4KL1A

Hcn4 cnbd in complex with cgmp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
193
structure length
192
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
molecule tags Protein transport
source organism Homo sapiens
publication title Cyclic dinucleotides bind the C-linker of HCN4 to control channel cAMP responsiveness.
pubmed doi rcsb
total genus 60
structure length 192
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4kl1A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kl1A02
2MNGA 2DCTA 5LRRA 3NW4A 4X6RB 4Q0VA 4Z82A 5I0SA 4MV2A 1X8MA 4XEZA 5FPZA 2EAAA 3EJKA 2BEOA 4XF9A 1DGWA 3MYXA 3KSCA 1H1MA 4JTOA 2D40A 3SXWA 1YFWA 3E6DA 3LA7A 3E6BA 3EHKA 1EYBA 1VP6A 5E16A 5FLIA 4QGLA 3BALA 3EQEA 1J3RA 3FWEA 4N9IA 2O8QA 5I0TA 4HVRA 3EBRA 5JSRA 4IEUA 2XLAA 1DZRA 2EVXA 4MUVA 3NSTA 2XKPA 3H1YA 3MZHA 4I09A 2ET1A 1J3QA 2UY9A 4OFGA 4XFBA 2WFPA 4MX3A 4F8AA 3I7DA 4FT8A 3ST7A 5HI0A 1UPIA 4AVAA 2XGXA 5BXXA 3WW3A 1I6XA 2IXJA 1O3RA 4LEJA 2GH2A 4EWEA 2E9QA 5CVRA 3CJXA 5C6CA 3BU7A 3L2HA 2Z69A 2ZCWA 5CADA 3SCHA 1G6NA 2MPFA 2OZJA 1I5ZA 3H1WA 2BYVE 2B9UA 3IWZA 2N7GA 1ZRRA 4PIYA 4TLFA 4ONUA 4EV0A 4IETA 4I0AA 2Q1ZB 3IIAA 2H6CA 5T3NA 3OTFA 1RUOA 5I8YA 4HVQA 1VR3A 4CYDA 2EA7A 3ACLA 3E5UA 2K9ZA 2UY8A 3FX3A 4FAGA 4JV4A 2UYBA 4LA3A 2ET7A 5KHKA 3RNSA 1DGRA 3NL1A 5FLHA 4K8FA 3DL3A 1NE4A 2K0GA 4DINB 4E2SA 1PMIA 1SQ4A 2ETEA 2XL9A 4LUKA 4MGZE 5BUVA 2CGPA 3ELNA 3UKNA 2IXKA 3CO2A 4KWJA 1QY4A 1U12A 2O1QA 3CF6E 1J1LA 1OMIA 4WBBA 1X7NA 1QWRA 4OLLA 4YRDA 1ZRCA 5BY5A 1ZZ6A 2PFWA 3ROUA 4AVBA 3U10A 1CAVA 3JZVA 2Q30A 3UKVA 2ATFA 4IEXA 4LULA 1X8EA 4O9EA 1YHFA 4Z07A 1NE6A 1Y9QA 2D5FA 3GBFA 4O9GA 1OI6A 2H0VA 4R52A 1YWKA 4MGKE 2GZWA 5LRSA 4JVAA 4EWDA 3LA2A 3IBMA 1NXMA 4I0BA 2OYZA 4N9HA 4YNIA 3M3IA 2VPVA 3E6CC 1L3JA 2VECA 4L11A 1QXJA 2VQAA 4HSLA 2PA7A 1O4TA 1LB2A 4HN0A 4J1WA 3OGJA 1UCXA 3HT1A 3OCPA 3OD0A 3SCFA 4E2GA 2B8MA 2ZKLA 1Y3TA 3LOIA 3OF1A 4KWLA 1RC6A 1SEFA 1CAVB 1FXZA 5I0UA 5FDBA 5FCCA 4X6QB 4XF4A 4Q0SA 2BNNA 1CX4A 4P9GA 5LEJA 1UW8A 4LUMA 3ES4A 3BPZA 2Q0AA 3BCWA 4Q29A 4IERA 4H7LA 3RZZA 3NJZA 1PM7A 3UKTA 4YARA 3B02A 4GULA 3WW1A 4QM8A 2UYAA 1ZVFA 5J3UA 2OA2A 4ORFA 4Q0PA 2GU9A 2PAKA 4YYOA 5EFUA 3KMHA 5BPXA 2XLFA 4NVPA 1ZZ7A 4BYYA 5JAXA 3S7IA 4PIXA 3NVCA 3USSA 1XE7A 1O7FA 5BV6A 4XFGA 4IEQA 1GQGA 3DN7A 4BH9A 4A2UA 1GQHA 4FAHA 3SCGA 4B29A 4R8HA 3QACA 3TNPB 1VJ2A 4WVZA 3WW2A 3RPQA 3MDPA 4ZU7A 3H1MA 3LZZA 2V09A 3H7JA 1CAWB 1CAWA 5D1IA 3WW4A 2XHKA 3SMHA 4MGIE 1O5LA 5FQ0B 2Q4SA 3I54A 3U11A 3HQXA 3GYDA 2BNMA 1RTVA 1ZZ8A 4ZU4A 3E97A 2IC1A 1J59A 5I91A 1XRUA 3ETQA 1UIKA 4HSJA 2I45A 4QGNA 4AXOA 1ZZBA 3CLPA 4BHPA 4IEYA 5CU1A 2HKXA 4XFAA 3ES1A 3C3VA 2D93A 4MH0E 5JR7B 3KGLA 4IEPA 4XF3A 2P17A 2BNOA 3D0JA 3EO6A 4HZFA 5FPXA 4D7SA 5KBFA 3HT2A 1RL3A 4KWKA 2IXCA 4UBGA 1TQ5A 2PTMA 1O3TA 4AVCA 4KL1A 4IEVA 4HVOA 5AVPA 2C0ZA 3PNAA 3KCCA 2CAUA 4I02A 4J1XA 1RGSA 3VHRA 2GC0A 1RUNA 1HW5A 4LLOA 3D0SA 4AQ2A 3RDIA 4D7TA 2GC2A 3H50A 1X82A 2D5HA 1ZRDA 5E1RA 5KHHA 2QVSB 3H3ZA 4KU7A 1LRHA 2FMYA 3LWCA 1IPJA 3H8UA 4HMZA 4EWAA 4Q0UA 4WZCA 2HJIA 2CAVA 1SFNA 4META 4LA2A 5FQ0A 4PJYA 5J7MA 3G7DA 2QDRA 4MGYE 4I01A 2QNKA 3CL1A 3R6SA 3MPBA 1FI2A 4F7ZA 1YFUA 1Q43A 4IESA 3S7EA 5I0RA 4EROA 1CAXA 3RYRA 2GC3A 4QXKA 3CEWA 4IEWA 2MHFA 2GAUA 2Z2SB 3D82A 3KGZA 5KHJA 3U0ZA 5I8SA 4FBFA 1WLTA 1OD5A 4QX5A 3RYKA 2FQPA 4UXAA 4QMAA 3H7YA 2CV6A 1WGPA 4RD7A 5C8WA 1ZNPA 1IPKA 5KHIA 1ZX5A 1LR5A 1O3SA 2IXLA 2PHLA 4E2QA 3IDBB 3E5XA 4UBHA 1CAUA 1EP0A 3FE5A 4I3PA 4XFFA 1FT9A 3IDCB 2OZ6A 3SHRA 4XF0A 2BGCA 4KU8A 3BB6A 3PVBB 5JSOA 1H1IA 3FZ3A 5JCTA 4JTNA 2PQQA 1YUDA 3S0MA 3RYPA 4L2NA 3TNQA 2QJVA 1NZCA 3QOPA 1Q3EA 3E5QA 1UD1A 5I93A 4MZUA 4PIZA 1J3PA 2IXHA 4XETA 3LAGA 5JSPA 2F4PA 4I2OA 2PYTA 2Y0OA 1CAUB 4BIFA 4Q0QA 5K8SA 2IXIA 5J48A 2PHDA 1V70A 3O14A 1J58A 5LEKA 1Q5OA 2XKOA 3DKWA 3FJSA 4HLTA 3H9AA 2GC1A 4XFHA 1WA4A 1EY2A 4ZU5A 3H3UA 1EPZA 3LA3A 5FLJA 2XLGA 4XFCA 2PAEA 1ZZCA 4LTAA 1XE8A 3HIFA 4HN1A 1YFXA 3ZDSA 1CAXB 2B5HA 2OPKA 3M70A 4YSFA 2PAMA 1OFNA 4AQ6A 1NYWA 2XL7A 2H6BA 5KHGA 1JUHA 1UIJA 3DV8A 4IEOA 5EZWA 1O3QA 3N4MA 1O5UA 3PLQA 2WC2A 3FHIB 1CGPA 2KXLA 1LKNA 1DZTA 4IEZA 1ZRFA 1YFYA 1QXRA 5I8TA 3NKTA 5F1RA 4QGMA 1ZZ9A 4QM9A 4XFIA 4HBNA 1ZREA 3FFQA 3I59A 2QCSB 3I59B 1YLLA 4XF1A
chains in the Genus database with same CATH superfamily
3MGUA 2J7MA 1NTMH 2J22A 2ZINA 4Z82A 1NKDA 1JZ4A 4L8JA 2HEPA 3EJKA 5JMCA 1M1KW 3SXWA 3B01A 3E8FA 4E4SA 5A3LA 4OPHA 4FQ4A 3ZYFA 4OHZA 4Q1RA 2EALA 1XHXA 1GN4A 3Q4HB 1WZXA 1PZ8A 4HVRA 4RN5A 3NNMA 1H30A 5IK8A 4P14A 3K08A 1FX5A 5LBFA 2WNVC 3A0HZ 3AK2A 4I09A 3VZOA 4OFGA 4RYDA 1OPOA 3K9AA 2Z42A 1TE1B 1UKGA 3LSDA 1JMUB 1QU0A 1FFXB 4FCAA 3ME2A 3E8HA 5C5UA 1XOYA 5IHRA 5IJ0A 3H1WA 5CN0A 3KVAA 3THOA 2P1BA 4LF6O 2F95B 3HR9A 1RUOA 4Y1XA 3WG7C 2UY8A 4UFHA 3FAVB 2JE7A 1ZBE2 1TG7A 4FO9A 3CCSV 1JJ2U 1W59A 3MIFA 1RPOA 4QKBA 4E2SA 1LR1A 3PUIA 1CESA 3LD8A 1SQ4A 2ETEA 1H6YA 2Q67A 1FV2A 4QWNA 2IXKA 3GHMA 2QM7A 1U12A 4N90A 2DUQA 3TYJA 1FMD3 2GNDA 1BGYH 2RDRA 3UT5B 1HR0B 1YSCA 5FLXN 1CZVA 2WO1A 3NNJA 4LFCO 1W6MA 4R52A 1B04A 3IDAA 1URFA 1GAXA 2VPVA 4HXCA 4BCUA 3DGTA 4YW3A 1COV3 3NJXA 2XJQA 3B00A 4Y26A 2JDYA 2VQAA 4DV3B 5FNVB 1QJX3 4AVTA 4N23A 3OCPA 3WSOA 2IBZH 1R091 2PHUA 3CWBH 3RBZA 5FCCA 2ZZJA 1NX9A 4QKDA 1CXZB 1VQ6V 2WZPP 2VMFA 4AE2A 1LOGA 2NLRA 1R6NA 1FPN2 4ISRA 1NT2B 2RN9A 1AR92 4LBLA 4LBEC 3TCUA 2Z3YA 4Q4X2 4NVPA 3ZO0B 3GJBA 1PNFA 3ZMVA 1LENA 4PA4A 4PIXA 1O7FA 4YZ2A 3DN7A 3GXUA 3Q9OA 4I0XB 4HNAA 1ZL8B 2Q5ZA 1L7LA 5C3QA 4ZU7A 3ZFFB 1TMF3 2OS2A 5A2QN 4JTDB 1P7BA 3SMHA 3AMNA 5LGUA 4ZS3A 3OFNG 3T2OA 2LGQA 1LULA 4XQ4A 1EM1A 5ABJB 2MK3A 3VBSC 5CISA 1AR1B 4ZU4A 3JARA 4BISA 4HSJA 4B3RB 2K2SA 2VVDA 2QBXA 2RDCA 1XYOA 3IM0A 1A8DA 1TAEA 4CH4A 2Y64A 4MH0E 1L1FA 4FQZA 5GJ6A 1V6MA 2BNOA 1UY1A 5C4WB 2XBO3 4P00B 1WCUA 3KV5A 1EN5A 2Q73A 4X64O 2EF6A 4Y22B 3U75A 2C0ZA 5F2VO 1XDCA 1I9RA 5H6QA 1PK6B 2ZOEB 2R062 2BZDA 3D0SA 4FM1A 4RAIA 1GP4A 1X82A 5FKBA 4XQWA 4BE3A 4DMIA 1W99A 3QD6A 3JAWA 1MVQA 3A0RA 2R49A 1EAH2 2VUAA 5AFBA 3ABLB 4UB8Z 5EP9A 2GH8A 1CR7A 5LMUB 5LA0A 5C8CA 4D69A 4Q4V1 2G4IA 4Y4YA 4BK4A 5IJ9B 3N7KA 2BW8A 2GBOA 2EXJA 4LC1A 4FPHA 2GSMB 4LXLA 4MW8A 2GAUA 3VB9A 2DQ0A 5LCWL 3GB7C 5I8SA 4FBFA 3T1LA 3RVZA 3RFRA 5F32A 2PHRA 5FYVA 5JXHA 2JVDA 1IPKA 3L9DA 2HFEC 2XJUA 4I0XA 5DPNA 3D3IA 3MIDA 3FE5A 2LS6A 5GLZA 4AEDC 1RHI2 3S5AA 1SLIA 1U0AA 4WFEA 1TNFA 1QMJA 4BWOA 4KBBA 1OF3A 1TGOA 4XUOA 5A7PA 1WNSA 3SJCC 1K7DA 4NWWA 2KR2A 1L0NH 4FOWA 3RYFB 2KB1A 3N2GA 1VAMA 5LBQA 1G86A 1LOCA 3PUAA 1KYOF 2AEYA 2XBO2 1I0HA 1JMKC 3MDSA 2HLEA 4Q26A 1VBB1 4H13B 2A3YA 5DDJ2 4GX5A 2EIDA 3M99B 1XOUA 2W39A 3V0AB 2B5HA 4QD2A 1XNBA 5C8YA 2DDUA 3H1LH 4AQ6A 4LK7A 2ZR3A 4KI5M 5LMNB 1Q7YW 3AJZA 3A22A 3L73H 1GOHA 2B42B 3W59A 4B3MO 4CP2A 1F31A 1IBLO 4KFMA 2DCTA 3ZFEC 2VTXJ 4BPZA 2JK5C 1NKGA 5JPNB 1F7YA 3AG2B 2DFBA 4K1ZA 1AX0A 1T6GC 4LE3A 4X1IA 3M8AA 4NXMO 2WFF3 4QGLA 3TETA 3MICA 4ZS2A 4DUZO 4CUBA 5JSRA 4WFHA 1DZRA 1MS8A 5C33A 3VDBA 4E9KA 4MUVA 3LIGA 3H1YA 2EILC 3ZS8C 3BTXA 2X5IA 1WJZA 3WW3A 2UXBB 2EIJC 3AYEA 3ZN6B 3UGHA 5CFCB 1UFIA 1S77D 2Z69A 4DR6B 3ZM8A 3IAYA 1XU1A 1K45A 1NLQA 2RHPA 1I5ZA 3HKDB 1FOD1 1VMJA 4D6RA 2A73B 2WA3A 4GD4A 4OUEA 3HAGA 4QPGC 1TUBA 4QX2A 3GF6A 3E5UA 4BIUA 5IJ9A 5KHKA 4P9IA 2RS53 4DRRA 3JD71 2ZIOA 4RWUA 1IKQA 2VW0A 4NHXA 5GZGA 2CGPA 5SV8A 4I7ZB 1A3KA 3N2GB 5FUPA 2D3RA 1C1FA 3ZN1A 5KUKA 2UXDB 1JPXA 1FXKC 1MACA 2Q4PA 1YYNA 2DTYA 4J6GA 1KITA 5AC91 3ZMSA 1DLBA 1SDWA 2PELA 2XDVA 2CGOA 4YFZA 1VE0A 5LRSA 4H14A 5B1NA 3K5NA 3HJRA 1EZVH 1RMU3 1VEWA 5JZGC 4EZHA 1I3HA 3AZWA 5CBFA 3RJRA 3GBWA 5BNNA 3OM3B 5FYBA 1ZAUA 4PDWA 4CCLA 4KWLA 1SEFA 1FXZA 5CBLA 5DMYA 1HV0A 3BTZA 2HEYF 1Z2GA 4O2AA 5FDBA 4XF4A 1H1AA 3AG4B 2CNAA 3E1F1 2QQIA 3BPZA 1AYN1 3NV1A 5JH7B 4DR7B 3ZX7A 1W8HA 1GU3A 3RZZA 1N34B 4LF8B 3MHZA 3BA9A 1TZOA 5A6XA 1QXPA 4MT8A 3T2MA 4LKFA 2DU1A 1AYN2 1GQGA 5DABA 1BHBA 5D8AB 4RL7A 1GZCA 4WCEV 3AYCA 2LROA 2Q5TA 3TB0A 3U14A 4HKOA 4INDA 4TQDA 1XNQO 3CPWU 3IT8A 4OQ9A 2JWPA 2XJRA 1HNWO 1OCZB 5F3EA 2EIKB 1VP7A 3JB8A 3IFXA 4HANA 1UZVA 1W2UA 1UIKA 3T4HB 2VXJA 3E22A 1KC8W 1JJOA 5J09A 3VOUA 3URFA 1JOJA 3I49A 2GP5A 3RWNA 2HKXA 3T1MA 2P17A 3ABZA 2PHTA 1OCRC 1M06G 2W6IG 1JYWA 1NU1H 3POYA 1WWYA 5E79Z 2WL1A 2GNBA 2QFEA 3JD72 1MOFA 4X64B 2TEPA 1UMIA 2Z4FA 2HWE1 1OC1A 1VBD3 1I5YA 3TAYA 2FMDA 5KHHA 2LALA 4Y20A 5KXDA 3PHMA 2UU9O 1DLCA 1J5EO 3WNNA 1H4GA 3K5LA 1XYNA 4QPJA 3ZYGA 3ZJZA 3ZPYA 3AVSA 1Q8IA 4Z92B 1XSRA 1WAZA 4META 5FQ0A 1M56C 3BPSA 1UN1A 1AF9A 3G71V 3R6SA 1WD3A 5LXTA 1HJGA 1FI2A 1SRYA 4GT1A 1P84F 3ABKB 2HWB1 1XNTA 4BU2A 1AYN3 2GC3A 3POBA 1RXGA 1TME2 4CTEA 1YJKA 2WLLA 2QSAA 1OD5A 1VBE3 5FREA 4A45A 3RYKA 4QMAA 5HPOA 3H7YA 1KECA 3CCEV 2RS51 4LITA 5D5PA 3OGIB 2VCMA 1KKCA 4KGGA 4LWSB 2FDIA 3ZXFA 1A34A 1QF3A 2CGNA 4O2BA 1XXNA 1SC5B 2NYYA 1NVPD 4B4RA 5JSOA 1OJHA 3QOPA 5A7WB 1I08A 3N2KB 2PYTA 1CAUB 1WCKA 4CEYA 1DGSA 4Q0QA 4WFGA 4AW7A 2OIEA 2JB8A 2RMU3 3VUOA 2RVAA 5FZOA 4XDKA 1NQTA 3QTCA 2RS12 2W87A 2XKOA 1IG3A 1HRV3 1QKQA 3R4DB 3JSNA 2XLGA 2ZXWC 5CG9A 1GM7A 3FN9A 4QX8A 3ZMNA 2BOBC 5A80A 4IIJA 5C71A 1BMFG 3RG0A 4XIOA 4IEZA 2AGSA 1GNYA 3H0OA 1YLLA 3KHCA 3DECA 4TUYA 4DR6O 4B3MB 2LW1A 2BTQB 4JCKA 2BEOA 5L73A 2Y69C 1LEMA 4XZUG 4R4ZA 5ABJA 3VL9A 3PIJA 5F37A 3EQEA 2QE3A 2ILMA 2WA4A 3Q4HA 1N3QA 2XLAA 4RR3A 1VBB3 5LGNA 4MS2A 3WCRA 1YI9A 4FT8A 1AVMA 3PMSA 4QHOA 3J7HA 2PMWB 5BMVA 1OCCC 5FPAA 2BTOA 2R9RB 1DGRN 5FYIA 2ZX2A 3O1PA 1RUH1 5BNQA 4BQ2A 2JG8B 1W6NA 1GWMA 2H6CA 2B1GA 4Y1VA 1CZTA 4EN7B 4AQYB 2WBKA 3CCRV 1RUH2 5FYMA 4C0HA 5LXTB 4GWJA 5LBEA 1JODA 2ZGUA 1M93A 1D5AA 1GKFA 2YEVA 2CTPA 1WA8A 3FBYA 2R16A 3GBGA 1E79G 4COYA 2QKAA 3C7EA 4ASUG 3VBSA 1R1ZA 1UY4A 1TUEB 4E4EA 3OOXA 2PFWA 4AVBA 5FY4A 5GW7A 3B69A 1H2LA 4XE9A 1UX7A 4LWSA 5H9CA 5EQUA 1NJIW 1CVNA 2R9IA 1K12A 4ZI7A 1N34O 3ZRVA 4CA9A 2K46A 1VMGA 4XHBA 3MHHC 1U96A 2J1SA 1G8MA 2YPDA 3WV6A 2L35A 4FMTA 1NXMA 5IATA 2V73A 3UCSC 1URXA 1ZBE3 2P3KA 2DMXA 3OD4A 5IJRA 3EB7A 5EYPA 2D97A 4K8XA 4YW1A 4UCUA 4JZ2A 4QPIA 2ZA9A 1DBNA 4EN8B 1FXVA 2F1MA 4U3JA 1REDA 2QUOA 1CN1A 4A5UB 4K7JA 3Q8CA 3CNAA 1RUC3 4JRLA 1KS5A 1NT0A 4LF8O 3AXDA 2E33A 3PTYA 1UZWA 3WNOA 1KMIZ 1W9YA 3AMPA 5A6QA 1SA0B 3T1CA 4XXAA 2X8KA 4XBQA 3MDPA 3H1MA 1CAWA 1HNZB 1UXXX 1VBA3 2YFZA 4P2ZA 3ZDVA 2E7TA 5LGTA 1V6KA 5FJHA 2RS52 4JI8B 3WDWA 1NTZH 2JJ2G 2IC1A 1FOD3 2GSYA 3CLPA 3ABTA 3EMRA 1TME1 1XC6A 5JR7B 1PHMA 1WMDA 1B09A 1MA1A 3BIWE 5KBFA 2EJ7A 1UJWB 1RL3A 3OE7G 4FPEA 3IKWA 4KWKA 2EIKC 4LBKA 2CH7B 4EE2A 4KL1A 3VBFC 4UVCA 4NXMB 4IGQA 3K4ZA 1ULPA 3SH5A 3WDVA 4MVQA 4CCMA 1K5QA 2VRZA 3STZC 4AQ2A 1V54C 1Z5WA 3SYOA 3ALQA 1N36O 4RS5A 1O8PA 5FV3A 4KU7A 2X0LA 5B3SC 2EINC 2HWE2 3CXCU 4EWAA 3IC9A 3FUOA 5LA6B 4WZCA 1IVSA 2YXLA 1YF2A 4HZ3A 2Q1MA 3WG7B 3VV1A 5F6LB 4FLYA 2XXZA 4RS5C 4WV8A 1JU4A 4YM0A 4FPYA 3KZ4C 2BBAA 4RHV2 1G4YB 4UVAA 1WGPA 2W47A 5J36A 1W8UA 1RUF3 4FSJA 1GNZA 1CAUA 2V72A 4OHVA 3LUTB 1K9MW 2WT0A 1ST8A 2ADPA 2PQQA 4GQ7A 1YUDA 4TLGA 4FJCC 2VZSA 3WHUA 4LT5A 4OHWA 4M3CB 2IXHA 5F3IA 2W92A 3J7AU 4AYUA 1GN3A 2QZ2A 2ZGPA 1NA1C 1WMXA 1MEC3 1H8TB 3OBRA 1SLCA 4P9PA 3AC0A 1H2NA 1WA4A 1PNMA 1AL22 1SQFA 4N43B 4GJYA 2ZAHA 4LTAA 5IJ0B 4CCJA 4DXSA 1IBKO 1DIWA 5IYZA 1Q8VA 4YJ3B 2TNFA 1O3QA 2GV9A 4NO4A 1UU5A 2JGUA 4I9WA 2EAKA 1LKNA 4QB2A 4WVMB 4OI2A 3L72H 4QHBA 4YVWC 5LK5A 4CU6A 2VZ1A 3MBWA 5EC2C 4YM3A 1S5JA 2DCYA 4J10A 3R05A 3N9NA 1NCRB 1OOPC 5E89A 4CUGA 3FYEB 1UU6A 4BWAA 3EHKA 2DVGA 4Q4Y3 2OQ7A 2O8QA 1Y43B 3E8GA 1K33A 3AZVA 1S5HC 2HWD2 5EYPB 5J37A 1YCIA 1XMOB 3JUUA 4AFBA 2ZS6B 3QH6A 5GLUA 4BQ1A 4HK8A 3CJXA 2X05A 4GAZA 1VB2A 4LOSA 3H1KH 3P1IA 4M00A 1ZRRA 5FXZA 3LPGA 1N1TA 1W06A 2WO3A 5T54A 2CL2A 4CYDA 4O2AB 2K9ZA 3VBSB 3NRUA 3WF0A 5HV0A 1FOD2 2E51A 2LGWA 3J7MA 3EVKA 4X1YA 3HKEB 2OPWA 4AQYO 4HAMA 4PDVA 1SLLA 4NIIA 4CEWA 1VQMV 5DZEA 2YIDA 3CD6V 5DAXA 5FMDA 4ATEA 4DR1B 1QJX1 5CMUA 4NHYA 2UU9B 1SLBA 1SESA 4ZY9A 4MXWA 1W2BU 4GH4A 1NQJA 2IH1C 3ABUA 3U10A 2XOMA 3MIEA 4X62O 3ZOIA 3I3MA 2ZD9A 2XAJA 4XPVA 4CVUA 4UFIA 3WXPA 4I9QA 4MGKE 4OUMA 1VBC1 4EWDA 3FKSG 1F5JA 4YZ3A 1MS0A 1OLMA 1LHOA 2ZEZA 2R1BA 5L9VA 2BCCH 1Y74A 4IE5A 1CEZA 3NJYA 5I0DA 1G1XB 2IUWA 3VBUA 5E6HA 2HWC1 3LDRA 3AZZA 1HNZO 2Q0AA 4Q2FA 2JIJA 2XUMA 3MLLA 3ETEA 5C9AB 1KXGA 5LHIA 3OEEG 5DDJ1 4K40A 2ZTNA 1VBB2 4EN0A 4NOTA 1GKBA 5IVJA 5IVEA 2VBDA 4JKLA 5DEDA 2P6CA 2XBO1 3WD5A 1FS0G 3NVCA 4M3CF 1S0EA 3SCGA 5A9GA 4LF5O 1R081 3TNPB 4C1XA 1E57A 3PL0A 1QDCA 3P3NA 1BS3A 3WW2A 1N32O 3H7JA 4TTGA 3WDUA 1SCRA 2YSUB 4DEVA 4WM7C 4YVSC 2ARHA 4JYYA 2EINB 1ZYBA 3VBHA 4W4KA 3HQXA 3ILRA 2UXCB 5KC6A 3K9SA 1NOVA 1ZZ8A 4RGGA 4SBVA 1HB1A 5BNOC 1KP2A 2I45A 4GMP3 4BHPA 4B8EA 5FO9B 4CC6A 5IWAB 2B7YA 3CKHA 2ZABA 4YGEA 4EN9B 1RUC1 4LO4B 4FI9A 2P3IA 5JOWA 4YGDA 1PZ7A 3OPZA 4GB32 4TSFG 5F2WA 2E76B 1MZ6A 2ZJCA 2ODMA 2VZQA 4F3JA 1O3TA 4KBZA 4LFCB 3GHNA 1AHSA 2GC0A 2A3WA 1JZ7A 1GRJA 2Y6JA 1EAH1 1B3QA 2WPDG 1LGBA 4CCOA 5A3UA 3V0BA 3W5MA 3TK1A 1LRHA 4P9JA 3GWKC 3CRCA 4MADA 1UYYA 2DBIA 5KA5A 2IU3A 4LA2A 1KP3A 1RSOB 2HH9A 1PK6A 2YEVB 2EILB 2Q7GA 3ZRSA 2JICA 5FYTA 1IX9A 4YM2A 1AR71 3ZHTA 2P4VA 4RD7A 3ZVXA 3ZSLA 1JX9A 1R1A3 2NMOA 3ETGA 1YJWV 2EX3A 3E8BA 1DDLA 1XNKA 5E1AC 3FZ3A 4RQFA 3JALB 5LP6B 4AF9A 2ZAAA 1CWPA 2UXXA 4J7ZA 1ENXA 3CQOA 2O57A 2Y4UA 3LNMB 2D6MA 3HD8B 4BIFA 1BCXA 2R0FA 4FPFA 4BZ4A 3N27A 3J7NA 4Q4X1 2YZ4A 4RR3C 4CUAA 2VNGA 5A1FA 3CBNA 1FPN1 2UUCO 2DYRB 4DW1A 1RVF1 1XE8A 3L2YA 2WLMA 4MHUA 5EJ1B 2XWJB 3THPA 3AKPA 1COV2 2AZ2A 4K8ZA 1O5UA 5KXEA 2PY5A 1H8TC 1RUG3 1WLWA 5B5EZ 4JQTA 1ZREA 2FDFA 3I59B 4AVCA 1V6OA 5LRRA 1Y6XA 3CHXA 3Q8AA 5FPVA 1F2NA 2ZGLA 4XEZA 2QQMA 1H1MA 4S2HA 3B5LB 2D40A 5JOXA 2K1EA 5LMUO 2E3CA 3ECQA 2IJKA 1ROPA 3FWEA 3L71H 4P9YA 4OHYA 2EJRA 2LW8A 1JZ2A 3A7QA 5HCHA 1PGL2 4PI0A 3WINE 1JI6A 2AH2A 5FBZA 4JI8O 3CYOA 1UY2A 2WJSA 1ZUQA 4EWEA 1CIWA 3WF1A 1XMOO 5EWSA 3C7OA 3RZGA 1HR0O 3OMIB 1SQPH 1YNAA 3SR2C 1KB9F 4IETA 1KU9A 4LBMA 1FPOA 3DGEA 4FAGA 4RFRB 3HMYA 2VVFA 4KMQA 4N53C 1JXNA 3FB7C 1BLZA 3OY8A 2XJTA 3UV9A 2ARAA 4XTPA 4CDXB 1OMIA 1N36B 3N7JA 1U5ZA 5DXDA 5A1LA 4YRDA 4GUNA 2XAFA 1AYM3 3A4UA 3ILNA 3JZVA 2EBOA 4IEXA 1H2GA 4ZIBA 4W50A 1XQNA 4QAWA 4JHTA 1OI6A 3T0AA 2H0VA 4I4TB 2DOSA 1YWKA 4BQYA 2ZDIC 2JEXA 1YQ8A 5LASA 1UWWA 4LBQA 4BAYA 2O8OA 2QQJA 1H8HG 1QXJA 2PA7A 1NH2B 2EXKA 1ENSA 2JENA 1NUKA 4LPLA 3SEEA 2E7QA 2RJZA 3TJTA 1Y9MA 1B35A 3OG2A 2EIMB 3MIBA 1EFRG 3RYIA 3V65A 2YDEA 3U07A 4B1LA 2D98A 4JHZA 4IERA 4IL7A 1WBFA 1PM7A 2UUBO 3K75B 5F39A 4B7EA 4YYOA 1JYTA 4B3NA 3S3WA 3JCIA 1W0OA 3P32A 1UY0A 4PBOA 1JFFB 1ZZ7A 4NAMA 2XQXA 3UO2A 1XE7A 5BV6A 5IWAO 3RZJA 4ISQA 2YHJA 3D6EA 4FAHA 3VKOA 4R8HA 2CY6A 1L0LH 1I94O 3RYCA 3RJ2X 4KHPO 1W2AX 3LZZA 2O14A 2VQFO 3CX5F 5FMCA 1ACCA 2ADEA 2XPJA 4IV1B 2B4KA 4CCDA 5HV4A 4FVMA 4JI6B 5FQ0B 4XDPA 2ZMLA 5GLTA 2CDPA 4X8NA 3A23A 2FDJA 1UYXA 3VD4A 4LF4O 3GWOA 1REEA 5ACA3 3I4IA 2G9ZA 4UFZA 4D7SA 2FZ2A 4PLNA 1DP0A 4AHXA 3BIEA 5D21A 4LIVA 2C24A 4MVMA 3M4FA 1Y76A 3KV6A 2MEV3 2W3JA 1HKDA 3VKNA 4DPNA 5DM6V 5EC1C 4WFFA 2W0XA 4UFLA 3HB3B 2AYHA 5FUNA 5IYDO 1VQOV 2OIIA 1S2EA 3F95A 2NQYA 4Q0UA 4X20A 1DQ2A 1B35B 1H38A 3O1MA 3D5OA 4QXBA 5GONA 4M4PA 1QVFU 2P5BA 2E31A 4JYAB 1AXZA 1AI6A 2VOVA 4BIZA 3SEPA 1K73W 3RYRA 3PUSA 2WZ8A 2XONA 4JDOA 3SH4A 4U3FH 1ZA4A 5FZMA 5C8WA 1ZNPA 1QJU3 1NLSA 3QH7A 3LDBA 4O4LA 3I3EA 4O4HB 2JJ1G 1FT9A 3JBG3 2DN9A 3T1HO 2J1VA 3SNMA 4BIOA 4X62B 3TBDA 3THDA 4ZHQB 4TQFA 1XNQB 4IV1A 2VZUA 3RZHA 5LMNO 1YI7A 4LNVA 2PLV2 3OTOO 4C91A 1F51A 2HEVF 3I3QA 2GNTA 3W5NA 4ES8A 1D4M3 2W94A 3VZMA 3ZXGA 2IZWA 1GMGA 3FB5C 3BEHA 1BYHA 2DE0X 3C3SA 1VF6C 4RHV3 3VBOA 4HLTA 2NN8A 4EB6B 3CRRA 1V9PA 1AR4A 3T1YO 3LFMA 1NCQC 2OPKA 1C57A 2WLHA 2PAMA 3WOGA 1F4AA 4IEOA 3ZYRA 1RPRA 1NAEA 4CU7A 1SF9A 4MTFA 2WT2A 5I8TA 4QB1A 3POEA 1VF6A 2VZRA 3RMXA 4Q27A 1R1A2 2BGPA 3NW4A 4X6RB 2GHYA 2J42A 1RM1C 2WWSA 5FUIA 2WR9A 2EAAA 2EIBA 3MYXA 3KSCA 5FIXA 1FXHA 3T2PA 4KWUA 3RYFA 1C8M3 1C4RA 2HEWF 3HKCA 3SLIA 1SKVA 4Y1UA 5A7WA 4XUNA 3VGIA 1QH7A 5FZ7A 3ZFEB 5B66Z 2VCBA 5IT6A 3ACFA 3LKJA 4DUZB 1OKOA 1PVC3 4LR4A 4IXLA 3AG2C 3BYWA 1E5HA 3GDBA 4A6SA 1UAIA 3A0KA 1HWYA 1QJU2 1N8RW 2UXDO 4CZSA 2DYCA 3BU7A 2A6XA 3JBG2 2OZJA 1Q81W 4JAUA 1EBOA 3BKZA 1LOAA 5IAXA 3MAQA 1UY3A 5T3NA 2ITDC 2NPIA 1JHJA 3U4XA 2AREA 1VR3A 4DR5B 3QO8A 4LA3A 1BL8A 2XT9A 2YG0A 4FFIA 3DL3A 5EIBC 3VZNA 3LNNA 4IGGA 4CEWB 3AG1B 3ABMB 4XXPA 3QLQA 3Q8EA 4OGQB 4OULA 5EBMC 1HV1A 1UYZA 2X6CA 4A7YA 5FZAA 3C90A 2VAUA 4QE9A 4DZGA 3LSQA 3TOJA 2OTJV 3A2FA 2WLIA 1SCSA 3OGCC 3M7AA 1YHFA 2VMIA 3AKQA 1LHWA 2HYXA 3KCXA 2VOXA 5D8AC 1S0BA 3AXEA 4EKWA 4MO3M 2X09A 4GX2A 2RMKB 5BMVB 5CZKA 2HWF2 4PLMA 4GKYA 3JXSA 3F2ZA 2IJIA 4TWTA 1KD1W 2F43G 4NJ4A 1UX6A 3PUHA 2WNUC 4G9SB 4BK5A 4J7KA 4GIQA 4JI5B 4EB6A 1WW4A 3KT7A 4QX0A 1LECA 1RUJ1 4UW4A 1BJQA 4YARA 1HNWB 4NROA 4GX1A 1QJU1 3RYCB 1XNRB 4Z1MG 4UXNA 3HWJA 3IPVA 4WM7A 2BSKB 2UUBB 2E26A 2YI9A 5JAXA 1WCQA 3HKBA 1F5FA 2R042 3UGGA 4XDQA 5BNOA 2RM23 4HPKB 3H8RA 4B29A 5J2UA 5HBAA 1BK0A 1BEV2 4LQRA 4KG0A 1JQ0A 1CP9A 2V09A 3G6BA 5E8AA 4Q6GA 3WW4A 1P8JA 2D3OW 3DKQA 1JCHA 2J1EA 1LAJA 1ZBA2 1QLEC 3U11A 4K9SA 4X1IB 4JI6O 1I5XA 3MHSC 2WNVA 3AL5A 2JE8A 4PCRA 5EJ3A 1QEXA 4IEYA 4LKDA 1BE3H 3B40A 1HW7A 5FYCA 3KCYA 2W9XA 4IV3A 2ZCEA 2ZDIA 5FBJA 4AVSA 4J7JA 4X8AA 3LDKA 2ZX1A 5FR3A 1Q6IA 1OA2A 3VHRA 4BA6A 2Q1FA 1M56B 2HWC2 4PA3A 1GZWA 4LNUA 3AP5A 3H50A 2D5HA 4NPRA 1CZSA 1AROP 2N04A 2IVJA 5E1RA 1E5RA 2FHRA 2P22C 3M8LA 3B9CA 2FMYA 3DYMA 4OI4A 1H4HA 4XYXA 2GDSA 1AZDA 2WLQA 3ORJA 3FFZA 4RA0A 4HMZA 2DJVA 3HQUA 4AEKA 2OUJA 4RUFA 1SFNA 2WIIB 4DV4O 1VBC2 1POV1 4MGYE 2OUHA 3ZPOA 4UWDA 3AFKA 1NG0A 1NTKH 2AHZA 4CEWC 5FAXA 1GICA 2N05A 3ZKYA 2RNBA 4P9LA 3D82A 4WM7B 1N3OA 1QNYA 2ZM6B 2JG8C 2QM4A 3SPGA 1D2SA 5FZKA 1ZRIA 2BJSA 2BVBA 4FFFA 3T1YB 4UFJA 3O1OA 4JZRA 4XAEA 4KU8A 3BB6A 2YICA 3GZAA 4N43A 4JTNA 4JGZC 3JALA 5LP6A 4XHXA 4UI9L 4L2NA 3J8F1 4NPLA 5KMGA 4GLXA 1QOSA 4R9BA 3I97A 1WN7A 4JC1A 2D44A 2F4PA 3D36A 1Z0HA 3AKSA 4Y1YA 1ZA7A 1N1SA 3N36A 5ABJC 1GFF2 4GWNA 2YC4A 3VHNA 5J48A 1FKAO 2WSSG 3WNXA 1X9PA 4K35A 2J1AA 1N3PA 1Q5OA 3DKWA 3U78A 4NTXA 1RINA 2W1UA 5B1AB 4TOIA 3TEYA 3NNLA 1RHI3 2V7QG 1RVF3 1X4TA 5FP9A 3X2QB 4PHZA 3E83A 3ZXJA 5KHGA 4X66O 4Y22A 4LF4B 1L8DA 1R3JC 5T5JA 2XR4A 4J25A 4AHZA 3O9OA 3I55V 1QVGU 5EXOA 1QJZA 1RIRA 3OY8B 1WLDA 3IIIA 1CPNA 2FTKA 2PYJA 2BOJA 3HEIA 2VMDA 2PZSA 3ACHA 1WPXA 3ZHQA 4CCEA 3J80N 3AG1C 3ML0A 1I94B 2QM8A 1OCCB 4N9IA 5CFDB 4E8DA 1D4M2 1AJKA 2PYLA 1B35C 1NLRA 4D6QA 3OR6C 5K9YA 4CZZA 4UV8A 5BNOB 3NAPC 5FZ1A 4FZ0A 3GGLA 2Q6AA 1GMMA 2ZT9B 5C6CA 4UF0B 4FM2A 2NN4A 1THZA 1S0JA 4UFMA 2JDIG 4TV8A 4NN0A 4GKKO 3MO4A 3S6PA 3PUQA 4GMP0 1PKXA 4WVWA 1PNGA 3AP4A 1R083 1LU1A 1OPMA 1XUQA 4AFAA 4OUSA 3BAAA 1MEC2 4GMP1 1SZXA 3ELNA 3UKNA 2XG3A 4FPGA 2VOTA 5B3SB 3RMYA 2A6YA 1HQLA 1Q86W 3E2EA 1H6XA 2FMLA 3SKJE 2A79B 2ZEYA 1AX1A 3JD0A 5BNPC 1VMFA 1OLRA 1KQSU 2JDAA 4COUA 2DU0A 1AILA 3FC0A 3VDDC 2W68A 3I2HA 1QHDA 3PJYA 1FNZA 1BQ0A 5AFEA 4G4FA 3AK3A 4JYAO 3JCZA 2HJFC 3E6CC 4HYOA 5B4NA 3ZIAG 2QDNA 4LHKA 3WCSA 4LF7O 1UCXA 4B08A 4JAVA 2ZKLA 5L9BA 4FXKB 4GWMA 4X6QB 4FPOB 3KHBA 4H7MA 1UW8A 2WO7A 3JARB 2KSDA 1M4WA 4GKXA 5K7PA 5GZEA 1FFTB 3ZHRA 2YXHA 2FCTA 3E35A 3T4ZA 3JAKA 3VQVA 4X89A 1ZVFA 1ZSPA 3IAPA 3ZYJB 3WP5A 3N3HA 3QNEA 1PNLA 1PGL1 5FZ8A 1XNRO 4H0LB 4IEQA 2IFWA 1GQHA 4OQ8A 3WFVA 3SJBC 1FJGB 1QLNA 1GSLA 4DOUA 3VKFC 4QPKA 5EYXA 2X5IB 3AM2A 1W0PA 2HLDG 3ZLIA 1CIYA 1ONAA 5CFCC 4C90A 4JF3A 1VQ7V 3WDXA 5FTTC 2VNOA 4OZXA 2OIGA 4X20B 1QJEA 2BTVC 2BV4A 2UWAA 3I2IA 4R9CA 1PGW2 1HRV1 4XDOA 4OXSA 3LSEA 1KDKA 3RI8A 1Y74B 5EYYA 1COV1 1IURA 1VRBA 4RR3B 2RMU1 2DUPA 1LNSA 1M5IA 4XMIA 4GJZA 4XCAA 4D6TH 5F2SA 4RQPB 5CU1A 3AG7A 4YZ1A 4IEPA 1RVF2 2YROA 3LIHA 5DQ0A 5LBBA 2ZR2A 4W65A 3IN9A 1TQ5A 5JIAA 5A3WA 3OUIA 3KQ4B 3CB2A 3H8XA 2P4KA 5ITZB 1F4NA 2LFSA 3CC4V 4QPIB 4FLVA 1HW5A 5CA3A 4XBNA 4JDMA 4AI0A 3INAA 2WKKA 2RV9A 4LBQD 5T52A 2ZM6O 1ENVA 4B4PA 1WA8B 3FX7A 3T3YA 5HCBA 1HQNA 3ZKUA 2P7TC 5L9RA 5A33B 4QKFA 4W6XA 5CG8A 2VQEB 3RVHA 3WG2A 5FZLA 4GWIA 1LTEA 5EBLC 4NB5A 4XUPA 1AR72 2ZHLA 1TVKA 5C5TA 2Y6HA 1KFXL 1EAH3 3JAKB 4G28B 1VIWB 1DFQA 5H9SA 3V0BB 1PM9A 5FZDA 3JQXA 4J80A 1AJPA 1NI8A 4L99A 1R1BA 1A78A 1US6A 4LF5B 2L9LA 2YU2A 1JS9A 1PO12 3IMMA 1N32B 2ZACA 2W08A 2QTSA 2BGOA 4CS3A 2OKXA 4DV1O 2BOCC 4I30A 5JCTA 1RXFA 4ET7A 5H9PA 3KT4A 3KS7A 4XQDA 1G7YA 3UT5A 1ZM1A 1DGLA 4PIZA 1LHVA 3AMQA 1SQGA 1XMQB 3PMEA 3POFA 1RMU2 3A0BZ 2W1WA 3WX5A 1XB9A 3K3OA 3GJAA 3H9AA 4BDVB 3H3UA 3SH3A 5EV7A 4GB31 1C1LA 1ZZCA 4QQ2A 2VZOA 3HBZA 3M1HA 4XBLA 4HN1A 1H8EG 3W7WA 4AILC 1TEIA 1UIJA 5LZ6A 2R0HA 2QWPB 4CDUA 4LH7A 1BBT3 2D6PA 3ZSJA 4X66B 1LHNA 1EPWA 3FFQA 4AI1A 3KVBA 3FB8C 1LOEA 2MNGA 1C5IA 2QKSA 1W3VA 3I2FA 1X8MA 3CJIA 4IDZA 4JI1O 1WP7A 4Y20B 1YFWA 3LA7A 3ZFGA 5FK7A 1VBC3 1R082 4YVSA 4M3CE 2F66C 2E74B 4AEJA 2NMNA 5FP8A 5IYYA 2W1QA 4AHCA 4FPPA 3AEIA 1T2XA 3MF6A 1BT8A 2X53S 3ST7A 1KFUL 5FP3A 5BXXA 2RS11 4RQPC 5LA1A 1O3RA 2GH2A 2RM22 1F8VA 5FOJB 4TWKA 1C3HA 2NM1A 4CP0A 4LMFA 1G9DA 1ND2A 4WM8B 3K06A 4EV0A 3BA8A 2QGNA 1V9U3 3UESA 5C3RA 3BTAA 5I8YA 2PXJA 3RW0A 4QXCA 1FMD2 2P90A 3WNMA 1LU2A 1CONA 5J2TB 3RNSA 2M6YA 2V5DA 4K8FA 2C4XA 2HWD3 4UFKA 3VBRC 2E7AA 3ZYHA 3ZXLA 4LUKA 4HG6B 3QF7A 3BU0A 4PDRA 4KWJA 2GMMA 5H6RA 2PGGA 1ULFA 4EEQA 4QKNA 4RGKA 1PPJH 4PV1B 4UOJA 2UUCB 4V2VA 5A6ZA 2VY0A 1L7RA 3KM5A 2HWB2 1Q56A 1QJX2 4N53A 3KF3A 3HR0A 4DV4B 1WLCA 4G3YC 1M57C 5DUXA 5G04L 4PI2A 5C70A 3SITA 4IHJA 1OZ0A 4J9YB 3DPRC 2R32A 3KF5A 1JUIA 3B8MA 5JI9A 4J1WA 1WP8A 3HT1A 3OGJA 3E86A 1TME3 3LOIA 2Y0IA 1MR5A 1RC6A 3I3DA 2IJJA 1JN2P 1I5PA 4U2AA 1DTOA 3H3LA 3VD5A 3OUHA 5FRAA 2Z79A 3BCWA 5IW0A 2ZEXA 4IV3B 2JG9A 1VBA1 1WMEA 1J84A 4Q4Y1 2WABA 3WP6A 1SBDA 4QX7A 2HWD1 1SG3A 1IG0A 4M0NA 4XTMA 5FZOB 5FL7G 2D7FA 1V6IA 4NTYA 1ASJ3 1IOAA 2PLV3 4LO7A 1R3KC 1ALYA 1D5NA 2XHKA 3FHQA 5FO8B 2JEMA 5J98B 3I2JA 1RUD2 3PU8A 5ERLA 2UUAB 2RJKA 4LE4A 1AJQA 5APAA 2JDZA 2UXCO 3ETPA 3GZTB 5F3CA 3JYCA 4I5SA 2X6BA 2D93A 5JQGB 1YTFD 3TN93 1OCRB 5FMOS 4HZFA 4J42A 3WHTA 3KB5A 5JXJA 4BMEA 4UCVA 3JB4C 1V6LA 3N9QA 4I02A 1RGSA 5FZ4A 3DYOA 1IXBA 3BUCA 4WZFA 4TZDA 3CRAA 3I2KA 1A8MA 3ZMUA 2XJPA 1N0NA 1NR1A 1WD4A 3NXSA 3BHPA 2BTQA 3K51A 4TYSA 1JOYA 4O65A 4WM8C 3SPIA 2C2AA 2ZNIA 3JAMN 2JG8A 2CSGA 1Z78A 4QGPA 3G80A 5CBGA 4YZ5A 1CJPA 2ZGKA 1HRI3 4WBNA 3ZR5A 1RUE1 4KXRA 1BSMA 3CCJV 1OVSA 4CPBD 3VBRB 4RHV1 5AC92 3WZ1A 4LF7B 4CDWC 3G4SV 1W9SA 5T5LA 3UK9A 1GO3F 4QX5A 3BVCA 4DUYB 1RB8G 3SC7X 1ZWIC 5FK8A 4BMBA 1G8WA 2FB5A 2NP0A 2YGMA 2CK3G 1NA1A 3MFCA 1VQKV 1S0CA 3H1HH 4QQHA 1IGOA 3PVBB 2C6SA 3VLBB 4TUYB 1ZLZA 5C8YB 5JVDA 3OUSA 3CJIC 5KMGB 3PDQA 4CSWA 4S2FA 2WAOA 3CXHF 1F15A 1QJY1 2P3YA 4DFSA 2ZZQA 5K8SA 3R4UA 2ZHNA 1O8SA 4CCCA 4LKEA 1AR5A 4O4LB 1XMQO 3F5TA 4FFBA 4FOYA 2X10A 1O6UA 4S2GA 4CS2A 5AC93 3ON7A 3GALA 2VR4A 1PM4A 1W9TA 2PAEA 1D4VB 5L3CA 1CAXB 2LP7A 4JV5O 4OMCA 1K5MB 2VNRA 1SQVH 4TSVA 4KQ7A 2L6LA 3IZOA 3W21A 1RUE3 1XSQA 1CGPA 2V4AA 3SPHA 1BHAA 1DZTA 3OJBA 2QJ1A 4BM8A 4XFIA 2EIMC 1KBHA 1WW6A 5DAQA 5DUUA 4CS4A 4C7UA 4QQLA 4LFBB 3GM8A 3CJHA 1O4YA 1DQ5A 3RT3C 2B45X 4U3JB 1GP5A 3DCQA 3DUIA 1JYIA 2JKBA 4JI1B 1W2OA 2CHHA 4BQ3A 1BCCH 5A32A 1W2NA 2EVXA 4RGAA 3ZRXA 2JS5A 3POGA 1UOFA 5EHDA 4DS0A 4DUXA 1US3A 2W2IA 3ZXKA 4DY3A 5C7GA 5LB6A 4ZZ5A 1OCOB 2DF7A 4YZ4A 1GZ9A 2YIBA 5L36A 1OXCA 4ITCA 5CADA 2EZOA 4AAXA 4UAPA 1YITV 3K58A 1SQBH 4NUBA 3NWKA 5F5IA 4ONUA 2CH7A 4I0AA 4KG8A 1GWKA 2I07B 2VS0A 1Y4MA 1WB8A 4XACA 4DXTA 3FD9A 1RHI1 1S2KA 3DSQA 5ACA1 3OGSA 1IQDC 1LUWA 5CKQA 1VARA 2DTWA 4EQVA 2QQLA 5FZCA 1V0AA 5BY1A 1WW5A 1B06A 1RUG1 1X7NA 4IHJB 3Q8BA 2RDNA 1XNCA 5LA6A 3WF4A 1DQ0A 3LDCA 2F4VB 4PDWC 4MVUA 3CS5A 1K42A 2ATFA 2FYUH 1YRZA 4DO0A 3FUQA 1Y9QA 4Q4V2 2ZE5A 3S30A 1PVC1 4XBFA 3AG4C 3ZFFA 3N7LA 1AR82 4OHXA 5A3OA 1VQ9V 5F5CA 5JJEB 4IGPA 5IYZB 3R65A 4FFKA 4DXWA 1XREA 4PELA 5FPLA 4XJZA 3NJVA 5IT9N 5FYYA 3MF9A 2BSKA 2VJXA 2ZX0A 2B8MA 4N8MA 1SS3A 5FZFA 2RCVA 2BWCA 1S3JA 4Q0SA 3SJQC 4N43C 1J95A 2R061 1SMVA 4LORA 3MIGA 2VMGA 2UYAA 2R071 4Q1PA 2NNUA 3D36C 1KUQA 5CB7A 1X9TA 3QVNA 4NR1A 3J26N 2KM2A 2ZEWA 3SQOA 3USSA 1MVEA 3HKEA 2DW4A 3GZEA 3EXAA 1BK1A 2D43A 5E88A 3HPNA 1DCSA 4NWVA 2FDKA 4A7ZA 1VJ2A 5JZGA 4WVZA 1PZ9A 2ORZA 1GM9A 4FIPC 3IC7A 4QE7A 5JVDB 2FDHA 1KKDA 4V1PA 4LLFA 4GH4B 4OMDA 2Q4SA 5IVBA 2A7AA 1UNBA 4M3CA 1DYKA 3JATA 2HKOA 1CPYA 3FMGA 2VZVA 3VDAA 1KJRA 1RJ7A 3ES1A 3C3VA 4UT5A 5B1OA 5IVVA 3D0JA 2Q69A 3PJQA 4HKLA 1AR91 1W39A 5SV5A 1AI5A 5ITZA 4HVOA 1PO13 3ZHVA 5EZYA 4OZOA 3ENRA 1N33B 3AMHA 3ZIXA 2M7WA 2ZE8A 4MXVA 4AK3A 3V0AA 4DR4O 4U36A 4K3AA 3K04A 4IYHA 1FYJA 2ZMKA 4FFBB 3ZBHA 4DUYO 3PU3A 5JI7A 3MW4A 3KZIZ 3JAWB 5JLVA 4D6SA 2AW9A 2YXYA 1K5MA 3BVOA 3M3QA 3AKRA 2FCUA 1UZZA 1AXKA 4NIGA 2H3OA 3T1HB 3G7DA 3G6EV 1MZFA 3ILFA 5IVFA 3G6JB 3POIA 4F7ZA 1YFUA 2GUZB 5GKAC 4EROA 2Y6LA 2MEV1 4DY5A 4CCNA 1POV0 4CPBA 2QA4V 2OCHA 1AJNA 1BZKA 1WLTA 3CDZB 2DCKA 4Y4RA 3ZMOA 5B1BB 3M2MA 1Y76B 2W0FC 5KHIA 2JJ6A 3LGRA 1SLTA 4E2LA 4KUMA 2PHLA 2P6HA 1VQ4V 1OA4A 2D6LX 3IDBB 4UW6A 4UBHA 4CDUC 4YFWA 4ASMB 2RR13 4I3PA 3WDYA 3ZN6A 3VDDA 2QKDA 3VBBA 4F83A 1GZWB 4QXHA 1R6TA 4W4LA 3NV4A 4X88A 4YVSB 4DK0A 1NCQB 1MQTC 4XETA 1TUBB 1W05A 3GCWA 3OTOB 1YIPA 4XILA 3O0XA 1UOJA 4M0HA 3KV9A 3H01A 2CTQA 1PMHX 3ZSKA 4P5YA 2R6QA 5DAPA 1DG6A 4V2WA 4LHLA 1UZ0A 1NH2D 4DV6O 3FLRA 2Q8VA 1ORQC 4DUVA 1CQ9A 1ULCA 1JUHA 3WR0A 1C8NA 4YGBA 2ADDA 4LF9B 1YC61 5FMOL 3AMMA 4O4HA 3W7UA 1YJLA 3WU2Z 1AYM1 1YZBA 1ZZ9A 4MW3A 4HK9A 3OPWA 2DURA 4ICGA 4AI8A 2R30A 3MW3A 3ZXDA 2FBEA 4L9BA 3AP6A 4XF9A 2A75A 3B7MA 3I2DA 3MLKA 2ZGRA 3J81N 2G9FA 4QDSA 5FLIA 3SYPA 1ULEA 2ID4A 1QH6A 4QX3A 1PMJX 3P30A 3VD9A 2XNDG 4CP9B 2OCCC 3MZHA 2ET1A 5HXMA 1D2QA 1MG1A 5A3TA 1LHUA 2CYFA 4UW3A 2VQTA 4YJ2A 5HI0A 1UPIA 3CMGA 5EBWC 2A1XA 3ZYIB 2KQXA 2OXBA 2E9QA 2ZGMA 1BBT2 1W04A 2AUYA 3WB0A 3LSUA 3I8TA 1LCLA 4NMIA 2B9UA 3IWZA 4RSUA 1APNA 3SYQA 3K5MA 1VBE1 2VG9A 2BOIA 3BODA 2EA7A 4JDNA 3FX3A 4ABMA 2QEXV 5LWBA 2LW7A 1BVP1 1NE4A 4DR5O 2XWBB 1LOBA 1HNXB 3GNEA 5FZ6A 4DNYA 3THCA 3SPJA 1QQP2 1NY71 4LHNA 4CC5A 2GMPA 2JX9A 2V4DA 3OGVA 4I0WB 5BNNC 2B1IA 1LEDA 1T5EA 2JEUA 4LO5B 3OW2U 4NRPA 4DV2O 1GLHA 1VALA 1GTOA 4D8MA 2D6KA 1IBKB 2C5DA 2VWKA 2DYSB 2OWOA 2ZX3A 1MMMA 1NZIA 2R7EB 1EUTA 2O0OA 1S0FA 1IBMB 3GZUC 1LJ7A 3TEZA 2VECA 1Y66A 4JI4B 1MS3A 4L92A 4MHRA 2CWSA 1PGSA 3TRSB 4NHMA 4QDRA 5BNPA 4AG4A 1POQA 3WEZA 1XNAA 3DEMA 2JS3A 3B02A 1AJOA 2YYOA 5J3UA 1RUF1 3VHOA 1HDJA 5EFUA 5BPXA 4CP9A 4WBNB 4BYYA 3VD7A 5KXBA 1OD3A 3CZJA 4XFGA 5CBHA 2VOWA 2E32A 3VBUC 3OGGA 2B9ZA 4I55A 5F7UA 1CD3G 4DV7O 5FYHA 3LCPA 5GTIZ 1PVXA 2CTVA 2WQ8A 4Y3OA 3UQ8A 2Q8OA 4QB6A 4YIPA 1JZ3A 2VUCA 1JYNA 4ZOLA 2BFUL 5LYJB 3OBAA 1O9GA 3I54A 1HRI2 4XJ8A 2ZGQA 3GYDA 4XIKA 2ATKC 1XRUA 5FY8A 5F5QA 3WT3A 4LBNA 4Q4W2 1AR63 4DRVA 4AEDB 4ASKA 2QR4A 4XFAA 1MS5A 3N2KA 3CIHA 2Y69B 3EO6A 4CU8A 2WS93 4WVMA 3ACGA 3LEGA 1Q6HA 3B77A 3CCMV 1W8FA 2IXCA 1PL4A 3ASOC 2LFRA 4FLUA 1OURA 4QPGB 4UCOA 5B1BC 4Q4V3 5K0UA 1ULDA 4MLOA 3USUA 2F6BA 4X8PA 2NR5A 3CCUV 1VAVA 1KRIA 3K0GA 4AI2A 1ZRDA 2WO2A 2ERFA 2VQUA 3K2OA 4O4IA 1WW7A 2F17A 4H2AA 2JDUA 1AI4A 4JI2B 1IPJA 4LO6B 1RUI2 1OUXA 1GOGA 1QLEB 1ASJ1 2P3JA 4XCBA 2WNEA 1ODNA 2HJIA 1BBT1 1X36A 4MGSA 1GN6A 4ZHNA 5J7MA 1SBEA 4OVEA 2QDRA 4GKJB 4NPMA 2HHHB 2YMZA 1KEXA 3CJHB 3UNPA 4YM1A 5T50A 4MSWC 4FPCA 3SPCA 1CAXA 2VOKA 3CEWA 4NRMA 2LUWA 2WLLB 5C8CB 3RYHA 3EFFK 4FLWA 3NNGA 3DXRB 4LNUB 5FWEA 2P37A 1Q82W 4LCUC 4XFFA 2VBPA 4UUJC 1DQ4A 1AVBA 4YW4A 1CPMA 5IYBO 1H1IA 2WS91 1AYM2 1QHTA 1JOPA 3O5SA 2Q8EA 1NZCA 3U1XA 3E5QA 2PHWA 2AGAA 2VW1A 4J9ZB 1YTFB 5F6KA 2VTXA 1EV12 1RJ8A 2Y0OA 5A32B 2HBUA 4IE6A 1S0DA 2WFF1 2EXHA 4AVVA 4FM0A 3KLSA 2AXTZ 1S4CA 3FJSA 2GC1A 2D3SA 2A9HA 2F23A 2HG5C 1EPZA 2VWJA 3VL8A 3AP9A 2VZPA 1U5IA 4HFSA 1NCRC 1HXS3 3O1SA 5HCFA 1NYWA 4B3SB 4X9QA 2ARBA 2AACA 1FXKB 1R6KA 4XW3A 1R3LC 1R093 4HBNA 1DLLA 1SETA 2YI8A 4E4ZA 4NIAA 2QCSB 3C2UA 1AP6A 5FZBA 3RWKX 2QWOB 4Q0VA 4ARXA 4NAOA 4Q8LA 2Y33A 3NAPB 4GKKB 5JOZA 3E6DA 1MQTA 1OBNA 5E16A 3K59A 3JATB 4CH3A 4JGYA 4CDQB 3ZN4A 3EBRA 1WLEA 3CCLV 4DR4B 1DHKB 4CDXA 4XZPA 3K77A 5BYNA 1HB3A 4YWAA 5DZFA 4MVRA 5C3OA 3N9MA 4F8AA 5BNPB 2WT1A 2VULA 1XL4A 3ZRWB 1I6XA 3N9LA 1UYPA 1MS1A 2JDPA 5CA0A 3NKGA 3FYIB 2YBKA 2ZGOA 3WQ7A 2MPFA 4A3XA 1AX2A 4FP3A 3WF3A 1R64A 2N7GA 4YVWB 4PF1A 3X29B 1R092 4YG6A 4TXWA 5LOVB 2PI4A 1MSWD 2D6NA 2Y38A 3UKMA 1BKZA 2AC1A 5CB4A 1MABG 1DGRA 2G19A 5FLHA 3VKLA 3VQYA 2VE1A 1VQPV 4E4HA 1U97A 1GNHA 3APOA 5EIBD 1YQ5A 4FOQA 5FY7A 3I2GA 5FXVA 1PIV3 1QWRA 4J11A 2HR3A 3EHBB 3CCVV 3UKVA 5FFOC 3AP7A 4PT6A 1X8EA 4O4JB 2VGDA 1OT5A 5FO7B 3H42B 3L70H 3ZMTA 4JVAA 3LA2A 2Y34A 2FDGA 1YI2V 2OYZA 1ZBE1 4ARYA 1SLAA 4LH6A 1W90A 3B94A 1OQEA 5HCAA 1LOFC 2DVBA 2YV8A 4PF5A 2Q8CA 1JR9A 1AR93 3CMEV 5I0UA 4I3GA 4P9XA 3Q8FA 4RO2A 4HOOA 2BNNA 2XQRA 1POV3 4Q29A 2CDOA 3UKTA 4QM8A 4ORFA 3H1IH 4O4IB 2GU9A 1W8OA 3QO7A 2XLFA 5IY5B 2R072 1H0BA 1SZBA 2WFF2 1XNDA 2ARCA 2WINB 1W6NB 1WBLA 4W6WA 5IYCO 3THTA 4L87A 3UETA 3APQA 3ZXAC 1FJGO 1CAWB 1O59A 1O5LA 1FD9A 2PHFA 1EV13 1AR81 3RRDA 2XUEA 3R4SA 3LF7A 5EPAA 4R50A 5A3NA 5FP4A 1X33A 3DXRA 4Q20A 4AXOA 2GUZA 3WDTA 1PP9H 4XJ9A 2DYRC 1NS1A 4ZPIA 5F8PA 5K0UB 3BOWA 4BQXA 1KDMA 4L97A 3L74H 2VQEO 1IHMA 2JD4A 2P2KA 5JOYA 3CRQA 5AG2A 2HWB3 1D0GA 4KP4A 1Q8QA 1RUG2 3DYPA 1SPPA 2CU5A 3ASNB 2LTNA 1GR3A 4IEVA 3T0BA 3JD2A 1HLCA 4ES9A 5ACA2 1XEQA 1ASJ2 5H2FZ 4LLOA 5FXXA 5GALA 3T4VA 4UCSA 4AFCA 2DCJA 2VXRA 3FB6C 5C9AC 1COWG 2IWGB 2VC9A 3SGIA 3MEPA 4LHSA 3RGBA 2JG9C 1W8TA 4A4AA 2IFRA 3B4SA 3HKCB 3H9VA 2X6AA 4DV1B 2A5ZA 3JU9A 5FWJA 3MPBA 3HOBA 3I3BA 1OSGA 4F6EA 2HWC3 2HHHO 3CE2A 1RUH3 3SISA 1XBFA 2FQPA 3BABA 3NO8A 3CC7V 4KH9A 2EZPA 4EYUA 1O3SA 3IMNA 1OH3A 5CB4B 1QJFA 1ZL8A 3J9SA 3IDCB 3SHRA 2VQFB 4XF0A 2BGCA 4FVVA 1M57B 1QNMA 3WG1A 4A44A 2ENRA 5EIYB 5J9PC 4DUWA 4NHLA 3D8CA 1Q3EA 3F7VC 4Z8BA 2NZ9A 4CH5A 5M0TA 5FZEA 1NBMG 5CA0B 3LAGA 5JSPA 1YQCA 5L7OB 5DUVA 2OVUA 4G27B 4DV7B 2IXIA 1IBMO 1V70A 5LEKA 4TV9A 3QCWA 5LOVA 5BXZA 4DK1A 1RUF2 4M01A 3FAVA 1AB3A 1OOPA 1QJY2 4OPAA 1BZWA 3S57A 5FJKA 3R0RA 2H6BA 3ZYBA 3SKVA 2KXLA 1XHZA 5CA1B 3NKTA 4FZ1A 1LNQA 4B3SO 3TEXA 4QM9A 3KT1A 1RM1B 5C3SA 4IYIA 1Q8PA 1QGLA 2QQOA 2WLNA 5I0SA 3BTYA 2GTAA 4AOCA 4JI0O 4AL9A 5LHGA 1GQPA 3O1UA 2R063 2ZGTA 1VB4A 4QHZA 2Y60A 4NKGB 4AHWA 2R073 5LBCA 3NSTA 2XKPA 1J3QA 2UY9A 2WSVA 3HNMA 1UOBA 2WNUB 1UO9A 1QQP1 4JI2O 3QO5A 4AVAA 1VQNV 4RUEA 3IDEA 3WQ1A 4HPKA 1W3XA 3ZSEA 4XOGA 1DQ6A 2W95A 4BQ4A 2LM3A 4Z1VA 1G6NA 4IV1C 5C4WC 3TWIA 2IU0A 2WN2A 2Q68A 3DPRB 3USUB 4R9DA 3IIAA 1VBE2 4GZ9A 4XUQA 4RFT0 1C8M2 4IW3A 1TVGA 3TN92 4UW5A 4YW6A 1TVKB 4HL0A 1J83A 2YB7A 1OHHG 2XAQA 3W7XA 2HWF3 3ABLC 1RFYA 5FPUA 3NMBA 3N35A 2YXSA 2YUAA 1GBGA 2FCVA 2Q30A 3ZX6A 2D5FA 2I74A 1HXS2 3GBFA 4GKJO 2G9GA 4JGZB 1N1VA 4HT1T 1HIXA 4X65O 1XQ8A 4DV5O 1RUD1 3IBMA 2DCZA 4N9HA 4FP2A 2H8PC 2ADQB 4PDMA 2QQKA 1OFSA 3ASNC 1LB2A 3T09A 5L19A 5DUWA 1WUVA 1SQQH 1OLME 3H8OA 3OF1A 1K34A 4DYLA 2Q7EA 5K1PA 3HNBM 4X1YB 1ULGA 4H7LA 2RS31 2J1UA 5JVVA 3ZSMA 4UB6Z 4B4QA 2WZR1 2D3PA 1M90W 2PAKA 3JD1A 1GUIA 3SYAA 3M3EA 2WQZC 2BE3A 4H33A 5CA1A 5BR8O 2XVKA 2RE9A 3RZKA 5GM0A 4BLIA 4GYCB 3DXTA 3CEIA 4AFDA 3RPQA 4OYUA 1PO23 3JD73 5JUVA 2AR6A 4Q5OA 4FPJA 2DQ3A 5L7OA 2FZ1A 2QDOA 4LP8A 1X50A 1AI7A 3MV01 1J59A 5EJZB 4H55A 3ETQA 3WY6A 3VD3A 2UUAO 4BJ0A 3ZYPA 4K1YA 1S55A 2MEV2 1XE0A 5KAIZ 4PA7A 3KGLA 1GN2A 2ZX4A 1V55B 4LK6A 4JI3O 1GANA 5BNNB 5FPBA 4UBGA 2PTMA 1JTZX 3DPRA 4TT3G 2Q8DA 4AZZA 2JRIA 5GLWA 1JBCA 1YXBA 1FATA 1RUJ3 3V56A 4CU9A 2GC2A 2G1MA 2GALA 2DYSC 2ZQMA 5IFTA 4QIWF 1UF2C 2QVSB 4YG0A 2WZEA 1YJ9V 3A8TA 3EYPA 2JG9B 3LWCA 1WKYA 1PX4A 4NTWA 5GZDA 3GCXA 3VBHB 2IW5A 2UU8A 2WLKA 2RM21 4JI5O 2AZ5A 1PO21 5LK7B 4CEYC 5LL6Y 4RS5B 3S3XA 2PN5A 3ZXEA 3VDDB 4IESA 5I0RA 2WN3A 3M3CA 1HN1A 2F93B 2XOKG 3O1RA 1Q8OA 1DF5A 5JJNB 5FY1A 3VZKA 3I56V 2PI5A 3KGZA 4C8DA 1NCQA 1QNWA 4CDXC 4FLTA 2KD7A 1J1TA 5CFDA 4ASLA 1N0JA 4P02B 4PDWB 5A1AA 2D2CB 4E2QA 3ZRWA 3E5XA 1H9WA 3OYWB 4RQPA 1QR8A 4JV5B 3AB0A 5TSWA 1YHQV 2WAAA 4FPLA 2QJVA 1QR9A 1RITA 1REFA 2BBVA 1PL0A 3C7FA 4CDQA 5JZGB 3HN3A 4MGTA 3ZEDA 3OB8A 2YS8A 3NNFA 1PNKA 2EXIA 4AQTA 3NV3A 1DF4A 1PV0A 1UZYA 3PVEA 3WUDA 1SFPA 4XFHA 3PVOA 3CRMA 2CWMA 2JD9A 4AR2A 1K3IA 3T4DA 2ZGNA 1RMU1 4JGZA 1IZ3A 4LKSA 3OMNB 2W91A 1F4HA 1R3IC 2RR12 3MLJA 1OFNA 3JD3A 3A21A 1W8NA 5EZWA 1ZRFA 1EN4A 5KUMA 3OT7A 5C93A 1SFYA 4CP1A 1XJAA 2IH3C 3I59A 2E6VA 3O12A 3NQHA 4JTAB 5FPZA 4BOWA 2UWCA 1PVC2 4MGQA 4GB33 1OCOC 1V55C 5DG1A 1VRH1 3ZN0A 2R043 1PIV2 1YDXA 4COWA 1YJNV 2D6OX 1ND3B 5I0TA 1K3EA 3P3PA 3LEKA 2XASA 1UPGA 3RYIB 4XJWA 5FYZA 1QBZA 3I7DA 2VUDA 5HFMA 2IXJA 1BQZA 5AVAA 2QWNB 1LGCA 3M7MX 2A71A 1I7FA 2UURA 2F4VO 1RUD3 3HPLC 2XJVA 4UVBA 2H94A 1W0NA 3KQRA 4JPRA 1K92A 3LFIA 4HVQA 2JDNA 1EN6A 4X65B 4DV5B 3MI8A 4DINB 2W6JG 4FLZA 3J4UH 5D8AA 4D3WA 1QY4A 2O1QA 3CF6E 4XURA 4R6ZA 5A33A 1W6QB 3L9JT 4KNCA 5A7QA 4D0QA 4DIQA 1ZRCA 3ROUA 5A70A 1CAVA 5J1XA 1PK6C 2VCCA 4DV6B 1V9U1 3ETDA 2QZ3A 4QPIC 4BLJA 3BGAA 1OF4A 4O9GA 4A41A 4LFAB 1HRV2 4GZRB 3E22B 2GZWA 1VIBA 4AI9A 3M3IA 1L3JA 3AZXA 2RS13 4HSLA 2IJHA 4WF9V 2ES3A 4IL6Z 1O4TA 3OD0A 4E2GA 1YEWA 1Z7S2 3OUFA 2YPJA 4JKMA 5DG2A 4H3WA 5LEJA 4WVVA 2WWJA 4LUMA 1DZQA 1MS4A 4ZKTB 5JPMB 4OX9B 1IS6A 3K0DA 4DO2A 1STMA 4MVSA 2OTLV 1ND2B 4WM8A 4XVHA 1SZTA 3WW1A 5K1XA 2YU1A 3UO3A 4CDQC 3DC5A 3LEIA 4K21A 2C9AA 3AYDA 3H1JH 5C8CC 4N21A 1BMV2 4PA9A 4URAA 2ZBJA 2DV9A 3K3WA 2RDQA 3OYWA 3HVDA 5TISZ 5L3FA 5A3PA 2VZTA 1MZEA 3K03A 1VBD1 1CX1A 2RDSA 1JHNA 5CAZA 1AL0G 4YG3A 3HN1A 2Y0PA 1N33O 5FY9A 4UCRA 3W7TA 1WCSA 5DAWA 4JI7O 2ZMNA 4CXWA 4QGNA 2W46A 3DF0A 4YW7A 4A42A 1S1AA 2IVIB 2BVVA 2Y6KA 4N7IA 1K4DC 3HT2A 1EUUA 5B4XA 5JCOC 1RUE2 4IE4A 4LBQB 4IIJB 3AG3C 1S0GA 3KCCA 1VF7A 4N53B 5CFCA 4D7TA 3PTRB 3IGAC 2ZHMA 3WF2A 2LRPA 3HKDA 4AEDA 2JIZG 1V54B 1W2TA 3H3ZA 1D0HA 3AL6A 1GM8A 3PURA 1XYPA 3VBHC 2ZE6A 5JCOA 3LDDA 3BFRA 3K5OA 1NXD1 1JH5A 3POSA 4ZKIA 4PJYA 4PQ9A 4XDJA 4I01A 2QNKA 4Q4W3 2VBBA 2A6VA 2HVJC 1Q43A 1FNYA 4DR3B 3VHPA 1V9U2 3B9IA 4QXKA 1VF5B 1LESA 1HP8A 5KHJA 1OUSA 1FXKA 3ICXA 2CV6A 3WG4A 2DVFA 5FZIA 1LR5A 3PJSK 2IXLA 2GN3A 5F3GA 1EP0A 3J7LA 4UCTA 1OKQA 1H2MA 4GXLA 2WLJA 1HX6A 1PX3A 3P6BA 3B09A 2CTWA 3RYPA 2BWAA 3AVRA 4MTXA 1UU4A 2VMCA 2Q7HA 4NE9A 4IQPA 1LODA 4NRQA 4JTCB 1FAYA 4ATFA 5LY1A 1VLNA 4E27A 5FY5A 1ND3C 2HJDA 4EJRA 1R73A 1J58A 1UL9A 3FBMA 4Q4Y2 2XVLA 4ZU5A 4QJFB 1VBA2 2JDKA 2ZKNA 4EN6B 3NAPA 1YFXA 4Y5TA 4YSFA 2C1FA 4M4RA 3BY6A 5KX5A 3DV8A 2QTOA 3X2QC 5KAFZ 1PIV1 4AGGA 4P30A 1PD3A 3J8F2 4BR6A 1VRH2 3FHIB 2SLIA 5K4LA 1YFYA 3MPPG 4QGMA 2SBAA 4NIHA 4LF9O 4CH6A 4OCTA 2QQUA 4JI3B 4MV2A 4ZI7B 5FYSA 4JTOA 2XHBA 5JJJB 1S0IA 3PIGA 4LR3A 3CP1A 4IV3C 3MW2A 3LEMA 3AG3B 2RR11 2PF4E 2HVKC 3AX4A 1JVMA 1DK1A 5CFDC 5T5PA 4XFBA 1SQXH 4LJHA 4W6YA 1U5YA 1HNXO 2HYKA 2QQVA 3FLTA 5EZYB 2XGXA 3VZLA 1KQRA 4LEJA 2P6JA 3U37A 1DU3D 4MSVA 3HKBB 3WB2A 1IS5A 1FMD1 3ASOB 1TMF1 4TLFA 2JIGA 2DFCA 2Q1ZB 3B2EE 4YXWG 3N9OA 3RYHB 1GWLA 4U7NA 4K0KO 2ET7A 2JXAA 4BB3A 5JR2A 4E4DX 1AR62 1PMIA 4H37A 3P5BA 4JI4O 4MGZE 4W4ZA 1VMHA 1G9BA 1OA3A 1FFXA 3CO2A 3W7SA 1S72V 1JA8A 4D94A 1ND2C 1MQTB 2CUGA 1V6JA 1NVPB 5FNVA 4JGYB 3ACIA 4R9AA 3OBTA 4YY3O 5BY5A 1ZZ6A 2JGDA 3KD4A 1GOFA 3ITQA 4F6RA 4O9EA 5DDJ3 4DV2B 3QBQA 2X7RB 5CYYA 1GV9A 5KX5B 2HBTA 4GX0A 4YJ3A 1AR61 3SJAC 2W5FA 4PA6A 4I0BA 4LBJA 4LFAO 1RUI3 1E5IA 2R9AA 2WQ4A 1KJLA 1W8ZA 4HN0A 1M4UA 4ZXEA 3SCFA 2G38A 1Y3TA 5KLVH 1BEV1 2OT5A 5CIRA 1TMF2 3SYCA 4O4JA 4O2BB 1CX4A 2ZE7A 4EFEA 1L7QA 2KKWA 3OEHG 2Z0AA 2XTAA 1M9NA 5B2GB 1IPSA 3NJZA 2JDMA 2KG7B 2OA2A 4G2KA 1AR83 2P34A 3VN4A 2EICA 2WSUA 3WG3A 3IPVB 2C26A 3T08A 4CE8A 4J41A 4O7XA 4FXGB 3S7IA 3VKMA 2WWUA 1E5SA 1CJDA 4JKKA 1XPWA 3QACA 2WNOA 1S2BA 1IQAA 5CKNA 3I5DA 5EK0A 1F23A 1BXHA 4MTGA 4DR7O 3C7GA 4P5HA 3AZYA 2W1SA 1PO11 2ETNA 1JFFA 3VBUB 3MUZ1 3NR7A 3OBZA 1GH6A 4YHHB 2B9VA 1NA1B 5T5OA 1ZZBA 1SHWB 4B7KA 2YFUA 1O9HA 1LUVA 5LW9A 2EIEA 4JQRA 3CCQV 2EIJB 1BQPA 5D5QA 1BHGA 1YIJV 2XJSA 3MIHA 2Q9LA 4JASA 3MD0A 4OI1A 5FPXA 3W9AA 4PD4F 3J8F3 2V4VA 3LB9A 3PNAA 3W20A 2CAUA 4J1XA 3CSXA 4JRAA 1Z5VA 1SACA 3KV4A 5KR7A 2VW2A 3K48A 3LPFA 3CZUA 3LDEA 1ENQA 3BI3A 4BXSV 5C4WA 3H8UA 3WNKA 3AKTA 1JW6A 5HXVA 2E75B 2WWWA 5T55A 4B3TB 1F35A 2Y4TA 2JE9A 2YC2A 2RG4A 3UM7A 4P9WA 4OI0A 5IUQA 2WNVB 5C9AA 2DBNA 2QWRB 4IEWA 5J2UB 1VAKA 2MHFA 3BN6A 1AP5A 4ZOLB 1K8AW 4DR3O 2RMU2 3ZMZA 2UXBO 1MZ5A 1DQ1A 1ZTEA 3RVYA 2FKXA 2VTFA 2R72A 1PGW1 1ZX3A 3ZHSA 4AQSA 1ZX5A 2Y26A 5J2TA 4UYBA 4DRXB 1P49A 2BUKA 5IAVA 3PVNA 2I2SA 3UYJA 3TN91 1IXMA 2Y6FA 4LO8A 1C8M1 1LGNA 3WLUA 1NR7A 5LHHA 1C5HA 1SBFA 1Y4WA 2LJ2A 5FMBA 4X1KA 4R4XA 4MZUA 1NQDA 5H9RA 3ASIA 1JYXA 5C3PA 1QCEA 1W9WA 4MXWB 4CBCA 2WNUA 2QQWA 5ANNA 3AFGA 3VBFA 2VCAA 2VH9A 1S0VA 1N1YA 1GYKA 2VVEA 5DZGA 1ODMA 4MVTA 5HFLA 5CA6A 3UJOA 5D2AA 5DAVA 1JU3A 5DN6G 2P06A 4FPKA 5IK7A 1I1EA 2XL7A 4OX9O 2E5LB 2DVAA 4A3ZA 2PLV1 2KA3A 3PLQA 1E1RG 2QE7G 1SPPB 5JWPA 2B39A 5F1RA 3VBOC 4XF1A 1EY2A 1SA0A 4MVZA 2VD7A 3S5QA 5FPOA 1VPHA 2BPA2 1OQDA 3WP4A 1WA6X 2X5IC 2XHNA 1Q8SA 4F6RB 2DWEC 1VBD2 5FOBB 1EYBA 1KS4A 4NXNO 1VP6A 2XAGA 1EZJA 4XUTA 4BXFA 1J3RA 2AEZA 5IY5C 1MS9A 1ND3A 1HQWA 1H2SB 5IK5A 2TUNA 2R70A 5L3DA 5JIUA 4IE0A 4W8JA 3BOPA 1BMV1 1G9FA 2V1DA 3POJA 5L3GA 1QJY3 1MEC1 4JI7B 3VZJA 1QIQA 4COVA 2JECA 3O65A 2ZCWA 4YY3B 1YXWA 3WQBA 2BYVE 2KG7A 2W52A 4KHPB 5GZCA 4PIYA 1V00A 1DYPA 1Z7S1 2GN7A 4JAAA 1VRH3 3OPTA 1Z7S3 2TBVA 2YUEA 1RSOA 3OTFA 4O61A 1KD7A 4YLZA 3ACLA 4JV4A 2UYBA 5JH7A 1W03A 4YW5A 2JGDB 4Y1ZA 3OAAG 1UKRA 2CAZC 2CE4A 2LO1A 4X1KB 1W0KG 3OEBA 4XJUA 1QQCA 5H5NA 4WFAV 1JYCA 3LE0A 1Y7BA 2XB6C 4OLLA 4YPJA 4FTBA 3B3QE 5GTHZ 1D4M1 3UJQA 2RS33 1OQ1A 3KKYA 4P9OA 2YIBD 2FL4A 3V64A 3JQWA 4Z07A 1TNRA 4FTSA 4TN7A 3RS6A 1GZTA 2A6WA 5KWRA 4AHYA 3AJYA 1DYOA 2Z5WA 3TGUH 2WAMA 3ATGA 4FTEA 4L11A 2QKCA 1YVWA 5FZGA 3HQRA 4K6BA 2JB4A 1J5EB 2OYQA 2VL4A 4YJ2B 2GP3A 4LFBO 4JI0B 3OGRA 1V6NA 3O1TA 4Z2WA 1UMHA 1ENRA 3STLC 4P9GA 2RQ6A 2DWRA 2BDRA 3ES4A 3WB1A 3OEAA 4JYBA 3T2QA 2ZNJA 3ZIWA 4GULA 2VMEA 5FP7A 1H9PA 4DR2O 2ZHKA 1A32A 1TA8A 2A0LA 3KMHA 4BQWA 4AWDA 2P67A 1ZBA3 1D7PM 5A6YA 4FFGA 2JDHA 3WP3A 4CXXA 4PJ0Z 3CU7A 2DWDC 4L0PA 5G05L 5B1AC 3ZFEA 4COZA 3ZFFC 4DQAA 4DEQA 4DV0O 4JGSA 3PN1A 3ZFGC 3OUJA 5D1IA 3WVJA 3UL2A 4MGIE 2GMEA 1W28A 2ITCC 2OCCB 2BNMA 1JZ6A 1JOBA 1RTVA 2WUHA 2V5YA 5KA6A 2RJ2A 3E97A 3JASB 5I91A 1HB2A 3VBFB 3T30A 4XABA 3DTUB 3RSJA 2BERA 3EXUA 3HNYM 3N9PA 2AZ0A 2ZXQA 1IDSA 5FPRA 2XMLA 2YIAA 1H2KA 3D3QA 2OT7A 1W6PB 3RI9A 4A7KA 5AVPA 1LOFA 2YBSA 1RUNA 3TXQA 1SDDB 2UWBA 3IJ4A 1JZ5A 1QDOA 2WLPA 4JYCA 2JKXA 4JX0A 2LQTA 2UXNA 1OH4A 3O0VA 4CDWA 4MYEA 4QQPA 5JXIA 5J96B 1N47A 1OLQA 4CRQA 4ZBMA 4FOVA 4QU2A 1HJFA 2F4LA 1O91A 5CEHA 3O7OA 3AYAA 1Q6UA 4PBPA 3AK0A 4B1MA 2QQPA 4H44B 4E8CA 4XAAA 3UGFA 5JDBA 2EULA 4D7YA 2FD8A 4NIDA 2J1TA 3S7EA 4I4TA 2ARXA 5FY0A 4K0KB 3OSDA 5LYJA 1AUYA 1US2A 1K5SA 2Z2SB 1OHFA 3F5WC 1FAFA 5BR8B 2BU9A 3IB3A 5FYUA 3FHAA 4EZ4A 2WDBA 3MUY1 4Y33A 4P08A 4UXAA 1HDKA 4ZZ8A 1XL6A 1BVVA 4CDUB 5L3EA 3RWRD 5A3MA 5JXGA 2J1RA 1PO22 2WZR3 4F4LA 5L7OC 1AL23 4A6OA 1ZBA1 2EIGA 2IM9A 1MSDA 1FYUA 1QQP3 5F9TA 4CXYA 3WNLA 2HP8A 2VUJA 5LA9A 2OZ6A 2A70A 2N74A 1DGWX 4S2DA 2PUSA 2ZKOA 1JYVA 1G6UA 4NYKA 3APBA 3QG5A 1WCDJ 1UXZA 1BEV3 5I93A 1NCRA 4U7OA 2YBPA 1J3PA 4I2OA 4MTOA 3K46A 4QX1A 1XI1A 3JASA 2R041 3WUCA 1H8VA 5GLVA 2PHDA 4GCZA 3O14A 2CDYA 3IAQA 3RZMA 3LA3A 2Q0OC 2VO5A 3L75H 4ZXKA 3ZDSA 1RUJ2 1P7GA 1DF0A 5IFPA 4QT6A 5JMOA 2AENA 3KWVA 3G67A 4BW5A 1VQ5V 3N4MA 1QU7A 4FLXA 1QOOA 3A0NA 4IGOA 1RP3B 2HWF1 3K4AA 3T0DA 2QWQB 2RJLA 5H9QA 4MG2A 4LOTA 1HN0A 4CDWB 4I50A 3CJIB 3HBKA 1DGWA 2BP6A 4IUGA 2K9PA 3E6BA 5LATA 3ZFGB 5A7SA 2ORXA 1F9KA 3ZCCA 3BALA 1UPSA 4JZGA 1C28A 4IEUA 4XMAA 4NXNB 4WFBV 1UQXA 2P5OA 1G9CA 2WFPA 4DXZA 4MX3A 3LQCA 1OOPB 1KGYA 4YHHO 3FL7A 1W0JG 3CC2V 2WZR2 1XBLA 5CVRA 2RS32 5IE9A 4B3RO 3L2HA 3SDLA 3DXUA 3SCHA 4R8CA 1EV11 4SLIA 3JCUZ 4Y24A 3ZHUA 2VMHA 1AXYA 4AI3A 3C7HA 3K57A 4QNHB 2WS92 4AEMA 1W8WA 4DW0A 5KC5A 5GONB 3JD4A 2QQNA 4I55B 1YO8A 4R7CA 3JBG1 4K8RB 4PQQA 3NL1A 2Y48A 1MPXA 2K0GA 5BZBA 1W9FA 3TEWA 4TV8B 4DR1O 2XL9A 3AK1A 5BUVA 1O4ZA 1W6OA 4UF0A 1FV3A 1HXS1 2VNVA 1J1LA 4YGCA 2XAHA 2X29A 4WBBA 3ABMC 2OX0A 3UT0A 1W6PA 1RUC2 5FZ3A 3ZN5A 4CCKA 3F7YC 4NHKA 1OCZC 4B3TO 1Q90D 4LULA 1UMZA 2PHXA 4N7UA 2B46X 4QDQA 1K5JA 1NE6A 1WPBA 2C9KA 2A06H 4LF6B 1GK9A 3O1VA 3M3OA 5FZHA 4BW9A 3U4SA 3RQ0A 4YNIA 1R1A1 2CTRA 1RUI1 1W6QA 5A7NA 3B93A 2WYSA 1Y67A 2YY1A 1W6MB 1CAVB 2WYFA 3VBOB 1YQ6A 3K3NA 1G9AA 1SERA 2A6ZA 4I50B 4FFHA 1GP6A 2ZXWB 4YIOA 1B6QA 2E63A 1NZ6A 3I2OA 4TV9B 1IKPA 5F5AA 2E53A 1K5MC 4Q0PA 1S5LZ 2ZIMA 4Z2AA 2ZGSA 2ZPXA 4ZONA 1IS4A 4K20A 4MOAA 3KG2A 1OVPA 2Y6GA 3ZR6A 1IBLB 2WLIB 1Y9GA 2DUOA 1S76D 4CUCA 2QTWB 3CMAV 3VQXA 4QQOA 2MW2B 4QPYA 4DB5A 4BH9A 4A2UA 4GA9A 4DV3O 4Q4W1 4QPGA 2VM9A 2A3QA 4L8QA 4K3UA 5FKCA 3ABKC 2WRAA 1HRI1 1XU2A 5L3BA 4JGYC 4Y5SA 1OV9A 1H8TA 1QOTA 2HWE3 4AAPA 3W58A 3WNPA