4KKQA

Crystal structure of vibrio cholerae rbma (crystal form 1)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
234
structure length
225
Chain Sequence
PVIEANLSLNQNQLASNGGYISSQLGIRNESCETVKFKYWLSIKGPEGIYFPAKAVVGVDTAGRMLNVTRGFWVPEYMADGKYTVSLQVVAENGKVFKANQEFVKGVDLNSLPELNGLTIDIKNQFGINSVESTGGFVPFTVDLNNGREGEANVEFWMTAVGPDGLIIPVNAREKWVIASGDTYSKVRGINFDKSYPAGEYTINAQVVDIVSGERVEQSMTVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RbmA protein
publication title Structural Basis for Biofilm Formation via the Vibrio cholerae Matrix Protein RbmA.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural protein
total genus 45
structure length 225
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkqA02
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkqA01
4BEIA 4KKRA 4BE5A 4KKPA 4BE6A 4KKQA
chains in the Genus database with same CATH superfamily
2DICA 2NY3B 2ICES 3VXTB 2E46A 4RIRB 1RUAH 5DF0A 3H55A 5SV3A 1KSRA 2NQ3A 2X4NB 3ZKQD 4ZODA 5IB1A 1I9IL 5F0PB 1A6UH 5DEZA 3D4ZA 3QR2A 4F7EB 5HHOB 2OMBA 4AWJC 3TO4A 3U2SA 3WTSA 4P23A 2NT0A 4NP4L 2BNRB 3MRGA 3TEZA 2JJWA 1Y18A 1AR1B 1C5CH 2QZ5A 1KGYE 3VD1A 4B3VA 3F7YB 4U33A 3K8KA 1IC5H 5DZPA 3IDIB 4X0KA 3SCMB 3KPRD 1OO2A 3DA0A 4D7BA 4WFHD 3CZSA 3EGXA 3EYQD 2OR9H 2ADYA 3QNZA 2HRHA 3D48R 4LLWA 3GKZA 1QOKA 1A4CA 2W80C 4QRPD 4UI2A 1GC1L 1TJIH 1EQWA 4NRYA 3R4DA 3VGAC 4QDGA 5I1GH 3SGEI 1FQ9C 4LCYB 3RIAK 4GQQA 1AYRA 1S8DA 3W9DB 3JTTA 4MMYB 2YKKA 4DOHB 2VRQA 2PWEA 2V8LA 1XH2A 4KRNA 4RISL 4IHOB 4Y16D 2K78A 1TZIB 2CALA 5E08H 2VMEA 5KUMA 3SOTA 5F6HI 3SE4C 1JGIA 1FA4A 2ZG1A 3HBZA 4YGVB 4AJ0A 2DJMA 3VM5A 4UV4H 4YHOH 2EDQA 2LVCA 4LVEA 1UT9A 1NBVL 3EOBB 4KUCF 4PTUB 4RZKA 2ZUTA 1TEFA 2EEXA 3BKJL 5E03A 3FQWA 2XWJA 1G94A 4GYBA 3HLAA 2I60L 2A38A 2AQSA 3MODL 2QR0A 4GG6A 1PLBA 4WSKA 3K71B 2V0AA 4G7QB 1SZNA 1KCRL 3N41B 4QXGH 1A6VH 2IBBA 4K23L 3CFNA 4MD5B 2EE2A 3OKOA 3OKNB 3WUWA 4R9HA 4HEME 3DTXB 1CE1L 1ES0B 1FC1A 5K33A 3RILA 2W0FA 5C08A 4ALAC 5DS2A 2OYKA 5I0ZA 1HX0A 3PJSA 4JPIB 1NFDA 2A9MH 5JW3L 4M5ZH 4MJ5B 4CMMB 3LKQB 3V0WL 2CA4A 1AAJA 2RJMA 3LV3B 4GIOA 5DFAA 3WE1A 2EVHA 3HHSB 1LQBC 2A6DA 4U6HA 2OXGA 2D3NA 3PWUB 4OIFA 4EDXA 3EJSA 3IKKA 4JFQA 4X4XA 3UTSA 2H41A 4JDEB 3JYBA 3P30H 4GQ9H 3T0XA 3V95A 1BYOA 5EO0A 3RFZC 2NY5C 1CICC 3WEXB 1CG9B 1QW8A 2VXTH 1NGYA 3AXHA 3BPLB 3QP3A 4MB1A 4AQZA 3MV8B 3K6SB 4LSTH 3AB0C 3G6DL 3KLAA 4HDIB 4NO0B 4AEIL 4BGDA 3O45A 4B0MB 3KGRA 4K8RH 4AQ1C 1HC1A 1FYHB 1JXKA 4MTMA 1SGKA 3QAZB 2P5WA 3R1GH 2DQUL 3H3PL 1X7QB 4O2EA 2QVMA 4J6RL 1AMXA 3U2IA 2EIBA 4GH7B 5D96C 2Q8AH 3I3DA 4DAGL 3FFCE 1ZWIA 4PP2B 4RBPH 2A73B 1E3FA 2WQVA 4ZMVA 2VWEC 4OLXL 1G1KA 4POZD 3TT1L 3ZO9A 1QPXA 3O8XB 3IJYA 3AY4A 5DZNA 1HXMA 3AXLA 1HJBC 3MJGX 1ETB1 3UTQA 5KANI 1T20B 4KJPD 5IBUG 4KZCA 1A9EB 1CLYH 1KEGL 1OT2A 2XWEA 1XIWB 2EABA 3GKWH 5CZKA 3UTTD 3MLTA 4GBXD 4YHPA 4AEHH 4JZOB 2LAGB 1QSVA 2JJTC 1T1ZB 3QRLA 1WA2X 4Y1SA 1QHPA 2XJLA 3PUUA 4NCDA 3B9KD 5HY9B 1NL0L 1PGRB 3IMSA 4EBQH 4QRRE 1TLMA 1FVEA 2OMUA 4K9EC 3MYJA 3BUYA 2V2WB 4MLIA 1WH0A 1X44A 2C3WA 2YAFA 4ZS7H 1QLFA 2GBAA 3G5WA 4AW7A 4UU9B 2R0WL 4YSQA 2DMGA 3AADB 3BD4A 5J56B 1KNOA 3UP1A 1P0SE 5D4JA 5BVJA 2YAHA 4NYLA 1OB1B 1F45A 4R7VA 5KVGE 2ARJB 1TEGA 2F1BA 1XMWA 1EXHA 1AZCA 3NJMA 5IMKA 3L3GA 4M5YL 2J6EH 3QZWA 5SWZD 4DFIA 3IETA 1GGBH 3GJFB 4X6EA 5FO9B 4NSKA 1FDLH 3BZFB 3MNVB 3EKCA 3O0RL 4U1LB 3TF4A 3D0VA 3NSYA 4LAJH 3PWLA 5C07E 5D7JC 4C83B 1NBQA 1I9EA 2DQEH 2BSTB 2IVFC 3MUGA 1KIRB 5EU7C 4C56B 3VSUA 4JFHD 4GAYB 1AGFB 4GKNB 4B95C 4YNYB 4GUPA 4LKXB 3BMVA 1JGLH 1N59A 3IU4H 4HCRH 2R9HD 3WHXB 3IDXL 2PR4L 3STBA 2VLLA 4I48A 1IRAY 3ARBB 4PBDA 4HG4K 4XPAH 1IBDA 4L5FH 2IAMA 1YMHB 2Z7WA 3FTGA 4KXDA 4GY4A 3IVKA 2FTAA 5CEZE 1TG8A 4EVNB 2MIZA 4LSPH 1H8SA 1R3KA 2BS8A 1N64H 1EJFA 4JN1L 3T1FA 2CUIA 3EYSL 5IWLC 3Q1SL 3ULUE 1MY7A 2XI9A 4YHNA 4N8CH 4P2OD 4G9DB 4NM8L 4J3BA 5EBMB 4K3JH 5F7BA 1MFEH 1TQBB 4NO3A 3JV4B 4HAFA 2EDMA 4I0PD 5I1IL 1IGJB 1B0RA 1PFCA 3LS5H 4M7KH 1N0LA 2XVBA 1DQQA 5HDLA 3MRJB 1ZLVH 2XIBA 1E9OB 4Z7NE 1P4LA 4OZFA 5H37H 1ROWA 1OCRB 3DX0A 3FB5B 3ATAA 1XCTA 1M1SA 2BRRL 3G6JB 1SM3L 5A3IC 2EH8L 2HH0H 1HI6B 1NICA 4YBLC 2SEBB 2YN3A 3GTTA 4X6FA 2W9EL 1XB3A 1DSFL 1GYWA 1LL1A 3CSPA 1ZS8B 4FL4B 1KPUA 4BXVA 2YGOA 3PY9A 5AKSA 2APWA 1UH2A 5JZ7D 4GIPD 1J1XL 1IX2A 3CDYA 4Y88A 3MLYH 1ANUA 3ESNA 4HD9A 4ODUA 2EC9U 2CDEA 1WGVA 1J11A 2WNKA 3L3OB 1YEJH 3ULVD 2NX5B 3AG1B 1OCWH 3FO9A 1G43A 4QRSB 3R18A 3Q2CA 3IRPX 4PG2C 1S5IH 5HYSB 5ABZA 5ICZA 2WO3B 3D85B 2DKMA 2KH2B 5KAQF 1T6BX 2XUWA 1BFTA 1MJ7L 2YC1A 3ME0B 4PJ8B 5IJDC 1HK6A 1B4JH 5ICUA 4G6ML 3NJHA 3HMXH 5B3JE 1TSHA 4PJBF 3G5ZB 3TBVB 4JREB 2VJ8A 3FQYA 4E41A 3MOBH 5IV2A 1BVKB 1I8KA 4L37B 4FQ1H 1OL0A 1A7QH 1CFNB 4B50A 3EH5B 3D08A 4OV5A 4IIQC 3S37L 5DJ2A 1WQVT 2QV2A 3BN9C 4W93A 1YMME 4HWBH 2B9AA 4LP4A 4PR5A 1L9OA 2FR4B 3CZFA 3S88H 4D0BB 4DVBB 1KC5L 3GZQA 4LSRH 3W5NA 3JYCA 3CFBB 4CRPA 1CDGA 1MCCA 5T1LB 3VXTA 4AQAB 4PJBB 2NNRA 2F5AH 2X4NA 5BUPA 2J8OA 2ICWI 2WLYA 4GO9A 5EEWA 1DDHB 4NCC2 4ZUUA 5HHOA 4YFLF 3QIUB 4BWUA 1A6AA 4HH8A 4K2UL 3VGBA 2YS4A 2BNRA 5TDOB 3SDDA 5A2KH 2R8SL 2X10A 4JVPA 1WTGT 1QNZH 1KYOJ 1F4YH 3F7YA 4GRLA 3TLRA 3BHBA 3SCMA 2Z93B 5LDSA 3BP5B 4YX2L 2NSMA 1JFQH 3H0TB 2FEJA 2ORBL 3ZKSD 5FYLH 1GMEA 2WP3O 3X3GH 4I7ZC 1OXYA 1MHHB 2PP7A 4U1KB 2RCSL 2SODB 4AL8C 2ITDA 4LEBA 3WS6C 5BVPL 5L2KE 5G55A 4DN3L 5HVHB 4LCYA 4NJAH 4CVZB 1WAAF 4Q9QL 2VO8A 1KXVC 3PHAA 3NACH 1E6OH 3IN2A 5T5FH 5DHVB 1IEAA 4F2EA 1TZIA 1P6FA 3DTDA 4LRIC 2RMNA 3WKML 5MEOA 1H15B 2GYSA 2JKTM 2VR9A 4YGVA 3EOTH 3L4TA 1ICTA 2IXQB 4HUXB 1OW0C 4YWGL 2KZBA 4WAFA 2E7HA 1MIEL 2NQDA 3EOBA 4PTUA 4HXAL 3U6XS 2MQGA 4JFFE 4MJ2A 4LLQA 1ZS2A 1NBZA 3TU6A 2OXHA 4GXUN 3CZGA 2R0ZH 3D39D 1SOQA 1RZFL 2ZOUA 3IM1A 1JWUA 3GLEA 2QSQA 4A67A 1NOLA 3R8QA 1I1AD 1QMUA 3BQUD 4MD5A 2J12B 3ZU8A 4OT1L 2G75B 3FOLB 4ES9A 5BW7C 1T7YA 1ES0A 2JCCE 3WKPA 3VG0H 2HFGH 3VNYA 1DBAH 4HS8L 1TITA 2APSA 2PO6D 4JPIA 3GBNH 3DGGB 4MJ5A 2B15A 4GW5B 3GB7B 3LKQA 5INCB 1QUNB 4HT1L 3OJ2C 3FF7A 3LV3A 4L3ED 3PPEA 2V5SA 4LLDB 5E99H 1EO7A 5AW4B 3SGJA 4AKQA 5JW4Q 5KBKA 3HHSA 3RY4A 1ET8A 1NCBL 4L8BB 3PWUA 1J48A 5G5DB 2X4RB 4KPHL 1FCCA 2ZOOA 4HKJB 4JDEA 4XMWA 1YPZA 4JJOA 5D72L 1CG9A 4ZFOB 1QSEB 1H5BB 2AJVL 4ZO9A 4LSQH 1OAJA 2VJ0A 5TGBB 3ULVL 3QQ9C 3MV8A 5HHXL 1ROCA 1H6UA 3QJHA 4WTZA 3FTYA 4HDIA 2FX8H 3GSNH 4NO0A 1DVFB 2W95A 4YHKL 3UAFA 1G9NL 3EYOB 4F58H 1VEMA 3VI3F 1QRNA 1SDAB 5D4IA 3EF7A 3I50L 3CTTA 3FMGL 4LT7A 3BDBA 3FB6B 5K69A 1JPSH 3RX8A 2AJXL 4MD4A 2H2PC 4MVBD 3LQZA 1AS6A 1X7QA 4WDIA 4WWKB 4PGJA 3TJEH 3RKDD 1PZDA 3L16A 2W92A 3BKML 5ADOH 4K8RD 4L05A 3MTXA 4ORGB 4EUPH 1JZDC 3O8XA 4OQTA 1M2VB 1RPKA 2Y2WA 4UAOB 3VFWA 3MRLB 3VI3B 1ETA1 2DI9A 3K6OA 3M17B 2FJGB 4FYQA 4J3WA 4YO0B 5E56A 4HFWA 2XJKA 3VAEA 4OF6A 5CEXA 4NNPL 2I5YH 5CD3A 3UJJH 1N2RB 4YHIA 4KKRA 2IBGA 1RZIB 4M1GH 1DANT 3QXAB 4XMTA 1YEFH 5T1KD 1WFNA 5KYWA 2NYYD 5EPMB 4LSSH 2VN3A 3WFHB 4EI5C 3LH9A 2AEWA 4KKQA 3S3PA 1RUAL 3GMPB 1V8HA 3IDGB 5C0BD 4HJ0C 5HTSA 3BWUC 4G8IB 3PWPD 3MC0A 1Z2KA 1A6UL 2V2WA 4HSAC 5I5MA 1T1XB 4JRLA 2NXYB 4UU9A 3QVAA 4XN8A 4RLDA 3H2QA 1RZ7H 1W8OA 5F7YC 5D4QA 5TE6H 4L8SC 4ZX4A 3QEHB 3BDXA 2ENSA 3ARUA 1C5CL 1OB1A 2FHFA 3CXHJ 2ARJA 2YAMA 4I9XA 1UB5B 3SY0B 2HPOA 1IC5L 1NIEA 4L23A 3GJFA 1UJ3C 1JRHH 5EC2B 5FO9A 4FMKA 2OR9L 5G4OA 3BZFA 1WFIA 3MNVA 4P5RA 3WN5C 3OVUB 4TNFA 4DEPB 1TJIL 1CDIA 5C3LD 4A2MA 4H40A 1KIRA 3UABA 2VM3A 5ID1B 5I1GL 1AGFA 2JJUA 1IEHA 4GKNA 1CC3A 1X9RA 3OL2A 4YNYA 4LKXA 4KKZA 1CI3M 3U2JA 4WZ9A 2VIRA 1EEYA 1VGEH 4MJ6A 2PYEE 3PE9A 2FJFB 5CZXC 5E08L 1XD0A 4LCVA 1ZLUK 3LD8C 1CBVH 1LQSR 3DX9A 4KO7A 5F6IC 1YMHA 1W0YT 1WICA 4UV4L 4OFKA 4YHOL 4EVNA 5BRZD 2CJUH 1YN6B 3G5XB 4Z5RA 3Q6FA 2XPGA 4JHAH 1SPDA 2J72A 3S36H 5J06A 2Q86A 3ARXA 2UX6A 3BIBX 3Q9PA 5C0CE 2C7UA 4YE0A 3WIHH 4G43B 2HT3D 4WTXA 5EBMA 5DC9B 1MFDH 3JV4A 4OLUH 4JQIH 5L9DH 2EEBA 3QJQB 4QXGL 4TV3A 1A6VL 4NAQA 4MZRA 4AZ8A 2IH8A 2YXWA 3C5XA 4UT9H 3RLSA 3V0AC 4FQIH 1U8NB 2Z9TA 4GMTH 4X6DE 5L4JA 3DPDA 3T2NH 3GXMA 1PF3A 4N0UB 2A9ML 2QGBA 2NZ9D 4M5ZL 1HIMH 3L1GA 5AW0B 5C92A 5IB4B 4ZFZB 4AH2B 1YEEH 1ACYH 1JYNA 1UG9A 2UXGA 3QO1B 2FT8A 1MVYA 2FWOA 1IT9H 4CW1B 5KWYC 3HW7A 4DKFH 1HI6A 4AENB 2Y69B 2ZD0A 3QUXD 4RFEB 5F7FA 2JNZA 3OR6B 1UM4H 3NEEA 4K7PH 1OP5K 3P30L 4GQ9L 2BXZA 2CE6A 2FWUA 4F9PA 2YAQA 2VXTL 4Z7UF 1QSZA 1VENA 1F4XH 1NDGB 2QSTA 1WIUA 3DRQB 3LZRA 4LSTL 3FO1B 4OR1A 1ECZA 1HKLH 4NI6A 2ERJC 2FECI 4K8RL 1D6VH 5AAMA 1QAWA 3E9UA 5FFLA 1SJXA 2WJ5A 3O3EB 4FKEA 3ROLA 3VRJB 1DN2A 2NDFA 3L3OA 3R1GL 3CU7A 2IAND 4G7SB 3BUPA 4F8QA 4Z7UB 5BS0E 2Q8AL 5KBMA 5HYSA 4PB0H 4IOIA 4WRLA 3D85A 4OZ4B 1COBA 3N0PB 2WSDA 4S2SB 3ME0A 4F57H 5AAWA 5M95B 4XX5A 1UWGH 1S9XB 2R0KH 3QI9D 5D7IE 1ZLWH 4QI3A 5D70H 3G5ZA 4B9GA 1CLYL 3O6KH 1TYJA 3CUPB 4L37A 1YQ2A 4NFCA 1SMDA 2W8CA 4GP5B 3D3VD 2P47B 3HZ3A 4AEHL 2B39A 3RIKA 3CBJB 1TQCC 1I7TB 5H37G 5D1ZC 2C4FT 3MLZH 4OGXH 1WFJA 4X9BA 4YPJA 3Q44A 2ZTBA 3KPLA 1AACA 4APQC 4YSPA 1OP3H 2FEDD 4D0BA 4BSWA 4DVBA 3CFBA 3TFKC 5T1LA 2Z91B 1BA9A 4PJBA 4EBQL 5IHZB 1W8NA 4ZS7L 1JI1A 3HIZA 3VWJA 4E5XG 3RVVD 3EH2A 4FC3E 1WFOA 2ICEC 2Q3XA 4KVPA 4X8GA 4OLZH 1RLWA 1THAA 3WIAA 2PF6A 3KPRB 3L9YA 5EIIG 1RP8A 4GI9A 1GGBL 1TU2B 2P8PB 3BFQG 5EO1B 3U0PB 2IDTA 1FDLL 3HLKA 1T0NA 1OANA 5MENE 1KTJA 3UROR 2BCKA 1ZDQA 4YN3A 3II2A 4BHUA 3OJDB 5GJSH 4QRPB 2ZQKA 1FORH 1VFBB 4S1QH 1MHHA 2XETA 4FMVA 2DQEL 4ZQKB 4U1KA 4O00A 3V8CA 4GRWE 1O9VA 1UFGA 2FD6H 3D07A 3NEXA 4W4OC 3TZVC 4YDLB 4P5TD 4CVZA 2UZXB 2MFNA 3FB7A 5FYLD 1LLAA 1JGLL 4HPYH 3IU4L 4HCRL 2NTFB 1IKOP 1ODAA 4Y5YB 4YXKL 1Z3RA 2Z1KA 3PP3K 4Y16B 3MI6A 4EPSA 1JRHI 2EIZB 3CPLA 2CJ3A 4UTCA 2A6IB 4UQEA 2EJ1A 4XPAL 4L5FL 2OKMA 2E0PA 4CMHB 2Z3FA 4RFOH 1J8HE 4HIJA 4LSPL 4HUXA 4Z8FH 3VFPB 5FHAH 2W60B 1N64L 1AP2B 1CT8B 1WAAA 1EJOH 2BY0A 1VCBC 3IRZA 4KOBA 5IW6B 2VR4A 4JHVA 1CXLA 4OIIH 3TNMA 3CGTA 3TH2T 1YY9C 4N8CL 5HHQB 4K3JL 4L0ZA 1MFEL 3DO4A 1WITA 1X9QA 4BXSV 1XB8A 2OZ4H 3GI8H 3LS5L 4M7KL 3ZGIA 1U6AH 4BWWA 4WEEA 1VACB 2W07A 3B5HA 4MLSA 4AYMC 1KIQB 1VZHA 5E1AB 5F7KC 2AC0A 4QO1A 5D93C 5BV7H 4PRNB 4TNEA 4GW4B 5IBUB 4LAQH 1CU4H 4YBHA 1IBHA 4PLJC 4S10A 3LIZA 2DYPD 3MRKB 1NC2A 5INCA 4GW5A 1SY6A 3GB7A 3QFJE 4QJ3B 1QUNA 4F80A 4PQXA 1NIFA 2HH0L 5IB3A 2ZKHH 5JO5A 1HOCA 1ZJAA 2H32B 3ZUCA 4F91B 1ZY9A 5G5DA 1IJNA 1MW1A 4FQXC 3BRGC 4N9GB 2X4RA 2Q20A 1C5DB 1OOWA 4AQ8C 3M1BB 1IBYA 5AVVB 4UQBA 5GS2H 4PJXF 5JLZA 3P9LB 4A6YH 4LOEA 4XGZA 1NCJA 5F1IB 3QDMD 5F6HJ 4PLKD 3CQFA 4ZFOA 1EAOA 1B90A 1GAFH 1H5BA 1QSEA 4N2BA 4OCYH 4ESKA 2O61B 1TMQA 2CHZA 4KUZH 3RL1B 3CJJA 4NZRH 3MLYL 1BAFH 3OLDA 3KPSD 3EYOA 3LRHA 4JY6B 2IQ9H 3VI4F 2YHGA 3F6JA 4V1DD 2QMKA 1VHPA 1EK3A 1YEJL 1HL8A 3EJCA 4N22A 2X4SB 1ZGLM 1OCWL 4PJXB 1B0WA 5AL0A 3QSKB 3C2AH 1S5IL 4ORGA 5I5RA 5F7LB 1XGQB 3RJDA 2X4PB 4NI3A 2XKSA 3RB5A 1KYDA 32C2B 2X1OA 2YUVA 3VI3A 3VI4B 4UWQB 2VABA 1VA9A 2FJGA 2KI6A 4Q6YA 2PKDA 1RPUA 1B4JL 1VKXA 1EEUA 3HMXL 2EDFA 2LGNA 3EJJX 2K70A 4U05A 4HW6A 3MOBL 2IMNA 3CH8A 2MHAA 4FQ1L 1A7QL 2VSKB 1TTRA 2XZAH 4GBXB 3UTTB 4HIIB 1QVOB 1DLFH 2WCGA 4ZMZA 2Q0ZX 2I25N 4KI5D 1DO5A 4HWBL 4DGVH 3SPVB 5IOKA 4R7NB 1SVZA 3FPYA 4N2NA 5A6MA 5I8KH 5IHBA 3BKCH 3S88L 1L6XA 4LSRL 5CMAB 5EPMA 2NYKA 3B9KB 4EQ3A 2Y06H 1LWRA 1H3GA 1PZAA 3SDAD 3IDGA 5AB9A 2F5AL 3LXAA 1JIBA 2DYRB 3GMQB 4HISA 2BZ7A 2K4WA 3TO4C 1RIHH 3ARGC 1P53A 1EHNA 2AQ2A 3JV6A 5KVFH 3GRBA 3OMZA 3QEHA 5T3XH 3VFUA 3VXME 1U8MB 1W16A 1K72A 2X3BA 3ESPA 5LWYH 3NCYS 1EUTA 1QNZL 1AC0A 3SJVD 1F4YL 4F3FA 3FU0A 2JI2A 5SWZB 4HWUA 1WK0A 1OP3K 5MHSD 3B6SB 5EC2A 3SO3C 1JFQL 1IGCH 5JPMB 5FYLL 2ZOKB 3DVIA 4U1MB 1MCKA 4KKPA 3X14B 4LQ1A 3X3GL 2IH1B 1RHFA 2GK0B 4V2CB 2F54D 5I75C 4EUPG 4OKVA 5ID1A 3LKRA 1PBYA 3QXTA 4QWWC 5KYNA 4NJAL 4OBRA 3CN2A 2CIKA 3NACL 1E6OL 1NFIB 1J0ZA 2DD8H 5ICXB 2OI9B 5T5FL 4DHLA 5JHBA 2VXQA 1TYRA 4TVSa 2R4RH 3MV7D 1NANI 2NXZD 2Y5TB 4MMXB 2ADIB 1P1ZB 4OJYA 1R4XA 3EOTL 4A2EA 3MRIB 4CVUA 3OPZH 1JZ8A 1IFGA 3G5XA 2V5TA 4RGNC 1KY6A 5JQ6H 2Y36H 1EJ6A 4J8QA 1I3VA 3OAWA 1NUGA 4G43A 4P2OB 3LKOB 3VO0A 4LPVA 5G4MA 3F62A 2R0ZL 2AK4E 3NFPB 2MPVA 4RCAA 1R3IH 4KJQD 2J44A 4N2EA 2XVLA 3EDEA 5AW3B 4I2XE 4FQ2H 1URIA 3ZMRA 5D7SH 4AK1A 5E24E 4WO4D 4POYA 2WYHA 4DKDC 1XEDA 2ALAA 2G9KA 4J3SA 4U1JA 1KJ3H 1U8NA 3CFEA 1AO7E 3L54A 3VG0L 1MLBB 2HFGL 2LTQB 1DBAL 3DK0A 5HDBF 4NDMB 4MYWB 3GBNL 2GBTA 4X4KA 5IB4A 4ZFZA 4JAMB 4AH2A 3U4EB 2EIMB 3DURB 3LNIA 4R8WH 5E99L 7PAZA 1T4WA 2X12A 4ETYA 3TGXA 3MGTB 4GAJH 1F8TL 4HP5A 4AENA 4DUVA 2DWDB 4HG4J 4RFEA 3HPLB 2MEJB 2XBTA 4FFWD 3ULVF 1WD8A 2FX7H 1XSOA 3K2UH 2VDNH 2VLKE 3L4XA 3OR6A 5HDBB 2QADC 3OKLB 3DV4B 4PJHF 1JZHA 4P2CG 5ANMB 2VWEE 2X2YA 1NDGA 4LSQL 1G7IA 2GIYA 3DJZA 5D8JH 1P4UA 3FO1A 3BVUA 2FX8L 3GSNL 3OZKA 3JV0A 4L1LA 4F37K 4F58L 1EO8H 2E76C 1JPSL 4OCLC 3PWNB 4IIZA 1H9VA 1EDYA 1T2JA 4J4PD 2WXPA 5IMLB 1BF8A 4NKDB 3TJEL 2E9GA 5B1JA 4PTTB 4XP4H 3WS3B 5ADOL 4M93C 3EZJB 5DC4B 3WGUB 3P4NB 4DIXA 4LOVA 3WL9B 3MXVH 5CLZA 2XY1A 3AY4C 4NQEA 1N5AB 4OZ4A 3SE6A 2NW2B 4DKTA 2WLMA 4NN6B 5I6NA 5FYJH 4JFZH 1NMAH 1S9XA 4L4VD 5GGVH 4JPQA 3VJ6B 5DC2A 2WVUA 4KMTH 3RU8H 1UXWB 2LOEA 2VLRE 4B5EA 1E28B 1CMOA 2I5YL 3RGBA 1D2OA 1DANU 2XCMC 3CUPA 3UJJL 2XQYG 5C0IB 3CXFA 2IWEA 4IGBD 5IROA 5I1JH 1N6QH 4M1GL 1I7TA 2RFXB 1YEFL 2RTTA 4G1EB 1C9SA 3DXAE 3T4YB 1JZ6A 2YZ1A 4P49A 4LSSL 4IKLA 1N4XH 2BNUA 2Z91A 4FJ6A 4WGVB 3GRWH 2XFGB 3IJHB 5LBSH 1YCSA 1INQA 4PP1D 4IBSA 5I74C 4ZXBC 3HI6H 3LKPB 3WKQA 1LHZA 1H6FA 1RZ7L 5I9QB 1M2OA 1PY9A 5EU7E 4EF3A 5TE6L 5E2JA 4H0HB 3MLVH 2GFBA 4YK4B 3JTBA 2D3LA 3H56A 4KVNH 5AOKA 5KBPA 1E2WA 3GLDA 3TN0C 5KYXB 2AF2A 2P8PA 5IJVB 1JRHL 3DMMC 3U0PA 5IGXH 5LGHH 5J6GA 1BPVA 1GSMA 4BCYA 1I8IB 1U36A 4QRPA 5EEXA 3F64A 1VFBA 2DQTH 2OJEA 3DBSA 4N2IA 4ZQKA 5DS1A 3MGOA 4ZDHB 2DTMH 4IRJC 1S9WB 2Y0SA 5KZCD 4X2UA 5HI3D 2IQAA 2P5ED 5IHWA 3NA9H 2LABA 2WBXA 3TVMA 2NTFA 1DJXA 3EJQA 2QELA 1VGEL 3AY2A 4Y16A 3V4PH 3BVWA 2BSSB 3I9IA 3KH3A 2EIZA 3LEXB 1PD1A 2ZZUT 1G6VK 2A6IA 1CBVL 3TESA 4PRPE 3TYFB 2WVVB 4P46C 1QHOA 4FABH 2CJUL 4BFJA 2ICWJ 2W60A 3NA4A 1TJMA 1EO5A 1MCNA 2VNCA 3CE1A 4JHAL 4LLYB 3RWCB 3S36L 4W6YB 5IW6A 5IJBC 3WIHL 4FD0A 2AV1B 3D39B 5HHQA 1MFDL 4GMSL 4OLUL 4TNGA 4JQIL 1QFWH 5L9DL 4MKMA 3BUIA 2W81C 5DO8A 1IM9A 5DZLA 1S7TB 3BQUB 2XIDA 4X5LA 3L1FA 2E8YA 2NY2D 4UT9L 5IUCA 1KIQA 4FQIL 4WK2B 5E1AA 1A21A 3ZVVA 5KVEE 4GMTL 5FKPB 2BIIA 2V3EA 4JFVA 4HETA 1D7DA 3ZK0A 1JDDA 5ERWB 1HIML 1NWPA 5FF6B 1D9KD 1YEEL 5DCCA 5KOMC 1ACYL 5FUZH 3VVVA 5KBLA 1IT9L 1NA8A 4DKFL 1BZQK 5C9JA 2FDBP 1BQRA 5T1DH 5E4OA 2KL6A 5JDSB 1UM4L 4K7PL 4LCCA 3M1BA 3IXAB 7TAAA 1V3LA 4XO8A 2LW3A 4F7CA 1RLBA 4GQZA 5F1IA 4OLYH 1NGXB 4JKPH 1F4XL 3EJUA 4XX1E 2DLTA 2O61A 5DUMH 1UM5H 2RALA 2JTYA 4HAGA 3KMDA 4R7LA 3RL1A 2MTAA 4ZS6C 8PAZA 1HKLL 3I6GB 5KG9B 1D6VL 2IPKA 3IGAB 4WI7A 4JY6A 5GS2D 4Y7OC 4ELKA 5IG7A 1YC7A 5AVSB 4U6VH 3QYNA 1N6VA 5F3FA 3HUJE 1YYLH 2X4SA 2H3XC 3N40F 2Y7NA 4AM0Q 3IWVA 4PW9A 3VRIB 5F0LB 4P4KD 4WENB 4PB0L 1JV5B 4QAMB 3S8WA 3MUZ1 1NCIA 2X4PA 2XN9D 4F7TB 5EDSA 5FO8A 3UBXG 4V2BA 4ORZC 3VI4A 1KWKA 2QKIB 4F57L 3CX5K 1G7HA 1UWGL 1HAUA 2R0KL 5I71C 3LPPA 4NQVB 4NQXA 3VU1A 2C4XA 5D70L 3W0WA 3O6KL 1B6UA 2EO9A 4YH6A 1KXHA 4KK6D 3DYOA 2OMXA 5D1XD 4GBXA 4WUUE 4ZSOB 3KWTA 2X1QA 1QVOA 3D8MA 1VPOL 4OGXL 3MLZL 4M4RB 3H9YA 3E1F1 2VR3A 5BZWB 1K8DB 3FT2A 3FTZA 2IWKA 4FLQA 4OF0A 3I75B 5CMAA 5F9DC 1HS6A 3ZKMD 4ODVH 4JRYD 1IAII 3CLEH 3FQUB 5C0BB 2DQFB 3PWPB 3GMQA 1HH6B 2NY6C 3ECWA 3BYYA 4NIKB 1EVUA 4Y19E 1U95B 2HJFB 3SDDC 1HL4A 3EUDA 1KB3A 2D0FA 1K85A 5FAAA 2WZ0A 4X6CF 3I85A 1U8MA 4GRLC 4OLZL 1PIGA 3SCMC 4W9HC 1KV3A 3BLBA 3DI3B 5FGCE 3W37A 2RHEA 5CJ8A 2JIXD 4AGPA 4JCMA 3B6SA 2GBUA 2WBWB 1KJMB 5T3XD 3PYCA 1GGTA 1TXKA 1YQVH 3TPUB 4U1MA 3X14A 5GJSL 2IH1A 4X8CA 1FORL 2GK0A 4S1QL 4F8TA 1G4MA 4S1DD 1VZGA 1I1FA 3FU3A 4Z3EA 2HTLC 2FD6L 1D7FA 2HTKD 4UQCA 3WMPA 4HPYL 4BK4A 2FRGP 3UP6A 1W0WB 2EYRA 1OGAA 1FYTD 3PNWA 4OFYD 2M1KA 4WW1A 1CWVA 3UO8B 1F90H 3MLSH 4JM0A 4XNZB 3GMLB 1KGCD 3WXVH 3D12B 2YPVA 3AS1A 4DEUA 5EUOA 4BRJA 4MMXA 2ADIA 2B59B 2FGWH 1KXTA 3FUJA 2VC2H 3JWOH 1SFDA 3PL6B 4LVOB 4RFOL 4Z7QB 5BRZB 2JB6B 4Z8FL 4JRXE 3POCA 2DIAA 3QRBA 5FHAL 4AE0A 4HHWA 1EJOL 1G7MB 5ID0B 2ZPKH 3RDTD 4FA8A 2AFNA 4OIIL 5FYKH 1B2WH 3EDDA 3HAEA 4P2OA 3LKOA 2P52A 2C3HA 1GW0A 1PVHA 3NFPA 3R0MA 4I0PA 3U4AA 3Q3GB 3VFSB 4YL9A 3J7HA 2OZ4L 3GI8L 3NPSC 3DSFH 4U3XA 1J8SA 1U6AL 2DWSA 1F0LA 2FBJH 2A6KA 1KB5H 1IGTB 3FCTB 3H42H 3BE1H 5BV7L 1MLBA 1Z6JT 3CHQA 1WWBX 1CU4L 1ZHBB 3DUUB 3Q8BA 4LAQL 1F3JB 1JHKH 4HS6B 1NUNB 1BEYH 5J12C 4BUGA 2ZKHL 3QG7H 3MGTA 1RKRA 1J0YA 3NRQA 2LQRA 1IC0A 2F74A 3JT2A 5E8NA 4IDLA 4M29A 5K1VA 3ESOA 4Z7VE 5CILH 3RZCD 2XACC 3HPLA 3BXNA 1WS8A 3U7YH 4A6YL 2JF1A 3OKLA 4MWFA 4PSRA 5ANMA 3C08H 1WS7A 1GAFL 3OAYH 4OCYL 4DO5A 1L9NA 5LNGA 4KUZL 3AACA 3APFA 1A1OB 2X88A 4NZRL 3C5JB 5FKAA 1BAFL 3P0GB 3SB3A 5D1QE 5HYJE 4E0RA 1UZ8A 4E5XB 2IQ9L 3AREB 1SMOA 2P8LB 2Q5BA 5E2VH 4BUHA 3N55A 3K6NA 2IANB 3T0VA 3MRRA 5IMLA 1Q8MA 3FHQA 2ZYRA 4NKDA 1NBCA 4PJHA 4X4ME 4PTTA 3C2AL 4XPTH 1R17A 5HSFA 2BP8A 3OBAA 4OLVH 5EIIB 3P4NA 1WC7B 1JBJA 3QEQE 4N2HA 1U42A 1N5AA 3KXFE 2NW2A 1Q9OB 4UOZA 3NIFF 1P9MA 5L0QC 2BMKB 1LMKA 1BF2A 3QI9B 4H4NA 2K8MA 3VJ6A 4WI3A 4LXFA 1RK0B 1MCPH 2Y7LA 1R9FA 1N18A 2EDDA 1N19A 1E28A 3UO1H 1LK2B 3K4DA 4LEEA 1CCZA 2LU5A 1PNDA 2A4EA 2XZAL 3D3VB 1EDHA 2I85A 1DLFL 1WE5A 5FYJD 3VVWA 2RFXA 2RR3A 4FQHB 4CBZA 1J1PH 4U1NB 4DGVL 3KS0H 3NIFB 4G1EA 3ABMB 4X9HA 5I8KL 1BJ1H 3T4YA 3QYMA 6TAAA 4NT6B 2Y06L 3VSVA 5F7UA 2QFRA 1IIKA 1IAKA 2YEVB 3BJLA 5I1DB 4WIQA 1ZD6A 3IJHA 1BD2B 2HG5B 4MYPA 1A5FH 1LEGA 3H4FA 4GXVH 1RIHL 1J12A 2NCMA 1AD0B 1OE2A 2WZ5A 2WSKA 4WI4A 4Y4KD 2IOOA 5T3XL 5KVFL 4OGAC 5MI0C 4BQ9A 4ONHB 3US0A 1KLUB 3F7RA 1JWMB 1LP9F 1Y1DA 5ECGA 3IJEB 3ZDYE 2LT9A 2FATH 5HI4C 5KSUB 5KYXA 5CEZH 3GTNA 3VDAA 1IGCL 3PHOA 4W9FC 3DLQR 2GJ6D 2X4UB 4CN4A 3OXSB 3NZ8A 1HH9B 1RK7A 1ZGLB 4ZDHA 2F53D 3QPQD 1UENA 1S9WA 2ZXAA 4N8PA 4Z77B 1ZRUA 3MJ9H 4LEOB 4P5TB 2EEAA 5LVEA 1D7CA 1LP9B 4ZNEA 4QRFA 4KOCA 2BC4B 3CU1A 2ED9A 3QDGD 1PKQA 3TPKA 3DHPA 2MNWA 2BSSA 2R4RL 3NCYP 5F9WC 5I0VA 1UWYA 4ADJA 1XH1A 3DETD 4GP8B 4UIMB 1FGNH 3TYFA 1T5XA 4OZGA 2DLIA 3PGCB 2VJXA 2JXMB 3OPZL 1IC1A 4KHTH 4BRVA 3KBHE 4Y4FD 1FZJB 5JQ6L 2Y36L 3EW3B 3RWCA 5EF3A 2BSBA 3X1BA 3F7QA 4GAAA 1BMZA 2AV1A 4IOFD 4PI0A 1JI2A 5CGBA 2CJTA 5K93A 4ZX5A 4IOSD 1BECA 1R3IL 3CC1A 1VSCA 4BV1A 5LGJA 2OMTB 3Q05A 3FN3A 1OHZA 2ODHA 4FQ2L 4A2GA 5D7SL 4U1HA 1EX0A 1I1AA 1S7TA 3BQUA 4QGYA 4F7MB 3QAQA 3KR3H 2FO8A 1J0JA 4P04A 3BVNB 3COOA 1KJ3L 3GS7A 2PW1B 4PHZA 5DD6B 5FKPA 4UAHA 1OSEA 1PG7X 5DYOA 2PO6A 3IT8D 3SSGA 5ERWA 2DYPB 4U1GC 1RXLA 3PV7A 2P48B 3QJFB 4IRZH 5FF6A 3DO3A 3FUEA 3IDNB 1KZQA 1R34A 1ZT4B 4L3EA 4R8WL 5DQJA 5F8QC 4GLRI 3P4OB 1CGYA 4OZHA 4GAJL 4P2QD 3ILEA 2DLFH 1GTFA 3TCXA 5L8KB 1GS6X 4MDJB 4N2MA 1AGDB 3FQTB 2FX7L 3K2UL 3I9GH 3QWNA 1T2QH 5JDSA 3IXAA 2XPYA 5CN3A 4MNQD 3QDMB 1NGXA 3ALXA 5JIDA 5D8JL 1JK8B 2YFOA 4I3SH 1LO0H 3UPAA 5I16B 5KG9A 2ESVD 1DVTA 3GK8H 5DGRA 3UIZA 1EO8L 3IGAA 4IJ3B 1DEEB 3L3OC 4V1DB 2VDKH 5J13B 2FBRA 3MLXH 2I07B 4JGNA 4R97B 3WY1A 1LGVA 2VLME 3FUHA 1IEBB 1NMCC 3NQIA 3GSNB 1WYJA 1S7XB 4XP4L 2VLJE 5I0YA 2E56A 3DKHA 4KMLB 4MA8H 2I7SA 3FRPG 1VEPA 3KYAA 3MXVL 5BJTB 4KI5F 1EERB 5AAWC 5T8IA 2AJYH 4NQCE 3SDXF 1IMHC 2QKIA 5D5ME 4M6NL 5FYJL 4JFZL 1NMAL 4Q0XL 1EAQA 5GGVL 4NQVA 4KMTL 4EUPB 3RU8L 2C26A 4L9LB 1KF9B 2ZXDA 4XB3A 3C5SB 1JNJA 5E4EB 1A47A 2DWEB 4OD2B 1ADQH 1F5WA 3OLEA 4G5AA 2Q76B 5HVWA 5I1JL 5DJYB 1N6QL 1UZ6F 5M94B 4JANA 1DQLH 1Y6NR 5T1KA 3SDXB 5KS9F 1ZVHA 4KX9A 3IYLW 1G1CA 1K8DA 1PD6A 3PCYA 2GIXA 4O5LH 5CHNB 3HEIB 5DHMC 1YLBB 1N4XL 2V7HA 1FG2A 3SDAB 1H6EA 2RQEA 4E9VA 2FZ3B 3GRWL 1IILE 1SVBA 3TTYA 2DQFA 5LBSL 4DESA 4N6RB 1JZ4A 1MIMH 6PCYA 4Q97A 1A3QA 2QVIA 1O7DE 3VWJC 3HI6L 1XX9C 1OAKH 4H2CA 3BDYH 1HNGA 3KGUA 2GG1A 3ELAT 1U95A 1BIHA 1QFWM 1JG9A 2ALWA 2GJZB 3OHXA 4LPCA 3VQ2C 3MLVL 1Q9WA 5KS9B 3FTUA 4KVNL 2G2NA 5DHXB 3SJVB 2F2HA 4UOJA 2Q9OA 4R4FH 3CC5B 2UYLB 4X5WB 2ZYHA 4G42A 1PAMA 3JZ7A 4B60A 2C34A 2L7QA 3GM8A 4X9FA 1KJMA 5IGXL 3HC0A 1PZ2A 2GJPA 4Q74A 5LGHL 1T0MB 1XZWA 3TPUA 3D69B 3B37A 1RHHB 2IAAC 5DA0B 4FNLH 2DQTL 2F54B 4UM8B 4WI2A 2J6EA 4X6CA 1PMYA 4TVUA 1A1NB 2DTML 4NNYA 3ZL1A 3AWFA 4X4YB 3K72B 2QLYA 3DUSB 2FL5B 4D9RD 1FAIH 3RNQB 3V0IA 4A7QA 3NA9L 2BLFA 1U2CA 5DJDB 1W0WA 3ATDA 2XU9A 3MDJA 3V4PL 4KK9C 3WXWH 4GUCA 3MV7B 4ANXA 3GMLA 4QY8B 1IAMA 2NXZB 4PD4K 1NEUA 2XT1B 5DMJB 4JFTA 4TSBH 4ENZA 1LEIB 2B59A 4HK0B 4HCRA 3QEUB 5BRZA 4FABL 2JB6A 2V6HA 2LAAA 1SRDA 3T8MA 1G7MA 3US9A 2J1KA 5J89A 3TJHC 4K3HA 5ENWB 1QRKA 4XB8A 4GUQA 1SXNA 4PRHE 4I3RH 4LDEB 1OF2A 2HCZX 1OGTB 1GR7A 2PW2B 2UWEE 3BD3A 1QFWL 4FLRA 5F97E 3BMWA 3QJXA 5FUCC 4WO4B 3DBXB 5EUKB 5DMKA 1HL9A 4KKCC 5FYKD 4Y2OB 1IARB 5KSBF 2UX7A 3DX6A 4XT1C 5FB8B 4FTVD 3NJGA 2XTJD 2F6AA 3FCTA 4X5QA 3RY5A 2WWOA 2YK1H 1DQKA 3DUUA 1WWAX 2CKBH 3QZMA 2ZONA 1F3JA 2WYZA 4PRDA 1REIA 2QPSA 4HS6A 1E3ZA 1KGUA 3MCYA 4Y4HC 1BQHA 4F33B 5FUZL 4XXWA 1HCVA 1S7VB 4U1SB 4OB5L 2IDQA 4K5PA 3MQIA 4XBPB 2DB8A 3VGDA 5T1DL 5EFIB 5HPMB 4OFQA 3QUXA 5GJTH 3ARPA 5EDXA 2AZUA 5E7FA 3HE6D 3S37X 4XNMB 2OPCA 3VXSD 1ND0A 2BZDA 2MKLC 2ZXCA 3EBGA 4LGPB 1QATA 3A22A 5IFAH 4KNUA 4OLYL 4JKPL 5CP7B 2G0KA 4F8LA 5JHDB 3QPKA 3DPBB 5DUML 1UM5L 5D6DA 1JNHA 5AVQB 4PV9B 4L3AA 1JF6A 4XBMA 1QW9A 3F2LA 3QIBA 3C5JA 3RUGF 3QDJD 1ZLDA 4ANKA 2P8LA 3O6FD 4CVXB 1E90A 4D9QE 5E9DD 4U6VL 4E42B 2IANA 1YYLL 1WCBB 3PIQB 2APXA 2GUOB 3OKDB 3BWZA 3IMBA 4NBYB 2BSRB 3WNJA 4AIEA 2G5UA 6FABH 5EIIA 1A1MB 4QOKE 3RBGA 2CR3A 1GYAA 3CFUA 1WC7A 4UAOC 1UA3A 3T3PE 4JO4H 2A4CA 3NK4A 1Q9OA 4OM1H 3X11B 5CR1A 4KNSA 1UYWH 3ECBB 2X2HA 5EN2A 4MNGB 2BMKA 3T4AA 1NGPH 2V5RA 4HGMA 4L4VB 4P3CH 3BPOB 1G9EA 5KTEH 3UZQB 1GZPA 1FHGA 1RK0A 3REWB 5KSVB 4QRAA 3X3FH 1LK2A 1ZHNB 2YPKB 1JSYA 1IU1A 3OAZH 3D3VA 4IGBB 1J05B 2VITB 5I73B 2P24A 2ZX9A 2VSCA 2O93L 4PJ7F 4FQHA 5ANHA 5TH2A 1O6VA 4JFPB 3PV6B 3CBKB 2H7WA 5LAPA 2NZIA 3IPFA 4NT6A 4C4KT 3OKEA 1HJCA 4DO6A 4ODVL 3SHSA 1A2YB 3CLEL 5I1DA 1S9KC 3CVIH 4HWBA 4WWID 2DH2A 5DI8B 4M6AA 1XGRB 2CMRH 3ZTDC 3FN0H 3VFMB 3VX0A 3MJ8A 4HJGB 4PJ7B 3HC3H 5C07D 4P0DA 3JWNC 3SEPA 2NY0C 2D0HA 1UT1A 1GGCH 4Q89A 5F88A 1JWMA 4HXBH 4QKXB 1WBYB 5KSUA 2V33A 4LBAA 3CVDA 3VGGA 5J6SA 2G30A 1YQVL 4ONGH 4DEPC 4R4BA 3CHSA 2G5BB 4Q4EA 2ATKB 2X4UA 3NZHH 3QXDB 3OXSA 2VSDA 1URLA 1HH9A 1ZGLA 3P0YH 3L7EB 3S3CB 5CEZD 3T9WA 2WTPA 1X5FA 3WMQA 2R39A 4P5TA 4RGMB 1LP9A 4LNRB 3CWGA 4WI8A 3LIUA 1A3RH 2BC4A 3FT0A 4M9PA 4GG6E 1YJDC 1INEH 4HK3J 3VB9A 4ECNA 3CG8A 3BZDA 4P9MH 3V4VH 2MQ3A 2J2ZA 1F90L 1TNMA 2FO4B 3MLSL 3MMEA 4AV5A 3WXVL 1QWHA 4UIMA 1J18A 2YLHA 2F68X 2FGWL 2KKQA 1EVTC 2VC2L 3JWOL 4PWIA 3PGCA 2Z8VC 4OTXH 3BSZL 5C08E 5T5FA 1FZJA 4NN5B 2HJKB 5KJRH 1BPLB 1NFDE 2HKAA 2ZPKL 1E50A 3VMOA 1P6WA 2BSEA 2NW3B 4CSPA 1UTDA 5FYKL 1B2WL 1AHWB 5C3TA 3AU0A 3H85A 5AKVA 2PXYD 2QSVA 5E8EA 3QHTC 5F8RC 3UTSE 3DX2A 4LLVB 4K0OA 1E40A 2NY2B 3RI5K 2FBJL 3QWOB 3UBXB 4QUOA 3H2WA 1NAMA 3LZFH 2PW1A 1I8MA 1KB5L 1NUFA 3H42L 4K94H 3MA7A 3BE1L 5CU5A 3UEQA 3NMEA 1FVDB 1X5KA 4PCSA 2DYPA 1JHKL 5LGKA 1T89C 1D9KB 3OXRB 4N20A 2TSBA 4OFIA 2NRDA 2X4QB 3FRUB 3V0VB 3IDNA 1BEYL 3CLWA 4QHMB 2X44D 2P5WE 3AS2A 1J9QA 5FHBH 3P4OA 3QG7L 3K0WA 2VN7A 2DKUA 2XX1A 5BV7B 1NDTA 1B88A 4NQDA 5CILL 2AGJH 3G08B 3BZ4B 4BA0A 4F2MA 4RNRB 1AGDA 3FQTA 3U7YL 1W9XA 4KJYB 1P4BH 3WFEH 3LXUX 3C08L 4GB9A 4NQTA 1WO2A 4CJ1A 5C0FA 1RIVH 4U3SB 1D5BB 5JORB 1JK8A 4HU2A 1KBGH 4K71B 4RX4D 2X4OB 2WXQA 5DK0B 3VRLE 2Z31C 3KPSA 3W39B 2XY2A 4I18A 1UFUA 4A6YB 5HD8C 4XPGH 4FNTA 4OJEH 5E2VL 4HQQH 3LHAA 2I07A 4TF4A 4Z76B 1AYOA 4YLQT 1KJ2H 1IEBA 1IL1A 3GSNA 3HCVB 1YZZA 3BD5A 4P4KB 4BZ1H 4XPTL 3DSNB 2ARJQ 1H19A 4HVBA 4OLVL 4JPSA 5J6HB 5BJTA 5ITBH 3AS3A 2XN9B 3DC0A 1L0PA 1CI5A 4KXZI 4GEIA 1IBBA 1YMMD 2X0UA 3Q2NA 4KWUA 3VE0A 3APNA 5JXED 3EH4B 3F6IA 3TBSA 1B3JA 1H3TA 1S3KH 1MCPL 2EDXA 4JEGB 3ZGHA 2QGDA 5IREA 5DK2B 3UO1L 5K9KB 3FONB 4Z3TA 5D1XB 5FM8A 4M1CD 3BVXA 1Q72H 3ARDD 3ATFA 2ZSVB 3K6DA 2BO0A 4NC0B 3W11C 5DJCB 1NPJA 2XYBA 1J1PL 3B2DC 2P4AB 3SDXA 1KWGA 3L3IB 5CR8A 1CDBA 4EIZC 4Q4IA 3WD5H 2FZ3A 2OJZH 4PYGA 3X1EA 1XO8A 2JMRA 3K5SA 2WXNA 4DZ8B 1CL7H 1A5FL 1A9BB 1X5JA 3MRCA 4EI0A 3INOA 4GXVL 4BH7B 1DCLA 1GPOH 3JV5A 4LGRB 4MJ4A 1XF3B 1RJZB 4UOQA 3ALPA 4LVHC 8FABA 1KLFB 1ZTMA 2WTRB 4GAGH 3SJVA 4A2LA 1GVIA 5L2KD 2CUAA 1KBPA 2FATL 3CC5A 1ORQA 2UUDK 2XC8A 4HV8B 2DH3A 2JIXB 2Y23A 4X5WA 3V6OA 5CEZL 3OSKA 5IESH 2X9WA 4AKOA 1XAKA 4PJ9D 4LPTA 3IDYB 4IBQA 2W0KA 1T0MA 3EH3B 5J8OA 3D69A 5EC1B 4IK6A 4W9KC 2WCSA 5GZND 2VR7A 4XBGA 1NWOA 2F54A 1TKWB 4UM8A 2WKOA 1Q4NX 5GSRA 3BJ91 5HHMD 5EU5A 4MMZC 5DLMH 1A1NA 2I32A 3BCDA 3KPQA 4X4YA 5KSAC 2ZX8A 2CDGB 3MJ9L 3K0YA 3DUSA 4RFNB 5DVOA 3RFRA 3TVMC 1I3RB 3BLKA 3RNQA 3EDKA 4C4KO 2J3SA 3O3AB 2MCG1 2CRIA 2HP4A 4JKWA 2QVTA 5DMIH 1MWAH 1FYTB 3UADA 3CVBA 3OLGA 4JFFD 3SKNB 2ZNWA 3HRPA 1KEMH 1PCSA 2CM5A 2MMXA 3PHQA 1FGNL 3W2DH 1IE4A 1WFMA 5IMMA 3H6JA 1DO6A 3ZZ1A 1AQHA 3LDBC 3QEUA 2Y1VA 4AMKH 5K59E 1G7JB 2X41A 5I1KH 3RDTB 2FQFA 1TPXB 3BT2H 4YDZA 3T3ME 4P2RD 5ENWA 4N5ED 4QEGA 3LKNB 2COQA 2EVGA 2O6DA 4RETB 3EJPA 4NENB 1OGTA 2Y4SA 2CR6A 2FWLB 2PW2A 3MBEB 3NCCB 3OHMB 2F15A 3RVUC 3GMNB 2CBTA 2ZUXA 2Q6WB 3WIHA 3DBXA 3B2PA 1YO4A 3KR3L 3KVPA 5GRJH 1FZOB 2J8UF 3KWXA 4Y2OA 5DMGD 5I6MA 3ISWA 4XOCA 1HEZA 5DO2D 2O6EA 4RMTA 3RZWA 3H9HB 4IRZL 4HC1H 1XCQB 4UT9A 4NUPA 3PGFH 1CGSH 3SE3A 1ZANH 5E8PB 1S7VA 2XQYA 4D7PA 4KKAC 4GKOA 4TUUA 2DLFL 3BAYA 4XBPA 4N2DA 1SDYA 3VXUA 4L48A 1MFMA 5EFIA 4LCCC 2J8UB 1NFAA 3RZCB 5GGSA 4AUYA 4BM7A 2IDFA 5KSBA 4A66A 2AQ3A 4RZCB 4XNMA 3TBTB 4ELME 3I9GL 1T2QL 1RCYA 3FTXA 2EKSB 4N2OA 1SOXA 2EUWA 5CP7A 1CPUA 3NK3A 4WCYH 3SZ6A 3DPBA 1WRFA 4BUQA 2WQUA 4I3SL 5D6CB 4ZUVB 4NGHH 3GK8L 1EAJA 1T22A 4E41E 4AUJA 3RTQD 1BF5A 3MO1A 2VDKL 4CVXA 3MLXL 2DKSA 4OV6F 1KN4H 1ZK9A 4J4PA 2RAMA 1WCBA 1X4XA 2A99A 2A3TA 3FBKA 2QQKH 5E6ID 2GUOA 2Y6SD 3QB7C 3OKDA 1PEWA 4POZC 15C8H 2EQDA 1U58A 4MA8L 4Z7WF 2MRYA 2X9XA 1I8AA 5EU6E 3X11A 5BXFA 3ECBA 4KJPC 4U6YA 4D0DA 3RUGA 3EJZC 4MNGA 2O6PA 4L4VA 2H2SD 3CFKB 2LHAA 3OV6A 4JY5H 4FEIA 5E8OA 1IC4H 1AZNA 4ZUTB 3REWA 3ZIYA 3V79C 5IOPB 3GZPA 1CYGA 2UXVA 1ZHNA 2YPKA 5CD5D 5KYUB 1O6TA 2BNRE 1ADQL 4IGBA 4Z7WB 2VITA 2CA3A 3ZE1F 2YD6A 2HXAA 2K45A 2X05A 1DQLL 3IAQA 1PJWA 1CTNA 4GKSB 4R4ND 2W91A 4MQTB 5H35B 4O5LL 4LHUD 1YEDB 2K9FB 1U4FA 1BIIB 2KQNA 5C0EB 3VG9B 3B2MA 5MERB 2NQCA 1MIML 2BHYA 4NZTH 1SXAA 2ZCHL 4OCSH 4NZFA 1S7UB 1OAKL 3BDYL 2UVEA 3ZE1B 2OX5B 2H8PB 5F7DB 1JPST 1EGJA 2GSMB 1FHNA 3MRHB 4NRZA 5AD0B 2YJQA 3GD1C 5GS1A 5I18H 3BO8B 4Q9RH 4R4FL 1GGYA 5I0WA 4QIRA 2VERN 3TH3T 3AGVA 1IV8A 4F9LC 4HMCA 4GSXA 2GJ6B 3WCYA 5A1AA 5I8CA 4ALAH 3EFOB 4Z7IA 2ATKA 1MZYA 4LFHD 3QXDA 4FNLL 1M3IA 1UJTA 2R1XA 3C9NB 4YPGB 2F53B 3AROA 2YFNA 3L7EA 4JUTA 2W38A 1FNAA 1JMZA 1X7SA 5B21A 2P5EA 4MXWH 4LNRA 1FAIL 2OI9C 1JYVA 1HSAB 3QDGB 4N86A 4GIAA 1ZTXE 4EKXA 2BY1A 5C0CD 4Y1AE 3WXWL 4JO8A 1C8PA 5FK9A 2BWIA 5TQ0H 4ODWB 3ZHKA 2FO4A 4OFVA 5B3NA 2PPDA 4MMXC 2NY5H 2R2HB 4XVJH 1RJYA 4LHUG 2V17H 2GY5A 4TSBL 2XG4B 4JUSA 4PWGA 1I1YA 3BGMB 5C8JA 4Y4FB 4YFEA 3V4PB 2VZTA 1ZXKA 1A7BA 2EVIA 3CSTA 2YEZA 2NW3A 1AHWA 4I0PC 1FO0A 4I3RL 1MG3C 3GO1H 1AZVA 4JFED 1KYFA 4ODSH 4EXKA 4MHHI 2V2XB 3UAJC 4LLVA 3IKCB 3TA4D 1YPZE 4B9PA 3VFTB 3QQ4B 2IWFA 2Y5QA 1OT4A 4FLHA 3N2JA 3LZPA 3QWOA 5EZPA 1ZV9A 2DWTA 4XCYA 3U83A 1KCSH 1BLIA 1NEPA 1U3HD 2DEXX 2IDCA 2YK1L 2E86A 4RMSA 4LFHG 4FAAB 1KPVB 2CKBL 4LPUA 1QRNE 3MNDA 2A1WL 3O3DA 1D9KA 3OXRA 4P05A 3D2TA 4XH2B 4FN0A 5HDOA 2X4QA 3V0VA 2F0CA 4QHMA 3LRSB 4Z18A 2QHLA 4HFUH 4QF1B 2ZXQA 1YAZA 4YLCA 5GJTL 2Q7YB 3G08A 3BZ4A 4YHLH 3Q5TA 4TNVK 4MNQB 4WHDA 5IFAL 2CSPA 2Z35B 2ZOWA 4JKKA 3K8MA 1L9SA 3VXPB 2D9QB 3WFBH 2FEEL 4U3SA 2ZUVA 1D5BA 5JORA 2QZQA 1JXDA 4K9EH 2R29H 4BK8A 1WHPA 2ESVB 2X4OA 1XQ4A 3B3IB 1SHWA 5L4IA 3U7AA 2CBPA 5C09E 5I8EB 3BQVA 3WIIH 4A6YA 1BQSA 2Z6FA 3AMLA 3RA7H 3PABB 4DT2A 4MCMA 4NRXA 1CK0H 5E00B 4BFOA 3GSOA 4RAVB 2ZJSH 2J43A 4U2YA 4QRTA 3MV9B 3HCVA 4P4KA 5INDB 4KRPC 3DSNA 4FQCH 1IBFA 2ZKYA 6FABL 2AVGA 4A2HA 2UXTA 3DUHA 5IBTH 2VT0A 4YIQB 2XN9A 4S0SD 4JO4L 3HKFA 4OM1L 3S6CA 4DPCX 2BERA 1UYWL 3BGAA 3QORD 5CGYD 5HI5D 3W82A 3P02A 5L8LB 2DEYX 3V0JA 1JWSB 1NGPL 1EJ8A 4P3CL 4I88A 4W9GC 1TF4A 2VMFA 5CLTA 4QMEA 5KTEL 2HLFC 3QIWA 4BKTC 2LLLA 5BPPA 2UZYA 2DOCA 5FV1L 3RHWF 4JFXB 1Z9LA 3X3FL 4OFDA 3FONA 2ZUSA 5D1XA 3MYZA 2WXHA 3CIAA 2ZSVA 1XF5A 4IEFB 2CNZA 5DJCA 4UCFA 5ESVB 3BZ5A 2NY1C 1MCLA 3WLWC 1GRWA 3C6LC 3SQRA 4GT0A 1M7IB 5L2JB 3L3IA 4HWZB 3AG3B 1FGVH 3BSHA 5EEUA 1PPIA 5IQLA 4JRYA 2XNAB 4JM2A 3CVIL 1WZLA 4DZ8A 4QD2E 2GUYA 1A9BA 3NSDA 2ZXWB 2CMRL 5ESAA 3FN0L 4TQHA 5GGSY 2EE6A 3BH8A 3FZUD 4EZMA 5IEKA 4U1IB 2JE8A 2PTTB 1UKTA 4YK4C 1XF3A 3T6ZA 1RJZA 3ARFD 5DJ0B 3BWSA 1EHKB 2DI8A 1GGCL 5FEBA 3KLKA 2WTRA 2CG9X 4HXBL 1MW3A 3UTZB 3V0HA 4H1LH 4AUUA 3GHEH 1LEKB 3U0WH 4HV8A 1BZ7B 3C09B 2JIXA 4K7PY 5ACZB 2HT2D 2QJDA 3N43F 4ONGL 1Q9LA 3CDCA 3O2WH 5CS7A 1S9YA 3DOSB 1OD9A 1T66C 25C8H 3NZHL 3JSSA 3VXQA 5LJYH 1TKWA 1GHFH 2VGLM 3P0YL 1U0QA 1P84J 4LIQE 2Z92A 3OQ3B 1J8HD 3HG2A 2FUTA 4MA1B 3DYPA 3IFLH 2WVSA 5I0DA 1I3RA 3K2KA 2QTVA 4EKJA 4TTGA 1INEL 2AQTA 4YDNA 3NAAH 2YD1A 4P9ML 3V4VL 2KQMA 4OFYA 5CXPA 2CIIA 3N43B 1M7UA 3FC8A 1HZHH 4NN7C 3SKNA 1QLRB 3SZKC 2ZG2A 5KVEH 3RX5A 4PGBA 4FXGB 3NVQA 4OTXL 4UNTA 2KZKA 5KJRL 3ENEA 2EYTB 4O02L 4ZO6A 5LLIC 3RDTA 3MOAH 4ISVA 4YSDA 2Y07H 5LO7A 3RNKB 2VC2B 2EUVA 2EXWC 3KS0J 1I1AC 4ZAKB 5K1NA 2XOTA 2OAAA 2Q6WA 4N26A 2DI7A 1FZOA 1JZGA 1M7DB 1SHXA 4FERA 1P7BA 4FTVB 3LZFL 3MREA 2XTJB 4O2CB 1ZA6B 1AQMA 2PO6C 4K94L 3ZQ9A 3BVVA 3NFNA 3OGOE 3KM1A 4PJ5A 1GS8A 4IKKA 4X42A 1XCQA 5E8PA 4HH9B 3PDGA 5FHBL 4AV0A 1KB5B 1OT1A 1E4WH 4KJWD 2G2RA 3D05A 4PJCE 2D0GA 3VW3H 1QR1B 1ZXQA 1UKQA 2FNBA 2AGJL 2J8UA 2ED6A 3T0AA 3HE6B 5KVDH 4PD4J 3RZCA 2YSSB 3VXSB 3TBTA 2FUQA 4EDWL 2X53A 1MREH 2ZOLB 2EKSA 2HA1A 1P4BL 5E94B 3RJOA 3WFEL 5GZOD 5AVYB 3ZZQA 1RIVL 3FYIB 4EIGB 4L4TA 4AVJA 1T5WA 3ZLQC 5J9PB 5D6CA 4ZUVA 4HOMA 1KFAH 3QDJB 4N0CC 1GH7A 3GM0A 2GC7C 4XPGL 4AIZA 3EGDB 4LVNC 1DFBH 4E36A 4XPFH 4HQQL 5DEGA 2E5EA 3FUIA 3CSFA 4ZW3A 4FCHA 3RTLA 1KJ2L 2GI7A 5A2AA 5JDJA 3BISA 1NLDH 3U25A 3CFCH 3JTSB 4AYEC 4BZ1L 4JKNA 2IF7A 1JK9B 4CBPA 5AW9B 5ITBL 3RWDA 4AT6B 1R6VA 2QKIC 1AR1D 4PJBE 3FT3B 3WO3B 1U8KB 1MHPH 1N8OE 1E9QB 4X83A 2VM4A 2WYTA 3VMPA 3CFKA 1S3KL 3LVTA 4G82A 1BG1A 2FB4H 1AG0A 4AL8H 2EAEA 4ZMPA 1KBVA 3D06A 3JVGA 4QRRB 5IOPA 3L1EA 1ZMYA 3NSXA 5EA0H 5KYUA 1Q72L 4Z7WA 3R06A 3TIEB 1NPNA 4YC2C 4UTAA 3P9WB 3V52H 5I17B 5DHVH 4HA1A 3CCHB 1ORSB 4GKSA 3VXMD 1J5OH 1K2DB 5H35A 2XZCH 2AEQH 2WNXA 4RGOH 4ODHH 1YEDA 4OJFH 1G7PB 1BIIA 3WD5L 4KH2A 4N8UA 4XO9A 5CJXC 2OJZL 4L29B 4X7DC 4XNXH 2IALB 1CVSC 1PZSA 2XXMB 3HC2A 3AQYA 1M9SA 1CL7L 1S7UA 1LE9A 2A74C 2DS4A 3QCUH 2RH0A 3OHXC 2WBJB 1GPOL 1QQDB 2ZX5A 3ZSTA 2FO1A 5ALBH 3CFJB 1J0HA 3S36X 5B22A 3CDZB 4Y4KA 3ISYA 3ABLB 2WM0A 5C07B 3GRWA 1CIUA 5F7DA 4G8GD 3KPMA 2XWCA 3QQ3B 3L3HB 4GAGL 5GIRA 1HVXA 3K5RA 1IGYA 4HJEA 1D6EA 4U0RB 1OKEA 4X99B 3BO8A 4HSCX 3U4KA 4BE5A 1OZTG 5IESL 1O6SB 3AC0A 4G80A 4J8RA 3A5VA 2LU7A 3KDMB 3WNKA 1OAUH 2GJ6A 3ES6A 2YXFA 2F18A 1CZ8H 3DVNB 3KG5A 1UUSA 2PWFA 4KC3B 2FNWA 1WAAE 3D25B 3C9NA 4YPGA 1WCQA 2F53A 2RGSA 4X8JA 1HZLA 3FQRB 1G87A 4KVCH 3ULUC 1HSAA 1P5VB 2WXFA 4X5XB 3Q48A 4P48A 5DMIL 1MWAL 2VDRH 3ZW3A 1ZGLP 1BBJB 3NUKA 3VX1A 2XIIA 4UT6H 4YHYC 3UCRA 1KEML 2AK4D 3W2DL 5FUCE 4K7PX 3E0GA 4LLAA 1JPFB 2O26U 2Y25A 5A2BA 2FQDA 3IPBA 4AMKL 4Y4FA 1SHSA 5I1KL 3N42F 5E0QA 2QKSA 4ONOA 2YQ2A 1CICD 2D2OA 3BT2L 1AO7D 1GW6A 1T5KA 3NJKA 4OQ1A 2PXYB 1G7QA 1WA1X 4IOSA 1Q9KB 3T2PA 3ZMNA 2EZ0C 1L5GB 3FRPA 3NJNA 4MA3B 2CBQA 5LKNA 2R1YA 4M6MH 3VFOB 5GRJL 1MLCB 1NCAH 1XAUA 3LRMA 3N42B 4DJMA 2WGNB 4YSOA 4PS3A 4PGDB 1JV2B 1KPVA 3GMRB 1U8LB 4XAKE 4G8AC 4HC1L 5DMYA 2BWDA 3PGFL 1CGSL 4JDVA 1ZANL 1KGIA 5FX3A 4L1DA 2JV6A 1MEXH 3QUXC 4IU2A 2GPZA 4P2QA 4QF1A 1H3XA 3VNZA 3DRTA 2Q7YA 4K3EH 3TV8A 4FA6A 2FHCA 3A6CH 4KK8C 1BMWA 4JLRA 5AW6B 4MNQA 4CC4A 3GBDA 1CJYA 2Z35A 1U30A 4WCYL 3VI3E 4LCUB 2ADJB 3QRFM 3QIBC 4JDZA 1HU8A 1X4YA 4LHQB 1BJMA 5D2LA 3O4OC 4NGHL 2ESVA 5DUBB 3GLAA 3B3IA 4N90D 1ML0A 2H0EA 5HHVH 3STZB 1QO3B 5I8EA 2JFCA 4HGWB 2AXGB 3PABA 2IH3A 4HHAB 5B8CB 5E00A 1KN4L 4P2AA 4RAVA 3T65B 4WFFE 2QQKL 5C2UB 1MXGA 4S1RH 2WNGA 1FVCA 4M48H 3B2UC 2VLRD 3EYUH 1T21B 5INDA 2JLLA 3MN8A 15C8L 1L9TA 3U7WH 1TVBA 2VDKB 3QZOA 4N1CA 5F9AC 3UGXA 2JQMA 5C0AE 3T4AC 5B7FA 1YMMB 4LGSB 4NKOB 2AEOA 5E6SB 1J8KA 4O51A 4IK7A 2VDPH 4JY5L 1IC4L 1HFUA 2P26A 1FSKB 3GJEB 3BWAB 3L4CA 4JFXA 4LK4A 4M5TA 5SX5K 3FQNB 4DCQB 2JI3A 5LNDA 1G6RH 1PYWB 2H1PH 3RWEB 2EKJA 4IEFA 4E9QA 4L2LA 3CVCA 3EJRA 5D7JD 5E6YA 5ESVA 3JWNE 5F7MC 2FEDC 5L2JA 1M7IA 4C56D 4O9HH 4HCIA 2WLJA 2JSFA 4ODTH 1UB6B 1UD4A 2MSPA 1XT5A 3FHAA 3GSVB 4XO5A 1F6FB 1NH6A 4G8EA 4NQQA 3OMNB 4WI5A 3X12A 4L4JA 5DJ8B 3WUZA 4FRWA 2IGFH 1RZ8B 4AYDC 4NZTL 4OCSL 2RQ8A 1TYEB 5EU4B 4KRMB 1TZHB 3SE9H 1OPGH 4H5SB 4U1IA 2PTTA 4BD4A 1M05B 1XGTA 1ADWA 1YECH 1E5CA 1BQKA 2VDMH 1QR4A 1A6ZB 2IMMA 2YPLD 5DJ0A 5TK2A 2AAAA 4QTFA 3PG2A 1YSOA 5L2KB 4U49A 3A0OA 5ETUA 3LN5B 1ZLSH 5HJ3B 2N3JA 3RKPA 5I18L 4Q9RL 2WYIA 1LEKA 4LQFH 4QYOB 1BZ7A 3T6XA 4Q9CA 3GPSA 4PJ9B 2ITCB 4ZQTA 1ONQB 3QCTH 3CSYB 4XN4A 4ZMYA 2A9AA 4ALAL 1KYUA 3DOSA 1KG0A 1KTDB 3K4ZA 1L0YA 5HHMB 3VD3A 4I85A 4PRPD 3RWFB 1RZJC 2BH0A 3GXTA 1VGKB 3BESR 1IGIH 3EH1A 2D03H 4NP9A 5DZAA 3O9WA 4MXWL 1K3ZA 3KEHA 5HGHB 2Y7MA 2JTDA 3HN3A 1AQDB 1L7TH 1XGPB 1LK3H 4JFFB 4XVTH 1AOHA 5F72S 5TQ0L 1JF5A 2NY5L 4FI7A 1QLRA 1QSFA 4XVJL 5A3ID 2V17L 4WV1B 3LRKA 4FXGA 1DBKH 3T8XB 2DMCA 1MCFA 3JBG7 3HN5A 1TTBA 4NPYB 5IF0B 2CH8A 4EMZA 4YDJB 5C0DB 1OK0A 1EZUA 3B34A 2CZNA 1ULVA 2GBVA 4IMKA 3TEYA 2ZIDA 2EYTA 3FCSB 1CXEA 4ZYKB 4P2RB 3BRFA 2C1OB 4I8DA 3U9PH 3QJRB 1BVLA 3GO1L 1DLHA 1WG3A 1Z0NA 3G6DH 2PCPB 3STLB 3MRDA 4HIHB 3E80A 4J5VA 1UUNA 3FAXA 1YUHB 3QUZC 2EYSB 4WK0B 2J5WA 4PGCB 4LCIH 4Y5XA 1JVKA 4JY4A 1M7DA 4FTVA 2NY4C 4O2CA 1ZA6A 1KCSL 4WJ5B 4PVNA 2P1YA 2ATAA 4R0LC 3QJUB 4PJEE 3CMOH 4H1LG 4Y5VB 4HJUA 3A24A 2FIKB 1DJIA 4HH9A 3L95B 1SLUA 3I3EA 1KB5A 4HFUL 4PJ8D 1LDPH 4XCEB 1S2EA 4A2DA 5C86A 4GKZA 2CKBB 1XBDA 2EDNA 12E8H 2FJUB 1GIGH 2CPCA 2FX9H 2D3VA 3VXSA 4YHLL 1JTTA 1FNLA 1UOVA 1V7NH 1FZMA 2OLDA 2ZOLA 4NQEE 5EBWB 4FOMA 1IVTA 1HDMB 2PUQT 4N2LA 1HHGA 3WFBL 5I5IA 2HJLB 1XL4A 2VKXA 4MXVF 2E9WA 4I18C 4K9EL 2FT7A 2R29L 3LJ3A 5GRUH 2XKNA 2WPGA 5H2BB 3T6VA 2PYFB 2R69L 3QDJA 3SYOA 3WIIL 3RTQB 3O6FA 2IFGA 1YRKA 3RA7L 5E9DA 4HWEH 4P06A 1CK0L 3G5VA 3WENA 1Y6MR 2ZJSL 1BXXA 4EQ2A 5E6IB 3Q8CA 3JTSA 3LZNA 1PQZB 4FQCL 1QFHA 4FFYH 5C6WH 1JK9A 4A37A 3F04A 3QIUD 4WUUD 5IBTL 3BZEB 1CYXA 3WNMA 2YA0A 1PX8A 2R1WB 3OB8A 3FT3A 5HGDA 4JKLA 5IBLC 1Z9MA 2N1KA 2BVPB 3KBPA 4OUOA 1ZIBA 5C0ND 1E9QA 2E47A 1PY4A 4PWFA 4DGIH 4GFTB 2N7BA 2JKIS 3I6KB 3QUML 4BCZA 5I19H 1LO5B 3WO4C 3DJTA 4LLUA 4P57A 3ARWA 4ODBD 2CO7B 3HFMH 4KI5C 3HR5A 5JHAA 3OC5A 3KBEA 5D7KD 4PGEA 1XTMA 3TIEA 1UXSB 4JZJC 1ORSA 4FXKB 5GRZA 1FGVL 3LQAH 1U9KA 1H3VA 1K2DA 1QEXA 4LHUB 4WFHE 5BMFH 4AV4A 1B0IA 2O4EA 1U41A 3CHXA 4L29A 2IALA 2EDEA 2ZKXA 3I9AA 3ZL4H 4GSDH 1NFKA 4PPTA 4CKVX 4CL7A 5JYLA 1QQDA 4Y2DA 5EZJA 4OJAA 2HRPH 3CDZA 5C07A 2UXFA 3QQ3A 1UWXH 3QO0A 3LRGA 4PY7A 4Z23A 4JR9H 4JQXA 3V6OC 1T7WA 5AW1B 2BP0B 3GHEL 3U0WL 1FZKB 3L5WB 4DPAX 1AQ8A 1SOKA 3KDMA 4CNIB 4AGOA 3NIGE 4ZD3H 1FUNA 5ISZA 3ZRSA 1CUOA 3DVNA 3O41A 5C0JB 3ZKNC 25C8L 1L9PA 3D50A 4G9FE 1GHFL 3VSQA 2VZVA 4RDQG 1JTOA 5D2NB 3FQRA 3IFLL 4JRXD 3RE0A 5KYYA 2I7OA 35C8H 1P5VA 2BNQD 3OKKB 4X5XA 3NAAL 5C0CB 1M42A 3IF1B 4IBYA 1BBJA 2G4GA 4MAUH 4MZIA 4U7KA 4GEJA 1Z9PA 3APCA 4IW4C 1HNYA 1HZHL 3KNBB 4GQPH 4UIKH 5LUMA 3MJ9A 1ZJBA 5KVEL 1F97A 2DQHH 4N0FA 5IQMA 4AYSA 1RERA 1JPFA 4AYGA 2Z7YA 1JZ5A 4AITA 3IE4A 3V4VB 1Z9NA 5EBLB 4N0RA 1G7LB 1HE7A 3QC5X 2VMJA 2ZUUA 4GAFB 2MQ0A 3MOAL 3FO2B 3NTCH 1I3GH 4B41A 4X6DB 4KTYA 2Y07L 5G4NA 2ZT9C 4JFEB 3SO5A 3QQ9D 3SDCD 2JVUA 2PXYA 1Q9KA 3MNMA 1PZBA 1DVFD 3TA3A 4PS8A 3FOMA 5IB2B 4O02B 3II1A 2AXFA 3QCVH 4HZAA 2EC9T 4RQQB 4N8VG 3FCUB 4UV7H 3TIDB 3CFTA 4WWKD 1HHJB 3S2AA 1NGZB 4PGDA 1JV2A 5IB5B 1TO4A 1E4HA 3GMRA 3SE3C 1U8LA 5JPNC 4KH9A 4M3JA 5TJWK 1CXKA 1P6AB 1E4WL 2LVEA 4WTQA 5AYTA 4XP5H 3VW3L 4OI9A 4H0LC 4XHQA 5KVDL 1AMYA 3ZYJA 4X7EC 4TULH 4MJJA 1MCHA 1MREL 1MRFH 2EDKA 2DBLH 3MNZB 4PN6A 4R26H 1GXEA 1MCRA 3VI4E 1AXSB 2D31A 4PVLA 4XN1A 5E23A 1OGSA 1BG9A 4RX4A 3QEQD 3P77B 1KFAL 3KXFD 4XXCA 3STZA 1QO3A 3X17A 3SKOB 3W0WE 1EIBA 1P69B 1DFBL 4EI5D 3Q13A 2WZAA 4HGWA 4PREB 4XPFL 3WDHA 5B8CA 1R47A 3QH3A 5E2WH 1QKZH 2QQQA 4HJ0D 3T65A 4AXWA 3OKMB 3OZ9H 4MJHA 4PJGF 1NLDL 4DQAA 3CFCL 2YLKA 3P40A 4ZUWB 3BN3B 3B3BA 2IADA 1K4CB 4MAYA 1AGEA 1ITBB 5TE4H 2EVFA 2H0JA 3QORB 2B5IC 4G6JH 1YDPB 4NKOA 4NWUH 3VUAA 1DVYA 1KJ2B 3SGEH 1MHPL 5JXEA 3UG5A 2FB4L 4AL8L 5HHNB 1NINA 3GJEA 3BWAA 3EO1A 1CDYA 4IGBC 4PJGB 1DQMH 2FWSA 3FQNA 5EA0L 4YDKH 2EIJB 2A6JB 2ZWSA 4D0CA 1PYWA 1CQYA 3ARDA 3F7KA 1L0QA 1PU0A 3GIVA 4N68A 5GPRA 3V52L 5DVNA 1CN4A 4O4YH 2X89D 3TX4A 4FNQA 1OWRM 1UB6A 1DJWA 1J5OL 2XZCL 4MRCA 2AEQL 4RGOL 4B7IA 4ODHL 4OJFL 4HUNB 9CGTA 5CU9A 2VM9A 3Q1EA 5DJ8A 4L0YA 4XNXL 2P9RA 4WNSA 4CAGA 3BIKB 5CZXD 4Z0BH 3QCUL 3D0AA 4R7DB 1Z5HA 2FBOJ 1EDQA 4JFHE 5ALBL 1V3MA 1M05A 1J7VR 3ARFB 4CDHA 4BK5A 2K6ZA 1A6ZA 1ACXA 4YWGH 5GS1C 1QP1A 2CLVA 1H8NA 1OGAE 5L2KA 3LN5A 4RSYA 4CN6A 5JA9A 4KRLB 3BPNB 3M1OA 4HIEB 1PFOA 3MZGB 3Q5OA 3QA3B 3SE8H 4PJ9A 5EUOE 1CS6A 1XGZA 1ONQA 2Q3AA 3GSXA 5DHYB 1OAUL 4FNUA 3BEVA 1CZ8L 1KCWA 1ZT1B 3AWEA 1Q1JH 5GZNA 1JL8A 1KTDA 1D5XB 3HPJB 2HKHH 3RWFA 3TH4T 3ZTCC 4DETA 1J8HB 2XG5A 1WZAA 2Z64C 5DQ9B 3E2HB 4KVCL 3VGHA 2OYPA 3VDCA 5I0XA 1VERA 1M71A 1QABA 1K8IB 4TVPH 3VYOA 2GT9B 2VDRL 1AQDA 1IGMH 3F5WA 4NPJA 4M8VA 1TEYA 4JFFA 4U0QB 3BGFC 3D51A 4HT1H 4UT6L 3HE7D 3KL3A 4JGMA 1X5ZA 4IKJA 5DFVC 1E4JA 4BDVB 2VERA 5AAPA 2DBJA 3HI5H 3T8XA 1AR2A 2KLTA 5I1AA 5IF0A 2UY7B 2HMIC 2QV4A 3B1TA 4YMPA 4IBUA 1IO4C 1YNKH 4ZNCD 4P2RA 4ZYKA 1FV1B 1I7ZA 1KV7A 4TYUA 2LU4A 4P3WA 3FXIC 3EF4A 4WKZB 1UXMA 3HHMA 2PCPA 3UTPE 1ZSHA 3QFJB 2MKWA 3AT0A 2KYIA 2EYSA 4M6ML 4O2FB 5HDBE 3ESMA 4PY8I 1NCAL 3O3UN 3MUY1 5FA4A 3IMVA 5JXAH 4Y8DC 4DUXA 4DW2H 2L4OA 4UNIA 5E5MB 3CK0H 2X7LA 5ALCH 1QTYT 2M83A 3S96B 4OI7A 1RUKH 4JFDA 4TNWF 4X98B 1HXKA 3WJLA 1MCQA 1SJEB 4Y5VA 3BPCB 1F1AA 2XHNA 4UUJB 2J1XA 3L95A 1MEXL 4GRMB 3FH5A 4XCEA 4B9IA 4MJIE 4PJHE 1GZQB 5DJZB 1ILUA 3DIVA 2CKBA 3ECUA 4K3EL 5DTFB 3A6CL 3SIKA 3MHZA 4NO5B 43C9A 2M26A 1OGPA 5DZJA 5F7WC 2VH5H 2VLMD 4P4RB 3CFDB 2AI0H 4F7PA 1HDMA 2OR7A 4R90H 2VLJD 3FB8B 1N12A 5F0JB 1QD0A 2J5LB 5D1ZD 4XWOD 4Y9CA 1DN0A 4OD1H 5H2BA 3V6ZB 5HHVL 4APQD 3SYPA 4NQCD 1NLBH 3TFKD 1T6VN 1ZSDB 2HVKB 3Q06A 5E1QA 4W9CC 5E6IA 4ZPTB 2F19H 1XF4B 3LCYA 3L4UA 2H6PB 4M48L 1PTZA 4S1RL 3EYUL 2PPFA 4MDIA 3U7WL 5D7LA 4LPYA 3UPCA 3BH9B 2X0VA 1TTFA 3CLFH 3U1PA 4E2OA 4Q52A 2DY2A 4WW2C 1R24B 4AGMA 4HBQA 3S2CA 1N5YH 3QIWC 2BVPA 4ZTPH 3WJJC 2AKRB 3QNXB 1NZRA 2YMXH 1PCXA 4LCWA 2VDPL 1NCDH 1I3UA 1UD2A 4GUOA 5IZ7A 2P8MA 3QUYC 1G6RL 2H1PL 2AW2A 4PJIE 3IXTA 3QQXA 3K6FA 4M8QB 4KO5A 1TJXA 2EO1A 4JCWA 3NFSH 4O9HL 2NLJB 4ODTL 3FL7A 4PJDF 3SDYH 3VGAB 2AJSH 3VXMB 4U7SA 3WFZA 5K9OB 1L9MA 3TZVD 4LHUA 2A9NH 3F83A 4JM2C 3TNNA 2CO1A 1OAQH 2IGFL 4FS0A 3SGKA 4GNKB 3UMTA 1NKOA 2ENJA 2NUTB 3L7FB 3SE9L 5HYIA 1R3HB 1HWGB 3LSOB 3MKKA 1OPGL 1UEMA 3N41F 1YN7B 3FFDB 4ZNEE 1YECL 4U3CA 2VDML 4PJDB 3MLWH 4G8GB 4QRBA 3TCLA 5IQOA 5BQDA 2NMSA 1PKQE 1DQVA 2AMUA 3LPOA 2FAUA 3Q9QA 1ZLSL 2VR5A 4YVNA 2FK9A 2GW5A 1FZKA 1IC7H 4LQFL 4B9ZA 3I6SA 4G8FB 1YY9D 3F6LA 5CZVH 4XE0A 3QCTL 4OZGE 5FYJU 3CNKA 4CNIA 2HFFA 3C5ZC 1HWWA 1E27B 4S1DC 1LO2H 1IQWH 5C0JA 1UC6A 2AANA 2CBMA 3OR7A 4WFGD 1FNEB 2CHXA 4P9HC 3VXRD 4DSYA 2ZUQC 1Q94A 2IH9A 3M7OA 1IGIL 5D2NA 2D03L 3CMGA 1XF2B 2CR0A 4HIXH 3G04B 4UYQA 3A3YB 3OKKA 1HHIB 2XTSA 1L7TL 2ZG3A 4PLJD 1LK3L 1NIDA 4XVTL 1OM3H 5F7EH 4JQVA 4MAZA 4ZW8A 2AK4B 3KNBA 2WXMA 3LB6C 2WY3B 5AW7B 1DBKL 4WNQB 2VOTA 2D7MA 4FQXD 4F5CE 1EBPA 3V4VA 5EBLA 1G7LA 1Z1WA 3RFZB 1CICB 5JQIB 1NOAA 3FO2A 3U9PL 1AO7B 4L3EE 2WW8A 4OZHE 4G70B 3A6BH 4FNPA 4JFEA 3BH4A 3AB0B 5F0MB 5IP4A 2ZICA 2X87A 2E7BA 4AQ1B 3E3QC 2XRAH 4WU7B 4BFIB 4HUVB 1F4HA 4LCIL 1AZRA 4RQQA 3VWKA 1AD9B 5JYMA 4LMQE 4AYFB 1HHJA 2Z0BA 5GS3A 1SN2A 1U3HA 5D55A 5D96B 1AXIB 1AG6A 1QI5A 5HHPB 5AKTA 3CMOL 4FNSA 4ANVA 3R8BB 2WUCH 2CQVA 4GSUA 3IB4A 3Q2LA 1LDPL 2OSLB 2W0LA 4BQCA 3FU5A 3IS1X 3CVHA 2X1XR 4ZRGA 2EDTA 2VZUA 12E8L 4N87A 2OW6A 1GIGL 3GNMH 2FX9L 4FQLH 1FPTH 1V7NL 2OMYB 4FFZH 1LXMA 1A4JB 4FZEH 4OCRH 3WNIA 4ZOEA 3CN0A 4G71B 3MNZA 3KW8A 3V5DA 1EBAA 3KPNB 1H8LA 4UTBH 1R3JB 1S5HB 3NESA 5GRUL 4R96A 3TBBA 2C7FA 2WXIA 3SKOA 1USZA 4UQ2B 4ZMTA 5JR1H 4HWEL 2OCCB 5IR1B 4ICWA 2BOLA 3U79A 2LLGA 5DEFB 1FFOB 3B7SA 4JK0D 1KUMA 1C08B 4DP6X 1KCBA 3MFFA 2F7PA 3VD7A 4XCNB 2VLRB 3HS8A 4JE4B 4P8QA 5IW1A 3TO4D 3H7BB 4ZUWA 1P7KB 4FFYL 3ARGD 4KDTC 1YEIH 4MASA 2VB5A 2ZE0A 2WAHA 1OSPH 1X5IA 3ML9A 4JZNA 5J1SC 3X1GA 3VSTA 2EE9A 5HDWA 1YDPA 3WTXA 5E6RB 5DK3A 3ULSB 3DXAB 3QDHA 3V6FA 4BZ1A 4DGIL 2BDNH 3JVGC 1YEKH 5I19L 3GMMA 3WDJA 4B9KC 1HKFA 4PJGA 2P7TB 3HFML 2VO5A 4DPBX 2A6JA 5T1MB 4NXSA 1FNGB 1X5XA 2IDUA 1AIZA 2PN5A 1TTAA 5D7JB 5JW4R 1MVUB 4JG5A 5K9QI 1Z7JA 4XPHH 2BP5M 4H26B 4R2GC 1P2CB <