4KKDA

The x-ray crystal structure of mannose-binding lectin-associated serine proteinase-3 reveals the structural basis for enzyme inactivity associated with the 3mc syndrome
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
421
structure length
390
Chain Sequence
GNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLPGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGLSDVLQYVKLPVVPHAECKTSYESRYSVTENMFCAGYYEKDTCLGDSGEAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan-binding lectin serine protease 1
publication title The X-ray Crystal Structure of Mannose-binding Lectin-associated Serine Proteinase-3 Reveals the Structural Basis for Enzyme Inactivity Associated with the Carnevale, Mingarelli, Malpuech, and Michels (3MC) Syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 80
structure length 390
sequence length 421
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4kkdA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4kkdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4kkdA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4kkdA04
2HLCA 1GJ7B 1S84A 1GHAG 1PYTD 1GBEA 3SGBE 5TJXA 3SI3H 3RMOH 3TNSA 3PWCA 5FHTA 1J17T 1TPOA 2G5NA 3LH1A 1F5KU 2BDYA 3SZNA 3QZQA 2WUCA 3SJ9A 4WMEA 1QJ7B 4IN2A 1GI6A 2YOLA 2XYAA 1SI5H 3S7KB 4GCHF 4ISLA 3R62A 4VGCC 3SU4A 5BPEA 1TGBA 1ZPBA 1OK2A 2P3UB 1L4ZA 1SOTA 1GHVH 1GJAB 3MNXA 2OTVA 5GWZA 6GCHG 1TOMH 3MU0A 1GI7B 1NRRH 1HLTH 1GJ9B 2QIQA 1S5SA 1QJ6B 2AGEX 2XTTB 1GHZA 3L6PA 4ABBA 3LIWA 2VVUA 4I8LA 5LH8A 4BAKB 1ABJH 4M7GA 1ETRH 2G52A 4CHAC 1ELAA 1UHBB 3RXVA 4LOTA 4KTUA 2Z9JA 3E8LA 2WV4A 1THSH 1WOFA 3SUDA 1O2RA 1EPTA 4YESB 2QN5T 2H5CA 4OS4A 3SORA 1C5ZB 4INLA 5LPFA 2BY6X 4JZDH 4WY3A 1O5DH 1QTFA 2FOAA 1GBAA 5B6OA 3PMJA 1AQ7A 2J4IA 3EDXB 4ABDA 1C5UA 1BRUP 4HFPB 4Z6AH 1NRPH 1V2OT 3SV9A 2ZGXH 4DOQA 3O8RA 1D6WA 1GMHG 2H5DA 5LPEA 3QX5H 1FUJA 2XNIA 1DWDH 3B8JA 1GBMA 1HFIA 1LCYA 3S69A 3OY5U 1TNHA 1U5MA 3HATH 3KIDU 3NXPA 1T4VH 2C8XB 2ZDNA 1JIMA 1QRXA 4BXWA 4FUHA 1GBCA 1C4V2 3MH7A 3EJHA 3ATIA 1MH0A 1YKTA 1YGCH 3SO3A 1TRYA 2V6NA 3NK8A 1ZOMA 7KMEH 2IZ3A 3OXUD 1AKSB 4DJZB 1XUGA 4Z0KA 1XKAC 1H8DH 1WYKA 1IQKA 1HAGE 4UONA 1AWFH 1TGTA 4DW2U 2UUKB 3E16B 1QBNA 1Y8TA 3FZZA 2A1DB 1HFHA 1HAIH 4LZ4B 2Z9KA 3TJOA 1OWIA 1SGIB 1G9IE 5GCHF 1KXFA 1GKGA 2GDDA 1FN8A 1O3CA 2UUJB 3GCTG 4HTCH 2XRCA 5T3HA 3RM0H 4ASHA 1PPBH 1OX1A 2F3CE 3ATWA 4X2VA 5F6MA 1F0TA 3SNBA 3TK6A 1E37B 3PMHB 2LOJA 3QGNB 3HKIB 1B5GH 5F8ZA 1HUTH 3P8OA 1CGJE 5FXLA 1YPLH 5DK1A 3B9FH 1KXBA 4Q7ZA 3URDA 1D3QB 3LGIA 3DT0H 3K2UA 4ISIH 5A0CA 3DHKH 4GUXA 1C1OA 1T8MA 5HZPB 2P8OB 3SGQE 1C2IA 1JXPA 1WUNH 1CU1A 3U8TH 3ZYEA 4Q80A 3MNCA 1AE8H 1ZGIA 3ATKA 1VJAU 1FIWA 3ZVAA 1S83A 1SQTA 3D49H 1H2PP 1E35B 1ESBA 5JBCS 1WV7H 1ARCA 8KME2 3Q3XA 2BVSH 1MD8A 1CT0E 1GJBB 1GHXH 4X2XA 3GY5A 1ANEA 2ZFPH 2WPKS 1VGCB 2EA3A 3OY6U 1LO6A 2VGCC 2WUBA 1BMLA 1LTOA 1TNGA 1ZZZA 3MNBA 4MNVA 3GDUA 4GHQA 1QQUA 2ZWLH 1KXDA 1W0YH 1YLDA 2FP7B 1SLUB 4Y10E 2OUAA 3SV7A 3PMBB 1UK4A 4IBLH 2ZHFH 4B71A 4FXGH 4AYDA 3ZZ7A 4DURA 1L0ZA 2SGAA 4J1YA 3LJOA 1DOJA 3BTHE 4Y6DA 1A0LA 1O2QA 3RXHA 4FXGG 2SFAA 4TWWA 3MU8A 1YLCA 2G5VA 2O8WA 4ZXXH 4CRAA 5HGGA 1DXPA 2VJ1A 1KIGH 2G81E 5T6GA 1G3EA 1ZSJA 1C5XB 2FDAA 1L4DA 4CH8B 4I7YH 2PFEA 1U6QA 2QAAA 2FI4E 1HPGA 2VVCA 3ZV9A 1HJ8A 1TABE 3A82A 2OBOA 1GBDA 3DA9B 4FU9A 3BN9A 2A0QB 1LHGH 3GOVB 1G4FA 1QNJA 1RTLA 4AG2A 1GMCG 2GX4A 1C4Y2 3RDZA 3LOXA 1DWCH 3ZZ6A 2C8WB 2CGAA 3HK3B 3VPKA 3ZD2A 1XUFA 3I77A 1C5YB 1W13U 2OC7A 3VB5A 3GYLB 4MPXA 1UVTH 1MBMA 2IN2A 4THNH 4IGDA 1BQYA 1W3CA 1BDAA 5A0AE 1EAXA 1A3BH 1QGBA 2LNCA 3RXJA 2FO9A 1HIAA 3MOCA 3MH4A 3V12A 4INHA 4MUCA 3T29A 1SVPA 2R2MB 3A7WA 1ELVA 1FNIA 1SB1H 4NCYA 3A7ZA 5TCCA 4YZUA 1N8OB 2CHAC 1ANCA 2ZF0H 4NG9H 1ZHMA 5AHGH 2OC8A 5K0HA 1BTHH 1EZUC 5J4QA 1Q31A 4FUJA 3PYHA 1BTUA 1DICA 1O3FA 2FODA 2EHFA 2H9EH 1K1OA 5C20A 3UY9A 5L6NH 3BTGE 1KTTB 1H1BA 2XC0A 1TBZH 4B76A 4ZHMU 1QHRB 3GYMA 3PO1B 4JYTA 2Q6FA 3A7YA 2C4FH 1VJ9U 4I33A 4DG4A 4D7FA 1AN1E 1P09A 3ZZ8A 4IMZA 4MQAA 1GDQA 3RLYH 1YPMH 2PSXA 4UDWH 5TCAA 5IDKA 4GCHG 2C8ZB 1C1SA 2XWJI 2SGPE 3RXKA 1VGCC 3QO6A 2ZGBH 2CN0H 5EOKA 4JZEH 4TYDA 4CRBA 1Z1IA 6CHAB 1QGFA 3MO6A 2C8YB 5AVDA 2BVXH 3LC5A 1NS3A 3Q76A 1GI0A 1TGCA 2QXIA 1RD3B 2PKSB 4NZQA 2Q6GA 1S85A 4AG1A 1G37A 1XUKA 3A8DA 4LXBH 4X2YA 4AYEA 1HAVB 3EAJA 3LT3A 1CA0C 4X1QU 4I8HA 1GBKA 3M5OA 1Q2WA 1O2XA 1Y3YA 1NT1A 1V2UT 5HMAA 2PUXB 5T6DA 1RIWC 2VIQA 4CBOA 1E34B 3AAUA 4O97A 1KDQA 4HGCA 2VWNA 3EA8A 1SS2A 3QGJA 3N7OA 1FAKH 1PFXC 3AW1A 4MPWA 1V6DA 1TGNA 1P01A 5ETXA 3VXEH 2DE9A 5E2PA 3GCOA 5C5NA 1OP2A 4KP0A 1O2UA 1O30A 3LONA 1PYTC 4YOJA 2A4QA 2G00A 3KXVA 1IQHA 1NRQH 5AFZH 2CV3A 1O2SA 1HBTH 4DCDA 1O2PA 1O3PB 2NU3E 1BBRK 4B1TA 1V3XA 2QXJA 3ZZ9A 1DPOA 2TBSA 3BTDE 1BJUA 2ULLA 4ISOA 2UWPA 1ETTH 1F2SE 3A83A 1NC6A 3E0NB 5EQRA 1C9TA 3LPRA 4AORA 3RU4E 3GICB 2BY5X 1SGYE 1G30B 4TPYA 1QL7A 3D62A 3W95A 2HNTF 1A4WH 1GL0E 1QB1A 1PQ5A 1A1RA 2BD7A 3A86A 1A0JA 3A81A 5C1YA 2A7CA 1D4PB 2RKZA 4SGBE 1UTJA 4FVDA 5IYTA 4UFEH 5H4IB 4A5WB 2DUCA 2ZTYA 2Z3DA 3NKKA 3M37A 1O2IA 1TNJA 4KTSA 3PO1C 1TNIA 1VITH 1PPGE 3Q3YA 1EAWA 1O3GA 3NUMA 1C2DA 3M61U 3KN2A 2FZZA 2VWOA 3KHVA 1T32A 1UTQA 4YOGA 1VITG 2J9NA 4YNXA 1TA6A 1LVYA 2BDBA 1C1ZA 3LGVA 4CRCA 3MQLA 2ZO3H 1NESE 2WV5A 2G55A 2ZPRA 1O5BB 3KZJA 3RC6A 4NIWA 1AVWA 2VIPA 1VCQA 2BVRH 4BNRA 4AB8A 2GZ8A 4ZH8A 3MWIU 5DGJA 3TVJA 3TIUA 5DKMA 3ZVGA 8GCHF 1SGPE 1NFXA 4YO9A 4PZ5A 1P2QA 2BQWB 3UFAA 2V8EA 1C1RA 1YPEH 2AERH 2TGDA 3RC4A 4X8SH 1CO7E 3QTOH 3PTNA 3V13A 2QXGA 1UTOA 1K1IA 3V3MA 3M7PA 2ZDVH 1BBRH 3URCA 1WCZA 1GG6B 1Y3XA 3UOPA 1XXDA 1XUHA 1FY4A 1MAYA 5E0HA 1O5EH 3M3SA 3K9XB 3KQEA 1SHYA 3RXSA 1KXEA 1OK3A 3EYDA 4Q2KA 3U69H 1CT2E 1Y59T 1FY1A 1O3AA 1XM1A 3T5FH 2Z3CA 3GISB 3M5LA 1HDTH 1IQMA 1V2TT 4YOIA 2BD9A 2SNVA 1E88A 2O9QA 1E38B 1G3CA 4ISNA 3R3GB 2O8LA 2H2ZA 1O5FH 1UCYK 3H5CB 3ELAH 5BRRE 4K2YA 3GCHC 4A92A 1IQJA 1DSUA 1P2NA 4PROA 2K1QA 3CALA 1HJAC 5FBEA 2R0KA 4D9QA 4JCNA 2ZA5A 1KY9A 1OWDA 2O8TA 1QCPA 1IQNA 2WYJA 3ZVDA 1XMNB 3MU4A 4FUIA 2PKAA 3BSQA 1C2GA 1BIOA 4U2WA 4GVUA 3SGAE 3MU5A 2GMTC 1T8LA 1SC8U 2CJIA 3UPEA 3WY8A 2PUQH 5JB8S 4X1RU 1C5MD 5DP3A 2ERJA 2QXHA 3SNAA 2P16A 3EA7A 2YNAA 1LPKB 3M7QA 4FUFA 4X0WU 3EQ0H 1MU8B 1EPTB 1Y5BT 2A45B 2XBXA 1P05A 3TH3H 1SLVB 3ZZBA 4AFZA 4AX9H 3RXCA 1CHGA 1H9LB 1P57B 4AFSA 4UE7H 1AB9B 1UVOA 1Z1JA 2TPIZ 1N1LA 4GPGA 3GY2A 3FZDA 1SG8B 1ARBA 3FP6E 4C16A 1O3JA 1TALA 2ODQA 4CBNA 1JIRA 1AGJA 1CE5A 3SHAH 5AFYH 1O3OA 2F9UA 2EC9H 4Y0ZE 1NRSH 3V0XA 3VGCB 3VFEA 4JZIA 5SGAE 4K5ZA 1W10U 3BF6H 1O3LA 2ASUB 1K21H 5EGMA 2FOHA 4MLFB 2PHBA 1BA8B 1TX7A 3P8FA 4MVNA 4JYUH 1MQ5A 3T5OA 1UCYH 1T8OA 1HFDA 3PV4A 4CRDA 3PMAB 2FYQA 1F0RA 2Y81A 4R8TB 2B9LA 2AYWA 4YLUA 1PPZA 1G36A 6ESTA 3VB7A 3MMGA 4MPUA 2XRDA 2ZHEH 2FESH 1OJYA 2V3OH 1BT7A 1ZMLA 2BTCE 4AN7A 1LVOA 1UTLM 4FUEA 1TPPA 4DGJA 3OX7U 1TNLA 2ZFRH 5FX5A 1TWXB 2NU0E 2Y5GA 1HYLA 2HPQH 1ORFA 5A8YA 2JH0D 1ELFA 1GKNA 1XXFA 2ANMH 3UNQA 5DPAA 1SQAA 5DG6A 1OWHA 2R9PA 1TPGA 1D9IA 3P92A 3E3TA 1S81A 2OLGA 2ZTXA 1C1WH 3IWMA 1ZR0A 2GKVE 3SJIA 3A89A 3SNCA 4ZHLU 2XCFA 7ESTE 1E0FD 2AGIX 1MKWK 3BG4B 3K6YA 2RLPA 4OS6A 2VIOA 4FU8A 5CHAC 4A1XA 3UR6A 1IAUA 2HOBA 1YC0A 2WPHS 2GCTB 1AFEH 3E1XB 1EJAA 3FP8E 3P8GA 1VZQH 2AMDA 1TNKA 1AWHB 5EXNA 3RM2H 3SHCH 1QIXB 1AVGH 3BV9B 1V2KT 1NRNH 1THRH 4R0IA 1KXAA 3O8CA 5EPYA 2FWWA 1CHOF 4U32A 1GHBG 5EW2H 1GBHA 4NFEA 1YPHE 1FBRA 5HYUB 3L33A 1M9UA 4CRGA 1EOLA 5JPMH 2FEQH 4ZKSU 2GD4B 5GXPA 2Q6DA 2G4UA 2PSYA 4WVPE 4OGXA 1H04P 1GGDB 1MTNB 3A7XA 1EJNA 2G7IA 1GVZA 2Z9LA 3GY6A 4DT7B 1O36A 1UTPA 5EG4A 1OWKA 1QL8A 2GP9B 1J14A 2P94A 5GPIB 2P3TB 2F9OA 1EASA 1HJ9A 1O2ZA 1OWEA 1OYTH 3RXEA 2ZFSA 4GHTA 3UR9A 4B2CA 4AYMA 3KL6A 5A2MH 3DFLA 5LPRA 1EXFA 8GCHG 4XFQA 1DVAH 1EB2A 1GMDG 3SQHE 1O2LA 1TPAE 1MMJN 1GDNA 3UQOA 2AGGX 1MKXK 3CS0A 3PLPA 1GBBA 2WPLS 2VU8E 1YCPM 3ZRZA 1SGDE 4BAOB 3A7VA 3GCNA 1PPFE 1T7CA 5EQQA 1NFUA 2JETB 1GHYH 3EE0B 1MKWH 4B2RA 1Z92B 2VH6A 2I6QA 1HIAB 3RMMH 1ZMJA 1O39A 1SSXA 3SUFA 3KGPA 4CREA 1UHBA 1A5HA 2B5ID 5EODA 4LOYH 5FBIA 3B23B 2XXLA 3UNRA 2BDHA 2ZC9H 1AE5A 9ESTA 3G01A 1YPGH 4QT8C 2Y7ZA 3SBKA 2MCZA 2A55A 1W12U 4ABEA 4CSYA 3FFGA 2ZGCA 4AOQA 2AIQA 3A80A 3MO3A 3TU7H 4ZKNU 3S7HB 1A61H 5FCKA 1KLIH 1QBOA 2RCEA 1C1MA 2XBVA 1MD7A 2ZECA 4NSYA 4MG3A 3HKJB 1P2IA 2HVXA 2QY0A 1B7XB 2OD3B 1Z7KA 3GDVA 1HAOH 4CRFA 1LQEA 4LOSA 7GCHG 2AMQA 1QR3E 1O2OA 2GCHF 2OQUA 1O2HA 3OEDC 2PW8H 1W0ZU 4WJG2 2UUYA 1UO6A 4UFFH 1NO9H 1C4U2 5F03A 1OXGA 2ANYA 2KAIB 1BCUH 3ZV8A 4AYVB 3OYPA 4X8VH 3A84A 4K1SA 4DJZA 1AKSA 5L2YH 4IC5A 1F92A 5ABWA 1F5RA 1O3NA 4KGAA 1DITH 5JB9S 1AY6H 3TLOA 2C90B 2ZQ1A 2F9VA 1MQ6A 1AO5A 2ZG0H 1QB9A 1ZSKA 1MKXH 3T26A 4ABIA 1OP0A 1DWBH 1SGRE 2P3FH 1GCTB 1J9CH 2PLXA 3HGPA 2XWBF 2B0FA 1RTKA 2A5KA 4RKJB 2FLRH 1GJDB 4I32A 2STAE 1MTWA 3FP7E 5A8ZA 3KCGH 2SGDE 1MTNC 1AFQB 5HXFA 3PLKA 2XW9A 1ZMNA 1C2EA 1EX3A 1EATA 1ZSLA 1MTSA 1TQ7B 3QTVH 4D8NA 2GT7A 2OBQA 4XDEA 4XBDA 1KSNA 2OC0A 4IN1A 1KDQB 1YP9A 4X6OA 1TGSZ 3BIUH 1C5PA 2HNTC 3O8EB 3BTME 3S9CA 1FY8E 1YBWA 2CG7A 3PLBA 1GBFA 2JGWA 3EGKH 3ZZ3A 1O0DH 2ZHWH 2XCNA 2Z9GA 1CGHA 1BZXE 1OK1A 1BMNH 1EZQA 1UTMA 2W3IA 2BZAA 4BXSA 1IQFA 1VVCA 2BZ6H 3RXQA 2P8OC 3S9BA 1GWAA 5A0BA 1SGEE 4IW4E 5FPYA 3GY7A 1SPJA 1C5NH 1NN6A 2EI7A 4MNXA 3SUGA 3GY8A 1AUJA 1SR5C 2FI5E 1TOCB 3SN8A 3Q3KA 1H9HE 2ZDLA 5DO4H 1O2TA 1TB6H 1DT2A 2XWAA 1P10A 3RP2A 4ZUHA 3OU0A 4ZKOU 2GDEH 1UK3A 1T4UH 2TGAA 2QF0A 2F83A 5DP5A 1SGTA 2DE8A 2ZKSA 4NZLA 4NWLA 4B2SA 2BLQA 2Z7FE 3K65B 1GI8B 1RRKA 1JWTA 3QK1A 4NFFA 1DUEA 1HGTH 3AASA 3UWIA 3KEEA 3TGIE 3ZZDA 1Y3WA 1XVMA 1FQ3A 4A7IB 1TPNA 2VIDA 4BAQB 1KYNA 3KF2A 1QB6A 5G4BA 3SV2H 1SFQB 1DY8A 1O3EA 3KQDA 3NFPI 1BMAA 2FX4A 3A8AA 1TYNA 1A3EH 3PWBA 4NA9H 1GHAF 2AH4X 1ZYOA 2BD3A 1L2EA 3GY4A 1P3CA 2NWNA 1S6HA 2BY8X 1H03P 3UTUH 4K1EA 3TVJB 1SGFG 3H7OA 3RXIA 1O2MA 3F6UH 3VEQB 1AUTC 1Y5AT 1EP6A 4AYYB 3RXLA 1LY2A 1VCPA 1ANDA 3TGKE 3P6ZB 1DLKB 3TJUA 4U30A 8ESTE 4B74A 1H9IE 2R3UA 1YF4A 4AB9A 4NA7A 2CF9H 2HWLB 1GJ4H 2A7HA 2ZU2A 3LGYA 4F49A 1QA7A 3IU3I 2PGBB 1UTNA 3KQCA 4INKA 2XC4A 1K1PA 1D6RA 2PWXA 3SUEA 2CXVA 1P2OA 1UOTP 3RU4D 1QQ4A 1N8OC 2WIIC 2XBYA 1GBJA 3QN7A 1C1PA 3STIA 2AMPA 1N6XA 2FYRA 5GCHG 3SW0X 1C5QA 2VINA 4K8BA 2F91A 3SJ8A 1F5LA 3TITA 4ZMAH 4GLYA 1CBWB 5FCRA 1GMHF 4XE4A 2HPPH 1EZSC 2NU4E 3H7TA 3NWUA 1O3BA 2PTCE 2ZDKA 5FX6A 4BAHB 1PPCE 2OC1A 2UWLA 1ZRKA 1P2JA 1NROH 1JBUH 4Y8ZA 4FUDA 1RXPA 3ESTA 1E5GA 3MI4A 2QYIA 4SGAE 3O8DA 3CP7A 3TH4H 1DY9A 3RXGA 2FX6A 3P8NA 4X2WA 1G3BA 4NIYA 1TMTH 2PKAB 3ERBA 2EI6A 2EC3A 1UCYE 2CF8H 4IMQA 4NIXA 4H6SB 5A8XA 3ZVBA 6CHAC 1ZRBA 2ANWA 1C9PA 1X7AC 5HYOA 2VIVA 3ATLA 3E91A 2PKSC 2JKHA 4KKDA 4JK6A 2BD4A 1L1NA 3PTBA 3F9HA 3S9AA 4B2AA 1DFPA 2BX4A 2GGVB 1DS2E 3FANA 1KTSB 3GCTF 2KMSA 3RU4T 1EQ9A 3RXTA 1QJ1B 1UVPA 5C5OA 1ELEE 2A2QH 3U1JB 1YPHC 5EXMA 3DD2H 5EXLA 1ZTLA 2AS9A 3U8OH 3ZZ4A 5I25A 2CMYA 3DUXH 4X1SU 2VIWA 1C1QA 3VXFH 5HM9A 1B0EA 4J38B 1C1VH 1JOUB 3M7TA 1P04A 4CH2B 1TBRH 4FUGA 3OP8A 4AZ2B 3QLPH 1NFYA 4TY6A 1IHTH 1AU8A 1RTFB 5EU8A 1SBWA 2Y5FA 2TRMA 4X6PA 5C1XA 3RXPA 4XSKU 1KXCA 2ZGHA 1LHCH 1PPHE 2A4OA 1GJ5H 1P0SH 4VGCB 1PJPA 2BMGB 2BDAA 1SRZA 1DUAA 1EP5A 1SGFA 2H9HA 3UWJH 4U01A 1HCGA 1H4WA 3M5MA 2ZEBA 4NA8A 1LKBA 4IC6A 5HM2A 1A46H 1WAYB 4XBCA 3S0NA 2J94A 4X1NU 1TFXA 1NZQH 1GDUA 2SGQE 1BHXB 4ONTD 4YT7H 1VCWA 1IQLA 1ID5H 3D23A 1K9OE 2OP9A 2GZ9A 1K1JA 1ZGVA 2P59A 5JBBS 1IQGA 4JMYA 1A5GH 2OCVB 2VWLA 4OS2A 1Z8JB 1MBQA 4ZHAA 1FJSA 3IX0A 2YNBA 3HPTB 4BANB 1O32A 4H6TA 2MCYA 1C2HA 4Y8XA 1WBGB 1ZTKA 2GV7A 1C5WB 3VB6A 1BRBE 4DY7B 2FS9A 1NWVA 1W8BH 1DANH 2G51A 1CT4E 2IJOB 3RXUA 1GMCF 3ZYDA 1Z6JH 1HCCA 1SL3A 3NCLA 1EJMA 3ITIA 3QUMP 5AF9H 1GHWH 1BRCE 2J34A 4RKOB 4I31A 1J16A 2A2XH 4BOHA 4Q7YA 2A4RA 3LC3A 3ODFA 3ODDA 3L89M 2ZZUH 3ATMA 1T8NA 2B8OH 3AW0A 1WQSA 3R0FA 4GSOA 1IQEA 2RL0A 1TIOA 2BD5A 1AZ8A 1O2WA 2QC2A 2XWBI 4UFGH 1O2YA 2TGPZ 3E0PB 3HGNA 1GG6C 3UNSA 1SHHB 1GHQB 3BEIB 3FVFB 1WQVH 3PROA 4Y76A 1FIZA 1EAUA 1FPCH 1D3PB 2Y6TA 1MCVA 1P12E 5GIBA 2B7DH 2V0BA 3M5NA 1NY22 4Q7XA 1O2KA 1PQ8A 2ALVA 4O3TA 1A2CH 1Z8IB 5FO8C 1C2MA 4E05H 5K7RA 2Q1JA 3TK9A 1BTZA 4X6MA 2YRAA 2A5AA 3V7TA 2ODYB 2KRIA 5C67A 1BTYA 4Y11E 3C1KA 4Y7BA 4AGKA 2BD2A 2JH5D 1KLJH 1UVUH 1N6YA 2QV1A 5FPSA 1UJ1A 2F9NA 4A1TA 3MYWA 1ELDE 5E8EH 3UIRA 3A8CA 1K1LA 1L1JA 1QA0A 3ZZ5A 2H9TH 2P95A 1LVMA 4FUBA 1ELTA 1UVSH 1QUBA 2V3HH 1D3DB 3F9GA 5L2ZH 4JHSA 2G8TA 4TPIZ 1BUIA 1W2KH 1A0HB 2FXRA 1A7SA 1BOQA 2Z6BD 1LHFH 3RC5A 2THFB 3LJJA 1E8BA 1SFIA 1YM0A 1Y5UT 3MFJA 4KTCA 2CKUA 2ZU1A 2VGCB 4Y71A 1GBIA 3LGTA 4MPVA 1YYY1 1C5RA 2ALPA 1O2VA 3BEUA 1O3HA 4OS5A 3M35A 4FUCA 1MAXA 1CSOE 2QF3A 3SQEE 2PTNA 1FV9A 1AMHA 5C1UA 2FS8A 3BTEE 4TWYA 2Y82A 9LPRA 1GI9B 1EPTC 2ZFTA 1H8IH 2ANKH 1FONA 1O34A 2H1UA 2OQ5A 5EPNA 4O03A 2WPMS 3GDSA 3A7TA 1AB9C 1O9AA 1S0RA 2QY0B 1K28D 2UWNA 1BTWA 1G2LA 3RMNH 1SGNE 2BQ7B 2BHGA 5DP6A 2BXTH 1V2JT 1Z71A 2R2WU 4OS7A 1CQQA 1LPGB 1F0SA 1OPHB 1DXWA 4BTIB 4ZROA 3VGCC 4CR9A 2ZPSA 5JPMG 1O5GH 5DP7A 1CGIE 2HRVA 3SU6A 4IS5A 2AEIH 3F9EA 3SU3A 3RXRA 1FXYA 1LPZB 1O3KA 4AFQA 1C5LH 3RXBA 1C2LA 3UQVA 1OJVA 1ANBA 1O38A 4JZ1A 2QA9E 1P9SA 1P2MA 3LH3A 2Z9IA 2AIPA 1TBQH 1DX5M 1GBLA 1HXFH 1NFWA 2BDGA 1C5TA 2W7SA 3GY3A 5C2ZA 4MNWA 1NU9A 1D3TB 3RJ3D 3BG8A 2VVVA 1O2GH 3SJKA 3INBC 2BOHB 1WU1A 4B73A 1RJXB 3ZVCA 5DP8A 1QURH 1G3DA 1S0QA 1FI8A 1S82A 4JYVH 3IG6B 5GDSH 1QRWA 3C27B 2C3SA 2FOMB 3ENSB 1ELBA 2J38A 2XC5A 1FN6A 8LPRA 4ZH1D 3IITA 1AD8H 1DM4B 3JZ2B 1SGQE 1HAPH 2CHAB 2FPZA 1GJ6A 3BTWE 2AFQB 2M5TA 2ZFFH 2J92A 2ZPQA 1SLXB 3T28A 1P3EA 2BDCA 3ZZCA 1VITF 5E2OA 4H4FA 1XVOA 3TNTA 1IHSH 1ELGA 3BTFE 4ABFA 2OINA 4WH8A 4I8GA 1G2MA 1CA8B 4ABJA 4X8TH 1PPQA 2BZMA 1P02A 1TLDA 2UWOA 3I78A 1BJVA 1C2FA 2QGRA 4UD9H 2Y5HA 3VB4A 1H2QP 1G4GA 1XUJA 2F9BH 1ZPCA 5ESTE 4CR5A 2D2DA 1EAIA 1AHTH 1LDTT 1ZPZA 1GI3A 3BG4C 1BITA 3LU9B 3ZVFA 1OK9A 2GVFA 5DP4A 1OOKB 4ZXYH 1P9UA 1C5OH 1BHXF 2GCTC 3QWCH 1QFKH 1Y3UA 1O3DA 2NU1E 4H42U 1TRNA 1GI5A 1IOEA 1TMUH 3RXFA 1GJCB 3K6ZA 3OSYA 1O33A 3LGUA 1S6FA 4WMFA 2BOKA 2RG3A 2JRAA 2F9PA 1V2ST 1KLTA 1AZZA 1FZZA 2W5EA 1CA0B 1W11U 1XKBC 1YPKH 2RKYA 3CS7A 2ZP0H 1O3IA 1P8VC 4NGAH 3U1IB 1Y3VA 2V35A 5EW1H 1RIWB 4BTTB 4WF8A 1TX6A 3OTJE 2FOCA 3SJOA 5ESBA 3JZ1B 2LPRA 1DSTA 2P93A 3QDZB 1MTVA 1GGDC 4NWKA 4K8YA 5E0JA 2SGFE 1C1UH 1ESAA 2ZU5A 1V2PT 4AFUA 1GJ8B 1GVKB 4HI3A 4ZKRU 5DP9A 1GL1A 1BMMH 1HNEE 3Q00A 4Y8YA 4F4OC 5GJ4B 3RXOA 1RS0A 4K12A 2BLWA 2A31A 2A7JA 1TMBH 2ZIQH 1ELCA 4BAMB 1IQIA 2FMJA 4HZHA 1GPZA 4XOJA 4RSPA 1K1MA 4I8KA 6LPRA 1ZLRA 1LHDH 4AYIA 4JK5A 4NSVA 1O2JA 1O3MA 2BLVA 5JBAS 1QL9A 4YT6H 4O9VA 1ZHRA 1O2NA 2FOBA 3W94A 4X1PU 1YPJH 5LGOA 1O35A 1LVBA 1LMWB 2C93B 1HRTH 3DFJA 2JETC 5JDUB 3SNEA 4K1TA 1HAHH 1OS8A 2FTLE 3KNXA 2ZNKH 4J2YB 2Z3EA 2B5TB 2HGTH 2Y7XA 4DIIH 1C1TA 3E90B 1HXEH 2SGEE 3BIVH 1TPSA 2VH0A 3TH2H 2J95A 1TRMA 3A87A 2GT8A 1HB0B 2BQ6B 1INCA 1ZHPA 1O5CB 2ZDAH 2CG6A 3AAVA 3F9FA 4UFDH 1BBRE 1OYQA 1AIXH 5CMXH 1GI4A 2D1JA 2J2UA 1C5VA 1UTKA 1FAXA 2GV6A 3T25A 3P17H 4ZAEA 1XUIA 4YLQH 2BX3A 2ZHDA 4MTBA 1LHEH 2BXUH 3LKWA 5JYIA 1P03A 4YTAA 3VB3A 2SNWA 1W7GH 1C2JA 2VNTA 1Q3XA 2FI3E 2FOGA 2KAIA 1Z6EA 3UOUA 1HAZB 2BYAX 1PQ7A 5DJ7A 1OKXA 1THPB 3TPIZ 3P70B 4AGJA 3GOVA 2FTMA 1Z8GA 4WWYA 2GZ7A 3U8RH 1GI2A 3RXAA 2WYGA 1FDPA 2A4GA 5T6FA 1XX9A 2O8UA 4D76A 2ZHQH 4A6LA 1JMOH 4ABGA 1GCTC 6GCHF 1UMAH 1EOJA 3ZD1A 2ESTE 5F8XA 5EQSA 3UREA 3M36A 1AFQC 2JGXA 1CKLA 2R0LA 2WINI 1GBTA 2G4TA 2Y80A 1CHOG 1TONA 2W81A 1LKAA 1DDJA 2BY7X 4K3JA 1SOZA 1PPEE 3P95A 1TPMA 3SU5A 1O5AB 1BTXA 3M3TA 5HYTB 5I46H 2ZGJA 4WH6A 5A09A 2O8MA 2TIOA 2FM2A 2RLQA 3GCHB 2JH6D 4XBBA 2IZ4A 2IPHA 2HALA 3AVZA 4WXVA 1HJAB 3NZIA 3SU1A 4MNYA 1AI8H 1MTUA 4B2BA 2WPIS 5E0GA 4K60A 3I29A 4X8UH 1QBVH 2ZFQH 4E7RG 3U98H 3EA9A 1V2VT 3NPSA 4WMDA 2PV9B 1C2KA 1K1NA 4NIVA 1F7ZA 4Y0YE 2PR3A 1P2KA 3BTTE 1OJWA 3UUZA 3L3TA 1OSSA 3T27A 3F68H 2GMTB 1F0UA 2W7UA 1PQAA 2I6SA 3T2NA 1O37A 2NU2E 1GHBF 3SI4H 1B0FA 1EUFA 3RXMA 2ZTZA 1DWEH 1HAYB 1BB0B 5FAHA 5L30H 1E36B 1A5IA 3LGWA 1WSSH 4A5TS 4ISHH 1FMGA 1FY3A 1C1NA 1DE7H 1RFNA 5F8TA 2A5IA 4B75A 2EI8A 1HAVA 1TE0A 2XBWA 4JZFH 3ZVEA 1TAWA 4WXIA 2FIRH 1MU6B 3FAOA 3TJVA 3MU1A 4LZ1H 3RUOA 1Z8RA 5I0QB 3RMLH 2EEKA 1VVDA 1V2NT 1FPHH 2H6MA 2WPJS 1ESTA 2D26C 4FU7A 3PM3A 1NTPA 2O39C 3BEFB 3SOSA 4YM9A 1W7XH 1V2WT 3MH6A 2A32A 1GMDF 1MCTA 1BTPA 1G32B 1YCPK 2BDIA 4GAWA 1QY6A 3KQBA 3BTKE 3RLWH 3F1SB 2UUFB 2YBYA 4ESTE 3E6PH 2ZI2H 2ILNA 3STJA 2GCHG 1NPMA 5FPTA 1DLEA 3HK6B 3Q77A 3A8BA 5HYPA 4K69A 2RDLA 1MZAA 4TY7A 3MH5A 4OGYA 1GI1A 1GVLA 1ACBE 1WTHD 2RA3A 3MHWU 2HNTE 4A1VA 4D7GA 3RXDA 4E7NA 1RGQA 1TX8A 1JRSA 3O8BA 1EKBB 1K2I1 2ZCHP 1GCDA 2OXSA 2QCYA 3GXEA 2STBE 1J15A 1CVWH 1WTGH 2W80A 1HAXB 1MZDA 1SLWB 2FLBH 3BTQE 3A85A 2ODPA 1JRTA 3MNSA 2VB0A 4I8JA 1V2LT 4FVBA 2ZU3A 1SQOA 4UEHH 1ZJKA 1MUEB 1NM6A 3SNDA 4DVAU 1ETSH 3T62A 3QZRA 4CHAB 1J8AA 1T31A 1CBWC 1EZXC 1TA2A 3ZZAA 7GCHF 1UK2A 2PGQB 2XRBA 1VR1H 4DIHH 2ZQ2A 1K22H 1L1GA 1SGCA 2BLOA 4KELA 3CENA 1SMFE 2ZCLP 1TQ0B 4E06H 3SV6A 1FY5A 5JBTA 5J4SA 4OS1A 1OP8A 1AVXA 1QO6A 2RA0A 1O31A 3SU2A 5CE1A 5CHAB 3SV8A 2BB4A 2Z94A 4O3UA 1YCPH 4MDSA 1EB1H 3D65E 1FLEE 2R3YA 4Y7AA 1C5SA 4X6NA 3A88A 2IOTA 1OWJA 3TJNA 2GTBA 2XQWC 1NU7B 4LK4A 1P06A 1ABIH 5PTPA 2BM2A 1P11E 3SW2B 1ZJDA 1ZTJA 1LQDB 3U9AH 2W26A 3PB1E 2VWMA 2FOFA 2ZU4A 1HV7A 4RN6A 2W3KA 2FOEA 2D8WA 2ZDMA 2BD8A 3TK5A 3LDXH 3MTYA 3M7UA 4ABAA 5C3NA 4ABHA 2TGTA 3MO9A 2BY9X 4BTUB 1BRAA 3TGJE 1W14U 4D9RA 3M3VA 3SU0A 7LPRA 1V2RT 2ZCKP 4Y79A 1V2MT 1QRZA 1V2QT
chains in the Genus database with same CATH superfamily
2HLCA 2Y8RA 1GJ7B 1S84A 1GHAG 1PYTD 1GBEA 2KR7A 5TJXA 3SGBE 3SI3H 3RMOH 3TNSA 3PWCA 5FHTA 1J17T 1TPOA 2G5NA 3LH1A 1F5KU 2BDYA 3SZNA 3QZQA 2WUCA 3SJ9A 4WMEA 1QJ7B 4IN2A 1GI6A 2YOLA 2XYAA 1SI5H 3S7KB 4GCHF 4ISLA 3R62A 4VGCC 3SU4A 5BPEA 1TGBA 1ZPBA 1OK2A 2P3UB 1L4ZA 1SOTA 1GHVH 1GJAB 3MNXA 2OTVA 5GWZA 6GCHG 1TOMH 3MU0A 1GI7B 1NRRH 1HLTH 1GJ9B 2QIQA 1S5SA 1QJ6B 2AGEX 2XTTB 1GHZA 3L6PA 4ABBA 3LIWA 2VVUA 4I8LA 4P00A 5LH8A 4BAKB 1ABJH 4M7GA 1WDIA 1ETRH 2G52A 4CHAC 1ELAA 2PP6A 1UHBB 3RXVA 4LOTA 4KTUA 2Z9JA 3E8LA 2WV4A 1THSH 1WOFA 3SUDA 1O2RA 1EPTA 4YESB 2QN5T 2H5CA 4OS4A 3SORA 1C5ZB 4INLA 5LPFA 2BY6X 4JZDH 4WY3A 1O5DH 1QTFA 2FOAA 1GBAA 5B6OA 3PMJA 1AQ7A 1W0JD 2J4IA 3EDXB 4ABDA 1C5UA 1BRUP 4HFPB 4Z6AH 1NRPH 1V2OT 3SV9A 2ZGXH 4DOQA 3O8RA 1D6WA 1GMHG 2H5DA 5LPEA 3QX5H 1FUJA 2XNIA 1DWDH 3B8JA 1GBMA 1HFIA 1LCYA 3S69A 3OY5U 1TNHA 1U5MA 3HATH 3KIDU 5F53A 3NXPA 1T4VH 2C8XB 2ZDNA 1JIMA 1QRXA 4BXWA 4FUHA 1GBCA 1C4V2 3MH7A 3EJHA 3ATIA 1MH0A 1YKTA 1YGCH 3SO3A 1TRYA 2V6NA 3NK8A 1ZOMA 7KMEH 2IZ3A 3OXUD 1AKSB 4DJZB 1XUGA 4Z0KA 1XKAC 1H8DH 1WYKA 1IQKA 4MSLA 1HAGE 4UONA 1AWFH 1TGTA 5KECA 4DW2U 2UUKB 3E16B 1QBNA 1Y8TA 3FZZA 2A1DB 1HFHA 1HAIH 4LZ4B 2Z9KA 3TJOA 1OWIA 1SGIB 1G9IE 5GCHF 1KXFA 1GKGA 2GDDA 1FN8A 1O3CA 2UUJB 3GCTG 4HTCH 2XRCA 5T3HA 3RM0H 4ASHA 1PPBH 1OX1A 2F3CE 3DSOA 3ATWA 4X2VA 5F6MA 1F0TA 3SNBA 3TK6A 1E37B 3PMHB 2LOJA 3QGNB 3HKIB 1B5GH 5F8ZA 1HUTH 3P8OA 1CGJE 5FXLA 1YPLH 4TSFD 5DK1A 3B9FH 1KXBA 4Q7ZA 3URDA 1D3QB 3LGIA 3DT0H 3K2UA 4ISIH 5A0CA 3DHKH 4GUXA 1C1OA 1T8MA 5HZPB 5C0TA 2P8OB 3SGQE 1C2IA 1JXPA 1WUNH 1CU1A 3U8TH 3ZYEA 4Q80A 2WSSD 3MNCA 1AE8H 1ZGIA 3ATKA 4P02A 5IK2D 1VJAU 1FIWA 3ZVAA 1S83A 1SQTA 3UAIC 3D49H 1H2PP 1E35B 1ESBA 5JBCS 1WV7H 1ARCA 8KME2 3Q3XA 2BVSH 1MD8A 1CT0E 1GJBB 1GHXH 4X2XA 3GY5A 1ANEA 2ZFPH 2WPKS 1VGCB 2EA3A 3OY6U 1LO6A 2VGCC 2WUBA 1BMLA 1LTOA 4HG6A 1TNGA 1ZZZA 3MNBA 4MNVA 3GDUA 4GHQA 1QQUA 2ZWLH 1KXDA 1W0YH 1YLDA 2FP7B 1SLUB 4Y10E 2OUAA 3SV7A 3PMBB 3FN8A 1UK4A 4IBLH 2ZHFH 4B71A 4FXGH 4AYDA 3ZZ7A 4DURA 1L0ZA 2SGAA 4J1YA 3LJOA 4APLA 1DOJA 3BTHE 4Y6DA 1A0LA 1O2QA 3RXHA 4FXGG 2SFAA 4TWWA 3MU8A 1YLCA 2G5VA 2O8WA 4ZXXH 4CRAA 5HGGA 1DXPA 2VJ1A 1KIGH 2G81E 5T6GA 1G3EA 1ZSJA 1C5XB 2FDAA 1L4DA 4CH8B 4I7YH 2PFEA 1U6QA 2QAAA 2FI4E 1HPGA 2VVCA 3ZV9A 1HJ8A 1TABE 3A82A 2OBOA 1GBDA 3DA9B 4FU9A 3BN9A 2A0QB 1LHGH 3GOVB 1G4FA 1QNJA 1RTLA 2KCYA 1GMCG 2GX4A 4AG2A 1C4Y2 3RDZA 3LOXA 1DWCH 3ZZ6A 2C8WB 2CGAA 3HK3B 3VPKA 3ZD2A 1XUFA 3I77A 1C5YB 1W13U 2OC7A 3VB5A 3GYLB 4MPXA 1UVTH 1MBMA 2IN2A 4THNH 4IGDA 1BQYA 3OAAD 1W3CA 1BDAA 5A0AE 4TT3D 1EAXA 1A3BH 1QGBA 2LNCA 3RXJA 2FO9A 1HIAA 3MOCA 3MH4A 3V12A 4INHA 4MUCA 3T29A 1SVPA 2R2MB 3A7WA 1ELVA 1FNIA 1SB1H 4NCYA 3A7ZA 5TCCA 4YZUA 1N8OB 2CHAC 1ANCA 2ZF0H 4NG9H 1ZHMA 3OEED 2OC8A 5AHGH 5K0HA 1BTHH 1EZUC 5J4QA 1Q31A 4FUJA 3PYHA 1BTUA 1DICA 1O3FA 2FODA 2EHFA 2H9EH 1K1OA 5C20A 3UY9A 5L6NH 3BTGE 1KTTB 1H1BA 2XC0A 1TBZH 4B76A 4ZHMU 2LELA 1QHRB 3GYMA 3PO1B 4JYTA 2Q6FA 2J98A 3A7YA 2C4FH 1VJ9U 4I33A 4DG4A 4D7FA 1AN1E 1P09A 3ZZ8A 2X2ZA 4IMZA 4MQAA 1GDQA 3RLYH 1YPMH 2PSXA 3N7DA 4UDWH 5TCAA 5IDKA 4GCHG 2C8ZB 1C1SA 2XWJI 2SGPE 3RXKA 1VGCC 3QO6A 2ZGBH 2CN0H 5EOKA 4JZEH 4TYDA 2W6JD 4CRBA 1Z1IA 3EE7A 6CHAB 1QGFA 1QZ8A 3MO6A 2C8YB 5AVDA 2BVXH 3LC5A 1NS3A 3Q76A 1GI0A 1TGCA 2QXIA 1RD3B 2PKSB 4NZQA 2Q6GA 1S85A 4Q63A 4AG1A 1G37A 1XUKA 3A8DA 4LXBH 4X2YA 4AYEA 1HAVB 3EAJA 3LT3A 1CA0C 4X1QU 4I8HA 1GBKA 3M5OA 1Q2WA 1O2XA 1Y3YA 1NT1A 1V2UT 5C0UA 5HMAA 2PUXB 5T6DA 1RIWC 2VIQA 1WXRA 4CBOA 1E34B 3AAUA 4O97A 1KDQA 4HGCA 2VWNA 3EA8A 1SS2A 3QGJA 3N7OA 1FAKH 1PFXC 3AW1A 4MPWA 1V6DA 1TGNA 1P01A 5ETXA 3VXEH 2DE9A 2WV9A 5E2PA 3GCOA 5C5NA 2EY4C 1OP2A 4KP0A 1O2UA 1O30A 2L6OA 3LONA 3VG8A 1PYTC 4YOJA 2A4QA 2G00A 3KXVA 1IQHA 1NRQH 5AFZH 2CV3A 1O2SA 1HBTH 4DCDA 1O2PA 1O3PB 2NU3E 1BBRK 4B1TA 1V3XA 2QXJA 2XOKD 3ZZ9A 1DPOA 2TBSA 3BTDE 1BJUA 2ULLA 4ISOA 2UWPA 1ETTH 1F2SE 3A83A 1NC6A 3WWFA 3E0NB 5EQRA 1C9TA 3LPRA 4AORA 3RU4E 3GICB 2BY5X 1SGYE 1G30B 4TPYA 1QL7A 3D62A 3W95A 2HNTF 3KYFA 1A4WH 1GL0E 1QB1A 1PQ5A 1A1RA 2BD7A 3A86A 1A0JA 3A81A 5C1YA 2A7CA 1D4PB 2RKZA 4SGBE 1UTJA 4FVDA 5IYTA 4UFEH 5H4IB 4A5WB 2DUCA 2ZTYA 3VWOA 2Z3DA 3NKKA 3M37A 1O2IA 1TNJA 4KTSA 3PO1C 1TNIA 1VITH 2Y8TA 1PPGE 3Q3YA 1EAWA 1O3GA 3NUMA 1C2DA 3M61U 3KN2A 2FZZA 2VWOA 1MABB 3KHVA 1T32A 1UTQA 4YOGA 1VITG 2J9NA 4YNXA 1TA6A 1LVYA 2BDBA 1C1ZA 3LGVA 4CRCA 3MQLA 2ZO3H 1NESE 2WV5A 2G55A 2ZPRA 1O5BB 3KZJA 3RC6A 4NIWA 1AVWA 2VIPA 1VCQA 2BVRH 4BNRA 4AB8A 2GZ8A 4ZH8A 3MWIU 5DGJA 3TVJA 3TIUA 5DKMA 3ZVGA 8GCHF 1SGPE 1NFXA 4YO9A 1NBME 3U28C 4PZ5A 1P2QA 2BQWB 3UFAA 2V8EA 1C1RA 1YPEH 2AERH 2TGDA 3RC4A 4X8SH 1CO7E 3QTOH 3PTNA 3V13A 2QXGA 2RDEA 1UTOA 1K1IA 3V3MA 3M7PA 2ZDVH 1BBRH 3URCA 1WCZA 1GG6B 1Y3XA 3UOPA 1XXDA 1XUHA 1FY4A 1MAYA 5E0HA 4XRNA 1O5EH 3M3SA 3K9XB 3KQEA 1SHYA 4ACBA 1VKYA 3RXSA 4B6FA 1KXEA 1OK3A 3EYDA 4Q2KA 3U69H 1CT2E 1Y59T 1FY1A 1O3AA 1XM1A 2F43B 3T5FH 2Z3CA 3GISB 3M5LA 1HDTH 1IQMA 1V2TT 4YOIA 2BD9A 2SNVA 1E88A 2O9QA 1E38B 1G3CA 4ISNA 3R3GB 2O8LA 2H2ZA 1O5FH 3CNRA 1UCYK 3H5CB 3ELAH 3KQ5A 4K2YA 5BRRE 3WWBA 3GCHC 4A92A 1IQJA 1DSUA 1P2NA 4PROA 2K1QA 3CALA 2K8IA 1HJAC 5FBEA 2R0KA 4D9QA 4JCNA 2ZA5A 1KY9A 1OWDA 2O8TA 1QCPA 1IQNA 2WYJA 3ZVDA 1XMNB 3MU4A 4FUIA 2PKAA 3BSQA 1C2GA 1BIOA 4U2WA 4GVUA 3SGAE 3MU5A 2GMTC 1T8LA 1SC8U 2CJIA 3UPEA 3WY8A 2PUQH 5JB8S 4X1RU 1C5MD 5DP3A 2ERJA 1SQRA 2QXHA 3OEHD 3SNAA 2P16A 3FGRA 3EA7A 2IJD1 3ZLDA 2YNAA 1LPKB 3M7QA 4FUFA 4X0WU 3EQ0H 1MU8B 1EPTB 1Y5BT 2A45B 2XBXA 1P05A 3TH3H 1SLVB 3ZZBA 4AFZA 4AX9H 3RXCA 1CHGA 1H9LB 1P57B 4AFSA 4UE7H 1AB9B 1UVOA 1Z1JA 2TPIZ 1N1LA 4GPGA 3GY2A 5C17A 3FZDA 1SG8B 1ARBA 3FP6E 4C16A 1O3JA 1TALA 2ODQA 4CBNA 1JIRA 1AGJA 1CE5A 3SHAH 5AFYH 1O3OA 2F9UA 2EC9H 4Y0ZE 1NRSH 3NRLA 3V0XA 3VGCB 3VFEA 4JZIA 5SGAE 1BMFD 4K5ZA 1W10U 3BF6H 1O3LA 2ASUB 1K21H 5EGMA 2FOHA 4MLFB 2PHBA 1BA8B 1TX7A 3P8FA 4MVNA 4JYUH 2L74A 1MQ5A 3T5OA 1UCYH 1T8OA 1HFDA 3SZEA 3PV4A 4CRDA 3F2FA 3PMAB 2FYQA 1F0RA 2GJGA 2Y81A 4R8TB 2B9LA 2AYWA 4YLUA 1PPZA 1G36A 6ESTA 3VB7A 2V7QD 3MMGA 4MPUA 2XRDA 2ZHEH 2FESH 1OJYA 2V3OH 1BT7A 1ZMLA 2BTCE 4AN7A 1LVOA 1UTLM 4FUEA 1TPPA 4DGJA 3OX7U 1TNLA 2ZFRH 5FX5A 1TWXB 2NU0E 2Y5GA 1HYLA 2HPQH 1ORFA 5A8YA 5DN5A 2JH0D 1ELFA 1GKNA 1XXFA 2ANMH 3UNQA 5DPAA 1SQAA 3N7EA 5DG6A 1E79D 1OWHA 2R9PA 2Y8SA 1TPGA 1D9IA 3P92A 3E3TA 1S81A 2OLGA 2ZTXA 1C1WH 3IWMA 1ZR0A 2GKVE 3SJIA 3A89A 3SNCA 4ZHLU 2XCFA 7ESTE 1E0FD 2AGIX 1MKWK 2AHME 2WPDD 3BG4B 3K6YA 2RLPA 4OS6A 2VIOA 5GNDA 4FU8A 5CHAC 4A1XA 3UR6A 4YXWD 1IAUA 2HOBA 1YC0A 2WPHS 2GCTB 3DSGA 1AFEH 3E1XB 4ASUD 1EJAA 3FP8E 3P8GA 4F48B 1VZQH 2AMDA 1TNKA 3OE7D 1AWHB 5EXNA 3RM2H 3SHCH 1QIXB 1AVGH 3BV9B 1V2KT 1NRNH 1THRH 4R0IA 1KXAA 3O8CA 5EPYA 2FWWA 1CHOF 4U32A 1GHBG 3F0PA 5EW2H 2JJ1D 1GBHA 4NFEA 1YPHE 1FBRA 5HYUB 3L33A 1M9UA 4CRGA 1EOLA 5JPMH 2FEQH 4ZKSU 2GD4B 5GXPA 2Q6DA 2G4UA 2PSYA 4WVPE 4OGXA 1H04P 1GGDB 1MTNB 3A7XA 1EJNA 2G7IA 1GVZA 2Z9LA 3GY6A 4DT7B 1O36A 1UTPA 5EG4A 1OWKA 1QL8A 2GP9B 1J14A 2P94A 5GPIB 2P3TB 1EASA 1HJ9A 1O2ZA 2F9OA 1OWEA 1OYTH 3RXEA 2ZFSA 1K0HA 4GHTA 3UR9A 4B2CA 4AYMA 3KL6A 5A2MH 3DFLA 5LPRA 1EXFA 8GCHG 4XFQA 1DVAH 1EB2A 1GMDG 3SQHE 1O2LA 1TPAE 1MMJN 1GDNA 3UQOA 2AGGX 1MKXK 3CS0A 3PLPA 1GBBA 2YMSB 2WPLS 2VU8E 1YCPM 3ZRZA 1SGDE 4BAOB 3A7VA 3GCNA 1PPFE 1T7CA 5EQQA 1NFUA 5CDFE 2JETB 1GHYH 3EE0B 5HIZA 1MKWH 4B2RA 1Z92B 2VH6A 2I6QA 1HIAB 3RMMH 1ZMJA 1O39A 1SSXA 3SUFA 3KGPA 4CREA 1UHBA 1A5HA 2B5ID 5EODA 4LOYH 5FBIA 3B23B 2XXLA 3UNRA 2BDHA 2ZC9H 1AE5A 9ESTA 3G01A 1YPGH 4QT8C 2Y7ZA 3SBKA 2MCZA 2A55A 1W12U 4ABEA 4CSYA 3FFGA 2ZGCA 4AOQA 2AIQA 3PV5A 3A80A 3MO3A 3TU7H 4ZKNU 3S7HB 1A61H 5FCKA 1KLIH 4AC9A 1QBOA 4B6EA 2RCEA 1C1MA 2XBVA 1MD7A 2ZECA 4NSYA 4MG3A 2J98B 3HKJB 1P2IA 2HVXA 2IPQX 2QY0A 1B7XB 2OD3B 2QF5A 1Z7KA 3GDVA 1HAOH 4CRFA 1LQEA 4LOSA 2I2LA 7GCHG 2AMQA 1QR3E 1O2OA 5T1VA 2GCHF 2OQUA 1O2HA 3OEDC 2PW8H 1W0ZU 4WJG2 2UUYA 1UO6A 4UFFH 1NO9H 1C4U2 2F4LA 5F03A 1OXGA 2ANYA 2KAIB 1BCUH 3ZV8A 4AYVB 3OYPA 4X8VH 3A84A 4K1SA 4DJZA 1AKSA 5L2YH 4IC5A 1F92A 5ABWA 1F5RA 1O3NA 4KGAA 1DITH 5JB9S 1AY6H 3TLOA 2C90B 2ZQ1A 2F9VA 1MQ6A 1AO5A 2ZG0H 1QB9A 1ZSKA 1MKXH 3T26A 3DCLA 4ABIA 1OP0A 1DWBH 1SGRE 2P3FH 1GCTB 1J9CH 2PLXA 3HGPA 2XWBF 2B0FA 1RTKA 2A5KA 4RKJB 2FLRH 1GJDB 4I32A 2STAE 1MTWA 3FP7E 5A8ZA 3KCGH 2SGDE 1MTNC 1AFQB 5HXFA 3PLKA 2XW9A 1ZMNA 1C2EA 1EX3A 1EATA 1ZSLA 1MTSA 1TQ7B 3QTVH 4D8NA 2GT7A 2OBQA 4XDEA 4XBDA 1KSNA 2OC0A 4IN1A 1KDQB 1YP9A 4X6OA 1TGSZ 3BIUH 1C5PA 2HNTC 3O8EB 3BTME 3S9CA 1FY8E 1YBWA 2CG7A 3PLBA 1GBFA 2JGWA 3EGKH 3ZZ3A 1O0DH 2ZHWH 2XCNA 2Z9GA 1CGHA 1BZXE 1OK1A 1BMNH 1EZQA 1UTMA 2W3IA 2BZAA 4BXSA 1IQFA 1VVCA 2BZ6H 3RXQA 2P8OC 3S9BA 1GWAA 5A0BA 1SGEE 4IW4E 5FPYA 3GY7A 1SPJA 1C5NH 1NN6A 2EI7A 4MNXA 3SUGA 3GY8A 1AUJA 1SR5C 2FI5E 1TOCB 3SN8A 3Q3KA 1H9HE 2ZDLA 5DO4H 1O2TA 1TB6H 1DT2A 2XWAA 1P10A 3RP2A 4ZUHA 3OU0A 4ZKOU 2GDEH 1UK3A 1T4UH 2TGAA 2QF0A 2F83A 5DP5A 1SGTA 2DE8A 2ZKSA 4NZLA 4Q4LA 4NWLA 4B2SA 2BLQA 2Z7FE 4FOUC 3K65B 1GI8B 1RRKA 1JWTA 3QK1A 4NFFA 1DUEA 1HGTH 3AASA 3UWIA 3KEEA 3TGIE 3ZZDA 1Y3WA 1XVMA 1FQ3A 4A7IB 1EFRD 1TPNA 2VIDA 4BAQB 1KYNA 3KF2A 3CI0J 1QB6A 5G4BA 1SFQB 1DY8A 1O3EA 3SV2H 3KQDA 3NFPI 1BMAA 2FX4A 3A8AA 1TYNA 1A3EH 3PWBA 4NA9H 1GHAF 2AH4X 1ZYOA 2BD3A 1L2EA 3GY4A 1P3CA 2NWNA 1S6HA 2BY8X 1H03P 3UTUH 4K1EA 3TVJB 1SGFG 3H7OA 3RXIA 1O2MA 3F6UH 3VEQB 1AUTC 2HLDD 1E1QD 1Y5AT 1EP6A 4AYYB 3RXLA 1LY2A 1VCPA 1ANDA 3TGKE 3P6ZB 1DLKB 3TJUA 4U30A 8ESTE 4B74A 1H9IE 2R3UA 1YF4A 4AB9A 4NA7A 2CF9H 2HWLB 1GJ4H 2A7HA 2ZU2A 3LGYA 4F49A 1QA7A 3IU3I 2PGBB 1UTNA 3KQCA 4INKA 1S6LA 2XC4A 1K1PA 1D6RA 2PWXA 3SUEA 2CXVA 1P2OA 1UOTP 3RU4D 1QQ4A 1N8OC 2WIIC 2XBYA 1GBJA 1RLHA 3QN7A 1C1PA 3STIA 2AMPA 1N6XA 2FYRA 5GCHG 3SW0X 1C5QA 2VINA 3SYJA 4K8BA 2F91A 3SJ8A 3FGTA 1F5LA 3TITA 4ZMAH 4GLYA 1CBWB 5FCRA 1GMHF 4XE4A 4OM9A 2HPPH 2JDID 1EZSC 2NU4E 3H7TA 3NWUA 1O3BA 2PTCE 2ZDKA 5FX6A 4BAHB 1PPCE 2OC1A 2UWLA 5EJLA 1ZRKA 1P2JA 1NROH 1JBUH 4Y8ZA 4FUDA 1RXPA 3ESTA 1E5GA 3MI4A 2QYIA 4SGAE 3O8DA 3CP7A 3TH4H 3WSYA 1DY9A 3RXGA 2FX6A 3P8NA 4X2WA 1G3BA 4NIYA 1TMTH 2PKAB 3ERBA 2EI6A 2EC3A 1UCYE 2CF8H 4IMQA 4NIXA 4H6SB 5A8XA 3ZVBA 6CHAC 1ZRBA 2ANWA 1C9PA 1X7AC 5HYOA 2VIVA 3ATLA 3E91A 2PKSC 2JKHA 4KKDA 4JK6A 2BD4A 1L1NA 3PTBA 3F9HA 3S9AA 4B2AA 1DFPA 2BX4A 2LP6A 2GGVB 1DS2E 3FANA 1KTSB 3WW7A 3GCTF 2KMSA 3RU4T 1EQ9A 3RXTA 1QJ1B 1UVPA 5C5OA 3NJAA 1COWD 1ELEE 2A2QH 3U1JB 1YPHC 5EXMA 3DD2H 5EXLA 1ZTLA 2AS9A 2KFWA 3U8OH 3ZZ4A 5I25A 2CMYA 3DUXH 4X1SU 2VIWA 2CK3D 1C1QA 3VXFH 5HM9A 1B0EA 4J38B 1C1VH 1JOUB 3M7TA 1P04A 4CH2B 1TBRH 4FUGA 3OP8A 4AZ2B 3QLPH 1NFYA 4TY6A 1IHTH 1AU8A 1RTFB 5EU8A 1SBWA 2Y5FA 2TRMA 4X6PA 5C1XA 5DN4A 3RXPA 4XSKU 3FO8D 1KXCA 2ZGHA 1LHCH 1PPHE 2A4OA 1OHHD 1GJ5H 1P0SH 2YMSD 4VGCB 1PJPA 2BMGB 2BDAA 1SRZA 1DUAA 1EP5A 5DSFA 1SGFA 2H9HA 3UWJH 2ZYCA 4U01A 1HCGA 1H4WA 3M5MA 2ZEBA 5EJ1A 4NA8A 1LKBA 4IC6A 5HM2A 1A46H 1WAYB 4XBCA 3S0NA 2J94A 2KX4A 2JIZD 1TFXA 4X1NU 1NZQH 1GDUA 2SGQE 1BHXB 4ONTD 1H8HD 4YT7H 1VCWA 1IQLA 1ID5H 3D23A 1K9OE 2OP9A 2GZ9A 1K1JA 1ZGVA 2P59A 5JBBS 1IQGA 2K0QA 4JMYA 1A5GH 2OCVB 2VWLA 4OS2A 1Z8JB 1MBQA 3OFND 4ZHAA 1FJSA 4FETA 3IX0A 2YNBA 3HPTB 4BANB 1O32A 4H6TA 2MCYA 1C2HA 4Y8XA 1WBGB 5EIYA 5HIYA 1ZTKA 2GV7A 1C5WB 3VB6A 1BRBE 2KCPA 4DY7B 2FS9A 1NWVA 1W8BH 1DANH 2G51A 1CT4E 2IJOB 2QF4A 3RXUA 1GMCF 3ZYDA 1Z6JH 1HCCA 4RT0A 1SL3A 3NCLA 1EJMA 3ITIA 3QUMP 5AF9H 3PRBA 1GHWH 1BRCE 2J34A 4RKOB 4I31A 1J16A 2A2XH 4BOHA 3KYGA 4Q7YA 2A4RA 3LC3A 3ODFA 3ODDA 3L89M 2ZZUH 3ATMA 1T8NA 2B8OH 3AW0A 1WQSA 3R0FA 4GSOA 1IQEA 2RL0A 1TIOA 2BD5A 1AZ8A 1O2WA 2QC2A 2XWBI 4UFGH 1O2YA 2TGPZ 3E0PB 5KEDA 1FX0B 3HGNA 1GG6C 3UNSA 1SHHB 1GHQB 3AK5A 3BEIB 3F6KA 3FVFB 1WQVH 3PROA 4Y76A 1FIZA 1EAUA 1SKYE 1FPCH 1D3PB 2Y6TA 1MCVA 1P12E 5GIBA 2B7DH 2V0BA 3M5NA 1NY22 4Q7XA 1O2KA 1PQ8A 2ALVA 4O3TA 2KCOA 1A2CH 1Z8IB 5FO8C 1C2MA 4E05H 5K7RA 2Q1JA 3TK9A 1BTZA 4X6MA 2YRAA 1E1RD 2A5AA 3V7TA 2ODYB 2KRIA 5C67A 1BTYA 4Y11E 3C1KA 4Y7BA 4AGKA 2BD2A 2JH5D 3F2GA 1KLJH 1UVUH 2KZ4A 1N6YA 2QV1A 5FPSA 4XD7D 1UJ1A 2F9NA 4A1TA 3MYWA 1ELDE 5E8EH 3UIRA 3A8CA 1K1LA 1L1JA 1QA0A 3ZZ5A 2H9TH 2XNDD 2P95A 1LVMA 2WZQA 4FUBA 2EQNA 1ELTA 1UVSH 1QUBA 2V3HH 1D3DB 3F9GA 5L2ZH 4JHSA 2G8TA 4TPIZ 1BUIA 1W2KH 1A0HB 2FXRA 1A7SA 1BOQA 2Z6BD 1LHFH 3RC5A 2THFB 4YIZA 1E8BA 3LJJA 1SFIA 1YM0A 1Y5UT 3MFJA 4KTCA 2CKUA 2ZU1A 2VGCB 4Y71A 4ZCNA 1GBIA 3LGTA 4MPVA 1YYY1 5KGOA 1C5RA 2ALPA 3N99A 2HVYB 1O2VA 3BEUA 2V3MA 1O3HA 4OS5A 3M35A 4FUCA 1MAXA 1CSOE 2QF3A 3SQEE 2PTNA 1FV9A 1AMHA 5C1UA 2FS8A 3BTEE 4TWYA 2Y82A 9LPRA 1GI9B 1EPTC 2ZFTA 1H8IH 2ANKH 1FONA 1O34A 2H1UA 2OQ5A 5EPNA 4O03A 2WPMS 3UB0A 3GDSA 3A7TA 1AB9C 1O9AA 1S0RA 2QY0B 1K28D 2UWNA 1BTWA 1G2LA 3RMNH 1SGNE 2BQ7B 2BHGA 5DP6A 2BXTH 1V2JT 1Z71A 2R2WU 4OS7A 1CQQA 1LPGB 1F0SA 1OPHB 3FOAA 1DXWA 4BTIB 4ZROA 3VGCC 4CR9A 2ZPSA 5JPMG 1O5GH 5DP7A 1CGIE 2HRVA 3SU6A 4IS5A 2AEIH 3F9EA 3SU3A 3RXRA 1FXYA 1LPZB 1O3KA 4AFQA 1C5LH 3RXBA 1C2LA 3UQVA 1OJVA 1ANBA 1O38A 4JZ1A 2QA9E 1P9SA 1P2MA 4PO7A 3LH3A 2Z9IA 2AIPA 1TBQH 1DX5M 1GBLA 3F2HA 1HXFH 1NFWA 2BDGA 3OTPA 1C5TA 2W7SA 3GY3A 5C2ZA 4MNWA 1NU9A 1D3TB 3RJ3D 3BG8A 2VVVA 1O2GH 3SJKA 3INBC 5HKKD 2BOHB 1WU1A 4B73A 1RJXB 3ZVCA 5DP8A 1QURH 1G3DA 1S0QA 1FI8A 1S82A 4JYVH 3IG6B 5GDSH 1QRWA 3C27B 2C3SA 2FOMB 3ENSB 1ELBA 2J38A 2XC5A 1FN6A 8LPRA 4ZH1D 3IITA 1AD8H 1DM4B 3JZ2B 1SGQE 1HAPH 2CHAB 2FPZA 1GJ6A 3BTWE 2AFQB 2M5TA 2ZFFH 5C94A 2J92A 2ZPQA 1SLXB 3T28A 1P3EA 2BDCA 3ZZCA 1VITF 5E2OA 4H4FA 4Z1MD 1XVOA 3TNTA 1IHSH 1ELGA 3BTFE 4ABFA 2OINA 4WH8A 4I8GA 1G2MA 1CA8B 4ABJA 4X8TH 1PPQA 4RT1A 2BZMA 1P02A 1TLDA 2UWOA 3I78A 1BJVA 1C2FA 2QGRA 4UD9H 2Y5HA 3VB4A 1H2QP 1G4GA 1XUJA 2F9BH 1ZPCA 5ESTE 4CR5A 2D2DA 1EAIA 1AHTH 1LDTT 1ZPZA 1GI3A 3BG4C 1BITA 3LU9B 3ZVFA 1OK9A 2GVFA 5DP4A 1OOKB 4ZXYH 1P9UA 1C5OH 1BHXF 2GCTC 3QWCH 1QFKH 1Y3UA 1O3DA 2NU1E 4H42U 1TRNA 1GI5A 1IOEA 1TMUH 3RXFA 1GJCB 3K6ZA 3OSYA 1O33A 3LGUA 1S6FA 4WMFA 2BOKA 2RG3A 2JRAA 2F9PA 1V2ST 1KLTA 3K3TA 1AZZA 1FZZA 2W5EA 1CA0B 1W11U 1XKBC 1YPKH 2RKYA 3CS7A 2ZP0H 1O3IA 1P8VC 1YWUA 4NGAH 3F3BA 3U1IB 1Y3VA 2V35A 5EW1H 1RIWB 4BTTB 4WF8A 1TX6A 3OTJE 2FOCA 3SJOA 5ESBA 3JZ1B 2LPRA 1DSTA 2P93A 3QDZB 1MTVA 1GGDC 4NWKA 4K8YA 5B6LA 5E0JA 2SGFE 1C1UH 1ESAA 4BWCA 1V2PT 2ZU5A 4AFUA 1GJ8B 1GVKB 4HI3A 4ZKRU 5DP9A 1GL1A 2QE7D 1BMMH 1HNEE 3Q00A 4Y8YA 4F4OC 5GJ4B 3RXOA 1RS0A 4K12A 2BLWA 2A31A 2A7JA 1TMBH 2ZIQH 1ELCA 4BAMB 1IQIA 2FMJA 4HZHA 1GPZA 4XOJA 4RSPA 1K1MA 4I8KA 6LPRA 1ZLRA 4ACAA 1LHDH 4AYIA 2YMSC 4JK5A 4NSVA 1O2JA 1O3MA 2BLVA 5JBAS 1QL9A 1H8ED 4YT6H 4O9VA 1ZHRA 1O2NA 2FOBA 3W94A 4X1PU 1YPJH 5LGOA 1O35A 1LVBA 1LMWB 2C93B 1HRTH 3DFJA 2JETC 5JDUB 3SNEA 4K1TA 1HAHH 1OS8A 2FTLE 3KNXA 2ZNKH 4J2YB 2Z3EA 2B5TB 2HGTH 2Y7XA 4DIIH 1C1TA 3E90B 1HXEH 2SGEE 3BIVH 1TPSA 2J97A 2VH0A 3TH2H 2J95A 1TRMA 3A87A 2GT8A 1HB0B 2BQ6B 1INCA 1ZHPA 1O5CB 2ZDAH 2CG6A 3AAVA 3F9FA 4UFDH 1BBRE 1OYQA 1AIXH 5CMXH 1GI4A 5FL7D 2D1JA 2J2UA 1C5VA 1UTKA 1FAXA 2GV6A 3T25A 3P17H 4ZAEA 1XUIA 4YLQH 2BX3A 2ZHDA 4MTBA 1LHEH 2BXUH 2KM0A 3LKWA 5JYIA 1P03A 4YTAA 3VB3A 2SNWA 1W7GH 1C2JA 2VNTA 1Q3XA 2FI3E 2FOGA 2KAIA 1Z6EA 3UOUA 4DT4A 1HAZB 2BYAX 1PQ7A 5DJ7A 1OKXA 1THPB 3TPIZ 3P70B 4AGJA 3GOVA 2FTMA 1Z8GA 4RI0A 4WWYA 3W1EA 2GZ7A 3U8RH 1GI2A 3RXAA 2WYGA 1FDPA 2A4GA 5T6FA 1XX9A 2O8UA 4D76A 2ZHQH 4A6LA 1JMOH 4ABGA 1GCTC 3FKSD 6GCHF 1UMAH 2JJ2D 1EOJA 3ZD1A 2ESTE 5F8XA 5EQSA 3UREA 3M36A 1AFQC 2JGXA 1CKLA 2R0LA 2WINI 1GBTA 2G4TA 2Y80A 1CHOG 1TONA 2W81A 1LKAA 1DDJA 2BY7X 3PRDA 4K3JA 1SOZA 3ZLEA 1PPEE 3P95A 1TPMA 3SU5A 1O5AB 1BTXA 3M3TA 5HYTB 5I46H 2ZGJA 4WH6A 5A09A 2O8MA 3F0OA 2TIOA 2FM2A 2RLQA 3GCHB 2JH6D 4XBBA 2IZ4A 3H09A 2IPHA 2HALA 3AVZA 4WXVA 1HJAB 3NZIA 3SU1A 4MNYA 1AI8H 1MTUA 4B2BA 1W0KD 2WPIS 5E0GA 4K60A 3I29A 4X8UH 1QBVH 2ZFQH 4E7RG 3U98H 3EA9A 1V2VT 3NPSA 4WMDA 2PV9B 1C2KA 1K1NA 4NIVA 1F7ZA 4Y0YE 2PR3A 1P2KA 3BTTE 1OJWA 3UUZA 3L3TA 1OSSA 3T27A 3F68H 2GMTB 1F0UA 2W7UA 1PQAA 2I6SA 3T2NA 1O37A 2NU2E 1GHBF 3SI4H 1B0FA 1EUFA 3RXMA 2ZTZA 1DWEH 1HAYB 1BB0B 5FAHA 5L30H 1E36B 1A5IA 3LGWA 1WSSH 4A5TS 4ISHH 1FMGA 1FY3A 1C1NA 1DE7H 1RFNA 5F8TA 2A5IA 4B75A 2EI8A 1HAVA 1TE0A 2XBWA 4JZFH 3ZVEA 1TAWA 4WXIA 2FIRH 1MU6B 3FAOA 3TJVA 3MU1A 5EJZA 3ZIAD 4LZ1H 3RUOA 1NBMD 5I0QB 1Z8RA 5DN6D 3RMLH 2EEKA 4F55A 1VVDA 1V2NT 1FPHH 2H6MA 2WPJS 1ESTA 2D26C 4FU7A 4M9FA 3PM3A 1NTPA 2O39C 3BEFB 3SOSA 4YM9A 1W7XH 1V2WT 3MH6A 2A32A 1GMDF 1MCTA 1BTPA 1G32B 1YCPK 2BDIA 4GAWA 1QY6A 3KQBA 3BTKE 3RLWH 3F1SB 2UUFB 2YBYA 4ESTE 2RFKC 3E6PH 2ZI2H 2ILNA 3STJA 4N7EA 4I86A 1YY3A 1UW7A 2GCHG 1NPMA 5FPTA 1DLEA 3HK6B 3Q77A 2M2AA 3A8BA 5HYPA 4K69A 2RDLA 1MZAA 1YLNA 3MH5A 2W6ID 4OGYA 4TY7A 1GI1A 1GVLA 1ACBE 1WTHD 2RA3A 3MHWU 2HNTE 4A1VA 4D7GA 3RXDA 4E7NA 1RGQA 3GS9A 1TX8A 1JRSA 3O8BA 1EKBB 1K2I1 2ZCHP 1GCDA 2OXSA 2QCYA 3GXEA 2STBE 1J15A 1CVWH 1WTGH 2W80A 1HAXB 1MZDA 1SLWB 2FLBH 3BTQE 3A85A 2OK5A 2ODPA 1JRTA 3MNSA 2VB0A 4I8JA 1V2LT 4FVBA 2ZU3A 1SQOA 4UEHH 1ZJKA 1MUEB 1NM6A 3SNDA 4DVAU 1ETSH 3DSPA 3T62A 3QZRA 4CHAB 1J8AA 2VBCA 1T31A 1CBWC 1EZXC 2KCAA 1TA2A 3ZZAA 7GCHF 1UK2A 2PGQB 2XRBA 1VR1H 4DIHH 2ZQ2A 1K22H 1L1GA 1SGCA 2BLOA 4KELA 3CENA 1SMFE 2ZCLP 1TQ0B 4E06H 3SV6A 1FY5A 5JBTA 5J4SA 4OS1A 1OP8A 1AVXA 1QO6A 3PV2A 2RA0A 1O31A 3SU2A 5CE1A 5CHAB 3SV8A 2BB4A 2Z94A 3WSXA 4O3UA 1YCPH 4MDSA 1EB1H 3D65E 2J5UA 1KMHB 1FLEE 2R3YA 4Y7AA 1C5SA 4X6NA 3A88A 2IOTA 1OWJA 3TJNA 2GTBA 2XQWC 1NU7B 2WHXA 4LK4A 1P06A 1ABIH 5PTPA 3MQKC 2BM2A 1P11E 3SW2B 1ZJDA 1ZTJA 1LQDB 3U9AH 2W26A 3PB1E 2VWMA 2FOFA 2ZU4A 1HV7A 4RN6A 2W3KA 2FOEA 2D8WA 2ZDMA 2BD8A 3TK5A 3LDXH 3MTYA 3M7UA 4ABAA 5C3NA 4ABHA 2TGTA 3MO9A 2BY9X 4BTUB 1BRAA 5CHBA 3TGJE 1W14U 4D9RA 3M3VA 3SU0A 7LPRA 1V2RT 2ZCKP 4Y79A 1V2MT 1QRZA 1V2QT
chains in the Genus database with same CATH topology
2HLCA 1GJ7B 1S84A 1GHAG 1PYTD 1GBEA 3SGBE 5TJXA 3SI3H 3RMOH 3TNSA 3PWCA 5FHTA 1J17T 1TPOA 2G5NA 3LH1A 1F5KU 2BDYA 3SZNA 3QZQA 2WUCA 3SJ9A 4WMEA 1QJ7B 4IN2A 1GI6A 2YOLA 2XYAA 1SI5H 3S7KB 4GCHF 4ISLA 3R62A 4VGCC 3SU4A 5BPEA 1TGBA 1ZPBA 1OK2A 2P3UB 1L4ZA 1SOTA 1GHVH 1GJAB 3MNXA 2OTVA 5GWZA 6GCHG 1TOMH 3MU0A 1GI7B 1NRRH 1HLTH 1GJ9B 2QIQA 1S5SA 1QJ6B 2AGEX 2XTTB 1GHZA 3L6PA 4ABBA 3LIWA 2VVUA 4I8LA 5LH8A 4BAKB 1ABJH 4M7GA 1ETRH 2G52A 4CHAC 1ELAA 1UHBB 3RXVA 4LOTA 4KTUA 2Z9JA 3E8LA 2WV4A 1THSH 1WOFA 3SUDA 1O2RA 1EPTA 4YESB 2QN5T 2H5CA 4OS4A 3SORA 1C5ZB 4INLA 5LPFA 2BY6X 4JZDH 4WY3A 1O5DH 1QTFA 2FOAA 1GBAA 5B6OA 3PMJA 1AQ7A 2J4IA 3EDXB 4ABDA 1C5UA 1BRUP 4HFPB 4Z6AH 1NRPH 1V2OT 3SV9A 2ZGXH 4DOQA 3O8RA 1D6WA 1GMHG 2H5DA 5LPEA 3QX5H 1FUJA 2XNIA 1DWDH 3B8JA 1GBMA 1HFIA 1LCYA 3S69A 3OY5U 1TNHA 1U5MA 3HATH 3KIDU 3NXPA 1T4VH 2C8XB 2ZDNA 1JIMA 1QRXA 4BXWA 4FUHA 1GBCA 1C4V2 3MH7A 3EJHA 3ATIA 1MH0A 1YKTA 1YGCH 3SO3A 1TRYA 2V6NA 3NK8A 1ZOMA 7KMEH 2IZ3A 3OXUD 1AKSB 4DJZB 1XUGA 4Z0KA 1XKAC 1H8DH 1WYKA 1IQKA 1HAGE 4UONA 1AWFH 1TGTA 4DW2U 2UUKB 3E16B 1QBNA 1Y8TA 3FZZA 2A1DB 1HFHA 1HAIH 4LZ4B 2Z9KA 3TJOA 1OWIA 1SGIB 1G9IE 5GCHF 1KXFA 1GKGA 2GDDA 1FN8A 1O3CA 2UUJB 3GCTG 4HTCH 2XRCA 5T3HA 3RM0H 4ASHA 1PPBH 1OX1A 2F3CE 3ATWA 4X2VA 5F6MA 1F0TA 3SNBA 3TK6A 1E37B 3PMHB 2LOJA 3QGNB 3HKIB 1B5GH 5F8ZA 1HUTH 3P8OA 1CGJE 5FXLA 1YPLH 5DK1A 3B9FH 1KXBA 4Q7ZA 3URDA 1D3QB 3LGIA 3DT0H 3K2UA 4ISIH 5A0CA 3DHKH 4GUXA 1C1OA 1T8MA 5HZPB 2P8OB 3SGQE 1C2IA 1JXPA 1WUNH 1CU1A 3U8TH 3ZYEA 4Q80A 3MNCA 1AE8H 1ZGIA 3ATKA 1VJAU 1FIWA 3ZVAA 1S83A 1SQTA 3D49H 1H2PP 1E35B 1ESBA 5JBCS 1WV7H 1ARCA 8KME2 3Q3XA 2BVSH 1MD8A 1CT0E 1GJBB 1GHXH 4X2XA 3GY5A 1ANEA 2ZFPH 2WPKS 1VGCB 2EA3A 3OY6U 1LO6A 2VGCC 2WUBA 1BMLA 1LTOA 1TNGA 1ZZZA 3MNBA 4MNVA 3GDUA 4GHQA 1QQUA 2ZWLH 1KXDA 1W0YH 1YLDA 2FP7B 1SLUB 4Y10E 2OUAA 3SV7A 3PMBB 1UK4A 4IBLH 2ZHFH 4B71A 4FXGH 4AYDA 3ZZ7A 4DURA 1L0ZA 2SGAA 4J1YA 3LJOA 1DOJA 3BTHE 4Y6DA 1A0LA 1O2QA 3RXHA 4FXGG 2SFAA 4TWWA 3MU8A 1YLCA 2G5VA 2O8WA 4ZXXH 4CRAA 5HGGA 1DXPA 2VJ1A 1KIGH 2G81E 5T6GA 1G3EA 1ZSJA 1C5XB 2FDAA 1L4DA 4CH8B 4I7YH 2PFEA 1U6QA 2QAAA 2FI4E 1HPGA 2VVCA 3ZV9A 1HJ8A 1TABE 3A82A 2OBOA 1GBDA 3DA9B 4FU9A 3BN9A 2A0QB 1LHGH 3GOVB 1G4FA 1QNJA 1RTLA 4AG2A 1GMCG 2GX4A 1C4Y2 3RDZA 3LOXA 1DWCH 3ZZ6A 2C8WB 2CGAA 3HK3B 3VPKA 3ZD2A 1XUFA 3I77A 1C5YB 1W13U 2OC7A 3VB5A 3GYLB 4MPXA 1UVTH 1MBMA 2IN2A 4THNH 4IGDA 1BQYA 1W3CA 1BDAA 5A0AE 1EAXA 1A3BH 1QGBA 2LNCA 3RXJA 2FO9A 1HIAA 3MOCA 3MH4A 3V12A 4INHA 4MUCA 3T29A 1SVPA 2R2MB 3A7WA 1ELVA 1FNIA 1SB1H 4NCYA 3A7ZA 5TCCA 4YZUA 1N8OB 2CHAC 1ANCA 2ZF0H 4NG9H 1ZHMA 5AHGH 2OC8A 5K0HA 1BTHH 1EZUC 5J4QA 1Q31A 4FUJA 3PYHA 1BTUA 1DICA 1O3FA 2FODA 2EHFA 2H9EH 1K1OA 5C20A 3UY9A 5L6NH 3BTGE 1KTTB 1H1BA 2XC0A 1TBZH 4B76A 4ZHMU 1QHRB 3GYMA 3PO1B 4JYTA 2Q6FA 3A7YA 2C4FH 1VJ9U 4I33A 4DG4A 4D7FA 1AN1E 1P09A 3ZZ8A 4IMZA 4MQAA 1GDQA 3RLYH 1YPMH 2PSXA 4UDWH 5TCAA 5IDKA 4GCHG 2C8ZB 1C1SA 2XWJI 2SGPE 3RXKA 1VGCC 3QO6A 2ZGBH 2CN0H 5EOKA 4JZEH 4TYDA 4CRBA 1Z1IA 6CHAB 1QGFA 3MO6A 2C8YB 5AVDA 2BVXH 3LC5A 1NS3A 3Q76A 1GI0A 1TGCA 2QXIA 1RD3B 2PKSB 4NZQA 2Q6GA 1S85A 4AG1A 1G37A 1XUKA 3A8DA 4LXBH 4X2YA 4AYEA 1HAVB 3EAJA 3LT3A 1CA0C 4X1QU 4I8HA 1GBKA 3M5OA 1Q2WA 1O2XA 1Y3YA 1NT1A 1V2UT 5HMAA 2PUXB 5T6DA 1RIWC 2VIQA 4CBOA 1E34B 3AAUA 4O97A 1KDQA 4HGCA 2VWNA 3EA8A 1SS2A 3QGJA 3N7OA 1FAKH 1PFXC 3AW1A 4MPWA 1V6DA 1TGNA 1P01A 5ETXA 3VXEH 2DE9A 5E2PA 3GCOA 5C5NA 1OP2A 4KP0A 1O2UA 1O30A 3LONA 1PYTC 4YOJA 2A4QA 2G00A 3KXVA 1IQHA 1NRQH 5AFZH 2CV3A 1O2SA 1HBTH 4DCDA 1O2PA 1O3PB 2NU3E 1BBRK 4B1TA 1V3XA 2QXJA 3ZZ9A 1DPOA 2TBSA 3BTDE 1BJUA 2ULLA 4ISOA 2UWPA 1ETTH 1F2SE 3A83A 1NC6A 3E0NB 5EQRA 1C9TA 3LPRA 4AORA 3RU4E 3GICB 2BY5X 1SGYE 1G30B 4TPYA 1QL7A 3D62A 3W95A 2HNTF 1A4WH 1GL0E 1QB1A 1PQ5A 1A1RA 2BD7A 3A86A 1A0JA 3A81A 5C1YA 2A7CA 1D4PB 2RKZA 4SGBE 1UTJA 4FVDA 5IYTA 4UFEH 5H4IB 4A5WB 2DUCA 2ZTYA 2Z3DA 3NKKA 3M37A 1O2IA 1TNJA 4KTSA 3PO1C 1TNIA 1VITH 1PPGE 3Q3YA 1EAWA 1O3GA 3NUMA 1C2DA 3M61U 3KN2A 2FZZA 2VWOA 3KHVA 1T32A 1UTQA 4YOGA 1VITG 2J9NA 4YNXA 1TA6A 1LVYA 2BDBA 1C1ZA 3LGVA 4CRCA 3MQLA 2ZO3H 1NESE 2WV5A 2G55A 2ZPRA 1O5BB 3KZJA 3RC6A 4NIWA 1AVWA 2VIPA 1VCQA 2BVRH 4BNRA 4AB8A 2GZ8A 4ZH8A 3MWIU 5DGJA 3TVJA 3TIUA 5DKMA 3ZVGA 8GCHF 1SGPE 1NFXA 4YO9A 4PZ5A 1P2QA 2BQWB 3UFAA 2V8EA 1C1RA 1YPEH 2AERH 2TGDA 3RC4A 4X8SH 1CO7E 3QTOH 3PTNA 3V13A 2QXGA 1UTOA 1K1IA 3V3MA 3M7PA 2ZDVH 1BBRH 3URCA 1WCZA 1GG6B 1Y3XA 3UOPA 1XXDA 1XUHA 1FY4A 1MAYA 5E0HA 1O5EH 3M3SA 3K9XB 3KQEA 1SHYA 3RXSA 1KXEA 1OK3A 3EYDA 4Q2KA 3U69H 1CT2E 1Y59T 1FY1A 1O3AA 1XM1A 3T5FH 2Z3CA 3GISB 3M5LA 1HDTH 1IQMA 1V2TT 4YOIA 2BD9A 2SNVA 1E88A 2O9QA 1E38B 1G3CA 4ISNA 3R3GB 2O8LA 2H2ZA 1O5FH 1UCYK 3H5CB 3ELAH 5BRRE 4K2YA 3GCHC 4A92A 1IQJA 1DSUA 1P2NA 4PROA 2K1QA 3CALA 1HJAC 5FBEA 2R0KA 4D9QA 4JCNA 2ZA5A 1KY9A 1OWDA 2O8TA 1QCPA 1IQNA 2WYJA 3ZVDA 1XMNB 3MU4A 4FUIA 2PKAA 3BSQA 1C2GA 1BIOA 4U2WA 4GVUA 3SGAE 3MU5A 2GMTC 1T8LA 1SC8U 2CJIA 3UPEA 3WY8A 2PUQH 5JB8S 4X1RU 1C5MD 5DP3A 2ERJA 2QXHA 3SNAA 2P16A 3EA7A 2YNAA 1LPKB 3M7QA 4FUFA 4X0WU 3EQ0H 1MU8B 1EPTB 1Y5BT 2A45B 2XBXA 1P05A 3TH3H 1SLVB 3ZZBA 4AFZA 4AX9H 3RXCA 1CHGA 1H9LB 1P57B 4AFSA 4UE7H 1AB9B 1UVOA 1Z1JA 2TPIZ 1N1LA 4GPGA 3GY2A 3FZDA 1SG8B 1ARBA 3FP6E 4C16A 1O3JA 1TALA 2ODQA 4CBNA 1JIRA 1AGJA 1CE5A 3SHAH 5AFYH 1O3OA 2F9UA 2EC9H 4Y0ZE 1NRSH 3V0XA 3VGCB 3VFEA 4JZIA 5SGAE 4K5ZA 1W10U 3BF6H 1O3LA 2ASUB 1K21H 5EGMA 2FOHA 4MLFB 2PHBA 1BA8B 1TX7A 3P8FA 4MVNA 4JYUH 1MQ5A 3T5OA 1UCYH 1T8OA 1HFDA 3PV4A 4CRDA 3PMAB 2FYQA 1F0RA 2Y81A 4R8TB 2B9LA 2AYWA 4YLUA 1PPZA 1G36A 6ESTA 3VB7A 3MMGA 4MPUA 2XRDA 2ZHEH 2FESH 1OJYA 2V3OH 1BT7A 1ZMLA 2BTCE 4AN7A 1LVOA 1UTLM 4FUEA 1TPPA 4DGJA 3OX7U 1TNLA 2ZFRH 5FX5A 1TWXB 2NU0E 2Y5GA 1HYLA 2HPQH 1ORFA 5A8YA 2JH0D 1ELFA 1GKNA 1XXFA 2ANMH 3UNQA 5DPAA 1SQAA 5DG6A 1OWHA 2R9PA 1TPGA 1D9IA 3P92A 3E3TA 1S81A 2OLGA 2ZTXA 1C1WH 3IWMA 1ZR0A 2GKVE