4KKQA

Crystal structure of vibrio cholerae rbma (crystal form 1)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
234
structure length
225
Chain Sequence
PVIEANLSLNQNQLASNGGYISSQLGIRNESCETVKFKYWLSIKGPEGIYFPAKAVVGVDTAGRMLNVTRGFWVPEYMADGKYTVSLQVVAENGKVFKANQEFVKGVDLNSLPELNGLTIDIKNQFGINSVESTGGFVPFTVDLNNGREGEANVEFWMTAVGPDGLIIPVNAREKWVIASGDTYSKVRGINFDKSYPAGEYTINAQVVDIVSGERVEQSMTVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Biofilm Formation via the Vibrio cholerae Matrix Protein RbmA.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural protein
molecule keywords RbmA protein
total genus 45
structure length 225
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkqA02
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkqA01
4BEIA 4KKQA 4KKRA 4BE5A 4KKPA 4BE6A
chains in the Genus database with same CATH superfamily
4N8PA 5BS0A 2DDQH 3VFWA 3D4CA 3L81A 5IGXL 2WUBH 3JSSA 5FWRA 2VDOH 3BAYA 4NNXB 3ZZLA 3G5ZB 3L95B 4HPOH 2EYRB 2EH8H 1EJOL 2R4RH 3M17B 2KH2B 3MLVL 2V2XB 3TT1L 4LBEA 5F44A 3OJVC 1SN5A 3F05A 4L8DA 2NR6C 1A6VH 3H7BB 1PX8A 1OF0A 3K7UA 3LQAC 4GMTL 2VJ8A 3CFCH 5EU3B 2YSSB 2ZUUA 1EFXB 3LPWA 1YEJH 2AQRA 2D2OA 4JHZA 4Z3FA 3C60A 5CUSL 2OCJA 4PJGB 2K45A 3FHEA 3JT2A 3AROA 2HG0A 4KKAD 4O5LH 4M62H 4N0RA 2AXFA 1CQYA 1XCTB 2BSRB 1IGTA 4IHOA 4JANA 3O6LH 3ISRA 1OTTD 2HRPH 2Z91A 4G5AA 1R5WB 4YK4C 1EEYA 3CHOA 4KX8A 2ISDA 4WKXA 2FWLB 2FAUA 1O5PA 3SDXE 5ANME 2ADFH 4YHPA 4ZXBD 2SODB 1B2YA 2X10A 3K46A 2DH3A 1MCNA 3MC0A 4LDCA 5SWSB 1D6EA 1N9PA 3K1KC 4NQDA 4U6TA 4AQAB 3C09B 7CGTA 4X6CF 2IGFH 3QNZB 3HZVB 2DQDH 2R4SH 5INCB 1S8DB 2VDKB 3QJSB 3GBDA 3LZQA 1NFDF 3CPLA 5ILTL 2KKQA 4AMKL 1NKOA 4H5SB 4ZQKB 3F6IA 4OZ4A 4AIEA 1CBJA 3WY3A 3IDJB 1BXXA 4LLAA 1CG9B 2ENJA 5I8OH 4MSWA 2A6IB 4HKZB 3RNKB 4QJ4B 3ET9F 3VGBA 1OCWH 4FQIH 3H4HA 5C9JB 1HHKA 2VW7A 5AALA 3RJOA 3BUYB 3OHXA 3K6FA 3WEMA 2F1AA 4JR9L 5C2UB 4QJ5B 1L7IL 1RIHL 4JLRB 4FLSA 4GRMB 4K71C 1A4KB 5KSUA 1BD2D 4FNPA 2V4LA 1AR1C 1MFNA 1F18A 2K4WA 2JKXA 4L8CA 3T0DA 1FV1A 1T6VN 3TONA 1ZSHA 1RZQA 2DJMA 3DRQB 2H2SC 1X5JA 1QFOA 4Y5XA 2IPUG 4DK6A 4EVNA 2AK4A 1GZHA 5CWSB 4X5XA 4PJHF 1QRKA 2GJZB 4ELDA 4OIIH 3BN9D 3SGEI 1JFQH 2IAMC 1TZOA 3NIFE 4NZRH 4ORGA 2H41A 3QIUB 1PDKA 1KT2B 3WENA 2ZYIA 5A2IH 3L1OL 1JZ8A 1TJXA 4LLMB 1F6LL 3MRBA 3WSQL 3TS8A 2DQCH 4JG0L 4X6FA 5EUOB 3N41B 5JDSB 1C08B 2NYKA 3T0VA 1E3XA 4P5MB 1N59A 4AVIA 1E8XA 4XE5B 4MDJB 5C0GB 2XWJA 4JQVC 2VRAA 1L9OA 3FQTA 2UYLA 4NNPH 5AOLA 5AWNL 3RVUD 1DVFD 1KYFA 1COBA 5CGYC 3REVA 2FBJL 1PVHA 4OLWL 5D1QD 3GMNA 2LQRA 4D2NA 1T5XA 3Q3GA 1RPUA 3HMWH 4PJ5B 4FKHA 4QHKJ 4X6EB 5GS0D 4F7KA 5FHAL 4R2GD 2X1OA 1ZS8A 1NGXA 2FIRT 3OR7B 4QOKD 1N0LA 4TNWF 1JPSH 3BVWA 2R0WL 3KPNA 3EHBD 1Q9WB 2L8AA 3ZDYB 4X6FB 3AQXA 5DHXB 3G3LA 4E41E 1IFGA 2L4OA 1E27A 1U4EA 2XX1A 3FT3A 1CIUA 3MUZ1 2VDRB 2PETA 3CVCA 2ICWI 5D7KE 2VM3A 2YQ2A 5L8KB 2VZ1A 1U8HA 1HHIA 1ZRUA 2CLVA 5D1ZI 5DHVA 4HEPG 3UJJL 2FJFB 1DUZB 3AS3A 1RUQH 4R7NA 5DZVA 4ZFOB 1T3FA 2OR8A 2X38A 1NICA 4NDMB 3HLAA 3MV7D 4ICXA 2M1KA 1MCIA 4XCEA 3EYUL 4X4YA 2GAZA 1AZRA 2VLJE 4IRSB 1ET8A 4Q89A 1FZKB 3DK2A 4GXFA 3LS5L 5M94B 1GGYA 4MB5A 2Y69B 1QMUA 3CZFB 1JV5B 1YEWA 1GPOH 3QDJE 5HGBB 1AACA 3VXSE 4JFPA 1U91A 3EO1B 4HCFA 1TZAA 3FT9A 5F7AA 3F62A 3GXIA 3G5VB 4LVNC 4TLTA 1EGJH 3BP6B 1QI3A 4B27A 2HCZX 1N6QL 2B77A 5GJSL 5HGGS 5CJOH 3DX1A 3U36B 4HGKC 4AENB 4U1NB 4S1QH 1U8MB 1FYTD 5MENE 4Z3GA 3H42H 4L3CA 3A4EA 3HE6A 1EDYA 3WXVH 4WFFE 1TJHH 5HDBF 1TFPA 3ULUC 4AL8H 4L37A 4MAUH 1IGMH 3OC5A 5D7SH 3RWDA 4ES8A 3FTXA 5HJGA 3SJVA 4HOZA 3RUGF 4F9PC 5BV7C 3RG1C 3EXJA 3DX7B 3FQ4A 1OGTA 3BAJA 3W9DA 1TF4A 3TBYB 2RALA 4G7YH 1X9RA 5FKAA 3BGFB 4Y4FD 4LARH 1AXIB 5FCUL 3D34A 2K8MA 3IPFA 2WCPA 5E1AB 3DURB 1SLXA 3TEUA 5KBKA 1M1XA 2PP8A 2G9KA 5HHVH 1RXLA 4GUCA 4Q14A 2CWRA 2WN3A 3CVHH 5FGCE 1V7ML 2EXWD 2QR0A 4M7JL 3G6AB 4KK5D 5JA8B 4QRBA 2E75C 3T3PB 1UD3A 4P5KA 1I3RB 3WKNA 2YUWA 5LUMA 1LD9B 3RVVC 2X87A 4FNUA 2JELL 3ZTEA 2DLEA 2GK2A 1X5YA 4L05A 4AL8C 1R17A 1AQ8A 3BZEB 5JXED 4F3FB 1INEL 3FKUS 1RMFH 3M6DA 4FQQA 1OP4A 2V2XA 2D0GA 2O6DA 4XZUA 2ADGA 1QTPA 1D2OA 1AOZA 2QSCH 1FNFA 1BQLH 4PH8A 3BPCB 3QR1A 2IALA 3KPRD 3VRJA 2C1PA 4KTDL 1M3IA 3BZ4A 3EF4A 3MODH 3CFKB 4IIQC 4JFYB 1VZHA 4ZQKA 1SYVA 4U7KA 5I1LB 4O02L 3RU8H 4BQ6A 5CJOL 3ZTJG 2OAAA 4MS8C 5GJTL 3QIWA 5JO5A 2GBAA 3ZTNH 3ASOB 3QNZA 2ICEC 4N0YH 1BFOA 2EIEA 1OO2A 2FX8L 3NSYA 4HWBH 5EPMA 5AW2B 4R26H 2HPOA 4ONFL 1JBJA 1ZT7B 3MXVL 5IF0A 3D9AL 5DRZA 3ZYZA 5EEXA 3PWNA 4RFNC 1G7MB 1EEYB 1XH0A 1IEBB 1MG3C 5J1TC 1KEGH 4Y2DA 4WHCA 3LDBB 3MROB 1DP0A 1JGUH 4K7FA 5SV3A 4NM8L 2A2QT 3VFOA 1N8ZB 4F8TA 5H35B 5FCUH 3RL1A 5EO0A 3BP6A 3UTSD 1QYGL 2HLAB 3VQ1C 5EU6B 1GYVA 1MHPH 1L9NA 4UQBA 3CK0H 4KUZL 1B4LA 3KYNB 4LNRB 5CEZE 2G75B 1VFOA 5I23A 4LHUD 2XI9A 3R7RA 4FLRA 3WGVB 4Z18A 3HJEA 3LD8B 2ADYA 4JO4L 1Y6NR 2UX6A 1KGCD 3D51A 4NUGL 2D7PA 5DWPA 1D5ZA 4AH2B 5I1IH 4R8WL 1NC4A 1F3JA 4OLVH 5D1QE 2X3AA 3LNIA 4M00A 3V4PA 4QHUB 4M9OA 1OPGH 2HFFA 3Q6FB 4H25A 2WYTA 2BDNH 3MR9B 2QV2A 2KDGA 5FUZH 4FX5A 4XP5L 5DHVB 5F93C 5F88A 4HUNB 1KXQA 2P3YA 2NY4C 2WBJA 2PPAA 4A66A 3WNLA 3ESPA 4GO9A 3PYCA 1YVLA 3T6VA 4FNQA 2WZPD 3R0NA 2GUOA 2OMYA 4N90D 1JGDA 4JRFA 4E9LA 4DESA 3ATEA 3BQUC 3P3UA 1HSAA 4G43B 4FJZA 4GW4B 1ESOA 4GKNB 2OCFD 3N3EA 3FQYA 3IJ7A 8PAZA 2DTMH 9PCYA 4CVZB 3GMNB 7PAZA 1T0MA 4RMRA 2F7PA 1SHXA 3NJLA 1RK7A 3Q01A 5F7FA 1A6ZA 2J2ZB 3HZYA 1FZJA 1NGYA 2VAAB 1ZHKB 3ILEA 1KEMH 4CC4A 3TNMA 4G7VL 3V5HA 1RFDL 4MAYC 2BVPB 2Y2YA 4U1LA 5IMMA 1HQ4A 3W11D 3HBQA 1ZLEA 5I6XB 3ABKB 4G2AA 1BD2E 3LNDA 5EBMA 3MRPA 1UACL 1GGBL 1TVBA 2B1AL 2JKSA 1EDQA 4F57H 1MLCA 2BFVH 1NBQA 1OE1A 4OQTL 3BPLC 4CGTA 2JB6A 4K7PX 1D9KC 1QKZL 4LBAA 1OLZA 4WTZG 1P6AB 2N7SA 3K2UL 5E51A 6PAZA 4TXVB 1CO1A 1JS4A 1TZ8A 4Y2LA 4JO1H 5A40E 3PV6B 3BVVA 3JT0A 1P1VA 2VLJD 3E8VA 2WXOA 5KUMA 4EBQL 5I5MA 4OGYL 1INDL 2OQJB 3L3DA 1S7UB 1PSKL 2UWEB 4CADA 3CFDB 4YPJA 3L5IA 1Q0EA 1T0PB 1U8PB 3JTBA 3VWJC 5JPNB 1JZ5A 2PCFB 2XN1A 4KRMB 5JORA 4Z3JA 4JLRA 1UASA 4R96A 2A4CA 4OGQC 3MFGB 4M4RA 4XVJL 3GBML 3LZPA 1JFHA 5I9QB 3WIHA 1N3NB 3ESMA 4WI5A 3N1GC 2ZCLL 4XP4L 4EI5A 3I50H 4GQ9L 2A1WH 1CG9A 2DYSB 4GQZA 4POUB 3WGUB 1CQKA 1QSVA 2VDLL 3BRGC 1NH6A 4Q6IA 5G2NA 4WO0A 2YAQA 2H8PB 4NQED 2Q1EA 5D7JA 4CVUA 1J88A 3BN3B 2J8UB 1YECL 4JDEA 4OM1H 4JVUA 4AOFA 3DPDA 4XODA 3HUJE 4NZFA 2ICEA 1RZJH 1TPXB 5E56A 4L9LC 2X0UA 3US0A 3MFFB 1J1PH 4R7XA 3BKMH 4FQLL 4JRLA 5BJTA 3NPZB 1ZMYA 5CF3A 1QR4A 5BO0D 4Z8FH 3LNGA 2DYPB 4X4XB 4XWOD 3THML 2PWGA 3OZ9H 1I1AB 1DTUA 1QVOA 3SGJA 1KUMA 1BREA 2NUPA 3GUTA 5E8OA 3S36H 3WKQA 5FB8B 4N0CC 4PBVC 4U1HA 5E8EB 5FXCH 5LAXB 1BZ9A 2HZHA 4LSPH 1NFDE 1JDAA 4UT9H 1ZVSB 1A9VA 1NA8A 1MCKA 3N40F 4K5LA 4KZCA 1NCDH 5D4HA 1F41A 1G6VK 2G30A 5EEVA 3MJGX 3EJZC 1BMGA 3N41F 2LLNA 1KB5L 3F7VB 3QJZA 5K1VA 2E7LA 2DOCA 1FVDB 2WZ0A 5H94B 5AAPA 3GSQA 3V4PH 3MUJA 4LXFA 1IM9B 5EO9B 3KYKH 3W0WE 2PYEB 4LVOC 3HC0A 4LESA 3MLZH 3NAAH 4LCIH 2FO4A 1LWRA 2E27H 3GFUA 3A47A 4GKZB 1EXHA 2MKLC 2BSED 2DLHA 2YD9A 1O6VA 4GKSB 3NEOA 4F9LA 1NDMA 2XZCH 4YJZL 1XFPA 2YD0A 4B9IA 1JZ4A 2ESVE 4GSRA 2SEBA 4UQEA 3S5YA 1AGFA 4J8QA 4JZJC 3SDCB 2FSEB 4P4KD 4DGIL 3UADA 2BWIA 1KJ2A 3SQOH 1KJMA 1Y07A 3IVKA 4YDMA 5IBLC 3MRFA 3SE8L 4K7PH 5IJVB 1E5ZA 2N56A 4F7EB 2V3FA 1MY5A 3A6CL 2HLEB 4N2BA 4X83A 3CFJA 2EIZB 2YGQA 4A2FA 5I6OA 3W1ZA 5ISZE 1IC4L 4FTVD 2C26A 1ONQB 3MCKA 4QHLB 3CLEH 4U1SB 2FQFA 4MX7B 4L2YA 3QWNA 3P02A 2CLZB 5EIIB 3SOBH 1V7MH 1A14H 1LE5B 3QUKB 1T0NB 5TQ0H 4NZ8A 5F3HB 4OLXH 5CGYD 1THAA 4XPTH 1QRNB 2GTZA 1XGTA 1BX2B 1RZ7L 2QSVA 3BPCA 3RFRA 2UZXA 1X5KA 3KCWA 3OBAA 4I5BA 4W9JC 2EH7L 2W81C 4YHZH 3RZWA 4F7CB 1K2DA 4X98B 1ORSB 3BZFA 4QNPE 4YGAB 4G8GA 2ZG2A 2PP7A 1A9EA 1ZA6A 4AE0A 3AS2A 4Y4KD 3FCSB 3KCPA 4O02H 3O6FB 1SVZA 3X2QB 3BWAB 4L9LB 1TPXC 1YNKL 4DZ8B 4BWUA 4F7TB 3RDTA 2Q20A 1BW8A 5FO9A 5KVFE 2EYTA 5D7LD 4CBZA 5BUPA 4G7SB 3R8QA 1CYWA 3S35L 2G0LA 3QH3B 4FTVE 3UPRB 3PNRB 1PG7H 5HYSB 1CWVA 5DJCB 1N64H 3BC9A 1HSBB 2F53E 4G11A 3VD0A 3ZL4L 1IZKA 3RFZB 1NOAA 2MFNA 1JWMB 2DQHH 3VQ2C 4EIBA 3ZKMC 4NCC2 3HJ0A 1MNUL 4XXCC 3DVNA 2ZUXA 2H8PA 3MKGA 3TYGH 2VLRA 2L7UA 2ZONA 4AVKA 4UBDC 1ZDSA 2L7EA 1T1WB 2DM2A 2YGPA 3ARFB 3MO1B 3X3GH 4HPYL 5D9SA 1M7DB 2BNUA 1A4BA 1WBYB 2DQGL 2XPZA 2IH1B 3L9BA 3U0TB 4LEEA 5LDSA 1WS8A 2EH7H 3IXTA 2C3HA 2E7DA 3BCFA 3N5AA 1T80A 3PXJA 2PCFA 5JORB 3TA3B 2NNFA 3ESOA 5I8CB 1RJYB 3NJHA 4CMHC 5C0JA 4LCWA 4IIQB 1YDPB 1D9KB 5EBLB 2P46B 1ZVNA 1I9JH 2Q7YB 3V79C 1TT6A 1A1MB 1R1CA 3NYKA 2XQBH 3L48A 4NPJA 5GS0L 4DN3H 4JPIB 4GAYB 5CFHA 2QGCA 2C8NA 4LPYA 2N0MA 5J6GA 3QIUD 1CD1A 1WITA 3HPLA 3SDDD 2Y5EA 1UXWB 3QI9C 1JZIA 5GRXG 1JSYA 4WW2A 4ZMQA 4H1LH 4JDEB 3ZGIA 4ZMZA 4RGND 3IF1A 3ARRA 2AJZB 3MLYL 2IMNA 1OAQL 1PY9A 4XNQB 3Q2NA 1MCRA 2HG5A 4CN1A 1BAFH 4ENED 3FT1A 4ZMLA 2FGZA 4IOSA 5HHOB 4MD4B 1OT4A 5F1IA 4N2KA 5FWQA 1QP1A 2WLJA 3IE9A 2NY4B 4X6CA 1Q0XL 1LEIB 2NPLX 1DBBH 2BERA 4U3SB 5KYXA 1JHKH 4M1CC 3L3GB 4UM9A 4ODUB 3INUH 3K72B 4OCNC 2PO6C 5DMIH 3H42L 1UG9A 4H8UA 3B8YA 5FUOL 4G3YH 5KS9B 3B2VH 5E6IC 1BSIA 4JL2A 4JJ5A 3OKKA 1CD9B 5I76B 5ACLA 4HD9A 4G8EA 2VDKH 4J2QA 4PJEE 4GFTB 4FHBD 1MJUH 4ZBJA 3LD8C 5IFAH 1OSEA 1KOAA 4RNRA 1UB5B 4PRIE 1I85C 2MOGA 1XCQA 4QRQB 5GGQL 3VXUD 1KNOB 2ZP8A 2HH0H 4OVUA 1HEZA 1QW9A 4H25B 2O6PA 1LEKA 1S4IA 4OIIL 5KSAD 4PTUA 1RSFA 5M95B 3L1FA 2DLIA 2VB5A 4Y16A 2P80D 4NRXB 5AW3B 3TO4B 2BZ7A 1IGIL 3WEAA 4QWWD 4XPFL 3I85A 4NUMA 3VCLB 5CP7B 3IJ8A 2FT6A 3KVDD 5ABZA 5KSAC 2EIKB 3KPSB 3TNMB 2JWYA 2N0KA 3GLEA 2ZNXA 4AKPA 3E1ZA 4M7LH 3JZ7A 5DHYA 2EEDA 3F7PC 2G75A 4K7PY 4PGDB 2WVUA 4ZDHA 1LK3H 4J3WA 2X4UA 4G1MB 3GMPB 4BCXA 4D3CH 5CJXA 1AH1A 2YRPA 1ZLSH 4A7VA 4YN3A 2G2NA 2XWEA 4E9WA 4DFIA 2NXZC 1CURA 4XNYL 3HMXL 1Y18B 4J6RH 4KY1H 4PJFF 1WLHA 4ZJ9A 2UZPA 3BKJH 4H5SA 2CNYA 5BVJA 1WF5A 1IKFL 1MFCH 1VFBB 2PWEA 4LF3B 3LKSB 2IPKB 4PJGE 1ZA3A 1OQXA 4POZD 1HE7A 2F08A 4MWFA 4WFFD 2D7TL 4V1DB 5DRXB 4OIBA 5L2KE 5C0CA 1BLNA 2D4DA 4QRRB 5BV7L 5KYUA 3AADB 5D70L 1XT5A 3ULUH 5I1LA 1R5WA 2W94A 3WN5A 3V4UL 4WO4D 3LKRA 4OV6F 5EG6C 1ZV2A 5E9DE 5CBEA 2EDYA 4DP7X 4J3UA 5IHZA 5I0XA 5I8EA 4K8RD 4XC3L 4U1JA 1SGKA 2XN0A 3EYUH 3K8KA 4BWTA 2P5EE 3EOAB 2JJUA 1MWAH 2HJFA 2WLKA 1Q8MA 2AV7A 4Z9KB 1BCIA 4P23A 4XMPH 4ALAC 4F9LC 3O6FC 5G4MA 3X1FA 2WAQA 3FZUC 3TNNA 5EU6A 2X9XA 4IKNA 1S9VA 2JB5H 4M7JH 4N5ED 4I85A 1UURA 5T3ZD 1BYPA 3MRCB 1TQWA 4MGXA 3VA6A 4CSTA 4Q9RH 1C5BL 4MQTB 4TYUA 3AG4B 1FG9C 3MV7E 1TZIB 4X80L 3TXAA 4JPWL 3T9WA 4FQXD 5GS3A 2NUTA 4NQSB 5JQHC 5J4MA 1OGTB 5DQJB 4P57B 2Q3XA 3SY0B 4BK5A 1F3RB 3FRUB 2A0LC 2DAVA 3UYPB 3X17A 4H1LA 4RMBA 3WD5L 1HCVA 1UVQB 4Y89A 3JUYA 3DX4A 2VIRB 3U0PB 3HVDA 4OIAA 4UYQA 3L9RA 4Z76B 4OJEH 4FG2A 1N2RB 4GP4B 4K8RH 5E5RB 1IGFH 4AM0A 3ISYA 2P5EB 1K8DA 3UTSB 3RGVC 2EKSA 3SYAA 4HIHB 5F1SA 3BMVA 3QW9A 3FFCE 3V0VB 3LZNA 1SOQA 4L4VA 4FJ6A 3RA7H 1I8MA 2J4WH 3M46A 3KGTA 4C4KO 2ZZUT 3V5DB 1DQVA 3KR3L 5A3ID 3N04A 4FXGC 4X9GA 8FABB 4YXLL 5F0JB 1RD6A 1A7NH 3VXMD 4NKIL 3SPCA 3OM3B 1BVLA 4TTDD 1J8RA 4W6XB 2WQUA 1FZKA 4GUQA 2AITA 2CXKA 3C5XA 4PG9A 1NFIA 3G7TA 3BWSA 1FIGH 4M3JA 2EUVA 2E9WA 3D3VA 5MENB 4YX2H 2APSA 2JTDA 4AJ0A 1YAZA 1ZK9A 2VN6A 1QNZH 1J5HA 4PEEA 3DOSA 4O2CB 2AC0A 1TQUA 2CIKA 3S36X 4IOIA 1BYOA 4WWKD 4XN1A 4DETA 3DSNA 1OGPA 5GS0H 1E27B 3C08H 5FW6A 1QSEE 5K9OA 4EO5A 3HI6H 4JDZB 1KMGA 1HJCA 3BRFA 4P2QE 4HA1A 4XBMA 5JHDE 1ROCA 2ADJA 2W07A 5I26A 3D39A 3V8OA 2NTFA 1C16B 3VXSB 5I1EH 3ME0A 4I3SH 1SDDA 3G5YB 3QI9A 3OHXC 5IHLB 1F6AB 3NK3A 1H9DA 1SLVA 4Z0XB 3VGGA 4PJ9A 4LQFH 1ZOXA 3FSZA 4KH2A 4KWUA 2XNAB 3KPOB 2C1OB 5BVPH 1MCPL 2CO7A 4L5FL 1KLGB 2X89A 1JV5A 2OTWA 3U7WL 4NLAA 4G9FA 1YECH 1Z2KA 1G7HB 4R0LC 2FWOA 5K9OB 1EBPA 4LRIC 4PJCB 2V5SA 3HE7D 1CFQA 2W38A 2LOEA 4LAQH 2GI7A 1WBXA 3ZYIA 3BLPX 1P4BL 4R3SB 3V5KA 5T3ZH 3BCDA 2J1YA 3QIUA 2R83A 1E3FA 1ZHLA 4FQHB 4PJBB 4XMLH 4Z6AT 1U8HB 4U6XB 5EN2A 4QF1B 5GRYA 1R3JA 2OMVB 1CFSB 3DV4A 1C8PA 1NCJA 5CWSA 4BHUA 3P0VH 1YEEL 3CFBB 4RGOH 1RJZA 5D2NA 3VU1A 5LGJA 2BSCA 3ZMEA 2ZCHH 3BSZH 4A2LA 3ULVE 1B6UA 4XN5A 1G6RB 1WYJA 3T1FB 2XKSA 1KYOK 2VAJA 3ILDA 3JWOC 4DOHE 3EFFB 3K2IA 3Q13A 3V5DA 3OF6A 3QE5A 3TH3T 2OTUA 1RLWA 4N20A 2AV1B 4JE0A 1C12B 1OWWA 3X14B 4Q4IA 2WBJC 3VFVB 5J1AA 2V7NA 2XQ0A 3ZDZF 3CMGA 3B8SA 1DQKA 4PRHD 4WK0B 4UBDD 2V9TA 2B59B 2YAOA 3UBGA 2GFBA 4BCZA 1NAMA 5FO8B 2F7QA 1CZ8L 3QC6X 4NENB 2GB2A 3K8LA 3LXUX 1DE4A 1IBGH 4G6KH 1AGCA 1LK3L 1YEKL 1RFDH 1SJXA 1WGVA 1HYSD 5DJ8B 3GXPA 3LKOA 3SY0A 4ECNA 1ZHBB 5D7IF 2GK0A 3NJKA 1B4JL 1SVCP 3JYBA 5DD1H 1T22A 2BXZA 3STLB 3QPQC 4CSPA 2Z7UA 2H0EA 3T8VA 3P73B 4ZFZB 3STZB 2BVQA 2I25N 5EO1A 2DLFL 3A67L 2TSAA 2YPVA 3IXAB 1T7XA 2MTAA 3Q1EA 4GAYA 2G4GA 4WNQB 3DV6A 2EVJA 4D8OA 5JUEH 1QEXA 4XMVA 3MV9B 3HFFA 3N42B 4YSQA 4YHNB 3LPGA 1Y0LB 4QGTA 1EAPA 5JW4N 3F7QA 1R33A 3QHFH 2LW3A 5GGQH 4U6HB 4WENB 3TNNB 5JR1H 5EEZA 2X09A 3C60B 4JFED 5HYJD 2P7TB 1SN2A 1MCOH 3D9AH 2HRLA 3U1SL 1MCWM 1JD9A 3T0BA 2IBBA 5LGYA 3B1TA 1AGBB 3TX4A 5HHPB 1CXEA 1E67A 1R3LA 1RVFL 5C07B 3ZQWA 3QUZB 1HHHA 1JGVH 1JGUL 1FVCA 4NBYB 4AWJC 3AWEA 2EIDA 4HGWB 1EVTC 3IXAA 1FC2D 2PYFA 5CJ5A 4TSBH 2D31A 2W9DH 4APQD 3KMDA 2EYRA 1HNFA 3C5ZB 4A37A 1AAJA 2ZOWA 4WI2A 3ZUCA 3H2WA 4MMZA 1OY3B 1OVZA 3TBVA 3SHSA 3VACA 3WFDH 2IPKA 4DEUA 4K9EC 5KS9E 3SPGA 3F6JA 3HFML 2QQNH 4DO5A 1RZFH 1X9LA 2CBQA 5HYQB 4X8GA 4PRAB 3ULSB 3LS4H 5D96C 4WU7A 4NQDE 1KCUH 2BCKB 4G6MH 3FU3A 5GZOA 1U8IB 3DKHA 5MHSE 2WZPA 4R97C 1NLBH 4L3EE 2WNXA 4YHYC 1DVTA 1JV2B 2I9LA 4L9LA 1BHGA 4HUWB 1E4XH 3SGDI 4MXWH 4X6BA 1EFQA 4JFFB 3BP4A 3U46A 4ZW5A 3BXNB 1R5VA 3SPVB 3UAJD 2FECI 2HWZL 3VWKC 3QUMB 2YOAA 1GY2A 1CDGA 3WMPA 2FIKB 3GSWA 9CGTA 3VD1A 1TDQA 4I2XE 3KLHD 4GRWF 3EJRA 4JY5H 4XX1G 3HR5B 3PABB 3E6FB 3EOBA 5I73B 2ATAA 4G8GE 1U3HA 1EMTH 1UOWA 3DUUB 3F01A 4LSSL 4Y5XC 3T08A 2WUBL 4LKCB 4OI7A 5AZEL 1MQKL 5GHWH 4JPKH 3WIHH 3V5KB 2FX7L 2BY2A 3EO9L 2CBOA 1OTSC 5ECGA 2ZPKL 1BZEA 1NEUA 3O2DH 2XV6B 2A38A 5IIEA 2NY0C 4PCKA 5CEXA 3M1BA 5KVGH 4JZNB 1J5CA 4UM8B 3MJ8B 1BWMA 4NOBA 2WLIA 1DUYB 4G9FB 1JE6A 2VERN 2B9BA 1O9WA 5I16A 1GW0A 3L5WB 5DGRA 5TK2A 3UBXB 1DBML 3PWUA 4EBQH 1PPIA 4Y19E 5D5ME 5I8KL 1PAMA 4Y1SA 4G6JL 3E3QE 4MCYB 5F7EL 3OSVA 3GHPA 2QZ5A 4I0PC 3RGVB 3IF1B 4U6VH 3BVNB 2VERA 3RX8A 3EUDA 1ANUA 3SE3A 1XB6A 2W59A 1QSFD 2GVYA 4BDVA 1DVQA 4PGCB 4IOIB 4X0KB 5EZPA 3MZTA 5ADPL 1HXYA 4GI9A 3FCGA 5EO9A 3T3PF 5DU7A 2MKWA 4NQEA 4ATTA 4BH8B 1JPGB 2Y6TE 4OZHA 5T1DH 4HXBL 4UV7H 3S88L 3RP1A 4WEBL 3CG8A 2ICES 2YRZA 2WXGA 3Q1SH 3Q44A 5DC9B 3FQ2A 3WI9A 2BFVL 4HS6A 2I07B 2RQEA 3NCCB 4MHHI 4RMSA 4HQQL 5EBLA 5EA0L 1YNTA 1Z32X 3PWLA 3QS2A 3W56A 5I8CA 1KELL 5C6TH 2P9RA 2IV9A 3OKLA 5E7FA 5FM4A 3B3IA 4U1MA 5FA3A 1PYWB 2DYPA 1FJ1A 2CGRH 4NKMA 1DDHB 1BFSA 2HN7A 3QDGB 4Z0BL 3TT3H 1HCYA 5DK3A 4DN3L 3W38A 3VB9A 3MRJA 4MFHA 5DJXB 1KPVB 3RTQA 2Q87A 1IM3A 3CDGB 3UGUA 3KH3A 3G08A 5PCYA 5FKPB 2WNGA 4UQ3A 2XVLA 3ZL4H 3UO1L 4N2AA 3GSRB 2PR9A 3ZHDA 1TCRB 4M48H 4GG6A 4X0NA 4CAGA 4BA8A 2EIBA 4UDUA 1NZRA 2PW1A 4FNRA 1Q9LA 1E50A 2ESVA 2L7JA 3PFUA 4I9WE 3ABLB 5IROC 1XXFC 1GKOA 4UDTB 4D9RD 5GIRB 2PTUA 4NXKA 4FL4B 1XQ4A 5CJQL 1WAAA 4LSQL 5AG9A 2EINB 3RGBA 3NJNA 3UMTA 3AG2B 5KVDH 1BDYA 4K3EH 1G43A 1M05B 1CDCA 5MI0B 4IKIA 4D9QE 2G5RA 4TS6A 1ZPUA 1NCBL 3OAUL 4ZOAA 4GB9A 3VO0A 4IK6A 2P5WE 1VLXA 4D7PA 3QIWC 4ZTOH 4FNLL 3L3KB 2G3ZA 3BSZA 4PRDB 1FFNA 3FU9A 3FB6A 1RU9H 3LEXB 2H4EA 4WI0A 5DXWA 5HGDB 5T1JA 2QLVB 3HG4A 3ZDYF 2EICA 4JDTH 4P46C 5IHZB 4LL9A 4DOHB 5HYEA 2BC4B 2IXQA 3LRMA 4NBXB 3QFJB 1CGVA 1O7SA 5DVKA 5EORH 4FN0A 1A6TB 5T1MA 2JB6B 5DZNA 3D50A 5C0CB 1HINH 1BIIA 3DYOA 2JSFA 3SDYH 4DZBB 4QHLA 2R0ZH 3LSOB 4LF3A 5B3SB 3HKFA 1S9YB 4OF8A 3BP4B 3IGKA 1X5LA 3VI4B 2MCPH 1IKNA 1XAUA 1YY9D 3MCG1 3QZWA 5GZNA 2ENSA 4UWQB 1IV8A 1RZ7H 4IRJD 4L4TA 3VD2A 2E7LC 3GHEL 1MVUB 2BOCB 3B1UA 3QWRA 4UOJA 5IWLC 4M1DH 4YL4A 4LSQH 2Y3NA 2XZQL 4O2FB 1W72B 4YDKL 3X13B 4ADJA 5ITFA 2OKMA 3ATDA 1T6WA 4CL7A 3LMJL 3KNBA 1U3JA 3EJJX 1NBZB 3P0GB 3LRSA 4Q8BA 4GMTH 4TLSA 3S34H 4CBPA 3BI9X 2V17H 3V6ZA 2Y6SC 2O5NA 5IHHA 3AREC 3LN4B 5F7UA 3DROB 2V9RA 4MJ4A 1HH6A 4MDRA 1SEBB 2ZXBA 4X9FA 1HX0A 3VXRD 2PYEA 2ZYHA 4V33A 1FFQA 3S0PA 5T33H 1RHHB 2D31B 1UM4L 3E8UL 4P4RB 1KNOA 1EVUA 1KTLB 2PTTA 3NSJA 5AAMC 1MRFH 4DFHA 3D18B 2WQVA 3WMQA 5F3BA 4FMFA 2MH4A 2DDQL 3HG0A 4DP8X 1E6OL 2F1BA 2ITCB 1FNEA 3H3PL 4QD2E 4XAKE 1KBPA 3LNFA 5FOBB 2Y4SA 1QWUA 4G1EB 5KBNC 4BFKA 3PP3H 1I1AD 4NIYE 3FRPG 4OZGB 1S46A 3OKKB 2BS9A 2HFTA 4XVOA 5EU7E 4UNTA 2I7OA 3L3IA 3MDJA 3BO8B 4LSUL 4X5QA 4XMXA 5DJDA 3VTMA 2NUPB 2OPCA 5CNHA 1TTFA 1FNSL 1Y0LA 4ODUA 5GGTH 2BX5A 2GITB 1XEDA 4KQ3L 2OMZA 2QQLH 4GXUM 5H37A 4N2NA 1TTRA 5IMOB 1MVFA 2BVUA 3HCVB 4NO2B 4D7BA 1R0AL 4GAGH 1MDAA 1ZSDA 1T5WB 4AUYA 3O4OC 5J5EA 4NQCE 3VWJD 2Z7ZA 2A4ZA 3O4LD 1L7IH 1RIHH 3KS0J 3OD3A 4DP5X 2V2WA 2VXTL 3NCJH 4OCSL 5F70A 3TL5A 4A67A 4DJMA 2YXMA 3OLEA 3KZ8A 5JOEA 3VRLE 4QJ3B 5DJ0A 1ORQA 2B0SL 3I3EA 2R9HD 3OG4B 4AGLA 3EYFB 5HHNB 1AZVA 1R47A 5C92A 3AB0C 4S1QL 4ZFFA 1KJ2L 4HH9B 4IU2B 4EAEA 3G04A 3R06B 1ITCA 5GGSY 2HTKD 1T21B 3ILPB 4HKJB 2GUYA 1PLBA 2WLYA 4P9MH 3S3DB 1CD1B 2D7NA 3HPLB 2HX8A 4PJIB 1LLAA 5J6GB 1NCWH 4X99B 2MCAA 1R19A 3F7YB 3MXVH 2HKAA 4QXGL 4AGMA 4H0LC 3SPIA 2X40A 3ZRFC 2H45A 3QZBA 4Z7WA 4WUUD 4NO2A 1CDUA 4XAWL 1C12A 4Y8DC 1E4WH 3MLTA 1S9XA 2Z35A 4TSCH 2R69H 3TFKD 5FHBL 4K5OA 1OP5H 2FVNA 4FYQA 3GGWB 4XOEA 3ZE2E 4M8RA 3T2LA 5DJ2B 1DLHA 3OKDB 4TPRL 4HUUB 3L6FA 3QA3B 4KDVA 1REIA 1H5BC 2FJSA 2QEJA 3TA3A 4GBXC 5B21A 1WRFA 1XGYH 2EEXA 1XIWB 3OMZA 3MRMA 2CRIA 1RUKH 4QF1A 3D25A 3H0TA 2WW8A 1GGUA 2BMKB 1MCQA 2K6WA 5KN5A 4XPHH 4F15C 4PUBL 5TDNB 1URZA 4JFFE 3GHBL 4PRBA 4BXVA 3QIWD 1S5HA 2HJLB 3BT2H 4WTWA 3AXLB 3GXFA 4L4JA 1LO0L 2X3CA 3GSNL 3WDJA 3BSGA 4B96A 4JN2B 3EH2A 4ONFH 3DXAD 5C2BL 4MAZA 5GS0C 3HNSH 4UQCA 2FL5A 3BUQA 4N0UA 1NGYB 2C3WA 1DQML 4MQXD 4N0UE 1ADQA 5AW7B 5T1LB 4G6FD 1DLFL 4PJ9C 1OARL 3ZHKA 4PJFA 3QI9B 1IGFL 5ADPH 3VSQA 3PUUA 1DVFA 1QNIA 1I9IH 2EYTB 2HKFH 3AAZA 3IDIB 4FQXA 15C8H 1FQ9C 2OMTB 3LQAH 1A2YB 4J1UA 5JIDA 3GLAA 4G8IA 5ALBL 2XG4A 3PXHA 3GBLA 4FFVD 4JDZA 3IDMA 4JZNA 1AG6A 3AFLA 1RUPH 4NGHH 4NZTL 4S1DC 2XFGB 4Q0XL 5HI4C 1E5BA 4ZAKC 3C8DA 2E0PA 3R8BB 3BEVA 5E1HB 3QG7L 2IOIA 4NZUL 1OB1A 1UJTA 5I75B 2K3TA 3GSXB 3ASNB 2V2TB 5F9WB 4APQA 4EMZA 3FUHA 4G80A 4I18B 4NT6A 3BKJL 4XBGA 1LEGB 3AM8C 3NCYS 1IC7L 4JKLA 1WIPA 2CUIA 3BESR 2A6DB 5SWZD 3FO1A 4PUBH 4YE4H 1MHCB 2H32A 4DEPC 2FEDD 3CZNA 3NJVA 4TVSa 2IWFA 3TF4A 5DLMH 4R7DA 5FA4A 4F24A 1RUQL 3O3AB 4UNUA 2K78A 4DQOL 1L5GA 3X1BA 4F7EA 1KXVC 1OQOA 3WNNA 3IBEA 5EU6E 2WVSA 3P77B 1DVUA 5BRPA 2OCCB 1SM3L 2H2PD 5A1AA 3IDUA 5LQBH 2DQJH 3FUNA 5HJ3A 1A4JA 5CKAA 3DJZA 3BRDA 2FGWH 3U4EA 2R0KL 4M7LL 3Q8EA 4KRPC 1ZT7A 3QUYD 5IF0B 4F33B 2VM9A 2OA9A 3MRQB 3F3HA 4GG6B 2PXYB 4WWKA 2Y23A 3NIDE 1JD7A 2AJUH 3HB3B 3KWWB 3MRKB 1RUPL 4NGHL 4NZTH 3T3MF 3VSVA 4IBVA 4CGUB 1U8KB 4I7ZC 1WT5A 4N2CA 5E23A 1QBAA 2JLPA 4GYBA 4MASA 4WJG3 4NZUH 5K59E 2EDXA 4HF5L 4OLZH 1BAWA 3QR0A 4KKAC 1ZIAA 1UGKA 2VH5H 4Q9BA 2ZSVA 1N5YL 4FQQB 1BZ7A 1DDHA 5TGBB 4NFCA 1D5XB 4YXHL 2P52A 3ULUD 1S9VB 2EE2A 1A6AB 3BUPA 1EO7A 2BIMA 1RURL 2J1ZA 3N6YA 4U6YA 1MIEL 1S5HB 2HJLA 2VGLM 5T3XL 3SQBB 4AQOA 5KSUB 2NY0D 3LX9A 3CXHJ 3PDOB 4R5XA 3U9WA 3RWFA 4F37K 2FECL 4OFVA 5AW1B 2NR6D 2I85A 3EOAA 2HYMA 3IAPA 1DEEB 2VLJB 4M5TA 3SSGA 2E8YA 1V3MA 2R2CA 3QIBC 4UOW0 4A55A 4P2RE 2OSYA 4MXQC 1XD0A 3KPLB 2W60A 1C5DA 3IGFA 1GGCH 4L1TA 4FG4A 2DBLH 4KK8D 4P99A 1KYDA 5FYJU 3ZK0A 1OEZW 2VNCA 3WLBA 3TN0A 2VLKD 4K9JA 3RURA 5INDA 2AQTA 2MQ3A 1ACYH 1ET7A 2YPLD 3CSYA 2CR0A 4YHPB 5J9PA 3TO4D 4XC1L 2DWDB 1DE4B 5BVJB 2O5YL 4PJ5E 4QTIL 4R4FH 1I3UA 4WUUA 5GGRA 1UA6H 2DQEL 2NZ9D 2Z91B 3K6DA 5CEYA 4GRLA 2DQFA 1VCBC 3F7YA 4N5UA 3WFDL 3NIFF 2IAMB 5C0IB 5HYFA 1LO3L 1EGJL 2XZCL 4JMXA 5CJXC 3FHQA 4XP5H 1AI1L 4LVOB 5LGHH 2CHNA 2AV1A 3M45A 5IFHH 4UQ9A 3O3DB 5HY9A 2YK1L 1BD2A 1OCCB 2YD3A 3K6SB 3ARDA 2UWEA 4IOFD 3PV7A 2AZAA 4I4WA 1XAKA 2DQUH 3EJPA 2WQWA 1QHOA 2DY2A 4N2EA 4AIOA 4FKEA 1RJZB 4KTYA 3X1NA 3EDFA 4ISVB 2IG2H 3P3TA 3RHWK 3TV8A 5IEHB 4PTUB 4YHMH 5H2BA 4MCMA 1T3FB 4NNXA 1CVRA 4RBPK 1A7PH 1KLUA 4QRRD 4JHAH 5D4QA 2FR4A 3KLLA 3ESUF 4ONGL 4FQ2L 4WFGD 1ZLWH 3TEZA 5DEFA 3ULVL 1TQBB 1QBLH 1V7NH 4E9QA 5FK9B 3OKMA 1CFQB 4G8EB 2Y5TA 1LP9B 1K5NA 5GS1C 5TDPA 3GSWB 2FWOB 1CFTB 3UBXI 2AVFA 4QRTB 5C0AD 5DJZA 1P4IL 3ZDYE 1O0VA 5L9DL 4W9DC 4WQOA 3UZQA 5D2LE 3WL9B 2R7EA 5DUML 3FN3A 4X6BB 4XN9A 4N9GA 3PL6A 2QSQA 4N9OB 2EEFA 3GRGA 4JO1L 4P2YA 4GW1B 4X6CB 3P4OB 2GJPA 3ZTDC 4KRPB 5JNYA 2UYLB 3NN8B 3RUGA 3G5YA 2XKNB 4PGZA 1NBYB 3GMQA 5ICZB 3HI6L 3N44B 5JHDB 1TKWB 3U2SA 3FSWA 4GP8B 1HSAB 4G43A 4GW4A 1O9ZA 3SE8H 3MYJA 4L2LA 3I75B 2F61A 3PLYA 4QEGA 4Z1PA 1T0OA 3Q9PA 3MNWA 2FJGB 2R69A 3H53A 1S5IL 5HHMD 3F6LA 4YXKL 1DLFH 3MRIA 4J3OF 2MOVA 4FNSA 4IS6A 4Z23A 4KK9D 3ARWA 1IFRA 2BIHA 4MJ6A 5FR3A 3K1DA 3EGDB 3P2DA 4M5ZL 4HWEL 3C5ZA 3CLFL 3NZSA 1XF2A 3D0LB 4JM2B 3WJLC 5H37H 3SDXA 3GRWA 4JO2L 2VN4A 3N40P 5DD6B 2WBJD 3VI4A 2ZOLA 3QVAA 1MHEB 4FG6C 4TQPA 3E1F1 4W6YB 1F8TH 4PG9B 5ILTH 5IV2A 2NX5B 2KERA 3ES6A 4KXBA 3NA9H 4PLKD 4PI2A 5HDBE 4XNMB 3IMWA 1JPFB 1BQHG 4BELD 1PJ9A 5J3HC 2YXWA 3O4OB 4AYFB 2QADD 3NJIA 3MLRL 3ZT7A 5CCGE 2QPDB 1QLFA 4NN6C 4EQ2A 2ZSWB 5D6CA 2IH3A 3FAWA 3IXTB 2CR3A 4K73A 3KYNA 1EK3A 4L1LA 4LNRA 5CD5D 1OTTC 4K0OA 4QCIA 2Z8RA 2EKSB 2OXHA 1X9QA 3RNKA 2JNZA 3VFOB 3DJSA 1G9NC 4WNQA 2XT1B 4NBZB 1AXSB 3S35H 3VXQA 4B97A 3B37A 1YMMD 2C3GA 4S11A 1MFEL 4WI0B 3S8FB 2DIEA 1DHKA 2F18A 3Q6GL 4OLUL 1B4RA 1ZY9A 2OR9L 4P46D 2J6EH 4HJGA 3VD4A 1VADB 4HUCA 3ZUNC 2QJDA 1XH2A 3WNOA 1BFOB 1MFDL 3OG6B 4WFHD 4WRLA 4BSVB 1FHGA 1JNLL 4KJQD 4OB5L 5EHFA 3QXWA 3QRBA 3VGDA 3OXRA 5HPOA 1H3TA 2ZCZA 3BLKA 2QKIA 2DJUA 2WAHA 2ATPA 3MLYH 4N2GA 4JFYA 4QLRA 5C09D 3TYGL 5KUKA 3WJJA 1Q0YL 4J2XA 2ODIA 2XDHA 4GAJL 2VXSL 3FBKA 5EIIG 3NIGF 3TM6A 3P30H 5D1XB 4XMTA 3KE0A 2IDQA 5CZXD 1GZQB 2NY5H 4S1SL 1MXDA 1OCRB 1FFRA 2X4NB 3AWFA 4QHNB 5FDWA 5I71C 3LEYL 1B4JH 1VFUA 4UQ3B 2MTPA 3EXLA 2AJYH 2CO1A 5IBTH 3RTQB 2Q76B 4RH4A 3INUL 5DMIL 4OJAA 4LBEB 1L3WA 3QHTC 4GBXB 4O00A 3LIZL 2WMPA 2VC2H 1WD8A 5E00B 1JPSL 3UJIL 5FW7A 3G5XB 2UZIH 4FMVA 3KHQA 1IEAA 3CFEA 1KV7A 2UWEE 1KCRH 2GTZB 3LN9A 2XTSA 1UTDA 1UFGA 3B3IB 3ARXA 3GIZH 4U1MB 5I1JH 3LAFA 1HKLH 4YO0A 2CG9X 2YAEA 4HG4K 5D6CB 3OZKA 1YMHB 2J6WA 5ALCH 1J8HD 5HI4D 2ZYRA 3JQOB 1H3UA 3MLWH 4BXSV 4TVPL 2X42A 3EDJA 1ONQA 2NNCA 3NJMA 3ZPDA 2PO6D 4HFWA 4JPVH 5A2KH 1MWAA 1QUNB 5CCJA 1N10A 5ICYA 4ENZA 1IC0A 4KK6D 1K4CA 5SWSD 5TPWH 4JREB 3AB0B 4IRJB 3HEIB 5EZJA 4OT1H 1CICD 2ZKHH 3JWDL 4PJXE 4W81A 3H6AA 4MJIB 1JRHH 1MW1A 3L9EA 3LQZB 1KJVA 2VXVL 1QATA 3EJSA 3UC0H 3VI3E 4HZLA 1C16A 4R0LA 3VXSA 4M1DL 4Y2DC 3TYFB 3RX7A 1A5FH 2Q2LA 4KY1L 3ZDZB 1RL1A 4XXWC 4HYTB 4HUXB 4YDIH 4EIGB 5DEGA 3ZRSA 2GAZB 2BOBB 4M62L 1DJXA 3CVDA 3KDMA 3MX0A 5KBLA 4M7LT 4ZFGH 5KVMC 4HJ0D 1WISA 2ITDA 1ULVA 3IJHB 3B9AA 4GUPB 3S37H 1JWSB 1FVDA 4B9ZA 1S2EA 4GO6B 3EBHA 2F8IA 3SKOA 1HHIB 3GIZL 5I1JL 2WLIB 4MA8L 4CNIA 4DVRH 5DJZB 1XB8A 2ZOKA 4BINA 2AK1L 2P43B 5B8CB 2PLTA 2A74A 4B5EA 1DEDA 1MJ8H 3FMGL 1IGCH 4K94L 3KHOA 4G8GD 4UUJA 1L4IA 4Z7UF 4CMMA 5E4EC 1T2JA 5BV7B 2CU9A 1LL1A 4ONGH 1MF2H 3QNYB 3QUYC 5I1CH 1JXGA 4Q74A 4PJ5A 3D69B 4WJ5A 4HBCH 1IKOP 1TQVA 1N7MH 4TRPL 3MA7B 3S3CB 2BP3A 5I1GL 1N6UA 4JQIH 4XPGH 1MXGA 5KTEL 3FQTB 5IHUH 5IW1B 4E42A 4XVSH 4H8WC 4K5PA 4MDJA 4XNYH 5I82A 1CE1H 3ZT6A 5LNDA 5LBGA 5CMAB 2HG5B 2AJVL 2CJUL 1HXMA 2VLME 2R9HC 1UB6A 3IS0X 1YEIL 3DHJA 2ZX9A 4LVNB 3LZFH 4FG0A 1F42A 1EHNA 3ECQA 4Y19B 5D5MB 2Q8BH 2EIMB 4W9HC 5AOZA 5I8KH 2D0FA 4ETQB 3ZDZE 1J1OL 1IC1A 1KT2A 3B7UX 4FQCL 5EU5A 1XTLA 4D0BA 1Y6KR 4WU7B 3AREA 4AXWA 4TUOA 5IW6A 3C09C 4V1DD 3WTWA 1NCAL 1BP3B 3TIEA 1U8NB 1UUNA 5E9AA 4K7PL 4HJIA 3U7AA 3UXFA 3HNVH 4AUJA 4OLYL 5D7HA 2WXJA 3QQ4A 2DI9A 4DVRL 3LYRA 5ANMB 3IJEA 3N9GH 3PP4H 1AKJA 4YK4B 1UT1A 3UGEA 5CD3A 1KC5L 1HESA 2K0RA 5ADOH 2OM5A 4Q97A 1NGZA 1UOVA 5T3ZE 3CXFA 4HJGB 1NCCL 1JN6A 5HTSA 4HPYH 1WBZB 2WP3O 4A6YB 4PIRF 4MVBC 4U0RC 4OZIF 2W95A 2IH1A 1MF2L 3LZLA 2ROXA 2DQMA 3E2HC 4LSVL 4OGZA 2OJZH 4JRXE 4BE5A 4EUPG 5ITBH 1EIBA 1HHHB 1YG9A 2XIIA 3O0RH 3LKRB 1AGBA 4O9HL 4AMXA 1J86A 2E56A 3ARBA 5IQ9B 1B3JA 1RHHA 2JIXD 5ISZB 2W91A 1MLCB 2X9WA 4YL9A 1UWGH 2IDSA 4AC4A 1CIDA 2UXFA 1KBGH 1NCTA 4JB9L 4U1IB 4XXDA 1F1GA 2E9GA 4IOFC 4OCRL 1ZGLB 3O6KH 1D5XA 1CE6A 3JVGA 3ES6B 3LRSB 1ILUA 3MJ7A 5DD6A 3HG1D 3D0LA 1D5BA 2F2HA 4JM2A 3VW3L 4MNQA 2WQSA 4PJ7E 4XN8A 1NBCA 4OJCA 3H56A 4J3VA 1FDLL 4MNHA 5K9QG 5GZND 1YJDC 3NFPA 4U3XA 3M7OA 1ED3B 3T04D 1AGCB 4CW1A 4RGNC 1DO5A 1Z5YD 2L04A 3FCSA 1W0WB 1W9XA 3KCPB 4KKCD 5IMKA 3L4TA 5ICXA 3LSOA 3EYSL 4K3JL 5GRJH 1G6RL 1FBIL 2X4SB 3OQ3B 3RWJB 3RGVD 5DD0L 4FJYA 1U92A 5JHDA 1U58A 4FKKA 4F8PA 3D1MC 1BIIB 3GHEH 4NN5B 2R15A 3SDDA 1QRNA 4LSVH 2NNAA 3AM8A 1HE8A 3HOGA 4WK2B 5SWQA 3FOLB 1JGLL 1NC4B 2IXQB 2IPTL 4HMCA 5I30H 2RA1A 2DQGH 1H6EA 1I4FA 3L9YA 4PM1A 4R5TA 3RTQC 4F8LA 1WG3A 2X2YA 4Y5VB 4P2OB 4G71B 3IMSA 1AHMA 3JV5A 1LMIA 1H3VA 3KPRB 3VD3A 2MEJB 3KGUA 5TDPB 3ATAA 3MV9E 2XWZA 1J0JA 2C4FT 1J5IA 4R2GC 1TNMA 1SMAA 1MFAL 1MI5E 3NRFA 5T33L 3K72A 3V4UH 1PSKH 1QQDA 3TVMB 5DVNA 4FMKA 1JXJA 2MPAL 4MMYB 2F54A 1FAKT 2VR7A 3BUTA 4J4PC 3FDWA 1E9OA 4E9YA 3J8F7 1DVZA 1DCLA 3C60C 1BJ8A 5CHNB 3V9FA 5L2JA 2APTA 3FSOA 4PJCA 3SCMC 3QDGD 2L3BA 4PJ7B 1NDMB 1FH5L 2Q3AA 5TPWL 1T2XA 4NC0B 3I9PA 5D2LF 3B2MA 3WUWA 5I2IB 3WCYA 3D0VA 3DUSA 3W0WB 4K8RC 1A3LH 3NTCL 4I9WD 1JZ3A 1G1OA 1B4TA 2AEIT 2J43A 3ZHFA 3LQZA 1V27A 1OZUA 2X6AA 4UT6H 3HN5A 3BZ4B 2O30A 1A7OH 1DQJA 1WC7B 5T1LA 5F7WC 5C86A 1PGRB 1FGNH 4UI2A 2AEPL 3ME0B 4F8NA 2O93L 3HE7B 1QSED 4P59H 1LO5A 2YQGA 2W07B 2ZX5A 4Z7IA 1F11B 4KAQH 4M43H 3SDXF 2JVUA 2Q8AH 4QTHA 5IB3A 4LHQB 3BP5A 4OV5B 4PJHA 2E76C 3GO1L 4J3SA 4X6CE 5T5NF 3D3VD 4Y4KC 3FQWA 5CLTA 1BZ9B 2LFGA 1U93B 2YMXL 4RZKA 3OZ9L 5E8EA 3EOTL 2QR0B 3WJJC 5BRZD 2VMFA 1AMXA 4CJ0A 1XMWA 2I07A 3ARFC 3NABL 4DQOH 3DURA 3G5WA 4DKFH 3GTNA 3OAZH 2I7SA 2WY3B 2CK0L 4TNEA 2VDPB 1YYML 4LP8A 4X4XA 4F15B 1SY6L 3VXME 1WZKA 3MUGA 1KTBA 2VDNB 2WXHA 5T5FL 2WMPB 4XWGH 3PGDA 3QA3A 1SF3A 1E28A 4WUUE 1HK6A 1E90A 4LVEA 4PGCA 4X0KA 3HG3A 4OF3A 3VM5A 3E9UA 2VDRH 1JDCA 3WTVA 1A6WL 4PVMA 4U6YB 5I1GH 4M7KH 5CKGA 3UC0L 5DT1L 2ARJB 5CCHE 1BJ1J 2VLRD 4U7SA 4AYID 3QNXA 3VI3B 1TVHB 1AD0B 2BHFA 1J0YA 3EO0A 3MV8A 5B38B 4F92B 3VXNB 4MZ3A 4X8JA 1UWFA 3QAQA 1UA6L 4W1TA 1I75A 2VH5L 4Y2NA 4GRWB 4X5RA 1L0XA 1WS7A 4G6ML 1EJ8A 4J6RL 4YSAA 5IUCA 5DZJA 5FO9B 4XP9L 1WZLA 2AGJH 4ZMWA 1F13A 3APFA 2C9PA 2QVFB 3FO0L 4ZUWB 1XH1A 1ZLVK 3HZKB 3BFWA 4PW4A 3PGCA 4IKLA 3OMAB 4IGBB 5FYKH 4NEHB 3U4EB 5KOMC 1VACA 1T5WA 1OF2A 1WFNA 4MD5B 3SQRA 4AEEA 3BUDA 3G6JA 1AP2A 4WWNA 4MMYA 3MRCA 2HRHA 4TOYL 3QUXC 4KI5C 4O2EB 3ZDXE 1HVXA 4PP1C 1L5GB 1G7JB 2NCMA 3QUZD 4E36A 3QBTB 2G2RB 3OKOA 4DGVL 2ENYA 4P23B 5IROD 1P5VA 4P3CH 1FZMB 1UH2A 2BWDA 1YEHL 1AD9A 4TV3A 5E9DD 4AYFA 3HZ3A 4J28A 1PY4A 2FT8A 1RZKL 1CYGA 2JKLA 3H2PA 3SKNA 5JIIA 1QPPA 4WI9A 3QUMA 3WS3A 1QI4A 4C59B 1G7IA 2KS0A 3RZCA 2OMNA 5C0FB 3K2UH 2YZ8A 4UAOC 4X6EA 2ZOLB 1J8KA 3SDAA 1QX1A 3RWGA 3MREA 4AZUA 2W5PA 2GT9A 3UH8A 3NZHL 1LTXA 5D1ZB 4MCZA 4HIPA 3VG0H 3P54A 4QRRA 5J57B 2V2TA 2PUQT 2GJRA 1W0YT 3DYPA 4M5YH 1UOLA 4QRFA 2F5BL 4MRBA 1D7CA 1T1XA 4HJ0C 4LCUB 1GXEA 3RWJA 2PR4H 5ESQB 1JGDB 25C8L 4ZSOB 5AB1A 1BQSA 1VFBA 2CA4A 1PG7X 3HW7A 4KNTA 2ATKA 5IBUB 4NRYB 2WO3B 2BNRB 1JFQL 1R5IB 2FJHB 2PF6A 2YUXA 4HLEA 4PB9H 3HBGA 4PS4H 4HV8A 1XGZA 2H2PC 3HC0B 5LQBL 3EYOA 1CDIA 5D1ZA 2WD0A 1ICTA 2LTQC 2R59A 3P4NB 4NM8H 1KIQB 3PL6B 4JG0H 3IAQA 4NHCL 4Y16D 4JHAL 3ROLA 1JHTA 1D5ZB 3SBPA 2AXGB 1S9YA 2NY1C 1CGTA 3EO9H 4P46A 5C08B 3SGKC 1IM9D 4ACTA 2VN5A 3V0JA 4Q9QH 5IK3B 2PYED 1I1AC 3BKCH 3IFNH 1NGQH 2LU3A 3GBNL 4XP1H 5GQBA 5KOVC 1JWUA 2UY6B 1IC7H 4QXTA 1HEZB 3P0YL 1A1OA 3FUJA 2NCEA 4R8WH 2B3RA 4NWUH 2D9CA 2WQXA 3GI8H 2OR7A 2YAHA 4Y4FC 3RWCA 1CBVL 5EN3A 4A6YA 4WGVB 1RURH 2VL5A 4G9DA 1MIEH 5T3XH 3BAEH 1J12A 1UWXH 2APFA 1PCXA 1HILA 3O81A 4JJOA 3ARED 2YD7A 3OSKA 3MYZA 3IJEB 4PR5B 1QSEA 1B9KA 2XLLA 4PV8B 5JO5B 4ZMTA 2J8UA 1QD0A 1IT9H 3CSFA 5BOPA 2DQ6A 2KLSA 3MOAL 1AKPA 4LVHC 2DICA 2O5ZH 2C7FA 3T65B 3CDYA 3U7YH 3PWPD 2HTLD 4IBQA 4PS4L 4WVRA 5C0BB 5JZ7C 3K6OA 2EO9A 1JNLH 3QJTB 3DPBA 5D1XD 4LQFL 4UDUB 2ZKYA 1AD0A 1TVHA 2H1LM 4H8WH 1BVKA 3QUHA 2XTJD 4PWGA 5IB5B 5I0ZA 5JPNA 4Y4HD 4YFLF 4GW5B 1M56B 3STBA 4OCXL 1JZ2A 4C56D 4U1GC 1CT8B 4ODWB 5C0BE 2AAVA 5GGVL 1FA4A 4P2QB 3VD7A 2X9ZA 4JM4H 1R6VA 2J6EA 1FE8L 3L3DB 2C9VA 4U1KB 3TN0B 2OULB 2Q8AL 1FNAA 4N6RB 1ZSDB 3VUAA 4XT1C 1ADQH 2DM3A 4IDJH 3S8GB 1QLRB 2CGRL 3MV7A 2CXGA 1C5DB 3AUVA 4C57C 2Q2EB 5C0DA 1KACB 1J8HB 4R3SA 2OL3H 4QXTB 3UBXG 4CMMB 3B2DC 1HL4A 4FZ8L 5JHBA 4L37B 4NHUA 4XOBA 3O9WC 3RWFB 1S7RA 3BDBA 3HE6B 2XVBA 2ZJSH 1J11A 4IMKA 3SQBA 5FOBA 2X1QA 3QDMB 5LG6A 1W6WA 1OP9A 3BP5B 1ZEAL 4CNIB 4OV5A 1NIDA 2XTJC 2CCWA 4ORZC 4JNXA 1SFHA 4WSKA 3UFIA 1F58L 5D93C 2J8OA 1DBJH 1K4DB 4FFTA 2Y06L 4WO4A 2ITDB 5CU5A 2CRYA 1X4ZA 4YZFE 3FFCB 1YN7B 4RMVA 3G5VA 4OKVA 3WFHA 2ED6A 4NFBA 2B14A 3ILQD 3NQKA 4N2LA 5K1NA 1Z9PA 5HHQA 3QXDB 1CLOL 4GKNA 1GRWA 4JKKA 1MRDH 3SCMA 3RGVA 5I2IA 1G9ML 2ZWYA 1D7FA 1A7BA 2DMKA 2D8KA 3NSDA 1FI8C 3K80A 3QUYB 2FATL 5CUSH 4MS8D 1F4XH 1Z9MA 2WWKO 4F27A 3LZOA 5L2JB 2PXYD 3MGTA 1XGRA 4FF9A 4WFED 4JY6B 4U4IA 1L0QA 1LM8V 5AYTA 1HIML 1RIUH 2H6PB 1DBMH 1AIZA 2BIPA 2FX9L 1TYEB 5J11B 4LEXL 4BJLA 3QEQB 1A3RL 4TM9A 3AU0A 1H5BA 2DJ4A 2WOYA 4L4TE 4DW2L 4JZOA 4KZDL 3OZLA 2Q6WA 4LRNL 1TYRA 1FYHB 4JO3H 5KAQF 5J56B 4KMTL 4AITA 3I9AA 5D70H 1PL3A 1GZPA 1P6FA 3OGOE 2V37A 3EFDH 4HWZB 3L16A 4YSRA 3RVXC 1D5RA 2O4EA 1E6OH 4MMXA 4NPKA 3U1SH 1TO5A 1CF1A 2X4PB 3WBDA 4XN4A 2CKBH 2NSMA 1I8MB 1OT1A 4L4VB 1KLFB 2B4CH 2OYMA 2XA8H 3K0YA 4G80B 4UT6A 2VTFA 2C9UA 4P3CL 5F3HA 3BH8B 3MBEC 2KC0A 3ETTA 3NRQA 2ZKWA 2W9DL 1U58B 1AP2B 4HS3B 4MD5A 3H9ZA 3N42F 3QYMA 3BXNA 4OCRH 4YFEA 3W2DH 4ZUWA 1TTBA 4LOFA 1S7SA 2Y0SA 4B9JA 4NQDD 5FDWB 2GYSA 4FQXC 3QJHB 1F4XL 3B2UD 2ROYA 4HEMA 3MTRA 3FO0H 3P9LA 4LCYB 3AW5A 4JQXA 2VDNH 1D5BB 3VW3H 3PCYA 2HVJA 3C08L 3ZE0B 4QHPA 3HHMA 2G3NA 3BMWA 1NM4A 2R27A 3KVQA 1LGVA 3QNFA 4O5LL 5GS1A 4QRAA 3PRZA 4V2BA 2YBGA 3TU6A 4X4MA 1NUDA 4KUCF 4PWJA 3S5LB 1IC4H 4MMZB 3RJQB 3T3ME 1R24B 1YO4A 3KDPB 1PX3A 2R56H 5F89B 5C0EB 2B8OT 1IM3B 3CDGA 5AAWC 1QRNE 4OFYD 5CO1A 4K3GA 4D0CA 4M1GL 4TPRH 1F8TL 2H9GA 3GSNB 1SN0A 4NERA 5G4NA 5GGTL 3SDAC 1YRKA 4GXVH 2J20A 3TZVC 3P4LA 4G9FE 5EULV 2EH8L 5GGUA 4ZMAT 2P28B 1MWOA 3JV4B 1ZLVH 4BYHA 5HYJE 5IHUL 3NP3A 5TDOA 3QUMH 1P4BH 3RIAK 2Y07L 3D5OF 3MJWA 4C83A 4IBZA 3GLZA 2BP8A 3CFCL 1T7YA 5ANMA 4XMZA 5FAAA 3LKSA 2PW2B 2QVTA 1HOCA 1JGEA 5C0AB 5LGKA 4NYLB 3GRWH 3MNMA 5EC1A 3SJVD 3MTXA 2W88A 3NJFA 3M1OA 4HXAH 1P69B 1QHPA 5JIKA 3T4YA 3IRCA 4RDQF 4GRWH 4BKTC 3WNJA 2VSMB 5LCVL 3UBHA 2Z1PA 3I9GH 4Z7WF 3FBQA 4BSWB 1Q1PA 1RAMA 1ZE3C 1NM9A 3LKQA 2A6JA 2EDFA 4OGXL 5CIPH 3JZYA 3S37X 4H40A 1KJ3L 1KC5H 1OGAB 4LFHD 2AFNA 3CZFA 3LB6D 3MYJB 2EDJA 4LLVB 3HRZA 3LXAA 1EERB 5HHMB 1WTLA 2BHUA 3FTGA 5KVFL 3AS0A 1JZFA 3W9EA 4KI5F 4P59L 5T8IA 5IQMA 1A6PA 4B41A 4FLOA 3S4SA 5CEZH 1E8YA 4YHOL 1GAFH 2I26N 3QNYA 2Y24A 3RL2B 2QGDA 4P0DA 1B0RB 1FE8H 2WXNA 3T1FA 3VFWB 4XOAA 5JHAA 3VXUE 4HQQH 1GL4B 3WUZA 4HG4J 5GGSA 1A3ZA 1E8ZA 2YWYA 3I6GA 1SBBA 3A67H 3NGBB 2XBZA 4GRWE 4JJ5B 3B9DA 4HJEA 5BRQA 1QBML 1I31A 2BNRE 3MBWB 5DEFB 3RX9A 1B0RA 4J23A 4KHXH 4I0CC 1D2PA 4RBPH 3NFSL 3HNSL 2V5YA 4LKCA 1KFAL 5KYXB 1PZ5A 2BW4A 4GUPA 4QOKE 3V8CA 1CK0L 3WAKA 1NCNA 3E2HB 2VABA 4BH7B 4Q6IC 2ZJSL 4TN9A 4IMKC 4YDVA 3EYQC 5DEGB 1QSFA 1WIOA 3CN1A 4JPVL 15C8L 4JCLA 3L7EB 4F1SA 3GSOB 4X7FC 3C6LC 2CCVA 4QRSA 4J3OD 3REWB 2I24N 1E4KC 4YDVB 4S1DD 2A74C 3RNQA 3FTZA 1NGPH 4FFWD 4HJSA 2YAPA 4OZFA 5GRJL 3Q8AA 1IMHC 4QO1B 5DZ9A 3PAZA 2KZ1B 2DI7A 1SJVA 1AIFA 1G9HA 3QWOB 4QXVA 1J05B 1AS7A 1QTYT 4N90E 5CSZA 5D5MF 1U9KA 4XP6H 3DOHA 4LRIA 3TBTB 2D7OA 2FBJH 2FUQA 1VAHA 3TT1H 4ZO8A 3UAFA 2ADJB 3O3BA 3NIDB 1I1RA 2X2UA 4ZNEE 5ESAB 3FPXA 2WO2B 2FATH 2GHWB 1QUNA 2NY2B 1IUZA 4F5CA 3OLDA 1BEYL 1B0GA 1VGEH 2LAGB 3I6GB 2HMIC 3CUPB 3C8KB 1KCSH 3LN5B 1I9RH 1KF9B 3FUIA 4LNVA 4H0GA 4XHJD 5C0CE 1RU9L 3H85A 3PDGA 2F58H 5ISZA 3BD4A 3RTQD 3K6NA 1TJGH 32C2B 3N44F 2C34A 3V7AE 3S3BB 2PYFB 1Q94B 1HHKB 4ZPVB 3QP3A 4LHJB 3OWRA 4M8VA 3HAEB 1WPCA 2RCSH 4MS6A 3BZDA 4JGMA 4GLRH 4ZI8A 4YBQD 3Q2WA 4YXLH 2A6JB 4ZW3A 4LLUA 1JN6B 5BZZA 3UAJA 5FUCC 3PDOA 2O26U 4HPOL 4H7VA 3VFMA 3F58L 4U6HA 2EJ1A 5DR5H 5KJRL 4AJWA 1N0XL 3DA0A 3HMXA 4W9GC 3UTSA 1UM6H 3GIVB 1N19A 3B9KC 4JFDD 2IQ9H 1NGPL 5AFAA 4P5TA 4N24A 5DJ6B 3ZX1A 3PIQB 1J1XH 3MBXH 1IEBA 5DMJB 5EO1B 2AJVH 4YFDB 1UADC 3O0LA 1CLYH 1HOCB 5KVGL 4L18A 3V0AC 3TESA 1T1ZB 4RFOL 1G7QB 5F1NB 1RULL 4MJID 4F8QA 3CFQA 1YN6A 2F9BT 4XPAL 4H1LB 2AQQA 4GPVA 3BWAA 2B2XH 3GJFK 4M6OH 2X0WA 3ZMNA 2OV0A 3AACA 2NYZA 4JE4B 3IFOB 3KLAB 2Q7AA 4MXWL 3ZYJA 1PG7L 2AEOA 5KSBF 1PF3A 3CVIH 2JMRA 4GG6F 2GFBB 3B2PA 2ILLA 3NIGE 2ID5A 5L4MA 4E42B 2DPKA 5F1OB 3SBRA 4KKLD 2MWCA 3V4VL 5CZXC 3M17A 1NAKL 1A14L 2FRGP 1S7QA 2CPCA 5SX4H 1OAZL 5TD4A 5KAQG 1HHGB 2WWOA 1YNLL 3K4AA 5DK2A 4Z95L 2AJ3B 5ENWA 3N0PB 4TTDC 3H3PH 4WW1B 3K71A 1NEZB 2YEZA 5E9DB 1FO0A 3PWJA 4JPKL 4KFZC 1I3GH 4NM4H 3X3GL 4ZYKA 1MHCA 3MCKB 4L0YA 1OCWL 4P06A 3CCHB 1UHVA 2A74B 2UWEF 5ABAA 3GI9L 4AI7A 4OCMC 3ZQ9A 4AGNA 1H5BB 2WLMA 1WZAA 1EEZA 3KWTA 2GW5A 1IB5A 4Z5RB 1FORL 4LPUA 2VDPL 5TDNA 1KIPA 3OB0K 1DBAL 5HXMA 3IDXL 3KDMB 4QHKI 4WTXA 1WA0X 3MZGB 3DTXA 5HDOA 2ALWA 1U8MA 4UB0L 4BDVB 4WUKL 3WIFA 3IU4L 4OZHF 4XPAH 4DERA 3MVSA 3U9PH 5IFJB 3MOAH 3TYFA 1CXKA 1ECYA 3TWCL 1YEFH 3ZR5A 2XIDA 4M5SA 1DVFB 4PJAB 4PJXF 4PBXA 5FDYA 5E24E 2JKRM 2EE9A 2HRGA 3P4OA 2A1WL 1S7WB 3IJSB 4LSRL 4YSCA 4ZG1A 1SDDB 4E5XG 5GZOD 1SHSA 2P47B 1U33A 2E7CA 4HWEH 3VMOA 5GS2D 3O11A 5IB1A 4PJGF 1CYXA 4WJKB 2Z6FA 1ET5A 3ZIYA 4C4BA 3OVUB 2NY6C 1I7ZA 2BRQA 5KANG 5BMFH 4K5NA 1MI5A 4J12A 2D3NA 2Q7NA 5J13B 4HP5A 5KSBA 1ZANH 3D52A 4JFZH 4P07A 5ESAA 5F7DA 1DBBL 1SDYA 3RIAF 1KYOJ 2NX5E 3WFEH 1DUZA 4FNTA 1XR9B 2IFGA 1QFHA 3GQFA 3MACL 3U0WL 4KAQL 2J73A 4PGJA 3PABA 3LHAA 1AZZC 2V8LA 5BW7A 3MGTB 4FNLH 1F1DA 2E3VA 2E59A 2QVKA 4NXSA 3WIIH 1BZQK 3H8NA 4ZO6A 3QYNA 5F0MB 4FULA 1FYTA 2OXGB 4CVXB 3BUBA 2YPVL 3EJTA 4I4WB 3L6FB 1FNLA 1RK1B 4GW5A 3IK2A 5EZOL 1QEWB 4HCRL 4NRZA 1VGKA 3O6ML 2V0AA 4IBSA 1CFMA 1GCFA 3BH4A 4FD0A 3FFCA 5JTWA 2CK0H 4WEUD 3FB7A 3PWPB 4XNDA 5DK0A 4BFNA 1UXSB 2NDGA 3CHXA 1A22B 2WLHA 2ZP0T 4W4OC 5CEYB 3WS6C 2E86A 5EUOA 3ILPA 4DN4H 1D5IL 2O6EA 4N8CH 4GAJH 5D2LB 1UVQA 4NAQA 2ZWSA 1PLGH 5EFIA 1OP3K 1JCKA 5LO7A 3A3YB 3GMOB 1CFBA 3ISWA 4LMQI 1UACH 2OMUB 4PMEA 1RMFL 3IMUA 5FM5M 3BDYH 4FLHA 1HTYA 1A1NA 5J0BA 1IC5H 3L45A 4MQ7B 1H8SA 1PMYA 2CUMA 2AQSA 1T20B 1HEHC 3KJ6L 3L3OB 2DQTH 4X5XB 4ERSL 7PCYA 1AI1H 4N1EA 4N6RA 4NUPA 5GSVB 4NC1E 4G7QB 1KCSL 4WFEE 3DX8B 1H8LA 3O9WB 4LLVA 3EOTH 3ZE2F 4KROD 3H9SE 5TE6L 3W5MA 1HI6B 5ERWA 1YEEH 1K6QL 2BNQD 5L88H 2O5XH 4FFVC 4YUEL 3LKQB 4XGZA 1JVOA 1VF5C 5ETUB 4P2OD 2K8QA 5IK3A 1YMMB 4JFQA 4EIZC 5BCAA 4J7RA 1S9KC 4F7PA 2C9QA 2MCMA 2BSEA 1CLCA 1W91A 3MLWL 3SN6N 4P46B 2ZTBA 1RZJC 3A6BH 1DFXA 3TN0C 2WLNA 5K5YA 2UX7A 1G7PB 5LBSL 3U7YL 4PW9A 1GOFA 1QYGH 1E0OB 2G9HA 4RIRB 4YHZL 1DSFH 4D0DA 3CDZA 1T22B 4NNYA 1VPOH 2WYZA 3QDJB 4YBHA 2AKRA 4HV8B 2VDLH 2KUTA 1YEGH 3IEAA 4UF7C 4D3CL 2WVVB 4EN3A 4M7ZB 2XWCA 5ICUA 2IAAC 2ZWKA 4JPQA 4CRPA 3ARGD 2F54D 2BNQE 5F9AC 5HJBA 1M2VA 1F02I 2WNWA 3CHSA 4PYHA 4RAVB 5DJCA 4JVPA 4PJDB 1AGDA 3NFNB 4N2FA 1BQKA 2FCBA 3AG3B 1MNNA 1BQHB 2BIQA 2E7HA 1WVZA 5FV1L 3SDDC 2OYPA 2HX7A 3OL2A 4DPCX 1SHMA 1TCMA 5AZUA 3UP6A 1QTSA 2OSXA 3GZOA 4N85A 5IJBC 43CAA 5B4MC 2FWSA 1A1OB 2ARWA 3SO3C 3HI5H 5D6DA 5T3XD 4ZSOE 1NFAA 1NUNB 4Y9BA 2R2HB 3GJFB 4DKEH 1BF5A 4DGIH 2AQ1A 5F89A 2YAMA 5TQ2L 3GPSA 5B4MD 1I7TB 2HAZA 4LU5H 4ODTL 3VD5A 3IWUA 3OQRA 2FHBA 1NC2D 2WWNA 5IB1B 1LO2H 3C6LD 2VXQH 1KN4L 3LPOA 3DGGB 3L4WA 2XOTA 2XICA 3DVFA 1KENH 5D1XE 4UMSA 4HK0A 1TQBC 2CO6B 4FA6A 2WCSA 1ZVYA 5FYKD 2F74A 2QPSA 3L1GA 1T0NA 2CJTA 3FQRB 3I2CL 3WE1A 5IB2B 2Y06H 1UM6L 3VFGH 2G5BA 2VRQA 2JKTM 3I84A 4APXB 3ULVF 3U25A 4FRWA 4BK5C 5IEHA 3X3FL 1JAEA 1THCA 5C09A 1GJWA 4LEOA 1CICB 2ZF8A 1RH8A 3DBXB 5DA4A 5E4AA 1IFHL 4KK6C 1O75A 3OR6B 4KNSA 4PWKA 3PHQA 4QY8A 5HHXH 5ID0A 1WA1X 5HGHB 2CJUH 1MUJB 1GS8A 1UENA 2OJEB 1HDMB 2XNAA 3KPOA 3LS4L 3Q8FA 1JZJA 4TTGA 1SY6A 2VR3A 3IRPX 1YUHB 1F6AA 5CCKL 2AERT 1G7PA 4LO9A 2NR6A 3NEXA 1IAIM 1L9RA 3CVIL 3SD5A 4A68A 4DW2H 5CILH 3CX2A 5C6WH 3I6KA 4JZJB 1DQIA 2HFEB 2X6UA 4RMUA 3GSRA 3U82B 1JYWA 4GKZA 2YGOA 1NEZA 5ETUA 1Y7VA 4I3RL 2P80A 3IMTA 1VRSA 2DTML 4F80A 5J9PB 1GZPB 3ALPA 3FYEB 1I3RA 4YLCA 3KJ4C 1UUSA 2MQGA 2FEJA 3C6LA 4JO2H 3W11C 1NAMH 3G6AA 4OM0H 5LWYH 3MRJB 1MJJB 3KPSE 5B1KA 1KENL 1JF6A 4U31A 3DIFA 3UACA 4PGBB 3QJFA 1S3RA 2VE6A 4ZX3A 3D25B 1GAFL 4JQIL 4XPGL 3W39B 4Q0XH 2D73A 5AG8A 4IJTA 5AZEH 4C47A 3ASWA 2EDBA 3DBSA 5FKAB 1HH9A 4AQ1C 4GSDH 2FO8A 4OM1L 5BZWA 1FSKC 3BZ5A 4DAGL 1YNTB 3WOVA 3DO7B 1GJIA 3L3JB 4XTRD 1OGSA 1I1AA 3APDA 3FQ1A 2GTWA 2P5WA 3BX7C 5DQ9B 1I8LA 2BK8A 2ZOUA 3WIIL 3VYNA 3NA4A 1SFDA 2JCCB 4WUKH 1RZKC 3CFIC 3NMEA 1K8DB 2MIZA 1MELA 4TVUA 1F11A 2VO5A 1WCBA 2N7AA 3VXRB 2HFGL 3VI3A 4XNZC 3IRZA 4NQEB 2ARJA 3FL7A 3N85L 3IGUA 4IU3A 4AE1A 4ENEC 1PZCA 2NZ9C 4FFYL 4GSUA 5DS1A 1MVYA 3B9KD 4HCRH 4HXAL 5TFSH 3SDAD 4PJAE 3EH1A 4XZ4A 1U91B 3EO1A 4WNJA 1HJBC 4GS7C 1R4XA 1TEGA 1MCDA 1E9QA 4O02B 4JFPB 3MNVA 3QQ9D 1I9IL 2HKFL 3BP7B 3EYFA 4U6VL 5HHNA 4A7UA 2I27N 2MCPL 4E2OA 4P57A 1V5JA 2BIOA 3WY4A 5C0DB 4QYOA 3V4VA 3ENEA 3IB4A 1IO4C 2BNRD 4NI3A 4ODVH 5FO7A 2GJ6E 2H0FA 3L3OC 2BNQA 1H3PH 1F0LA 3O3EB 1UZ8B 3H1ZA 5BQ7A 4KQ0A 3QJRB 1MFBL 4YDJB 1XGPB 3QDME 2OMZB 1N67A 4BM7A 1ZT1B 1KN2H 4OUOA 2E27L 3RPIB 4KXDA 2QGBA 2J8HA 4DSYA 4O9HH 2YD8A 2BP5M 2NQ3A 4EE2A 5BS0E 3FCTA 3LIZH 1FVEA 4UZSA 1ETJA 4AT6B 5B7FA 3E0GA 3FTSA 3BAKA 4DAGH 5DJAB 2I32A 2WK2A 4GINA 1ZTXL 3MRDA 4HVBA 1H15B 4QOKA 1HIMH 1ID5I 1RIUL 3UCRA 3WXWH 4ESKA 5HI3D 2QPFA 1G0YR 1LO4L 2F7RA 3L5XH 4I5BB 1CF8H 4PLOB 4YXHH 3MXWL 4PJDF 2ETWA 3MRNA 4PVLA 1E2WA 4ZX4A 2AI0H 1Z3GH 1AIFB 3QWOA 4XO9A 4BFIB 3ULAB 1QHQA 3WN5B 4G82A 1PAZA 3RE0A 2JTYA 5FECB 2WUCL 3QUKA 2YLHA 3EW3B 3LNHA 1X5IA 4UQ2B 3BEVB 1QLEB 3QZLA 3GSOA 4AC2A 2OBGA 3A6BL 3BPLB 3MN8A 2ZG3A 5TK4A 2OTPA 4NKDA 1C08A 2M8XA 2WKOF 3HE7C 3TP4A 5L8LB 3SPHA 5I1CL 1HL9A 4HUWA 1P7QB 4LPXA 1GHFL 4M48L 1E3ZA 4ODHL 4QUOA 3ZT5A 3SDCD 4FYTA 1KSRA 1I8KB 5GSRB 5GZNC 3IVKB 5ITFB 1MJ7L 3O2DA 3X13A 3MLZL 1J9CT 1EJ6A 1GPOL 2EDQA 3KVPA 1KJ2B 3MLSH 3QG6B 2BOCA 4JDVB 3MLVH 4KO9A 4LOVA 3FB8B 1RJCA 4KNUA 3FTWA 4MXVF 2VDMH 2VXSH 2Z1KA 4XO4A 5LHDA 3US1A 5KVDL 3NCEB 4FTVB 1WUNT 4WY7L 2MRYA 3CCHA 3L8QA 4Y5XB 3DGGA 4NQCA 5FLUA 3EBIA 3B2XA 3CX5K 4Y4KA 5L4IA 3P40A 4W93A 1FV1B 1DN0A 1I7ZB 3SYCA 1I8UA 4JGUA 4R7LA 3NT0A 1TO4A 4H1LG 1WFJA 3LKNA 3WN6A 4JG1H 4KJYA 1GS7A 1JTTA 2UY7A 2Y7QA 2YKKA 2R51A 3FSAA 3QHFL 3R7QA 3UJTH 2KLRA 1A4KA 1GC1H 2CJSA 4ZUUA 5A16B 4K8RL 4WI6A 5K9KB 3J7HA 3AMLA 3TIDB 1JNHB 2OK0L 3W9EB 1NCAH 4C56A 5IWLA 3NUKA 5CU9A 3DXAB 1FCGA 4AJYV 1U92B 4PV9A 4OZFH 1PBYA 3QUZA 3KYMB 3VRIA 4DNLA 2RAMA 3ZTJH 2B1OA 5I1KL 3MRMB 3LEXA 4KRNA 2ED9A 1QA9B 3QK0A 3T0ED 2CKBL 5LAXA 3H54A 3ZE0E 1J5DA 1I8AA 1FPTL 3B5TA 3QDHA 3ZU8A 5KS9A 2CO2A 4BKSC 1YEGL 2E4TA 1VFAA 1WIUA 1X7QB 1O6SB 1EEZB 2V8MA 2Z35B 1S9XB 3GKWH 3DV6B 3JWOL 3QUGA 3QDMD 2QL1A 3MREB 3DX9A 3LVEA 1XB3A 1RZFL 3EDDA 1A8ZA 4GI8A 1QSZA 3NH7H 3DJTA 2A4EA 1WCQA 2IQ9L 4UDTA 3VI4F 4A2DA 1FL3B 2VLKA 4PGEA 1NMAL 2VDQL 1ZHBA 3OXSA 2VR5A 4ODXB 5EU5B 5FGSA 4ZYKB 1T04B 2J57A 4XNQA 1FNHA 5JW5A 1T21A 3MJ9L 1AD9B 2XC8A 1LO0H 3GRBA 1MFVA 1E65A 3G04B 3R06A 1K5WA 1P84J 1RULH 3U4AA 2J21A 5C3TA 4N2MA 5CMAA 4J39A 2C1PB 3QJUB 4L0PB 3VRJB 3AUWB 3I6LE 4HGMA 4UANA 4PV9B 1HC1A 5AW5B 1P7KB 1SQMA 1RP9A 5GSVA 4ZPVA 2VXQL 5K33A 1JF5A 3GSNA 4Y9FA 1ZE3H 4M4RB 4Z7VA 3NK4A 4ZD3H 5EOCJ 1MRCL 4QHMA 1E40A 1UD4A 1V3LA 3TA3D 1PD1A 1J0IA 4S1RL 5BZDB 4PJEF 3WELA 1YDPA 3LH9A 3FCUB 3LN5A 1E8WA 3DTUB 2G60H 4PRPD 3WV0A 4KU1A 5D2NB 5CGBA 1USQA 3BSHA 3VXUB 1CGWA 3U0TA 1C7SA 1JNJA 1BPVA 1Q9KA 5F3BB 4HBCL 4YR6A 5J6SA 4JO4H 1OW0C 3PIQA 3UZEA 1YQ2A 4ELMB 2Q86A 4OZHB 1HT6A 1R0AH 1ZCRA 3OX8B 3QG6A 4MHHG 5J1SC 3GINA 3QAZC 2HLFD 2VLRB 1BVNP 1FO0L 5DFTA 1LE9A 3KPSD 3DJRA 1EHAA 2X44D 3LTVA 4AEFA 3HHSB 4YSEA 1M9SA 1OSYA 4MA3B 2CDEB 5ACZA 4QRPE 2AGJL 3CDCA 1OALA 2APBA 1E28B 3GMRA 1K8IA 5AB2A 1AR1D 1AQDA 4GQPH 2VR6A 4F7MB 2AJXH 1AGEB 1YLBB 2BFGA 2XUWA 2ZYSA 2ADIB 4BZ1L 2NSQA 1NBZA 4R2GB 3IU4H 3N85H 4GQQA 4JRXD 1X6LA 2FWUA 5FYLE 1C7TA 1MHHA 1SUJA 3I9GL 1JZHA 4YLQT 4MLIA 1W72A 1G1YA 3MBED 1KCWA 2XV0A 2IWKA 32C2A 4Y1TA 3DMMB 3FONB 5DWUH 4I3SL 1CICC 4LLDB 1IGIH 4GSQA 2EECA 4XPFH 5JIHA 2Z0BA 1WD9A 3CZEA 3MRDB 2WBXA 5C3LD 2OL3B 2YIHA 4IKKA 3G6JF 5AVYB 2O1AA 4L8SC 3LKPA 4MYWB 3OJ2C 2NNXA 1CL7H 4BZYA 3LB6C 1OAXH 1IIIA 1CDBA 2MSPA 3FPYA 3OTTA 3ZLQC 2N1TE 1FGNL 2JK5B 3QEQA 4G6AD 3MLRH 1O7DE 2Y2TA 1RUKL 2JI3A 4H0IA 4NZDA 4PJEB 4XCFH 4YO0B 4PVBA 3NBNA 3D0AA 2A9MH 4BFJA 3UL4A 3LZRA 1MHHB 4GG8B 3V6FA 5FO7B 2BDNL 4KOBA 5T5NG 3V4VB 3EJYC 1EPFA 5E00A 3IWVA 2BRRL 2VC2L 3UJIH 4F7MA 4PJ9D 3WHXB 1JTPA 2WBWB 5C0ND 4UB0H 2APVA 4PS3A 2J1KA 3BAEL 4HKBB 5ID1B 2W0PA 4G7YL 3DSFL 1NFKA 2FQGA 4WF7A 1E9OB