIKA 2CGRL 1IAII 4RQQA 3KYNA 3IDUA 4CMHB 1GGUA 4MJ5B 4EDXB 4KY1H 1J11A 4G80A 1FYHB 3WUWA 5BJTA 1KELH 3EZJB 2W65B 1T7VA 1R3JB 1L0YA 4UT7L 1DVFC 4MA8H 3BT2H 3S35H 3QXAA 3LDBC 5CSZA 1A7RH 5J1AA 4OIIH 5HVFB 4QTHA 1OGTB 3QIUC 1WEJL 1MJJB 5BV7C 5HVGB 1MRFL 1K8DA 4LLYB 4M02A 2F5AH 4NC1E 2HRPH 2GW5A 2K3TA 5A40E 2BOCB 3DGGA 1TTUA 4L8SA 1FYTD 2WWMC 4LSTL 3RWHB 1L6XA 1CXEA 5FIEA 3QUXB 2GSIA 3QNXA 2ZUUA 1X9QA 1RURH 5C3LD 2NX5B 5J13B 1XR8B 4JFYA 5A2JH 1LMKA 3QEQE 3EOAA 1K85A 1JHLL 2WP3O 4LOUD 1HEZB 1RZJH 2W59A 2DQDH 5FCUL 4KFZC 1ZVHA 5D2NC 1MCJA 5EZIL 2DQHH 1A6PA 4G42A 3NGBB 3VXOB 1JWUB 3VXTB 4OD1H 3MNWB 1D9KA 2X42A 1FO0L 4Y4FD 4LPWA 4KTYA 5EZJB 4U1MB 5D7KD 1RQ5A 3VG9B 4FFWD 5DFVD 5IW1B 3WN5B 4AZ8A 5HDBE 1TVHB 5M7QA 1J1OL 3ARTA 1P84J 3CC5A 1QBBA 4C4KO 1BBJA 3REWA 2RGSA 3HUJB 4ZQKB 1HQRA 2YRZA 3SKOB 1Q9KB 3NMEA 3OKYA 3ZKMD 5D1ZC 1J87A 1KBGL 4KTEH 5FYKH 4OSUH 1VEPA 4Y5VB 1S7XB 5C8JA 2GUOB 4FRWA 1I8KA 3MRIA 4JY6A 1H3XA 3EFFA 4Q6YA 4JFDB 5DI8A 1JGEB 1KV3A 5GRZA 3L6FB 1NGQH 1JPST 3WFBL 3QHFL 5BMFH 3B9KD 5DVOA 1R3HB 1C5BH 1OSPH 1MCOH 4EIZC 3MFFA 4EI5D 1MWAA 3X3GL 1YDPA 4JHZA 5AG9A 1HIMH 5DQ9B 3O6ML 4PJ7A 1ZHBB 3MGAA 4K2UH 5JQ6L 4MHHG 5LJYH 4L9LC 3BDBA 1FAIL 5IK3A 4N0UE 1FLTX 4XAKD 2DQTL 2H9GB 4G8IA 1G84A 3C60A 2Y4SA 4LASL 1P53A 3RUGB 2ESVA 1J5OH 3NFNA 2OR8A 1YEIL 4XBPA 3FMGH 3D39A 3MRHA 5C0JA 4NQVA 1ES0A 3N9GL 4GBXD 1PG7L 1M7DA 5A16B 4I48B 3HI6H 3LKPA 3SKJL 1BOGB 1CZ8L 4IRSC 1I1AB 5F7MC 5DFTA 3NCYP 3ISWA 5FKPA 1JYNA 4H20H 4Q0XL 1G7QB 2PYEE 3ARUA 3MLXL 2XG4A 3BW9B 2DN7A 1HH6B 2ICWB 1NUGA 1WGOA 1TVDA 1Q38A 3BIAX 3P2TA 4U1LB 4PLJC 3QULA 5D7LE 3MZTA 1PAMA 3ULVE 3RAJH 2AJYL 1XGUA 3WXWH 2ZG2A 3DV4B 1T4KA 3QZWA 2Y07H 3UTZB 4HUUB 1YN6A 4OGXH 5T1LD 4ELKA 1QFWM 4S1RH 5F1NB 1P6AB 1XEDA 2VLJA 3GSNL 4QF1B 4JAMB 4X7FC 1S9KC 2X9YA 4QRPA 1TZHA 3MRCB 4LSQH 5LXGH 4YBQC 3QRGH 1QRNA 4FTVE 3MNZB 5KSAB 4IHOB 4CMHC 5BS0A 3IU3B 3KNBA 3SE9L 5B39A 3KPRE 1ZEAH 3BOVA 4RGNB 4OLUL 3OXRA 4PGEB 5C0NC 3ARZA 1NCDL 2V2TA 4S0SD 5TE7H 4KAQH 4WNQB 1NBVH 1UKQA 4MJ6A 5JW3L 5CJXA 1A3QA 4OGAD 1MHEA 1UXWB 2A6KA 4LVOB 3N1PC 1H8SA 5J9PA 1SHMA 4AYFA 2CLVB 2MNUA 3MBEA 5JOFA 5IB3A 1I85A 2NY4B 3C2AL 3DVFA 1JPSH 1RZ7H 4U1JB 1C8PA 4ODXA 5DEZA 4X6CE 5F93C 4U6TA 4DN3H 4CVXB 1CU4L 5AYUL 2GTWA 4AT6B 4PLNC 5DK2B 4YUEH 5B3NA 4GAGH 2R0WL 3E1F1 2OSLB 5T1KD 3VXUE 4YHKL 1JYWA 1XIWD 1DFBL 3SGDI 4PJCF 1JYXA 2YWZA 3JV4A 1QFUL 1MJ8H 4JZJB 1KLUB 5I8KH 3DOSA 2F8OA 2LQRA 1T20A 2HKFH 3PABA 4KKLC 1MCFA 4LCIH 3F7VA 3I6KB 2VISA 1KPVB 2DWEB 3KPOA 1C16B 5DK0B 5D5ME 3OKEA 1N2RA 4Z76A 2YPVH 1MWAL 1FL5B 1NMAL 3MJ9L 4Z7VF 5HHMD 3NFSL 2E27H 1VEMA 1QPXA 2FR4B 3OKOA 3JXAA 4AMKL 2J1KA 3MJ8A 3SY0B 2DIAA 3O3BA 4UB0L 4JKPH 4PRBB 2Y36H 4OV5A 1BZ9A 3NGBC 2UWEF 1X5LA 4GKZB 3BKML 4OZHB 4HK0B 3HZVB 3V52L 2LFGA 1FNHA 2P4AB 3LH2L 1P9MC 3UJJL 5SWQA 4DOHB 5AZ2L 5CUSL 5GGRA 5C70A 4NZDA 3IXTA 4J12A 4FQ2L 3MV8A 1S7WA 2Q86B 5IP4A 2GITB 3BO8B 3JWOC 4X7TB 2BFVL 2FJFB 1FDLH 1BJMA 2NY0B 5DQJB 1C08B 4PJGF 4OCRH 4AL8L 4IOIA 4X99A 4LVNB 4Y1AB 4Q97A 4Y5VC 3B5GA 3MLZH 4U3CA 5D1XB 3UPCA 2QADD 4JFOA 1E4JA 3IKCB 4PGZA 5J7CC 2V5MA 4ZUVA 4YHOL 4LPXA 4MB5A 4X8XA 1AIFB 3DRTB 5DD6A 2NZIA 2DDQH 3W9DA 3VXRD 1C7SA 1CD1A 5TE4L 4AEEA 4RAUA 1HHGA 5KW9H 5D6DA 5MP6L 5GRJH 3ULUL 1MHHB 1J86A 5I8EB 4PG2A 1YMHA 3H3PL 2JB5L 1BVLB 2Z4QA 1AQKL 2RCSH 4MJ2A 4PRAA 4AENB 4P46B 4WENB 1RZKH 2OMNA 4NQXB 4P99A 4D9QD 3B43A 5CJQL 4FFVC 5FAAA 1BWMA 1G6RH 1EEZB 4ZNEE 4H26A 3RGVB 4JY5H 4K8RD 1FIGH 3NVQA 2NMSA 3I6LD 2DBJA 3SBWA 5IBLC 2EKJA 3QUYA 3MCKB 1JWSB 5C0RL 2COQA 1MJUL 3DJ9A 1OF2A 2Z8WC 4CBPA 3VA2C 2D7OA 2AI0H 2X70B 3LRGA 1MEXL 2DS4A 1U8NB 3VCLA 1NL0L 4XCNA 4GXVH 1JNHA 4W4OC 3JTTB 5ESQB 3WIIH 4GG6F 4GSDH 4D3CL 3IFNL 4I3RH 4Y4HB 2BNQA 5FDWB 3WCYA 2YHGA 3QEQA 3TBSB 2E6JA 5DJ0A 3ARFA 1LNUA 5D1QB 1MREH 4XPGH 1UM6H 2GHWB 1TQBC 1UENA 4LCCA 3AS3A 3HAEG 5FGBC 3GIZL 3TYGH 3F58L 4O2EA 4ERSH 1MIMH 3H7BB 4NO5A 4TRPH 4LHUB 5E8OA 3BAEH 2YS4A 5HVHC 4QCIB 1NC4D 1UJ3B 4N8PA 3ALXA 1PZ5B 2OJEB 2VLRD 4WCYL 3KS0J 4YDIH 2FX9H