4KKQA

Crystal structure of vibrio cholerae rbma (crystal form 1)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
234
structure length
225
Chain Sequence
PVIEANLSLNQNQLASNGGYISSQLGIRNESCETVKFKYWLSIKGPEGIYFPAKAVVGVDTAGRMLNVTRGFWVPEYMADGKYTVSLQVVAENGKVFKANQEFVKGVDLNSLPELNGLTIDIKNQFGINSVESTGGFVPFTVDLNNGREGEANVEFWMTAVGPDGLIIPVNAREKWVIASGDTYSKVRGINFDKSYPAGEYTINAQVVDIVSGERVEQSMTVVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Biofilm Formation via the Vibrio cholerae Matrix Protein RbmA.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Structural protein
molecule keywords RbmA protein
total genus 45
structure length 225
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkqA02
2.60.40.3880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4kkqA01
4BEIA 4KKQA 4BE5A 4KKPA 4BE6A 4KKRA
chains in the Genus database with same CATH superfamily
3U6RA 4U1HB 1A3LL 1D5MB 1XF2A 3ULVF 3MACH 5IUCA 5IQ9A 5EU6D 4TPRH 1OAQH 1G7JB 2V17L 4P04A 1RV6X 4GI6A 5JA9A 3CVHB 2N0MA 3KPQB 5C0AB 3NJVA 1KTDA 3CHPA 3QRGL 4MNHB 4OTXL 4ABQA 1OCCB 5HJBA 2IC2A 1DP0A 3U2SB 1XSIA 2NPLX 1J48A 1OGAB 3TJEL 4DUWA 4XMUA 1XFPA 2V2TB 2JKIS 2QSQA 4X6BB 5HYQA 4UQ2A 2X3BA 1X9QA 4GBXB 4XO9A 1IEAA 4OIIL 1JWSB 1X6LA 3HE6B 4M48H 3WNNA 2J88H 1KYOJ 5AQ0A 4FA6A 4ZBJA 3V4PB 1CGXA 1NOFA 3EZJB 3QUGA 1R5WA 5I66A 1XR8A 4UBDC 4JCWA 5T1DH 3OB0K 3TBBA 1Y1DA 3E0GA 4BA8A 4M43L 4R90L 4OCRL 3ARRA 4O02L 1K8DB 2UWEB 3CSPA 4N2MA 3U7AA 4ODXA 1GGBH 1LO2H 3V0VA 1WEJH 4F9PC 4GSDL 1DQLL 2BS8A 1SYVB 2R56H 4GW4A 4P57B 4OAWA 2JKTM 5KS9A 5I17B 2IPKA 4OGXH 4CC4A 3VWKA 2D7NA 3NTCH 4AQOA 2WINB 4R8WL 4G9FA 4ETQB 3BVNA 1HX0A 4KKBD 2CDFA 3SPCA 1BMZA 1CL7I 1V8HA 2LQRA 3TWCL 1BQHG 2AXFA 2CJUH 4DZBA 1M7DB 4FCAA 4XP1H 3WD5L 5FYLE 4MA3B 4WGKA 1T0OA 4BFBD 1BA9A 4UQ3A 1FNEB 3WDIA 4YUEH 1AQMA 5F7LB 5J13B 3LRLA 1NA8A 4P23C 5ABZA 4KZ0A 3IJSB 1U58A 2VQUA 1GJWA 2DLGA 3VA2C 3C5JA 4MA7L 4HIQA 3QXTA 4OIFA 4ZTEA 3L08A 3OMAB 3ZDXE 1DLFL 4N5EC 3MGTA 3HRZA 3DVIA 4KX9A 3DC0A 3N40P 3S35H 3UX9B 1LVEA 1U4FA 2A6JB 3ZDYF 1O7VA 3GXMA 3P9WB 1F02I 3MRBB 3L7EA 3OG4B 4PG2C 3EG9A 3CX5J 1OAKH 4Y4HA 4B7IA 3BD4A 2X6VA 1ID5I 3CGTA 1MWOA 3X2QB 4ONFL 5FO7A 4PH8A 4M43H 4JFFD 5C9JA 1T5XB 1I8LA 1G4MA 3C5SB 3WNPA 3GSXA 3NZUA 1EHLL 3ZYZA 2VXUH 3ZO9A 2C9AA 2K8QA 2E76C 1F00I 5ANMA 2Q7YB 5I19H 2B16A 2CLZA 4U4BA 3IVKA 4YE4H 1IAKA 2WXGA 5B22A 3NCCB 2G2RB 5DTFA 1LEGB 1YMMD 3CSTA 3D85D 3ESPA 4YSOA 1YNKH 4IIQB 3H8NA 2DYPA 4PJXA 5E6ZA 2AC0A 1WBXB 4GT7A 3V0HA 2FX9H 2AEWA 1HHJB 1D2PA 3BQUC 3CXFA 3OZLA 3TV3H 3WN5C 1SLXA 3D30A 5AW1B 5CJQH 1S7RB 2JSFA 3QJHB 4EDXA 1WH0A 3LX9A 2WY3B 4KJQD 4MJIA 3T8VA 1R3KB 1IIIA 2IAMC 2P80D 2PYED 4AE0A 2UUDH 2EKJA 4LCWD 4N0UA 2KDYA 3I3BA 1A65A 4P5TC 4LHUD 2AABH 5DHVA 3WDJA 3ZZQA 4D0DB 5IV2B 3C8HA 2IQ9L 3LV3A 3VU1A 1YJDH 2NY7H 5TFSH 4YHIB 4ALAH 5E8PA 2ZUWA 4PRHD 3N43B 3ZTCC 2V9UA 1C5DB 3W82A 5E9DA 3C08L 1BAGA 4I9WE 3C6LB 5GIRA 5TDOB 3S4SB 5EEWA 4LPVA 1DTUA 1MI5A 2A1WL 4MBOA 3D25A 3TCLB 4ZFFA 3T0DA 2J43A 5CJ8A 5DS1A 5ESVA 1YN6A 2Y6SD 3IFLH 2VQ1B 4JPWH 1CVRA 2J25A 4L2LA 5HPMB 1UHVA 2HB0A 1P4IH 1XCQA 4J4PA 1U6AL 2X0VA 1SUJA 2ZIDA 3QCTL 4NLAA 3IGKA 2FECI 3KVDD 4N86A 3HG2A 2B9AA 4UQ3B 1QSFD 2WO2B 7FABH 2O6CA 3LKQA 5IQNA 3H9SA 3AGVA 4Y19E 1KYOK 4M48L 3SYOA 2HH0L 4JDEB 4Q4IA 4BSJA 1EUTA 2XG5A 1JZ3A 4I1NB 3KW7A 2EDYA 3ELQA 4HGKC 1U8OB 3DX9B 1BVLA 1YNKL 2JKXA 2A6KA 1SMAA 1HQRA 1MREL 2RTTA 2C1PB 1AQ8A 4HHAB 4WHTB 3NIGB 5A2AA 5F6IC 1ETA1 5E1AA 4PM1A 5J12B 1I7RB 3CHOA 3T0EB 4TULH 4LDCA 1IAIM 3FDWA 4LL4A 1ZHKB 4F1ZA 1CICB 4AE1A 3JT0A 1R17A 2XV2A 4YEFA 4ECNA 4M8QB 3FB5B 1RPUA 1DVFD 3G6DL 2X5PA 4HIPA 3P0VH 1RZIA 3AY2A 4J3OG 1VJSA 3T8MA 3VSUA 5HYSB 1B9ZA 2PO6C 4U7MA 3L5XL 2A9AA 3MLRH 1QFPA 4KZDH 2BSED 2OTUA 2AVFA 5BRZE 1TO5A 1INEH 4MMZB 5F3HB 1X7SA 4RAHA 3P0YH 1XGQB 5E03A 2HVJB 1U8CB 32C2A 4NO0D 2WW8A 1CXIA 4JANA 4PJXB 1M2VA 3KPLA 4H1LA 1T5KA 4QMEA 2QQQA 3QQDA 2F54E 1ZGLP 5ELIA 2B4CC 3EYOB 3KJ4C 1UQSA 3SBPA 5I1CH 4M7LH 3AREB 3D33A 1SLWA 3HFML 1A7PH 3K8KA 4JM2A 4YSDA 5DHVH 4H8UA 1NCDH 2JI3A 2YR3A 1AD0A 3QDJB 4ZFOA 1OCRB 4LSQL 4GT0A 3FQRA 3FW6A 3FSWA 2CGRL 5TE6L 2HVKA 4NFCA 2VWEE 1MVYA 3X3GH 2YN3A 5J6HB 4N90E 1KCWA 4KROB 5ITBL 3IF1A 2W65A 1IGJA 3F58L 1UWEL 1RHHB 4MXQD 1F8TH 1HJBC 1MWAH 2DQIH 3LN4B 4L18A 3L5HA 1M1XB 2ZD0A 4NAQA 4KJPD 1V3LA 3O3DA 4M6AA 1Q1JL 2I32A 3K80A 5DHMC 5E1AB 2VLRA 3LIUA 3B9AA 2DRUA 2OYMA 3MRJA 1K9TA 4GKZA 5CJQL 4IBTA 5A7BA 3LOWA 3LQAC 4NI6A 3T1FA 1GL4B 4LO9A 3PWPA 3L1OL 5BVPH 5I1EL 3RNKA 3GSVA 4J2XA 1GH7A 1WHPA 1HHIB 2DM2A 1NCNA 2YMXH 4PPTA 3N41B 2OSLB 1H3GA 5I82A 4GO8A 4Y4KB 4QHKI 5IQ7L 4HG4K 3VFVA 1BZ9A 1K4CB 4PY7B 4OCLC 3VXNB 3HR5A 4LGRB 3NFPB 3IDXL 3VRJB 3QYCA 4UM9B 5IOKA 1V7NL 2HWZL 4IJTA 3OLEA 4GMTL 2B1AL 2AXHA 2VERA 2VLLA 4G7QB 1URZA 1BLIA 1DVSA 3M17B 4D0BA 1SUHA 1UA7A 5EOCJ 4L1LA 4G82A 1NIFA 2K0RA 2HRLA 1QP1A 3FT3A 5L9DL 1IBBA 4I5BA 2H26A 4JHUA 3LPOA 2VABB 1R3JB 1MWAL 2DQIL 3VXQB 3SD2A 1GSKA 5C9KA 1P5VA 4HCRA 3L1EA 2NLJB 1IC5H 3MJ7B 3W0WD 4E9XA 5DJDB 3OKKB 1WF5A 4DGVL 1S7RA 1VPOH 3L54A 4P2RA 5KJ4A 4WWKD 4I48A 3X1GA 3K6SA 4UNVA 4X80L 2CBTA 4IRZH 1KEGH 1S7QA 3S96B 5KJ7E 4K23H 5ADOL 4HSCX 2DMGA 2BIHA 5G4MA 4Q8BA 1MRDL 4WKZB 3HNTL 5FYLH 1WS7A 4O4YL 4AYDC 5J13C 2FATH 1L6XA 4M6MH 2XXFA 3US9A 4GMSH 5DLML 2DDQH 1BOGB 2IIJA 1OHQA 4RZKA 1PVHA 3GMPB 4JG5A 5ACZB 3EBGA 2WCPA 4ZT1A 4G6AC 5ANMB 4ZUVB 2VYRE 2F53B 4N8VA 1ACZA 4NUPA 4X7DC 1J9SA 4G8GB 2NY6D 4W4OA 2JTDA 5GGRY 3HG1E 4X5XA 1VLXA 1WTGT 3Q6GH 1I7UA 5B3JF 3MNDA 4NQDE 1CR9L 2ORBL 4HLZG 4M61A 3IT8D 4PJEF 3V4UH 1BQHA 1INEL 3TCTA 1DBJL 4XAKD 1A64A 1XHHA 5BQDA 4Z3TA 3SE4C 1FNLA 3NJXA 4NKMB 1Q90A 2HFTA 4AYMC 1ACYL 3SO3C 1Z3GH 3F00A 2C9VA 4M00A 2EVIA 1FF5A 3CNKA 3H9HB 3IGUA 1LEIA 1PKOA 5FFOA 2VSDA 1D6VH 2Y4SA 5I1CL 4RISH 4XZ4A 2GABA 4Z7OB 1PKQA 4HXBH 4L8SA 1NCAH 2OX5B 1A6VH 3Q5TA 2VLJE 3U9UB 1NC2D 3WLBA 2CIKA 2R0ZH 4TV3A 4E9SA 3QEHB 1MQKL 1LE9A 3FFCD 5F9WC 1PDKA 5CJOH 1E6JL 2XFXB 3F12B 4G8EA 3G9AB 5GJTH 3II1A 3ZQ9A 2AMGA 3LPFA 4UAOC 1ZTXE 5TE6H 1HAWA 4LSVL 2F8VA 1JE6A 4JCLA 5DFVC 2DQJL 4Q2ZA 1E2ZA 1KT2B 4CNIA 2LABA 5HBBA 3T4AB 5IW3A 3CJJA 3REVB 1S8DB 1XF4A 3MXVH 4NKQB 1PFOA 2VXVL 3FCTB 1MF2H 3EFFA 5HGDB 3ZN6A 3L1GA 3GSQB 3WG7B 4OAWB 4Z3EA 4U1IA 2HKAA 1CD1A 3HW7A 1HHKB 4UM9D 3TZVA 4K7PY 1SEBA 2H41A 2K70A 4B5EA 5A2BA 3WELA 2WQRA 2UY7B 4Z95H 1G9EA 2D7TL 1YN7B 4F15C 1N5AA 5A40E 2GG1A 2G2NA 4ZO6A 1J88A 1DJZA 4Z7QF 3QS3A 4JN2B 3S3BB 1XGPA 3A6CL 1RK1A 2VXSH 1TCMA 2Y2TA 2DYRB 2XU9A 4R6UA 2XN9A 5D2LA 2G4EA 1JHLL 2VZUA 2FX8H 4Y16A 1F4XL 4KY1H 3WYRA 1BJ1J 5CIPA 5T1JA 5DRZB 4BZ2H 1M3JA 2WLLB 4DIXA 5D7JA 2E27H 1SHMA 4POZD 1NMCB 4CA4A 1ADQA 1ASOA 4L1TA 4R96A 2ARJB 4GH7B 2R0WH 1DVXA 3GPSA 4QXGH 3WNMA 3RU8L 3H9SD 5I76B 1TLMA 1KCLA 5DJCA 5IJVA 1BYNA 5FK9A 1KIPA 5GJTL 2UVEA 4XCCL 2BX5A 3I6GB 5D7JB 5DK2A 4PRIA 4FFYL 3FOLA 4UU9B 5C0BD 2LU4A 3TH2T 3TVMB 1DSWA 5I8KH 3V0IA 3VXSA 1Z5HA 3PAUA 3AXLA 1UH3A 3A4DA 1RAMA 4J3OF 2IWKA 2UXFA 4F24A 1M9WA 3EJSA 3GRGA 4LEEA 4PCKA 1U3YA 1DFBH 2Q6WB 3TPUB 2CM6A 4FG6C 3R06B 3U36A 3VNZA 3BOVA 4TTDC 1ZPUA 5E2VH 4X80H 1KEGL 4NXSA 3I9AA 1OZTG 3SDXE 2J57A 5JOFB 3MO1A 1G0XA 2HFFA 1QUNB 2JKJA 4D0CA 5EBMB 1EXUB 2ERJB 2XRAL 4ZNEE 5JQ6H 4Z7WE 3F65A 1FLRL 1R46A 3M1CA 1E5YA 4JO4L 3KL0A 1GZQB 3FTSA 3QIWC 1U95A 2IFGA 2QQKL 1EZVY 2PR9A 4XXCA 5E2TH 2KLTA 3D2UA 1MXDA 1DUYA 4OJYA 2YUVA 2YQ3A 1HL8A 1P9MC 2XFXA 2B3IA 2BIIA 5DUBA 3KYNB 5B3NA 1E6OH 2Z8VC 2F54B 4ZS6C 3RTQD 5HHQA 3SDAD 1B2WL 1RVFH 4PJ9A 2ATPA 5T5NF 1T5WB 3CWGA 2CH8A 3TA3C 4F57H 5I15L 2HPOA 1EO5A 3MV8E 4B6ZA 4XBGA 2QSVA 4PJHF 2E6QA 3WL9A 4RFEB 2EIKB 1D7CA 3EO0A 4WUUD 5K9KA 3QJZA 1A4JB 5GGSB 5L8JB 3NG5A 2X4NB 4MJ2A 2H45A 4KV5E 4ONOA 3CLWA 1QPPA 4A37A 1DO6A 1KTBA 4JDTH 5C86A 5FM5O 1QWUA 1BGXL 2AJSL 1WCQA 1NC4A 1GOHA 3ECBA 1KLFA 3MNWB 3SDXB 1TETH 5DJ8A 4DK5A 3SPIA 4Y7MA 2W81C 2VDQB 5FA4B 3MRKA 5FM4A 1YEIH 1BQRA 2GTQA 1UZGA 3MXVL 3DARA 2P47B 3AG1B 3WS3B 3B9KC 1M2OA 3PWPD 5DD1H 4TUJB 2X4QA 1QQDB 3Q6FA 3D2UD 1F42A 1D5XB 3TBYB 4KJYB 1TCRA 2R1XA 1S2EA 2BY1A 3GF8A 4U6XA 4R26H 1LO3H 1AHWB 1AJ7H 2ZWKA 4UZUA 3H3PH 4MXWH 1QO3A 3WSQH 1J5OL 4LEXL 1XGUA 3MLSL 2G9HA 3ILDA 2Y1YA 4XCEA 3GSUA 1IT9H 1AYOA 3AU0A 7CGTA 2VXQL 3FMGH 2AW2A 4KVNH 5EEVA 3GMRB 4WFGD 3ECQA 3PGCB 4U05A 3S36L 5LNDA 1Q0YH 1J1OH 5GGSA 4OFYA 4OF8A 2EKSA 3RY4A 5T1LD 4Y5YC 2EZ0D 4QO1A 1KLGA 3QI9D 1SYSB 3BAWA 1EMTH 3Q13A 4JQIL 1A22B 3J27A 3QIBB 3IDNA 4Z7AA 3W0WE 3QHZH 1E9OA 3L5WA 4S10A 1HIMH 4WU7A 1KLUA 4OZHF 2JIXA 5AEAA 3PRZA 1J1XL 5DUJA 1HWGB 4DERA 1PLGL 3PGDA 2OLDA 3NP3A 1ML0A 3P73A 4MD0A 3MRQA 3KYNA 4OM1L 3ZLQC 1G7MB 5KYXA 4MNQE 5AVZB 1DUYB 4AMXA 5K9QI 3LZPA 2NNFA 1HXKA 4PJBB 1E7UA 4RLDA 5D6DA 4U7KA 2WNXA 4FI7A 4OZGF 2OMUA 3PHQB 4F7TA 1PKQB 4OIIH 3O9WD 6CGTA 3QHFL 1YEFH 1F3DH 4PIBA 3PP3K 1EJ8A 1HKFA 1M57B 1QUNA 1QATA 2MCPL 2EDNA 5BCAA 3RDTB 1NOAA 3HIZA 2XVLA 1JWUB 1JFQH 2APWA 4DOHB 1S7TB 1M7XA 3MLSH 3O11B 4IRSB 4KBPA 4OCNC 3V7AG 1A7OH 3APFA 2OM5A 4LDLB 4IOSA 2Q0ZX 5D4HA 2OZNA 3CXHJ 2YSTA 2QQKH 4KFMA 1P6AB 5IFJA 1P1VA 4BQ9A 1JGUL 3MRIB 3N44B 2YPLA 3AY4A 4WWPA 5CHNB 3QEQA 2KZKA 4PRIB 4V1DD 1YEWA 2LU3A 4KKLC 4AUYA 1KCKA 1MFAL 3ESVF 1BJ8A 2DM3A 4NWUL 4P2RE 5HGGS 1FL3A 3OD3A 3I75B 3GJFA 3V9CA 4JHZA 4J6RL 5KSBF 1VFOA 5F1IB 2R2BA 3RWFA 2HVJA 3TBTB 3ULAB 4C47A 5B38B 1Z9MA 1CE6A 4YR6B 5ESQB 2GPZA 1HDMB 2X7LA 1C16B 3FCBA 4PY8I 5I6XC 5D72L 5IJKC 1MH5A 4G7RB 4TN9A 4E0RA 1ACCA 3E8UL 5I30H 1W72H 3GTVA 4PJ6A 3S8GB 3VFSA 1F4HA 4MZIA 4G3YL 4HJTA 5T1LB 5HYSA 3QZWG 2UWEF 3UTOA 3N42F 1E3XA 1J8HA 2W94A 4I18B 4N5UA 1AO7A 4ATTA 5MERA 2H2PD 4M5ZL 5HHVH 4UT7L 3FB5A 5C7XL 4RGND 2J2ZA 1G87A 2IV8A 4MDJA 2VR5A 3JWDC 1H8OA 2PCFB 1G9NH 3A5VA 2VLMD 1OT4A 4HETA 4NO2A 4IOFC 2OQJA 3OX8A 3QH3B 1RZ8A 3MLXL 5LBGA 4MB5A 4ES9A 2AFNA 3C9NB 1GGYA 2AJXL 2XA8H 3NJIA 1N0XL 4GKOA 3RWIB 4JL1A 3NSJA 3QUZA 4PB0H 2IH3A 1AJ7L 2YPKA 5D1ZD 2QPEB 2Y5QA 4HCIA 3K72A 4MA1C 5IJBC 1WGOA 2W91A 4XNQB 1YMMA 5F7MC 2FVNA 2IQAA 4GW5A 1RJLB 3LNEA 4YLQT 5TQ2L 4YEEA 5C0FA 5TQ0L 2A74A 4MMXA 2QADD 1N2RB 4P2QD 2X0UA 1IQWL 1ZMYA 1TNNA 4QDGA 3CDCA 1BQ5A 2VQ1A 5L88L 1M71A 5ICZA 2H32H 4WENB 4I0PA 4JS7A 5I8CB 2EDHA 2QHRL 1DLHB 4S11A 4C4KO 1YQ2A 5GZNC 2NR6C 3QULB 2FQGA 4X6CF 4G43B 3KLDA 1N5YL 3OHMB 1AZRA 1A2YB 2RR3A 1MY5A 4P05A 4Q89A 1TENA 2OSWA 1KZYA 3BZFA 4FG0A 2J6WA 2MCAA 3RI5F 1JTOA 3WKQA 5DHVB 1HI6A 1S9WB 1H6FA 1WS8A 1N0LB 3FHAA 3TA4D 1OSZB 1D5ZB 5E6ID 2VRAA 3MCLH 1P7KA 4UQAA 3BRDA 3NK3A 2BVYA 4NQCA 4OLYL 4K7FB 3ZJAA 4AMWA 2CMRH 1JMZA 3WIAA 1UM5H 1ESOA 2ZNXA 2IWGA 1OLLA 2DQGL 5CLTA 4OUUA 4U1LB 4J4PD 1JZ8A 2EXTA 5EBWA 3MLPA 3LH8A 1XEDA 1R3HA 4J1UB 3LRSA 4Q9CA 2V9QA 2ZUQC 3BUYB 1TZAA 4IBYA 2GYSA 4K5LA 3RURA 3U48A 3L6FA 1OTUC 4FZEH 1I3RB 3MOAH 4OLWL 4LVNC 3T3MB 1IFRA 1JDCA 4ZW5A 1IVTA 1BP3B 1M53A 3ESOA 4PJ9D 5A1AA 1O7DE 1JGDB 2BOCB 4XVTH 3UYPB 2A9MH 4XO8A 5DC9B 3SE3A 1VZGA 2Z31C 1E9PA 1T7WA 2YGNA 1EBPA 5CCJA 1X5JA 3TWYA 1IGMH 1WZMA 1PNDA 1WFOA 1CDUA 3UFIA 4P5KB 3ZXAC 2PXYB 5JIQA 1KC5H 5HY9A 1YNLH 2Y06L 1R24B 3W9EA 3BC9A 4BK4A 3KPMA 2DKUA 4HK3J 1OV8A 3MACL 2XPGB 1SF5A 5ADPL 2X4RB 1AC0A 1OQXA 1U3HA 4JL2A 1OP5K 3OTTA 3TV8A 4HUNB 4JM4L 4K8RC 3GSRB 4OF3A 2BHUA 4RMTA 1QFWH 5DYOB 4P5MB 3U0TA 5KSAA 4EEEA 3BVTA 3LCYA 4LU5H 3VQ2C 1FG2B 1FYTB 1QBMH 1R34A 5E23A 3D39B 3RA7L 5GJSH 4V1DE 3QZMA 5CP3A 4B9ZA 3N44F 1U58B 4UOZA 4JKWA 3LMJL 2D8KA 2A6KB 3AXHA 4XB3A 3P30L 1TLKA 3A6BL 5DDHA 3QI9C 5IWLC 1XZ0B 1SDDB 2R4SL 2XZAL 1JCKA 3GSVB 2ICES 3V0FA 3QJSB 4JDZA 2R83A 3DGGA 4LL1A 4MZ3A 4PS8A 4YDIL 3DX0A 3B2UC 4FTVE 5C0RH 2J56A 4BELD 1EGJH 2PABA 3FU8A 1LLAA 2FK9A 1QPXA 2E7CA 1BVZA 4FC3E 4JZJA 1NUDA 2KQMA 1UXSB 4I9XA 5EBLA 4LLDA 4NZDA 1UJ3A 3INOA 4FI8A 2Z1KA 4Y1AD 5E51A 2VL5A 4Q9RL 1FDLH 1JZGA 4ODXB 4P4KC 3UZEA 4XVTL 5AVRB 4YNYA 4KH9A 4ODBD 4U7SA 5HY9B 4YOKA 3B9KD 2BZ7A 3WS6C 1LM8V 3ARBC 1OTTD 4FFVD 1BFSA 5T1LA 3V4PA 4XC1L 3S48A 1HFUA 2ED7A 4PJFE 4TNVK 1L9SA 3OZKA 2P45B 4LL9A 4NQDA 43CAB 2CDGB 4NQEA 2ED9A 4EVNB 4LCIH 4O2FB 1VHPA 1HDMA 2X7LB 1LWHA 4XHJC 3VD5A 3KWVA 1GC1H 3PWNA 3FUNA 4HUCA 5H37A 3ARGA 5KEZA 5F1NB 5IW1B 5E9DD 2IBZX 5ICUA 1LL1A 1UQSB 2EIDA 2P7TA 3QFDA 3GXPA 4MNQD 4YE0A 1SN2A 5GS2D 3V95A 4YK4C 4MHHI 3QCUH 4ONHA 3FZUD 5E8OA 4G80B 4B0MM 3PUCA 3BH9B 4FXKC 2G60L 3LZRA 4LPTA 2C1OB 3V6OC 1XSKA 3PWNB 4LIQE 2X6MA 2VH5L 5I5JA 2EE6A 1DQTA 2IEPA 2X42A 1WRFA 4F33B 4KRPC 4NQEB 1V05A 2CQVA 2EVHA 5D8JL 2FGWL 1CI5A 1V3MA 4HD9A 1MFEH 4QHUA 4ONFH 1G7PA 1II4E 3V5DB 1N0LA 1T5XA 3SPHA 1DEEB 3G08A 1UC6A 1GZHA 5KSAC 3IDYB 3RL1A 2GW5A 3MNMA 4A39A 4DTGH 3NBNA 5HVFB 4OV5A 4HUWA 1I1AD 3LKSB 1A6ZB 2VLJB 4E5XA 1ZA6A 5F0JB 1OAZH 1EUUA 4G43A 2EECA 2FUQA 4HJGA 5D96C 2ADJB 1J5IA 5IMLA 1QLEH 2XQBL 3WTUA 3ZYIA 1ECZA 1MOEA 1NUFA 1LD9A 1RPKA 2D2OA 4XBEH 3RWHB 3VXRA 2FR4B 3SZKC 1VPOL 4H0IA 3SE3C 5IOPB 3IE4A 2JK5A 4PJDB 4Y9FA 4XC1H 2JKRM 35C8L 4HFWA 1HXMA 3CSYA 2UZYA 2B59A 3QDHA 2AVGA 2AEIT 2FX7L 4WUUB 4L3CB 3UBXI 1DJGA 3GS4A 3WEMA 3ZIMA 1NEUA 5K59E 4ZMZA 4XH2A 1ZS8A 4ANVA 4BFRA 2WSDA 3PAYA 3V6ZB 2UXTA 3SZ6A 5C2BL 3EJCA 3O4LD 4KAQH 2AI0L 2EO1A 3RGHA 3KGRA 4TVPL 2A5UA 3LKQB 5C0DA 3BHBB 1SOSA 2WTPA 4D8OA 3RWEB 2IQ9H 4ALAL 3ZRFC 1MHEB 4LLWA 2NXZC 4XRCA 1TSRA 1QTYT 4QXVA 3GMMB 2OMYA 4Z7WA 5EN2B 4K3JL 4O2CA 4UV7L 2XY2A 1QI5A 3WFEH 3JYBA 3O2VH 3VU2A 3ZO0A 2EIBA 1K3ZA 3ARDC 2YARA 1Y0LA 4E9RA 2E86A 5B7FA 2W07A 4X4ZA 2DTML 3ML9A 2GUYA 4WRLA 4J12A 4AK2A 5BUPA 2ERJC 5F7NC 5ANME 1I4FA 4WV1A 2O61A 1B0IA 2J6EA 5IBUB 3AMLA 1YY8A 4FQXC 4UTCA 2I7OA 4P5KA 3WTTA 3NCYP 1H9VA 1M7IA 3MV7E 5I6LA 1AS6A 1DVUA 4PFEA 3TH4T 1UZ6E 3FQNA 5DZOA 5EU3B 1JIBA 1USQA 3D7PA 1QLEL 3BUQA 4M9OA 1N6UA 2R8SH 1EV2E 2Z64C 4YXKL 1TZOA 2RHEA 4QRBA 2ZKYA 2OXHA 4AEIL 3STLB 3P2BA 1OD9A 3OSKA 1ZE3H 4AQ1C 1Q9OA 5J9PB 2DYPB 3ABGA 3BE1L 2J8HA 5BQ7B 3FK3A 1N3NA 1CDIA 1YG9A 1FPTL 4LRIC 3T3PE 5IQ9B 3KYMA 4O5LH 4EI5A 3A6OA 1F4YH 5FYKH 5IB5B 2IGFL 3MRKB 4NZTL 5EZOL 2SEBA 2ZYRA 2C9RA 4Z95L 3KBHE 1XGRB 3HJEA 3DUSA 3LQZB 2ZUQB 3IB4A 1BG9A 4P9MH 3TT3H 4JO3H 1L3WA 1EEYA 4G1MA 4OKVB 4YUEL 5LG1A 1JSYA 4LQFL 4U1MB 4HUUB 1Z5LA 4WHYG 5DVKA 4PWHA 2FH6A 4EI6B 5I6KA 5IP4A 1ZV5A 4HGWB 4NOFA 4Z0BL 2D4DA 3CU1A 4XNBA 3P77B 3OJDB 4L9LA 1JWUA 4QHLB 1TYJA 5GGQL 4TRPL 3BX7C 3ZE0F 1A6AA 4X5WB 5IVNA 3BD5A 3CXDH 4ZUWA 2CBPA 5IB3B 4RBPK 4N5ED 1OE2A 2VH5H 3HFMH 3AQXA 1HOCA 1HCZA 1FYTE 1ZDQA 3CK0L 3CN3A 4OD3H 4QXGL 4TUUA 3VI4F 4E5XG 3INUH 5DK0A 3ARFB 4J4PC 1H15B 3HKZA 3N5AA 5D2NE 4B27A 1COBA 4O02B 5BNXD 5DQ9A 2AJUL 1DCLA 4NX0A 3RIKA 4FNTA 3B3BA 4LGPB 1IFGA 2YAFA 1HZHH 3FT4B 3LRGA 3BVNB 4E9YA 2F9BT 3NN8A 3QEQD 1OAZL 1VKXA 3L4TA 15C8H 3CSGA 1FO0H 1N7ML 3GSNB 3MRRB 4PRID 5I74B 3SDCD 4QRFA 5EBMA 4QY8B 1AZUA 4D9LH 3UAJD 2ZX6A 3S5LB 4AC2A 3LN5B 2ZCLH 5IBTH 2OMZB 3M7OA 3WHE0 2XJKA 3ARTA 3KLLA 2EKSB 4GAJL 3CZJA 3GKWL 4M6NL 4M8VA 3B2VH 3MJ9A 3QUYD 4DCQA 1C1EH 4CVXB 2D0GA 4ANKA 4YHZL 3Q8BA 4AV5A 2WUBL 3R1GH 3HRPA 3IRPX 5CFAA 2QADC 1UJTA 3Q2CA 3Q8EA 3MA7A 3S2CA 4XP9H 4FFYA 2H8PB 5HHOB 4ZAKD 5EEUA 4PV1C 4EN3B 3N41F 3OLDA 3TC9A 4M3JA 4JM0A 5C0AA 4QKTA 3WUWG 1OAJA 1QFWM 3PWVA 2XVKA 4GB9A 1GS6X 4PQXA 4N6RB 2B1AH 1ZLEA 3KPTA 2E9WA 1WZLA 4P4KD 4XNYH 1LJMA 5FYKD 1F6AB 2OJEB 3KLSA 1TQCB 3MJ9H 4HUVB 1KCSL 2CAKA 1KLFB 5DD5H 2DLIA 4Q6KA 3FUIA 1WHOA 2JELH 3QXAB 4N26A 5JUEL 3SDCA 3DVNB 2D0HA 1FVEA 3FCSA 1XR9B 3HLAA 1BZQK 2AAVA 1RK1B 2ZP0T 1XB3A 4TQEH 3VXUD 3DGDA 2IFFH 1NCIA 1KGWA 3KHQA 5KBLA 3JTTB 4IRSA 1BIIB 2KDGA 1MW2A 4C58B 2ZOUA 3B2VL 3UG4A 3LSOA 4FXKB 3ZT7A 4ENED 3FPYA 4PW4A 4HOZA 1UKTA 1PL3A 3U1QA 2HLFD 1SXZA 2DDQL 1OT1A 3EXJA 4RX4D 2XPYA 1Y07A 3TFKD 2OMTB 3NESA 4KJPC 1JPFA 3F7QA 4HIHB 3APNA 4OFPA 3CFMA 4C83A 4ZMAT 1U2CA 1ZGLA 3TT3L 2A99A 4FG2A 3MRQB 5GGTH 4JPSA 4HIJA 3ZR6A 3EXLA 5TGBB 1NIAA 2ORBH 3QEHA 5DVLA 3PGDB 4OGAC 4YXHH 2DJUA 1BZ7A 4N0RA 4RMVA 5B1KA 4OTXH 4MDIA 4N28A 4Q6YA 3GSOB 3RWDB 5E9NA 1U8JB 3PABA 5A16A 5KS9F 3MV7A 1NMBL 4PJ5A 5K9OA 1P84J 2UV3A 3H6JA 4JFHD 2P8LB 1EFXA 5CKGA 4W9EC 3G6AA 2FZ3A 4JFFA 4R5XA 3IDUA 3RYMA 5DD0H 2L04A 4PGBA 4YO0B 3S88H 2J1KA 4KUCD 2BHFA 4PJGF 1OAYL 1KIUA 1TEFA 4YAQA 1CBJA 5HHOD 1X4YA 3SJVD 5AB0A 2GJ6E 4EE2A 2OPCA 5TH2A 3FU7B 5EF0A 2NY5H 4AOFA 4YDJB 1PY4A 3JWNG 3PU7A 2BP8A 3RZCD 1ADWA 3RY5A 1MJUL 4IU3B 4Q6IB 2A9BA 3QI9B 5DUML 1AR1B 4U6XB 4PJ5E 1RU9H 3KYMB 3P2DA 2VUKA 4IHBA 4PP2A 3VI3E 5HDQL 2NQDA 3AT0A 1GOFA 2NT1A 1P0SE 4G8IA 1MW3A 1MCBA 5DFWH 3FQTA 1YEFL 5I0ZA 3PLYA 1BFVL 4PJIA 3BUIA 2NUPA 2HJLB 3CVCA 2DEWX 4MCYB 2EDFA 2VW7A 3LVTA 2XBDA 3LKPA 3UBXG 5JR1H 1HSBA 1OP4A 4XMXA 1CFSB 1PYWA 4APQD 1RZ7L 4M8RA 5J12C 1Z1WA 4DSYA 1NFDA 3O0LA 2VDML 3W9DA 3E6FB 2M2DA 1RMFL 5EIIB 1NL0H 1PSKH 2OULB 4XC3H 4G6MH 2V5RA 4YO0A 4C8XA 3UCRA 2IH1B 4PD4J 3RPBA 5FO9B 4PJXF 2AXGB 1BVNT 1CFQA 3SGDI 2OMZA 1L7IL 5C0NC 5CNHA 4ODTL 3FPXA 4PWJA 3QUML 4O58L 4QRRB 1OWWA 3VG0H 1P5UA 1A0QH 1MCFA 2H1XA 1U8MA 2XWJA 3KM1A 4BK5C 4S1RL 4ZW8A 4ANWA 3VXRE 3STBA 1BZ9B 1K4CA 2HTLC 1WK0A 3EJTA 4X83A 2NY5L 3UGEA 2DQFB 2Z93B 5EORL 1ZTMA 3CZKA 4ZSOE 4YWGH 4F27A 2AK1L 1T1XB 3LXBA 2GSGB 1L6PA 1CYWA 2BVEA 4WTZG 3BI9X 2Q10A 4HCFA 5CGYC 2GITA 5EB9A 5D5MA 1P53A 3COOA 4XI5C 5D72H 1KPVB 5EZLA 5JA8B 2MPAH 3GO1L 1NC4D 4MHHG 4L48A 4TQEL 1CWVA 3IMVA 5CEYA 4DGVH 3C8DA 1WIPA 3G04B 3TONA 4MDRA 5C6WH 2DKMA 2HLFC 2H2SC 4G3YH 3UC0L 1VACA 1ZT1B 2F7IA 2HFFB 1CI3M 3KWUA 1HNGA 4HUKB 1ZLUH 4DP6X 1WV7T 3FTYA 4E9TA 3NSXA 4QXTB 3UBGA 1OGTB 1XH0A 3L81A 4WNSA 3QZLA 4JMNA 4YX2L 3TTSA 2YRLA 5GRJH 2OMBA 1X9UA 3HB3B 4F7PA 3KJ6L 1QUPA 4OSUH 1R9FA 1Z3RA 5FHBL 4AC4A 2H0PA 1HCVA 4MASA 4ZUVA 2EEFA 2NX5A 1NCOA 4PSRA 5E00B 4AIOA 4F33A 4ODWB 4JRYA 2IAAC 3PFUA 1IEHA 2PYEB 1VZIA 5IJVB 2Q20A 1JPGB 4M1GH 5K1JA 2Y1AA 1TQSA 1YEDB 4G80A 2H3NA 4WKZA 4PGEB 2KHAA 3AXIA 1H8LA 5MHSE 2C3WA 5AAMA 1CLZL 3H3BC 1UWXH 2ITEA 3HJ0A 4NAMA 3OKLB 1ZLSH 1AFVL 1JXKA 2VDQH 3BGAA 4XCFH 1AZZC 4JR9L 4EN3A 1N8OE 1A6VL 1Q72L 4MMZA 2CUAA 5F3HA 5JXEA 4GRWE 2H7WA 3QQ9C 4DVRL 1VERA 3MR9B 2M26A 4GIAA 3X13B 5JIMA 3G6JA 2I60L 2EDMA 5CN1A 1B6UA 5ACMA 1NAMH 3IU3B 1THCA 1M7IB 5EN3A 3T2OA 3D39E 3GLZA 4KI5E 4W9CC 3ZTNL 1O75A 1PEWA 1CLVA 3LIZH 1JGEB 4LKCB 1RZIB 3HI5H 4X7FC 4NN7C 4DCQB 4OLXH 2BH0A 1JPTH 5F7FA 5K39B 1RULH 2VERN 4M8QA 2AMUA 3DHUA 1N5AB 4P5SA 4P2QA 1KWKA 2VLLB 4H25B 4NRZB 4TNVF 2GSIB 4M6OH 3GSWA 3JSSA 4UM9A 3VRJA 4UINL 2WXNA 3BVDB 5KVGH 5DD1L 4RBPH 5F1KC 3MOQA 1QACA 1S7SB 1E28A 3ARUA 1A3LH 3SDCC 3FFCB 1T22A 2R69L 4OLZH 1G9NC 1HHHA 4WI2A 1R0AL 1HQRB 3BP6A 1B3IA 3O2WL 4GQ9L 5FGSA 5KVEL 2ZX8A 3DGGB 3FF7A 3D05A 1FI8C 3G9VA 3BZEB 1CE1L 1BMWA 3FFOA 5AW2B 1AXTH 4PV9A 4L3CA 3KLHD 4N0FB 5SX5H 5IEHB 2C26A 1ODAA 2VLRB 3F7VA 3LZFH 3DTXB 3UYRH 2E47A 3HE6C 4JVUA 1KMGA 1AZCA 1MFBH 2VDLB 1T4KB 3Q0HA 5K1VA 2ZUXA 1EMTL 2B2XL 1YNLL 3IDJB 3QGVA 4UT6H 4GSQA 4ZXBD 2P5WE 1ZE3C 3B34A 4HKBA 1MI5B 2C9SA 1N19A 1AD9B 4FXTA 3DX7B 4IEFA 4NKMA 2RAMA 4KXDA 4L3EE 4JM4H 4M93C 2PW2B 3MJGX 4NNPL 3ZGIA 3MRHB 4CKVX 1MCRA 4MGXA 1FJ1B 1E8YA 3SOBH 5JDSB 3WIIH 3CLFL 4D0DA 2WLHA 4MTMA 5T33H 4G8GA 4A63A 4D3CL 3L2MA 2OCCB 2X2IA 3TBVA 2ICEB 4N8VB 1CT8A 1TQBB 5HDBE 1QBLH 3IAGC 3MKGA 1ZVSB 4K9EH 4LLUB 4FNLL 4XP1L 2ZXWB 1S9VB 4NENA 1BOGA 3VYNA 1FYTD 1EGJL 2PCXA 3QIBC 4YGVB 5C0BB 2H5UA 4ODHL 2KERA 1KJ3L 2A6IB 2B4CL 5JIKA 3NRFA 2HRPL 4U3SA 4PMEA 5AAMC 3ARXA 4Y2NA 5E0QA 3BKYH 4ZS7H 4F3FB 4G83A 5BV7B 3DV6A 1WAAF 5EF2A 1LWRA 3BSZH 3C5SA 3SYQA 3MV8D 4HC1H 3TF7C 2WC7A 4ZOEA 4H88L 4PHXA 3MRHA 5BV7H 3VXOA 2WCGA 1BM3L 3TYGH 5ENWA 4OD2A 1K2DB 3JWOH 5FB8A 5HYSG 1V7NH 3EG9B 4JBSA 2FHBA 3LZQA 4J2QA 3UP6A 1E4HA 1MFAH 1AE6L 2AJVH 1Z9OA 3ES6B 1IBHA 3V5KB 1EZVX 5C09D 3FOMA 5HD8D 1NANI 1Y0LB 4AV4A 3UBXB 2DV6A 3F7VB 4JFEB 3FB6A 5L9DH 1CXLA 4YN3A 3H53A 3IJSA 1XTLA 4TL4A 3MV9A 1N4XL 4RFNB 3LPGA 5DZPA 1TVBB 1N67A 4NBXB 4BE5A 5I30L 2ZJSH 3QAQA 2BNRE 5AAWC 3KYOA 3VWJA 5JIDA 2VM4A 2ZAHA 4K71C 1KDJA 5C0AD 4V2BA 2NOYA 3EOAB 2BZCA 3OGCA 2LGNA 1RPQA 2IBBA 1BBJA 3MUZ1 3OKNB 1KEMH 1JXGA 4MNQB 3QZWA 5D93C 3EYFB 2O5ZL 4ZXBB 1T22B 2JJSC 4AT6A 3FQWB 2V9RA 2ZG2A 4Y2OA 3O3DB 3UGXA 1UFGA 5I8OL 3C08H 1QLRB 1LQSR 3KXFD 5ICYA 1SY6H 1GJUA 2EDJA 3LN4A 4HQQL 3WFCH 4X5QA 1UZ8B 1NFDE 4PJHE 1KXVC 3ULUE 1IZKA 2ETWA 5KSVB 3HE6D 4MQTB 2OW7A 2YKLH 5D96B 4CAGA 4LKCA 1FNFA 3H3PL 1ZA3A 5C0IB 1XCWA 2XLLA 4D8PB 4YDKL 3FSOA 4U49A 1RUQH 1QKZH 2GKIA 2V4LA 5CSBA 3II3A 1KELL 4MAYD 1SLVA 3B9DA 2FX7H 3F3HA 5AZ2L 3IPEA 1AD0B 3QDJA 1BQLH 5F6HI 3HC3H 4XWGL 4YDLC 3DHPA 5B8CA 3PP4H 4MKMA 4EDXB 5IFHL 1J1OL 3FTUA 3UBHA 3KYKH 3GUTB 3ETSA 2XWTB 2WIIA 5F97E 2L8AA 3BH9A 3BFOA 5C0BA 4M8UA 2DQHH 3B2DC 1IGFH 2XACC 2H32B 2YBGA 3RY6C 3KPLB 4PLJC 1GY2A 1ZVYA 4P3CH 4Q56A 4OFQA 2PYEA 1SJVA 2X4SB 2YK1L 1KXTB 3BMVA 4G7VH 2DQJH 4NQUA 2CDGA 4HC1A 2ITDB 3FKUS 2PETA 4OM1H 5CZXC 3I9IA 3X12A 4OCSH 1SVCP 4F9LC 2ZUTA 1NEPA 2KL6A 3NCBB 4JKPL 1KYFA 5HYJD 2IADA 5KSAD 3S3SA 2YXVA 2YXFA 1M6OB 5FO7B 4KRPB 4P5RA 1VENA 3S5LG 1XGTB 4XCNB 3R4RA 4JE4B 5H2BB 4GG6E 4N2EA 2N56A 1NCBH 2YMTA 1S3KH 1L9RA 2JQMA 3K4DA 4ZFGH 5CR1A 4FJZA 4PWEA 1R5IA 1UXSA 3Q3GA 4UAHA 3C5JB 4FZEL 4OLWH 4HP5A 4YC2C 1BQKA 3UG3A 4BSWA 5DEGB 1I8KA 4GI9A 1U8KB 5I16B 2I07A 5DJAA 4LKXA 1RUKH 4XWGH 3D69B 2A7BA 3FFCE 2DI8A 4AZUA 4OFKA 4EF3A 2E0PA 3AU1A 5CBEB 4G9DB 1U2HA 5DD6B 4ZPVB 1YMMB 5JIIA 4XR8C 1KY6A 1TUPA 2GTZB 3D0VA 3A67L 4PJAF 3BH8A 5JPNC 2YPLD 1T1XA 4LSRL 2VDLL 3RZCB 5LN4A 3QAZB 4LSQH 3OMIB 1OB1B 1PAMA 4Z76A 4Z7NB 1JUFB 1FZOA 3QDGD 1CFNB 1E0OB 1FZKB 1I3GL 2XWDA 2V17H 3QS2A 4I1RA 1P5UB 3QIBA 4MS8D 5INCA 4ZK8A 4ACTA 1GCYA 4GG8B 3ULVL 4J6RH 1SM3L 3GT6A 5HP5A 2GC4C 1CBVL 3SKMA 4IOFD 5B7EA 5A2CA 3QYMA 4KQ3H 1NFIB 2AGJL 4LCWB 1M56B 2L4OA 2J21A 4BINA 4BUHA 3TEZA 2APFA 1IAIL 1J8HB 2VKXA 4M5TA 3NA4A 3SE4A 1CYGA 1T80A 2ICWB 4JZOB 5FXCH 4OJEH 5AZEH 3AY4C 3FYIB 2VDOH 1SBSH 4GS7C 4ERSL 3ARPA 1UZ6F 5DI8B 2PUQT 3ARZA 3T0EE 2DJMA 4DT2A 1NM4A 1HHJA 3NCMA 4RGMB 5AAPA 2YMXL 1DDHB 2N0KA 3AT9A 1WEJL 2Y07H 4K8RL 2H3NB 2HTLD 3OQRA 4AZ8A 3BEWB 1KULA 4KK6D 3ME0B 3K91A 5IQ7H 2BCKB 5AD0A 1N7MH 3P0GB 2KC0A 1DL7H 2MQ0A 4WHCA 3QI9A 4QT5B 2UUDK 4LCCB 2ZXEB 1LWJA 1KPUA 2CSPA 1P4LA 1G5AA 1EA9C 5DJ8B 5EFIB 3PWUA 5HHPB 2XN2A 5ESAB 3CN1A 2VDKB 3M1BB 2NY4B 4YH6A 3V0GA 2WXJA 3MZGB 4RGNB 5AW5B 2FRGP 4I2XA 1ZLUK 1F41A 1Q9KA 3S37L 4EKJA 1YC7A 1I7ZB 3BZFB 3LRMA 4PRAA 5TQ0H 3HMWH 4P46B 2QDWA 4XBPB 4DN3L 2ATAA 5F71A 1H3PL 3F5WB 5I8EA 1NGZA 1FFOB 2NDFA 4JFVA 2AQ3A 1MDTA 2D03H 4NN7B 4ZQTA 1M71B 2PLTA 2Z31A 3HZMA 4TUOA 5D4QA 5E4AA 3RVVC 5ICZB 5D1ZI 2FE0A 3MV7B 1JD9A 1MRCL 1U91B 3S7GA 2HG5B 5ADOH 2XSKA 3T2PA 3MODH 4L9DA 3OKEB 3E80A 3PIQB 4PJAE 4JFZL 3BVWA 1F11B 4M6ML 5DGRA 3RVUD 3TO4A 5I1GL 4W81A 4LSTL 4BGDA 4UOW1 4UB0L 3UIYA 1GGCH 4ODSH 4TNEA 1NCCL 1BAFL 1EJOL 3H7BA 5DC2A 3S8FB 3AAZB 5C3TA 5MEQA 3RWIA 4X6DF 2CGZA 1RIHH 1Q4NX 1U93A 4R4BB 4HAKA 3EDJA 2GJZA 3BWUC 3HUJE 5SX4I 4IK7A 4FN0A 2KZBA 4X5RA 3ULVC 4NBZB 2X28A 4JB9L 5JOFA 1HINL 4UANA 2E5EA 3FRUA 4YSQA 3BWSA 4OQTL 5E8NA 3QORC 4P46A 1K72A 5KN5A 1Q1PA 3GMRA 4FGMA 4NYLB 3ASOB 4F7MA 3WHXB 1OGPA 3JVFC 2GC7C 1ETJA 1Q0YL 1B0WA 1AI1H 3MROB 3OZ9L 3WY4A 2V3EA 1NCAL 2D9QB 2GHZA 1JF6A 3DYOA 1LK3H 3PWUB 3DRQB 1E4KC 1M3IA 3UTZA 4HJ1A 2OMVB 4IKJA 3G6JE 2F53E 3Q1SL 3CD4A 2AK4B 4NZRL 3TBWB 4PJCE 3STZB 1J1XH 4G8IB 2GFBA 1I8MB 3LXAA 3VXPB 4ZW3A 5AW3B 1UH4A 2ED6A 1J8SA 4ORZC 3BN9C 4PVNA 4FNUA 4LSTH 2PR4H 1P4IL 4N24A 1GGCL 4ODSL 3B9EA 3LKRB 4TUKL 3I50H 1Z0MA 3DX8B 2WKOF 3FTWA 1FZJA 3D6GA 4PJCA 5F7WC 7FABL 1S5HA 1F6LL 5TH2B 3H1ZA 4KO9A 4V11A 1ZT7A 4L23A 4U4IA 1Z9SA 5DMIH 4L3EB 2P4AB 3D9AH 4S1QH 2DJ4A 2R8SL 4GO6B 1F90H 4I2XE 1CU4L 1F2QA 4CC0A 2PYFB 5KSBA 1PZAA 3L3OA 4JKMA 5CU5A 3PUUA 1P5UC 1F4XH 4KY1L 1KZQA 2FZ3B 3SGJC 3B8YA 5A3ID 1BX2A 3R18A 5F3BA 2O26U 3QR1A 3DX4A 5AYTA 3V6BR 2LTQC 4DGIH 2FLRT 4O00A 1E5BA 5GHWH 4TXVB 5DRWB 3REVA 1CTMA 4HIXH 4S1DC 3AJ7A 4PLOB 5CCKH 1SN0A 3U30C 5IVXB 5FUZL 2F5BL 5E5MA 3QC6X 2YQGA 3ZZSA 4HKZB 3SJVA 1TXKA 4E68A 2I85A 5IK3A 3QXDB 3GBNH 2H1LM 5CP7A 4MD0B 3KEDA 4JO2H 2XZCH 3CAFA 1CMOA 5CZVH 4W93A 1W9XA 4LQFH 4P99A 1OKEA 1CD0A 4L8SB 3ML8A 4G9FE 2WXOA 4KU1A 4R0LB 4PR5B 5FECA 5E2UL 1U0QA 3SKJL 4A2DA 5E6IA 3JUYA 4UDTB 5DD3L 4CMMA 3MRCB 5F7BA 4G5AA 3F85A 2ROXA 2NY6B 4GQZA 3VMPA 3WO3B 3CXDL 2G60H 3MTXA 1JF1B 1JZFA 1T20A 1NSNL 3W39B 5FPIA 4HJJH 5G55A 2X09A 3WGUB 3SJVE 1IB5A 2CLVA 1EEYB 4G1MB 1ANUA 4OKVA 3VXMD 1G9MC 1AGDB 2O5YH 3OAYK 2EUVA 1U3NA 4UYQA 4DFHA 1RZFH 1KGCD 3IMWA 1FZJB 1PCSA 2MOVA 2Q86B 1HYSD 1W72A 4O9HH 5E2TL 3L3JA 1NLBH 4LHUG 4KJWC 4WK0B 5DHDA 2Y7OA 5T1KB 3SYCA 1BF5A 1AGBA 2KI6A 4FEMA 2FEDC 1KIPB 5AD0B 5E1IA 1QW8A 3U2IA 5HHNB 2GQHA 4H8WL 2RFXB 2MNJB 2PWEA 4F9PA 3WOVA 3A21A 1A47A 3WAKA 2CJUL 2J8UF 1L9TA 2AHIA 1JVKA 2JH2A 3TNNB 4G6FB 4BJLA 2Q7AA 3VFTB 3N85H 2G5UA 3O6LL 3VXUA 1PLCA 4OZ4A 3CVDA 1JVLA 3MJ7A 2GBTA 3BISA 5D7IB 4BZ1A 4CJ0A 1RH8A 3FQNB 5EU3A 5FDWA 1NC4B 4WI0A 3O4OB 4I5BB 1UWGL 2X44D 1EBAA 3SKJH 1LO5B 3IKCA 5SX4H 2OXGB 3T08A 3QQNA 1XGPB 1E27A 4JREB 5GRJL 3O0RH 5AWNH 3IN2A 4D0BB 1A4JA 1H19A 3SE8H 5E8NB 1GAFL 2FIKB 4XPAL 4WW1A 2LLNA 3FQ4A 4BQ8A 2AV1B 3BQUB 3ARBA 3WN5B 4NN6B 2YLHA 5HVWA 3TH3T 1IEBB 4DP7X 5BXFA 5INCB 5IF0B 4GMTH 3DJZA 4M1DL 1SNRA 2YD1A 4RWYH 1OB1A 2IG2H 3CMOH 4UMSA 2WSPA 1CFMA 2R0LH 3FQ1A 4Y19B 3VUAA 5IKCA 3M1OA 5L7XL 1BBJB 1F3JB 1NKRA 3H7BB 3E1F1 2Q5BA 4B9YA 3J7HA 2BVPB 5IVXE 4F5CE 5INDA 4AIZB 5EA0H 4JN1H 4NUGH 4C55A 4ELKA 1I8IA 1DANU 2V2WB 1KCVH 2VN6A 4TTDD 4FYSA 2B1HH 5F1OB 3QC5X 3W38A 4XNMA 4QOKA 1EAPA 2R1WB 2JCCA 1KTKE 2E4TA 2E7DA 3GIVA 1KJ2L 5EH1A 3MV9B 3PFQA 4JRYD 4OJFH 1XMEB 3NABH 3B7UX 1JPEA 1PU0A 2CO2A 2C9UA 4HXAL 4IRZL 4JRYE 3E38A 3UROR 1AR2A 5EEXA 1JV5B 4JO1H 4B9GA 3LZLA 1M6UA 2YA1A 4EN3C 2ZP8A 5M7QA 1TJGH 1F1DA 3MLUL 3ES6A 2CDEA 4L9LB 2ZOLB 3CPLA 1NJ9B 2E9BA 2VW6A 1CLOH 2A0LD 4J6IA 2JWYA 3T77B 5EOQH 5BUGA 2ZOWA 4KKQA 1KC5L 3BAJA 1JXDA 3GPEA 5E4IA 4NOBA 1ZLVH 2DD8H 3SBWA 1NAKH 2V7NB 1NGWA 5IWLA 3FOLB 1T66C 4KMQA 5HJ3B 2BXZA 2C3GA 1SEQL 1BHGA 3RJQB 3IXAB 3VI3F 2YUWA 4FCHA 4MQ7B 2XZQH 3RA7H 1U92A 5CD3A 2OR8A 3GMLB 4Y2DD 3BGFB 3NSYA 1CTNA 2OI9C 4TRPH 4DGYH 1WLHA 2PCPB 5JW3L 4XP5H 3IYLW 3ZZ1A 3MNVB 1YQVH 2B20A 2WCSA 1S7QB 4G6FD 3S96A 4BZ1H 5I73B 2BC4A 2WOYA 3IM1A 3HE7B 4I89A 4P2RB 1CLYH 1ZJBA 4A7UA 3PQYE 1QSEB 5CIPB 3GIZL 5ITFB 2HTKC 5D1QB 4WHYH 4DEWA 4GP5B 3RTQB 5CP3H 1FNSL 4IOIA 3ECUA 1DSFH 3D39D 4JVPA 3T1WA 3QG7L 1XH1A 1G9MH 2K45A 5JHMA 2DQUL 4TQHA 3QJFA 1M7UA 3WJJA 1ECYA 3PJNA 4DP5X 2OMNA 3WXWL 3DI3B 5LUMA 3MLUH 3HPLA 4FOMA 2DWEB 2ENJA 4XOEA 3IDJA 5DVOA 2DQCL 4H1LH 2FCBA 4FLRA 3TBSB 4QRTA 4R3SA 3OKDB 4WNQB 3ARFD 4JZJB 1FH5H 3QQ3B 1NCJA 4GUOA 1AKPA 4KHXL 3DROB 5BV7C 1C1EL 2IPUG 3IBOA 2DD8L 4WO0A 1GZPA 4LAQH 5FUOH 3L13A 4QCIA 5SWSB 4CU7A 1QSEE 3BHBA 1MKFA 3BPCA 1AGEB 2EYTB 4WI5A 3VGGA 1GS7A 1I9RL 3PWPB 5FOJA 1SDDA 4P3WA 5FS5A 4XP4H 3KCPA 3CFCH 3ZDYB 3JT2A 1H5BB 5HHMD 2DMCA 2J73A 5HPMA 3QQ3A 1A3ZA 1CGUA 1J1PH 3P54A 3BZDA 4PJDA 3GXTA 3RP1A 3RUGE 4ZTPH 5C0CA 4L3AA 4EUPG 3TYGL 4KKNA 2YC1A 2DQDH 2VISB 4FG4A 2J12B 5ALBL 3UPRB 2Z65C 4GNKB 5E9DB 3SO3B 2VNCA 1MCWM 3RVWD 4X9BA 2BO0A 3TYFA 3PHOB 3HMXH 1UYWH 4OU3A 2ZZUT 3FN3A 1F8TL 4WK4B 5CBAA 1IKNA 3MV8A 3NTCL 4UNTA 2VDNH 3KNBB 2DWYA 3PDOB 5ICXB 3VXME 4ZYKA 2YGQA 4JFFE 4PGCA 4ELME 3VD1A 3X13A 1JL8A 5I23A 1S3RA 2XV6B 4ELDA 1WBZB 4NQXB 4B7LA 1NIBA 4XBEL 1T83A 4JPQA 4NRXB 4EIBA 1MUJA 4LCUB 1ILSA 2E7HA 1WBXA 4UOJA 2Z8WC 2P1YA 1OCWH 2X4PA 1PZ2A 4P2RD 4Z7VB 1KEML 4KY2A 5L2JB 5EDXA 1C7TA 1TO4A 2H1PL 2P7TB 3EO9H 3CVIH 3F7LA 1SF3A 5D1QD 5EU6A 5C07A 4XNXH 2WSKA 2WZPD 2GCYA 3BO8A 4JO4H 5AKSA 5FGBC 2FL5A 1A4BA 4YBLB 1WBZA 4NQXA 1PS3A 3L2NA 1NGWB 3QQ4B 4NP4H 4N4YB 2AAAA 1CGYA 2WLKA 1ZAGA 3UTSB 3SBQA 1R75A 1UXWB 1OF0A 3K3QA 3KAAA 3KE0A 1DVYA 3U4EA 1JTTA 2W5PA 2ED8A 3FBKA 5TDPA 5CLWA 3NT0A 2XWRA 2YPVH 3JTSB 3B1UA 4OIBA 6TAAA 4F57L 1QHPA 1OGSA 3ASWA 1X3DA 3SDDB 3VJ6A 4CDGC 1J8KA 2VXUL 3DBXA 1O0VA 2WZ5A 3RWJA 4JFTA 1PMYA 1GGIL 2VLME 5EBLB 1EZLA 2XKUA 1I82A 4TQIA 4P46C 1I1FA 5GRVL 4TL5A 5DWUL 4KTDH 3K2UL 3BZ4B 1JNJA 1ZANH 3LY6A 1MJJA 3MI6A 3FULA 4BUGA 5C0FB 3IMTA 5CILL 2I26N 2XG5B 3S4SG 3G5XB 3NGBC 3BPCB 1UCBL 3K72B 3DPBA 1XMWA 3WO4B 4DAGH 1KPRB 4QJ3B 4Z7VE 1ADQL 4LSSH 2FYYB 1DUZB 2EUZA 2A3TA 3LDBB 1PD0A 3V6OA 3VD4A 5JMRA 2IDTA 3QRFM 3D4GA 3WTYA 1GIGH 1TU2A 1F4WL 5FYKL 3O4OC 3NZ8B 4XMKH 4JFUA 4LASH 3RX7A 4BSVB 4C57C 4M6OL 3QO0A 5CF3A 2DQCH 1RP9A 2Y06H 1NWOA 4GEIA 3BWZA 1NCHA 4WW1B 2EDLA 1L5GA 5DMGC 2DF3A 2J5LB 4AYBA 3OB0H 3UZVB 2OTPA 2VM9A 1A1OB 5FV1L 3S3JA 3L4CA 4NJAH 4OZIE 4L8BA 2DAVA 4WNJA 2X0WA 1E4WH 2DQEL 1M42A 1LXMA 2ILLA 3B37A 2GEEA 3L4WA 4FRWA 4Y4HD 4BZYA 4FKEA 3NIFF 4MLIA 4GBXA 3DV6B 3QCTH 3DETC 3U7YL 4XP4L 5JO5A 2KS0A 3A22A 3S2AA 3RBGA 3BPOC 1G7QA 1XH2A 2QLYA 4PJIB 5FC9A 5KAQG 3L6FB 5JHLL 1UD4A 3EJJX 1WSST 5GGRA 1RLWA 1HCYA 3B56A 3CVHA 2VDLH 5FM8A 3SPGA 5DHXB 4F20A 1OALA 2DPKA 32C2B 2FH8A 4B9JA 3C09B 1IRAY 1U41A 4ZMNA 3ETTA 5FW7A 2WIMA 4QTIL 4KMLB 2NX5B 4HSAC 4M4RB 3KPOB 3HMXL 2YPLB 4G2AA 4NO5A 5AVVB 5KUKA 3PDOA 3JYCA 3W11C 1TFHA 4LBEA 3X11B 5JHLA 3VD9A 3C2AL 3GMQA 5E2JA 4XB7A 3V7MA 3AITA 1OOWA 3KL5A 2YJQA 1KIUB 1JNLL 1FN4A 1NBZA 3IPFA 3G3LA 4H8HA 3NCYS 3ARED 3RVVD 1YEJH 5B39G 3UPRA 1DQJB 2FQFA 5I8CA 5LXVA 5FO8B 1MI5E 4DW2H 2HFGL 5HI3C 1ZT1A 3GM0A 4UTAA 1F45A 5ECJE 4I77H 4PJ5B 2DWDA 1E4WL 2WWOA 4OLUH 4WDIA 4L4VE 1KIQB 2FUTA 4ZUTB 5JORB 5FECB 2C1PA 3JWNH 3WFHA 3HG5A 1AOHA 2VDKL 5LCVL 4FA7B 3NIGE 4X6FB 4DZ8B 5EV7A 2XUWA 3QORD 3D4CA 3O3AA 3BZEA 1A4AA 2E27L 2F0CA 3H85A 4X4XB 1MLCB 1IQDA 1UENA 2J88L 3MBXL 3RVTD 3KR3L 4NHCH 1MEXH 2HLAB 2PO6D 1IFHH 3DV4B 3JZYA 3CPUA 3RGBA 3KGSA 1Y6NR 3OVUB 5D5ME 3QFJD 1HHHB 3W2DL 4X6EA 3KG5A 2GJ6A 4C59B 3S37H 3SDDC 1JPST 1B9KA 1WZ1H 1E28B 3ZDYE 4AWJC 5I17A 2EAEA 3I6LD 4GRLC 4KKRA 2L7UA 4KVCH 3QWOB 3V0VB 3EYSH 1MAML 5CUSH 3TCLA 3S6CA 2GAZB 2IH1A 4JR9H 3C6LA 5GIRB 5TDOA 4GOSA 3S4SA 2VR7A 4HVBA 1I9IH 3HBZA 1FE8H 3QPQC 3IKCB 3W0WA 4JAMB 3BKJL 3RIAF 2DJSA 3WD5H 3HFFA 4JG9A 4B9CA 4EXPX 1A25A 1A4KB 4MCYA 1NKOA 3DX8A 3MKKA 5ITFA 1MH5B 3MBED 1BECA 5I1LA 3C12A 4N1HB 3LEVL 3QUMA 4OJDH 4JQIA 1IX2A 2A9NH 3WNLA 1G7LB 2GUOA 3MC0A 2QELA 2J20A 3P40A 5EHFA 1QQDA 1IC7L 2JB5H 3K4AA 4IIQA 3FUKA 2CNYA 2X2JA 4QRUA 1PX3A 4N0CC 2F18A 2B5IB 3WTSA 2YKLL 3T3PF 3PQYB 1IGYA 3JUZA 2DTMH 3KW8A 4Y5VC 1P4BH 2BP8B 3GSXB 1UB5B 4ELMA 5FYJH 3GFUA 4Y5XA 3QNZB 2QV4A 1I7TA 1S7WB 1R4XA 5SV4A 4K94L 3IJEB 1YUHB 4PS4H 3LZOA 2OL3B 3T04D 5T3XH 2UWEE 1W16A 3KYKL 3QDMA 1DO5A 2RGSA 4UTAH 2JLLA 2ZYHA 4IGBB 1TFPA 3DUUA 1MFDL 4OBRA 4P5TA 3K81A 3N55A 2H6UA 4IMLB 3P4OA 3T8XA 1XH3B 4PJCF 4YHPB 3LH9A 4L1BA 1BZ7B 5ANHA 5A6IA 4UOW0 3BE1H 4KDTA 3IN0A 3SOBL 4UIMB 2F54A 4A67A 1XZWA 4Y16C 3GBMH 1FPTH 3MA9L 4PJFB 3E3QE 1UD8A 3QNXA 2WLMA 4QHPA 3UJTH 4UIKL 2MFNA 5AOMA 2NY7L 3QEGH 4F2ME 3I02B 1RQ5A 2ZUYA 4K3DL 4U1JB 4FNLH 2D73A 4G9FB 4XAWL 5D2NB 4GUPB 1F97A 5EOTB 5DO2D 4DFIA 4BQ6A 2DQGH 1D2OA 5C92A 3IBEA 3OR6A 2MOQA 3ZE1E 4ZFGL 3POCA 1M1SA 3RX8A 4W1TA 3KPSE 4MXVE 2FHCA 2BY0A 2NZ9C 3LSOB 4FXKA 4N68A 1J0HA 1NDMA 3BAKA 3RB7A 4XMTA 5C97A 1CG9B 4KV5F 5MEPA 2XXMB 1QR4A 5LAXB 3QDMB 1PIGA 2GY7B 5FYJL 3QSKB 4FQ2H 3P9MB 2QL1A 3NDYE 3TPUA 1TQTA 2VXQH 1FC1A 1OHZA 4KVNL 1NL0L 1HC1A 1B0GB 1PSKL 2V2XB 4OV6F 1JRHI 4HS6B 4KRNA 4TSBH 1D6VL 1KG0A 4NGHH 2PPFA 3L3KA 3EYVA 2Z3FA 1URLA 4PV8B 5IB4B 4UCFA 2QSTA 3SPJA 4BFJA 2B3RA 3MBXH 1SHSA 2L7JA 3TVMA 5D1ZB 2V2TA 1MCJA 5BJTB 2R1YB 3L4ZA 3MUGB 4LCCA 2G3MA 3GWJA 3K8MA 3RGVD 5CSGA 1I9JH 3UEQA 1KXVA 5E6YA 3GXNA 2DICA 1YRKA 4EI5B 4P23A 4F8OA 3TJHC 1D5XA 3TBYA 2AANA 3PS6A 3D0LB 5I0WA 2JV6A 3SE9H 1JZ2A 3LH2L 1S78D 4HU8A 4XGZB 4U2ZA 5G4NA 4ZS6D 3RTQC 5EWIL 2XQYA 1T2QH 4EDWH 1D5MA 3OBAA 1XF2B 3H2WA 1MFCL 1E4XH 4KQ3L 1YA5A 2Z1PA 1A1NB 1F58L 1H3XA 2VO5A 4HF5H 1ZHBB 3O45A 2WXQA 1KCBA 2H8PA 3VFPB 1JWMB 2HTKD 4BZ2A 3D34A 1KENL 4G6JL 4QRRD 5E7FA 1PAZA 3MA7B 5C6TL 3ABKB 2NW3A 4N8PA 1RFDH 1VCAA 1ZD6A 3U4KA 4X4MA 5C0RL 1TTAA 3V4VL 4WTQA 4S2SB 3MGOA 1JAEA 2C9PA 2JXMA 5F89B 4FE9A 4HZAA 4WZ9A 2BHZA 1JGVH 3F7KA 4F2FA 1FH2A 2CM5A 2Y2WA 2Y7NA 4HCRL 1JG9A 4TNGA 4JGUA 2J8UA 1P7HL 1WFIA 3T0VA 4HBCL 4JHWH 3G6AB 1KB5H 4JFFB 3E1ZA 3TZVB 4QPEA 2VAAA 1YEHL 4I7ZC 4UTBL 1XF3A 2OFQA 5CJ5A 3CQPA 1XF5A 3O6FC 1JNNH 4M7LL 2ZSVA 2WNGA 3WKNA 4GSXA 4PD4K 1H8SA 5KG9A 1ZLWH 1JN6A 4G72B 5CZRA 1KT2A 1ETZA 2C3XA 2E7BA 2HLAA 3IFPA 5FUCE 3UO1L 4CNIB 2MTPA 3AQZA 4NN5C 4YFLF 4X8XA 5KYUB 4DK3A 5B1JC 3MV11 3TURA 4EPSA 3X3GL 1AZBA 4FKHA 4Y0GA 1XD1A 4RGOH 1GC1L 1SY6A 3V55A 1UGKA 4WUUA 2V5MA 3K2IA 1T2QL 3DX6A 4OIAA 4G8GE 3FH5A 5IOPA 2FO4A 4L8DA 3Q5OA 5CGBA 4FQCL 2F2HA 1TVHB 2E75C 4BKSC 4PCYA 2KH2B 4PJEA 1QLEB 2CA3A 1JOIA 5H2BA 2VLJA 4E5XB 2MNUA 1DQIA 2WP3O 4GAYA 12E8H 1KYAA 4WFHE 3P3RA 3FCSB 5HDBF 3WAJA 5EEYA 2K6WA 3L1OH 4PVLA 3TFBA 2CBMA 1CF8L 2YD4A 3X12B 1KB3A 4R2GC 2P8MB 2ESVA 4HBCH 4JHWL 3QEGL 2F7QA 5JHAA 4HZ1A 4QKXB 4QYAA 4YSUA 2R2EB 4LFHG 3KLKA 4GIPD 5MENE 5AW6B 1IAII 1IM3B 1T0NA 4M03A 2BCKA 2TAAA 1UUNA 5DHEA 2YRZA 5KVDL 1KTLA 1T21A 4Y7OC 5E1QA 4NN5B 4AZ8B 1X7QB 2X70B 2H32A 4CRPA 2FJFA 2QMJA 5FYLD 5JHBA 1G6RB 3VRIA 1Q9OB 4GQ9H 5KVEH 1MZZA 3DXAE 3K0YA 5IHBA 4YSTA 2O30A 1U8QA 4FQ2L 1WA1X 5DRZA 4W4NA 3P4NB 1EEZA 4QLWA 2EVGA 5BJTA 4R84A 4AENA 2E8ZA 1FFRA 1E5UI 1P5VB 3RGVC 3QWNA 1RZJC 4XXDB 3U4BL 5F0MB 2X2YA 5EO0B 2BIMA 3MV9D 2W0PA 3SGJA 4F7MB 4PBDA 4AQ8C 4UILH 4DF9A 1ND0A 4IKLA 1SXSA 2JE8A 5EUKA 3CBJB 3BXNB 4JFOA 2P80A 1YNTF 5ICYB 5F1SA 2FEDD 3GMOA 1FORH 4K8RD 3UC2A 3BEVA 2OZ4L 4FP8H 12E8L 3TIEB 4U1IB 3Q8AA 1XIWA 3I74A 2IWFA 5E8DH 5DLMH 4X6EB 4EDWL 2C3VA 4JRXE 2WTRB 3HA0A 2VN4A 4HUMB 2ZYSA 3P0VL 4Y4KA 1EFXD 3QDAA 4TUKH 4XP5L 4UT9H 3LVEA 1KFAH 1QZNA 4JFPB 3OXRB 4WKXA 5DHYB 3HN3A 5ACLA 1SRDA 2WXLA 4W9HC 5E95B 5D1XB 1KGIA 5DK0B 5AW8B 3KWWA 5KZCD 4KVPA 1LE9B 4ERSH 1A3RL 1QRNA 2WB7A 2EICA 4PTUA 4XWOC 5GS3A 5T5FL 1F90L 4GKZB 4A2FA 1FNSH 3MZTA 3TF4A 2UZIL 4AVKA 1XH3A 1TNMA 1MVFA 5E6UB 3CFJA 1C12A 4WSGA 2K6YA 1CFVL 3FB6B 3HC4H 3MUJA 1OPGL 1TJHH 5CINL 1DN2A 1I1AB 1QYGL 2D3JA 2XIBA 3U0TB 3BN3B 4MAYA 1FV1A 1ZS2A 3R7RA 2XVBA 1A7NH 3LQMA 5HDBB 3S3DB 3T09A 4AH2B 5FFLA 1RZKL 4MCZA 1OGAE 2XWCA 3CFEA 1NCTA 3IJEA 2P5EA 5TDPB 2K4WA 5GRVK 1MAKA 1E9QB 2VLRE 2APSA 5CJOL 4WGVB 3X11A 1L9MA 1Z32X 4OZHE 4G5ZL 1J05B 1JZ7A 3ARGD 1T66D 5TE7H 3D3VD 3US0A 2IXQB 1OSYA 2X3CA 4FP8L 5EC2B 4HK3N 4K5OA 5IBLC 5T8IA 2EJ1A 1GKOA 2CJ3A 2PW1B 2R2HA 1DVFA 5D55A 4CVUA 1JYWA 4K7PH 3ZQWA 3RFRA 4W4OC 3R7QA 3QHTC 3WLWD 3MNZB 2H9GB 5I1DB 2BRQA 3I2CL 4XX5A 4JANB 2P5WA 3QUZC 1BG1A 4LHQB 4PVMA 5DT1L 1JYVA 3PWJB 4NENB 4YHYB 2VUYA 2NCMA 2MH4A 3B5HA 2NXYB 5F9JA 3T2LA 1A1MA 1EO8L 2G4GA 1CLCA 4P3DA 5KYWB 3JV5A 4IRJB 1OD7A 2AEQH 3ARBD 5CBAB 3OLIA 4QRPB 1CFVH 3GJEB 1AQKL 4GG6F 5B39A 1JZHA 3L4VA 4F93B 4HT1H 3QIUD 2D31B 4N8CH 4CMHB 1JI1A 3VAEA 2VLKA 4AM0Q 5CMAB 2F19H 1A7NL 3FRPA 3M17A 2QQLL 5AVUB 4ZO9A 2YEQA 1L4IA 4XI5D 3AWFA 3SKMB 5C08B 4KX7A 1CICA 5DQJA 1NANH 2F8OA 3B2MA 1ES0A 2EH8H 3KPRD 3V7AE 3B3IA 4IW4C 5I0DA 8PAZA 4L8CA 3KS0J 3QJTB 2H0FA 4NEHB 2NY1B 3KBFA 4HS3A 3NJJA 3PGFH 4NZUH 3QZWB 4DQOH 4YIQB 3DV4A 3B5TA 3Q7JA 1TZIA 4N9GA 4EZMA 3EO9L 2Z8SA 1CDJA 2HCZX 5C0DB 1GYUA 3BSHA 5IGXH 1ORSA 1VSCA 1OTUD 3LRKA 4Y4FD 2G5RA 2ID5A 2JTYA 5CCGE 1MJJB 1TVBA 3JWDH 1T7VA 1XCQB 4FTVA 1I8KB 4UZGA 5EOCH 1UXLA 2GHWB 1DCEA 3OAUL 4X2UA 4MKTA 2G75A 1FORL 3MREB 2VC2H 4APQC 3VXRB 3EHBB 1H3TA 2YPVL 3HUJF 2AQSA 3WTXA 3ESNA 5EZIL 1M1XA 2IPTH 4OCSL 2DBLL 3HPLB 3IJHA 4JKPH 4RWYL 5JQ6L 2XN1A 3PL6B 4K2UH 4APQB 4FQLL 1FN4B 1NBZB 1XGTA 3SGKA 4XAKE 5KVGL 2MEJB 4YHIA 3D3VB 5DD5L 4GRLB 3RL2B 3VDAA 1Z0NA 5JUEH 1HEJC 1N0XH 2AERT 3MLYL 2HFEA 2CWRA 5LO7A 4PG9B 1QG3A 2ITDA 4OZHA 4NO3B 3K6NA 4BHUA 1TPXB 1HHGA 1B2WH 1RVFL 2W38A 3BDBA 2VQ4A 3CDZB 3TJPA 1CF1A 4DP8X 5J6GA 5D4IA 4W6YB 2ZSWA 5HYJB 4PMFA 2FQDA 1O6SA 3O6MH 1R3HB 4N2LA 3QXWA 3FB7A 4DGWC 4ANUA 3NAAH 2WVVB 3EIFA 3SD5A 5I1JL 3NA9L 3HUJB 3IJ8A 2JB6A 3C8KA 3CHXA 5L2KE 5LDUA 1MNUH 5HI3D 1U8HB 2GIMA 1I85A 5K5YA 3FNKA 3CCHB 4X6DA 3MSPA 4XXWC 3ZHKA 1L0PA 2J1YA 4PW3A 1X7TA 3UPCA 2ADIA 5ILTL 4K3JH 1NDGB 2D3NA 1D6EA 4EUPB 3HNVH 3LEYH 1PJ9A 4KKCD 1JGIA 5C08D 1CL7L 1AC6A 2NR6D 4RGMC 4YXHL 1JNHB 1Q9LA 4HPYL 5E2UH 4MAUH 4QR7A 2ZUVA 7PCYA 1DLHA 2A6JA 1I1CA 3HB3D 4I0PB 1F6FB 3MGTB 1OM3L 4WWID 1J0JA 4A2MA 4AT6B 2QDVA 5I1KL 1AY1H 2L7QA 1KGCE 3QJUB 2GEQA 5HVHC 4OCXH 3T3PB 3FT2B 1CLYL 4QRQB 3GBDA 1DUZA 2E59A 4KXAA 4D9RE 3EGSB 2ZG1A 2VN5A 1EAPB 3RFZC 5DMKB 2FT6A 5G5DA 2IQAB 2YKKA 5CJBA 2PMZA 4NRYB 3H9SB 1JHLH 4YZWA 1BFTA 4JE0A 3T2NH 4C56B 4CSZA 2YPKB 3C87A 4JUTA 4L5FL 4NUJB 5F96L 3BZ4A 4DKEL 3VDBA 4NKIL 4ENZA 1XXFC 2WHVA 2QQLH 2YFOA 4X9IA 3V0EA 1JD7A 4A7VA 1MRFH 3B3IB 4KROD 4NKOB 5GZOD 2IPKB 3JWOC 2XWJB 1U8MB 4J27A 3GD1C 4H88H 5IT2H 3EHBD 1ES0B 1BM3H 4UQCA 3T6ZA 4AQ1B 3JWOL 2Y7MA 2OMWA 5DMGD 4W68A 5ADPH 1NCUA 3UCQA 2YD8A 3MVSA 5IY5B 5ILTH 2EVFA 2CE6A 1A6UL 2D31A 5JNYB 3CVHL 1R5WB 3H2PA 1IU1A 2UZXA 3LV3B 3GJEA 1WE5A 1DE4A 2Z92A 3F8UB 2Y1VA 2LU5A 2DIEA 1BF2A 1FP5A 4WUKL 4N0UB 2H6OA 2VMJA 4PJHB 2VDMH 3GM8A 3CC5B 3A6BH 4Q74A 4AIEA 4YLCA 3ZUNC 4E0RB 4OF0A 2FL5B 4WU5A 5EUOA 3EGDB 1QR1A 1BVOA 1MIML 3WY2A 5I1KH 4AGQA 1NPUA 4NC1E 4BFGA 5G2NA 3BUYA 3OF6D 2AEOA 3MODL 2X70A 2RFXA 3M8OH 4NFDA 3FXIC 3INUL 4AEHL 5HPOA 2G3NA 2WK2A 5LJYH 3B8SA 2P5EE 5IHUH 5BW7C 5IESL 5BRPA 3LNDA 3NCFB 3S5YA 5DS8A 1WFNA 3DKHA 4IU2A 3LHAA 1TZ8A 2DIBA 1FDLL 3UAFA 1UYWL 1X5HA 3LPWA 4JN1L 3KNBA 4H8PA 1ZJAA 5ICXA 2E6JA 3U9WA 4N8VG 5CGTA 1OGAD 1ASQA 8FABA 1FE8L 2ZCZA 1ZLDA 1J10A 3VYOA 2XPZA 4KGLA 3T77A 2FJUB 1J18A 2HJKB 2WXRA 5IBTL 5BZWA 4NZJA 3L7EB 3CPLB 1RJYA 2CXGA 3HC3L 1PJWA 3RDTA 2Q76B 4CW1B 4AYEC 2BVUA 4ZMPA 2ZWZA 1RCYA 4U6YA 2HN7A 4BDVA 5I71B 2RH0A 1CGTA 5H37G 3DOHA 3U1SH 5DC0A 1C12B 2UX6A 1EHXA 2C7UB 4PTTA 3GJFK 3PY9A 4ISVB 2XC8A 1MHPL 2VLJD 3WEAA 1QLFB 1JGLH 5CP7B 1YYML 4K73A 2UYLA 1I8IB 3HHMA 5DJYA 1DJWA 5E5UB 3C5ZB 5H94A 5FHBH 3D2UB 1PEZA 1MCOH 1RHFA 2AXFB 3IFOA 4DZBB 4MWFB 3IFPB 3ZKXC 3GEWB 3LPPA 3WNJA 4Y19A 5IKCB 1QA9A 3C60D 3BP5A 4R90H 4Q7DA 1JK9B 5D7JC 3TA3D 1L3NA 1XF3B 2XN0A 1SHXA 4R3SB 4YK4B 1LO0L 3JV6B 3ZKND 4OM0H 3MO1B 4XTRD 1UA3A 5DVPA 1OF2B 1GHFL 3ZT6A 3QDME 2CK2A 3OPZH 3RHWF 2UWEA 4HALA 4APXB 4F7EA 4OZIA 2ZOKA 3MJ8B 3PV6A 4R8WH 4W9LC 4RFNC 5IJCC 2XA3A 3MGOB 3QPQD 2YZ1A 2XTJE 2BSRA 4NLHA 3QJFB 4NC1C 3OAYH 3WSQL 1LO5A 2R27A 3P3TA 4JFDD 2W9DL 1WYJA 3BW9A 4QXUL 1WZAA 3CN4A 1CFSA 1DSFL 1PYWB 4LLYB 4NPYB 5FGCE 5KYWA 1F18A 1Q9WA 1IT9L 1J0KA 3KBEA 3R0NA 4KNUA 4NC0B 4X6BA 5HYQB 5GGTA 1JWMA 4HWBL 4AQ8A 5F9JB 1A4CA 4KMTL 1JI2A 5GS0L 1BYOA 1JPTL 1SMOA 5E7BA 3HE7A 1K3IA 1T89C 2M83A 3A67H 1KN4H 3U46B 4JFED 4N6RA 5DJCB 5JHDD 5F1IA 4NCC1 4S0TD 1QSED 1MJ7L 1A14L 2H9GA 5I1DA 3H2QA 1AKJB 2D2CC 1BPLB 3Q43A 1JPGA 5TF0A 4LEOB 4KI1A 3VB8A 3U6RB 5GGTL 5E94A 2QVFB 4Z7OF 1SM3H 1QW9A 5I6MA 4J7RA 2ESVB 2B39A 5HI5D 1J05A 2XTJB 3VSTA 3CDGB 3NCJL 4JDVB 1QOKA 3L3KB 4WUKH 2E3VA 1DSYA 2E8YA 3EBIA 3SY0A 2IDCA 4EAEA 3DDFA 1KXQA 2ROYA 3J07A 2WYTA 3CMGA 2P8PB 5KBKA 4JN2A 4OJAA 4RH4A 5C0GB 1RURL 5JXAL 1JF1A 3O2DL 5L6YH 4TLSA 3KPSB 5JHLH 1UM4H 3NZHH 1FGVL 1SXCA 3GHPA 3LD8B 3WL9B 2K3TA 2A38A 4MAYB 5AVTB 4TMPA 2DQDL 3D4YA 1UOLA 4PRBB 2BOBA 5D71H 4JM2D 1F4AA 2JKSA 3NN8B 4TSCH 3W11D 4CADB 1CFBA 2E7LA 1P1ZA 4UQ9A 5D7LE 4U1JA 2CHWA 2KZ1B 4GBXC 4FFVC 2JCCB 3H54A 4L4TE 3F84A 1IVLA 3RVUC 2CKBB 2AZUA 2CPCA 4YPGA 2XICA 3NFNB 4KTEH 3RWGA 2CK0H 3BP4B 3MXWH 4G8EB 2ZOOA 3UJJH 3U83A 3NYKA 1C08B 5E5MB 5HDQH 3L3IB 1JN6B 4LPYA 4ZO7A 3CZFB 2X1OA 2FD6H 3BPLB 1U91A 2P28B 4JO3L 2V33A 5CZXD 3FONA 1OAQL 2UX7A 3MCG1 1LEIB 3KPPA 1WFUA 3HZVA 4QRRA 1LDSA 3O3UN 1GYWA 3K46A 3CDFA 3QCVH 1VIWA 3V5HB 4QO1B 5ETUB 5CAYB 5LWYH 4KRPD 4LPUA 1ZGLM 5E4EB 5EUKB 1WD9A 1DDTA 1UWGH 1IAMA 4BRJA 1JYXA 2Y5TB 3WKML 3KXFA 1Y6MR 4NDMB 3X1BA 4EOWH 2JCCF 3SDCB 4X7SH 2G30A 1AQDA 5D70L 3DUSB 5AL8A 1XGUB 4E41E 4PJCB 43C9A 4XVUD 3GTNA 3IGFA 3KDMB 3FUJA 2KKQA 4FQIH 1YEEL 4O58H 4JLRA 3VG0L 4M5YH 4UMGA 2AZAA 3L7FA 3MQIA 3SGEH 3APDA 1YPZF 2PTTA 5HYEA 1G1CA 1BAFH 1EJOH 2AQ2A 5AZUA 2EE3A 2R0LL 3WTWA 3L95B 3ZOAA 4BFOA 4GSDH 5AVYB 2W60B 2GFBB 1HYRC 1KBKA 3EYSL 3OLGA 1KTLB 3DXAB 1S78C 1ZHLB 3H9SE 3B5GA 1AGBB 4N2GA 4WQOA 4V1DA 3K2UH 4FX5A 4WWKA 4FQCH 2GIYA 5DJDA 3TJHD 4IU3A 4HX1B 3MLWH 3QQ9D 1MJ8L 4PJDF 2XG4A 4Y1SA 4ZSOB 3C6SA 4M3HA 1T7ZA 3IRCA 3BLKA 4D9QE 3ARDB 3L5XH 3UYOD 1UD2A 3QPKA 2AQQA 2I69A 1A6WH 2Y5TA 4ZO8A 3GK8H 1SFHA 3C75A 3ECVA 1NPJA 3PDDA 5CLZA 3U1PA 1FL5B 4X98B 1OF2A 4XMKL 4JVWA 1YUKB 4HH9A 3K71B 1HHKA 4WIQA 1RZJH 3JVGA 3P4MA 3FONB 1J8HD 1ET8A 3GI9H 4HQQH 4PY7A 5H8DA 4Z7UE 5GGVY 3GSOA 1T5WA 3RWDA 3SEPA 1IIKA 1QA9B 4KGJA 4QAMB 3IEAA 1LTXA 1C08A 4L37A 5DQ9B 2BP3A 3T0BA 4IKIA 5JZ7D 2ZF9A 4XOBA 4BFEA 1NAMA 1IAOA 1G4RA 4HMEA 3H7LA 5I6XB 2VMCA 4MMXC 1FIGL 2N4IA 3DO7A 1ZT4A 1CIDA 3OKOB 4H5SB 4JY5L 4YPJA 1V5JA 2C7UA 4KOCA 1T83C 5T3XL 1RURH 4BSWB 1XF5B 5L6YL 3DUHA 3PYCA 1NBQA 1QRKA 1XCXA 4JKNA 4NB7A 2F1BA 4G11A 3OHXA 1NGYB 1ZSDB 3MLWL 1IGCL 2AEPL 2NY4C 2LVCA 2X6UA 2DBJA 5CGYD 4QEGA 2IOIA 1YAIA 3QG7H 2VSMB 1DN0A 3NRPA 1PTZA 2NY6C 4E41A 2G5BA 2AJYH 3ZDZF 1U9KA 3RL1B 1Z9SB 2FWLB 3SY0B 2WZ6A 5FW8A 3A3YB 4ABUA 3FQRB 3ARDA 1ZEAH 3DWTA 3VXSB 3IK2A 3BT2H 4L8SC 2XNAB 5DS8B 1S46A 4HBQA 3E9UA 4JEGB 5FKPA 5EG6C 5KVGE 2Q9OA 4AJYV 1OK8A 2QQNL 4LLVB 3F83A 3GBNL 5FK9B 3IDGA 1Q0EA 4QTHA 3PWVB 2Z7YA 1OPOA 1QFWL 2NX5D 1JERA 1CXKA 1M2VB 2HFGH