4KKCD

Structure of the e148a mutant of clc-ec1 deltanc construct in 20mm bromide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title Fluoride-dependent interruption of the transport cycle of a CLC Cl(-)/H(+) antiporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 46
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkcD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkcD01
2DQEL 1R3LB 4L9LA 2VN4A 4UNVA 3WNLA 3HHRB 2G60L 1LEIA 4AG4H 4TVPD 3WL9B 2P1YA 4BH8A 1NC4B 4Y4KC 2GI7A 5F71A 3O3BB 2VNCA 5F9OH 2LAAA 5L9DH 4XCEB 1E4XL 1I4FA 1PLGL 2EDQA 5LGHL 3FQRB 5HHVL 3ORJA 2Q8BH 5IKCB 1P7KA 2BZDA 2MPAL 1YEDB 3W11D 1K2DA 4Z7OF 5T5NF 4L4TB 2ICWJ 3QXDB 5E4EB 1JMZA 2EEBA 4XCYA 1IGFL 5JXAH 4HJ0D 5DF0A 1HQRB 5JW4N 5HYEA 4L8CA 1OF2B 2AQ2A 2EE6A 3KPMA 4JHAL 32C2A 1Q72H 1U0QA 3NVQA 4QEGA 3ZSTA 3WNOA 4YEEA 1AGFA 1YY9D 2QTEA 2Q87A 1F5WA 2YC1A 3UJJL 3F7RA 5HJ3B 2JTDA 2N56A 4PY8J 3LD8B 4P48A 2NXYB 1MHHA 4TOYH 5DR5L 3HPLB 1FCCA 4Y4HC 5KS9F 3DVFA 3K8KA 3PWNB 1X5JA 3QCUH 4I0PB 1RUPL 2X9WA 1OAYL 4G7VL 1LDPL 1MFAH 1AJ7L 1MFBH 1Z3GH 2IPKB 4UTAL 4ZMAT 1X5AA 5GS0D 4XRCB 1NGQL 5FYJE 1SMOA 4MA3A 5FKPA 3BDBA 3V6ZA 4HLZG 3RP1A 3LS5L 3KYOA 1HOCB 3MRHB 4JFFD 2ADGB 4M6NH 5C0DB 2ATKA 2V2WA 4HXAH 5BQ7A 4FXLA 4M93B 2XWTB 5CILH 5CGMA 3QQ4B 2DLIA 3L3KA 3SPVA 5IR1A 1LVEA 3OPZH 2V2XB 2YRPA 4YHIA 2JB6A 1DLFL 5JR1L 4E41A 3UTTD 1HKLL 1XR8A 2NZ9C 2BVTA 4B50A 3OAYH 5E5MB 3T4YA 3ARPA 3FQWA 3EDFA 2D7OA 3KS0H 1IL1B 2UY6A 2GTZB 4HIXH 3T77A 1MFEL 1XGRB 4GJTB 4OD1H 3V6FB 1T89C 3TEUA 3MODL 1RUAL 4PJHF 1EZVX 4YDVB 5D5ME 1Y0LB 1CLZH 5DMJB 1OLLA 1QA9B 4Z8FH 2A0LC 3UTTA 1I1FB 1KJ3H 1QRNE 1MELA 1UZ8A 3P4NB 2J8HA 1RAMA 1IFHL 2F74B 2HT3D 3DI3B 5IFAH 3CH8A 1S7XB 4X5WB 4F7TA 2UWEF 4U1KB 4R4BA 4WUKL 3LB6C 3ZHDA 1S7TA 3I6GA 4CL7A 3QQNA 1L0QA 3MROB 3GSVB 1ZEAL 5JIKA 4QXWA 5EN2A 4HV8A 2Z31C 1IGCH 2Y4SA 4PJ7E 5K9OB 1CGTA 3S5LG 1IAIH 1P2CA 3LKRA 4JGJA 1K6QL 3KPPA 4LKCA 1XH3B 2FLRT 2VR4A 3ZT5A 4S2SA 5HBBA 2I07B 1UWEH 4UT6L 1J8HD 1SYSB 1X44A 4PGEB 5C0CB 3EYOA 5ANMA 3U4EA 5KG9A 4I3RL 1KIRA 5EO9A 1F02I 4NZTH 2DDQH 4Y16B 1T03H 3ARFB 4NQED 2ZSVA 3GHEH 1N5YH 3IETB 5A2LH 1KJ2H 4H26B 5KSVA 3L3HB 2XFXB 4X7EC 1B0WA 1SVCP 3ARQA 5HYSG 4W4OC 5FGBA 1S9VA 5D1XC 1B4RA 3HC4H 3PE9A 3DURB 1P53A 3E1F1 3WXWH 3FO9B 4WWID 4N90E 5ALBH 4NQEA 1F11A 2GSIB 4M5ZH 1RZ7H 4MXWH 4KMTH 1XR9B 2IH3B 3DTXA 1R3HA 4BKLB 1ZT1A 3E8UL 5I2IB 2YOCA 1HQ4B 1RUKH 5IF0B 5MEQA 2DQTL 1SMAA 3IFPA 1ZHNA 1P4LA 4PYGA 1VFMA 1YNLL 3VFUB 5BOZG 4Z76B 1PX3A 5JHDB 4E42B 3G6JB 3PDOB 1MNUH 5IUSA 1U8JA 3GSXA 3QP3A 1KB5L 5E8NA 4NNXB 3QXTA 4XPAH 4UV7L 1CL7L 1NGWB 5F97E 1U8QB 5DLML 1MF2H 4Y2DC 3GMLB 1K8IA 3UMTA 5FO9B 1TCMA 2NW3A 4NQVA 3FT3A 5HI5C 3NPSC 1A2YB 1S9WA 1PEZA 4PJ8D 3AAZB 4APQC 2E27H 1BQUA 2BVOB 2GUOA 5B3JE 3EJYC 1JF1B 1CXFA 3DETD 5MENE 2HLFC 3GO1H 4HCRL 3UTPE 5IT2L 4NCC1 1X6NA 2DTMH 1IAIM 1I3GH 1N7MH 1RU9H 3LSOA 3FQTB 2R39A 4TSAL 2XACC 3WBDA 2VN7A 2DB8A 5MERB 4PJ8A 5LQBH 3X11B 3QUYB 5K9KA 2HKFL 2NY4B 4PJFE 1P84K 5AZEH 2JKXA 4G7YH 8CGTA 5T33L 3BH9A 4LHUD 3MRKA 2R23B 5C3LD 3MRCB 3MRDA 3UPCA 3KYNB 5JUEH 4TYUA 3BDXA 1H5BA 1FNSL 2W9DL 3HZYB 5EU4A 2CKBH 3RGVB 2VISA 3GJFB 4X7SL 3P40A 2J6EA 3RWGA 4MCYB 4RISH 3WD5H 5DRXA 1QBML 4GW1B 4JKPL 1YMHA 3AS3A 4O51A 3S35H 4YZFE 4ELKA 2F8XC 5ENWB 3B83A 3S9DB 3QNYA 4NO5A 4PY8I 3A6OA 3FQXB 4M7LL 3QFJE 5I8EB 1J1OL 1TVBB 4LHUA 4QHUB 5E2JA 4JDZA 4CDGC 1IBGL 1YEEL 2VWEC 3AM8C 3T65B 2X10A 3BXNA 5DA4A 5CHNA 3V7AG 4RMWA 1C5CL 3MUGB 3ZKMD 3O4LB 3BE1L 1BFVL 1AKJB 1P6FA 2XN9B 4PG9A 5FYJD 3QXAA 1KSRA 1N59B 1M71A 2CJUL 3V5HB 3IDYB 4LFHG 1PZUB 2BNRB 4UQ2B 2DKSA 2IC2A 5A40E 4NZRH 4GT7A 5CEYB 4JGMA 5HYJE 2QL1A 4XAWL 2P5WD 4X6FA 4GG6F 1JHTB 2FATL 4LCCA 4N9GB 1KTDA 3T0ED 4L3CB 1T66C 1QFPA 1IC5H 2IANB 2YXFA 3ARVA 4BJLA 3HTLX 1TCRB 3Q3GA 1HDMB 1TVHB 1NQBA 1O7VA 3P3YA 3LHPH 3FRUA 5EO1B 2IGFH 1NMAL 1RJLA 1UFUA 4XVSL 3DBXB 3MOAL 2W65A 3OX8A 4KI5D 3TESA 5JW5B 2Z92B 1QRND 3MRJB 5CKGA 3QDGE 5M95B 2AK1H 4EEEA 5K9JL 1BAFH 4JDTL 5D5MA 2JJTC 1OTUC 1MPAH 5MP6H 4KZEL 1I1YB 3SKNA 5D7IB 4Z9KB 3ILQC 2XXCB 3A67H 5HI4C 4YHYB 4CVZA 1QRNA 4K23H 1KFAH 5DFVC 4GW5B 3NFSH 1T22A 4MXQD 3IAPA 5HPMA 3VMPA 4NN5C 3O6FB 4PGBB 3RTQC 3TC9A 3P73A 1HKFA 3K2UH 3RY6C 4OLYL 1JGDA 2VZOA 3GIZL 2X4NA 1HYSC 3V5KB 4FQQB 4JM2D 5IB5B 2R56H 4UIMB 1VPOH 5TQ0H 3X3GH 1MOEA 2HVKA 3NCJH 2DD8L 5F1NB 3B8SA 3LQAL 3SKJL 4PJ7A 4YPGB 1AD9B 3QIBD 2UVEA 1Q0YL 2VXSH 3QUMA 5IQ9B 5GHWL 4QRPB 3LRGA 3UROR 3E6FB 4OF3A 6FABL 4JM2A 4YH6A 3N0PB 3JTSA 5L0QB 5ITFA 3S4SA 1T6WA 4POUB 5IESH 5DD5L 3M8OH 1NCCH 5IFHH 4N90D 5LCVL 1KLGB 3GJEA 4JHZA 4UI2A 1ZSDB 1OPGH 3CPLA 2OQJA 3O8XD 5JDSA 3S35X 4R3SA 3RVUC 1YQ2A 4KPHH 3G04B 4Y4FC 2VXQH 3DYOA 2I5YH 1KUMA 2FJHB 3MCLL 3OG6B 1KLUB 3UTSB 1EERB 3OXSA 4S1DD 3QUZB 3GI9L 4ZFZA 4QY8A 4Y5XC 3D9AL 1HILB 3F5WA 3O8XA 3RA7L 3IXTB 3EJZC 1H3TA 3C8KA 3CVIH 3KWWB 2BSSB 4HK0A 5GZND 3RL1A 1B4JL 4O2CA 3TBYB 2ENSA 2HFEB 4R4FL 2MQ3A 1DQQB 3P77B 1BZ7A 4MSWB 3KLHC 2BFVH 3LN9A 1S5HA 2R0LL 4F15C 1OQXA 3WO4C 2X7LB 4ZPVA 5D7LB 5TF1L 5MEND 2X1WL 2NY0D 5IVZA 1ZLVK 1UB6B 2YPVH 5DEFB 4XBGB 3V7AE 2BNUB 3MSPA 2BOCB 4PV9A 5HHPA 5C07B 1QO3A 2X44D 4EQ3A 2B4CL 3VJ6B 4LSUH 5DSCA 2CMRH 1CGWA 2CSPA 3BP5A 3PXJA 2A1WH 1OOAA 5CP7B 3QDHA 3B9KA 5GRZA 5L6YH 5M94B 5MENA 4P2QB 1IC7L 2ITDB 3QEQE 4JPKH 1X7QB 3BN9C 1G7MA 3DRTB 4P5MA 4HAFA 3TBTA 4OUOA 3O9WC 1IGTB 1A22B 5GGTL 1ETZB 5JW4Q 4HKBA 1MQKH 1KYOJ 2VC2L 4JANB 3UC0L 5IP4A 1Q9OB 5I1IL 1CF8H 2FYYA 5A2JH 3HNSH 4P2RE 4PJFA 3ARBB 3L5XL 4OJFH 3RHWF 4UAOC 5GGVL 3BH8B 4BA8A 5E08L 3DROB 3QFJD 1DFBL 4GSDH 4UUJB 2M1KA 3O2WH 5I9QC 1D9KB 1R3KA 1OAKL 1QUNA 3CVHB 4UOW1 2VAJA 4P46A 3QIWD 5L7XH 3ZO0A 4GG8B 3T3MF 5ADPL 4LGPB 3VFNB 1XIWB 3QFJA 2CDFA 2OS7A 4ZUVA 2J12B 2BNQD 2IF7A 2Y72A 1ZVYA 4PFEA 1DQLL 3EDEA 3K4AA 5F3HB 5HYJD 4HUWB 3U6RB 1BEYH 1Q9WB 1T04A 4P59H 1EEYB 5C6TH 3BZEA 1TZGH 2DM3A 3C2SA 1E4WL 3EOTH 3QIWA 4M61A 4MNGB 2A73B 5C6WH 4S0TD 4DZ8A 4JY5L 1UQSA 2FBJL 43C9A 4BFGA 3GSWA 4XNZC 1FN4B 4QHLA 1P1ZA 4G8IA 4NPYA 4M7JH 1M7DA 1SM3H 4J2XA 5HYJA 1F42A 4JG1H 5D8JH 4S10A 2DYPB 4U7SA 3SY0B 4H8WL 5DMIL 2EYSB 3BEVA 4QNPF 5JPNB 1RULH 4PRHE 2YKLH 3AB0C 3T0WA 5F3BA 5IBUG 1V7NH 4HJJL 2H32A 2NY7H 3MCKB 2O5ZL 3HMWL 3VXUB 1XGTA 3MOBH 5HGDB 3CFEA 2GT9B 3UBXB 1YEKL 4Y8DC 4PJIE 4D94A 2XWJB 5D2LB 4JE4B 2CH8A 4M7ZB 2VDOL 4FG6C 5EG6C 3MBED 5FYKU 4YHNB 3G6AB 1FVEA 4OSUH 1BVZA 2E8YA 2R9HD 3V8OA 3KNBA 4I3SL 3MV8B 2GQHA 5MEPA 2VMFA 3VRIA 3GI8H 4YO0B 1CYGA 1U2CA 2WLZA 5T3ZL 3MBXL 5J13B 3MBEA 5HYSA 4LSPH 4LARL 3RBSA 3MRMA 3NABH 1AHWC 4OV5A 4E0RB 1P7QB 4YXKL 4AIOA 1T1WB 1I75A 2AJZA 4DGVH 1AXSB 1ZV5A 3BHBA 1PG7X 1XF1A 2PCPB 3DLQR 2H2PD 1CFQB 4LLYA 4GBXB 5IM7B 1DBJH 3MJ6A 4Y4HD 1AFVL 2HFFB 4LKXA 4HEME 5D96B 5DD3H 1MCKA 3CU7A 3P2TA 5F88A 3NZHH 4AH2A 3K1KC 3OGCB 3DUSB 4KQ4H 4NO2B 1J5OH 4OM0L 4PJGE 2I9LA 3U36B 3WFHB 4JY4B 3L5JA 3BSZH 1JGVL 1D5MA 4Z78B 3ARTA 4HAGA 4NKIL 1JPTL 4Y4HA 5JW4R 3U0PA 1NFDA 3MNWA 2QSCH 3TZVC 1YYLH 3RPIB 2G75A 1I7RB 3PHOA 5CLTA 1G7JA 3CX5J 4Z6AT 5HY9B 4MAUL 4IMLA 1DQMH 2OTWA 5FEBA 1RY7B 1J05B 1KC5H 3A6BH 1NPUA 1JPSH 3OR7B 4U1LA 1C8PA 3IJHB 2YEZA 1VA9A 5FOBB 2CK2A 4U2ZA 4P23C 3BKYH 4EN3D 4H88L 3QHFL 2NZ9D 4P0DA 4Y5YB 4Y88A 1U91A 1KB9J 1T0NB 1C5DB 1S78D 2OM5A 4Q0XH 4GRLC 4MWFA 4YHKL 3QDJE 3PL6D 3QULA 4MA7L 4UOJA 4A2LA 2IBZX 1KF9B 3OXRA 5DK2B 4GLRH 3WN5B 1G9EA 4EN3A 3ETBF 4LLDA 4Z7WE 4OGYH 1MHPL 1OGTA 1ADQH 3NCYS 1WEJL 1SYVB 4CN1A 1Z0MA 2W0FB 4KJYB 1QRKA 3VRJB 3MRBB 4LP4A 3PL6A 5HHNB 5IVXF 1GIGH 2DM7A 1TPXC 1T89A 2CIIA 5SV3A 3SGDH 4KHTL 1T5WB 2O61A 3QAZC 1FZOB 4YC2C 4P5TB 5FO8A 3OJDA 2NTFA 2NXZD 2DAVA 4R26L 3DV6A 2VQTA 3IKKA 5E5UB 5B4MC 1XZ0A 1I1RA 1X4ZA 4LFHD 4I77H 4HUVB 3QEQD 3PV7A 2DQHL 4YR6A 4EIGB 4ZNEE 1A3RH 4D9RE 1J0IA 5IMLA 4X9IA 3RWFB 3D2UB 3Q0HA 5I15L 1A9BA 5EO0A 1X5FA 4H25A 2MCPL 4ODXA 3C6SA 5L2JA 4P2RD 3U48A 2Z31A 5ESVA 2IPUG 4PJCB 3CVHL 4DZBB 3QEQA 2A74A 3WFDL 4AEHL 5DVLA 2ARJA 3HG1E 3FO2B 3X14B 1F97A 1QEWB 4YUEH 2P8LA 4J1UA 4ZYKA 3FN3A 3PNWA 5TDPB 5I66A 5IFJB 4MA8L 3RHWK 5BW7A 4P2RA 3S6CA 2AABL 5C0IB 1JMXA 4LLQA 2X09A 4N8CL 1MAMH 4RA3A 1LNUA 2JCCB 4XVJL 5FM8A 4RMUA 1YA5A 4ZFFB 1NBZB 5D7KE 3MLRH 2V5RA 3CZFA 1RZJL 1IKFL 3HRPA 5ALCL 1RUQL 3KPLB 3CXHJ 4OTXL 3IXAB 4UT7L 5D1XA 4D3CL 4NN6C 5ESQA 2FR4A 3ZDYE 2QADC 4JEGB 5EC1B 3W9EA 5GRUL 4ZUUA 1W0VA 4DUVA 1INEL 1CDJA 5D2NA 1U8IB 2AJUH 3O41A 3VFVB 1KJ2A 4FHBD 4I48B 4W6YB 4LLVA 3L3GB 4ZUWA 5ADOH 1PSKH 3WHXA 3PJSA 2CLZA 1C5BL 5F7HA 2DOCA 4PRHD 5BV7B 5HI5D 4D0BB 2VZUA 1RZKL 1TJHL 2PR4L 1RZ8A 5IB1B 3PDDA 3LN4A 3UAJD 4NM4H 3QEHA 3EJYD 1HWHB 3RVTD 3BYTA 1K3IA 4MAYC 2EC9T 3FN9A 2ZUXA 3FFCB 1TTFA 5EDXA 1HZHH 1MCDA 1GGCL 5FGSA 1NCWH 4RBPK 4YX2L 1FAIH 2WIIB 4PRHA 4Z5RA 3FTGB 5EBWB 5IK3A 1INQA 5I1EL 5IIEA 5FA4B 2P44B 3EIFA 3BMVA 3O2VL 4LIQL 2MCG1 3MUHL 1OSZA 3NA9L 5GJSH 3L3OA 3P4MB 1EK3A 4PJIA 1I9RL 3Q6FA 1VEMA 3O4OC 1AO7E 2CGRL 2GJ6B 3CSYB 5SWSE 4R90H 4G8EA 4FQ1H 4BFEA 1A3LL 1AQKH 3G5VB 2AJ3A 2QLVB 4L4VB 2HN7A 3O3AA 3RU8L 2R8SH 3U1SH 2YSSA 3F7QA 4U3XA 1RHHB 1A7OH 4CVXA 3HAEB 1WTGT 1UEYA 4RQQB 2N7AA 3DX9A 1C12A 3DI2B 1TZIB 5SWZB 4AEEA 4XT1C 3H9HB 1MJ8L 1RJYB 4OD2A 3W39A 1GVIA 1KN4H 1RZIB 5HI3C 5CIPH 2WP3T 3PWLB 1C16B 1CL7I 4WW2C 5T1LB 3SBWA 3REVB 5DDHA 1RV6X 4NIKB 3AM8A 4XNQA 3ZDZF 1IM9B 1TJGL 4LRNH 1FFOA 1XGPB 4PJGA 1F4WH 3KPOA 5E6IB 5INDB 1I1AB 2CKBA 1AGEB 2AI0H 2PO6B 1ZT4B 4XH2B 4WI8A 3U30B 3GSRB 2VZTA 4HPOL 3H6JA 4XHJD 1KGCE 2WSKA 1XAUA 4ONGL 1H9VA 5TF0A 4NNYA 5C09E 1DQDH 4L5FH 4WFEE 3VG9B 4LPVA 2HFGH 1L9MA 2AXJA 1N3NB 3VXNA 2ZUQB 1NFIA 2ZUUA 4GRMA 1U8NA 1LO3H 2BVUA 5D1QD 5HHXL 2OSLB 1NAMH 3UP1A 5E2WH 5HHOE 1CK0H 1UM6L 2Q3AA 1MAJA 1OWRM 3U9PH 2E7LA 3QDJA 1AGBA 4OZIF 1CFVH 3FB5A 3GSUB 4KTYA 4C83B 5LGJA 4LF3B 5BS0E 4PJEF 4LQ1A 2ZKHL 3WLBB 4QXUL 4KRMB 4FXKB 5T1MA 5D1QA 4Z7WA 1Q9LA 3DGGA 2JIXA 2E7CA 3GNML 4Y89A 5I71C 5JORB 3SE9L 3QZWG 2VXVH 4J4PC 1DVFB 1CDYA 1IRAY 4QWWC 5E1AA 5DK0A 4WI3A 5A1AA 5DZLA 5IJKC 3TA3B 1JL8A 3FL7A 4G8FA 4D9RD 4MDJA 3HE6D 3SCMB 3IDXL 2JJTA 4WFGE 4NUGH 1NANI 1MRDH 3ESUF 3QQ3B 1ITCA 1JN6B 4PGDA 2PXYD 1QSEE 1S7QB 4KJQC 4L4JA 3NMEA 1VKXB 3TN0B 3RWDB 4U6HA 5CINL 4XP5H 3ZYIA 4AEIH 3BGMB 4FQPA 5KJRH 3VFRA 4X98A 2ZCKH 2F5BL 3HG1D 4GW4A 2B2XH 3MCG1 5E8PA 1UM4L 4U6XA 4ZNEA 3RY6A 3IDNB 3DX7B 5DUPL 4AMKL 3QH3B 2OZ4H 4QLRA 2GTWA 1S7VB 3NCMA 4NKDB 1EMTH 5HPOA 3U46A 7CGTA 2DBLL 3MV7E 4ERSH 3QWRA 3OKNB 1A6AB 3IJSA 3ZE2F 1ZAGA 1ZVSA 2FEDD 3HG1A 5AWNH 4ELMF 5D7KD 1MVFA 1CS6A 1T1ZB 3IDMA 1IQWH 1UM5H 3G5XB 5E9DD 4Y4FD 2Y06L 1TDQA 2R4RL 3PGDA 4ORGB 1ZE3C 2HRPL 2DQGH 5DJDB 1WT5A 3R0MA 5FGCE 1U8KA 2ZUWA 3V0WL 5I17A 5ILTL 4YDKH 2AEIT 1RUMH 5JLZA 5KSBF 3N1QC 5FO7B 3DIFB 4ODWB 5KN5B 3KXFB 3WV0A 1S8DA 3RUGF 4Y4FA 4M6ML 4L9LB 3TNNB 5EH1A 5I8CA 3LKQA 1LEIB 2Q7NA 2CUMA 1I8LA 2H26A 4TSBH 4W6XB 5C8JA 4GRWF 4J3VA 4KUCD 1FH5L 4G3YH 4ACPA 3BPLC 2R4SL 1A7PH 3EOYG 3RNQA 3DO7A 4Y5XA 3ZTNL 4TULH 3HC3H 1HHGA 1I4FB 2P47B 2XQBL 4ZODA 4AL8L 1KCUL 1K2DB 1GHFH 2GFBB 2P24A 3KJ6H 3SJVE 4NQSB 4LU5H 1CLYL 4FZ8L 5EFIA 2P8MA 3CLEH 4NRZB 4XCYB 4OGXL 2RJMA 2R2HA 2ICES 3MJ9H 4L8CB 1CU4L 3PUCA 3NFNA 4PJBF 1MFDL 3KPMB 5F1SA 32C2B 4S1SH 3RVVC 5KVFL 4NJ9L 1JI2A 1AGFB 1CLOH 3MGTA 3CFBA 3T2NL 2Y36H 5KTEL 3DUUA 2YC1B 4KQ3H 4NKOA 1MFCL 3H7BA 3ILPA 5F89A 2AVGA 3BGFB 4HFUL 1UC6A 1AO7D 1IVLA 5D93C 3C60C 4KWUA 3CMOL 5SWSD 3X12A 5J9PA 3F8UB 2HVJA 1QFWI 1Y18A 3QUXC 2CO7B 4I9WE 1F3JA 4A6YH 4M5YL 4MA3B 1WFTA 4FQCH 5FKPB 2BCKA 4G9FD 4OKVA 4HF5L 3MXVH 4M4PA 1AO7A 4JLRA 3KYOB 2XG4A 4GAJH 4O02H 5SWSA 4FXGA 1CDUA 3R06A 2R1YA 2ATKB 2V2WB 4ZUTA 1TTGA 3NCYP 5HGAB 5T5NG 4F8QA 4UBDD 3L3KB 1G7PA 5DJYA 4HH9A 5BMFL 5EZOL 1S7WB 4LPTA 3VD3A 3SGKA 4YHIB 2JB6B 3I6KA 5I74B 3CH1A 4E41B 2V9RA 2B1AH 1XR8B 3ZKND 3ZDXE 2XPGA 3T4YB 3D3VE 1ZLVH 3FQWB 4UQ3A 3O0RH 5DJ8B 2I9TA 4GKSA 4BSVA 3T77B 3DO3A 3MGOA 5HHME 3HRZA 3HI1A 3CC5A 4H20L 3LQAC 2FX7L 1ACYH 1JRHL 5DQJB 4UOW0 1OARL 2CRMA 4TNVK 4U6YA 3GHBL 1KGCD 3ZSSA 1ZLSL 1A4KA 5C09D 4WFED 5SX5K 3GEWB 5AYQA 2HG5A 1BFOA 1UZ8B 5T1DH 4L8SB 4NO3A 5CGYD 1KYOK 1HI6B 5EC2A 2NY2C 4M62L 3KGRA 2XY2A 4GMSL 5D71L 2WQ8A 5HHOD 1S7TB 3MLUL 3I6GB 4PB0L 5IHLB 3F65A 4K7PL 3BWUC 1WSST 3TT3H 5C09A 2P49B 5CUSL 2VJXA 4OLZL 4P2OD 5EN2B 3RL2B 4HV8B 3WMSA 1SVZA 4ZXBC 1N5AA 5A16A 4FG6D 1R5WA 3NPZB 4JRYE 3LKRB 1X5HA 1MHEA 4IDJL 4ZOEA 4LKCB 4LSSL 5HHOA 3LAFA 4DN3L 3QHZH 5KOVC 4JVWA 5C71A 5EOCL 5GS1C 3PWJA 4P2OA 5A3IC 3EYOB 2GIYA 5ANMB 1VEOA 5KG9B 1SY6L 3TYGH 4PPTA 1KIRB 5EO9B 2WP3O 3QDME 4P9HH 4WFGD 2ZSVB 2PYFA 1SEQL 1BQHG 1UA6L 1G9ML 1QSED 3L6FA 5KSVB 5D72H 3O2DL 3GB7B 3BZ4A 5DRNB 2F8VA 1F6LL 3CK0H 4LASH 2HLAA 5GGQH 2EDHA 5C0EA 2FJFB 3MNVA 4NQEB 1F11B 2KUTA 4W81A 3VFOA 1QSEA 5C0RH 1R3HB 1ZT1B 2FGZA 3B2VH 4R7NA 1T7WA 1K85A 2WUCL 3MV7D 3VCLA 4I4WA 5MEQB 3IFPB 4IOIB 1D5IH 1ZHNB 2EKJA 3UCRA 5ISZD 3HI5L 3RGVC 1P4LB 3S36H 2OI9B 1WZ1L 1N8ZB 1NFKA 5C7XH 1NGXA 3AXLA 3JWOH 1LP9F 1AC0A 1QFWM 4M48H 3BKMH 3RWJB 5TH2A 1P4BH 5F6IB 3T0BA 2ESVE 5E8NB 2E6QA 5JQ6L 1AXTL 1M05A 1QBBA 3MV7A 3MV9E 4J3UA 3TJHD 1IKNC 3EDDA 4ENEC 4KK6D 2DLEA 3H3PL 4G8GE 3LEXA 1MCWM 4G6FD 3TT1L 3BX7C 3H42H 1K8IB 1JZ7A 1WWCA 2NW3B 4NQVB 3TZVA 3FT3B 3ZYJA 4EUPH 4R4NC 1S9WB 1ZVHA 2H2SD 2EXWC 2H9GA 2GUOB 1I7ZA 3CNKA 3ECBA 4O58L 4TVPL 1CD1A 3X13B 1OWWA 5CJQL 3SDXB 4D9LL 3FO0H 4PJ8B 1KEML 1NLDH 5KVMC 2GEEA 4ZFOA 3OKKB 3SDCD 4L3AA 3MLXH 1R24A 2K3TA 5C0FA 4XWGL 4J3WA 3MRKB 4JJHA 2DQCL 2FECL 5F7LB 4Z7OE 1H5BB 3QO0B 5EU4B 2Z4QA 3REWA 1NCBL 2VISB 1W72H 1S3KH 3SJVA 3U9UA 3RWGB 3KJ4B 4O51B 1YMHB 1M4KA 1MCBA 3CX5K 3QNYB 4NO5B 3VD9A 4JDZB 4CMMA 4HQQH 1KT2B 3U0WL 3BXNB 4ZOCA 4P99A 5CHNB 3S37L 4UT9L 1YEFH 5MHSD 4JO3L 1ADQA 4X4XA 4I9WD 1HCFX 5IGXH 4O4YL 3QXAB 1EO8H 5KS9E 1M71B 1KB9K 1NBVH 1R3IL 5GS0L 4EI5B 2XZCH 3FN0L 1FL5A 3QJHA 2YRLA 3QIUB 5C6PB 3M1BA 1IAKB 3FMGL 2W0LA 2MHAA 1KIPA 2DI8A 2JJSC 3B5HA 4U6VH 3DSFL 4HS8L 4OCWH 1F4AA 3WXVL 1U8HA 4X6FB 2N1KA 5J56B 1IGIL 1AE6H 3SQBA 2ITCA 2CK0H 3NA4A 4LCCB 1KTDB 3MRNA 4U05A 5CJ5A 1Y6KR 3LKSA 1CLCA 5D7SL 3V4VH 1OAUH 3D3VD 3P9MA 3Q3GB 4O2EA 4ZD3L 5CD5C 1ZT7A 1N64L 1Q0XL 2HTLC 1MCHA 1FSKB 3D1MC 3WIHH 1LE5A 5HHMD 3H3BC 3FRUB 3SO3C 1RJLB 1OCWH 4OCNC 4NQDE 2Y7QA 4M8QB 3OX8B 2W65B 3S36X 1KTLA 4XB8A 5AZ2H 4EBQH 2M2DA 3D3VA 1DUYA 3V4UL 2QQKL 3LDBB 4PJHE 5J1TC 4WO4C 1BF8A 3QG7H 2E9JA 3QZWA 5DWUL 1A4JA 1IAOA 1FYTE 5D5MB 5JOPE 3EFDH 3SKNB 4Z7UF 5IQ7L 5I1KH 3BQUD 4QHNA 1Z0NA 1X5YA 4OF6A 3K7UA 1KCSL 4CVZB 1QRNB 1FV1A 1HHKB 4PS4L 1JJUA 4XCFH 2UWEE 5HPMB 1YJDL 3TPUA 4NJAH 5DZNA 3P73B 4C59B 2Q8AH 1JGDB 2X4NB 1Z9LA 1FRGL 5FF6B 5DI8A 4LSRL 5D7IF 5J6GA 3VFGH 5DZOA 3BQUA 1BFTA 3MYJA 2QHRL 4WJ5A 4G6AD 2VE6B 4MAYA 3P9WB 1T1XA 1FFNA 3RQ3A 1YEHL 4PJ7B 1IC4L 3VXSD 4JRYA 4L8DA 1M7XA 3QUMB 5E8DH 3BUYB 3CXHK 1UEMA 4OAWA 4KVCH 2R0ZL 1RIUL 3NH7H 3FFDA 5ITFB 3S4SB 3IFNL 1NDMA 4EUPG 3TFKD 4NCC2 4F9PC 1WTLA 4ONHA 5C0NC 3VXSA 1KG0A 1MCEA 2NLJA 1DANU 1D5XA 3CPLB 5D1ZC 2GITB 3OAUL 4M02A 2YD8A 3GM8A 4JZJC 1Q8MA 5JDSB 4R3SB 4N1EA 1WF5A 1SJEB 4S1RH 2BK8A 4JFDE 1NGZA 4XPHH 3ALXA 2X2YA 4YGVA 3FZUD 1CR9H 5IMMA 1RK0A 1NJ9B 2IQ9H 4G6MH 1CIDA 3JV4A 2EO1A 4QY8B 4HDIA 1WQVT 1A6ZB 5EA0H 5ICYA 4F37F 5JQHC 2XA8L 1DZBA 3B2UD 4UTBH 3F5WB 2ESVD 3C8KB 4HK0B 3VWJC 4P4KD 3WFZA 2VH5L 4LLUB 3MV9D 4O2CB 1R5VA 4RBPH 4G8GD 5CS7A 1DP0A 4Q6IC 1MSPA 5I19H 3HLAB 1BZ7B 4QGTA 5I8KH 4TSCL 1S5HB 4XP4H 2ESVA 3OKMB 5I1LB 4ZPVB 2AEPL 3FT2A 1FFPA 3MV9A 2CR6A 5IVZB 4EOWH 3UX9B 4YBHA 4G8GA 5C9JA 4UINL 4N0UE 4PV9B 3LKOA 1QO3B 1OAXL 1OP9A 3WFEH 3V0VA 2A9NH 3A6CH 4FQHA 1A8JH 2AK4E 3BP5B 5DRZB 5C2UB 3B3IA 1T0MA 3B9KB 2WV3A 5MENB 1TZHA 1R3JB 3T4AA 4PLNC 2J6EL 4R2GD 2IBGA 3I50H 5F7WC 1J0JA 1G7MB 4NDMB 4P5MB 5DT1H 3TBTB 4W6WB 2ZUVA 5E8OA 4K3HA 1FJ1B 1EEQA 4HKBB 2E9IA 3QQ9D 1MLCA 2FYYB 3BOVA 4PJFB 4XC3L 3NGBB 1PY9A 4JFQA 2Y07L 4BH7A 4K94H 3AMKA 4BZ2L 3WHE1 4BM7A 2A77H 5F6HJ 1Z2KA 5HYQB 3G6DL 4OCRH 2PTUA 1RZKC 5JZ7D 1R3KB 1NAMA 1X5IA 2EDJA 5E5RB 1ORQA 2ADJB 2ZOKA 4JZNB 3I6LE 4XPBL 4P46B 5I76A 4KTEH 2BP3A 2MQCA 5DHVH 3MJ8A 5DUML 3IDGA 3QFJB 5H8DA 4MB4A 3GJFK 5KVGL 5FKAB 2FDBP 5ERWB 2H3NA 2XTJC 4RMTA 1NDGA 1LO5A 1T04B 1DEDA 2C3XA 3BZEB 4M9OA 4KKAC 3O6LH 5TQ2H 3I2CL 4KJWD 3QIWB 3ALWA 5KS9A 2ARJQ 2RCSH 5CCKH 4NKQB 1G7IB 2EDYA 4YFEA 2X1XR 1UQSB 2C5DC 3ULUF 2EDXA 3GSWB 4BFBD 4QHLB 1QKZH 1P1ZB 4G8IB 1YQVL 5HD8D 4NPYB 3U2SB 5DEGA 1M7DB 5J6HA 4GG6E 1J1XH 4LNRA 1MWAH 5DRWA 1RURL 2J88L 1LO2L 1XGUA 4PTUA 1YNKH 2F54B 3IS0X 4D2NA 1BIIA 5GSVA 4DN4H 1KLFA 4NQDD 4K3EL 4RMVA 5KSAD 1G0YR 4ORZC 1DBKL 4UILL 3RWHA 3U4BL 4ZFGL 3I02B 4N0CD 1INDL 5TE6L 5KAQF 1XGTB 3CFEB 3ESVF 2OZ4A 1LD9A 3MLPA 4P3WA 3ZLQC 4Y2OA 1FIGL 5EOCJ 4G5ZL 4XNMA 1NEUA 4KKBC 1CD8A 5BO1L 5I1JH 1FYTD 1V8HA 5C86A 5JOPD 3SE8H 1JZ8A 2LAGB 4YHLH 4NQDA 3MRIB 4S1QL 5KSAA 4P4RB 4PLKD 2BHYA 5DURD 2DJ4A 2Y5EA 3KNBB 3D87B 3QCVH 2GJJA 5TE4L 3QDGB 2XV6B 1HN1A 4PJXB 2YPKA 2R0WL 4U0RB 3VH8B 5MEPB 4PJHA 2XKUA 4K71B 1NGPH 5D2LF 3VRIB 1BQHA 1XF2A 2APXA 3CFJB 4D0DA 1FYTA 3MBEB 3RVVD 5HYSB 3QUML 4OV5B 3HUJF 1Q1JH 1NAKH 3F58H 5L8JB 3C09C 4DKEH 4M3JA 3LEYH 4LLYB 2UWEA 4K2UL 3VWKD 5GIRA 4QCIA 4LKXB 3BYYA 2ZZUT 2YRZA 1B2WL 5F88B 2VDLL 3NZ8A 4L1HA 1DBML 2I9LB 3QUXD 4XGZA 4WI2A 1D5MB 1FNGA 3VWKA 4YNYA 4Y4HB 2MOVA 3CXDL 3MJ9A 3U0PB 4NBYB 3C60A 3MNWB 3FCTA 4EDXA 2D9CA 3PHOB 2X1QA 5FHBL 3LEVL 2OK0L 4CRPA 4PRIB 1T0PB 4HWZB 4IMLB 5J1AA 2X4OA 3GZKA 4JFDD 3QUXA 2FJGA 4NQTA 1FG2A 2OXGA 5L8KB 2ZPKL 3O45A 3RY5A 2YEZB 8FABA 4NWUH 1JTOA 4G6KL 4HZLA 4IRZH 4PUBH 4U49A 4PV8A 4XP6L 4IRSC 1F4YL 1WGOA 3O3EB 3OQ3B 1U91B 3KHOA 2BVQB 4YDJA 4XVTL 1QVOA 4KAQH 2YUXA 3OZ9H 4QOKE 3QULB 4JFDA 3CLFH 2Q3ZA 4ZS6C 3OXRB 1HHHA 4WCYL 4FTVE 4LVEA 5DJ0A 3EDKA 3NACH 1MCNA 4KVNH 4R0LC 2CKNA 3MUY1 1VFBA 4LLDB 3GBNH 3KPSE 2HYMA 4PGZA 1OGTB 3UJTH 3N1FC 1BZ9B 2DL9A 1NMBL 4ODSH 1KV3A 3PL6B 3EYQD 1YECL 1MJUL 1JYWA 1F90H 4KZDL 1FNEA 1QOKA 3AS0A 2O61B 5LBSL 3SDAD 5FO8B 2G60H 3OJDB 2NTFB 1BWMA 3MGAA 2AK4D 2VL5A 4M1DL 2NY5L 4X4YA 1XZ0B 9CGTA 1E4XH 5JA8B 1V7MH 1PLGH 5HHVH 2MPAH 2P5EB 4YR6B 4N0UA 5IMLB 3SDAA 5I8OL 1A9BB 4MD4A 5EO0B 1EGJA 4PRDB 4Q74A 4H25B 4ZQKA 2D4FA 2AK4A 2VOTA 3A0OA 3TH2T 3SO5A 4JFEE 4ODXB 3C6SB 2WWMD 2B7DT 2W1NA 2Z31B 4GXUM 4OLXL 4OQ1A 4RFNC 5ESVB 4JHAH 2BVEA 2A74B 3QEQB 4PP1C 3SQOL 2QR0A 4OV6F 3UJJH 5HYFA 4KK9D 4RMQA 2P8LB 3T0AA 5E1HB 3MJ7A 2X70A 4DKFL 3FQUA 4J1UB 2GY5A 3PNWB 5I66B 4Z0XA 3I6LD 5GS1A 5IROC 4P2RB 3L9RA 2MNUA 1RUPH 4LLQB 3EKCA 3MZTA 4PJCF 1LNUB 2XRAH 4HK3J 4JO2L 1U3HD 4MQXC 2VDPH 1GGTA 1EUTA 3C5SA 4LCWE 2OJZL 1JFQL 1G0DA 5SX5H 2MKWA 1JRHI 2X4TA 3CZFB 4I5BA 2VLJE 4FQLH 1T20A 3T3ME 2XZZA 4JDVA 5D1XB 3V9FA 5LXGL 3VXQA 1WK0A 5AD0B 3LS5H 5ESQB 4D9QE 3OTTA 3W5MA 2FR4B 3V5DA 2WBJD 1W0VB 3E2HB 3VI3F 1H15B 2NW2A 5C2BH 1U58A 4MHHG 3AUVA 3TV3L 1KJ2B 3ROOA 1RD6A 4LLVB 2VDKL 5BVPL 2QV2A 1F45A 4WFFE 1DLFH 3VU2A 3WFBL 3PJSB 3WHXB 2CLZB 5JR1H 1GC1L 5EWIL 1HKLH 5EUOF 3LN5A 4JM4L 3BIKA 2CDEA 2LU7A 4C56E 4ZOAA 2V5SA 3KPRE 2NY6C 3JWDL 5DMGC 3QEUB 3OB8A 2OMBA 2WBJA 1MUJA 1J0KA 4QT5B 4YXLL 3LN4B 4KKLC 1UXSA 2DLTA 3LIZH 3S88L 5BXFA 1J10A 3MODH 4GG6A 1Q94A 1KPUA 1RUAH 4QNPE 3BN3B 3CIQA 3OSKA 2RGSA 4Y2DB 5E6IC 4PRHB 4Z5RB 4QXTA 5IK3B 2PO6C 1INQB 2JF1A 2PW2A 4KROD 3TO4C 4MZ3A 1IT9L 1IFHH 5IIEB 4JQXC 4APQB 5EBMA 4NQXA 3VXME 4OCLC 3KG5A 3L3OB 3HPJA 4PJIB 4WUKH 3TLRA 1E4KA 5F1IB 3TJEL 3Q6FB 1OB1B 1ZEAH 3RI5F 4MVBD 1FC1A 4LLAA 3ARUA 5F9OL 2XICA 3RVWD 4G8EB 4YFLI 3HR6A 4KV5F 2EIEA 2Q20A 4P3DA 1K6QH 2AJ3B 5E2VL 4DUXA 4NUJA 5B39A 4YAQA 2HN7B 3O3AB 4OGAC 1LK3L 3RWCB 4F7PA 2YSSB 4X6DF 3KR3L 4PP2A 4UT6H 4M43L 4QYOB 3DX9B 1C12B 1QR1A 1A6TA 2EZ0C 3UTZA 4YE4H 4DGYH 1SJVA 4DTGL 1Q72L 1DBBL 4OD2B 3W39B 1AGDA 4QRQA 2ZCLH 3TA3C 2VDRL 4U6TA 4XNQB 1ZHKA 4ONFL 2YD4A 5IBTH 2BC4A 3SCMC 4PJGB 3KPOB 2CKBB 2BRQA 1W72A 2EDDA 1XT5A 1MFAL 2LU4A 1Z3GL 2XKSA 4P2CG 1CQYA 5GPRA 4X0KB 3Q1SH 3TN0C 2X89D 2EH7L 2DQTH 4HULB 3MFFA 2ZOLA 1VESA 3VGEA 2UVFA 4YHPA 4GRWH 4HWBA 5CD5D 3T09A 2HTLD 4QOKD 1J9CT 3DVNA 3IGAA 4MYWB 5FYLH 4I13B 4IHOA 3VXNB 3WLWD 4OFDA 3BD3A 1NFIB 4FTVD 4MJ5A 1KB5H 1U8NB 4LEOA 1MFNA 3ZHKA 1UKQA 4UV7H 1A5FL 3HZMA 2E9WA 4GQ9H 2ICWA 3DSNA 4RMRA 3HR5A 4F58H 4QOKA 4V1DB 5FV1L 1ES0B 2FECI 2Q7YA 1KXTB 3QDJB 5LGJB 1Y6NR 5T3XE 3EYFA 2CIKA 3VFWA 4FTVA 2RAMA 3J7HA 4AZ8A 4RGND 4U33A 5T1MB 1QLEH 1U8MB 4HIXL 1Q9LB 4Z7WB 4OD1L 3DGGB 4YGAB 2JIXB 5DD1L 5DD0H 5IT2H 1RJZA 3KPSA 2W60B 4KRLB 4Y8AA 5IVXE 1IQDA 3HN3A 5DK0B 1CLZL 3QFDA 1VDGA 4Z8FL 4TSAH 4OBRA 4FFWC 4WO4A 4L9LC 3ARGC 4G8FB 4XVUD 4HX1A 4MDJB 3OG4B 4JAMA 2HKFH 2A6KA 3ZT7A 2J8OA 5BRZE 5ICXA 1NUDA 1Z5LA 2JE8A 2C9AA 1YEIL 4PGDB 1ED3A 1PJ9A 2F53E 4JFED 3G5YA 4YBLC 5T33H 2NPLX 2ZG2A 5JIPA 3C5ZC 3HE7C 3QBTB 1UCTA 4PJ5E 4HS6B 4UDTA 4U6HB 4NN5B 5K93A 3RTQB 1FNSH 3QNXA 2W9DH 2P43B 4X98B 3RDTD 4J8RA 5E8PB 4X7SH 5F8RC 4LGSB 1IGCL 4RIRA 4YDLB 1ZS8B 2IAMD 1QBMH 2YS4A 3PG2A 1IAIL 4JPIA 2GTWB 1CBVL 4JFEA 3U46B 3UPRA 2D7NA 1J1OH 5IEKA 1IBGH 1YEEH 3WKNA 4LPYA 2OCFD 4KJPD 4CGTA 5BJTA 5KBNC 3NOIA 3W11C 1RIHL 5D1ZD 5F7FA 3RDTA 1C5CH 1VADA 2ORBH 3BE1H 1BFVH 3BKJL 3IDMB 3TWCL 2Q1EA 2LABA 2DDQL 4ISVA 1T03L 2VLJD 3PHQA 4HJ0C 1FL6B 2VLRE 2E6PA 2JK5A 5CFHA 4POZC 4HIEA 1KJ2L 1U8KB 4H1LH 4F9PA 3ZE1F 3UPAA 1NBYB 3KYAA 5I17B 1YY9C 2IADA 2FIKA 4XAWH 1Q9KB 5D1ZA 2VL4A 3MTRA 3IDIA 3S97C 4N8PA 4JZJA 4LCWA 3K80A 1O0VA 1RK1A 2JJUA 1S8DB 2YPLD 4Y4FB 2NY1D 4TTGA 2VLJA 5ALBL 3LKQB 4XX1G 4KMTL 5EIIB 4LBEA 5HVGB 1DLHA 2RR3A 5C8JB 4QF1B 3L95A 3KPRD 2HWZH 2B1HL 5IOPA 5HGHA 3I3EA 3RNQB 1FVDA 4Y5XB 5GS0C 1HHGB 4JZOA 3HA0A 2YD5A 5B38G 2P24B 3OGOE 5EFIB 3MOAH 2P8MB 4Q6IA 3QG6B 3Q48A 5JXEC 1C7SA 2R2HB 4C56A 5I75C 4ZTPL 3KPRA 3NFNB 4HBCL 5B8CC 3CAFA 4WI5A 2LV4A 4F15B 3QO1B 2HFTA 3MGTB 3VXMD 1HH6A 4MLIA 4LLWA 3RIAF 3CFBB 5K9JH 4XAKD 5HHQB 2EDEA 4NKOB 4JDTH 3T2OA 4KZEH 4DAGL 5F89B 2E27L 4HMCA 5T1KB 3RZCD 3N85H 2V7NA 4JQVA 3KYMA 2DTML 2X4SA 2O5YL 1I3GL 1N7ML 3X12B 5J9PB 3VXMA 4KUCF 4ZSOB 4OLYH 2UZXB 1Y18B 3DOSA 4UV4L 4N9OB 1F3JB 4Z0BH 1HIML 3H7LA 4PYHA 1D6VL 2BCKB 4OKVB 1BM3L 2ZCHL 3O9WB 1AO7B 2VXTH 4JLRB 2DD8H 4G7YL 2ED9A 5C0AB 2VTFA 5SWSB 4RAVA 1L4IA 1Q0YH 1C08B 2R1YB 3C6LC 5ACLA 4ZUTB 1OM3L 3O6MH 1UH2A 5JUEL 5GHWH 4LGRB 3N1GC 3IU3A 2CKBL 4UAOB 1G7PB 6FABH 2MKLC 4HH9B 35C8L 1B6UA 3FOLA 1JZ5A 3V8CA 5D9SA 1ZLWK 3CH1B 1PYWA 4MJIB 4Q6YA 2BY1A 1NKOA 2D31A 3FB8A 4OM1L 5DD5H 2WBKA 1QACA 2XPGB 3Q5OA 3D18A 5LCVH 5KOMC 2IBZY 1N2RA 3JV0A 4KKAD 3MA7A 4K3GA 4LMQE 2WQRA 4I3GA 2I9TB 2XY1A 3P0GB 4GKSB 4BSVB 3MGOB 3HRZB 2F5AL 3HI1B 3CDGB 2EE2A 4C4KT 4WHYG 1W0YT 2E7BA 3ZDZE 4U6YB 2FX9L 3MCLH 4N5ED 3SGEI 4HKXA 5CSZB 3QXUA 2DWEB 4MDIA 2HG5B 1BFOB 3S34L 3D9AH 1D5BA 4NO3B 4OQTA 4DVRH 1B4JH 4XTRD 3ULVF 3GUTA 1LO0H 1SHMA 4NZDA 4XNZB 5DHVA 5CBAA 4R4FH 4ZPTA 1JF5A 2OI9C 5CSBA 1YC7A 4CADA 3MRRB 5C09B 5E03A 5T3XD 1HK6A 2C1PA 5A16B 2R0LH 4MS8D 3AB0B 3TF7C 4Z7QF 3V52L 1MHEB 5AAMA 5TF1H 3K3QA 5FXCH 3GMMA 5ESAA 5HHOB 1YYMH 2E7MA 4OZIE 4TUOA 3JTTA 4FQ2H 4PJEE 4WGVB 2B4CH 3WYRA 1MWAA 5BS0B 2C4FT 1N6QL 3IJYB 4LVNB 3GSQA 3QEGH 1PZ5A 5F7EL 4YHZL 5DJZA 2PYFB 5BRZD 3GDBA 1S7RA 3GJFH 4F9LA 2AS5M 1IC7H 4JQIL 4FFZH 4H1LG 3L6FB 2F53D 5L2KB 1BAFL 3CSBA 4LOUD 5IVXA 4RDQF 1MPAL 1HHJA 3ARDD 3BZ4B 4UDUA 4JRXE 5GGTH 4ALAH 3TPKA 4PJ8C 4C54A 1CGVA 3UC0H 2HLAB 2J4WL 5C0EB 3NFSL 3MNVB 3DETC 2QKIA 1NC2D 1CDHA 3GK8L 3WNKA 1AHWB 4KI1A 4XX1E 5BRZA 3L5XH 4GAGH 3I9GH 3VFOB 1OAZH 1QSEB 4BK5A 2F53A 5GGVH 5E08H 4M00A 3VCLB 3ARDA 3EOBA 4PJ5A 1VPOL 2R0KL 2YA0A 4X9FA 4IMKA 3NCJL 5KW9L 3Q6GL 4OZHF 3AXLB 3KJ4C 1UYWL 1NC2A 4GO6B 4FNLL 2P8PA 2VXSL 5TH2B 3T2PA 4OF7A 4J6RH 2VLRD 5ADPH 5EORL 4NBXB 4GKNB 1OP3K 5IB4B 3ZE2E 4ELME 1DQLH 1F4HA 4IRSD 5F7DA 3U0TA 3TZVB 3GGWA 3CCHB 5LWYL 1NCCL 5IFHL 1YEGL 2EDKA 1WZLA 1UB5A 1OPGL 2VLRA 2YD1A 5EUKA 1UCBH 1I7ZB 4JY5H 2FBJH 5L88L 2X40A 4GQPH 4GMTL 4ODTH 5FGCB 5KSBE 2VXQL 3VFTA 4P23B 1CD1B 1I8IA 3MOQA 5E99L 4GOSA 3ZKMC 2R29L 3RUGE 4IRSA 5DC9B 5DMIH 2AXGA 4PGJA 1JNLH 1WIUA 4RWHA 4LCCC 4GRLB 4GRWE 1HCVA 4HFWA 4ZFOB 2A6DB 2VYRE 4HJJH 3LVEA 3FQNB 2O5ZH 5FYLE 1JV5B 1U36A 3HMWH 1R24B 5F96L 1KULA 2V5YA 5DO2C 5GRYA 1FSKC 4MCZB 3W5NA 4OZFA 4Y19B 4HC1A 1M6OA 3SDXF 4NKMB 5EULV 2VDOH 2Z4QB 3REWB 3T0EC 2GKIA 1MJ7L 3SJVB 4RAUA 3U9UB 1WCQA 2L4OA 4PJBE 5C0BE 3QNZA 3QAZB 4I3SH 2HP4A 1PVHA 4YC2B 3LDBC 2YPVL 3F6IA 4CMMB 3UJIL 4QRTA 1E4JA 3RIAK 3V0AC 1WZMA 5T3ZH 2ZSWA 3MBXH 1PG7L 4HGMA 4X4XB 1JHLH 4LARH 4KI5C 1QQDA 5HVFB 4WV1C 4CU6A 1BJ1J 4LQFL 4D0CA 2BOBA 3TVMC 2FD6H 3IT8D 1V3LA 1X4XA 2MHAB 1AFVH 2BSTB 3PIQA 1T4KB 2E8ZA 1U8HB 1MQKL 1JPST 1FGVL 3BPCA 1JGLL 3NN8A 4HKJA 2ITCB 4MQXD 3MRNB 4OM0H 4X99A 4LPCA 3HNSL 4N0FA 4RNRA 3MV01 1JGVH 4MXQC 3MLVH 3HCVA 5C0GA 3P9MB 1IEAA 4FQXD 4NKIH 1JPTH 4X7TB 1ZT7B 5IROA 5CEZH 1A7NL 2VLME 2UYLA 4HS3B 1J7VR 4JM2C 1YMME 4MAUH 5AYUH 5EZLB 5L7XL 3KS0J 5FIEA 1DANT 2Y7QB 4IS6A 3QIBC 4P5KA 4XZUA 1EXUA 1KTLB 1RIVL 2CO6B 1P9MC 3D3VB 3OV6A 4FQXA 4NOFA 4XPTH 3WDJA 1SBBA 4Y1AE 4AJ0A 2D0HA 3QHFH 4NN6B 1OAQL 4JN2A 4I18A 5GISL 2V5MA 5J12C 1IAOB 4Y7MA 4PY7B 1KCLA 4N1HB 5GJTL 4OB5L 3PWUB 4EXKA 1FV1B 1JWUB 4HJGB 3HI6L 5FYKH 4KRPD 4JFFE 3O8XC 4UNUA 1SM3L 3CSPA 1F13A 3TPUB 1WEJH 4ODHL 2MTPA 1U42A 1HXYA 5J6GB 5DI8B 2YKLL 1BMGA 4S1DC 3BQUB 1IM3B 4KHTH 1V7NL 1ZHLA 4MAYB 2VUOA 1T1XB 3MC0A 4R26H 1FFNB 4P9MH 1JVKA 3H9SE 2NTSP 4WFHE 3VDCA 4JRYB 1NLBL 3CD4A 1BBDL 5J89A 1S9YA 3TO4A 4OAWB 4JQXA 4MNHB 4OZIA 3MA9L 2VKWA 3IB4A 4PJEA 3B9VA 4JRXD 3FFDB 5JHLL 4Q2ZB 5I15H 3O4OB 1KG0B 4C4KO 1MCOL 2MCPH 2NLJB 2R69L 3QDMB 1D5XB 5GZOC 2VIRB 1NCTA 1WITA 5B22A 2NY0C 3GI8L 3CVHH 4PRAA 3WUZA 3WFDH 2AV7A 2DIAA 3VI4F 4XNUH 5GGSY 1NGZB 4JRXA 1W2KT 3ULUH 1IGYA 2KL6A 4YGVB 2BHZA 4JFOA 5IMMB 1RK0B 3JV4B 4MA8H 3NGBC 2AABH 5ICYB 2HJLA 4N8CH 1JNHA 2NY3C 3L3DB 1J8KA 3RJQB 1H3VA 4XVJH 4DFHA 5F9JA 2ATPB 1R5IA 3Q5YA 1U92A 1K4CA 1KPRA 5CJXA 1R5VB 3D69B 4N68A 2FH6A 4H0IA 2D7PA 1RZJH 1IKFH 1J8HE 1LP9E 3PDGA 2W0KA 3P4OB 4WW2B 1WFOA 5ALCH 1RUQH 5B38A 4UT7H 5E94B 1CXEA 3UDWC 5SWQA 4D3CH 2HT4D 4WWKD 2VDQL 2AXHA 3E6HA 5GRUH 1I3UA 3FT2B 3CSGA 3T0XA 3FB7B 1INEH 1FFPB 4ZFOL 4ELMA 4IIQA 2VR5A 1FP5A 4JO1H 3P30H 3TH4T 1KC5L 4NYLB 2ID5A 5JHDE 3LKOB 5ID0A 5TFSL 3QIWC 4F7EA 3V0VB 5AUMA 4FQHB 5KVEL 2Z91A 4LSTH 3L1OH 3B3IB 1G84A 1OGAD 1T0MB 3P0VL 4Z77B 1FNHA 4LSVH 3MFGB 1MY7A 1TZHB 1WBZA 1XF5A 5FYLD 2BY3A 3T4AB 5KSBA 1FLRL 3VRLF 1P5UA 3RUGA 2ZUYA 4FA8A 4X6BA 2ED7A 3BO8A 2ENYA 4YX2H 1MLCB 1DN2A 4YXHL 1RJCA 1NC4D 4CBPA 4OGYL 4JFQB 2APVA 1ADQL 1I8MB 3FB6A 5C0BD 1CXLA 3O2VH 3B9EA 2W92A 3NA9H 1KB5A 3PWVB 5EBGA 5HDBF 5I71B 5DEZA 5GRJH 1I9RH 1WZKA 4M9PA 3I3DA 1ORQB 2ZOKB 3AREC 4OCMC 2D03L 5FUCC 2WK2A 2CGRH 3IFLH 3UEZA 4MNQE 3TBVA 3ARGA 4PJBA 5C0BA 2RQ8A 3F62A 1A3LH 3NCCB 3IDGB 2OR7A 4XMPL 4U0RC 3FQRA 5IKCA 4K71C 3DWTA 1A14L 3FHAA 1YEDA 1J1PL 4DEPC 3MBEC 3IF1A 2W9LA 1NDGB 1LO5B 2NXYD 3C5ZA 3HE7A 2I60L 2R9HC 2DKMA 5KS9B 1OF2A 4I0PD 4AT6A 1MJ8H 2DQDL 4Y0GA 3R4DA 3SKOA 4QTHA 1CXIA 3W0WE 2R15A 2SEBA 2WINA 5J6HB 1WC7A 1Y6MR 4YUEL 4POZD 4LDOB 2VXUH 2DI7A 4FABL 5HJ3A 2VLMD 2XT1B 2J2ZA 3N9GH 1XGUB 4PTUB 1YMMD 1BIIB 1TJGH 2VDML 15C8L 2BNRE 4JFXA 3NCEB 4I0PA 1UJ3C 3PF2A 2H2PC 2JLLA 3RWHB 2KQNA 4Y1AD 3H3KA 4XRCA 3LV3A 3MLRL 4LPUA 4ZO7A 1F6AB 3BW9A 2YUVA 4HPOH 2E6JA 4M7KL 1S5IL 4ONGH 1YMMA 4L3EE 4U1MA 5FCSH 1K5NA 3DECA 3MRHA 2ADGA 3B43A 4NQDB 4PLOB 5C0DA 5KSAB 2HKHL 1JI1A 5GGRY 5JA9A 1URLA 4GXUN 4Y1AA 5HHXH 2K1MA 4WRLA 3RWIA 3K74B 3AFLA 2YPKB 5JXED 1QFHA 1UM6H 1XF2B 1BQHB 3BPLB 4H1LA 2P5WE 4Z7UE 2EO9A 1FYTB 5E5MA 4YK4B 3T0EE 4F7MB 1U93A 5DURB 4EN3C 4QXUH 5D7JD 1VERA 1IAII 1XGRA 3V6FA 4JFFA 3GNMH 3H9SD 4WFHD 1T1YA 2UWEB 5JXEA 4PJXF 1MI5E 4JO4L 1S78C 5GIRB 4QCIB 1BECA 3QXWA 2PETA 1Y0LA 2AV1B 3PL6C 5D7IE 5B8CA 1JGEB 1QA9A 5CGTA 4NZUL 5IW1A 4AQOA 4R96B 4EI6A 4XGZB 5KAQG 5D7JA 1BJ8A 2F74A 2GK0A 4KI5E 3H9SA 5GJSL 4YNYB 2DLFL 4DFIA 4LLMB 1HEZB 1CE6A 3C60B 5D93B 3FCTB 2X05A 4EDXB 5HTSA 3C6LD 2F5BH 4LPXA 5J1AB 5D70L 3QUXB 2FJGB 5K9OA 2NXZC 4X80H 5DUPH 5T3ZE 7FABL 3UBXG 4R90L 4Y16D 4FQ1L 2CDGB 5FA3B 3ARFD 3MLYL 3O45B 5TGBA 1WIPA 1XH3A 4HZLB 1JK8B 4PV8B 2DBLH 5EU3A 1TXKA 3U1SL 2BERA 1NUNB 3C6LA 4YDJB 2BMKA 2Y23A 1MIEL 1FFQA 4F80A 1DSFL 1HHHB 2FB4H 4Y16A 3ARFA 2PW1A 4PB9H 2R4RH 1A6WL 3IDJA 5BW7C 2HRPH 1VFBB 1ZANL 2FHCA 3L3HA 5I73C 2WIMA 3MRGA 3KLDA 3V0WH 5ILTH 5DS8A 2VSDA 3WS3B 5BV7H 4BELD 3DURA 3N1MC 5CEZE 1T3FA 1QFUL 5CJOL 1FNEB 1F4WL 2FEEI 4M6MH 1J8HA 1LP9A 5JHDD 2GSIA 1KENL 2XWBA 1XR9A 4M1GL 3MNZA 4HD9A 3BP4B 2VL5B 1QLRA 2NR6D 4PJAF 2R4SH 3E2HC 3WIFA 1U6AL 5D2NC 1KXQE 4RFEB 3ZTNH 2G9HA 2B5IC 2XQBH 2NY2B 4AL8H 1KCUH 1XGQA 4Z76A 2HFGL 4N0UB 5JHDA 3SDAB 2CUHA 4E42A 1NEZB 1CLYH 2MSPA 4I1NB 5I1HL 4MXVF 4XP1H 4MD4B 4FZ8H 4PJ9D 1UKTA 3DHJA 4ZQKB 1LO3L 2D7TH 2HH0L 2PYEE 1CU4H 1NGWA 4XBPB 4Q97A 1OSPH 1U8QA 5E2WL 1CK0L 4ZXBB 5ACZA 1MFDH 3TO2A 5KVFH 2OTUB 5FYKE 2QR0B 3S96A 3U9PL 4ODUB 4IBLT 4OT1L 3T2NH 4DUWA 1ZLWH 4K07A 5KTEH 5KANG 5F44A 1MFCH 3MV11 4PJ9A 2X70B 3QUYD 2COQA 2YK1H 1UACL 3QXVA 4XNXH 3TH3T 4HFUH 4TQEH 4Z0XB 5DTFA 5GS1B 1MJJA 3L9RB 3HAEH 4MNQD 5TPWH 3UAJC 3CMOH 1MRFL 4LP5A 1CVSC 3FQTA 3RVTC 1CGXA 4QKXB 1TETH 3C5SB 1JHKL 3O3UN 3DX6A 3X11A 2X4TB 3QUYA 1QYGH 1T20B 2WWKT 4HF5H 4HKZA 3S7GA 3VFMB 4JDVB 2X1PA 3VXQB 3B6SA 3RJDA 4MNQA 2GW5A 3V5DB 1SBSH 2EEAA 3RY4A 2AP2A 1GSMA 2IEPA 1CCZA 2O26U 5KJRL 3W0WD 4EVNA 2NW2B 1PG7W 1EIBA 1U58B 4AM0A 1BOYA 3GJFA 2X4QB 1AKJD 1B0GA 1KCRL 5BMFH 5EZOH 3ROOB 2X4RA 2OZ4L 4GW1A 5H35A 2DQJL 2HJKA 3LN5B 4ETYA 3BIKB 3ULUE 5GGTA 5IHUL 1RQ5A 2BNRD 5I8EA 4FOMA 2DMKA 4P57A 4K3JH 5IV2B 2WBJB 5JPMB 3W0WA 4KK8D 5JTWA 1UXSB 4H20H 5EZIL 2FX7H 3EYUL 3SBWC 1Q94B 1KPUB 5FDWB 4GG6B 2AKRA 5FGRA 4LPWA 1OARH 1EDQA 1N59A 4OIAA 3V5HA 4L3ED 1EJOL 2DQGL 5EB9A 3JUYA 4QXTB 2BNRA 5GQBA 1VFAB 3U82B 2PW2B 3G5ZA 4GXVL 4YDKL 4PBWD 1RUML 1DL7L 1J0HA 4M62H 3KDMA 4GMSH 2BNQE 3RVXD 1E6JH 3WNNA 5BVJA 3VXTB 4O5LH 1PEWA 3MLUH 4LAQL 4AYFA 1JPGA 4PB0H 1GGUA 5DO2D 4L3EA 3LH2L 4K7PH 4TSBL 4JFHE 3OKLA 3K4DA 5CUSH 4OLZH 4WVRA 3VXUE 4G3YL 5F9WC 3GKWL 3P11L 4OFYD 4AIXA 4NRYB 4IDJH 4NUJB 5B39B 2F58H 4YAQB 4UIKL 3BD5A 4XHJC 4F7PB 1MI5D 3N1PC 1HXMA 1FHGA 4DN3H 1X5LA 3KJ6L 1OD7A 2E7LC 1QHOA 4PP2B 2P5WA 4LU5L 4Z7UA 2RHEA 3UYOD 3HUJE 1FCGA 2QQNL 3HC0A 2AJVL 5EOCH 3ZMRA 3MJ9L 4Z95L 2Z92A 4N8VB 3T0EA 1SY6H 4KC3B 4KH2A 1OP3H 4D8PA 2NNAB 5FK9A 3UTZB 5D1QC 2C1OB 4OFYA 5FUCE 2C3HA 3PP3K 3O6FD 2FX8H 1SEQH 1UA6H 2EYRA 4LRIC 1G9MH 3K0WA 2QJDA 1MI5A 4KDTA 3O2DH 5E2UL 1AGDB 4KQ3L 2Z0BA 3TVMD 4HIHA 4WHTA 5D7IA 4QRQB 4HXBL 5AG9A 4OD3H 4KKNA 1ZHKB 2EDBA 4F7CA 4G9DA 2BC4B 5T3ZD 1G9NH 1IGMH 1W72B 3H2WA 3T0DA 4WV1A 3VDBA 3VG0L 1DE4A 4QRPD 1KCVL 4HMDA 2WUCH 3TVMA 3L5WB 1IC1A 1OP5K 3KPNA 3MFFB 1CIUA 3NAAL 2ZOLB 3RBGA 3HI5H 2XQYG 4RAHA 1EFXB 5I6XC 1AIFB 1UWGL 3H9YA 3HE6C 3DVNB 4PBXA 1B0RA 3IGAB 4YDLC 1IEBA 4IHOB 2PXYC 4WTWA 4JKLA 4MJ5B 3R1GH 4LEOB 4TPRL 1YDPB 2OX5A 4LVOB 4RCAA 5EU5A 1AXTH 4K3DL 3NTCL 3HZMB 1EH9A 2WBWB 1ZA3B 3TT1H 3WDIA 3SOBH 1NFDE 3SDYL 3SHSA 1AI1L 2OJEA 3UTSD 5CEZD 1NCAL 1GPOH 3QUZD 2DQFB 1XFPA 3SO3B 3EYFB 1TTUA 2CIKB 3VFWB 4PRNB 4OCXH 4XCNA 4NHCL 1WT5C 2QEJA 3QIBA 1RJZB 3KPSB 4XB7A 4O58H 5GS2H 1P9MA 4B0MM 1EGJL 2FEDC 1IQDB 2FJHA 3H8NA 5F9AC 3VXPA 2IG2L 1QFWL 2A6JA 1KLUA 3QFDB 4TTDD 5J3HD 1FNFA 5DYOA 1UH3A 5CJQH 1PDKA 4WO4B 3QUZA 5LAXB 4D9LH 3OL2A 1LGVA 4NWTH 2XNAA 4HX1B 1U8LA 1FO0A 1U3ZA 5FHAL 4JAMB 3OKDB 1I8LC 2A6KB 3L5HA 5DVKA 5ICXB 1Z5LB 3UZQA 3IXTA 3TCLB 2PYED 1FE8L 1ED3B 2EYTA 3TBYA 4XWGH 5JIIA 4NN7C 4CW1A 3ZT6A 2DQCH 4FFYH 1EHXA 5FYKD 2ERJC 3P77A 3QNXB 4NQCE 5IVOA 5C07D 4J8RB 3AU1A 4KDVA 4RIRB 4WI7A 3ARSA 4OZ4A 4JPIB 3OAYK 2PYEA 1ZK9A 2B39A 2FH8A 4JFEB 4M6OH 4P2QD 3UPRB 4KHXL 4WHDA 5IEKB 1NL0H 2EKSA 4KMQA 1GZPA 5DEFA 5BZDA 4XBGA 3U0WH 5BJTB 3S37H 5GZOD 2BOCA 4UT9H 3RDTB 3SE3C 4JO3H 2X9XA 1KTRL 1VADB 2FZ3A 1A7QH 5LG1A 3TNMB 1QSFE 4O4YH 4PRBB 4ISVB 1ZA6A 3PHQB 4P9HL 1R3IH 4AIZA 3ARBD 2JK5B 12E8L 4PJCE 2ITDA 4HIEB 3LRHA 4X6CF 2MJWA 1I85C 3DRTA 5FDYA 2IADB 3DSFH 4HS8H 1YNTB 2FIKB 1D9KD 1IGTA 5D1ZB 1JYNA 4JZJB 4U0QB 1A1MA 4LCWB 2NY3D 1RK1B 1IGIH 4MJ2A 2VLJB 3WUWG 3BWAA 4LBEB 3ULVH 1IEHA 3AGVA 1RMFL 3BH8A 3ULUD 1XIWD 5D7SH 4BQ9A 3VI3E 2CLRA 4UUJA 1JYXA 5HGHB 1FORL 1D9KA 1FVDB 1N64H 1Q0XH 1T5XA 3QA3A 1CFNA 4ZAKD 3S36L 3L3IB 5DJCA 3BUTA 4JZOB 1DBAL 3VWJB 3SGKC 2NY1B 1MEXH 5EUOE 4MD5A 5E24E 1RFDL 4GG8A 2AW2A 2X4PA 4Q6IB 3VFNA 4C56B 1XIWA 4JPVL 3KPRB 2BDNL 3V4UH 3UDWA 2BVPA 4BZ1L 5D6DA 2QQKH 2WAHA 3H42L 4ZAKA 4HUWA 4UBDC 3U6RA 2DYPD 1HH6B 1Q9WA 2IH1A 1EEYA 4OLUL 5D2NE 5GSRA 2DRUA 3F12A 2OL3A 3VD5A 4CVUA 5IQ7H 4WHCA 2A73A 3ES6B 3ZKNC 1UG9A 4O9HH 1KCSH 4JFHD 5KSUA 1FN4A 1BBJB 3VXUD 1PQZA 4PS4H 3IDUA 1JPFA 2V7NB 1GGIL 3KYMB 1YJDH 1U8OA 2WWKO 2GSGA 4FQJL 2BNQA 1BFSA 3FO0L 3GMPA 5CWSA 1NLDL 4NO0D 4LSRH 2JJWA 3AS1A 2VQ1A 1G6RA 1FIEA 3MCKA 3U7YL 1MIML 5DFWH 4RFOH 3VXUA 4G42A 4KV5E 1G0XA 5HGDA 1IC4H 3UBXA 5CGYC 3MXWL 3ARED 1R0AL 5D2LA 4X6DE 3IU3B 2HJFA 3S5LA 2XIDA 1W72L 4XPFH 4NO0A 1RIUH 3HKFA 4QO1A 4EDWH 3FOLB 1I3VA 3HUJA 4P2OC 1PYWB 1S7SA 1P7QD 2D31B 3FB8B 4LVNC 5DJXA 1LEKA 3D18B 3AREA 4XWOD 4L4VE 1N2RB 4HWBL 3IKCB 4GBXD 3MA7B 3OAUH 2P46B 5MI0C 5JOFB 1XCQA 3AY4A 4CN6A 4ZTOH 2ED8A 4NGHL 1RSFA 5E0QA 2XYCA 2NQCA 4K8RH 1UZ6F 2AEQL 1P7QA 1T1WA 2XTJB 4MDIB 2PCPA 3EBAA 2YA1A 4K7FA 4WGWB 4R8WH 1D5BB 2HFFA 3CMGA 3JSSA 4CJ1A 1TENA 2VH5H 3GUTB 1XMWA 4U1JB 1FBIH 5CBAB 4ZPTB 2CK0L 4HPYH 3U79A 4C55A 3WFHA 4JY4A 3RPKA 4GLRI 1D7FA 3FKUS 1X5XA 4TSCH 2C1PB 3VE0A 5E7BA 4TNWK 1UJ3A 5INCB 3WSQH 1WJ3A 5F1KC 2VLLB 3GMMB 5ESAB 1CG9B 1T80A 3SGEH 1CFSB 1KJVA 1NSNL 3D85D 4TUOB 2Y6SC 3JTTB 1FNLA 3OR7A 3SGDI 3AROA 1LDSA 1OAXH 3IJHA 3EO1A 1BD2E 3T8XB 3WJJA 1PZ5B 5JOEA 4PJDF 5DJZB 4Y5YA 3TJHC 1S7RB 4WU5B 1K8DB 1PX4A 2AJSH 3RNKB 4KK6C 3JWNC 1C5DA 3EGSB 3AS2A 4PGCA 5IVXB 4UDUB 1HHJB 1WAAF 3D85A 1EV2E 2QHLA 4NQCD 2IFGA 2H2SC 1I9IL 4UU9B 5F9DC 4JY6B 4X7CC 4XC3H 3U7WL 2Q6WA 1RI8A 2Q8AL 1JZ4A 5E6ZA 2IALB 4BZ2H 3MRBA 4DOHE 3C09B 2EE3A 2IFFH 3ARDB 6CGTA 3EOBB 4PJ5B 1CT8A 1WWWX 4OF8A 3VFGL 3G6DH 1F90L 1BVKA 4NQCA 4MQTB 2AAVA 2X41A 1WCBA 4OUUA 5B21A 5I1CH 1E0OB 1EAPB 1KJMA 4XPBH 1QSFD 1NC2B 3SDCC 4HSQA 4BQBA 2P8PB 4IEFB 5DUMH 4PR5A 3MMEA 2R2EA 1T2QH 2YN5A 5E70A 2W0PA 5F7DB 3U0TB 3GGWB 4QRRB 5E00A 3I2CH 1QSFA 4OGZA 4LCIH 3B9AA 1GCFA 1UB5B 1FQ9C 2VLRB 5EUKB 1CZ8L 1PGRB 3ZE1E 4JFYB 4PJCA 3OKEA 4RDQG 1ORSB 1YQVH 1FZJB 3VFTB 1QG3A 1ZGLB 3L7FA 4S1RL 1I8IB 2YA2A 4LCYA 1A1OA 4N0YL 4IRSB 1ONQA 1RURH 2AXGB 4OFPA 1LO2H 4NM8L 1CR9L 4G6ML 1A1NA 5TDPA 1NCDL 5FUOH 4HFWB 5EA0L 4CAGA 4UTBL 2KBGA 4K3EH 3UO1L 4LVHC 5E7FA 1LE9B 4ZFGH 4UILH 1DBKH 5TE6H 3GMOA 4R0LB 1GGBL 1NBZA 5KVDH 1ZHBB 5DQ9A 1TNNA 4OZFB 1FIGH 4G5ZH 1KBGL 2FWOA 1S7UA 3KPLA 1BX2A 5I8KL 1G6VK 5EUOA 2DQUL 2VZVA 4ODVH 4RAUB 5E9DE 5FCUL 4S1QH 3QHTC 4TRPH 1NCUA 1FL3B 1BVLA 3QNZB 4BSJA 1BQLL 5K9QG 1MREL 4OZGB 1Z9OA 4X5XB 4QRTB 1FZMA 3L3GA 3FFCD 3WFEL 3A6CL 3QUMH 4L8BB 3BVNA 2DKUA 1WLHA 5CD3A 4D0BA 1P4IL 3QRGH 2H8PA 3UYRL 1YN6A 4D0CB 2BOBB 3W2DL 1TQCB 3QI9D 1QBLL 4K2UH 2J1KA 3PIQB 2WNGA 5J11C 4RFNB 4JPWL 3PP4L 1B2WH 2MWCA 4M8VA 3BPCB 3CFCL 2YWZA 3BQUC 2VDLH 3BRFA 1DBMH 5IW3A 4N0FB 4Z7VF 5SX4H 3HCVB 3QI9A 1E6OH 3VGDA 5C0GB 1IEAB 2A77L 4L4VD 3TIDB 3NIDF 3CXDH 4X4ZA 4OCRL 4X6DA 1I7UB 5FHBH 2OK0H 5CEXB 1JIBA 2R1XA 4G6AC 3VD7A 3FT4A 3UYPA 4KUZL 1HSBA 4OQTL 4ZUSB 4IS6B 4FMFA 4P5KB 2ZPKH 4XZUB 1EXUB 4KXZH 3MRLB 4JGUA 2XA3A 4L4VA 1QBAA 4G6KH 1EHNA 2V2TA 4J3TA 3UZVB 4XP6H 1F4YH 1LWRA 3QISA 4JN2B 2L0DA 4Q9RH 1RHHA 1PBYA 1E28A 1CDIA 4JVUA 1X9QA 3TFKC 5F7YC 1CGSL 1NMCC 5ITBH 2DICA 2RCSL 4WCYH 4G9FE 1JZ6A 3HFMH 1SJHB 4KGLA 2G2RA 1QKZL 5DJAB 2WZPD 5TDNB 3ULVE 5BOPA 1C16A 1J1XL 1H8OA 2O5XL 2NY6B 5T3XL 3REVA 3M17B 1MQ8A 2YBRB 1NMBH 1YNKL 1YECH 1MJUH 5IMKA 1HXYB 1FGNL 4KZDH 4K9EH 3FZUC 5LBSH 4DGIL 3RGHA 1YPZF 4TNVF 1BD2D 1DEEA 3B2UC 4KRPB 4Z7QE 4WI4A 2NY5H 2JB5H 4P4KC 4XP9L 4Y5VC 1S9YB 1MLBA 3TO4B 4I0KA 3STBA 3EUUA 2I24N 3ISWA 1I8KB 2L7JA 3INUH 4PJEB 4YHLL 4XNYL 1BD2A 4LHQB 4UB0H 5FM5O 1HINL 3RIFK 2OSLA 2LFGA 5TDOA 3QPQC 4OLXH 2CRYA 3DYPA 1OLZA 4PRAB 2AV7B 3SQOH 5E95B 1ZMYA 4DW2L 3GSUA 2C26A 1T2JA 4JRXB 3F58L 2DQIL 3L7EA 4DKFH 1MCWW 3EFFA 4X6EA 5HGGS 4DKEL 4JFOB 1MCRA 3WCYA 3WUWA 4PTTB 4R2GC 3EAKA 5KZCD 4OCYL 5I1AA 4JO2H 5F9JB 2AJYH 5DMYA 1H3XA 1R5IB 1U92B 3TBWB 4P2YA 2OJZH 4LRIA 5DGRA 3QQ9C 1JFQH 4OZHE 4OI8A 3BGAA 2I26N 2FNBA 5B38B 2WUBH 4PIRF 5CZXD 5SWQB 5C0JB 1SY6A 4GFTB 3IRPX 3BGMA 3H0TB 2YXMA 4IIQB 5JZ7C 1JNJA 1AXIB 5JMOC 2Z35A 4CDHA 4WW2F 2VDKH 4DCQA 1QNZH 4F7EB 1GC1H 4NWUL 5EWIH 5AUMB 1J87A 1S7VA 4JVPA 4NKDA 4RA0C 2Z91B 3HE6A 1X5ZA 3F7YA 4HC1L 4HT1L 1A0QH 5DHYA 3JWDH 3IAQA 1H3WM 2Z8RA 3OKNA 1WBZB 1XF5B 4AK1A 4YXLH 2PXYA 5KSBB 3OZ9L 3STZB 3S88H 3CLFL 4OKDA 3GMNA 1UXWA 3RUGB 5ISZE 1MY5A 4KJWC 2J8UB 1CDCA 4X6BB 3BO8B 1UVQB 2UZIH 4YBQD 2VAAB 3PP3H 5IMOA 5C92A 5EOQL 4GRWB 3T1FA 5IEHA 3GBNL 5HD8C 1K4DA 1IT9H 2AEWA 3FB6B 1EAJA 1QLFA 5JMRA 1CFTA 4MJ6A 3LZFL 1A64A 2YMXH 4ODWA 3SDXE 5KN5A 2VR9A 3TJEH 3TNNA 4S0SD 3BMWA 5GS2D 4MMZC 5E9DA 5KSAC 3KPQA 3TBVB 1D6EA 1ZXQA 2C3VA 3ARGB 4N0CC 4PJBB 5C0BB 5E2VH 1OP5H 1HNFA 1EFQA 1V7ML 3HMXH 4BH8B 1ZLUK 1LK3H 3F7VA 1TFHA 2GFBA 1J11A 4YBLB 2YWYA 3KR3H 4NQSA 2P7TA 3IF1B 1AY1L 3C5ZB 3HE7B 4M43H 2VZSA 4NRZA 4YK4C 1P7KB 5F7KC 3O6KH 4PLKC 3E3QC 3OAZK 4J3XA 2NX5E 4JB9L 5DQDH 4AT6B 4YQXH 4DTGH 4JJ5A 1DBBH 3SKOB 4QTHB 5IW6A 1HYRC 2SEBB 3EO0A 3HS0A 4M6AA 2WINB 4GS7C 1WC7B 1ITBB 4HH8A 3V4PL 5FUZH 2VDRH 4XPGH 3C87A 5IB3A 1QP1A 4ONFH 4KY1L 4NNPL 3SE3A 1U8PA 4JFXB 1CWVA 3W81A 1MHHB 2XRAL 3VWKC 4TUKH 3MLWH 4PD4J 1BJ1H 3G9VA 2VDPL 4Z7NF 2HRLA 4DVBA 1B9ZA 3LV3B 2EH7H 3BW9B 1I85A 4FQLL 1YMMB 4U1MB 5MHSE 5FFLA 1K5NB 2DLGA 2J5LC 4E41D 4CUCA 4PLJD 3P0YL 4YIQA 1GJIA 4JHWL 1V5JA 3JV5A 3V6ZB 4JN1L 3S8WA 5HGAA 4DK6A 4Y1AB 1A5FH 5C2BL 3RWIB 1VHPA 4M1CD 4MX7A 4ETQA 3ULVD 2F19L 4G80A 2YD2A 5BQ7B 1H8SA 1S7WA 1FDLL 2DWDA 4H1LB 1J88A 3QPXH 4XXCA 4JG0L 3SPVB 5IR1B 4G9FA 4XBEL 1U93B 3KYKL 5DJ8A 2EICA 2EH8L 4JFFB 5DD1H 1T1YB 3LIZL 43CAA 5DQJA 5I75B 1QSZA 1GAFL 1D3CA 4XCCL 3RX5A 5B8CB 1KNOA 1DDHA 4HWEL 5IW1B 3IU4L 3MACH 4EI6B 1X6LA 4M7LT 5D7JB 2Z8VC 3PGFH 2HMIC 2GK0B 4L8SA 3UTTB 3D39E 2V9QA 3T3PE 1YEIH 1HI6A 3H9SB 4MA1B 4XHQA 4OIIL 3MX0A 1CE6B 3EDJA 4QXGH 1EHAA 3EYQC 3K46A 4F7TB 2PTTA 4R4BB 3MUZ1 3RL2A 3SDAC 1NCNA 1WVZA 5TGBB 4MQ7A 3ZL4L 1CBVH 2CXGA 2IPTH 1F6FB 2C3GA 2DJUA 5EU3B 3VI4E 2P42B 3LCYA 1P2CB 4NFCA 3C6LB 1RIHH 3KPPB 2BMKB 2RIKA 4S2SB 3BKJH 3TWCH 2Y25A 3WS6C 1I7TA 4DGYL 4YE4L 2PW1B 3VH8G 3IDJB 5JW3H 2WWMC 1A9EA 5BZWA 2RFXA 5F7UA 4ZS7L 1GZQA 3U4EB 4IOFD 3VXSE 4C57C 3MRGB 5TE7H 3GB7A 3OKYA 1ACZA 5DRNA 5DS8B 4HUXA 3SE4C 2XZAL 2ZCLL 4RZCA 1MCPL 1L6XA 4KK9C 3RKPA 2UV3A 4IRJD 2ZP0T 5IBTL 2AGJL 1T3FB 1Q38A 3PGCA 4OZHA 2ZG3A 1LP9B 1J8HB 1S9VB 2FJFA 4MD0A 5MEOA 1T7YA 2XWBB 3MNZB 1QLRB 1L7TH 3BT2L 4K8RD 3Q1SL 1QR4A 1U3HC 2B1HH 3WIFB 1I9JL 3EYSL 4P9HC 4IOIA 1OHQA 4IRJA 2G9HB 3DTXB 2CUIA 1N8ZA 3VW3L 1XGQB 5EPMA 5FYLL 1F4XL 3RWJA 2AJXL 4IDLA 2XXMB 2OR9L 2Y6SD 2KZ1B 4ZTPH 2WBJC 2MFNA 4HBCH 2RB8A 4GQ9L 3VRLE 1U8JB 4OLWL 5ACZB 3GSXB 1A7RH 3TO2B 3LS4L 4F58L 3S96B 2A83A 3AMLA 3F7PC 3LPGA 4JFZL 1AR1D 5I1GH 4DAGH 5ISZA 2W9EH 4PJ9B 3D0LA 1G7HA 1QLEL 5DTFB 1MJJB 5DD0L 3G6JF 3JWOC 4FQIL 3V95A 3X13A 2O5YH 5HGBA 3VGBA 5HDBE 1II4E 3J8F7 3SDXA 1E4KC 2I25N 4UV4H 1IMHC 2C7UA 3DX6B 1HIMH 4K55A 3LSOB 3OKKA 4PG2A 1D6VH 1BM3H 4HKZB 2ZCHH 4KROC 5DVMA 1LEGA 2R1WA 3B6SB 5GGVY 4MNQB 2ICWI 2NX5D 3QUKA 5K9KB 1OTTD 3OF6D 5IWLC 1OM3H 2EXYD 1CICD 4EVNB 3QO0A 3BDYL 4AM0B 3BH9B 2GJZA 1B0GB 4NP4L 35C8H 3MRDB 3EOAA 2D4DA 2X4RB 3GMRA 1A47A 5E2TL 5AEAA 5H35B 2DN7A 4MVBC 2HJKB 4LSDA 4EI5D 2XI9A 1N6UA 2P48B 4HIIA 3HB3D 1OT1A 4OM1H 3RVWC 2NX5A 3QIUD 4HUUA 3S98A 4P57B 2PUQT 3OF6A 1U41A 5DRXB 1KT2A 2BY2A 3SDCA 4ELKB 3W0WB 1CICA 2F5AH 1EPFA 3P4LA 2ORBL 4LHUB 2AKRB 3DYMA 2FX9H 1BGXL 4EI5A 4WY7L 2EDNA 3NFPA 3QIUA 5DHXB 2ADFL 5CZVH 2ZJSH 4PG9B 1IAKA 4H5SA 3RWEA 3G5ZB 3S34H 4HW6A 3KDMB 3MPCA 4KTDH 4O00A 4W70A 2F54E 5BVJB 1U95A 1JPGB 4L3EB 2HAZA 1BQSA 5IG7A 3OKLB 1C7TA 4BUHA 5I18H 2HWZL 2VABA 1CI5A 4LVOC 3V52H 5GRXG 3BKCL 3ZE0F 1HXMB 4NC1E 2P5WB 3GSOA 4Z7UB 3GKZA 2OR8A 3HC0B 4M8QA 2AXFA 3OR6A 3WLWC 3MO1A 3QJFA 1N6QH 1XGYL 3BPOC 3T0EB 4D8PB 3B9DA 5FK9B 5F7EH 4YHZH 4PJXE 4YLQT 3D39D 3EHBD 4JQIH 2YD7A 2EYRB 1MI5B 3FJTA 3IYLW 1N0XL 4HIHB 4WHTB 1MCQA 2OP4L 1KN2L 4F7CB 3N85L 1YUHA 1HHKA 1XF4A 4G9DB 2J4WH 1P69B 1PY4A 4RGNC 3SDDD 1EA9C 3M07A 3GK8H 4U1SA 3D39A 3E3QE 3S3PA 4WV1B 1JNNL 1J0YA 1DE4B 1AC6A 1T22B 3TVMB 4Z0BL 1Z6JT 4WTXA 4PREA 5FF6A 2C4XA 4XMKL 1T2XA 3KPNB 2R0KH 4XVUC 2VE6A 1V3MA 2VXTL 5KW9H 3Q6GH 1B0RB 4BSWA 3SDDA 3VA6A 1UYWH 1IEBB 2X4UA 4FNLH 4U3CA 3MZGB 3IVKA 4GKOA 3BUYA 2HVKB 3O6ML 3QWOA 1SQ2N 5EORH 2BSED 5EU5B 2XZQL 4IJ3C 1N4XH 1S9KC 4PRIE 3SGJA 4XMLH 1KEGL 3RDTC 2CPCA 4MGXA 2OJEB 2DBJA 2IAMC 5LWYH 4JM2B 1V3JA 1YEGH 3MRQA 1TLKA