4KKCD

Structure of the e148a mutant of clc-ec1 deltanc construct in 20mm bromide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
molecule tags Transport protein
source organism Escherichia coli
publication title Fluoride-dependent interruption of the transport cycle of a CLC Cl(-)/H(+) antiporter.
pubmed doi rcsb
total genus 46
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkcD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kkcD01
2C3VA 1RJCA 4FQPA 4HKZA 5GIRA 2NXZB 3SHSA 3TPUB 1EJOH 4UTAL 3TJHD 4NN7C 1G9MC 1BZQK 5EUKB 1Q9OA 1ZVHA 3DUUB 1LP9F 1IGJB 2QQNL 3QCUL 3VG0L 1M7IB 1CVSC 5GS0H 4O4YL 1NGQH 2H1PH 5EULV 5D1XC 4DEPB 3O6LL 4XTRD 3QEHA 3ARFC 1Y6MR 4G9FA 4ZAKB 5FO8B 2KQMA 3DYMA 1UXWB 4PJCF 2F19L 5SWSB 1T1YA 1KJ3L 4GSDH 2X4SB 4PBWD 1CI5A 1G7IB 3VFMB 4MD0B 5FAAA 1IM9B 1MAMH 2W0FB 5FKPB 4OD3H 1ZA6B 3SGDH 1T83A 3WDHA 4UIMA 2PCPA 1CXHA 5HDBE 2BNUA 4G8IA 1ZTXL 3RL2B 3UBXI 3RI5K 2CRIA 1NAMA 3D2UA 5IFJB 3ZSTA 4OFDA 4YIQA 4AK1A 4JKPL 4NCC1 3FRUA 5L8JB 4QRPD 2I26N 2QSCL 3CFIC 3H7LA 2B20A 1PZ5A 2CK2A 4WO4D 1ERNA 2HJLA 3P30H 5D6CA 1IFHH 4FQLH 1T03L 4G9DB 3CDCA 3QG7H 2DLEA 1J12A 1TJGL 4F3FB 5E2VL 3IDUA 3NZ8B 4IRJD 2GJ6A 3WFBL 3X13A 5KBNC 2VOTA 4WFGD 3LQAC 4KKAD 1Z2KA 2P5WE 5I8OH 2DD8H 2ED8A 4HZAA 2DDQL 4L3CB 4WO4C 3WJLA 4PPTA 5DK0B 3IVKB 4WI6A 4MNHA 4JE4B 1T6WA 5FHBH 1MI5A 2MTPA 1FC1A 1EZVX 4F7MA 4CGTA 1P4BH 4P57B 4K8RC 3MLVH 1BQHA 4J1UB 3MBXH 1QBML 1S7VB 2D2OA 4NUJA 2ICWA 1B2WH 2AJZB 4ZFOA 5I73C 2GTZB 5IFJA 2LU3A 3V4UH 3STLA 4WW1A 1DL7L 2E9IA 4OFKA 4KI5C 1QNZL 4PRHB 4D9LL 4Q9RH 3L3JA 3PL6B 43CAA 3VFOA 2B5IC 4XT1C 3TA3A 5HYSA 5EUOB 1OTUC 2DQUH 1Q94B 5CZVH 5KS9B 3HC0A 5EZOH 3PGDB 3RTQA 5MEOB 3HZKA 1U3ZA 4OGYL 3QSKB 3GZKA 1S9XA 5HPMB 4HK0A 4QHMA 3CIQA 1K9TA 3UJTH 5CIPB 1I3RB 3S5LA 5EFIB 4OZIA 4PJDE 1P7HL 1I7RB 3BN3B 1IC5H 4WU5A 5CIPH 3S36X 2AK4A 4ODTH 1B2WL 2CO6B 5F96H 3PHSA 4DKAA 3UYOD 1T2JA 4MB3A 3C2AH 1VKXB 3RWCB 4PRIB 5HD8C 4M1GH 3L3GB 1CQYA 5IHLB 1KXTB 2HKHH 4NWUH 5FM4A 2BVTA 4CNIB 1INDH 3MV11 1D5ZA 2OBGA 4P2QA 5GS1C 3SEPA 3VXRE 3AC0A 3C6LD 3MA7A 4Q6IB 1PKQA 4K3JL 3SKJH 4MB5A 2QR0B 3FT3B 5IBUB 2BHYA 4PJXE 1EGJA 2Z4QB 2AV1B 1IAKB 3B5HA 4RMSA 3MMEB 2N4IA 3VFUA 3TH3T 2Y7QB 1CG9A 1MCLA 1LDSA 4R2GD 4KK9D 1XGRB 2VDOL 4ZS7L 3O0RH 3V5DA 1AKJD 5AZ2L 2AXHA 1DE4B 3VFSB 2NY1C 3OKOA 2K1MA 5L0QB 4UT6H 4LFHG 1UYWH 1MVFA 2NCMA 2ARJA 4BSWB 2PXYC 3KPOB 3GJFH 1NMBH 1ZEAL 2PYEA 1MWAB 5D6DC 3H9ZA 2FHCA 3VFPA 1Q1JL 1SYVB 2QJDA 1A1NB 3I9GL 2X4UA 3JVGA 3DSFH 3T0XA 4J3WA 4KV5E 3HZYB 5LGJB 1BREA 4MWFB 1KTDA 3SE4A 1U8NA 4XPBH 3SDYL 1OD7A 2WWKO 3IDMA 1KF9B 2FJFA 1SJHA 2X1QA 3RGVD 3LD8B 1G7IA 1U8JB 4KRPC 3S34H 1FYTE 1PQZB 5TPWL 2NY4B 1A9EB 5DDHA 3QG6A 1U91A 4LMQI 5AZEH 1P4IL 3MV7D 4X5LA 2HVJA 4MQ7A 2ZCLH 4TULH 1FVEA 4XNMB 3HE6A 1KBGH 5E2JA 3V4PL 4MJID 4XGZB 5JQ6L 1BLNA 4L5FL 3FFCD 3BJLA 2WSKA 2I25N 2W0FA 5IV2B 2DIJA 4P46D 4OFYA 4X99B 2X4SA 4EUPB 1U41A 4M43H 3VXSE 5H37G 5T5NG 1UACH 2YMXL 4FABL 1TTUA 1KCVH 3KYKL 4JVPA 1WTLA 4LPYA 2M1KA 4OF7A 35C8H 2ATKA 2F5BL 3AS0A 4L8CA 5TQ2H 4FQJH 4DTGL 3B2UD 4WIQA 4PBVC 1GYAA 5E8OA 1U8IB 4RGNC 4LEXH 1HKLH 2DB8A 4RX4D 4PV9B 3ZHDA 5HYJE 5EUKA 3WSQL 5CEXA 1ZLUH 3H3KA 5C6TL 4QXGL 4XP4H 2YD9A 4JZNB 4Q0XH 2D0FA 5TF0A 5JHLL 2AQ2A 3HMWL 3VXUD 1RURL 3G6JB 4QRUA 5TQ0L 5ISZA 4OLXH 1IQDA 1QLFA 4ZUVB 4PRAA 5C6WH 3U83A 1F8TL 5K9KB 1CE1H 1CXKA 4JHWL 2FSEA 3P0YH 4KHXH 5F7WC 1T0PB 5KZCD 5IVXB 1JWMA 2JTDA 3HAEG 5EC2A 4IMKA 3QDMD 4P9ML 3RWGB 1H5BA 5FV1L 5GGRY 4CADA 2BVQB 5F1NB 5A3ID 1BM3H 5GGSY 1UB6A 4GXVH 5E9DE 3VWJA 1X5HA 1UKTA 3S3PA 3TT3H 1JTOA 5I1JH 4TTGA 1JYNA 3FONA 1N26A 5D71L 1CIDA 2DF3A 4NHCL 4OIIL 3Q6FB 1A0QL 1CICA 4WO4B 4NQSB 4S1RH 5C3TA 3I02B 3HUJF 2NPLX 4DGYH 1GZQA 5JW4R 4LNRA 3VI4E 3GMNB 1SY6A 2IPUG 1QO3B 1K4DA 3BGMB 1G7QB 1J8HE 3O4OB 4N5ED 4CW1A 3HC4H 1C8PA 2NY0D 2A6JA 2H26B 4YDJA 2FCBA 1JPFB 3WYRA 1D6VL 1ZHNB 3CXHK 1HWHB 1MWAL 4ALAH 3S88L 4G8GE 4Y2OA 4CVWA 4Y5YA 4LRIA 5SWZE 2CLVB 3BVNB 3PE9A 3OR6A 5FOBB 4OZGB 3W39B 2DS4A 4KI5D 2BNQA 5EOCJ 3DRQB 4JFOA 3QXAA 4ZUUA 3HE7B 5GJTH 4WI9A 2G5BA 1A64A 3A6BH 1QBBA 3T0WA 4Y19D 3MV7A 4MNQD 4ACPA 2UWEE 3BXNA 3G08B 4PJCB 4FQXB 3F65A 4OZ4A 2VWEC 5E9DA 5FYJE 5TGBB 4IIQB 1BZ9A 3EYVB 4OFPA 3V0VB 5BOPA 1QO3A 1GIGH 4N0CC 1IT9H 1LO2L 4PJXF 1FZJB 3UBXB 3GSNL 2CR6A 5IW1A 2ZSVA 1FZKB 3GNML 1ZLWH 4X6CE 2DBJA 1M7DB 5F7EH 2FSEB 1CLOH 2XY1A 3BJ91 4JANA 4ODHH 2P5WB 2ADIB 1ADQA 1J11A 3EGSA 4Z7UE 3ULVC 1AGEA 4HWNA 2B0SL 3IAGC 2GJ6D 1KT2A 4TUKH 1RQ5A 1OAXH 3DUSB 1SBSL 2ERJB 2VL4A 2IFFH 4Z95L 1DFBH 1QBAA 1CK0H 4HKXA 4MQTB 5EA0H 3TCLA 4MAYD 5KVDL 1R5VB 1S7TB 5DRXB 4JRXE 1H0DA 2PO6D 3C5ZA 2HJKA 3ZMRA 3T77B 5BJTA 2P44B 1QSEE 1KJVB 4NWTH 4PJ5D 5CZKA 3HFMH 1A9BB 4JRWA 4P9HC 5E2UH 4S1QL 5DUPL 1FCCA 1LE9B 1BFOB 4JG0L 3BP4B 2VDQH 4K7PY 4KJWD 5JXEC 3RVVC 4LQ1A 4HJGB 4NQDA 2APBA 3PNWA 2CUIA 2BOBB 1LP9A 5FHAH 1RVFL 4LKCA 5ICXA 3WL9B 1VERA 5GHWL 2QV2A 1I1AD 4D3CL 2NY3B 3GRWA 1E6JL 4KJQC 1L7TH 2KH2B 1SJHB 5DD0L 4XPFH 1DBKH 5I1LB 4NIKB 4XGZA 2R0WL 3WJJA 1I8KA 5HHNB 3G6DL 4PJHB 3AM8A 4EQ2A 5KOVC 3L95B 4F9PA 1GGYA 3TCXA 5LXGH 4JFFB 1NGXB 5TJWK 5C0NC 4Y2DA 4AENB 3NPSB 1U3HC 5AAMA 1MCWM 1GCFA 3KPMA 2DKSA 5FOJA 2DL2A 2EKSB 1DLFH 2I60H 3MUY1 1ONQB 4BSVA 2YA1A 4RRPG 2FLRT 3UDWC 3MREB 2IH3A 4IBLT 3TBYB 2E8YA 3IDMB 3DOSA 4HS3A 2FH8A 2JE8A 3FZUD 1FDLH 1JV5B 4O2EA 4EQ3A 5FYJU 5IFAH 4YQXL 1HH9B 4P3DB 2DQFB 4N1CA 1UCBH 3SGJA 3J8F7 4GS7B 5BS0B 3BZ4A 3ECBA 3Q1SH 1X4XA 4Y8DC 2DLFH 3X3FL 4U3HA 4D0BA 5HI5C 5GQBA 5GXBB 1CXLA 2XZCL 5BXFA 4K9EH 5GSVA 1B6UA 1LWRA 4IOFC 5DWUH 4OLXL 1JRHH 4XWOD 5HHOE 2WP3O 1NC4A 2R8SH 3HNVH 5IMLA 4ZQKA 2YPVL 4QXGH 4XP4L 5CGMA 1F4WH 4Y16D 4DZ8A 3C09B 5I1EL 1W72A 3AAZA 1FORL 4NQED 1BWMA 1R3IL 4M5YL 1G7LB 2Z9TA 4K8RD 1U8KB 2VXUH 5IKCA 3L95A 4KK8D 3VXUB 35C8L 4R8WH 1KJ2B 1KTRL 2CRMA 3IGAA 4O58H 4M61A 1C1EH 4ZOAA 2E7CA 2QR0A 3FT3A 5E5UB 5EFIA 2AJXL 1OD9A 2YPLB 4FQQA 4U3XA 4G6FD 3TIEB 4LVHB 4N0CD 1EA9C 1UJ3A 3ZTNH 3EOTL 4UIKL 4U4BA 2XWJA 3QCTL 4NSKA 4X9GA 1MEXL 4YGVB 4KKCC 2UYLA 4ONHA 4HV8B 1Q9WA 3J7HA 5IVZA 5ENWB 2H8PA 2FB4L 1VACB 5F3HA 2R9HC 4XRCA 2R1YB 4EEEA 1KPRA 1KIQB 2AJUL 5DD5L 4XNYH 2GUOA 5EU7C 3KPRD 1NEUA 2BMKA 5I2IA 3TN0C 4E42A 4IMLA 1YEHL 4OFYD 3CLFL 1J05B 4PJ7E 4EDWL 3CH8A 5FYLD 1OLLA 2JK5A 5HGGS 4X7DC 2YA0A 1F3RB 1MCOL 4HS6A 3QIWB 2FZ3A 5GGUB 3SE4C 3I9GH 3KYOA 3UTTA 3C6LC 3B9VA 5HDOA 1I9RH 3UZEA 2FBJH 1T0NB 3P9MA 3STLB 4OB5H 2HFGL 1MAKA 4ONFH 1Z3GH 2EH8L 4WUUA 4LIQH 2XG4A 4RGOL 5J8OA 2BSSB 3H9SB 1ZSDA 3OJ2C 2R9HD 3BX7C 4R26H 1CD1B 2R0LH 2LQRA 4FTVD 4B5EA 2VIRA 4NO3A 4AEHL 5L6YH 2EDFA 4MWFA 4KKLD 2J5LB 1FZJA 3ILQC 5F70A 3RUGA 2A6KA 4WNQB 3MRGA 3O6FB 4OCWH 4S10A 3TP4A 5DXWA 4QTHB 1CD8A 1F3DJ 4BK4A 1IM9D 4B53A 4MAYC 3PF2A 3C9NA 4NO5A 3VGDA 4HIXH 2A83B 3ARGA 4HUMB 3VFRB 2HVJB 4MQ7B 4ZSOA 2RBLA 1PDKA 1GZPA 2WLYA 3G5YB 4LGRB 1YC8A 4MGXA 4WEBH 1JK8A 3WLWD 3CMOH 4P2RD 1LO4L 4QY8B 1W0YT 4LLUB 5FDYA 5LGHL 4PGCB 1DE4A 1NANH 1EZVY 1RIUH 2VRAA 5GRVK 2VXQL 4MNQA 1MQKH 3IXTA 5EBMB 3U0WL 5IHUH 5I9QC 4A2LA 4WWKC 1NCAH 2MQCA 1C7TA 3D18A 5KSAD 1S78C 5HHPB 4BQ8A 2Z0BA 3UZQA 4B7LA 3PABA 5L9DH 3F7PC 3TWCH 3VXOB 1RK0A 1CGXA 3O81A 2IADA 3BZEA 1F4XH 1D5BB 3QQ3A 1WZMA 5B39G 2VLLA 3QCVH 1KJ2L 5I2IB 4GUPA 2AABH 1BBJA 1YDPA 4YHNA 2IC2A 5HGAB 1OHQA 1VADB 3VMNA 1HHJB 2OMNA 1CQKA 3BAEH 5D1ZB 1HWGB 3BH9B 3I75A 3NIGF 1KB5L 2DJUA 5MENA 3FO9B 2ATPA 3MRHB 4I3GA 1DBAH 3JV4B 1FP5A 4X7FC 1IGJA 2BHUA 5FYKE 3L3OA 5ILTL 3DV4A 1QHPA 5B3JF 3E2HC 1Q9OB 4Y1AA 5IBLC 1OAZL 2EDDA 4LARL 3W9EA 5E94B 1R24A 1QTYT 4XMLH 3DBXA 2P5EA 2UZXB 2X41A 1NL0L 1TPXB 5D7LD 5DQJB 3TT1H 1LO3L 3FO1B 3AMKA 1I1YA 5EU6B 5EU5B 1GC1H 4EI5B 3CFJA 4L4VA 3QXTA 2NX5B 4MA7H 1IGIH 2OZ4H 2G60H 3MA7B 4Q6IA 3HPLA 3PWPB 5FF6A 2NTFB 1ACZA 4TPRL 3FRPG 2YK1L 3O8XD 4NN6C 1UKQA 1KB5B 4HH9B 5D9SA 2R1WB 3MXWL 3NA9L 1AKJA 5CCKL 4GLRH 5GRUL 1ZHBB 5IVXF 5HHQB 3INUL 4XC1L 1MFEL 2YRZA 4AIZA 3DX6A 4LSUH 1S7VA 1OW0A 1GVIA 5E8OB 3QZWB 3BHBA 3PV6B 3LEVL 1HHHB 3I75B 2VLRB 4HG4K 4TUOB 2J3SA 3I85A 1AH1A 2R23B 2XWJB 5C09B 3FB8A 3K74B 1ZHKA 1D6EA 3MRKB 1NLBH 3MFFB 3IF1A 4LQFL 5MEQA 3I3BA 5T1KD 2PR4L 2IQAB 2BSRA 2VLJA 1RUKH 4CL7A 2A0LC 3MV01 1MREL 3THMH 2Q8BH 2BC4B 5J06A 1G84A 1BWWA 1BLNB 2XZAH 2NX5E 1UCTA 3DSNA 3ZHKA 2BRRH 5JORB 4MXWH 5AUMA 5IGXL 2E9JA 5E2WH 3QPXL 2FIRT 1KTKE 1JHTA 4K3GA 4JO3H 5CUSH 4XCNB 2P8MA 1UZ6F 1U8PB 4QRPA 3ROLA 4AT6B 1OL0A 5EB9A 3RU8H 4Y8AA 1LK2A 1OY3B 1Z5LA 4O9HH 3NFNB 5M95B 1QR4A 1V8HA 3ARRA 1H3PL 1XF1A 3U30B 1H15B 4OLVH 3BKCH 3SE9H 5LGKA 1T2QL 1DANT 1MCHA 4MCYA 4UAOB 2F54D 3IDIA 1G7QA 5I17B 4X4ME 3O41B 4LU5L 3FFCA 4GXUM 4U1NB 3NACL 4PUBL 3L6FB 2A6KB 3MOAH 4XCEB 4YR6B 3QRGH 3ZKXC 4HS8L 1XT5A 2BOBA 5EZJB 2R23A 4NRZA 4XX1G 2VLRA 4L3ED 2HH0L 4O2FA 2OL3H 1KPUB 3QXDA 3W0WE 3ARGD 3PP3K 2UWEF 4KROC 3ZL4L 2EDEA 3V5DB 4GT7A 5I1GH 1S3KH 1LE5B 4AENA 5TDPA 4FZ8L 1IGCH 2IMNA 1CE6B 1NGXA 1GHFH 3MRCB 4KZEH 2Y06L 1IGYA 4CDHA 1WITA 2R0KL 3V7AE 4F8TA 1RIHL 4MJIB 5F72S 5JMRA 1G9NH 4JPWH 1QACA 5E00A 5ICZB 4MXWL 1MH5B 2NY2C 3R06A 1KLUB 5J6GA 6CGTA 2HFTA 1MREH 3OKNB 4U31A 2YRLA 4WU7A 3MQIA 1SY6L 2Z31B 1KEMH 3DIFA 4LSRH 4FXGB 1OGTA 1YYMH 3VFWA 4X4YB 4I2XE 4OZHB 2IG2H 2BVEA 4BH8A 1HYSD 4U1HB 1J8HB 4NQTA 4U6XA 4DW2H 1XR9B 3SKNB 2Q8AL 1A3LH 1RZKH 2VSDA 5D7SH 5J89A 3KPNA 3R8BB 3EUUA 1NDMA 1PFCA 1UENA 4LCWB 3AXLA 5DD1L 1A1MA 1HHKB 1MFEH 1UZ8B 1UJ3B 1AXSB 4LSTL 1UM5L 4MNQE 5MEND 4KKBD 3VU2A 3WJJC 3RY6A 1N6QL 5DD3H 4IIQA 1OAUL 3T65B 1BVKA 3ARFA 1ZT4A 3BXNB 4W4OA 3GK8L 4Y5XB 1NBQA 1FL5A 2AP2A 1JNLL 1IVLA 2VE6A 1NEZB 2YKLL 3SE3A 2CLRB 1X5AA 3ULUD 1YMMB 1AGEB 3NABL 3SO3C 2XKNB 4UU9B 1F11A 3ALWA 3CSPA 4HGMA 4O5LH 3NIGE 2P5WA 4OZFH 4X6FB 2IBBA 3QXAB 1F4HA 1U8JA 5FYJL 4HZLB 5EWIL 1DUYB 1YEIL 2NX5D 3BQUB 5FCUH 2J88H 3LSOA 5C0CD 3EJYD 1EEQA 3I2CL 4X0KB 3T4AB 2Y25A 3U48A 5FGRA 4J2XA 5C08A 3BUYA 4HGKC 2R4SH 3BKML 1OGAD 4TN9A 2VITA 4LL9A 2OS7A 1LO0H 1OAYH 3CNKA 1HXYB 3RTQD 1RD6A 1HEZB 3SDAA 3SQOL 1G6RL 5DLML 3KR3L 1IAII 1OTTD 4XPAH 3B6SA 4Q9BA 4WDIB 4N0UA 4UT7H 2IPUK 4ODSH 2AQ3A 4P2RE 1I85A 5JA8B 2A74B 4UILH 3VA6A 1FAIH 1CDUA 1N8ZB 4HIHB 3OR7B 3QISA 3U7WH 5FYKU 5ACMA 3QFJA 4H20H 3A6OA 3LMJL 4YNYB 3OJDB 3QHFH 1I4FA 2EKSA 2VDLH 1MQKL 2WWMD 1P84K 4GKSA 5DFWH 5J7CC 1DQQA 1H3VA 4DOHE 4HCRL 1N2RB 3SBWA 1RY7B 4LDEB 1ZHBA 5F8QC 3WKNA 1ZVSA 1PLGL 4Z5RA 4JRYD 1YC7A 1NGPL 1NEZG 2XN9D 1EFXB 4PTTA 2WLZA 5AD0A 2GK0B 5JNYB 2YSSA 3VDCA 5EORL 2I9TB 3P2TA 3HC3H 3GIVA 3TNNA 5K93A 4GAGL 4YBLB 1WISA 5ISZB 5DJAA 2JJSA 5FIEA 1ND0A 3AXLB 3EBAA 1BQUA 4EIZC 5IB2B 3LN9A 4R9HA 5JIPA 5L6YL 5I1KL 2K9UA 1SEQL 2P49B 3HUJB 5ADPH 2VLRD 3MJ9L 5D93B 3QFJB 1R3KB 4OSUH 1YEDB 3BD5A 2F8OA 3I84A 1OGAE 1G9MH 1G7MA 4I9WD 3ZLQC 1AY1H 4H1LA 2X9WA 3ZT6A 3WEXA 2H3NA 4ZMAT 1VDGA 2WIIB 3HKFA 5KOMC 3REWB 1WWCA 2X4NA 3MV8B 3C6SA 3VI4F 1IM3B 5T1LB 3MV9D 4UZGA 4R4FL 4WI7A 3HE6B 3PUCA 2HN7A 5DJ6A 5IOPB 2GJJA 1RHHB 2W0PA 2B4CH 4KWUA 4U0RB 5T3ZL 3TBVA 4WW1B 4GAFB 2Q8AH 4FFYL 4NNXA 3L3HB 3OPZH 2DBLH 4L1HA 3HMXH 2ICWB 3JWOL 4QHKI 5GZNC 1S7WA 3RY5A 2AJUH 5DD5H 5CD3A 1J0KA 1K8DB 2VWEE 4ZUSA 1ZMYA 1R3LA 4LSRL 5IB1A 4XPTL 4AH2A 4P5TC 3WXWL 3BW9B 4G8FA 1A7OL 3L7EB 1IEBB 2HTLC 2Y23A 1C7SA 3BEVA 5T1MB 5TE7L 2YD7A 2PKDA 3MCG1 1EO8H 3TEUA 2Z35B 1U8OA 3G6AA 3V6OA 3ECBB 4MAYA 4NKMB 2X1WL 4AJ0A 4MJIE 5C0DA 4TTDD 4KZEL 1H15A 2ZUSA 1OPGL 3VGBA 3LKSA 3W81A 3KLHC 5I8CA 2HJLB 2OTUA 1G6RB 3ZL4H 4Z7NE 3FO0H 2PO6B 5JLZA 2NY2B 4KDTA 3GRWH 3QDMA 1GL4B 4Y2DC 3MACL 4POZD 1FIGL 2R2BB 1FIGH 5DK2A 2HFEA 3HAEB 3L3HA 2DQEL 2JELH 2XKNA 4Y5XC 5H8DA 5EOCH 1N64H 5FEBA 4JO4H 4PUBH 3D0LA 3IJHB 5DTFA 1K2DB 2FO4A 2HRPH 1AI1L 4F2MA 3VFUB 1GGCH 4JRYA 3KLHD 5E24E 1CS6A 4YXLH 3VXSB 5HYJD 3FT2B 3UTOA 4PJ9C 3VFMA 3P11H 1II4E 1YEKH 5DJYA 1SJEB 4UB0H 2IQAA 4Z9KB 3L9RB 3U2SA 1K8IA 1RIVH 4CNIA 4YX2L 1T1ZA 1YEJH 4X6DA 3TNMA 2EE9A 3DX7B 4HIEA 4JJ5B 2Y5TB 1MLBA 3MOQA 1WWWX 2V9QA 1F90H 1V3KA 2QLVB 5D72L 1KCSL 4M5ZL 1AGDB 2FR4B 2VKXA 3L3IB 3BPOB 5J3HD 4KUCF 3BPNB 2P42B 4JFDE 1A9BA 5D8JL 1OGTB 3D0VA 5I71B 4MQXD 2VTFA 4YDIH 5DD6B 4JREB 4CADB 1IGFH 1TQCB 3OPZL 3PWLA 5ADOL 4U1MA 5IBTL 3WFHA 4Z7NF 1KCLA 2QTEA 4FG6C 1URLA 3KYMA 4F15C 1PKQB 2Q6WA 3H9SE 3G6DH 4QXUL 2CIIA 4BYHA 1B3JA 3REVB 5F6IC 5FCSH 5HGBB 4NNYA 1CFSB 5E7BA 1ZVSB 2Z31C 4Z5RB 2V2TA 4PJGA 2ZSWB 5FGBA 8CGTA 2V2XA 2NZ9D 5J4MA 1AY1L 3F7YB 5CWSA 4Z7VA 5ANMB 1W72B 2EDXA 3AAZB 4WENB 4OZIE 4X7EC 5TFSH 4ZNEE 1DVFD 4H26B 2XN9B 4HK3J 1XGUB 4PV8B 2YXMA 4IMKC 2ZOKA 3C8DA 3GFUA 1BZ7B 4WGVB 1HOCB 5JA9A 3ULVH 4O51B 3SY0A 3OJMB 5L88L 5EU4B 4MHHG 4LPUA 3O2DA 1MCIA 4X98B 3UTSE 5BW7C 1IKNA 3AB0C 3O41A 4U3CA 5B39B 2RQ8A 1UEMA 3IJYB 2EDTA 3FQWB 4NQEE 5DO2C 2BOCB 1BVLA 4UUJA 3I6LD 4OLEA 3SDDB 5E99L 1GGIH 2DICA 3HNSL 3U4EB 1A4JB 3QI9C 2AERT 3MRIB 4HUKB 4OV5A 1MY7A 2AEQL 4LCUA 3VE0B 2OK0L 5E95B 3M8OH 2NY5C 1DBML 4XPGL 3ZYOA 3PQYA 4YHIA 4YHYB 4LF3A 2DM3A 4ZS6D 5E1HB 4K7PX 1Z9SA 3BAEL 3B9EA 4U2ZA 1V3JA 2B5IB 5I16A 2DQTL 4OCXH 4M7JH 3OAZK 3IVKA 1AGBB 1QFWM 3I3EA 2YEZA 2V6HA 1RZFL 4CDGC 1TJIH 4Y4KA 3BZFB 2JLLA 3QWRA 1S5HA 2NZIA 2Y07H 1TITA 5FGCB 3OKEA 1T89A 1BX2B 2NY4D 3OF6A 3OMZA 2NTFA 1P7QA 4JFPB 4PY7B 1RI8A 3LRSB 1A6WH 2HG5B 1OTUD 4X6CB 3O11B 1MIEH 5JDSB 3PHOB 2KKQA 1D9KC 4XH2B 1LEIA 3QT2A 1B88A 2X7LA 3H6JA 3OSKA 2DYPA 2B8OT 3BHBB 3SKNA 4H5SB 3EFFB 3QEQE 4PJ9B 4QRTA 4ZOCA 1LE9A 1QRKA 2Q76B 3RGVA 4M6AA 4TSCL 5AG9A 3RWHB 3PWVA 4WU7B 4R7NA 1YNKH 5H35B 4HKZB 5BCAA 2V7NB 3DHMA 4S0SD 1KCUL 2YKLH 4ZPTB 3RVUC 5C07B 1MUJB 5GS1B 3GK8H 2OL3A 4QOKA 1S7UA 4M6OL 1KIPB 1SMAA 4PY7A 3M17A 1LP9E 4R96B 5F7NC 4MD5B 1XF4A 2VERN 3HRPA 5FM5M 3L3GA 4Y4KB 1NFDE 1BQLL 5J9PA 4PJHE 5IESH 1A7PL 4GKZB 3RVVD 2HKFL 1A7BA 3OXRA 1C16A 3ZDYE 3DUUA 3WFDL 4LLUA 1RZKL 3FO2B 4N0FB 1Q72H 3D1MC 3TN0B 4ESKA 1LEGA 4X6DB 3DURA 1QZ1A 2O5XL 5F1OB 4HUWB 3P4LA 5D2NB 2NLJB 1T5WB 4JRXD 4N9GA 1RK0B 3H9HA 1T83C 4P9MH 5ERWB 1YEHH 4OLYL 5KVFL 3EKCA 4P2QD 3FQTB 5JXAH 2XTJB 3AU1A 3G5ZA 2AGJL 3WD5H 2A1WL 4C54A 5E5MA 5EH1A 4LP5A 1MAJA 3RBGA 3ZT7A 2IAMB 4F7TA 1IGTA 1RURH 1PGRB 1IGFL 3DI3B 1T4KB 4WTZG 5F1IB 3LKOA 4ZUUB 1TZGL 3VRIB 4HXAH 4QY8A 1MFCL 3OL2A 1E4JA 3OZ9L 4KVNH 1VFBA 4QLRA 5I8CB 4IDJL 3GMOA 5C70A 2D7OA 1U8NB 5KZCB 5TH2B 4TSAH 5HYJB 3E6HB 3MV9A 1KLGB 4CVXB 1ZLSL 1YEJL 2ZUQB 2X40A 1A1NA 3KPPA 4P46B 5SX5H 3QUML 4RMRA 2EDLA 1L0XA 1NCCL 4J3VA 2WIIA 3MGOA 1N64L 2BK8A 3CVHL 5TF1H 1J5OL 1MIML 4E42B 2AV7A 4HLZG 4O51A 3VXMA 4YXLL 3DXAE 5EU3A 3O2VL 1GGCL 4TVSa 4J6RL 1XGPA 2BNQE 1YYLL 2YPVH 2AXGB 2DQEH 2JELL 2CKBH 4I0CC 3LRHA 3S6CA 5M94B 3LEXB 1JRHL 5DWUL 4G6AC 1CDIA 4FFVD 1FH5H 4JFYA 1OSPH 1HCFX 4HIEB 2GK2A 4JJ5A 4K3DL 4KAQH 4YDVB 1MCCA 5HYIA 2V2TB 5K59E 1GAFH 1JNHA 1C5DB 2G9HB 4S0TD 1SBBA 2R4RL 2FZ3B 1UQSA 4PGDB 3SKOB 5DI8B 5DEFB 2ITCA 4BZ1L 4YQXH 5BS0E 4Y5YC 1ZS8B 5I1DB 1N5YH 2GITA 1I1YB 1OB1A 4PJHF 4U1MB 3WBDA 5SWZB 4L3EE 1OSZA 1JPSL 2GUOB 4OCLC 2PR4H 5E6IB 3FOMB 1AXTH 4LHUD 3SDXE 3KPSA 4GW5A 1JHKL 4Y4FB 3HMXL 1ORQA 2CUMA 4E9LA 1V5JA 1FNAA 3LDBB 2EE6A 5HHMD 1UYWL 2B4CL 2C3XA 1T04A 2CDEB 3SJVD 2EH7L 1MJJB 2MJWA 5D7IB 1CD9B 4QNPE 1NGYB 4JKKA 3V8CA 2VB5A 4APQA 4IJ3B 3S37H 2A73B 3IFPA 4M7LH 2OJEB 5IMKB 4BA8A 3EZJB 4NHUB 3BPNC 5EDXA 3O9WA 5KAQG 3T0EC 2HT2D 3E3QC 2I9TA 2OSLA 2AEIT 4R4FH 4P4KB 1HXYA 2X9XA 2IBZX 1HQ4B 2VITB 3L5XH 4XNXL 5I76A 4QHUA 3QUKB 1B0GA 4KJPC 4PREB 3QQ9C 3BW9A 1A47A 3BUTA 3TT1L 2FGWL 4YC2B 4NWUL 5CSZB 4MLIA 3BQUA 3HR5A 4XMLL 3PXHA 1PQZA 2AJVH 1CXFA 3EJZC 3C2AL 2EXWD 4P99A 1RZ8B 3NN8A 5CJQL 4OI7A 3P73B 3GMMA 3PJSB 4LEOB 3F12B 1A6ZB 3BPLC 2R29H 3ARGB 2A83A 3UBXA 3Q0HA 4LCWD 3IAQA 1V7NH 5LGJA 3SDXA 2VZVA 4L8SB 3CUPB 3K80A 3D69A 2FJGB 4F80A 4TVPL 3MNZA 4M03A 3ARZA 1FYTD 3ARDC 4L3EA 4NZUL 1CXEA 3T2NH 2DQCL 1EUUA 4AZ8A 1FNGA 5AYUL 1U8MB 4TSCH 5KW9H 5DMJB 4PRPA 3G9VA 1CN4A 1MJ8H 1CFTB 3QH3B 4KRLB 4AQOA 1J1XL 1NFDA 3T04D 1EK3A 4KQ4H 2J8HA 1YMMD 4TQEL 3EFDH 4F58L 3W9DB 5DMGD 4BZYA 1LNUB 5EZLB 1TCRA 5HJ3B 3L5HA 2ZG1A 2YWZA 5IW6A 4BH8B 4GKZA 4Z0BL 5EIVA 2E6PA 1MIEL 5KSBB 1RZGA 4ZFGL 4UT7L 3KS0J 4F58H 1LO4H 3FOMA 3RFZC 1IT9L 3CC5A 3DETC 3DVFA 2DJ4A 1QR1A 5DVLA 4K8RH 4LHUG 1IM3A 5T1LA 2VAAA 4XBGB 2VN4A 4YO0B 1H5BC 1JFQH 1J18A 3BKMH 4NHUA 3SQOH 2EC8A 5HD8D 2V7NA 3K1DA 1L6ZA 4I8DA 2IBZY 5EIIB 5IB3B 4WW2B 5FK9B 4KTDH 1PW3A 1F5WA 3O3BA 1RK1A 2P46B 4WU5B 3QWQB 5BVPL 5BS0D 1LK3L 2NY3C 3MLXH 1R3HB 3OKKA 3LHPL 2G2RB 1F6AB 3MR9B 5I1AB 4RGOH 3GJFB 5B3NA 1Z3GL 4QT5B 3WDIA 1OAUH 4MJ5A 1VEMA 1NANI 1D9KB 1K3IA 5J12C 3UC0L 1JNLH 5DRXA 4KI5F 4KV5F 1ZLVH 1CDJA 5IR1B 5L88H 4PTUB 2RJMA 4OZ4B 3U4AA 4L4TE 1E4WH 1E6OH 3SOBH 1QA9A 4YFLF 1JI1A 4P2OA 4CU6A 2DQJH 1LK2B 5GRJH 4YHPB 2FDBP 1IARB 2H9GB 3ARFD 3BP7B 4P9HL 4GXVL 1PY4A 2LU7A 4YNYA 2UZIH 1V3LA 3OHXA 2RB8A 5GS0L 1XF2A 1UJ3C 4UV4L 2A6DA 1EHLL 2DI8A 2QQNH 5IFHL 2APWA 1T21B 2BVOA 3IETA 2A9NL 4OV5B 1YYML 3EYFA 4QXUH 2BNRD 3ARVA 5BV7C 3QCTH 1BOYA 1T1WB 1EJOL 5FUCC 4HMEA 5ADOH 1XR8A 2WMPA 3HMWH 3NZ8A 1JYVA 3ABZA 3BKYL 1MELA 4ZXBD 3EHBC 3GSWA 1G9NL 4JPWL 1NMCC 5HHMB 4Z0XA 1ZKAA 1S3KL 3L3KA 3KYNA 3MUGB 1JZ5A 3NMEA 3X17A 2D0GA 4KUZL 3VWKC 3ZE1F 2MHAA 4R8WL 1T0MB 3JWDC 5IMOA 3BMWA 1GAFL 3QUYA 3QJHA 3UTSD 1J1PH 3DMMD 4BFBD 3FRUB 2C7UA 1FORH 2BNQB 2ZUQC 3V6FA 2YUWA 3CFKA 4XX1E 4KRNA 5I1EH 3EOBA 3VFTB 1CVRA 1MCPL 1RIVL 1DQDH 3V9FA 1KN4H 4M43L 3GO1L 1DQML 3KPQA 3KGRA 4HGWB 4FFWD 5I75C 3UPAA 4MVBD 1VPOL 1TQBC 4QHLA 1DZBA 1M6OB 5JQ6H 3REVA 4Z78A 2R15A 3C6LA 5C8JB 2XZCH 1CFNA 1AGCA 3WNOA 1ULVA 1AI1H 1BBDH 4HKJB 2NLJA 1FNEA 4GAYB 4JO4L 4L4TD 5DFVC 4JDZA 4CBPA 3WFHB 3JVGC 4JO1L 4MJ5B 1AIFA 3WE6A 4NFCA 4LHUB 1IGYB 5F1KC 2VXVH 4DVBA 1BIIB 4GRWH 4DJMA 1S9VB 4YHKL 1FNSL 1J1PL 1AR1D 5CLWA 4N0RA 5IB4A 2VISB 4BKLB 4IDJH 2Q86B 2FLBT 4JM2C 3GSUB 5JW3L 4PFEA 2IAND 3OXSA 3QDJB 4G9FD 4NKDA 3SQBA 5JW4M 5JPNB 1AKJB 4XAWL 5KSVB 5L2KA 1I7TB 2BSTB 1YY8B 3C5ZB 2AV1A 5B38A 1I7ZB 3WLBB 3DGGA 1EO8L 3RNQA 4C57C 1RHFA 2A1WH 3GIZH 2NY7L 5HY9A 1J10A 4OZFB 1E4XI 1PD6A 1QLFB 1FFOB 2R0WH 3PHQA 5D6DA 3TM6A 3BMVA 3DUSA 3WCYA 4JLRB 4XPTH 1JWSB 1XMWA 4DGVL 4LVNC 4HXBL 4NBXB 3RVWD 4G80B 2OR7A 2AK4B 1TZHB 1NAML 3FOLA 3UCRA 1UXSB 3QUZC 2Q3ZA 2D0HA 3RWFB 1AC6A 2HFFB 1I1CA 4FTVB 2FYYB 4KTEL 3IDNA 1IEAA 1RUPL 1X5KA 5DHVH 5C0BB 4Q74A 4GMSH 2WBKA 5IESL 3U79A 2WP3T 4JVUA 3T0VA 4TUJA 3SKJL 1XF3A 3VGFA 3AREA 1IAIL 4L4VE 5IB5B 4K94C 3MXVL 3I6KA 2F53A 2D03H 4GRWE 4QF1B 1CZ8H 4E0RA 1S8DA 2CGRH 2PYFB 5IK3B 3MLYL 3U36A 1XAUA 3UROR 5KVDH 3SDXB 4MSWA 4ODVH 4LARH 2HRLA 3KPTA 3LHPH 3NA4A 1UA6H 3KPRA 1U3HA 4NGHH 3P40A 2IFFL 1LO3H 2C5DC 5DQDL 1OAXL 5JQHC 9CGTA 5EUOF 1BQHB 1GC1C 4J1UA 2XFXB 1NCWH 3VD7A 4RCAA 3VGEA 3WV0A 4K23H 4R7DA 3DLQR 3FMGH 4GG8B 5FYJD 4ODHL 5F7HA 2FWOA 4ZFOL 2FD6L 3ARSA 4G7VH 2HT3C 5JORA 1AHWB 4ENED 2GJZB 3HC3L 1WF5A 2DLIA 3GNMH 4J23A 4GRLC 2CKBB 2DWEA 4KXZH 5DGQA 4HMCA 1A1OB 3QUXA 3JSSA 5CSGA 4NQCA 3IDJA 1QFWI 5K59F 4D9LH 3GGWA 4I0PD 3TC9A 2VR4A 3H3BC 5CILH 4X7TB 4LLDB 4ZFGH 4XCCH 4KK5D 5T3XH 4H1LB 3SDCB 4Z0BH 3MYJA 4R4BB 3D85A 2VDKL 5I1AA 1PVHA 2Y6SC 1UEYA 4DGIL 5E6YA 1RZFH 3U7YH 4H20L 4LRIC 2WIMA 4KQ4L 5CZXC 1IC7H 3QNXA 1JGUH 1MOEA 1FO0A 4IOFD 1MLBB 1A7NL 2AK1L 1HHJA 4WWKB 2R1WA 2J12B 5FYLH 5IB2A 2PXYB 2OK0H 1NCNA 4PJGF 4NQUA 1QRND 1XFPA 5E2VH 5E99H 2NW2A 3KYMB 3VJ6B 2FEDC 3QUXB 1BD2B 3O8XB 1Q94A 4OLWH 1T80A 4QOKD 4WWID 4EI5A 4Z7QE 1EXUA 5KG9A 2PYED 3VWKB 3VFOB 4MD4A 3MRMA 1EEYB 4P2RA 2WBJC 3U7AA 1H3WM 1ZGLB 3D39A 2DLHA 1BVZA 1NMCB 4PJEB 4ZTOH 1KIQA 4ZTPL 4DWHA 4V1DE 1G1CA 1HE7A 2P43B 3QXWA 1MLCA 4HPYH 2EH8H 3SDDD 3V6OE 4PJBE 2M26A 4S1RL 1WBXA 4OZIB 4LF3B 3BRFA 4JG1H 5D71H 5C9JB 3X3GL 3OGOE 5F7DA 4L4TB 3HE7D 3LKSB 5I71C 4BQBA 3CDYA 4LLDA 2EYSB 3V5HB 1UH4A 4LHJB 5T3XE 1X4ZA 4Y19B 1JGEB 5L2KD 3CLFH 3EYSL 2XWBB 2F19H 1KB9J 3LB6C 3MNZB 4WEMB 3WS3A 1QPPA 5HYJA 4JHWH 4N90E 1FNLA 1E28A 4HWZB 1VEOA 4XVSL 3QUMA 1NGQL 4O4YH 1UC6A 1AO7E 4ZG1A 5J1SC 5HI4C 3EJYC 2MSPA 3ULSA 5IBLD 1NKOA 5D8JH 4ZDHB 1KENH 1SY6H 5I6XB 2BNRE 4UIKH 4YHLL 4LK4A 3K4DA 1N5YL 1S7QB 4X9HA 1JZ8A 1HINL 2FHBA 4X4MA 5JXEA 1MEXH 4L3AA 5HPOA 3ZDZE 4OJFH 1UADC 1S5IL 1FCGA 3RVXD 3WHE0 1HXMB 3N1QC 4FNLL 4Y1AD 1KJMB 2CLZA 2GJ6B 1TTGA 2D31A 4QRQA 3P11L 3WLBA 3LKPA 2W9EL 3ARED 3MCLL 1FYHB 3C5SB 2I07B 4R0LC 2PUQT 4V1DA 4L5FH 5F71A 2FJHB 1C12B 1CTOA 4YDKL 2WZPD 4O58L 2LVCA 2YUZA 4IOSD 2XRAL 5I19L 1ZWIB 2V5SA 3KDMA 1KBGL 2IAMD 1P5VA 2CK0L 2HT4C 2ADGB 4FQHB 4I3SL 4HUXA 5D1QB 1C16B 4KHTH 4UBDC 5SWSD 4EN3A 4AEIH 5F9JB 4RWHA 2JJWA 3LN5B 4XVUC 2DQGH 1R3JA 1TLKA 1TZHA 4HJJH 1DN0B 1MIMH 4MJ4A 5DHYA 3CVHH 4P0DA 4HH8A 1P53A 3AREC 4H0HB 3FO0L 3HMXA 5DRNB 3IFLH 1FIEA 3C5ZD 3X12B 3RVWC 5CGYD 2W38A 4LU5H 4I1NB 1RJZB 3R06B 5J6GB 4H25B 1HHIA 3MRQB 4TTDC 5L8LB 1YPZA 3SKOA 5CSBA 1OF2A 1N0XL 4HKXB 1FDLL 1V05A 1QSFA 2NR6D 1W8NA 4LBEB 5B38B 5D1XB 2PW1B 2GT9B 1FVDA 5HGDA 4YFEA 2Y9RT 1VESA 3VDBA 1MHCA 2EO1A 4YDLC 3P77A 5FM8A 3KHOA 3O9WD 1HCVA 2ADIA 2EYTA 2XWTA 5A2LH 1Z6JT 1D7FA 3MV9E 5CZXD 3PWNB 2EDKA 3BH8A 3RDTB 3TO4B 2IH1B 1F02I 4PG2C 4GQ9L 4C56B 1XGYL 4WHYH 5CBAB 1CXIA 3NGBB 1TENA 1C12A 2VZSA 3GJEB 3X14B 5DJAB 4Y4HD 3ZDXE 2Q8BL 3DVGB 5I15H 4FXKA 1I9IL 1YUHB 1PEWA 4M4PA 1FNGB 3AY4C 4NQCB 1CL7L 4UQ2B 4EVNA 2V5RA 4NCC2 2CKBA 5DD0H 3CDGA 1SJXA 2AXJA 3FB7A 5I0ZA 4P2OC 1GOFA 1JHLL 1U8HA 1HSAB 1P7QD 2HP4A 1AGFA 5I66A 1T21A 1OTSC 4ORGA 5I18H 5TDOA 2QSVA 5DQ9A 4X4ZA 1NSNH 3EYQD 5I16B 3HUJE 5CP7B 4S1QH 5KVEH 4OSUL 4OD1L 1MHHB 2DMKA 3QNZA 3V5KB 3GUTA 3AS3A 4XCNA 4UINL 1QKZH 3RX5A 1FJ1B 4KJYA 5H2BB 3RWEB 4KK6C 4I18A 1A7RL 2QSTA 3S3JA 1XZ0A 3G5VB 5IWLC 2W9DL 5LKNA 4MZ2A 4XZUB 1KOAA 5FECB 1CK0L 2VLKB 2X6MA 4RISL 3QEQB 4BQCA 2JJVA 1SBSH 4G5ZH 4X9IA 1FFNB 2G5RA 3P9LB 2QKIA 4PJAE 3RX8A 1IJ9A 3MRJA 4M62L 4HULB 1HH9A 3MGAA 4P3DA 1OAZH 5C08B 3T0EB 5MEQB 4WFED 3TBWA 4M1DL 1QFWL 5IG7B 5MHSE 7FABH 5JW5A 4EXPX 4PRID 4GJTB 1F6AA 3MR9A 1ED3B 1PZ5B 1O5DT 1MCWW 4I77L 4PGJA 4JQXC 1CBVH 2YD3A 4ZUWA 4DCQA 3MV8D 1KJ2H 3LY6A 2EIDA 1FVDB 1CLOL 1YQ2A 1U8HB 4PJDF 2KZWA 3IJSA 3QP3A 2YRPA 3LOWA 1J7VR 1J86A 4MD4B 5E6IC 4JZOA 3UEZA 3R0MA 5BRZA 4EOWH 4WFGE 1ZS8A 5I1DA 5HGBA 4R96A 4ODSL 3MLUL 1FG2A 2DD8L 3AROA 4QOKB 4XPAL 1TJIL 1G6RH 5AD0B 3CFJB 5IHUL 4RFNC 4W70A 3X14A 3G6JA 5HXMA 1DN2A 2FRGP 2W60A 3JV6A 5D7KD 4GRMB 5F9DC 5BQ7B 1FN4B 4NKOA 1KNOB 4WUUE 4HWBH 3ZT5A 3L3IA 4AEFA 1EVUA 2J88L 3RX7A 3L7FB 4B41A 4TOYL 1WT5A 5GJTL 4X9FA 2P24B 3ZDXF 2L4OA 4WTZA 1U58B 4F7CA 3IT8D 3U6RB 4PGEB 3BEWA 4H0IA 4P49A 4ZO8A 3VCLA 2NY5L 1FG9C 5J1TC 5CBEA 5C0ND 4G6KH 4GUPB 1KLUA 3SE8L 5J11C 2DTSA 4NYLB 4QO1A 4D9RE 3S88H 2E9BA 1X5XA 4UI2A 5F7LB 4FS0A 4AM0B 2EDWA 4OKDA 2IGFH 4DZBB 1B0RA 2IPKA 4XB8A 1Z0NA 3U9UB 1JN6B 4QYOA 4R0LA 2CLZB 3HI5L 1AGCB 1IMHC 5K9KA 3D25A 4MJIA 4QCIB 5ESQA 5DD3L 3VH8A 2X44D 5BRZB 2EDQA 2VDPL 3BGFB 4RZCB 5JPMB 4GQ9H 4NQXB 1TJHH 4XC3H 1XGQA 4ZSOE 1R5IA 5TH2A 5LAXB 1SVZA 4MDJA 3EO0A 4ODXB 4LCCC 4TNWF 5EO0A 2AEPL 1RUAL 1XF5A 4QRRE 3OGCA 3MJ7B 3MV8E 5D7SL 3QDMB 2R1XA 3W9DA 1A3LL 4CN1A 2YZ1A 3DMMC 1REIA 3RRQA 1WLHA 2D7QA 2EEDA 2ZG3A 2IG2L 5E56A 2EIZA 2HMIC 2X89A 5HDQL 4ZPVB 1BOGB 2YUVA 3LVEA 4EI5D 3SDDA 4AYFA 1U8MA 1F8TH 5JR1H 2CDGA 4E41B 2H2PD 2MCPH 2VNCA 3MLWL 3FQWA 1CLZL 3C60B 3ILPB 1UG9A 3QB7C 2VN7A 1JUFB 5JHLH 1MJ7H 3HZMA 2V17H 4NO0B 4X5WB 5HGHA 3EOYG 1NUNB 1PG7W 3OAYK 1HHKA 1UZ8A 3FN9A 3KPLB 1QLRA 4IRSC 1RIHH 2FB4H 4XHQA 5MI0B 2BDNL 3QDGB 3WSQH 1IL1B 3T4YB 3DXAD 3OKOB 3DRQA 5CP3A 5EIQA 4NDMB 5GGTH 4PB0H 5I19H 1EBPA 3KJ6H 2XQYG 3W0WB 1WCBB 2BVPB 3ALXA 2X4TA 3V52L 4JFQA 4LEXL 3U9PH 2F58L 2XA8H 3BOVA 2VZTA 2F74A 2DIAA 32C2B 3LIZL 4Z7VF 2VC2L 5IT2H 2GKIA 4M93B 3NFSH 4Y1AE 2D7TH 3L5WB 4AMKH 5BV7H 2ID5A 3PHQB 3S36L 2YMXH 1QEWA 1SYVA 1Y18B 4LKXB 4G6JL 1VGKB 1YUHA 4LNRB 3UTZB 1DR9A 2GCYB 4Q6IC 5HHOB 2OJEA 5GS0D 4L4TA 3EO9H 5DD6A 3ZYJA 1A22B 2NNAB 4P5MA 1JGLH 3W9EB 2VLMD 1WFOA 3ZKMC 3O3DB 2XPGA 5F3HB 4KTYA 4YK4C 1HHGB 2Q86A 3DMMB 1ORQB 4U1IA 1HQRA 3TVMA 4K9EL 1M05A 5F9WB 5I1IH 3S97C 3CSYB 4ZXBC 4OQTA 1EEZA 4HX1B 5HPMA 4RIRA 3QDGE 2JCCA 2A9MH 5C0FA 1Q1JH 3QPXH 1SVCP 3VFNA 2GW5A 4NUGH 3TESA 3RWIB 1J0ZA 3FQRB 4L4VB 2FEDD 2FEEI 5C0JA 1UWGL 1WICA 3IGAB 4YXKH 2MFNA 4G42B 4JEGB 1EEUA 1RUKL 5L7XL 1B6DA 1JBJA 4PRIA 5C0RL 1T3FB 1RZJC 1KB9K 1NKRA 1NLBL 5FA4B 4XPHH 4D94A 1TQCC 3O2WH 3FT4A 2HLFC 4ZS7H 3QO1B 2GY5A 4ZTPH 4MA1B 4P5TA 3GI8H 5HYSG 2NZ9C 2BP3A 3GSRB 1PAMA 2AK4E 3TGXA 3ALPA 5CIPA 3S5LB 1A3QA 4MA3A 3BGFC 4S1DD 1YY9C 3RJQB 4LRNL 1EDQA 5ELIA 1ZE3C 4KGJA 4Y19E 1A2YA 3KLAA 4H1LH 4W4NA 3WDJA 4JJHA 3F6LA 4D0DB 2ED9A 3VXRD 4TPRH 4JFXA 2ENSA 4MJ2A 4F7EB 5C92A 4L9LB 3E6HA 5DVNA 1AHWA 3ZHLA 4F9LA 3CPLB 3UTPD 1IEBA 4NNPL 4ZO7A 3DO3A 4OGAD 2IWGA 5I75B 4K7FB 1NL0H 3O45A 3GSVA 1NC2B 3SGEI 3MREA 4C83B 3VRIA 4FP8L 4ELMB 2VDKH 3UJTL 5E6ZA 2HA1A 3ZDZF 5BVJA 3DX9B 5D70L 3B5TA 3MRRA 1ZA3B 4NPYA 5E8NB 1KTLB 4OGYH 1XGQB 4KMTH 2JIXD 1P7KB 2H32B 1HKFA 2GTWB 3C8HA 4UIMB 5HVGB 4RRPA 5HHNA 1FO0L 3FCTA 4HLJA 1DFBL 3QIWA 3NTCL 3VMOA 2VDNH 2OL3B 4KMTL 2KZ1B 4F3FA 4ZPVA 2B0SH 5KANG 4F15B 3GJEA 4WCYH 2IEPA 3DYOA 4NBZB 3MRNB 4QOKE 2R2HB 3OTTA 4W4OC 4AQ1B 4F7CB 4FP8H 2VDLL 2ZP0T 1QNZH 2X10A 3LKRA 1OAKL 1T04B 2HT4D 3MJ7A 1N5AA 3FOLB 4NGHL 3RL1A 2Z92B 4ODVL 1ZLVK 3LEYH 1J9CT 4RFOH 5EBGA 4YEFA 3WFBH 2CMRH 4U6YA 3NIFE 1XCQB 3BZEB 3TYGL 1HSBB 2ZNWA 2ZOLA 3PDOB 5SX5K 4Z6AT 1T22A 3HC0B 5J1AB 3P4NA 3QG7L 2YSSB 5BRZD 3STZB 3IDXL 3GMPA 1KXQE 3VDAA 1I7ZA 3B4NA 3VWJC 5HHPA 4PJAB 4KTEH 1H8OA 3C5JB 5FCUL 1MLCB 3NBNA 1QQDB 5IKCB 3FB6A 1CF8H 4XI5D 2QSCH 2C3WA 1YPZF 1IZKA 3DO7B 2YPLD 5TDNA 4IM8A 4XP6H 2L7JA 3SGJC 5ID1A 1IE5A 1IFHL 4FQLL 1T03H 1X6LA 5F6HI 4YHMH 2CIKA 4U7MA 2LAGB 1Q9WB 4I5BB 4XCYA 1FVCB 3FQXB 2WQRA 2DQIH 4ZQKB 1A6TB 3HRZB 4P23A 1TCMA 2WAHA 3T0DA 3QRFM 1MI5B 1PSKH 4HK0B 2VQUA 4M7ZB 5ESVA 3BIKA 2YBRB 3GDBA 1BJ1H 4Y4FD 4PRPB 3ELAT 5GJSH 1KC5L 4NT6B 1TXKA 4IHOA 3CXDH 1MSPA 1HDMB 2VXTL 3CZFA 2VZOA 1QRNB 3GM0A 4QHNA 3AS2A 4JZJB 4OD3L 3OAYH 1WGOA 1HILA 4L8SA 4PRHA 3CVIL 5DC9B 8FABA 1EO7A 3MO1A 4PS4L 5BV7B 1K4CB 1RPQA 2FWOB 3OF6D 4RMQA 4DW2L 2V2WA 1BZ7A 2WBJA 4I0PB 4PP1D 3TVMC 2MKWA 2DN7A 1A6PA 1IILE 3E8UL 4U1LA 1GH7A 3QBTB 1G7HA 2P8MB 3IDJB 1NBZA 2AJSL 3JXAA 2D7MA 4OM0L 1CDHA 2LFGA 5C6PB 2EE2A 1I8LA 2DWEB 3IXAA 5CLTA 4DQOL 2NXYD 4NP4H 5AUMB 1H3XA 3U4EA 4LPXA 5DC4B 3SO5A 3NCBB 3N1FC 2JJTA 4DN4H 3NFPB 1YJDH 4W6WB 3PWUB 3GBML 4DN3L 5B4MD 1J05A 5C6TH 1AO7D 4NOBA 1K5NA 3NH7L 2VQ1A 3QWOB 4G9DA 3UZVB 2NQCA 3VXRA 2NW3A 3OB8A 3C2SA 1KYOJ 4C56A 4JRXA 2EZ0C 3WS6A 4G8GD 2IH3B 2VYRE 2KDGA 3EAKA 1UWXK 5EOQH 3QJFB 4AG4L 5L2JA 4YIQB 5EZIH 1XCTB 4LIQE 4JQXA 1XIWC 5HGDB 4JN1L 4CJ0A 1WCQA 2F5AH 4QTIH 5IB3A 2G75A 3EDFA 3GMLB 5GRWA 1JWSA 4HIIA 1EEYA 4P2RB 4F57L 2MCG1 1CLZH 5F88B 4DN4L 1DSFL 1OB1B 4X7CC 4EVNB 4OF3A 1AHWC 5HVHC 5K9QI 4R97B 3BKCL 5KSBF 4UNTA 4N9OB 3M1BA 2QQQA 3FAXA 1WUNT 3QEGH 3V6OC 3PGFH 1UXWA 2OX5A 5D5MB 4FG6D 4CMHC 3KVQA 5AZEL 5L2KB 3BEWB 1A3RH 1CE6A 2R69H 2X70A 4YBQD 4UDTA 3PWNA 5IEKB 1LE5A 5CUSL 2AEPH 1YN7B 2BVUA 1I4FB 1ITBB 4XPBL 1FFOA 1U8QA 2ATKB 3CVIH 1GGUA 3Q5TA 3S5LG 3UJJL 1DP0A 4ZAKC 4JDTL 3GHBL 1Y6KR 1BBJB 4DK6A 1HH6B 3IFNL 3QQ4A 1I1AA 1NCBH 2ICWI 2XIDA 4O2CA 1D5BA 3DHJA 3QIWD 1MHEB 3K2MC 5JIKA 4OFVA 5DJ2A 3DV6B 1L7IL 2OQJB 2XNAB 4LQFH 2ADFL 2E5EA 1Q8MA 3ESUF 2FX9H 5F88A 2Z93B 3N1MC 4WFHE 3CK0L 2DKUA 4XMKH 1SYSB 1LK3H 4ZUTA 3H0TA 3P4OB 3GEWB 3EGSB 5AG8A 4HWBL 4Y89A 5DJ0A 4GG8A 1CIUA 2FH6A 4XNZB 2F15A 4OQTL 5F9JA 3U4BL 3TBSB 1XH3B 2R39A 1DQLL 4HUXB 3DVNA 1ZOXA 5C0BE 1T4KA 5CSZA 1CR9H 5JW5B 3IKCA 5MERA 5GGRA 3MRNA 4HUUB 3RP1A 4JR9L 1ZVYA 1CFTA 3QH3A 5B8CA 1JFQL 3HFML 4X7SL 2XZZA 4Y5XA 2R0ZL 4HHAA 4HF5L 4FOMA 1I8KB 5LWYL 1EUTA 3ARBB 1OARH 4JRYE 3UPRA 4JFZH 3EIFA 1XCTA 3C6SB 4RFOL 3GSQB 4EBQH 5E4EC 1EGJL 2XZQH 5HI4D 1P7KA 1IAOB 5EA0L 1QSFD 5T1MA 3ZKQD 3DI2B 1ZLWK 1LP9B 5HBBA 2Q20A 3RVTC 4M6ML 4KKLC 4TUKL 4N0YL 4WV1C 3X11B 1CD1A 4P48A 1CDCA 5CEZL 2MPAH 3OGCB 4XI5C 4KKCD 4WHTB 1MVUA 7FABL 4D2NA 1IGML 1QFWH 3VXPB 5I1CL 4Z7QF 2NY1B 4HK3N 3QCVL 1P9MC 3BDYH 4KPHL 4M62H 4OCYL 4LOUC 1AR2A 3L3DA 4RNRA 1I8MB 4I0PC 2VDNL 2E7MA 2DQCH 4RZCA 2Z93A 2Y4SA 5CZVL 4P2OD 3GSNH 1FO0H 1I3UA 4C56D 4ZFZA 4PGBB 1BHGA 1KG0A 4JY5H 1WSST 2R2EA 3HS0B 3MLTB 4YHZL 2DI9A 3EYQC 5JNYA 2EDRA 3U0WH 3OWEA 3KJ4C 3RVUD 1JGDA 3C8KB 1JNHB 5D1ZD 5EOTA 3IB4A 3K8KA 5IW3A 1BF2A 4NQDD 5SV3A 5JOEA 1HSAA 3I3DA 3OXSB 3RDTA 3MO1B 3TO4A 3T2PA 3QEUA 4WEBL 4JANB 2XWTB 4JZJA 5FHBL 1XGPB 3O3BB 1NAKH 5I8OL 3NPZB 5A16B 3ARDD 3L6FA 2ITDA 5DJYB 4NC1E 1A6TA 5IM7A 1Y18A 1P5UA 3T8XB 5HHME 5EO1A 2MNUA 5DJ8A 3G5XA 5CKGA 4QGTA 1S7SA 1Y0LA 3G08A 4OCSH 5C09E 4RNRB 1I9JL 5DEGA 2YD4A 4M6NL 3KNBA 3CMGA 3KXFB 1FGNL 3OV6A 1AFVH 2NY0B 3CVHB 1JHKH 3O2WL 1E0OB 4N0YH 5HHVL 1L9NA 5EPMB 1KN2H 2HFGH 3T2QA 4WI5A 1KEGL 3QA3A 43C9B 3VG9C 3ME0A 1CFQA 4R2GC 3HR6A 1S9YA 1DCLA 1ZTXH 5D7JB 5KSUA 2DQHH 4MXQC 5DUML 2J6EA 4XP5H 1ZWIA 1CDBA 2X1PA 4NZRL 4TYUA 2R2HA 1YMMA 2Q7YA 4OF0A 1UZ6E 4DKEL 4C55A 3T0EA 1QRNE 3FN3A 3WKMH 5ID0B 3TJEH 4KFZC 1A21A 1AQDA 2EDYA 3HZMB 2D31B 4XWGL 1U95A 2A9ML 2R0ZH 3QO0B 1JNJA 2LE9A 4MAYB 3TLRA 1JF1A 3BE1L 4JR9H 2EE3A 1I3VA 3R8QA 1KLGA 3P0YL 1E4KA 2XQYK 4S1DC 3WIHL 1FH5L 5CEZD 4DK3A 1S7QA 3BPOC 4CVUA 5C09A 4XXCC 4B7IA 4PJBB 3K8MA 3QCUH 2J4WH 3EHBD 1S7XB 3UMTA 1JMXA 2EDHA 4PRNB 1ZHLA 3JWOC 4WW2C 4BSVB 4XMKL 4BUGA 3QUZB 1G9NC 4NNXB 3CFEA 3ZE2E 3ZTNL 3B83A 3MLZH 1SYSA 3P0GB 4ZUTB 2PO6C 2VH5L 1S9KC 3SPVB 4LFHD 3QUMH 3UTTB 3T65A 4MMXC 4FZEH 4D0DA 2VC2H 5IT2L 2CO7B 1NGZA 1FFPB 2WWKT 1R3IH 4M5YH 1N59B 1I3GL 3H7BA 3BIKB 4KVNL 4LKCB 5ICXB 2Q7YB 1GOHA 1IAMA 4XVUD 3Q5OA 3R1GL 3U6RA 5F9OH 1TZGH 4LAJH 3CU1A 3RKDD 4NKDB 4ZAKD 1RJYB 5AEAA 3W11D 3NCYP 8FABB 3MLSH 3BPCB 5CMAA 1NPUA 3PXJA 1XF5B 4PJ5B 1MRFH 3GBNL 3K81A 4JM2B 4OLZL 4UQ2A 5DSCA 2VSCA 4MA8L 1U95B 3LZFH 1UB5B 2X7LB 2F8XC 4FXKB 1A2YB 4JGMA 4NT6A 4WHYG 1FAKT 4EUPG 4OLYH 3BE1H 1FGVH 3EDEA 3FRPA 1QSFB 5ESVB 3VXNA 3FN0L 4NN7B 4QCIA 5K9JL 4UT9L 5DEFA 3TJEL 5GGTA 2EC9U 5D7JA 3MODH 2UVEA 1IBGH 5F6IB 4I5BA 5BZWB 5BO1H 4NYLA 5MP6L 2EYTB 2DQHL 1Q72L 1J0YA 2IQ9H 4H0GA 3VXUA 4AG4H 2L0DA 2ZUYA 4GW5B 1JGVH 1OP9A 1OVZA 2KUTA 2VR5A 1LVEA 5FYKH 3I6GA 1AFVL 3O6ML 2ZUXA 4L8BB 4WV1B 3U0TB 5FFLA 1O0VA 5KTEH 5CMAB 2GITB 2R56L 3QQ9D 4KKNA 4N68A 1U6AL 4MAUH 1ADQL 1FYTA 3O6FC 4B0MM 3JTSB 3QI9D 2VDPH 5T33H 2J8UE 4JFED 4OLWL 5FGBC 1WC7B 5IQ9B 1QG3A 2VDOH 1MFDL 4XPFL 4QHKJ 3WN5B 4XCEA 4LLYB 2IGFL 3ZYZA 2AJ3B 1WBZA 3O2DL 4QRQB 3KS0H 4HPOL 1KCUH 5J11B 1KG0B 2LVEA 3T0BA 2VLKA 4J4PA 1F3DH 2GI7A 4JQIL 1NMAL 2DQDL 1NAKL 1JPST 5E9DB 4MXQD 3BEVB 4X9BA 1PY9A 4GQPH 4X6BA 2ADGA 3IETB 3P0VL 4MMZC 3RIFK 4JG0H 5GS0C 2A6DB 2HLAA 5DHVA 2BVPA 1EHXA 5DUPH 1R3LB 5FDWA 3C5SA 1XGTB 5E2UL 3BQUD 4G6MH 3QDGA 2WINA 2C3GA 2JB5L 5IMOB 4G8EA 1GRWA 4PGBA 4EI5C 1QA9B 3TVMD 1R0AH 1AD0A 4XBEH 2VE6B 5IOPA 1TZIA 2N1KA 2PNDA 1BF8A 4LCYB 1KPVB 1BVLB 1FE8H 1P1ZB 4EOWL 1YEFL 1QSFE 4PJGE 1N7ML 5FF6B 2CH8A 2EDNA 3HI1A 5B39A 1SEBA 3MROB 2D7PA 4DKFL 4LLYA 3OX8B 1UJTA 1DQJB 3BDYL 4OCYH 1NBYB 3EYFB 1TETH 2JB6A 1JWUA 4NKIL 1W72H 5LCVH 2QQKL 4K23L 4I77H 2B1HL 3GM8A 3HRZA 4JY4A 2NXZC 2X2YA 5A40E 5AAWA 1YY9D 2E6JA 1FVCA 3QZWA 5DMYA 3QIBD 1M7IA 3BQUC 1YNLL 3RZCB 3SJVA 1B0WA 4PJCE 5LAXA 3O3AB 4LSVL 4XNZC 1MCNA 2BNUB 4G42A 2OLDA 2DIBA 1ND0B 3ZKSD 5D1QD 1EXUB 1A6UL 1UKSA 4OUOA 1A6UH 3STZA 5MERB 3DRTA 3MRFB 2DDQH 2XNAA 4HF5H 3IDNB 1V7ML 3UYRH 1FYTB 1YZZA 2IPKB 2W9DH 3RPKA 3BWUC 2F54E 4YXHH 5SWSA 3PABB 4HAGA 1A7QL 1MJUL 2PXYA 1I7TA 2BSTA 3TZVD 2F9BT 4FQIH 3ROOB 3P4MB 2EECA 4NZJA 3KXFD 3DARA 1JMZA 4PB9H 5EBMA 1X5JA 2Q76A 2H32H 5KAQF 4OGXL 3RI5F 4NUJB 3TPKA 4RQQA 5LCVL 2BCKB 3QFJD 1N4XH 5IB4B 1CDGA 1MWAH 3OG6B 3DV6A 3C09C 4UOJA 2ZKHH 4IRJA 4DZBA 4EN3D 2OJZL 4ONGL 12E8L 4CRPA 2UWEA 4GRWB 3RHWK 2W91A 3LB6D 4LBEA 3MV7E 3L9RA 5KSVA 4U1GB 5SX4H 1ORSA 1A14L 4HLZH 5C0CA 5HVFB 5JPNA 4GLRI 1S9WB 4KUCD 1R5WA 4OT1H 4PJ5A 3FQUA 1R0AL 4XXCA 3UJJH 4FFZL 3SJVE 3O6FD 1I8MA 1KJ3H 3H8NA 4IOIB 3D2UD 32C2A 3CFEB 3MBEA 2N7BA 4G3YH 3W2DL 3PP4H 2K7PA 1U91B 2JB6B 5ALBH 2JIXA 1FNSH 3FAWA 4K2UL 4D9QE 1HN1A 2XICA 4X6DE 2V5MA 1CLYH 2MHAB 2Q3AA 3UYPA 3FQNB 1FPTH 5E8EA 3F7RA 2CQVA 3L3KB 4I0KA 1U3HB 3KPLA 3ZSSA 2VDRH 1P4LA 4PRIE 4U0RC 5DMIH 3O3AA 1KTLA 1VPOH 4OF5A 3RZCA 2VUOA 4L8DA 3V6FB 2X4PB 1Z9OA 3AREB 5AWNL 3D69B 3SE3C 4WHTA 1DQDL 1G6VK 2VLJB 3RPIA 5DYOA 5D2NA 5EOCL 5BMFH 5LVEA 3WFCH 3FKUS 3FB8B 3GI8L 5HHXH 1G7JB 4L8SC 3V6ZB 4HFUH 1AR1C 5TQ2L 4XPHL 1JP5A 2YC1A 4DUXA 3VW3H 5DJCA 4Z7OF 1OGAA 5LBSL 1BFOA 2FHFA 3SCMB 3LDBC 1QYGH 3DPBA 3FL7A 3EYOA 3VWJB 2HMID 1DVFA 1B9ZA 2ESVA 1UVQB 2DWDB 4KI1A 4MCZA 4JB9L 4XNQA 2Y7QA 4NUGL 5T1KB 5GIRB 1S5IH 2C4FT 4MHHI 3T8XA 4X8JB 5E8DH 4R90L 4MA3B 1NUDA 1S9YB 1NH6A 2J8UA 5D7LB 15C8L 4PRPD 4HMDA 4OM0H 2FATH 4DFIA 5I1HL 4UV4H 5C0AD 1EHLH 4HKBA 1NGWB 2Z8RA 3GBNH 4OLZH 4R4NC 2V2WB 3LPGA 4JAMA 5IUSA 4YDVA 4WFHD 4CN6A 3TVMB 2YA2A 5DR5L 5JPMA 2X42A 5F9OL 3CX2A 2O5YL 2LU4A 3WS6C 4GG6E 5C0EB 3SDYH 4ZNCD 4Y4FA 4IRSD 3W82A 3BDBA 3BKJH 5C3LD 1AJ7L 3D39B 4NRZB 5KSAA 1D9KA 1M71A 1HH6A 2MMXA 3ZE0E 4N0UB 3GJFA 4OIAA 4S11A 4D0BB 2D7TL 4AMKL 1WEJL 4DUWA 3D0VB 1Q0XL 3OKKB 3QDJA 1TDQA 3AUVA 3V0VA 2E8ZA 1DBBL 4P59H 1MF2L 4OCMC 3MJGX 3U9PL 3BPCA 3IAPA 1KJ2A 2X4OA 3FFDB 5DTFB 2NY6C 3TZVC 5DS8B 3LPFA 5FK9A 1C08A 3NCYS 3F5WB 3FFCE 1WCBA 2ZJSH 2AJZA 3H7BB 5CJ5A 4Z77A 2RAMA 2AXGA 1CF8L 1DLHA 4M1CD 3HE7A 1OTSD 1SJEA 2OCFD 2J8UB 3JWDH 4MDIA 2IANB 2PTTA 4ZFZB 3KDMB 4X8JA 4KRPB 5ACLA 4QWWC 2VR9A 3VGAB 1NLDL 4NQCE 1NBYA 3IJSB 3LKQA 4X5WA 3L3DB 2VLKD 3N9GH 1UB5A 3L1OL 4K8RL 2EIBA 4ORZC 3ILPA 2Z92A 3ZO0A 1FRGH 4K9EC 3WO4B 5FYLL 3W0WA 5JW4N 1N5AB 2Z8SA 2AK1H 2EDJA 2CKNA 3S98A 5J3HC 1D6EB 1OP5H 4LCWA 4ENEC 1KN2L 3PJSA 1EV2E 2HTLD 2NW3B 1FGNH 5B4MC 1OAKH 1XGUA 3CXHJ 3QHZL 2AK4D 3W2DH 1DQJA 4M02A 4TQEH 2LABA 2W65B 1L0QA 4EI6A 3MOBL 2QKIB 4XC3L 4UILL 4FFZH 4L3EB 4ZO6A 5KW9L 4JFDB 4OD2B 1NEZA 3EYUL 5E5MB 4QWWD 1J88A 3UPCA 5E70A 4F8QA 5JUEH 1CFSA 5GGSB 4TVPH 2ZUTA 3CFCH 3ES6A 3A6CL 1B0RB 1V7NL 2V5YA 2EDOA 4NC0B 1LDPH 2CDFB 5I9QB 2E3VA 2X4RA 2ZKHL 3HG1E 1T5WA 4LCCA 2UUDK 1IQDB 1DEEA 1T1YB 2ORBH 5KSBE 4FRWA 5GS3A 4F7PB 2UWEB 3GB7A 3VCLB 5EWIH 3MBEB 2VDML 4WI3A 4J3OC 4EN3C 3V79C 3CZJA 2NXZD 5EC1B 3WUZA 5E2TL 1JI2A 1FLRL 1S7SB 2CIKB 3S3SA 4J7RA 1A7QH 3MRBA 3D25B 4OF6A 1UA6L 4NKOB 5DJ2B 5L0QC 2X70B 5C0CB 4KROB 4QRSB 3SDDC 1BIIA 5IJVB 5D1XA 4IHOB 1DANU 2CGRL 1SM3H 3C5JA 3C60C 3S4SG 3MLUH 3TPUA 2YBRA 3MCKA 5KVGH 3MXVH 1FNFA 1UM5H 4PGEA 3ZKXB 3VJ6A 1MCBA 1TJGH 5C0BD 4Z78B 5C8JA 4M7LL 1ZV5A 1MCJA 1QSED 3NZHL 4H25A 4LRNH 4P4RA 1EFXA 5EN2A 3DVIA 3VXSA 4JY6A 3QIUA 4XP1H 4Y4KD 3FT4B 1A8JH 3D3VA 3KXFA 1CBVL 1K2DA 2FO4B 5ECJE 3PWJB 2K3TA 5BQ7A 5DUBB 1CGTA 3MRPB 3MRDA 4JKPH 5DZNA 3S35H 5GRZA 2P7TB 4M1DH 3U1SH 1JTPA 3CSGA 5D7LA 4U6TA 3TNNB 4Q9QL 2NY4C 4OZGA 4ZS6C 5F1SA 5T5FL 4YHYC 3MRFA 5E6ID 5C2UB 5DK0A 2GAZB 4RISH 4LOUD 2EXYD 5ESAA 3GIZL 5LWYH 4EXKA 5IVXE 4ZODA 5D2NE 4CMMB 3E3QE 3V4VL 3QEQA 1DQQB 2Y1VA 3WIIH 4GRLA 3W11C 4LGSB 5F9WC 2H32A 4XVTH 5JW4Q 2GIYA 1QD0A 5A2JH 2MQ0A 3IXAB 1T7WA 2ARJQ 2CKBL 1FJ1A 2UV3A 4KJYB 3C8KA 4NN6B 3DX9A 4TUOA 1YYLH 5EOTB 4PV8A 4BFEA 1VCAA 1JNNL 4HBQA 4V1DB 5CJXA 4PRNA 1S7WB 4YHPA 3P9LA 3RGHA 3QUYB 3D39E 3DX6B 4JO1H 5CWSB 3VXQA 1INEL 4F37F 5TF1L 1OT2A 4YHOH 4ORGB 4TVPD 4F7TB 3HA0A 5F3BA 2EIEA 2CLRA 1L7IH 5I76B 1ACYL 5FXCH 4X83A 3MJ8B 3O2DH 2WM0A 2F74B 3HN3A 5BV7L 3SE9L 4U6VL 4YBHA 4OLVL 4PYHA 3GHBH 4JN2A 5CGYC 1DQMH 3NCFB 4H8WH 2ZCHH 2IPTH 1XGYH 5C0AB 3QFDA 5ACZA 3C08L 4IMLB 2F58H 2D4FA 2JIXB 2XA8L 3HR5B 3IF1B 4X80L 3PGCA 5KTEL 2P5EB 5GGTL 1XEDA 1NDMB 3CU7A 3QUXD 3TN0A 1WTGT 3K8LA 3WXVL 2ICEB 5I74C 1RUMH 3Q6FA 2R69L 3PV6A 1CICD 1T7YA 3BP7A 3MUHL 2C1PA 3E2HB 3QWRD 2P5EE 1WK0A 4IRSB 2IQ9L 1K3ZA 1RZIB 5GSRA 2OQJA 3EO0B 4RMVA 5DUBA 1N0XH 5KN5A 4OGZA 5E8PA 1GGTA 4UMGA 4OKVB 3VWKA 3G5XB 2FEEL 4WUUD 4TSBH 3OKMB 1BD2A 1E27B 1FGVL 4AEEA 2NXYC 4P23B 2ZOLB 4F57H 4QYOB 5J13B 4S1SL 4QTIL 3BH8B 4NJAL 2A9NH 4XNUL 2PF6A 3LZFL 5C0FB 4ODWB 3I50H 5IFHH 4MA8H 5F9AC 2G9HA 5IMMA 2QL1A 4HJJL 3QIUD 4PIRF 3W5MA 4ZD3H 5C2BL 3D0LB 3IJHA 2ENYA 3RWHA 1CWVA 1EH9A 4IOIA 5MEPA 3RGVB 1MRCL 4I3RH 1ZGLA 4U1IB 3VD5A 2HTKD 2FR4A 1EBAA 1E6OL 3SOBL 2AI0H 4DEPC 1I3GH 4KDTC 1E4WL 1KIPA 5CCKH 1GGBL 3U9UA 4ELKA 4Q7DA 4OV6F 1CD0A 3TNMB 2JCCB 5LQBH 1C5DA 1XIWD 5C7XL 1K8IB 2FECL 1KUMA 4WFFD 3FFCB 4QRSA 4NO2B 3V7MA 3ES6B 1BMGA 1CFNB 2AQ1A 3VXMD 3SE8H 5TDPB 4ODBD 4IRSA 4PJ7B 2AJSH 2WBWB 4LNVA 2P1YA 4H5SA 1F2QA 5ILTH 3SDAD 4O2FB 4U7KA 2DYPB 1CFVH 1QFUH 3T3PE 4JCMA 4E5XA 4EDXA 2VKWA 4PJ8D 5IMMB 4IS6A 2AJYH 1K5NB 2GCYA 1JPTL 3OX8A 1VSCA 2YD1A 2BXYA 3HLAB 2NY6B 3A67L 3MJ9A 2I27N 1R6VA 4HT1H 4FFWC 4OZFG 1RHHA 3OJVC 3QUKA 2GJZA 3EYSH 5GRYA 3V95A 1UVQA 2DWDA 2OR8A 3ARFB 4APQD 2OXHA 2PYFA 5E08L 3HE6C 1OQXA 1F13A 2W07A 2W1NA 3QULA 2BC4A 3AM8C 5HYQB 1T2XA 3CFKB 1X5YA 5FECA 5A1AA 5L2JB 1PSKL 4OUUB 5ICYA 5DJCB 4PLKD 2ADJA 4X98A 2EZ0D 5DUMH 2BJMH 4ZFFA 5F89A 4KI5E 3L7EA 4HJGA 5H2BA 1JHTB 1RIUL 1T66C 1MJJA 2OP4L 2ZOKB 4MDIB 1VKXA 5ETUB 5LGHH 1KPRB 4XP6L 3B2UC 4WO4A 3MRIA 3VRLE 3Q3GB 4ZTOL 2XY2A 5CKAA 2BOCA 3N85H 3NFPA 5D7IF 3BRDA 3WJLC 4BQ9A 1SHMA 2WANA 5FO9A 3NZHH 2BVQA 3V7AG 1CG9B 1RZKC 4NC2B 4PG2A 3TYGH 2XTLA 2HJKB 1FLTX 4OCWL 1WAAF 4WJ5A 4HWEL 5KSUB 4U1SB 4HEME 3MRLB 3QA3B 43C9A 2HT2C 3LQAL 4OLUH 5I8KH 2ZCKL 1QKZL 4I2XA 4Z7OE 3CSYA 4POUB 1T3FA 5CEXB 5TFSL 5DEGB 1F00I 4G43A 3O8XC 4PJAA 2C3HA 4JY6B 2NXYB 4P23C 3ULVD 3EW3B 2FBJL 2PTVA 1JHLH 4QHNB 4WY7H 4D9RD 2VXSL 2NW2B 4XCCL 4RWYL 1YEEL 1I85C 1HDMA 2P47B 4LPTA 1M7XA 5JDSA 2DLGA 3QQ4B 4RAHA 4YR6A 3JTSA 3F7VA 2G2RA 2AEWA 2HTKC 4G8GB 4G7VL 4LLQA 3S37L 3BT2H 2C9AA 3NPSC 3CH1A 3HTLX 3L3JB 2YZ8A 1W0VA 3EFFA 4NJ9H 1S5HB 3H9YA 5KJRH 3FMGL 5FKAB 1X44A 2BY0A 3WIHA 4JAMB 5KSBA 4KVCH 4YHNB 3ARTA 3A0OA 3AGVA 1XIWA 3HPJB 5D4QA 4I13B 3UJIH 3N1PC 4NNPH 2X4RB 4DZ8B 3ULUC 2ICES 4P57A 4U33A 1G6RA 4XBGA 4L9LC 3MLYH 2AW2A 2D7NA 4Q6YA 4CU8A 1AE6L 3BSZH 5GGSA 2D03L 4ELMF 5DRZB 1NDGB 2CSPA 3MRJB 4LSSL 5HI3D 2ESVB 5FO9B 1T5XA 2BSED 2R4RH 4E0RB 1FFNA 2C26A 4UV7H 5DSCB 3MRBB 1TPXC 3I6KB 1YNTB 5BVJB 2CDGB 4M7ZC 3RHWF 2B1AH 1QP1A 1MFBL 1NUFA 2QEJA 5GISH 1KACB 1G0YR 2BVOB 2GYSA 4XMPH 2Z8VC 5C07E 4PJFA 4Z7UB 4FQCL 1FC2D 4TVPE 3QFDB 4WHDA 4F7EA 2H9GA 1V3MA 2X1OA 3LKOB 5HGHB 3DX8B 3D87B 1OT1A 3VA2C 3CK0H 1OLZA 1BJ8A 4YGAB 3V8OA 4YXKL 3C60A 2NR6C 1OPGH 1UWGH 1XGRA 1U8OB 5J9PB 1TVDA 1RU9L 2ADFH 5IB5A 1B0GB 4PJ5E 1KJVA 1NCCH 1WAAE 4PP2A 4KK6D 4PJ9D 4UNUA 5TE4H 2NY7H 1ZT4B 3X3FH 3AU1B 3G5ZB 5TE6H 2OR9L 2Z31D 4LLMB 4XCFL 4LEOA 4PJ8A 1ZANH 3LS4L 1S7TA 3UTQA 2E9WA 4P2QB 4OTXH 2N7AA 3SDXF 4Z77B 1I75A 3GI9H 3F5WA 3MZTA 1MFCH 3K4AA 4IRJB 4Y4HC 3FB5B 4XAKE 1G9EA 2A77H 5I74B 3S7GA 1IRAY 1F58H 4KJWC 4MQXC 1J8HA 3SGDI 1BPVA 3IRZA 3QDJD 5TDNB 1KGCD 2NYYD 4HUNB 4BFIB 1A02N 1CYGA 4PJEA 1JPGB 1AQDB 3O4LE 2FNBA 3LKQB 3PHOA 1AIFB 1E4XL 4QNPF 3T77A 4P5KB 3WHE1 1K6QH 5CBAA 1FNEB 2E27L 4GAYA 5K33A 1E6JH 4XBPA 1CCZA 25C8H 3M1BB 2P8PA 5GHWH 2FX8H 3GMRB 1QSZA 3GSRA 1PX4A 3FQXA 3ULUH 3LIZH 4BZ2H 3X3GH 1G9ML 3QEUB 5JOFB 2PXYD 4LVEA 4WV1A 2GSIA 3B3IA 1RK1B 3BZFA 2P45B 1EHNA 3CC5B 3PWVB 4JG1L 2CJUH 3QIUC 3C60D 3MGTA 4RDQG 2BDNH 4HQQL 1N0LA 4HFUL 1N3NB 1BD2D 1T1ZB 2VQTA 1AQKH 2X89D 4PJ9A 4QRTB 1W2KT 3RWJB 4JFFD 4D8PB 2B7DT 3ARXA 4HKJA 1RFDH 3KWWA 5BMFL 1J0JA 4PGDA 4DKDC 3LCYA 4GAGH 2WW8A 4PTTB 5T1KA 4X6CA 3B9KA 2DKMA 1BIHA 2MCPL 4NKQB 3W0WD 5EORH 4IEFB 4F2MB 4YPGA 1U8LB 1JZ6A 5DO2D 1KYOK 4TRPH 3KYAA 3Q3GA 2DRUA 5DURD 1IL1A 1I8IB 3T4YA 4U6HB 1BJ1J 2UZIL 1IC7L 3PWPE 3ZYIA 1NC4B 4HS3B 4G8EB 4ZOBA 3U30C 3TBWB 3RBSA 1RZJH 5GGVH 4HDIB 2JKXA 1D5IH 4LCCB 2Z91A 4BK5A 5KVMC 4U1SA 3U7WL 3UO1H 4Z8FL 2EXWC 3HI1B 4N1EA 4YE4H 4WJ5B 1MFNA 1P1ZA 3S9DB 2ZSWA 1T1WA 5CILL 2BX5A 1ZGLM 1XZ0B 3NOIA 1LO0L 4G6KL 5IP4A 12E8H 1TNNA 4GKNA 5JIHA 4P4KD 4R7DB 3V5HA 1D5ZB 1EJ6A 4DOHB 5D2LB 3K1KC 3SKUD 5EU4A 4A2MA 3LQMA 4NQDB 1LEGB 1NCWL 5FUCE 1I8IA 3UTTE 5GS2D 1U0QA 1NBVH 1FBIH 5DRWB 4PJ7A 2XQBL 1S8DB 5IK3A 1BGXH 4OCRL 2VL5A 1Z9MA 4X4YA 1D6VH 3BD3A 4RA3A 4UTBH 2OZ4A 4Q2ZB 3VGAC 1WBZB 3HC4L 5DC0A 1NDGA 1V7MH 4LASL 1S9XB 2E7LA 4O00A 3RWGA 1QFHA 5C0JB 1LILA 3LN4A 3MLPA 3KWWB 4L4JA 4WW2F 3EDJA 1G7PB 2BCKA 1KIRB 4HIJB 3P3YA 3QO1A 4QRUB 1YNLH 3MPCA 3CVHA 3VXSD 2DM2A 5FA4A 2BERA 4JPIA 3C5ZC 4GXUN 1X5ZA 3IYLW 4K7PL 1NAMH 1T20A 4ISVA 5ITFB 1TMCB 3PIQB 3GMPB 5I73B 1W72L 3DROA 3EJJX 4HXBH 1R5WB 1TETL 1KEML 2B4CC 3AVEA 3CJJA 4WFEE 1JK8B 1M7DA 1ORSB 1UWEL 1MUJA 2IANE 1CDYA 4YBQC 3NTCH 1L4IA 4GMTL 2W0LA 2YD2A 1FE8L 4JDZB 1CGUA 3IU4L 3ARPA 2IADB 2DI7A 3Q48A 5JOPE 3Q6GL 4EUPH 4JFFE 3VFPB 4D0CA 5EBLB 1MI5E 2Y06H 4LPCA 4NN5C 3WLWC 1QUNA 2VISA 5D70H 5F97E 4A6YL 2FL5B 2VIRB 4M5ZH 3QUZA 4XH2A 1HYSC 3QXVA 4I2XB 1GPOL 4N0UE 1A9EA 4LCIL 1MRDH 2HH0H 3MGOB 4P3CH 5C0AA 1LO5A 1T7ZA 4NQVA 3RNKA 3V0WL 4PJDB 1BEYH 4U1NA 1P2CA 5B8CC 4K3HA 5A2IH 1YEKL 1CL7H 3TO2B 3VRJB 2MQ3A 2XI9A 1I1FA 2IBGA 5KN5B 3U36B 4J12A 3SCMC 3V4PH 3IJYA