4KKXA

Crystal structure of tryptophan synthase from salmonella typhimurium with 2-aminophenol quinonoid in the beta site and the f6 inhibitor in the alpha site
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
268
structure length
268
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and substrate channeling in the tryptophan synthase bienzyme complex: evidence for two subunit conformations and four quaternary states.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase/lyase inhibitor
molecule keywords Tryptophan synthase alpha chain
total genus 102
structure length 268
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4kkxA00
3GKFA 1B3OA 1YDNA 3CWOX 3FA5A 1J5TA 3GXPA 1QO2A 1DV7A 1I2RA 1NF7A 4PTNA 3UYCA 1WX0A 1JCMP 1TPEA 4IPJA 3ABOA 4AF0B 1RV8A 1IXQA 3O6YX 3PG9A 4DPQA 2QCDB 1VPXA 4NX0A 5D2WA 1IIHA 1PVNA 3LGEA 2NWSA 8TIMA 1DKWA 1FUYA 1XBZA 1PV8A 1TPWA 3EKZA 1VS1A 1OX5A 3LI1A 1ZENA 3SZ8A 5T26A 3W76A 5AC7A 1XFBA 4DF1A 1ZAHA 1HO4A 3ANYA 2E5BA 3BW3A 3SI9A 3FJ6A 2HSAA 1GVRA 1T99A 3HO8A 4XTIA 1PHQA 4K8EA 2PRMA 1IIGA 3S1WA 3C0JA 3T44A 4UMBA 1VCGA 4BR1A 1TPH1 3M6YA 4HPXA 2ZRVA 3LXBA 4Q33A 2ZA3A 4IJBA 4LVGA 1VC4A 3HPSA 4M7SA 3BV4A 5AHIA 3W7CA 2GQ9A 4QM1A 5C2XA 2E5DA 1QDSA 3TA6A 3LI0A 4JNMA 2QAPA 2GOUA 2RH9A 4QITA 5HINA 4ZMGA 1K8XA 1VLIA 1X8FA 2WV8A 4CQ8A 4IMFA 1ZNNA 1UBSA 3PBWA 4IPIA 5TBOA 3G3DA 3ABSA 3FIGA 3JRKA 4UR7A 1TTQA 4MPQA 3MHGA 2Z1BA 3LCWA 4JY8A 4QNWA 1WDWA 3C2EA 3FKKA 5G2WA 2R14A 2CLLA 3NQCA 1SO4A 1Y0EA 1LOQA 2GQ8A 3W86A 3CU2A 1H51A 5D38A 2HMCA 1A5CA 1W31A 4HKPA 5HUOA 3G1VA 3LHUA 4XKYB 1VYSX 1K8YA 5IBXC 3LRKA 3W84A 3NA8A 4O54A 2B7OA 2B7NA 2FQIA 4CLMA 3ZWTA 2TPSA 4H4IA 5AHMA 3P60A 5HJLA 1J2WA 2YPIA 3QPZA 3THAA 3QF0A 1LOSA 4K37A 5LNRA 3RLUA 1LYXA 1AL7A 1UCWA 2V0TA 3PS7A 4EF9A 4BF9A 5AHEA 1YXDA 3GR8A 2QDHA 1JUBA 5F1UA 3LLFA 1W1ZA 4YLWA 5EKYA 5C6MA 1KW1A 1W5MA 4XUGA 4LS1A 3FLUA 3W88A 3BO9A 4UTKA 1ME9A 3W23A 3QH2A 3TC6A 4KWVA 1DHPA 4GBUA 1D9EA 3NL3A 5DCEA 2C19A 2ZDRA 5FF7A 4ADUA 4Y6GA 1QFEA 4U4MA 3VKJA 1NFBA 2FJKA 1X6UA 1RR2A 3S5ZA 3P5YA 3WJYA 1QPOA 4A3UA 2CLMA 2Z0IA 5CSSA 3HJZA 3W73A 1O5KA 3UZ5A 2B7QA 3UD6A 3WK2A 2C6QA 1JQVA 1M7OA 3P8IA 4R33A 3CT7A 1YTDA 4GUFA 3UY8A 4RX0A 2B0MA 4UFMA 3TU9A 1OJXA 1FCQA 3MO7A 5HULA 2QUUA 1A5AA 4AH7A 3PSVA 5FESA 1FX6A 1SO3A 4K7VA 3HOJA 1H60A 1W8SA 3ZS4A 1H7WA 4UIOA 5AC6A 1FCVA 1N8FA 2VENA 3WK1A 2QCEA 4D2JA 3TCEA 4YL2A 1UUMA 2YXGA 4S2CA 4K36A 4NNBA 4XTDA 2VFEA 3ATYA 1TV8A 3P8JA 1OFDA 4IXHA 1XC4A 2AAMA 3E96A 4O4WA 3T40A 3BARA 5BOOA 1GJPA 1GWJA 2ZZ1A 1PE1A 1SO5A 2QCMA 1EEPA 4UC5A 5K4XA 1QMLA 5A5WA 5LGXA 1MZHA 2JKAA 4I7UA 3VE9A 3W1AA 3HGSA 3ZR4A 4NQ1A 5D09A 4XZ9A 2V30A 3NQEA 4ML9A 2G95A 1XXXA 5C54A 2P10A 4AHQA 3W70A 1KV5A 3NPVA 1ONRA 3M47A 3TXZA 3V1PA 4DQWA 5AYYA 2VFDA 2E5CA 2TSYA 1CW2A 2VEPA 4O1DA 3HMJG 3SY5A 3SIZA 4ZQOA 1A5BA 3L0KA 4OE7A 2R8WA 4CQAA 1JCXA 4RK8A 3TK7A 1I2OA 4JIQA 3GDRA 2V2DA 4LU0A 1XDLA 5BW6A 4QQ3A 3H53A 3EWUA 3HPXA 4CNPA 3HF3A 3P81A 2V5LA 4RR4A 4YWIA 3NQFA 4ICNA 4NJKA 4MZ1A 1OX4A 2DJLA 4GXMA 2ZTJA 3BG5A 2GPTA 3NXFA 5U7SA 4YMZA 1B9BA 4P2VA 5KZDA 1G7UA 1P4CA 3N3MA 5FEWA 3YPIA 1LLWA 2C3ZA 4JXCA 3WK3A 2Y85A 3NQ2A 4QSHA 3MBFA 1XCFA 3LV5A 1KA9F 1ZHAA 4HT3A 3DZ1A 3W87A 3NQ7A 4J9JA 1I2PA 1AG1O 4IQLA 1LBFA 3LOTA 4A2SA 4EF8A 4AMAA 5HR6A 2NV2A 3QEZA 1YXCA 1XM3A 4PH6A 3FFSA 5TIMA 3T55A 3L67A 1OFEA 5D2XA 2E6AA 3W7LA 2QDGA 3B0PA 4G1KA 5DXYA 1R2TA 1LRTA 3QYQA 1XI3A 4QNEA 1VZWA 3D0CA 5I3IA 1D3HA 1LLZA 4JYFA 1S5WA 2NLIA 3F1QA 4OGZA 3UWQA 5F4XA 4O19A 2YYTA 4MVAA 1KBIA 1K7FA 5EL1A 4JTLA 4JS3A 4FX6M 3NQ8A 3HGJA 3A5VA 3LLDA 1LRNA 2H3DA 3OVRA 3UWVA 4FHAA 4DF2A 2C14A 1R2SA 1F05A 1F6KA 3MI2A 4ZQNA 3IV3A 1KTNA 2WJZA 1QO5A 2X1SA 4OU1A 3PBUA 2ZZ3A 2ABAA 1B4KA 4TR9A 3IVSA 3KOFA 5KMYA 3RK8A 4JTFA 3PSWA 4H3DA 5KINA 5D2TA 1QPNA 2AGKA 1OVDA 4UMCA 3WJSA 4UTWC 3PB0A 4LC6A 4WJEA 3TE9A 1MXSA 1DBTA 2WKJA 3DFTA 4ZQRA 4O15A 4WX2A 3R13A 2Q8ZA 4X22A 3TQ0A 3B0UX 3VFLA 2ZZ2A 2Y7FA 5E0KA 1EWDA 2DZTA 4IX0A 1PCKA 1U5JA 1PIIA 3LTPA 2PURA 5CG7A 1EUNA 3S5OA 5DBTA 3NYZA 1MO0A 1OFPA 4QAIA 3N2XA 3THQA 2RKXA 2PRLA 3NAVA 3W7IA 4LT9A 2A85A 3M5VA 2J6XA 1KFKA 3DI0A 1N55A 5H91A 3DI1A 5CZ0A 1D3GA 5H2ZA 1W37A 4E0CA 2R91A 1WOAA 1QCWA 3O06A 3W2KA 2C0AA 1YTEA 3TXVA 4UFHA 1W5PA 1VYPX 2J9XA 4IGHA 4C1LA 3CEUA 3CEPA 2KZHA 3GIYA 1GVFA 3W7KA 3LB0A 1I2QA 3RMJA 3DH7A 2H8XA 4TO8A 1GG1A 3O15A 4JGDA 1EUAA 5F4WA 2OX1A 1M5WA 2X30A 3LHZA 4O53A 1JCYA 2OZ0A 4N9CA 2A5HA 5K3VA 2VOMA 4WXYA 3L21A 1K03A 3EB2A 3QMTA 1O5XA 2NUYA 5BMXA 3W1QA 2ZRYA 3MI6A 1FWTA 5D05A 2EPHA 2BTMA 3TC7A 1QPQA 3C4UA 5DY2A 4O1BA 3DFSA 3I68A 1L9WA 3W07A 3P67A 3QC3A 2VEKA 3IVTA 2A1YA 2FDSA 2VEMA 3QQ1A 3ABRA 2J9ZA 4LS0A 1S3HA 4S1FA 2ISSA 2V82A 1TV5A 4HHPA 1OHLA 3DFQA 4UFIA 3HQ1A 3IGSA 1OFOA 1Z44A 5C5YA 2E6FA 4LRTA 3W2JA 3ZWSA 3LTYA 1P0NA 3GNDA 3SGUA 2LLEA 3G3MA 4MY9A 5U4NA 2W0UA 5KZMA 2XFWA 4JEQA 4S2BA 1FXQA 4XBSA 3P7YA 4N9EA 3GK0A 3PM6A 2QUTA 4BI5A 3GXNA 4IOTA 2DZVA 4JTGA 1XBYA 3R5EA 4UUIA 3LCGA 4DO6A 1KFEA 1TYGA 1EB3A 2V2CA 4JTIA 1MEIA 2CFFA 5EBUA 4HN4A 4IMDA 3N34A 4RLIA 5L9FA 1VGAA 3NPWA 2ATSA 1SO6A 3CB8A 3E02A 3Q94A 4CCDA 1B4EA 3PG8A 4X3ZA 2FB2A 3LRMA 3RU6A 1KLZA 1L6WA 4UFJA 1K8ZA 3PB2A 5D32A 2H3BA 3FYOA 1ME8A 3C3NA 3F03K 5KSWA 1YDVA 2RDWA 4E2BA 2NUWA 3LRLA 2X2GA 4K6AA 3IIXA 1RZMA 3S8HA 4LRSA 4RKAA 2QJIA 4L4LA 3EWWA 3EWBX 4ZL1A 1SZEA 4B5NA 4DPPA 4FNQA 4LNYA 5K9DA 5LKYA 1LROA 3W1TA 1AW2A 3TIMA 1JUEA 2BWGA 1OG0A 3G1SA 1Q3NA 4OWGA 3WJZA 4BFAA 3L5MA 3OG3A 4E38A 3HGRA 3NO5A 2YGYA 2FIQA 3M5XA 3G1FA 3VE7A 2ZFAA 1V5XA 3W1UA 4QISA 2ABBA 3M7WA 4UTTA 1TO3A 1IXOA 5DCBA 4PA8A 2C13A 2QAFA 3P82A 1VLWA 3WK0A 5E1QA 1QOPA 3DFOA 4NVTA 1GVSA 4JICA 5F2LA 3WJXA 3F4WA 3EX1A 3C6CA 2A7NA 5I3GA 4K7YA 3RFAA 1FWRA 2DJXA 3GDLA 4U28A 4M19A 3UXAA 4AEOA 1GTHA 1LTDA 1S5TA 1XBXA 4MYAA 1UJPA 3EWXA 3CWNA 2FLIA 2V5BA 1XDMA 3LHWA 1WYIA 2VFIA 1OFQA 1DJNA 1SQ7A 2QCHA 4MZYA 4M7TA 4NXSA 3G0SA 1KM1A 5DCDA 4IXXA 4JTUA 3W1LA 4I9AA 1OF6A 3GDMA 4UFLA 4JD4A 2HS8A 3DBPA 1KFBA 2JGQA 4N9DA 3SR7A 3S1VA 1Q6QA 2ZRUA 4XBKA 2OMAA 5AYZA 1PL9A 4JX4A 1H1YA 4FIRA 3OIXA 3M16A 5DN1A 4KFPA 2NX1A 3JS3A 4PL1A 3EX2A 4MYXA 3PC0A 4MKNA 5L6UA 3O63A 3TMLA 3QRHA 1T96A 2A6LA 4UNKA 1LDCA 4UTHA 3NQAA 2DU2A 5DLCA 5D04C 4HSNA 2CLHA 5CPOA 2F84A 2VFGA 2E68A 3UNDA 3FEMA 2ZA1A 5CZJA 3STFA 3KFTA 1A50A 1F5ZA 1SFJA 4CNOA 3G18A 2E09A 1QOQA 1RQHA 2Z6IA 4WD0A 2FFCA 2CWNA 2QCLA 4MLRA 3UWUA 1EP2A 1KM4A 2YSWA 1H5YA 3W1XA 3V75A 3LHVA 3DXIA 3VI2A 1OX4B 4ADSA 1IXPA 1P1XA 5EMUA 2FPVA 4Q32A 2OT0A 3IVUA 3W22A 2ISWA 3TFXA 2RDTA 1SZNA 3P61A 3WFAA 4PODA 2FB3A 3NNTA 3ABQA 3W7EA 2A21A 4O1CA 4I7VA 3LBMA 5D2YA 1SPQA 4HSOA 1C9DA 2I14A 3N14A 2EKCA 2WNNA 3K30A 3U2OA 4RCXA 3C2OA 1R46A 2Y7GA 2ZZ5A 4PL2A 3S9YA 1BWLA 2ISVA 1OYAA 2X1TA 3C8FA 3E12A 7TIMA 3IIZA 4Y9AA 3STCA 2ZQ0A 3T7VA 5CZSA 3G1XA 2WSYA 3LBCA 4MLJA 4UTTC 3RLVA 3QSTA 1Q45A 4A21A 3S5YA 2WOQA 5K9XA 1Z41A 4NZFA 2ZCGA 2VEIA 3S1UA 3HG3A 5FF2A 5CGQA 1WBJA 1ZAIA 4HIBA 1HL2A 4DF0A 4IUOA 1WV2A 1G6CA 3B4UA 1HG3A 2W6RA 1FDZA 1ICSA 1XBVA 5K7JA 3DKLA 4IMCA 3G1HA 3F4NA 2YDAA 3W6YA 1G4PA 3NGJA 2NZLA 4E2DA 3W1RA 3HB9A 5CPMA 2BLEA 4QIUA 1IF2A 3G22A 5AHFA 4FXSA 1QWGA 4JTEA 3R12A 3GXTA 5EPDA 4JTSA 3W2UA 1U83A 2V81A 5HMSA 3RF9A 1H50A 3DENA 4O50A 1F7BA 2DZSA 4LTSA 2YW4A 4JX5A 4O12A 4R7JA 3TH6A 3B05A 2J9YA 2WNZA 2Y61A 5FF3A 1MEWA 4Z1AA 2C1HA 1LM1A 4UCGA 1H7OA 1TJRA 4LV4A 1BWKA 1TIMA 3UY7A 3LX9A 3KVJA 2QUVA 2JBMA 3MJYA 4MY1A 4OQVA 5J5DA 4FO4A 3GAYA 3M0ZA 1XUZA 3INPA 4FNSA 3BG9A 2VFHA 1H7XA 4N4PA 3C61A 3I6RA 1EPXA 3IRDA 1DOSA 3P62A 1SW0A 4OV4A 2GVLA 1VRDA 1M6JA 1NAL1 1JVNA 3PBVA 5GVJA 2CLOA 3G1YA 3QM3A 2WSQA 4ALDA 3EWYA 1WA3A 2O7QA 3BPWA 1X7FA 5HQEA 5LNVA 1OK6A 5D33A 5LGZA 4NJHA 4OHQA 3U6WA 5I3FA 1BTMA 2GQAA 1SZFA 3P74A 3B0VC 2PE4A 3A24A 5K2ZA 3M5ZA 1OX6A 4CQ9A 2OT1A 5AC8A 1FQ0A 3NL6A 4DO4A 2CW6A 3NQGA 2TMDA 4Z0SA 1TV7A 4RXFA 1FCUA 4R34A 4AVFA 1W3NA 1TJPA 2JKPA 3QJAA 1XL9A 4O57A 4X2RA 5AYXA 1ICQA 4AHPA 1I4NA 1EWEA 1LRQA 4AWUA 3GZ3A 4OV9A 2C16A 3OVPA 4W9TA 1NEYA 3BG3A 5HWMA 4UTIA 1A5SA 4FF7A 4NJGA 4EOUA 3PAJA 1XKYA 1WAUA 1IGSA 3W72A 4JY9A 2ZZ6A 5G4EA 5BRBA 3EWZA 3E9AA 3G1AA 2DZWA 2Y7DA 3BLEA 4WY0A 4Q4KA 4NNAA 3TDFA 4ONVA 1TCDA 5G4WA 1G4EA 5HWNA 2GJNA 1OF8A 2E77A 3OEXA 3KRSA 2PCQA 4MJZA 3VCRA 1Q6RA 5LHFA 2X1UA 1FWNA 3NPXA 3TSMA 1Z48A 3W7OA 4HNUA 3S6DA 4YCPA 5BMWA 2QCCA 1EA0A 3M43A 1R30A 1TPUA 2IQTA 1Z42A 3G24A 1EP3A 5LNWA 5FEPA 2CZ5A 3P5ZA 4FNUA 1FXPA 3NZRA 1SR9A 3EKLA 4MY8A 3W1NA 1KBJA 2EAWA 3A21A 3BW4A 1O94A 1R47A 1G67A 2H90A 1QAPA 1H7RA 1TQJA 3CQ0A 3W7QA 3HG4A 4K38A 3BGGA 5EY5A 1EIXA 1KTCA 3TW6A 3FKRA 5D2VA 4DXVA 2Y70A 5FF0A 1HUVA 4UTMA 4UXDA 4BK9A 3UWYA 1V7YA 4N9BA 4BWLA 3KVMA 2OJPA 3O16A 3OHIA 4C1KA 1GTEA 2CZFA 3TFCA 4TMBA 3A5FA 5F1VA 2CLIA 2B7PA 4KFNA 1X1OA 1A53A 4O1AA 2E6DA 4ADTA 2NV1A 5I3KA 2Z2UA 2VELA 4HNVA 1H63A 1RVGA 5DBUA 3A23A 1Q6LA 5KTLA 1K7EA 2VKZG 5EA9A 4IMGA 4NX5A 4XKYA 3GLCA 4WOQA 3PF3A 2WNQA 5CKSA 1UASA 4AHOA 3TAOA 1G69A 1NF0A 3W2NA 1W56A 1W3TA 3L66A 2F7FA 3LERA 3ATZA 3LV6A 2WQPA 2NX3A 1YYAA 2P0OA 1ZAJA 2NUXA 3IGXA 1L6YA 1TRDA 2Y88A 3QW3A 4JYDA 2NX9A 5HUPA 3G0UA 4DEFA 1LP6A 2QR6A 3IIOA 2H8ZA 4Z0JA 5LSMA 1JCNA 4LC8A 4A29A 1AL8A 2EF9A 1VH7A 2H6RA 1ALDA 3S5NA 1DQWA 1TPDA 2CU0A 4I7WA 4WY0F 1GG0A 4GUIA 3TX9A 2Q8LA 3TW7A 2J88A 3UZJA 3MHFA 1AMKA 4N2YA 1O95A 4O10A 3STGA 4CCEA 1GQNA 4XQ6A 2BZNA 3NM3A 1ADOA 3G1DA 3DGRA 5G5IA 4POCA 1THFD 1H1ZA 4YXGA 4A2RA 2QCNA 4NUWA 5G2IA 1G4TA 5HR7A 2QJHA 2YR1A 1K02A 4WXZA 1L2UA 3FS2A 1FDYA 1YXYA 2CLKA 4GNJA 3NG3A 4FXRA 1DQXA 5AB3A 1E51A 1SW3A 3SJ3A 3MHUA 4Y96A 1QNVA 3NR0A 2R94A 3PUDA 1P0KA 1AW5A 4MIMA 1JCLA 1W54A 1XUUA 3N19B 3KXQA 4MZ8A 4O8RA 5CPNA 1F74A 3W7MA 3DAQA 3QPYA 5K9CA 4OBTA 3HBLA 3W74A 2XN1A 4DO5A 4BI6A 3NL5A 1YADA 2X1RA 4PCFA 3EXSA 4YCOA 2EGZA 3GX9A 1UUOA 1TTIA 1GT8A 4QJ1A 1GVOA 3L2IA 1TPVA 1SU5A 3LCXA 3CM4A 2QCFA 3TNOA 3FJLA 4Z1DA 4DBDA 6TIMA 1SW7A 1T8XA 2A0NA 1NSJA 3SFKA 3MWAA 3NQVA 3OBKA 1PS9A 3M41A 4K39A 4JR5A 3O6DA 1JQXA 3HPZA 5G2HA 3W71A 2ATMA 3M9YA 1SSDA 5CZTA 1OYCA 3W7PA 2DZXA 1W3IA 4WY0B 4JTJA 4JX6A 3N9SA 1OFBA 5F2MA 4Y90A 1LBLA 2DORA 2ZZ4A 3Q2DA 3STEA 3TR2A 4AWTA 3GR7A 3MW7A 2OCZA 2W79A 3CIWA 5LNSA 3NOEA 4GUGA 5AHNA 2BSLA 2RDUA 4LW7A 3TV8A 3NQ6A 2JGYA 4P61A 1GEQA 4TX9A 1GOXA 1OK4A 4N6EA 5K4ZA 5KITA 2A4AA 3FOKA 3G0XA 5CSRA 3L5LA 3KRZA 5I3HA 1ME7A 1X1ZA 3EX4A 1K3UA 3I65A 3QMRA 4M6QA 4A22A 3BW2A 5LNUA 2ZRWA 2Y7EA 5BNKA 1OFAA 3LHTA 3TSDA 2A2IA 2GVGA 3P80A 5D02A 1T0OA 3W7GA 3CHVA 1SZGA 4GUJA 4GWEA 2Y62A 2XN2A 1ICPA 3IEBA 3LHYA 4Y8FA 1JJKA 2D73A 2HTMA 4UTWA 2RFGA 4GE8A 2YW3A 1VCVA 4IMEA 4MOZA 4O0KA 1JCJA 2VXNA 3H54A 4FIQA 4TIMA 3QSRA 4O14A 4GC4A 4JIPA 4DBEA 3B8DA 1CI1A 4FX8A 4O17A 2NWRA 5AFDA 2X16A 3CLMA 3C56A 3LCFA 3PR2A 5F2GA 2QCDA 1H7NA 3MYPA 3NPUA 5EYWA 1I8JA 4AF0A 3MBDA 4X9SA 2YFNA 3W2LA 1OABA 3N2MA 1KM6A 2FTPA 1H62A 2Y63A 2DP3A 3DFNA 1HTIA 3O8AA 3SGZA 1WOBA 3C52A 4FNRA 4GFSA 1CX9A 3ZFHA 2YZRA 3CC1A 3I7QA 4UMAA 2UV8G 1K7XA 3N73A 2CZEA 2TYSA 5D30A 3TMQA 2A7PA 3WJWA 1LCOA 3FYPA 3N9RA 3Q58A 5ABTA 2A7RA 1VYRA 1KFCA 4JTKA 4LV9A 3U8GA 3W2MA 1JR1A 3DFPA 3KVKA 1ZFJA 3W7HA 2ZBTA 4FEZA 1JULA 5CPLA 3HGOA 2QCGA 1TTPA 3MYOA 4WZHA 1TQXA 4K8HA 3ELFA 1SFLA 1TPFA 3BLFA 2ZRZA 1TMHA 1GYNA 4NJIA 2CZDA 2I1OA 5AN7A 1YPFA 2QKFA 3W7JA 5HNRA 3B03A 3I7RA 5IBXA 3KRUA 3S0CA 1KV8A 3MP4A 1J4EA 3W85A 4KFOA 1QR7A 2Y6ZA 3QMSA 1M7PA 3TJLA 1DJQA 3G8RA 3QW4B 1PCWA 2ZA2A 3QQ0A 3L65A 2ALDA 4NJJA 3Q37A 1RQEA 3EEGA 4M6PA 1KM0A 4UR8A 4BI7A 4O28A 4HPJA 4N02A 2P1FA 1ZALA 3PULA 5LZLA 2ZRXA 3P84A 3L5AA 1VHCA 3CPRA 2G97A 3QFEA 3UPBA 5AOUA 2V2HA 1W5QA 3PUEA 3R8RA 3S42A 4CCCA 4RJEA 5AHLA 2FPYA 3LM7A 1W5OA 1PHWA 4IWWA 1DL3A 2J27A 3NM1A 1KFLA 3AJXA 1WQ5A 3VNDA 4RXGA 4MUZA 3LXAA 1GPWA 4GRSA 1OYBA 3BGJA 3BVJA 3KX6A 4HNNA 1DVJA 4O18A 3PWAA 3TUUA 1RPXA 2QF7A 5SWUA 1MEHA 4PFMA 2PRHA 1ZY9A 4FNTA 1BKSA 1N7KA 3GB6A 1TRIA 4NNCA 3EXTA 4PEKA 3MP5A 2QEZA 2GUUA 2VC6A 4OT7A 4ZVJA 1LORA 4EVZA 5LHEA 1QPRA 2V9DA 4UTJA 3W7DA 3S1XA 1SUXA 4CNNA 3M5YA 1FDJA 3OA3A 3W3OA 3JR2A 4Z1CA 5HWJA 3MUXA 4JDBA 4FX7A 1FWSA 3IIVA 3TAKA 1LBMA 4GJ1A 3W1MA 2HS6A 5DXXA 1JRCA 3L68A 4AAJA 2Z6JA 3NQMA 4O52A 2NXHA 2ZZ7A 5F4SA 3W9ZA 1O4UA 1MSSA 3BK0A 1NVMA 4R53A 2QJGA 3T4CA 4N4QA 5KZEA 2C18A 3GAKA 4O0ZA 2Y89A 3TKFA 1TREA 1JUKA 3USBA 1ML1A 2EHHA 4L4MA 4M6VA 4FB7A 1H7PA 4NU7A 5G1YA 3MI3A 1F73A 3DKJA 3EX6A 3SW6A 3B04A 4LVAA 4AWSA 3H55A 5C55A 2VFFA 3KHJA 6ALDA 2DZUA 2NXGA 3LXCA 1RD5A 3W1PA 2AQWA 3A22A 2E1DA 1G4SA 1ZCOA 3KAOA 3M44A 3QZEA 4JYEA 4EIVA 2BXVA 3L0GA 1OFRA 1C8VA 3GKAA 1KM5A 4DELA 3LCLA 3HIJA 4LVFA 5DELA 1FY6A 2E6YA 3PUOA 2FPTA 4JTHA 4H6KA 4ORMA 3TQKA 4O16A 3W83A 1AW1A 4O11A 3C2VA 3DU0A 5A8GA 5TQLA 4RZ6A 5D37A 1KLYA 5FEXA 1C29A 2ZYFA 1VCFA 4BWLC 1VHNA 4MFEA 4O13A 1JRBA 3NZ1A 1FBAA 1I45A 1SSGA 3UWWA 4UFKA 1EX5A 5F2IA 3DHDA 4ZQMA 3I7SA 3A9IA 1G7VA 2G5WA 1TPC1 3GYEA 3O05A 3PY2A 2TRSA 1UB3A 2Q3RA 4NT0A 4O4VA 4ZQPA 1LZOA 4TMCA 1Q6OA 3UQNA 2WPBA 4GUHA 1KM2A 1VQTA 3EX3A 4AXKA 2BX7A 4WOZA 3LCIA 1AK5A 5I3JA 3HG5A 5DY3A 1W5NA 1YPIA 3IGUA 3W7RA 3LCHA 3HG2A 4AB4A 3CIXA 2JKEA 4M5PA 3M1ZA 1KFJA 2V8ZA 3TSBA 1WXJA 3L9CA 1TSIA 3NL2A 4NXKA 3MP3A 3T78A 3MMTA 1BEUA 2YCEA 3PVFA 5J5RA 4TU1A 1YDOA 1HO1A 5G1TA 3UXDA 4N6FA 4MFDA 4Z1BA 2C15A 1L6SA 1TTJA 2DZPA 2YYUA 4UTLA 1EP1A 1WBHA 2CLEA 3IIPA 4WQ6A 3LTSA 1VR6A 2B4GA 3TJXA 3PBYA 3O07A 3CTLA 3TROA 3L0NA 4RZ5A 4UTUA 1YTKA 4LWWA 1P5BA 2CLFA 1YLVA 1R2RA 1LOLA 4LUJA 3TQVA 2XN0A 1H61A 3DHFA 1F6PA 1TPB1 1S5VA 4FNPA 1F76A 1F2JA 3NVTA 4JN6A 3OVQA 2PC4A 3EXRA 4XWUA 3GDKA 2Q3OA 3UPWA 3R2GA 2WO5A 3GDTA 4LOCA 1FWWA 2GVJA 4JTTA 5FI8A 2JK2A 3E0IA 4LUIA 1IXNA 4MJMA 3R89A 4KWWA 3NEVA 3O6CA 2G96A 4EWND 2YFOA 1GVQA 2GJLA 3UWZA 1KM3A 3BLIA 2NXIA 1ZJIA 3W7NA 5MHBA 4WUIA 2I9EA 1O60A 3LDVA 2YX0A 4LVBA 3NDOA 4IX2A 1I2NA 4ORIA 1TB3A 2WSRA 2A6NA 1KTBA 3GVGA 4ZQCA 1GYLA 1W0MA 4Z08A 1DORA 1VJIA 4NZJA 3E49A 4HNTA 4LS2A 3B06A 3RNDA 1HFBA 1RQBA 3W75A 3AO0A 2O7SA 1FCBA 4UNLA 3C2RA 4KKXA 4LVDA 2J24A 5E93A 4JDYA 3C2FA 5FEZA 2RHGA 3O1NA 3KVLA 5IM51 5FF4A 1B57A 4RV8A 3NQDA 4PC8A 1GZGA 4LY8A 4RZ4A 3SECA 4ZZ9A 3SSJA 5D03A 3GNNA 2ZTKA 3G8EA
chains in the Genus database with same CATH superfamily
4A8NA 4GG9A 3GKFA 4IIFA 4PUEA 6XIAA 3WQ8A 3GO2A 1QO2A 1DV7A 4HU3A 3UYCA 1R38A 3ZJ6A 3BJSA 1PXGA 4IPJA 2DT0A 1QI5A 3O6YX 1ZQ5A 5TAOA 5A2AA 4NX0A 4R3UA 5D2WA 3WBEA 1DTNA 3KOYA 1DKWA 3WY1A 2FZBA 1ZTVA 4HZ7A 3HM7A 3EKZA 1GK8A 1OX5A 5C7VA 5HXMA 5T26A 3W76A 3DG6A 3ENLA 1XFBA 4F4RA 3WEZA 2E5BA 3BW3A 3KP0A 4XTIA 3E6EA 5HAOA 5IFTA 2W61A 4CN1A 9RUBA 1TPH1 4C5ZA 2OYLA 4HPXA 3FN9A 4LVGA 4W8BA 1N82A 3ARZA 1V3HA 3QY8A 1QASA 4GGBA 2NQZA 3W7CA 3GW3A 3TA6A 4HN8A 2QAPA 2GOUA 4QITA 3VFCA 1M68A 3K8LA 1MI3A 4HBKA 4KIRA 2C71A 3H2MA 5FJTA 3PBWA 5B80A 4ICMA 3JRKA 3WLMA 1PIFA 3PBMA 4UR7A 3FEQA 4MPQA 3MHGA 2Z1BA 3BAXA 1MVYA 1OCJA 3LCWA 4REQB 3C2EA 3K4DA 3UEQA 3PTMA 3CMGA 3W86A 5FL1A 5C9RA 4HKPA 4XAYA 2PP3A 1H2JA 2OOGA 3OZMA 4BF7A 1K8YA 5IBXC 4MADA 3LRKA 4IG2A 3IGHX 4ATDA 3OW1A 3M4HA 2I7GA 4LF1A 4LAZA 5AHMA 2Q6ZA 4CQCA 1AH0A 3D5HA 3QF0A 2PWVA 2W92A 4V27A 5LNRA 4B4HA 3RLUA 1XSIA 3PS7A 4EF9A 2VHLA 5AHEA 4QGCA 3GR8A 4NAEB 1B5TA 5BWAA 4PCNA 4GZ7A 4PUMA 1W5MA 3BLPX 3BMXA 4ACZA 3UESA 3CL6A 3VVGA 4F9DA 2BMBA 3DBNA 4A8RA 2QPSA 4GBUA 3VKCA 2WCAA 1D9EA 1IWPA 3NL3A 3WLRA 2CBIA 1PDZA 3BSGA 1L6FA 2EPLX 4U4MA 3M0VA 3FSUA 5IFPA 3S5ZA 3FCPA 5HATA 3VGDA 2Z0IA 2BVWA 4E8GA 1O5KA 1RSCA 2OSWA 2B7QA 3KE0A 1M7OA 4RUBA 4MAZA 3UY8A 2B0MA 4IP7A 4UFMA 4JKKA 1FCQA 4N0RA 4GKTA 1XPYA 1A5AA 4HD5A 3HA1A 2OLSA 1UPPA 2IPFA 3WH8A 4UIOA 4CNTA 1C8QA 2VENA 2QCEA 3HURA 3KCOA 4GYPA 4PTVA 1TG7A 4H9MA 4Q4MA 2PDYA 1TV8A 3P8JA 3V35A 3WD0A 2IW0A 4LYRA 1OFDA 1XC4A 3E96A 4O4WA 3S83A 5BOOA 3N9KA 1PZ3A 2ZZ1A 1PE1A 1SO5A 3KM8A 2ZDSA 1FWAC 3LGDA 2ZUVA 4W93A 4HYVA 3FDGA 1R8LA 1XKJA 2NLYA 1PTGA 3HFYA 2QIIA 3ZR4A 1XQKA 3ARTA 3NQEA 1GHRA 1KV5A 3NPVA 2F61A 2E5CA 6ENLA 3GYCA 3SRFA 4O1DA 3WNLA 1NM9A 3SY5A 4JHMA 2XH0A 3S6TA 2DGAA 1ZPTA 5RUBA 3V18A 2V2DA 1ZLPA 1C93A 4YWIA 3EDJA 1RLDA 4NJKA 4AIBA 4WIWA 4MZ1A 1OX4A 5CCZA 3R43A 4W85A 2ZTJA 5U7SA 3T2OA 1HXJA 3U2ZA 3HJEA 1XIEA 1IV8A 3KBJA 2C3ZA 4JXCA 1ZSXA 1NH6A 3W26A 3MBFA 5T8GA 1PZ1A 4HT3A 4GNVA 4AZ6A 1UUQA 2EPKX 2W67A 2P8CA 2VI0A 4EF8A 2QV4A 1FWIC 2QVHA 4LYQA 2NV2A 4HQVA 4AZ5A 1CXEA 3LN3A 7REQA 2VO5A 3F7JA 5TIMA 3L67A 1EHNA 3U2CA 1OFEA 2BNJA 2E6AA 3GR4A 1PYMA 3WFZA 4AIEA 2QDGA 1Z6KA 5HNNA 3K13A 1KWGA 1D3HA 2NLIA 4W89A 4DI8A 5BZAA 3SAZA 1C8XA 1KBIA 3WDPP 4CD8A 4YYCA 3I4KA 3IV8A 3NQ8A 4ZOCA 3A5VA 2ZICA 3LLDA 1R0MA 2BG5A 2A3BA 1L8PA 1QI4A 2Q02A 1F05A 4HCDA 1F6KA 3IV3A 3SFWA 2DIKA 3VGBA 4EWJA 4MWAA 4QLJA 4KT2A 2EJAA 4PCPA 1HT6A 3BXWA 5KMYA 1JZ8A 4JTFA 3ZT7A 2VGFA 4L1XA 2EPMX 1QPNA 4CCZA 3GC2A 1OVDA 4M6UA 4UMCA 4UTWC 2DH3A 3AXXA 3GIQA 4DAIA 5GPRA 4I3GA 4F0RA 1XGDA 1UG6A 1J79A 1QI2A 1XLJA 2ZOXA 4X22A 4RDYA 1P7TA 4PB4A 3E2QA 3OLIA 4GIEA 3WNMA 1UKTA 1PCKA 3S5OA 1W1B1 3BMWA 1OFPA 3TN6A 3THQA 4D8LA 3NAVA 4W7VA 1BYCA 2J6XA 4XZMX 3ZJ8A 1D3GA 1W37A 1M41A 2R91A 3PJTA 3O06A 4PBFA 4KGLA 4FALA 1EBHA 2HPIA 1XV8A 2C0AA 4B5UA 3TXVA 2Z1XA 2DT1A 1E0TA 1QW8A 3SCVA 4UFHA 1JZ5A 2D3LA 4IGHA 4C1LA 4NHVA 3S6OA 3GIYA 1M3UA 1GG1A 5E09A 1T7LA 2ODOA 5AZ1A 1S5NA 5F4WA 2X30A 2ZC1A 3F5KA 4ZO8A 4TVCA 1E9IA 4WXYA 2Y2WA 3UCDA 4CVUA 3KS5A 3QMTA 4AUBA 5BMXA 4Y9NA 5AY7A 3E1F1 1FWTA 3A9BA 5CC7A 2BTMA 3TC7A 1QPQA 4FXFA 2BASA 3UGRA 3WELA 1L9WA 3CQJA 1QNOA 4HYRA 4FF5A 3ABRA 2VNCA 2QUNA 1BRLA 2ISSA 4TXEA 4HHPA 4LAOA 8A3HA 1E4IA 3HQ1A 1JPKA 1OFOA 1O5QA 1Z44A 2INZA 3IACA 3ZWSA 3GC4A 5CPTA 3OIHA 4FPSA 1RALA 1E1CA 5U4NA 4JEQA 1FXQA 3MMWA 4XBSA 3GXNA 2H9AA 2DZVA 4JTGA 1TX0A 4AEFA 5HA7A 4R9OA 2CFFA 2QGHA 4DUWA 2EO7A 3VABA 5L9FA 1R9YA 2WBGA 3OU8A 4I9MA 2DZBA 3LRMA 3IAQA 4DAFA 4OECA 1HGWA 2Z27A 4UFJA 1L6WA 1OZQA 5D32A 3E2SA 2H3BA 1ME8A 3C3NA 1A5LC 3F03K 2RDWA 4YTQA 2QULA 1RZMA 4Q7NA 4RKAA 4DM1A 3GD6A 4YTSA 4G8TA 3EWWA 1HIZA 3CZKA 4HK5A 4JN7A 2NW0A 2PWDA 4UR9A 2PC8A 4OOZA 3T0AA 1F6YA 1AW2A 4HP5A 4XSLA 1X38A 1ZUAX 2GK1A 3WJZA 4XO6A 3FV9A 1ZCCA 2QW5A 2XSBA 3OHMB 2TODA 3DEQA 3NO5A 3T42A 4OUIA 2V63A 5HANA 1KCLA 3GY1A 2FGBA 3VNLA 1M1BA 1O66A 3H23A 2QAFA 1V3IA 5E1QA 4JICA 2V3DA 5F2LA 4K7YA 4R7WA 7XIMA 3BJFA 3GDLA 1VFOA 2PDGA 2DDXA 4R88A 1S5TA 1CXKA 4J1OA 1V0LA 3CWNA 1C92A 1XDMA 4KRZA 1OFQA 1RP9A 1DJNA 1RH9A 4GNKB 2GJRA 2QCHA 2WB5A 2VVSA 4C6KA 4NXSA 3G0SA 4AZIA 3WSUA 5DCDA 4IXXA 3A12A 3VNMA 2FVLA 3KTCA 3WDJA 2HS8A 4AD4A 3RITA 5XINA 4AQLA 4C6PA 1KFBA 9XIAA 1NDWA 1JYWA 3E0VA 4R27A 1EGVA 1DJHA 4M29A 4FIRA 4MNLA 1JYNA 4I6KA 3F2CA 5LYRA 3EX2A 4MYXA 4PUUA 1K9DA 3VZYA 4MKNA 3TMLA 2A6LA 2BHUA 4PUNA 1DWJM 2QQ6A 1LDCA 4QCEA 3NQAA 1V79A 4AD2A 4CU7A 2WWDA 2BOEX 5D04C 4HSNA 4EKJA 1A5MC 3ARRA 1PDYA 5M1TA 4AVNA 1WNOA 1KRAC 1YRRA 3WNNA 1SFJA 1BWVA 1TCMA 3SCUA 1O6IA 1CXFA 4U10A 2CWNA 4MLRA 4NAFB 1EP2A 4QJ5B 1UROA 3W1XA 3V75A 3LHVA 4JIHA 1OX4B 2UY3A 3G6LA 3AYVA 1SJBA 3NSNA 3FSTA 2WCSA 4DWSA 2OT0A 2OSXA 4FI4A 3BQ6A 1SZNA 3W7EA 4O1CA 4BKNA 3CPUA 4WF7A 2EKCA 2Q01A 2WNNA 3CYVA 3K30A 3U2OA 5I09A 1R46A 3NWRA 1OYAA 2OEJA 2X1TA 4Y9AA 3STCA 1FWHC 3GHUA 5CZSA 4JTQA 2WSYA 4MLJA 1XYAA 1XD0A 4B9ZA 2X42A 3RLVA 4DWSB 1Q45A 1MRQA 3UBPC 2J77A 3KHDA 3S5YA 4A8IA 3LSCA 1GKQA 2Y0FA 2ZCGA 1HKJA 5CGQA 4HIBA 4L1GA 4DF0A 5ABEA 3UYIA 1XD1A 1HG3A 2W6RA 1J0KA 1FDZA 4XZNX 1XBVA 2JEQA 5K7JA 3G1HA 3W6YA 1G4PA 4GQRA 4L9ZA 3NGJA 1F61A 4GY7A 3GTFA 4XG1A 4XZLX 5CBJA 1CBGA 1U2YA 3PWGA 1ITXA 3CASA 4ZOAA 3R12A 4E5TA 2VQUA 3W2UA 4TV5A 3UCQA 2PDLA 1BRLB 1PWLA 1GVYA 4O12A 2V3FA 3VIOA 3NO3A 1CECA 1H7OA 4XV0A 3KVJA 2QUVA 2JBMA 4ZOBA 3GAYA 3ES7A 2HNHA 1E3XA 1M53A 4FNSA 1LL7A 2VFHA 1Q2SA 1SMDA 3I6RA 9CGTA 3IRDA 3P62A 3GHRA 1NAL1 3PBVA 2GGJA 2WSQA 3EWYA 5A6SA 1X7FA 5HQEA 3RRXA 4ZBCA 1E4NA 5IHSA 3N2BA 5D33A 3KBSA 4OHQA 1SZFA 2Z1VA 2PE4A 2OVLA 1FH8A 1E43A 1XYLA 3ABXA 3M5ZA 3FW6A 1OX6A 3H21A 4XAGA 3DDMA 6XIMA 2WZHA 3NQGA 2W62A 4Z0SA 1TV7A 3WQVA 4WVXA 1QNRA 2W3ZA 3A64A 2OSYA 2Z7KA 4XX6A 5DT7A 1MNZA 3QJAA 2NVAA 5AYXA 1XDJA 4AHPA 1I4NA 1EWEA 3GZ3A 4LBSA 2C16A 3OVPA 3QKEA 4MWAB 3VIGA 2HWGA 4W9TA 4Y9MA 4PMOA 3FYYA 4UTIA 4FF7A 4NJGA 2Z2BA 1KGUA 1W1PA 1WAUA 2W5FA 3S2LA 1HF6A 3E3HA 5G4EA 5ABFB 3GUWA 1GGOA 3EWZA 3H2NA 2DZWA 4WY0A 4GABA 3SURA 2XWDA 1WCGA 1TCDA 1G4EA 5HWNA 3HV8A 3WQ4A 4M56A 5A6BA 3CQHA 1Q6RA 5LHFA 2FMOA 2X1UA 2X0SA 1FWNA 3NPXA 1XIHA 3KP1A 1Z48A 4HNUA 4ZEPA 2QCCA 4LCRA 1GNXA 3M43A 2OLAA 2IQTA 4HHLA 1Z42A 2W63A 2CZ5A 4FNUA 1CDGA 4DYJA 3IANA 3DFYA 1XWYA 3A21A 3TCSA 1REQB 5FIPA 4NG3A 1R47A 1G67A 1H7RA 1QAPA 1TQJA 3CQ0A 4WCJA 4AFYA 1S2TA 3PNUA 1ZJHA 4NL1A 2R6OA 1EIXA 4HMCA 5D2VA 1HUVA 4P5UA 4UTMA 4ILSA 4PMVA 4JOMA 4XK2A 4WLCA 1B3WA 3AICA 2OJPA 2MUCA 1YKWA 3QY7A 4J40A 4C1KA 1GTEA 3ZT6A 4H9XA 4TMBA 1UR8A 3ITVA 4J27A 3CH9A 1TWDA 1A53A 4O1AA 4EACA 2CKSA 2VC5A 4IFKB 4JNZA 1JFHA 4MWAE 3CS2A 1RA0A 3A23A 4P7OA 2OODA 3GFZA 5EA9A 4KPLA 2WNQA 5CKSA 1DXFA 4D6CA 1NF0A 1DWFM 3L66A 3E0WA 6PTDA 1NWTA 3KZSA 4HHHA 2NX3A 1YYAA 2P0OA 2WM1A 4Q4QA 1TRDA 2Y88A 3LZ3A 1JF6A 5HUPA 3HU7A 2DVTA 4DEFA 3TEVA 1LP6A 2QR6A 4G1NA 4LUSA 3P2VA 4Z0JA 4G5DA 4FSAA 1OCBA 2IKGA 1Q66A 2EF9A 2H6RA 7TAAA 2QJNA 2EPOA 1GG0A 1UQYA 3VYLA 3FHAA 3EDFA 3E5PA 1FKWA 2V5DA 3UZJA 2E40A 4PB3A 4LGXA 4QJ4B 3TTOA 4O10A 2JQXA 3TONA 2BXYA 5G5IA 4POCA 1EOKA 1IWBA 3EMCA 1R3WA 4C7DA 3QN3A 1HKIA 3BH4A 2EXOA 4TTUA 2GUBA 4YXGA 1GCYA 1K02A 4WXZA 1L6GA 1JDFA 3Q45A 4NAFA 5AB3A 4Y96A 2R94A 4DBUA 1JCLA 1W54A 3KXQA 4O8RA 2DSUA 1WO2A 1IT8A 1AUSL 4DO5A 4BI6A 1JPIA 3KTSA 2DUAA 3NL5A 2X1RA 4PCFA 1BF6A 2EGZA 3DCPA 4C6EA 4JL1A 1NIUA 1TKKA 4DBSA 1SU5A 1AQFA 3THDA 4GI4A 3H7RA 4NAEA 1PJ9A 1XLBA 3FJLA 6TIMA 1SW7A 2VWTA 3U9IA 3SFKA 1RBAA 2D0GA 3FNDA 1BVWA 4B5TA 1HNYA 3WF1A 4JR5A 2GZXA 1JQXA 1N8WA 2VUYA 3MS8A 1BGAA 1KKRA 3WD2A 1B30A 3EZ4A 4KGJA 3W4RA 1UKOA 2Z1SA 4KQNA 4C6OA 3U5YA 1V3LA 2BFGA 2AL1A 2W66A 4PMYA 1OFBA 4ZE5A 1LBLA 3STEA 4AWTA 2NT0A 1CGTA 3CIWA 5LNSA 2YL9A 3NOEA 1XJBA 2DQXA 3TV8A 4H9TA 2ZX5A 3B0YA 1GOXA 3P0WA 4D9PA 3EA1A 5KITA 1ZB5A 4ZO6A 1RUSA 5KEZA 4ZB5A 5I3HA 4GYFA 4IICA 3I65A 2E9MA 4A22A 1EOMA 4Q7IA 2ZE3A 2YL5A 3TYAA 3WUFA 1VAHA 2BHYA 4L5ZA 2V67A 1TWIA 4PMQA 2YCKX 3TSDA 4Q8OA 4LANA 3EA2A 3W7GA 1PZ2A 3V1HA 2YB1A 3DGBA 3OBEA 2Q8XA 3N18A 2RFGA 4REQA 9XIMA 1VCVA 1NDYA 1R85A 1LWIA 6REQB 4O0KA 3T8QA 4H8HA 4FIQA 2J7HA 3KBWA 3TYCA 2G41A 1KQZA 5FKYA 3CXOA 1CI1A 4O17A 3PZIA 2X2YA 3LCFA 4JZ5A 1H7NA 1EJRC 3N15A 2PD5A 5EYWA 3BCDA 3VOFA 1FOBA 4HSHA 2ZXBA 1OABA 1KM6A 1H62A 2DP3A 2PTXA 3FHQA 1WOBA 2WAGA 4GFSA 1CX9A 2PDUA 3I7QA 4IM4A 4UMAA 1EZ2A 5D30A 2A7PA 1LCOA 3FYPA 1WXZA 3Q58A 4MDPA 5ABTA 2A7RA 1KFCA 2DW7A 3U8GA 1IE7C 1PO9A 3CLWA 1ZL1A 1XGZA 3DHUA 1JULA 3VD3A 3WNPA 3HGOA 2CLPA 3K1DA 4LY4A 4K8HA 4W4QA 1SFLA 1FP8A 4F40A 3BLFA 4N7QA 4NJIA 2R24A 4JAWA 5AVNA 5HJYA 2VCAA 2CZDA 4L56A 5I7GA 2F9RA 4D6IA 3GBDA 5I77A 1NOUA 4RPQA 4GVGA 5AN7A 2QKFA 3AQUA 5HNRA 1AVAA 2XUCA 3S0CA 3UR8A 3TZNA 2PDFA 2C7FA 4B2DD 1RLCL 2BV9A 1UH3A 4O1FA 4ERGA 5C0QA 3D6NA 2O92A 3M0KA 1WXYA 4EK7A 1M7PA 3TJLA 3AROA 3I10A 2PDHA 1W3JA 2ZA2A 2PBGA 2BY1A 1JG9A 4YN5A 4CU8A 2POZA 3EEGA 4M6PA 1KM0A 2CKRA 3FX4A 3VO0A 3RLGA 2WJFA 2CBVA 3KZPA 4HHMA 3VDHA 3L5AA 3F2DA 1OD8A 3UPBA 3MDWA 1CXHA 1XG4A 3S2JA 4HK6A 3BAKA 1LQAA 3VNDA 3PJUA 3BOXA 4GRSA 3BGJA 4HNNA 3PWAA 4BEUA 2QF7A 5C71A 4B3ZA 1BKSA 1J12A 1J6PA 4IF2A 1NU5A 2VC6A 3MSGA 4EVZA 1EYEA 1SMAA 5I6SA 3GSMA 4UTJA 3TC3A 4IQEA 4X2PA 1PKYA 2VEFA 3M0IA 4QHRA 4Z1CA 3WLHA 4DWSD 2ZIDA 2WLYA 2HJPA 3TAKA 1GVIA 4GJ1A 2XDFA 5DQPA 2Z6JA 4BHYA 3ZLHA 3UETA 5E9AA 4GD0A 3AIBA 3QY6A 5ECVA 3I6TA 4FB7A 4MUPA 2WHLA 4F0KA 3DKJA 2P5NA 1GUVA 3KUMA 1ONWA 3B04A 3GVQA 4E6MA 1MQPA 3KHJA 6ALDA 1RD5A 1GOOA 1W9PA 1G4SA 4TVUA 2WC7A 3M44A 4JYEA 2ZUMA 3L0GA 1OFRA 1V03A 4AZ7A 1KM5A 5JUVA 4DELA 1XIFA 3CK5A 3AXKA 1E5JA 8XIMA 2E6YA 3GU1A 3AXMA 2DUZA 5A8GA 3C2VA 2J79A 1Y7VA 2V68A 2VDIA 4H9VA 2OO6A 5E6YA 2ZYFA 1YHTA 4O13A 1J0ZA 1KGWA 1XRVA 3C0QA 2RGMA 1FBAA 4MAVA 4UFKA 3VGFA 1EX5A 3PZ9A 3A9IA 3OPSA 3H2AA 5MKGB 3JU2A 4IL2A 1PTAA 3WF3A 4JKLA 2XGBA 2CESA 4NT0A 3DX5A 2HCVA 3HFTA 1FHVA 1B31A 5K9DA 4B4FA 1Q6OA 4AXNA 3ZZ1A 4AXKA 4WOZA 1SJDA 1HVXA 5I79A 2FMNA 5DEZA 3U57A 1C7TA 3CIXA 4H19A 1TSIA 4NXKA 1LT7A 1TZ9A 4DX3A 4YHGA 4HPGA 3H4GA 2D2JA 1YDOA 3SN4A 3QR0A 3PK7A 1WDDA 4N6FA 4Z1BA 7A3HA 4ENLA 2YDRA 3POCA 3MANA 2YYUA 1I6NA 1EP1A 3WD3A 3LTSA 1VR6A 2B4GA 2HQAA 2INFA 3PBYA 3T0DA 3O07A 2PLKA 5DRIA 3TROA 3CMFA 1Q4NX 3L0NA 1LUCA 1MW2A 3VXGA 3WQFA 1GJWA 1LOLA 3WMBA 3NXLA 3M07A 1EC9A 1S5VA 1I1WA 4FNPA 1F76A 1F2JA 3AMLA 3AXHA 2PC4A 3EXRA 4XWUA 4QJ3B 3UPWA 4NSBA 2F6KA 3HQOA 3RDKA 2WO5A 5CGMA 1Y5XA 2PWGA 4JTTA 2HE5A 3FAXA 3ONBA 1MFVA 2V69A 3CAQA 5LIKX 4PRWA 3ITXA 3O6CA 2FHFA 1IWAA 1T8QA 2GYIA 3B97A 4EWND 2YFOA 1S1PA 1JZ7A 4WKFA 5A8MA 1KM3A 2NXIA 4DLFA 4F66A 3O3RA 4WUIA 4JFSA 2UBPC 2I9EA 3N6JA 1E0VA 2OKOA 4LVBA 3PJXA 2RAGA 1TB3A 1E70M 2A6NA 5GJNA 1KTBA 2ZADA 1W0MA 2WSKA 2AOSA 1DORA 3SSZA 4GIRA 1BAGA 3HPFA 2I56A 2XIIA 3RNDA 1HFBA 1YEYA 4D6GA 2DT3A 3AO0A 4L1WA 4UNLA 2IKIA 1OT2A 2QZRA 2VCBA 2PFHA 4JDYA 4JIEA 4QE4A 5FEZA 2RHGA 4FOKA 3ICJA 3FK4A 5FF4A 1B57A 6TAAA 4RV8A 3EWCA 1S38A 2QLYA 1GQKA 4JHOA 4GMEA 3ITLA 2X7WA 4JHZA 1E6PA 3WDQA 5D03A 3VZXA 3BJTA 1NY1A 1E55A 1YDNA 3CWOX 4GZEA 1L2QA 2J47A 1UR2A 3FA5A 3NZGA 1WX0A 1JCMP 2ZUSA 3BLLA 1YE4A 3ABOA 4AF0B 3GRIA 1RV8A 3RCNA 3PG9A 2VX6A 4AIOA 1IIHA 3LGEA 4CU6A 4F48A 2GGGA 8TIMA 3U4AA 1XBZA 1TPWA 5FJPA 3SZ8A 2FYMA 4QG8A 3EOOA 3GE7A 5ABGA 4WSKA 5AC7A 3ANYA 1KR1A 5TNVA 1X8CA 3SI9A 1E6RA 1PHQA 4AWEA 1WKFA 4K8EA 2PRMA 3S1WA 3C0JA 3OYZA 1GOKA 3ALFA 2VURA 3WQ6A 1FWBC 1MMFA 5IXEA 3DERA 1Q6GA 3APTA 3PPHA 1J01A 3PZVA 3TJIA 2I16A 3HPSA 4V1XA 1QXLA 3BV4A 2FGZA 1ISYA 2GQ9A 5C2XA 1QDSA 4JNMA 2RH9A 4ZMGA 1VEPA 1K8XA 3GXIA 4C6FA 2CWXA 2WV8A 1RHCA 1X1NA 1ZNNA 1UBSA 4ZB2A 1VENA 3G3DA 3T0BA 3FIGA 1ISZA 3OP2A 5CPQA 1XRFA 3GBEA 5I00A 2Z26A 1NOFA 5G2WA 4ATWA 5BYWA 3NQCA 1Y0EA 5JVLA 3BAWA 1E6ZA 3T0CA 1Z32X 1VFTA 2J4GA 3TTQA 4EANA 2WMIB 3AMGA 5HUOA 3LEPA 4XKYB 5FA5A 3HQPA 4YTRA 3W84A 4OFCA 3RAOA 4LXFA 2FQIA 3L4ZA 3ZWTA 4H4IA 1XPGA 5F7UA 3A3XA 1LG2A 1J2WA 2YPIA 2WHMA 2ZC8A 1LOSA 3BTNA 3EAUA 3UPMA 2D3NA 1LYXA 1AL7A 2WHJA 1XYCA 2XVKA 1YXDA 3LYEA 3BICA 1EHAA 3KL3A 1UH4A 4A3YA 1KW1A 3A6OA 4LS1A 2IPJA 4PTWA 3QH2A 2PGFA 4KWVA 4QP0A 4HYWA 1DHPA 3RCYA 3CHCA 5DCEA 2C19A 5FF7A 4ADUA 4Y6GA 3M7SA 5I0DA 2VZUA 4KCWA 5B7ZA 3LNMA 2J7FA 1RR2A 2CLMA 1PKLA 2J78A 1XRSA 2ON3A 4Z2GA 3VK5A 3LGGA 1V6YA 5A69A 3WK2A 2VD8A 3P8IA 5FL0A 1A0DA 4R33A 3CT7A 1YTDA 3IJLA 1VFSA 3TU9A 1OJXA 1QT1A 4KESA 3MO7A 4JQ4A 3PSVA 4KEZA 1FVPA 5FESA 1FX6A 4A8LA 2WYSA 3ZS4A 3SCQA 4LUYA 3OLDA 4KEMA 4S2CA 4NNBA 3ATYA 3DECA 2AAMA 1G1YA 1DIDA 2FZMA 1EC8A 3MU7A 4HTBA 4Q4OA 4UC5A 5K4XA 4C7FA 1U33A 4FR1A 4EAMA 4V2XA 2BODX 3HGSA 4HJWA 4H6EA 1B54A 1QPKA 2J7CA 4XZ9A 2V30A 2G95A 2P10A 1XCWA 3TTYA 4Z2HA 4W84A 2I5IA 3BLOA 2BS9A 1T5AA 1ONRA 3M47A 4PMXA 3VDGA 3IJDA 4F9JA 1TMQA 5IDZA 2WZIA 3N6HA 3BSHA 5JMUA 3URAA 3HMJG 5DMYA 4DZ5A 2X1IA 3SIZA 4ZQOA 5AKQA 4UZUA 3M0YA 3V4BA 1P6WA 4TTGA 3ITCA 4RK8A 4GVFA 2ANUA 1I2OA 1UD3A 5BW6A 4QQ3A 3H53A 4CNPA 3HF3A 4P8XA 4AY1A 3NQFA 2WPGA 2DVUA 3AIWA 4KH2A 4DHGA 4LPCA 5HNUA 3ZJ7A 2J66A 1G7UA 3N3MA 5B7YA 1J0IA 3PBGA 3NQ2A 4QSHA 1NTHA 3DYMA 4FR6A 3LV5A 1ISVA 3DZ1A 2ZXDA 1OGGA 3NQ7A 1I2PA 1AG1O 4A2SA 4S39A 1RPKA 4X0VA 2UWFA 3T55A 3ARVA 1UH2A 3W7LA 2OFJA 1CT5A 4G1KA 4I90A 3QYQA 1LRTA 4YIWA 1KBBA 3D0CA 4JYFA 5CSUA 4JTCA 3F1QA 3HQNA 3OYXA 1K6WA 4O19A 4S23A 4B5VA 1K7FA 1W2PA 4JTLA 4JS3A 3HGJA 4L64A 4H01A 2OPJA 4BQ5A 3VDBA 1QHZA 5HQMA 4FHAA 4DF2A 2VUNA 4HMDA 3MI2A 3GNRA 1KTNA 4V1YA 2WJZA 2ZXAA 1XIGA 4OU1A 5EFFA 1EA9C 5EMYA 1ODUA 2ABAA 1VJZA 1ADDA 2VGGA 2YBVA 3BURA 2ACQA 2YJQA 4H41A 3PSWA 1BSIA 4H3DA 3H26A 1MDRA 2ZX9A 1EJ7L 4UQDA 4IFKA 5BU6A 3PB0A 3VOGA 1FWJC 2R1LA 1MXSA 2J74A 1OWQA 3SY8A 4ZQRA 1GHSA 2VGIA 4WX2A 7ODCA 4BY3A 2ZKMX 3T81A 3TQ0A 4B16A 3B0UX 1TV2A 4J3WA 2DZTA 4H04A 3W6MA 2PURA 3LTPA 4DXKA 1EBGA 3NO1A 3N2XA 4YVPA 5M2FX 4LT9A 1ITUA 1ONXA 3ID7A 1KFKA 3DI0A 1KXHA 1N55A 1A0EA 3AJ7A 5H91A 3DI1A 5CZ0A 1EJXC 5CEWA 3LY0A 1WOAA 4AVOA 2XIBA 3PPGA 2G3MA 3W2KA 4MB4A 4PUJA 2PDJA 3QGKC 3W6LA 2OELA 1W5PA 1VYPX 4OIFA 3B8SA 3M0XA 1BXBA 1ECEA 4Z2LA 4ZOEA 2AGTA 3LB0A 4ECLA 1PSCA 3DH7A 1I0BA 2H8XA 3RMJA 2CHNA 1HZYA 4GH1A 3GHSA 3GNOA 3TYBA 1HKKA 3W0KA 4K1WA 1M03A 4DUVA 1M5WA 1B0IA 3BGAA 1Q8JA 1DE5A 1CYGA 2VOMA 2DEPA 1K03A 4M80A 1JPHA 3UR7A 2ZRYA 3WUBA 5D05A 2EPHA 5DY2A 4C7GA 2CZVA 4WK9A 3KTXA 4BA0A 3P67A 1BFNA 2VEKA 2A1YA 2VEMA 3B8IA 4Z17A 4LS0A 1WKDA 4S1FA 1OC6A 1OHLA 1HL9A 3IGSA 4B5SA 1W3HA 3ITOA 4LRTA 1P0NA 1Y8BA 2LLEA 3G3MA 3KBNA 1N8IA 4N9EA 5CLTA 1ZJAA 3R5EA 4UUIA 1HW6A 4DO6A 1ZZMA 1W9BM 1UKSA 5EBUA 4CD4A 1GPFA 1NQKA 4RLIA 1AODA 2WKLA 1Q65A 1Q13A 1UR4A 4CCDA 1B4EA 4X3ZA 2FB2A 5I24A 3WFLA 5GJMA 1P6BA 4Q8PA 1Q2RA 4D1IA 1EPVA 1YIXA 3VKAA 2NUWA 2X2GA 4K6AA 3IIXA 4EPEC 3WMLA 1DQUA 4IMAA 4J2MA 3A4JA 3R25A 3IK4A 4OJYA 1YQ2A 4LNYA 2GGHA 2R1NA 3B8VA 1LROA 3W1TA 4ES4A 3MV11 2WCGA 3BOFA 1XR2A 5A2BA 1AQMA 3CZLA 3MKCA 2FTYA 3PANA 4OWGA 2R1MA 2INEA 3JZUA 4BFAA 1XHGA 3RM8A 4NRRA 1QTWA 4ROPA 3HGRA 4DVOA 3M5XA 3VE7A 1V5XA 3W1UA 2ABBA 1TMLA 4QS6A 3M7WA 4UTTA 1TO3A 2OO0A 5AYBA 5DCBA 4PA8A 3CNYA 5I23A 1DJYA 3DFOA 3F4WA 3EX1A 4GO9A 3RFAA 4AEOA 2YCIX 4IH3A 4GXPA 1LTDA 2FDMA 4E3VA 2YIHA 1EXPA 3NQBA 4PFHA 2V5BA 1TE6A 5T9BG 4TVDA 4M7TA 5A6LA 4UQ9A 1ZJBA 2ESCA 3A4XA 4JTUA 3PHAA 3W29A 4E3TA 5JXQA 3GXDA 3W1LA 2O0TA 3GDMA 3GTXA 4JD4A 2J7BA 4PYSA 4H6RA 2ZRUA 1UWAA 3B9DA 4C6DA 2NX1A 4PL1A 2XZ9A 4HZ6A 3BLDA 5L6UA 3O63A 4BCEA 4UNKA 2DU2A 1I60A 1PKNA 3WLIA 1LLOA 1XYMA 3LPPA 3KFTA 5T91A 2DIEA 3G18A 1RQHA 3N12A 2FFCA 4DZIA 1KM4A 4GY0A 4X60A 1EQPA 4H7VA 4LUSB 4U31A 3L23A 1H5YA 1XYZA 3ALGA 4IJCA 3FVMA 4U5IA 1F4HA 1IXPA 5HMEA 1P1XA 1S2WA 4IGNA 3K2GA 1PEZA 4I9JA 2CC0A 3TFXA 3WFAA 2XSXA 1E0UA 2FB3A 3NNTA 4JEJA 3LBMA 2PI6A 3N14A 4N42A 4RCXA 4Q6JA 3SCNA 2ZZ5A 3S9YA 2VQTA 1V3JA 3WLTA 2GQ3A 2ISVA 4QG9A 2OWWA 4HA4A 4HK7A 4NASA 3T7VA 2HK1A 1RY8A 1VB9A 3OGSA 1UP2A 2Z2AA 3HG3A 1E71M 2XU2A 4DUXA 4Q6XA 1WV2A 1G6CA 3RX2A 3B4UA 1JZ3A 1U5VA 3GNPA 4IMCA 1PKMA 5M3WA 2YDAA 4PTDA 3QC0A 1A4LA 4E8DA 2VVNA 2VC7A 3BZGA 3HB9A 4HA1A 1CB2A 2BVTA 3NIYA 1QWGA 3R8GA 1DIKA 1GORA 4NP7A 1XX1A 3ISIX 4LBRA 3GXTA 5EPDA 4KF1A 1TJ1A 3N29A 1U83A 1H50A 1BD0A 2YW4A 1FHLA 4R7JA 4Z2IA 4A3QA 1CLKA 2J9YA 3AS1A 1MEWA 3K1GA 2A3HA 1EF3A 3OTRA 2XINA 4LV4A 3UERA 1QNPA 1TIMA 3UY7A 4MPKA 1XRTA 1AH3A 4OQVA 2VR4A 1XUZA 3EB4A 3INPA 3BG9A 1DOSA 4OV4A 2YBUA 4CVWA 4S3GA 3WLKX 3ZR6A 2CLOA 1V02A 3QM3A 4LYKA 2O7QA 1XLFA 3BPWA 4G6CA 2VOTA 1OK6A 1S5MA 3U6WA 3N11A 1DXEA 5I3DA 3A24A 1CLVA 2OT1A 5JU6A 4M51A 4WSHA 4TX8A 2TMDA 4RXFA 3NURA 1E56A 3VGEA 3LUTA 5A6KA 2J62A 4R34A 3AZSA 4AVFA 4OBSA 1XL9A 3VUSA 4O57A 1SJCA 2WZMA 1P0EA 1RJQA 2PWHA 1PBGA 4AWUA 2XH4A 3VNJA 1S2CA 1NFPA 1I1XA 3PZGA 4EOUA 3PAJA 1B90A 1IGSA 1IYXA 4W7WA 4G7EB 5BRBA 5EBAA 4Z42C 4DJFA 3BLEA 1O7AA 1U22A 4R7OA 5IDIA 5G4WA 1OF8A 1V0NA 3ZQ9A 4MJZA 3MZ2A 2D2OA 3P6LA 4IQDA 4U3AA 2EG7A 1S3TC 1JGMA 1TWWA 2WK2A 3S6DA 1JPMA 5BMWA 5A8QA 1AZ2A 1VFMA 4XVEA 3I3DA 4GC3A 3G24A 2PF8A 1KWKA 2UZ9A 4D71A 3GVWA 4PSRA 2DFAA 4RZBA 1O94A 2YLLA 4WGHA 3EOSA 3E74A 1DJGA 1OC5A 3RLHA 4IISA 2PSNA 2VMFA 5EY5A 3VTRA 3D47A 2HEJA 1UIOA 1Q7QA 5CZKA 3WLLA 1HQTA 3VCCA 4BK9A 2HE8A 4N9BA 3ARQA 3QZ6A 1N2VA 2CZFA 3U0HA 4DY1A 3W28A 2CLIA 2B7PA 4KFNA 1NJJA 1HKMA 4ADTA 2Z2UA 1BVNP 2YCLA 4W5ZA 1QWKA 3UZYA 1J0JA 4WRHA 4WDWA 4OBRA 4J3TA 4HCHA 5EU9A 4BJHA 3SADA 1Q85A 2J8GA 1D3CA 3T08A 4P8UA 2E28A 4QLLA 3DC0A 1MFUA 1QATA 5C2CA 3ATZA 3GU9A 3T8LA 3C0SA 2WQPA 2Y1HA 3VNKA 3CPGA 1CB7B 3IGXA 3EB3A 4GZIA 2JE8A 3R58A 4QDMA 3WQGA 4GH3A 4FXJA 4ACZB 2OEMA 2P3ZA 4AZCA 1JAKA 4LC8A 3GU2A 4A29A 3H4WA 3P0XA 3TN3A 1NELA 1HJQA 3ES8A 4WY0F 1OINA 2Q8LA 3TW7A 2J88A 3AALA 1AJ0A 1CCWB 1CIUA 4CCEA 1GQNA 2BZNA 3SRDA 3G1DA 3K8MA 4RW3A 2PP0A 2J75A 1UR9A 2XPKA 4GA8A 4HNCA 1AMYA 1BXNA 4H83A 3DGRA 3W38A 3VMOA 2ISDA 2CXEA 1THFD 1ZBCA 4NUWA 5HR7A 2Z4GA 5HDRA 3FS2A 1YXYA 5GJPA 3TYDA 3OB8A 1J8VA 3MHUA 3NR0A 2EEXA 3PUDA 3DG7A 1F74A 1V7AA 3AIRA 3QPYA 5PTDA 3HBLA 3K5XA 1G5AA 1OIMA 4D8ZA 3ONCA 1YADA 4YCOA 1GOWA 1UUOA 4QJ1A 1YBQA 3LCXA 2R1PA 3L4VA 3AAMA 3CM4A 2QCFA 1POKA 3TNOA 2FVKA 1O5RA 1JL8A 1NSJA 2VZOA 4HTYA 5T9CE 1X98A 3MWAA 3NQVA 3OBKA 3K4AA 4IPLA 5JBEA 1R3RA 2XH2A 2H9AB 4RE4A 4M0XA 5G2HA 3S1GA 1J10A 3W71A 3GG7A 1AH4A 4IG2B 4IZGA 3F4DA 4KCUA 2JALA 3M9YA 3SCSA 3CQIA 3RCMA 2DZXA 5E6ZA 4JTJA 4D72A 4PN2A 3LPFA 3N9SA 3TQPA 1EH9A 2F6XA 1RP8A 4IIGA 4RDWA 4HA3A 3VX0A 4DYEA 3Q2DA 4Q3MA 4J7RA 1B1YA 2FGLA 1YW1A 1H09A 1V6XA 1VPQA 3G0XA 1DEDA 1ME7A 1X1ZA 3BUVA 1ISXA 4GX8A 1BPLB 2ZRWA 3WDIA 4AYSA 2F8QA 1MUMA 3N6QA 4H9ZA 4MWAC 5BNKA 1OFAA 3LHTA 2NSXA 1WUEA 4JFTA 3WQ5A 5C2GA 3ARXA 1T0OA 2G8ZA 5DX7A 4GUJA 1V6TA 3UZWA 4GWEA 3WQDA 2XN2A 3LHYA 1JJKA 3B8TA 4QX4A 3AIQA 4L6OA 2YW3A 3II1A 4IMEA 4B15A 3RO8A 2Q71A 3UFYA 1VBRA 4LAMA 3U4FA 2PUZA 5M03A 4TIMA 4JIPA 2Z25A 3N4AA 4FX8A 3NDYA 3VOIA 1VFHA 3CLMA 3C56A 1HJWA 3MYPA 5E5CA 4JIIX 3M0JA 3N3TA 1B3VA 4B90A 1R7AA 5FJUA 3ZT5A 2FTPA 3DFNA 1FWEC 1XLDA 2J7GA 2UV8G 4I5UA 2CZEA 3WJWA 1FWDC 1WDRA 1J93A 2YDSA 1Z89A 4LV9A 1VYRA 2V5CA 1CXLA 3W2MA 1ITCA 2WZEA 4UBPC 2HVMA 2PF0A 2GJPA 4FEZA 3SJNA 2J13A 5CPLA 3MYOA 2P0IA 4KEVA 4WZHA 3F5LA 1TQXA 2GWNA 1EF2A 1TPFA 1CGUA 5CSYA 4W8AA 3EGJA 2ZRZA 4AD3A 4C90A 4A35A 1YPFA 3TN5A 5CGTA 4IPNB 4ZSUA 3B03A 4GI6A 1V6UA 1JGIA 2POTA 3KRUA 1KV8A 4WGXA 1J4EA 3PZQA 3VAVA 2P50A 1RXOB 3SUUA 3QMSA 3G8RA 2PLJA 4GINA 2QHAA 3L65A 2ALDA 3Q37A 4M1BA 4UNIA 3C8NA 3QQWA 4CN4A 2HRWA 3URBA 4O8AA 3W25A 1DJZA 4UR8A 1F9CA 2J7EA 4N02A 1J0YA 5LZLA 1VHCA 3TTEA 4IJRA 4DJFC 5I5RA 2G3FA 3EKGA 2WC4A 4CCCA 2XIOA 3I6EA 5CQ1A 1UZDA 2FPYA 3LM7A 4RNFA 2WVTA 3AHZA 1XG3A 1PHWA 4IWWA 1KFLA 4ZENA 1WQ5A 4MUZA 1JZ4A 3LXAA 2WVUA 1YNQA 3NCOA 1TE1A 4U2ZA 4PFMA 4FA3A 3ZMRA 2CIPA 1N7KA 1PZ0A 3IRSA 1TRIA 4B3LA 4EXBA 3MP5A 3M46A 4IP4A 3STPA 4GO8A 5BRPA 5I78A 2V9DA 1A80A 3S1XA 3M5YA 1KO0A 3AIVA 3MTWA 3VIMA 3V0TA 1A5OC 2CBUA 4ZSTA 1UZ4A 1FWSA 4FX7A 2RGLA 1LBMA 1UMYA 1QI3A 2QT3A 5DXXA 3QFWA 3L68A 3TNBA 4PMJA 2NXHA 1Q63A 2W4XA 3C3UA 3W9ZA 3SCRA 3OLGA 4R53A 3AIUA 1H5VA 2OX4A 4N4QA 2WNWA 5KZEA 4M24A 3GAKA 1JYVA 1TREA 1UWSA 3GH5A 1JUKA 4HMEA 4QDPA 2W9MA 3AYSA 4NU7A 3ZVHA 1F73A 3EX6A 4S3AA 4BEQA 4LBUA 3WBXA 1SYTA 4LVAA 1BTCA 4H7CA 3SO7A 2VFFA 4EP8C 2DZUA 4NIRA 3W1PA 3BAJA 2AQWA 2E1DA 3CUIA 5CBIA 4EIVA 1I75A 4GYJA 2IXUA 1UKPA 1RK5A 4XZHA 3VIKA 4LVFA 5DELA 3ORWA 1IT0A 5D9PA 4ORMA 4O16A 5A6BD 5TQLA 3DU0A 2HZGA 2VGBA 4HGXA 1S2AA 4RZ6A 4A05A 5D37A 5FEXA 3RJYA 4S3EA 4BWLC 2YLAA 4JFUA 1JFXA 4MFEA 3PP7A 3VCNA 5F2IA 1ONEA 3G77A 3I7SA 3A4WA 3O05A 3RUBL 1VBGA 2Q3RA 1K9FA 5AECA 1W2VA 3B8UA 4ZQPA 3FAWA 4TMCA 1A47A 2WPBA 3R4IA 3LCIA 1YE6A 1EO5A 4KWSA 1FWCC 3W7RA 1XH2A 4AB4A 2JKEA 4M5PA 1WE5A 3CAVA 4EAYA 1L8NA 2V8ZA 4DJDC 2WWCA 1C3FA 3L4UA 3B4YA 4R85A 5J5RA 4TU1A 5G1TA 3H4XA 3UXDA 2YCJA 2QJMA 4MFDA 5FCZA 1L6SA 1AQHA 1R3SA 5GNXA 3U5UA 1JYXA 3IIPA 3FXYA 2PZ0A 3GQYA 3TJXA 1E5NA 3PZTA 3WUGA 1E4MM 2F2HA 4LWWA 1YLVA 4URIA 3UU0A 4LUJA 4EXAA 1KBLA 2OTDA 4JN6A 4B5WA 4LOCA 1FWWA 1Q8AA 4JQAA 2HXTA 3GTNA 2JK2A 1XLLA 4LUIA 1REQA 2G96A 3UWZA 1JIBA 2G37A 3CUGA 3BLIA 2QV5A 4JIRA 4RPPA 5MHBA 3CZEA 2OLHA 3GVRA 2GVYA 1ZRQA 1SM9A 4ORIA 1E6XM 2E0PA 3LQGA 5A6MA 1VP5A 4Z08A 3MA8A 1VFFA 3N04A 1E0WA 2BOGX 3ZVIA 5C7HA 4AZHA 2JFEX 4H7ZA 3VIJA 1M9HA 1C90A 4MNJA 1K8CA 4J3UA 1QK0A 3NQDA 4PC8A 2GSEA 4JL2A 3N2OA 3UR5A 3NDZA 3P93A 3VIHA 1JPDX 1XSKA 1B3OA 2GGIA 3RX3A 2Y5EA 4UWMA 1I2RA 1NF7A 2GJXB 3CB3A 1R6WA 1ODZA 3WL1A 1GKPA 3GFXA 3R94A 1IXQA 1W1VA 4CD7A 4LEQA 3K46A 4XISA 3N4EA 2X40A 4NY2A 4QFUA 4C6NA 3T2QA 1PV8A 1V3KA 4J3XA 1JEZA 1ZAHA 1KRBC 2JIWA 3BV7A 3QV8A 1T99A 4HA0A 1IIGA 4RE3A 3T44A 1P43A 3QLLA 1VCGA 4BR1A 3M6YA 4MGGA 2ZRVA 2C91A 2ZA3A 4IJBA 5ENLA 3AHXA 4M7SA 5AHIA 3H2FA 2E5DA 2OQYA 2OR2A 3PNZA 1FH7A 1TFVA 1CENA 3UG4A 4GQBA 3ABSA 1M65A 1TTQA 1X6LA 5CAKA 1XQLA 3QOKA 4J28A 4JY8A 3MV01 5DANA 4TX6A 1WDWA 1UWTA 2R14A 5CG0A 4D6JA 5TF0A 3ARUA 3WD1A 2XM2A 3CU2A 1H51A 5D38A 5HJXA 2QGYA 3LQLA 3LHUA 7PTDA 2OYKA 1VYSX 3CV7A 4Q4PA 3NZPA 4ZFMA 4O54A 2G3JA 1YBQB 4CLMA 1J18A 4JTRA 4P7RA 4QROA 3P60A 5HJLA 4KS0A 3QPZA 5FOOA 1LG1A 4K37A 1BF2A 3D3AA 3GZAA 1UCWA 2QMJA 2BY0A 2W27A 4MM1A 2QDHA 1UR1A 3JZEA 1MNSA 3QOMA 4ASTA 3WD4A 1E4LA 2QXWA 1W1ZA 2XHYA 1H49A 3BCFA 1TA3A 5C6MA 4XUGA 4DM2A 3BO9A 4UTKA 1ME9A 4PTMA 1R5YA 1US2A 5CBBA 2ZDRA 1UMLA 4BQ3A 2IXVA 2GOKA 1GONA 1NFBA 3VKJA 5HNTA 4FMVA 2VX5A 4FS9A 2FJKA 1X6UA 4AY8A 3P5YA 3WJYA 3A3WA 5CSSA 3HJZA 5DO8A 3W73A 2PCEA 4ZO9A 3UZ5A 3UD6A 1KC7A 5I03A 3IUDA 4D1JA 4EPDC 1V6WA 4S3BA 4BF5A 1M01A 3CZGA 3PPCA 4DXXA 4AH7A 5FAJA 3S9ZA 1V0MA 3SQMA 1AJ2A 3PZOA 4K7VA 1H60A 1OY0A 1H7WA 2ZUUA 4TOQA 1FCVA 2PTZA 1DHKA 2GUYA 3SQLA 3L2LA 1UZHA 2PDIA 2DUXA 2YXGA 3UA4A 5DMNA 4XTDA 5EB8A 4L9YA 4QEEA 2WMKA 3T40A 3BARA 1GZ1A 5FJRA 2DH2A 2BY2A 1GWJA 2GDQA 1EEPA 3KDOA 1QMLA 1MZHA 4I7UA 3E2RA 4NQ1A 3UG3A 4RE2A 5HPCA 1FFRA 1XXXA 5C54A 3W70A 1E3ZA 3S2CA 2Y8KA 3V1PA 3TXZA 4DQWA 2AAAA 1J2BA 2CCRA 2VEPA 3IJIA 5JBDA 2EBNA 3B9EA 3L0KA 4OE7A 2R8WA 1UQZA 3VNZA 1E72M 1U1UA 4UCFA 3TK7A 3GDRA 2JIEA 2V5LA 3KLKA 2XVPA 4ICNA 2E8YA 1UJQA 2DJLA 3TW9A 2YKKA 1BYDA 2GPTA 2CEQA 2YXXA 1F3XA 1B9BA 1EDGA 4P2VA 4YMZA 4MWAD 5FEWA 3SCWA 3AI0A 1LLWA 4NYYA 3WK3A 3H2CA 4F0MA 1M7XA 1VD6A 2V6AA 2J7DA 3W87A 3WDHA 4E2VA 3LOTA 4RDVA 4AMAA 5HR6A 1V3MA 1YXCA 5HBFA 3AMKA 1S46A 4PH6A 3AIEA 3CHDA 4NZ3A 2WMIA 5D2XA 3CUHA 4ZFCA 2KX9A 3B0PA 4JCMA 3VGHA 1XI3A 4QNEA 1VZWA 5I3IA 1TWZA 1CEOA 1VIWA 1LLZA 1S5WA 2FVMA 3S2NA 5F4XA 1E40A 4LYPA 4M1RA 2YYTA 4ML4A 3CIVA 2QS8A 3V5CA 3KWSA 5LXXA 3IK2A 4U33A 4HVXA 2NQHA 2WQDA 1C91A 3WL0A 3UWVA 5XIAA 4K1GA 1R2SA 4AISA 4GIYA 1XISA 6CGTA 4AG0A 2I5QA 4PR4A 3WUEA 1QO5A 2XVLA 3PBUA 4FLOA 3SCPA 1W1IE 4JTAA 2ZZ3A 3V0SA 1R3YA 4TR9A 1YPXA 3IVSA 4DWDA 2OZ8A 2XSAA 3RK8A 1ZBVA 4C6MA 3W24A 5D2TA 3EDKA 3WJSA 4BQ2A 2PS2A 4FOUA 4LC6A 3M6DA 4WJEA 3TE9A 1J5SA 4C65A 1DBTA 1MQRA 4DZHA 4O15A 3TJ4A 3R13A 3KW3A 2WLZA 1ZP4A 4JKMA 2Q8ZA 4GVIA 1TIWA 2Y7FA 3A4AA 1DWAM 4WEVX 1X6NA 5CG7A 1W3LA 1EUNA 2XVGA 5DBTA 1MO0A 4AU0A 4QAIA 3A47A 4U2YA 2RKXA 2PRLA 1UP0A 3UZZA 4E0CA 1KRMA 1S1RA 1QCWA 4X9YA 2Y4SA 2J9XA 2J25A 4RW5A 1EDQA 3OBAA 2J6VA 4AEEA 3CEUA 3WLOA 2MANA 3CEPA 2XZ7A 4DWSC 3PTDA 4GCXA 3NSXA 1DJIA 3CAKA 4F79A 2GL5A 5IHRA 4L65A 4F2BA 3TOPA 1K9EA 1EUAA 3WLNA 2E67A 3CV1A 2OX1A 3THCA 3S4TA 3DESA 5E0CA 2Z28A 1O68A 4O53A 2OZ0A 4N9CA 2A5HA 5K3VA 1O5XA 3POHA 2NUYA 4GISA 1YMYA 2XISA 3BCJA 5DF0A 4O1BA 3I68A 3W02A 4GBDA 4NYUA 3W00A 4V28A 1BSLA 2ICSA 3QC3A 3WZ0E 2PDWA 1S3HA 2V82A 1TV5A 4UFIA 2V3GA 1JDAA 1UBPC 4XUYA 4FAMA 4IGMA 3QVQA 2E6FA 3LTYA 3ZVHB 3HV9A 3SGUA 3WN6A 4HJFA 5KZMA 3AUOA 2XFWA 4S2BA 4D6DA 1B3ZA 3P7YA 3PM6A 2QUTA 1F3EA 4BI5A 4ERIA 1EDTA 4IOTA 4Q4SA 1XBYA 2A3EA 4KWUA 3CQKA 1XS2A 1TYGA 3AUJA 3H7VA 3L12A 3T2PA 1VEMA 2V2CA 4MF4A 2NQ5A 1Z69A 1MEIA 2VEGA 2OWXA 1MXGA 1AD4A 2XWEA 3N34A 4DO7A 5HMFA 1ADSA 2WMGA 3MMUA 1VGAA 3E02A 4GX9A 3R7MA 2A3CA 2E9LA 3DYPA 3RU6A 3RN6A 1K8ZA 3PB2A 4Y9OA 1JZ2A 4IL0A 4C91A 1ZP3A 2DVXA 5KSWA 4LSBA 1YDVA 1XLCA 3R1ZA 3KCJA 5GNYA 4LRSA 4J3VA 3RPMA 2QJIA 3GNXA 2ZVRA 2VYOA 2YB4A 2PU1A 4ZL1A 5LIWX 2WXDM 3CAWA 3OZYA 1C8YA 3V16A 1OG0A 4ZE4A 1PPIA 4WJ8A 1Q3NA 2PTDA 3UW6A 1E1CB 2NQ9A 5HQLA 5MKGA 1NOWA 4WJXA 2FIQA 3G1FA 1OCNA 2ZFAA 3TYZA 4C6QA 4QISA 4XAPA 4B91A 3VOCA 5CC6A 2C13A 2EQDA 3P82A 1XLGA 2R1KA 1W1TA 4QE1A 4NVTA 3HPAA 1QK2A 1VRXA 3WQEA 2A7NA 5I3GA 4I5XA 3PZNA 1O1ZA 1OADA 4C6BA 3KL0A 4Q8MA 1GTHA 4PCSA 3CMJA 1XBXA 1RK6A 4MYAA 3KL5A 3EWXA 4E8CA 4PCTA 3LHWA 1WYIA 4YVXA 1G94A 4AC1X 2IS7A 4Q7BA 2V38A 1KM1A 4I9AA 4UFLA 1HL8A 4UQEA 2X09A 3COTA 5AVHA 2JGQA 3E0LA 5DFAA 4XBKA 5AYZA 4CQDA 2G0WA 4JX4A 5MF5A 3VGGA 1LWHA 4KFPA 1Z9AA 3ME3A 4C6CA 3JS3A 1DIOA 3PC0A 1KXTA 3T6CA 4TQTA 3QRHA 1T96A 3E38A 4UTHA 3QBUA 5DLCA 4HPHA 4GZJA 3VMPA 2CLHA 4QQUA 3KEHA 2F84A 2VFGA 3L7RA 1JZ6A 3LPOA 3UNDA 1AFSA 2PGEA 2VR2A 1A3XA 1CGXA 5AZ0A 1XH0A 1QOQA 2Z6IA 4WD0A 3UWUA 4E4PA 4P7NA 1WZMA 5DRCA 3DXIA 1QBAA 3Q67A 5EMUA 2E1WA 2FPVA 4Q32A 1IZCA 2AKZA 3IVUA 3W22A 3RPDA 2RDTA 3P61A 1KNWA 2PLMA 4PODA 1E9LA 1E9YB 2ZX8A 4O0QA 4I7VA 2C1GA 4HSOA 1C9DA 5DMMA 5D9NA 3B9AA 2X0HA 3VNYA 4DZAA 3C2OA 2Y7GA 4PL2A 1BWLA 3ZR5A 3C8FA 7TIMA 3ECQA 3IIZA 2HV5A 3LBCA 4PUDA 3RM4A 2WANA 1UWIA 3QSTA 3QXBA 3CUJA 1QUMA 2OKTA 1A0CA 2WOQA 5K9XA 1Z41A 3E0FA 4IIBA 4NZFA 2RJGA 5BXPA 3WQWA 1Y5WA 5JQ9A 4PUWA 3SEPA 3UGVA 3DKLA 1H41A 2PDBA 3F4NA 3KBVA 4CEUC 2VZSA 4K3ZA 2NZLA 2DQWA 1RCXB 3W1RA 3ZIZA 1ISWA 5CPMA 1J6OA 4QIUA 1IF2A 3WF2A 5GQBA 4IFOA 4JTEA 2Z1WA 2GLKA 1AD1A 2E25A 5HMSA 4CD6A 1XFCA 3RF9A 4GFIA 4O50A 1MXDA 3TH6A 2Z00A 2GWGA 2D24A 1RCQA 2AMXA 5FF3A 3T05A 2ZUTA 2P53A 1JDDA 3BOLA 3LLXA 1HP5A 3LX9A 4MY1A 3U7BA 3S46A 5J5DA 4J35A 3V5OA 4IT1A 1H7XA 1MQQA 5D8WA 4U5KA 1SW0A 1VRDA 1M6JA 3VOHA 2O9OA 2XGIA 4B92A 3G1YA 4ALDA 1WA3A 5LNVA 1LQ2A 4GLEA 5LGZA 3P74A 3B0VC 1Q6FA 1IGWA 4QTGA 2GGEA 3NL6A 2XFFA 2BGQA 3TWAA 4DO4A 4L61A 4DI9A 4F0LA 3T0TA 3T4WA 2GFTA