4KL1A

Hcn4 cnbd in complex with cgmp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic dinucleotides bind the C-linker of HCN4 to control channel cAMP responsiveness.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 60
structure length 192
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4kl1A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kl1A02
3E6DA 4HSJA 4HZFA 1UW8A 4XF9A 1YFUA 2F4PA 3E6CC 4XF0A 1SFNA 3H50A 2B8MA 1YHFA 4IEWA 4IEUA 4UBGA 2D40A 2QJVA 4IEYA 2BEOA 3IDBB 1WLTA 4QGNA 1O5UA 4HN0A 1YFWA 3D0JA 2VQAA 5JSRA 3GBFA 1TQ5A 4HVOA 4KWKA 4AVCA 1CAVA 1GQGA 1ZRDA 2IXLA 3HT2A 5LEJA 2OYZA 2K9ZA 4XFHA 4LA2A 1NE6A 3OGJA 4E2SA 3ST7A 1RTVA 3RDIA 3H1MA 5I0TA 2GU9A 3FWEA 4KWLA 2PAEA 1QWRA 3DN7A 1IPKA 2D5FA 1CGPA 4IERA 4YNIA 3RYKA 4ONUA 4MZUA 3SHRA 1CAVB 4QMAA 3R6SA 1J59A 3RPQA 4KU7A 3DL3A 5E16A 4E2QA 2CGPA 2FQPA 4L11A 2BNNA 4QX5A 4Q0VA 2QNKA 1Q43A 1OMIA 2PA7A 3CO2A 4XETA 3TNPB 1Q3EA 3IDCB 3RNSA 3I54A 3KCCA 1SQ4A 3NVCA 4R52A 3UKTA 1Q5OA 4EWAA 1RGSA 1YWKA 4X6QB 4EWEA 4R8HA 3I59B 3IBMA 4HBNA 2CAVA 5J48A 2UYAA 1OD5A 4EWDA 2VECA 4B29A 4Q0SA 5CU1A 3NW4A 3WW2A 4Z07A 4LULA 1NXMA 2XKPA 4IESA 3S7IA 3NSTA 1JUHA 1H1IA 3N4MA 3IIAA 3BALA 4LUKA 4I2OA 3E5XA 4P9GA 1XRUA 1YFYA 5EFUA 5I8SA 3D82A 4MGYE 4WBBA 4YYOA 5LRSA 1RC6A 1WGPA 3DV8A 3RYRA 2WFPA 3ZDSA 1PM7A 2QCSB 5KHHA 3FE5A 3ELNA 1VJ2A 3L2HA 3KGZA 2ET7A 3BPZA 2PFWA 1LR5A 1CAWB 4BIFA 1YFXA 4LEJA 4HN1A 3H7JA 2D5HA 1NYWA 4MX3A 1FI2A 2MNGA 2N7GA 1UCXA 1L3JA 3HIFA 3OD0A 4L2NA 4QM9A 4KWJA 1OI6A 2H6CA 3CL1A 5C6CA 4LLOA 4IEVA 4BYYA 4I01A 3LA7A 4HSLA 2P17A 5J7MA 3LOIA 4ORFA 3U10A 3E5UA 3OCPA 1LB2A 2CAUA 3ETQA 4LA3A 5JR7B 1CAWA 3EQEA 2IXJA 3MDPA 1CAUB 1DZTA 4NVPA 3NJZA 3E5QA 3H7YA 3SCFA 1GQHA 2OZ6A 1U12A 4IEXA 2IC1A 2Q0AA 3U11A 4KL1A 2XLFA 1G6NA 1UIKA 3I7DA 4J1WA 3LZZA 4JTOA 1LKNA 2B9UA 2ET1A 1H1MA 4F7ZA 3B02A 3CEWA 5I8YA 4Q0QA 2O8QA 1CAUA 4FAGA 3S0MA 2BGCA 4XFBA 5BUVA 3OTFA 4HVQA 1ZREA 4JV4A 2XHKA 4I09A 3TNQA 3FFQA 3SCHA 4KU8A 3MZHA 3M3IA 5I0UA 1Y3TA 1EYBA 5LEKA 2O1QA 2Q4SA 1QY4A 4FBFA 2XKOA 4QGLA 4AQ6A 2IXHA 1XE7A 4UBHA 3UKVA 4F8AA 5I0SA 4AVAA 3I59A 4ZU4A 4XF3A 2IXCA 4XFIA 4AXOA 2EAAA 2ZKLA 4FAHA 1ZZ7A 1I5ZA 2PQQA 2ZCWA 3BU7A 3SMHA 2Q1ZB 3BCWA 3GYDA 5KHIA 4IEPA 4JVAA 1O3QA 1YUDA 2GAUA 3BB6A 4I02A 3CLPA 3FHIB 3PVBB 5C8WA 1O7FA 4LTAA 1O5LA 1FXZA 3KGLA 4A2UA 2WC2A 5J3UA 2OA2A 4I3PA 3SXWA 2PYTA 3H1YA 1O3SA 1NZCA 1OFNA 2ATFA 4UXAA 4HMZA 1X82A 5FDBA 3EHKA 5FPZA 2ETEA 3LA3A 3ROUA 4D7TA 2HKXA 5T3NA 4PJYA 5D1IA 1J1LA 4WVZA 4XFGA 4RD7A 2PHDA 2D93A 1J3PA 3WW1A 3IWZA 4EROA 3SCGA 1ZZ6A 3LWCA 2GC1A 3DKWA 1X8EA 4Q0UA 3FX3A 3H1WA 4J1XA 1CAXB 1X7NA 5I93A 4FT8A 1VP6A 4OFGA 5FQ0A 4QM8A 3D0SA 4MGKE 3CF6E 5FLHA 5JAXA 3USSA 2KXLA 1ZNPA 3PLQA 4QXKA 5JCTA 1WA4A 4YSFA 3KMHA 2MPFA 3QOPA 2V09A 2GC2A 4Q29A 2Z2SB 3LAGA 4X6RB 4PIYA 4XF4A 4XEZA 1I6XA 1DZRA 3OF1A 4XFAA 4ZU5A 2BNOA 2BNMA 1YLLA 3RZZA 1ZVFA 5FLIA 5KHGA 2IXKA 1CAXA 1X8MA 4Q0PA 3S7EA 5KBFA 5K8SA 2UYBA 2BYVE 3G7DA 3JZVA 1UIJA 3E97A 2XL7A 3CJXA 3PNAA 3LA2A 1ZRFA 1CX4A 2FMYA 1J3RA 2UY9A 2XGXA 2K0GA 4MGZE 2I45A 2XLGA 3H3ZA 5JSPA 4BHPA 5KHKA 4D7SA 4JTNA 4IETA 2PHLA 2H0VA 3O14A 4XF1A 1RUOA 4I0AA 2Q30A 4HVRA 3NKTA 1Y9QA 1ZRCA 4H7LA 3UKNA 4ZU7A 4O9GA 3KSCA 2GZWA 4CYDA 4I0BA 2XLAA 3MPBA 4O9EA 1O3TA 3H3UA 1EY2A 4META 4XFFA 1UD1A 5E1RA 3FJSA 4AQ2A 3ES1A 1EP0A 4EV0A 1QXJA 2UY8A 3FZ3A 3EBRA 4OLLA 5BXXA 2DCTA 1ZX5A 1QXRA 3WW4A 1O4TA 4Z82A 4AVBA 2C0ZA 4MV2A 2PAKA 3H9AA 1EPZA 4E2GA 5F1RA 2IXIA 1RUNA 5FLJA 4MUVA 5CVRA 1UPIA 4QGMA 3VHRA 2QVSB 1O3RA 3HT1A 4BH9A 3H8UA 5KHJA 2E9QA 2CV6A 2MHFA 4PIXA 2GC3A 1V70A 5AVPA 5FCCA 2EA7A 3RYPA 5BPXA 4IEQA 5I8TA 1LRHA 5I0RA 4GULA 1HW5A 5EZWA 4TLFA 3U0ZA 2GC0A 4MGIE 2OZJA 2GH2A 5I91A 3C3VA 3MYXA 4XFCA 4PIZA 2OPKA 2QDRA 4MH0E 1VR3A 3M70A 4K8FA 2Z69A 2PTMA 1SEFA 1DGWA 1J58A 3E6BA 1RL3A 2B5HA 3QACA 1ZRRA 1IPJA 4YARA 5BV6A 4N9HA 4N9IA 2EVXA 2HJIA 1ZZ9A 5CADA 3ES4A 1FT9A 3EO6A 1PMIA 2VPVA 4IEZA 3EJKA 4WZCA 1DGRA 5FQ0B 4YRDA 3WW3A 4DINB 3HQXA 1ZZ8A 4IEOA 3NL1A 1J3QA 2Y0OA 1ZZBA 2PAMA 1NE4A 1ZZCA 2XL9A 5LRRA 5FPXA 1XE8A 5BY5A 3ACLA 5HI0A 2H6BA 4LUMA 4HLTA 5JSOA
chains in the Genus database with same CATH superfamily
1SDDB 2F4PA 1QQP1 4ZZ5A 1PL4A 3E8GA 1BHAA 1K7DA 2ZMNA 1UZWA 1W8FA 2QWNB 2XJPA 1XNTA 5CFDC 3VKFC 1EAH3 5JIAA 3WX5A 3KVBA 1ZBA1 2VQAA 3SYAA 3R4DB 3IDAA 4CC5A 1WCQA 2JXAA 2JICA 5L3DA 1GQGA 2C9AA 1K73W 5CYYA 3OMIB 4WM7B 1GLHA 3WCRA 1H2GA 2JVDA 4IE4A 5DUVA 3GGLA 4E4DX 5A6YA 2VQEO 5JQGA 4LF6O 3OTOB 1DBNA 4QPGA 4W8JA 2CGPA 2A6ZA 3OGVA 3EFFK 2WAMA 5FZ6A 1GZ9A 4FOYA 3TNPB 1AR61 5EBLC 5IW0A 3J7LA 4D3WA 4YIOA 4R6ZA 5HV4A 3I59B 1AXZA 2X0LA 4LF9B 1E5IA 2B42B 3E1F1 2HEWF 1VBB1 3OTOO 3MFAA 4EEQA 2XHNA 4DR1B 2EINC 4UYBA 2EX3A 1QJU1 5G05L 2ZA9A 3ZJZA 1UXXX 1S0CA 4GX2A 3H8RA 3RVZA 1W9WA 1PGW2 1UX6A 3K3OA 1M1KW 3ZX6A 2D5HA 3LCPA 1W6PA 4NXNB 4FPKA 1H8VA 5GTIZ 4L2NA 5C6CA 4BYYA 2ZKOA 2XAFA 3OCPA 4BQ1A 1W8HA 1H2LA 5BMVA 3ACGA 4KG8A 4CH6A 1CAWA 2IXJA 4P14A 3AG4C 4XACA 4W50A 4W4LA 4DR2O 2KR2A 1FFXA 4D0QA 1XDCA 2JG8A 1MQTC 4QPIB 1FPN3 1PHMA 4N7IA 2KKWA 3VKNA 1FPOA 3U11A 2HLDG 1GP6A 2QTWB 5L3EA 3Q8FA 5CN0A 3CJIC 2WPDG 3HBKA 2W1QA 1YITV 2EZOA 1FKAO 1W0NA 1HN0A 2VD7A 4ZKTB 3SCHA 3OPWA 1IS3A 1MQTB 1N1SA 4JHZA 4JGZB 5KUKA 5A3OA 3KWVA 3GCXA 1RUI2 4BIUA 3KHCA 1B6QA 3HKBA 2PF4E 1XU2A 4YM2A 1EV12 2V5DA 3VZNA 2VWJA 1SHWB 3FAVA 4KGQA 1COWG 4A44A 1GM7A 2ZCWA 2DVAA 3NKGA 1GUIA 3F5WC 2E31A 2FDFA 2WAOA 2BOJA 3AM2A 2ZZJA 3HN1A 1XNBA 2UWAA 3ETDA 4QU2A 2WA4A 1RITA 2OX0A 1KD7A 5FZLA 4E4ZA 2AREA 2JJ6A 3C7HA 3SCGA 4R9BA 2VZVA 1UMZA 4J42A 3WD5A 3CCSV 4ABMA 5LMUB 5FPAA 5ITZB 4PQQA 5IYBO 2YIAA 3ITQA 3KMHA 1A78A 4YM0A 2UU9O 1R082 4DV4O 3LAGA 3CCVV 4M3CB 1H4GA 1DZRA 3OF1A 3QO8A 4F3JA 1LNQA 4DR7O 4RGAA 3J8F3 3VD4A 4UB8Z 1Y74B 3K4ZA 2VMIA 2WO2A 3PNAA 4ZS2A 1K97A 2CGOA 1J3RA 1HNZO 2BW8A 1LHNA 4PF5A 3KS7A 1LECA 3R4SA 4H7MA 4WM8A 5D8AA 1KUQA 3Q8CA 1VQKV 1CPMA 1JN2P 4B4PA 5LBFA 4FTBA 1Z7S2 3UKNA 1GOGA 4CSWA 1AL23 2WT1A 2HEYF 1QJFA 2BGOA 3V0AA 1U0AA 3THCA 4JYAO 4OMCA 4O9EA 1Y67A 1GBGA 5C4WB 3A0KA 1IXMA 2F1MA 4U2AA 3PJSK 2WLMA 2UY8A 1AXKA 3EBRA 1P49A 2NLJC 1Y9MA 2TBVA 1JXNA 4N23A 3M3QA 5DUXA 2PGGA 4CCOA 3CWBH 3RZJA 4Q20A 3OD4A 1LOFA 2EA7A 3A21A 3MD0A 3E22B 4DEVA 4MG2A 3U0ZA 2OZJA 2GH2A 3ML0A 3MYXA 4PIZA 2XBO2 1TME1 2QDRA 4J7JA 2NM1A 3B00A 4DQAA 2XHBA 1VF7A 3DXUA 4FQ4A 3QACA 1VEWA 4OQ8A 4JTAB 5IAVA 2Y6FA 2R1DA 2EVXA 3WP3A 4RQPA 4WZCA 5BNPC 3SPCA 5ITZA 1BSMA 3VKMA 5CA3A 2PAMA 4XC9A 1IBKO 5IE9A 3ZCCA 4B4RA 4G4FA 1Y6XA 1W6OB 1K45A 4S2GA 5H9QA 3OEEG 3ZFGC 3E6CC 1UOJA 4MSVA 4CXWA 4XQWA 4XDJA 2FCUA 3T08A 4CP0A 2XT9A 2RHPA 2QM4A 4QPJA 5FY8A 1QJU2 3RYHB 2BEOA 5FMOS 2VE1A 5C9AC 2AACA 3D0JA 5A32A 1Q82W 2DCKA 5BNNC 2WYFA 3V0BA 5D8AB 4QHBA 1NE6A 2UXDO 4NKGB 4OI0A 5B3SB 4YIPA 4UCSA 2JE9A 3SR2C 3ZRVA 3V0BB 1SA0B 2CL2A 2DUPA 1D7PM 1LOEA 4W4ZA 1AVBA 3JYCA 2GTAA 2M6YA 2PA7A 2EIKB 1UMHA 3IDCB 4N53C 2YY1A 2Y6HA 1Q5OA 3IN9A 1RGSA 4PT6A 1R092 2XQXA 1XHXA 2CAVA 5J48A 2W3JA 4O4HA 5F3IA 3ZHTA 1ASJ1 2KB1A 3N4MA 3JQWA 4LBJA 4NTYA 4CEYC 1ONAA 2LALA 1FOD2 2ENRA 4LO6B 4XCAA 2Q7HA 2ARAA 4B8EA 3ELNA 5IY5C 1RINA 1R64A 3POWA 2EILB 4A45A 1RJ7A 4JI0O 2JS5A 1G9CA 3THPA 1W2OA 1XPWA 2F6BA 4HSLA 3LSQA 4ZHNA 2VH9A 3U10A 1LOBA 2CAUA 2W52A 2WL1A 1NCRB 4CS2A 1MMMA 4DR6B 5GLVA 1K12A 3TEXA 5HXVA 5ABJA 4B3SB 1GRJA 3K48A 2EAKA 4CDXB 4DV0B 3R66A 4C1WA 1VQ8V 1G6NA 1VBC3 1HRI3 4JI2O 2CU5A 3B02A 4RGGA 4OZOA 4PDWC 4EYUA 2J1SA 4M3CF 2DFBA 4FZ1A 3KHBA 2D3PA 5IVFA 4PBOA 2EIJB 4AI3A 3GF6A 4AAPA 1BCXA 1PNGA 4JGYC 4AR2A 5GZCA 3AFKA 4AQ6A 4Y20A 3O1UA 4CS4A 1DGSA 1RUG3 2XWJB 1Z78A 2GAUA 1Z7S1 1I7FA 1D5AA 2JS3A 1KRIA 2R071 3W9AA 3LFIA 5J3UA 4HL0A 2VULA 3G71V 4MGQA 1AR1B 1BL8A 1CIYA 4XBQA 3H42B 5AVAA 3OW2U 4UCRA 3ZMUA 1W8ZA 3AZVA 3LA3A 4ITCA 1N1VA 2DBIA 3WHTA 4JDMA 4XJ9A 4IL6Z 2J1AA 3I2GA 1U5XA 1J3PA 3NV3A 1N3OA 3OGSA 4YFWA 3BGAA 4Q4Y3 2GC1A 4JPRA 3IAQA 4CUGA 1FAFA 2WN3A 4AEDC 1F5FA 1KJRA 1VP6A 4OFGA 4AFAA 4H33A 4Q27A 5ANQA 5GJ6A 4P9JA 2V4AA 3CCUV 2WYSA 5FZOB 1Q6IA 3PMSA 3VZJA 4LKSA 1WPBA 3P1IA 3RZZA 4JTDB 4X1IB 1VQPV 4YVSC 2YXLA 1O91A 4CDWB 3CCQV 1X8MA 2PQSA 2ZZQA 2JB4A 2BYVE 3GWKC 4QGPA 4GYCB 1NXD1 1UXZA 2E53A 3U1XA 1SLAA 4A41A 2K0GA 2XLGA 4FO9A 3T3YA 3O1VA 5LWBA 4AGRA 2WRAA 5LHGA 1RUOA 4K8XA 4CDWA 4H7LA 2ZX4A 4AFBA 1DF5A 1OZ0A 1OF4A 4CBCA 4GQ7A 1FS0G 3TWIA 1O4YA 5K1PA 5FJKA 2RMU1 4MGSA 5FZ8A 2P3KA 3ASIA 1HIXA 1HQLA 1WLCA 4CDUB 5IY5B 2OUJA 2KG7A 2QTOA 4LNVA 1G9BA 5FXXA 1UY3A 4EQVA 5IJRA 3S3XA 1P4RA 1VQOV 5FBZA 2MHFA 1V70A 3RYPA 3VZKA 5EJ3A 1URFA 1XI1A 3WZ1A 3H1KH 4D8MA 2CDOA 1OF3A 2Y48A 1RUF1 4DEQA 4NTWA 3SISA 1TEIA 1WA6X 1ZRRA 4NIIA 1R6NA 3LEKA 4YW1A 2CHHA 1K5QA 3K4DA 4BPZA 2HWC3 2RV9A 3VDBA 4PDWB 1ZZCA 3I2KA 1BHGA 3K3NA 5BY5A 4EB6B 1NI8A 3QO7A 1WMFA 3WNLA 1J95A 5F2WA 2K9PA 2ARXA 3L75H 2X6CA 4FVVA 5JVVA 2FCTA 5FY0A 2ZJCA 4X1IA 4X66O 1JOJA 4IEUA 4I4TB 1AL21 2O14A 5FP4A 3IPVB 1AI7A 3FLPA 3T4VA 1EV11 1YSCA 1I94B 2BTVC 2WZ8A 2R0FA 4Y1ZA 3E2EA 2X5IA 4R9AA 4TT3G 1OCZC 2LFSA 3KB5A 3M8AA 5D5QA 2D6OX 3ABKC 4CDXC 4DO0A 3JARA 1CGPA 1JYTA 2P22C 4CXYA 3M1HA 1OQEA 4IERA 3E86A 1HLCA 3KQRA 5HCBA 3ETEA 5B5EZ 1OCRB 5LXTA 2XUMA 3I2HA 3FKSG 5LGTA 4TV9A 2DYSB 1JZ2A 1OKQA 4PDVA 2OIGA 3N7KA 2LGQA 3UKMA 4YW2A 3ZYGA 1C5IA 3A7QA 5B4XA 5CB4A 1OD3A 5JOYA 5J96B 1SQ4A 3ZDVA 5FZ7A 1S5LZ 1PGL1 3CRCA 3O1TA 3N2GB 1S77D 1VBD3 2BFUS 1BLZA 4JZRA 4GMP1 3BVOA 1IPSA 5HPOA 3Q4HB 5LW9A 3MW3A 1NXMA 2JDKA 2WNEA 3BALA 4C0BA 5A70A 3W59A 5FZ9A 4YYOA 1QDCA 1GKBA 4Q4Y2 1NLSA 4GCZA 1MVEA 4LBLA 5FFOC 1CZVA 2ET7A 5DEDA 3AKRA 2FHRA 4BIOA 1NYWA 4GALA 1DQ1A 1JJOA 2JWPA 2G9FA 4I4TA 1N47A 4CCCA 3LA7A 4QPYA 2P17A 1M4WA 3K46A 3BHPA 3GCWA 4DO2A 1X50A 2WNVC 2ZOEB 3VBFA 4MW8A 4DV6B 5T54A 1SQVH 3K5LA 5EQUA 3WG1A 4AAXA 5LL6Y 4JV5O 3K9SA 3W7XA 4F7ZA 2X29A 4PDLA 3OBZA 4IE7A 1M57B 3S0MA 4FFHA 4BA6A 5LXTB 2ATKC 1PO11 5IAXA 4CEWA 1WCSA 2VRZA 5K0UA 1W39A 3C2UA 4MW3A 4WFHA 3W58A 1TGOA 2O1QA 3ME2A 4YPJA 3S57A 4GWJA 3DXRB 1NTKH 1GOFA 2ARCA 1PIV1 3ACIA 5FZCA 2ILMA 3MIGA 4LORA 3CDZB 4XMAA 1ZBE1 5LY1A 3BCWA 1XBFA 2Y6GA 1YUDA 5IK8A 3VLBB 2ZM6O 4LWSA 1HRI1 1JYXA 1MS8A 4OYUA 4IV1C 3N3HA 1R3IC 3K57A 2ORXA 5IVVA 1QNYA 3ZN0A 1BEV1 3M3EA 4YVWC 2A3WA 4FOQA 3LPGA 2QQKA 3MIDA 3TAYA 2DTYA 1W9TA 3VQYA 3AKSA 1KEXA 2YUEA 1JOBA 2PMWB 2VBDA 5CFCB 1QH6A 3K58A 4J6GA 4U7NA 2JENA 2JRIA 5CA0A 3T2MA 3WR0A 3WEZA 1OCRC 3F5TA 2GC2A 4X6RB 3CBNA 4XFAA 3MUZ1 4LF6B 1N33B 2FDIA 3RWKX 2ZGLA 5KBFA 3VQXA 1RUI3 4YHHO 3T2OA 4MTOA 3UO2A 5EXOA 1M4UA 2A79B 3GZEA 5EWSA 3ASOC 5K4LA 3FBMA 1VBA3 5FUIA 1I9RA 2HHHO 3GALA 1QJY3 1ZRCA 1WMXA 5GZDA 2GMMA 2HWC1 2VW1A 4HKLA 2XAQA 4XIOA 4G9SB 1JFFA 4XFFA 5H9PA 4GB31 1AB3A 3ZHUA 2J1RA 1VBA1 2BTQB 2A06H 1NAEA 3MW4A 3VBOA 1Y7BA 4F83A 3PN1A 5J2TA 1W6NA 3H9AA 5GONB 4Q4X2 4FTEA 3O0VA 2GBOA 4TTGA 3ZBHA 5CVRA 1RUD3 3HT1A 1OHFA 4BH9A 1BK0A 4CP1A 5FCCA 3UETA 4CDQB 2BWCA 3ZN4A 4O4IA 1JOYA 5L3FA 4P00B 3GBGA 2UU9B 2EINB 5IUQA 1QJEA 2IVJA 1VQ5V 1FXVA 2AR6A 2GNDA 4X8NA 2J1VA 1K4CC 1CIWA 3D36A 4XILA 3QNEA 5FL7G 1SF9A 4QHOA 4DV2O 2XVKA 1KMIZ 5A7SA 1BBT2 3S5QA 2LUWA 3NNJA 4QX3A 3CPWU 2I74A 1LOGA 3RYIA 5HI0A 1OOPA 2H6BA 1SLBA 4J11A 4HLTA 1D4M3 1NVPB 1HNZB 4LOSA 2N74A 2NR5A 2OQ7A 1K92A 4RQFA 1GNYA 4MVOA 3AYAA 1COV3 4IEWA 1S2EA 1SQXH 5IYDO 1GP5A 4NIAA 4A42A 3B9CA 5LBCA 5J1XA 4XUPA 4BB3A 5LCWL 2BWAA 5A3UA 2XTAA 2OYZA 2PHUA 5J09A 4QQPA 4UVAA 1RTVA 4KFMA 5BR8O 1YVWA 1LHUA 3T09A 2JKBA 2W2IA 1HNWO 3IMMA 4XJWA 4OCTA 3HQRA 4MOAA 2A6WA 5LK7B 5DAWA 3CP1A 4QX5A 4P02B 3BIEA 3VBOB 4PCRA 1Q43A 4AI0A 2W47A 4Y33A 4YW4A 3ZXGA 4UFHA 4QXHA 2DVBA 5FMCA 3E89A 4RS5B 5EBWC 3J8F2 3CEIA 2YU1A 4BWOA 2DTWA 4NJ4A 4AEKA 2HWF2 1RIRA 3ZRWB 3ZR6A 4LFCB 4BQXA 1LEMA 3UGFA 2WFPA 4XDPA 2VO5A 2Q8OA 1ORQC 1QVGU 5T55A 4RGKA 4IYHA 5JJNB 2ZKNA 2WSUA 2OW4A 3AL5A 3D4KA 2V7QG 2RMKB 4JI5B 3WT3A 2R043 4QM9A 1OI6A 4LLOA 2YICA 3LEMA 1HV0A 3E83A 1F23A 3CCRV 2UXNA 4K3AA 1AYN2 1W6QB 3H7YA 4AL9A 1GQHA 1W6MA 1RHI2 1OHHG 3MV11 4P9PA 1G6UA 2GUZA 4XE9A 5LATA 3FHAA 1AILA 1W9YA 2ZGTA 1AR4A 5FKCA 1W9FA 5JVDB 4PD4F 3MIHA 3OTFA 1HX6A 2A1XA 2QDOA 1FMD2 1QU0A 2JG8B 1PO13 4BAYA 1SPPA 2GMEA 2FTKA 1OKOA 4GX5A 1GNHA 4MHUA 4DUZB 4GLXA 1BYHA 5LEKA 3VL8A 4DW1A 4QGLA 1BE3H 1XE7A 2GSYA 1LOFC 3I3MA 4GX0A 1SCSA 3FN9A 1ZA7A 4HPKA 4XFIA 4V2VA 3HEIA 2ZKLA 3TBDA 3SJQC 1EN6A 2YZ4A 4XQ4A 4ZONA 3UGGA 3IAPA 3AVSA 3PVBB 5H5NA 2JDZA 1FXZA 3GJBA 1R1BA 1SCRA 3H8OA 4YLZA 4CC6A 2E51A 3K9AA 2QKDA 2Q1FA 5DPNA 3VZOA 4GB32 3E22A 3SJCC 4D6RA 5F8PA 4YJ3A 3T1LA 4IV3B 4AE2A 2HKXA 1VF6A 3AX4A 2QEXV 1URXA 2EIKC 4K7JA 2D43A 1ZSPA 4J7KA 5J2UB 4LH7A 4LHKA 4QB6A 1VBC2 3A2FA 3OUSA 1RUF3 2K2SA 2JEXA 3ZFFB 5FQ0A 3UESA 4H13B 5G04L 4OI2A 1ZNPA 5BNNA 2HEVF 3EMRA 3POEA 4LITA 3WSOA 5JXHA 4H44B 2JD4A 1DF4A 4LC1A 1I6XA 4LHLA 1RMU3 1RUE3 2LW1A 3ZVXA 1I0HA 1O4ZA 4YY3B 2IXKA 3G7DA 3HMYA 3CKHA 2ZDIA 1UIJA 3LA2A 2EIGA 2P3JA 2VMDA 1ZRFA 1BBT1 1FAYA 2IJHA 3BA9A 1YHQV 3WQ7A 4X8AA 5KHKA 2PYLA 4FM2A 2UURA 1VB4A 4QQ2A 1WB8A 3I56V 3EXUA 4YHHB 3X29B 2YG0A 1Z5WA 4C7UA 2OQ6A 4WM7A 1XXNA 1FYUA 1MS0A 1S1AA 4O9GA 2NN4A 4LHNA 1EPWA 3H3LA 1O3TA 4DR7B 4ATFA 2G1MA 4KHPB 1F31A 1TAEA 1BVP1 4EV0A 2E33A 1AI6A 2IW5A 1I08A 4CPBD 3ENRA 1R3JC 2OCHA 3CU7A 5JXGA 4UUJC 4X20B 1NH2B 4D6QA 5F1RA 1SC5B 4I9WA 2W1UA 4ASMB 3AG3C 4JAAA 4QJFB 2E9QA 2CV6A 4GULA 2R30A 2EIEA 3IZOA 1NZ6A 2ZNJA 2CTWA 4XJUA 4COZA 5FREA 4CEYB 4DV1B 1D4VB 4WCEV 1VQ7V 1NBMG 5JOZA 2CAZC 3CCLV 3ZSKA 1YI9A 2DQ3A 2WWUA 2VPVA 3RZGA 3CXHF 4W4KA 4IEOA 3QF7A 1KQRA 3KV9A 1PO12 3E35A 5EPAA 2DWEC 4ES8A 2IJIA 4CZSA 1JYVA 4QX0A 5J98B 2B5UA 1BZKA 1EUTA 5EYXA 5B1BB 3KKYA 2LROA 4FPPA 4PDWA 4FXGB 2B1IA 3ZXEA 1RUC3 1VQLV 2E32A 3GBFA 3J26N 2J42A 3AG4B 1W0KG 1TUBA 2VZ3A 1NT2B 1Q81W 3OGJA 3THDA 5IFTA 2EICA 3ZN6B 1YJWV 5JZGA 3N27A 3H1MA 5JJEB 2ZABA 5GKAC 5DAQA 1D2DA 4JGYA 3GBWA 1M9NA 1MZFA 5C9AB 3NMBA 4CXXA 4LF9O 4QMAA 3R6SA 3RPQA 1AYN1 3J9SA 4XIKA 3ZN6A 2OTJV 3CNAA 1OMIA 3I3QA 4YWAA 4LP8A 5B3SC 2YPJA 2ADQB 1EN5A 1KP3A 4R52A 2N05A 1NTMH 2NPIA 1FJGO 1F35A 4JDOA 3IBMA 1OCOC 5KC5A 1DCSA 4QKDA 1U97A 2QE3A 3WW2A 3DTUB 4LULA 4L87A 3NSTA 3OUHA 2A0LA 2L35A 4WFFA 3E5XA 2QA4V 2JEMA 3I2IA 2VOKA 4RQPB 2YROA 5C8CA 2ADPA 4XMIA 4CDUC 1ZWIC 2ZD9A 5B66Z 1LHVA 4NR1A 3W7TA 4O65A 1PX3A 2P4EA 4LK6A 3AZYA 2ZGPA 3D3QA 4DPNA 1F8VA 4P9IA 3LEGA 3UM7A 3PURA 1G9FA 2VZQA 3LOBA 4K0KO 4GX1A 1LGCA 3SKVA 2YBPA 3E5UA 3AEIA 1ULOA 2BOBC 2NQYA 3KCXA 1CAUB 3CD6V 3D3AA 3WB0A 2YIBA 3A0HZ 5B1AC 4E2LA 2Y26A 3E5QA 2P37A 2WWWA 2OZ6A 2ZHMA 2RN9A 1TUBB 1VQMV 1ULGA 1K42A 3I5DA 2NMOA 2UUCO 4MTFA 2PLV2 4J1WA 1QQP3 4NHMA 4B3RB 1CWPA 4XJZA 5I8YA 1JJ2U 1VBE2 4K20A 1HRV1 3SPGA 2E75B 3KV6A 4U3JB 1SQBH 4FLWA 1Y3TA 1QLEC 1D2SA 2XH6A 1N0NA 4PDRA 4GWMA 1QJU3 3OSDA 2D44A 2QBXA 5C4WC 4LIUA 3BCCH 5JI9A 3Q9OA 4RUEA 2WFF3 1G1XB 2Q1ZB 2RS31 4JVAA 5CIRA 1AR93 1X9TA 1PO22 4LQRA 1H8TB 3RS6A 2J22A 5A3TA 1VMFA 1AROP 4FSJA 4F6RB 2DU0A 3VD9A 4GZRB 1APNA 2JJ1G 4A3ZA 2ATFA 1PX4A 4UXAA 2C24A 2DW4A 4V2WA 5DM6V 2RS13 4YZ4A 2EIBA 5IVEA 2P3YA 5AC92 4P9LA 3FD9A 3GZTB 2BJSA 5FMDA 2VW2A 5CBGA 1Y9GA 1QJY1 1XU1A 5L9BA 1ENXA 1BCCH 3TK1A 5CAZA 3H1LH 4Y1VA 3VBUA 5EIYB 2RCVA 3FLRA 1BQPA 4HNAB 4OULA 4JRAA 1YLLA 4B3MO 1GZWB 4QKBA 1IXBA 5FLIA 4Y5TA 3SDLA 1KS5A 4UWDA 1EAH1 1MVQA 3J7AU 1ULCA 1NQJA 2ZMLA 2OUHA 3I49A 5GLTA 3GHNA 3VKLA 1WCUA 2AZ5A 3ZSEA 5EYPB 1XMQO 4FVMA 5AG2A 3OBAA 3M7AA 1YNAA 1IOAA 4AEMA 2WAAA 3CJIB 5KX5A 1JVMA 2RQ6A 3O1PA 3U37A 3B01A 1XJAA 4CE8A 3EHBB 3J7MA 1KGYA 4YG0A 2ZR2A 3IFXA 3H1JH 4XUOA 4AQ2A 1OA4A 3HJRA 1BVVA 2ZMKA 5HCHA 3FZ3A 4R9DA 1AP6A 2W08A 5FZHA 1IKPA 2DCTA 2Y38A 1ZX5A 3HKCB 1QXRA 4B3RO 3CRAA 1W2UA 2WO1A 3CC7V 4AVBA 3K0GA 4YG3A 3USUB 5A1FA 1DGRN 3A8TA 2FDKA 3DC5A 4MUVA 1VRH2 1QJX3 3P5BA 4X1YB 3ZXDA 1UFIA 5FPVA 1MABG 1BQZA 3ABMB 2OPKA 1VR3A 3DYMA 4BWAA 4JI4B 1PZ8A 1SFPA 1GMMA 4CVUA 3VHNA 5IYYA 2F43G 4XBFA 4JC1A 3OT7A 4RQEA 2GNMA 1PMIA 2BPA2 4UCVA 1OV9A 4QXCA 1ZX3A 2WNVA 3MIBA 1ENQA 3VBFC 4EN0A 3IJ4A 4LFAO 4HNAA 3WG7B 2AC1A 4OZXA 1VIWB 1PNMA 2EIJC 1H38A 5IJ0B 3ABKB 2ZCEA 1NCQC 4IEYA 4M00A 1WLTA 5CKQA 4AQTA 2X6BA 3CHXA 3RYIB 2ODMA 1DG6A 2UU8A 1UQXA 1IBKB 4KWKA 3SC7X 5FNVB 2HR3A 3R4UA 4CEWC 1QNMA 3C3SA 5ACA1 1L0NH 5CFCC 5IVJA 4Q26A 4CPBA 2HFEC 5EIBC 2HWD1 5I0TA 5E6HA 4GJZA 5H9CA 2OKXA 4L8JA 4DR5O 1UZVA 1LGBA 1XC6A 3C7OA 5JH7B 5F6KA 2NNUA 2Q8VA 2WZR3 2YC0A 4LF8O 4CEWB 2A5ZA 2YHJA 2VOVA 4HT1T 1VE0A 5AFEA 1HR0B 1UYYA 4NIHA 1RUD2 2YB7A 3NVCA 2BRTA 4DV1O 1Q8IA 1IBLO 2QQVA 4R8HA 5KWRA 1K5MB 1HXS2 1WLEA 3B93A 1BXHA 3CMGA 2BZDA 2IJJA 1NZIA 5LB6A 2R1BA 2VOXA 3IIAA 4W6YA 2DQ0A 4RHV3 1COV2 2RDSA 4FQZA 4K6BA 2CH7A 2VZ1A 4CP2A 3LGRA 3G6BA 1XREA 2XBO3 1GO3F 1OLME 5M0TA 1NA1C 2WNUA 3SPIA 4WFAV 1UU4A 2WSVA 4LEJA 1VMJA 1WNSA 3OD0A 1DU3D 3TRSB 4FI9A 1VARA 5C3OA 5L9VA 3A0BZ 1LB2A 5FO9B 1GN3A 1ZTEA 3ZXJA 3MDSA 2ZTNA 1SQGA 5L36A 3SCFA 4U3JA 3IKWA 2WLJA 1OUXA 2W92A 3MF9A 2E7QA 4JTOA 1I5PA 4DZGA 3J81N 4DR6O 4CUBA 3LIHA 1NJIW 3AZXA 3ZYPA 4QDSA 3NNLA 3OBRA 3TNQA 1J1TA 3HKEB 4XDOA 4DXTA 3NNMA 1ND2C 2QM7A 1EAH2 4CU7A 2HYXA 2XPJA 5HXMA 3LNMB 5FV3A 4AVAA 4O4LB 3DXTA 4FFFA 5GW7A 1I5ZA 1SLIA 3FB8C 1HNWB 2VY0A 2R0HA 2SBAA 5FZIA 1GU3A 4TV8A 5FWEA 2FCVA 3CLPA 1O7FA 3D36C 2Y33A 3WNNA 2UUAO 1KXGA 2NYYA 5L3CA 1K3EA 3NO8A 1NZCA 1ULFA 3NJXA 4O4IB 2JKXA 2IH3C 2CYFA 1ENRA 1S2KA 2W1SA 2QFEA 2TEPA 5KR7A 1DK1A 2RR13 1VF5B 5D1IA 5FK7A 3ZHVA 3WNXA 2FD8A 1VRH1 3TJTA 1WP7A 1ENSA 1LHOA 4CU6A 2JG9B 1JUIA 4Z1MG 2ZXWC 4QXKA 3ZX7A 2ZE8A 2QWPB 2VCCA 4EB6A 2WS93 1W2NA 1H9PA 4XJAA 1JODA 5BNOC 1G8WA 2HH9A 5CFDB 2R7EB 3JSLA 4JYCA 3C7GA 4N43B 1HWYA 3TB0A 4AW7A 3OYWA 4ARXA 1C8NA 1B3QA 4Q5OA 1FX5A 1J5EB 3RW0A 5LGUA 2AXTZ 2Q30A 3AP5A 4BW9A 2R063 4PF1A 1OLQA 1O9HA 3ZPOA 3H3UA 4META 4KMQA 1LU1A 4Z1VA 4DK1A 1EP0A 2VTXJ 1V0AA 5ACA2 4DV2B 4CCNA 1CZTA 4IIJA 1Y76A 4KWUA 2XXZA 1F4MA 2WLLA 3MO4A 4AILC 5H6QA 3E8BA 4ZKIA 5EZYB 2DJVA 1MS5A 1E57A 1E5HA 1UZYA 1W3VA 4E4SA 1K5MC 2JGDB 4UFZA 1JZ5A 1W6NB 1Y76B 2RS11 4QX2A 4WFEA 3DGTA 5KA6A 1IBLB 3LIGA 4HKOA 2DYCA 2HWB3 1WB7A 2VQUA 4CDQA 5LASA 5EP9A 2A75A 5CADA 3Q8AA 2XOMA 4B3MB 1QH7A 4DR3O 4RSUA 2WWJA 5F39A 5F7UA 2LW7A 2ZPXA 3BYWA 4HZFA 1UW8A 2YXSA 3AMNA 2XVLA 1EZVH 3RYFA 1FV3A 1WA8A 3ZN5A 3FMGA 1YQ2A 3IDBB 1CPYA 4Z2WA 4AFMA 4N21A 1XNQB 1TNRA 1ND3A 4GIQA 1FFXB 1HRV3 2K9ZA 5IYCO 2D3OW 4KG0A 4LA2A 5FMOL 3K3WA 4P30A 3PDQA 2ARHA 1SDWA 1QHDA 3K2OA 3TEZA 2MEV1 1CJDA 1RPRA 5FYSA 2RDQA 2WZR2 2GDFA 4X64O 5K0UB 1KYOF 5AC91 3WP4A 3C8XA 1WBFA 3JD4A 3CO2A 4XETA 4LJHA 1ODMA 1Q3EA 3OOXA 4XUNA 1R73A 3ZHRA 4KUMA 3RT3C 3DXRA 3JALB 4FCAA 1Q90D 2RM23 5C3RA 4JHTA 2RM22 1DYPA 5GTHZ 1FNZA 2JGDA 3NW4A 1DTOA 4I0XB 2Q8CA 4DV3B 5C7GA 5ISLA 4K8ZA 4Q4W2 3ZDSA 5IHRA 4RS5C 2FL4A 5KHHA 3WG3A 3VBRA 3KGZA 4OQ9A 4X1KA 1JYIA 4DV6O 3GB7C 5LHIA 3HVDA 3H7JA 3SLIA 1Q6UA 3LD8A 1JQ0A 4LFCO 1PPJH 4EE2A 2P67A 3CS5A 3ZN1A 3ZO0B 2VUJA 1XQ8A 2JG9C 2F17A 4Q2FA 1RM1B 3J80N 3NJZA 2E7AA 5B1NA 4AQSA 5A7NA 1GR3A 4WM7C 1SZBA 2DE0X 4QD2A 1QOOA 3CIHA 3IMNA 3Q8BA 4XZUG 3LE0A 5LP6C 1H1MA 4N43C 3DCQA 4HK8A 4FAGA 3ASOB 4YW3A 3RZKA 1R083 4O2BA 2R49A 4Y3OA 1ZREA 2W0FC 3KF3A 3M3IA 2F4VB 5B1BC 3D6EA 1SERA 2WQ8A 5JLVA 2W87A 3WDWA 3WDYA 5JVDA 5BYNA 1AXYA 2DMXA 4M01A 1SBEA 4UBHA 4EZHA 1JZ7A 4ARYA 2IXCA 1KFXL 4RR3C 5JCOC 1AL0G 1PZ7A 2PQQA 4N8MA 3SMHA 5L7OB 3GYDA 1EV13 3UYJA 2LFRA 4FFBB 1F15A 2Q1MA 2PXJA 2VCMA 4K8RB 4OGQB 3CJHA 4AI8A 4DW0A 1MEC1 2PYTA 2PI5A 1JBCA 2WR9A 1JU4A 4Q8KA 1GZTA 2B46X 4LF4B 2UXXA 2PY5A 3A4UA 3RYCA 1UMIA 1MS3A 1I1EA 2ZQMA 3WF1A 1W6PB 1O8SA 2UUBO 1TMF3 1ZZ6A 4DRRA 1OLMA 1HJFA 3LDCA 5CFDA 5L9RA 3RN4A 4YJ3B 2KXLA 3RZLA 4PELA 5BMVB 1W6OA 2RS12 2XR4A 4PIYA 3RI8A 1G7YA 5FXWA 3KV5A 2JDAA 5LY2A 5FYCA 1YI2V 3ACFA 2HLEA 5A7OA 5E89A 2UYBA 1AX0A 1PO23 2AZ2A 1GN6A 5LHHA 1N33O 3CSXA 1AF9A 3PL0A 4BJ0A 1HXS1 4LBOA 4FPCA 4O2BB 4Q4V2 4I0AA 5SV5A 1MR5A 3K59A 2WO3A 4ZU7A 1Q6HA 4COVA 3AG1B 4PLOA 4BE3A 2Z4FA 1O9GA 2BVBA 1WZXA 3VD5A 2D2CB 2V5YA 2JDMA 3MPBA 2X53S 4URAA 2RG4A 1KBHA 4YJ2B 1OURA 1VPHA 4HPKB 5EZYA 5CBFA 1O4TA 3TGUH 4W6WA 5A7PA 3CZUA 2AH2A 1S0FA 3WP6A 4QDQA 3CZJA 4Z8BA 4PI2A 5F3EA 3AMMA 2QVSB 4B7KA 4CP9B 4CH4A 2MEV2 5C8CC 1WD3A 5JXJA 4PA7A 3W21A 4OX9O 5I0RA 5FYIA 4DOUA 5DUWA 4DNYA 1X59A 1N1TA 3AK0A 4UW3A 5E79Z 3K4AA 5BXZA 2W5FA 3UT0A 1OXCA 1OOPB 1A34A 3E6BA 1AR71 3FLTA 5FZGA 2C5DA 4XTPA 4N9IA 3ABUA 4UV9A 5FZFA 3HQXA 4DINB 4NOTA 1M93A 3R65A 4QAWA 4I3GA 3LKJA 3T2TA 4JAUA 5AFBA 5JSOA 3LSSA 3E6DA 4XXPA 2JG8C 2O57A 2WLHA 2ZE7A 1H30A 3I55V 3BOPA 1B06A 1Y74A 3DSQA 4X89A 4PA6A 3NAPC 4NN0A 2KQXA 4YW5A 4M0HA 4Y1UA 5JSRA 4JZ2A 4J25A 2BU9A 1MPXA 2RE9A 3UGHA 3GZAA 1CAVA 3GHMA 5A3NA 5LEJA 4URTA 1W8NA 1OPOA 4KWLA 3OUFA 3LF7A 3ETGA 3A0RA 2LS6A 2B9ZA 3ZS8C 1AYM1 3VBSA 3SQOA 3MICA 4KU7A 2WLQA 2QTSA 3B94A 5BZBA 1RUF2 1DLCA 1H2MA 2MK3A 4CRQA 4K1ZA 4JQTA 3KCCA 3HKBB 3U75A 3H8XA 2BP6A 3SKJE 3VBSB 3VDDC 2IJKA 1NOVA 1G86A 5CKMA 3ZEDA 2P2KA 3LDRA 2ZGNA 4HBNA 4LCUC 4QT6A 4FPGA 3BUCA 1GSLA 3VD3A 5FY4A 2WIIB 1DQ0A 1Q8VA 3S7IA 3PUHA 2UUBB 1PNLA 3N9OA 2ZGKA 2VNVA 5J9PC 2UXCB 1GKFA 3D82A 5LRSA 4DY5A 2VQFB 4M3CE 2OVUA 4XAEA 1Q56A 4TUYB 2ZHLA 3PVNA 4GJYA 1IHMA 3VBUC 1HDKA 5A33A 1CAWB 4N7UA 3ZIWA 2Z3YA 1GANA 2EULA 2N7GA 1PVC3 1NLQA 4EKWA 1MEC2 4TSFG 4L97A 5FPRA 1KU9A 2Y6JA 3ILRA 1S72V 2IUWA 2BBAA 2JDPA 4UAPA 1J5EO 2XVGA 2EILC 4WM8C 5D8AC 1DF0A 1DZTA 4NVPA 5EK0A 5DDJ2 3ICXA 4IEXA 3VV1A 2AUYA 2VVDA 3T2QA 3ZRSA 5JWPA 1I5YA 4ZI7A 1AJPA 1SLCA 5BNQA 3AG2C 5F9TA 4ATEA 3SEEA 4GKXA 1PV0A 1SKVA 4CU9A 5KX5B 2ZGOA 4QIWF 5FYBA 3AB0A 3WF0A 1N32B 1VBD2 2V4VA 4ZOLB 1E5RA 2AHZA 4YZ1A 4FBFA 3U14A 5FOJB 1CZSA 1IS5A 1W9SA 4DS0A 2DCZA 4XF3A 1S5JA 1KDKA 1RMU1 4AXOA 2WQ4A 3HKCA 4QHZA 3VGIA 3BU7A 4AVSA 2EF6A 2YGMA 4Q4W3 1AYM3 1QJX2 3RVYA 3WQ1A 4I3PA 2YS8A 4U7OA 3ZMVA 3T4ZA 5BNPA 2HWB1 1ZBA2 5C8CB 4BQ4A 1ZUQA 4D6SA 3POBA 2ZAHA 1QF3A 5FP7A 2X8KA 2QZ3A 4XABA 4F6RA 3IT8A 3DKWA 1X8EA 1YIPA 2WA3A 4Q0UA 1CAXB 4AHXA 2PHFA 5DN2A 5IK7A 1NTZH 3VUOA 3UNPA 4QM8A 3WINE 3HPLC 1KD1W 1VQNV 2Q8DA 1E1RG 1NCRA 4LBQB 2V09A 4TYSA 2BNOA 1QOTA 5CFCA 1GICA 1NG0A 1R1A3 3OE7G 2ZAAA 5IJ0A 1H1AA 1UYPA 4LO4B 3POSA 3BTYA 1YF2A 3JU9A 3ZSLA 2D6PA 2VBBA 1Q7YW 3H3ZA 4JGSA 2WNOA 5FZ1A 4AG4A 3DF0A 3MHSC 1GOHA 5IJ9A 2X5IB 5DZEA 1BMV2 1E79G 4Y22B 1POV1 3VQVA 1XNDA 3WLUA 2BDRA 4FMTA 4DV7O 4DRXA 5FOBB 1RYYA 4N53A 1WPXA 1Y66A 2ZR3A 2ID4A 3POGA 5L3BA 4J7ZA 4BK4A 5FY1A 4Y22A 1YQ5A 4XHBA 5JUVA 4NAMA 3HBZA 2WFF1 4JYAB 2C0ZA 4CS3A 3HR9A 5K1XA 3OJBA 4CEYA 4OUSA 3IGAC 1DIWA 1UF2C 2PLV3 4MADA 1RHI3 5KHJA 5JPNB 3GXUA 3BN6A 5BPXA 4IDZA 2W68A 2UWCA 2GC0A 4NHLA 4E4HA 4TN7A 1V6KA 3VQWA 1XOYA 3T1HO 1N3PA 1DGWA 3HNYM 1VQ9V 1GQPA 2XWBB 4P9XA 1MG1A 2HJIA 1UZ0A 4AQYO 4LF7B 4IEZA 3EJKA 3WQBA 5F3CA 2VQTA 3O12A 1J3QA 3MEPA 1XNQO 3RFRA 2A3QA 1BT8A 3AXEA 1H8HG 4HSJA 3HAGA 4BZ4A 1ULEA 3M7MX 5ABJC 1KQSU 4UBGA 1DGWX 2D40A 1GWMA 2QGNA 3MLLA 4JGYB 1GTOA 5TSWA 4BLIA 3RBZA 1US6A 1TQ5A 2GH8A 2QM8A 3W7UA 4JI7B 1VBA2 3WG7C 3HT2A 4DR3B 2FMDA 3VDAA 3QH6A 4NRQA 2V73A 4E2SA 1UZZA 3ST7A 2DN9A 3IPVA 1KKDA 1YQ6A 3JASA 2Q7GA 4MVZA 3MLKA 4Y26A 1R1A1 3WCSA 5GZGA 2H0BA 4DV4B 1PZ9A 3DL3A 5E16A 5FZ3A 2RS53 4DUWA 2ZXQA 1PL0A 1SG3A 1HB3A 2QNKA 2CDYA 2ZX3A 1R3LC 4Y1XA 4QNHB 2P06A 4C1XA 4ICGA 2GP3A 4YW6A 2LM3A 2A9HA 4AHYA 2VTXA 3NV2A 4TV9B 3ZYFA 3GDBA 2UYAA 3MV01 3U07A 4R4ZA 4Z92B 3T1MA 1R081 1WWYA 1LU2A 5CU1A 3LDBA 3TN93 5A33B 1H1IA 3WUCA 1M56B 2VMEA 3SH4A 2Q67A 2PHTA 2G38A 2JJ2G 1D4M2 1HR0O 2CTPA 2B1GA 3VN4A 3JAKB 4PJ0Z 3BPZA 3FUOA 2PFWA 2ZBJA 3STZC 1B35A 4OHWA 1AR82 2W39A 3ZMNA 2C4XA 4DV0O 2W94A 4AOCA 2UXCO 2Y60A 2H6CA 4BIZA 2FMLA 1UAIA 4Y4YA 3DEMA 4O4JB 3J7NA 2HWB2 3LOIA 4M0NA 3L73H 1PMJX 1F51A 1IDSA 5JR7B 2WO7A 3UK9A 2F23A 3RQ0A 4DB5A 1CP9A 3CB2A 2CUGA 1KC8W 4LHSA 3Q8EA 4YVSB 3OGIB 4O4JA 4NXMB 4JI1B 4ZOLA 4QDRA 3I7DA 2PUSA 5FPOA 3APOA 3I3BA 5CBHA 2JIZG 3CEWA 4OPHA 2LQTA 4JI5O 2RR12 2BGCA 2WABA 4XFBA 5KLVH 5ACA3 4P08A 4PBPA 1C8M2 2YXHA 5D5PA 5IYZA 1X36A 3PUIA 5LA0A 2A3YA 3N9PA 1AR72 1V6IA 1OSGA 1XSRA 1LESA 2HG5C 3S3WA 2JIGA 3LEIA 1W2BU 4YZ5A 2ZX0A 4HYOA 2B9VA 1PMHX 5IK5A 5IYZB 1K5MA 1ZZ7A 2HJFC 1BMV1 2VQEB 2UWBA 3A23A 4RAIA 4GKJO 4CA9A 4TOIA 3HKDA 3OR7C 1SETA 4IHJA 1P8JA 2OA2A 2ADEA 4LKEA 3HWJA 3CRQA 1ULPA 3KG2A 3ZXKA 4MTGA 1UOGA 2ZM6B 2GP5A 3T1YB 3UL2A 1KJLA 2NN8A 5FPUA 3M4FA 1OA2A 4A7ZA 2VZPA 3LB9A 4XFGA 5LA6B 4RD7A 2PHDA 5KUMA 4X62O 1DQ5A 3SH3A 5DAPA 4EROA 4X9QA 2EIDA 3U78A 4L9BA 1RVF3 3OUIA 1AR62 3S6PA 1PNFA 4J9YB 1AP5A 1FV2A 3H1HH 4I9QA 3AP7A 4R7CA 3CF6E 5FZKA 4YVWB 2YYOA 5CISA 1JU3A 5FXZA 4YSFA 2MPFA 1FYJA 4Q29A 1WCKA 1C28A 3VBFB 4XEZA 3FB7C 5CZKA 1A3KA 1VBB2 1L7LA 1QJZA 3RSJA 3K5MA 1RUJ2 4Q0PA 5TISZ 4XHXA 4CDXA 1H0BA 3CJXA 4IGQA 4LFAB 5F32A 1CX4A 3UV9A 1JMUB 4BOWA 2UY9A 3ZFEC 1MA1A 5FLXN 4QPWA 3WU2Z 2QQUA 4IGOA 4DUXA 3HKEA 3JAMN 4EN9B 1H6XA 2R16A 1UN1A 4UI9L 5EV7A 4NHXA 4TZDA 4XTMA 3W7WA 1VQ4V 3LFMA 4NROA 4UVCA 4QQHA 2HP8A 1ASJ3 4Y20B 4OLLA 5HCFA 4JI4O 3SGIA 1PD3A 1UU6A 3ZHQA 4R9CA 4A6OA 4MV2A 2PAKA 4MGTA 2VAUA 1XUQA 1NT0A 4ZHQA 2Q69A 1ZBA3 3HKDB 1OCCB 2XJVA 2ITCC 4FLUA 4GWNA 5L3GA 1FXKA 1Q8PA 4RS5A 2W6JG 1RPOA 1YI7A 3ZR5A 2VVEA 3WF2A 3CQOA 2Q73A 2DU1A 1IZ3A 3MLJA 2VXJA 2CWSA 2KSDA 2PTMA 3N36A 3POFA 1W0JG 1X9PA 1W8UA 4BMBA 3KZ4C 4QPKA 1RL3A 2XAJA 5GZFA 2QQWA 4D69A 2R9RB 1U96A 1ZZ9A 1GM9A 3VL9A 2Y69B 5CNAA 5GLUA 4JKLA 4QWNA 5L7OC 1CVNA 4B3NA 3M99B 1WJZA 3NRUA 3PU8A 3D5OA 4CCJA 4XF0A 5DZFA 5A80A 3DYPA 1VBD1 2B8MA 2P6JA 5CMUA 4MXVA 2B39A 2Y4UA 3G6EV 2WSSG 4EZ4A 5C33A 5LP6A 4NIGA 1HXS3 1GNZA 2CY6A 2XUEA 4P5YA 4CCDA 3GZUC 1XBLA 5K0UC 4DYLA 1ZRDA 2VXRA 5LP6B 2R072 1ROPA 2HBUA 2I2SA 2D5FA 3C90A 3OGRA 1XYOA 2N04A 4Q4V3 3UT5B 3H0OA 1Y43B 4LMFA 2QWRB 4LBQD 1W2AX 3VBHA 4JQRA 4RR3A 3INAA 1WD4A 1X33A 4Y5SA 1TME3 3BODA 4FXKB 3V56A 3PVEA 2D7FA 4LF4O 3BY6A 2R9AA 1FFTB 3ZOIA 3R0RA 1ND2B 5LZ6A 1TMF1 3RNSA 5JPMB 4Q1PA 1LOCA 1GP4A 3NV1A 1SESA 4NE9A 4UV8A 4EWAA 5FWJA 1JYCA 4A7YA 3WF3A 3UJQA 1C8M1 1OD5A 4BXFA 3WFVA 4BCUA 5J36A 1C5HA 1MNGA 3PUSA 5JXIA 2E5LO 4LWSB 4MS2A 3POYA 4Z07A 3WDUA 2VC9A 1W2TA 4X66B 1T2XA 5EFUA 3PTRB 4HZ3A 4RO2A 1QR9A 4ZIBA 3WDVA 1QGLA 4JYBA 3LQCA 5F6LB 2VGDA 3B69A 4TWTA 5KMGA 1YJNV 1S0GA 5FZMA 2XJQA 4LO8A 2VMCA 1FI2A 3TXSA 4H3WA 1L3JA 5LBEA 4INDA 1JZ4A 2X7RB 1K9MW 5H9SA 1JW6A 1S4CA 5J7MA 5KXCA 2W6IG 4AK3A 3KLSA 1IBMO 1FD9A 2XBO1 2DVGA 3SYCA 5DN6G 2RDCA 1GV9A 2WFF2 4K9SA 4X65O 2IC1A 3IDEA 5CEHA 2Q0AA 2A7AA 3MFCA 3TN91 1QCEA 3TEYA 1CAUA 1L7QA 4NHYA 4YY3O 5BUVA 1MZ5A 2IZWA 4GMP3 4JI1O 3VBOC 2XDVA 3KF5A 1FATA 4AF9A 4FOVA 1EYBA 3K04A 2Q4SA 1QY4A 2X05A 3AYEA 5L19A 4F8AA 3LDDA 1FNYA 1EBOA 1ZL8A 3RJRA 5T52A 4FAHA 2AGSA 4JI3B 4JDNA 3Q4HA 4CCKA 1FXHA 1R3KC 2J1EA 5LGNA 1EN4A 4GB33 1CQ9A 4A2UA 3ZYBA 1LTEA 3NJYA 4ZPIA 5EBMC 1MSDA 3ASNC 4XOGA 3OEBA 2AEYA 3VBRB 3ZYJB 1OOPC 4I55B 1HQNA 1UX7A 4WVMB 1SBDA 3DPRC 5C3QA 1S76D 4A7KA 4WFGA 2JDYA 1S0DA 4DUVA 3GNEA 4GD4A 5I93A 1DFQA 3T1CA 3ASNB 1FPN1 5C5TA 2ZGUA 1CD3G 1XE0A 3ZYHA 5CKNA 2E63A 1Z2GA 2FB5A 4FLXA 3CC2V 3N9MA 2BNMA 2VS0A 1JR9A 1ZVFA 2QZ2A 3JZVA 4U36A 4RA0A 2XL7A 1RXFA 2FMYA 2I45A 4UB6Z 1PVXA 3RZMA 5EIBD 4JTNA 1LAJA 2H0VA 5FZ0A 2V72A 5T5JA 4XF1A 1K33A 1U5ZA 4LKDA 3RRDA 1PO21 2O8OA 3E8FA 1KECA 1MQTA 3ZIXA 4EFEA 3JXSA 2GZWA 4XDLA 4CYDA 4I0BA 2XLAA 4Q4X3 4TQFA 1XMOO 2VMGA 5LYJA 5LBQA 4PI0A 3H9VA 4LBEC 1UPSA 4GZ9A 4FP2A 4LK7A 3ES1A 4ZS3A 1VBB3 3ZLIA 3CJIA 3FAVB 3UJOA 1ZL8B 4PLNA 4QPGB 4X8PA 3OG2A 3OB8A 2DVDA 5C71A 1PGSA 4BQ5A 2VM9A 1AR81 1C57A 2UXDB 1RUNA 2H8PC 2Q6AA 3VDDB 4OI4A 2WDBA 1OCOB 1W90A 5AVPA 1C4RA 5JMCA 1QJY2 4HXCA 1GN4A 3EXAA 4JCKA 4E8CA 3OM3B 3JSNA 3N2KB 3ZRWA 2WLKA 4WVMA 2D3RA 1MEC3 5IWAO 4CU8A 4GKJB 1IX9A 2ZACA 1XHZA 3CCEV 1XL4A 5BV6A 2WZPP 1I5XA 5C8YB 1W04A 4YM1A 4W6XA 1B09A 4LXLA 1DGRA 3KQ4B 1LCLA 1ZZBA 1YXWA 4GKKB 3ZPYA 3KVAA 4NYKA 1UKGA 5LA2A 1S0BA 2F95B 1UYXA 2CDPA 1YFUA 4D7YA 3VKOA 3H50A 1WW5A 3L9JT 2OCCC 3ECQA 3AYDA 5BR8B 3OFNG 1LENA 1US2A 3AMQA 1YC61 2IBZH 2Y34A 3RDIA 1RSOB 4ASKA 1QWRA 5LA9A 3JB8A 1OJHA 3W5MA 2VZSA 2L6LA 3HNBM 5A3PA 2RS33 3RYKA 2RDNA 3QD6A 1XQNA 3QH7A 1AR91 3OGGA 3SHRA 1VRBA 5KXEA 2WS91 3BEHA 2BNNA 3AKPA 2WLIA 2EJ7A 4XAAA 5J2TB 1LNSA 5JR2A 1K4DC 4P9OA 3B77A 3JUUA 1JYWA 4JI2B 5LA1A 2VZOA 2IWGB 3WNOA 3PUQA 3T0DA 5FZDA 1V6NA 4Q0SA 1VF6C 2R72A 3AK2A 1V54B 2YIBD 2XKPA 2X10A 1S5HC 3RJ2X 2AW9A 4HOOA 3WNMA 1XMOB 3DV8A 1OH3A 2L9LA 2QJ1A 4IE6A 1LUVA 3UQ8A 3JD1A 3L2HA 3AXDA 2DDUA 5IFPA 4FPHA 1V54C 1YFXA 5FYZA 1H4HA 5KXBA 5DG2A 2R9IA 1W6MB 4QQOA 3EYPA 5FZBA 2Q5TA 1WN7A 2IFRA 3CL1A 4WV8A 4RQPC 1HP8A 3ZFFC 5BNNB 1IURA 1XL6A 4S2FA 1E1QG 1VAMA 4AI2A 4E4EA 4LBQA 4KXRA 4OI1A 1GZWA 3UO3A 1HW7A 1T6BX 4COYA 4Y4RA 5FZEA 1UIKA 4AQYB 2R062 3VD7A 4C91A 5CBLA 2ET1A 1V6OA 3PHMA 3I3DA 5JQGB 1XNCA 3LDKA 3TYJA 5C70A 1YIFA 1ZM1A 4OUMA 4WM8B 2Q4PA 4JI6B 4HVQA 3P32A 4JV4A 4D6TH 2XHKA 3P6BA 5ABJB 1YRZA 3JBG1 1RJ8A 1AJQA 4H37A 1HQWA 1AL22 3STLC 4UFLA 5JIUA 4UCUA 1P84F 4LKFA 3DUIA 1N0JA 3I59A 1YO8A 3APBA 1KS4A 2BGPA 4I7ZB 3BKZA 5FO7B 1OT5A 2YMZA 3RMYA 4FLVA 1UU5A 1Y4WA 2B7YA 4I02A 3FHIB 4J10A 5E88A 1RVF2 2DCJA 3SXWA 4LF5B 2VUDA 2OWOA 3C3TA 2EXKA 4UXNA 4I30A 4AFCA 4QX1A 2WUHA 1JS9A 2BFUL 2Z5WA 1JZ8A 4DIQA 1QIQA 2Z42A 2X6AA 2VWKA 4UW5A 4EJRA 1WAZA 4J1XA 5GLZA 1PGL2 2O0OA 2BCCH 5DG1A 4A4AA 5D21A 3AVRA 5K7PA 4KI5M 5JJJB 2UXBB 3USSA 2E26A 2QQPA 4DV5O 2AZ0A 4HG6B 5JZGC 4MVRA 1MSWD 4CCLA 1F4HA 1H9WA 4QPIC 2WQZC 3I2FA 3I4IA 3NNFA 4L8QA 4IGGA 3WNPA 2HWD3 3F7VC 4CUCA 3ATGA 2HYKA 4FOWA 4MHRA 1C8M3 4MVTA 4Y5Z0 4G28B 5FNVA 2MW2B 4AI9A 5LMNO 4HVRA 1QLEB 4YGEA 1SLTA 1JHNA 3HPNA 4LIVA 3G80A 5A6QA 4H55A 1FOD3 4RFT0 5EYPA 1V9U2 2BERA 4FLZA 4OMDA 2DVFA 3JD73 3SH5A 2DYSC 3FJSA 2RVAA 1QXJA 2QQJA 3AC0A 2HWE1 1DGLA 2JDHA 3OPTA 2VMHA 3WW4A 5FYHA 3BTXA 4MVUA 4OHVA 4LF7O 2ZEZA 4XDQA 2H94A 5FLJA 5CG9A 3QVNA 1UPIA 4QGMA 4FFIA 3K75B 3AK3A 3LSUA 3AMHA 3GM8A 3BI3A 1YJKA 5IWAB 5C93A 3FHQA 4CDUA 5BNPB 1LRHA 3P3NA 4CH5A 5I91A 2JDNA 1AI5A 2D6MA 3AYCA 1LODA 4ASUG 4IIJB 2ZHKA 4OHYA 2Z69A 1RHI1 5LOVB 3IAYA 1J58A 4NPRA 4HANA 4K0KB 2B5HA 1IPJA 4RHV2 4D94A 3ZSJA 1RUE1 3TN92 5GZEA 3N9QA 2JIJA 2Y64A 4NAOA 3JATB 1ZZ8A 2GN3A 4OX9B 3ZHSA 1C1FA 1ODNA 3JCUZ 1Z0HA 1YZBA 1FMD1 3ACLA 4FPYA 1HRI2 4UOJA 1SFNA 3RG0A 1XSQA 2RJ2A 1POV3 2WNVB 1BQ0A 5FP8A 3RMXA 4HN0A 3BA8A 3OAAG 3NWKA 1CX1A 2FBEA 1M90W 2BOIA 1PGW1 3U4XA 5FUNA 1V9U3 1POV0 2WT0A 2JK5C 2YFUA 3AL6A 3KT4A 3JD71 4YVSA 3FWEA 2XJUA 1PVC2 2PAEA 4GH4C 2VBPA 4J9ZB 1A8DA 5FO8B 5C4WA 3ON7A 3B7MA 4MYEA 2VOTA 1F9KA 2OPWA 3HOBA 1UPGA 4CDWC 5APAA 4B08A 1OVPA 3USUA 1TE1B 5DMYA 2G9ZA 2GTSA 3IC7A 2VQ0A 1NKGA 2H3OA 4NXMO 5GLWA 2R061 4ISRA 1SQFA 2KM2A 3T4HB 3U4SA 4R50A 2E76B 5K9YA 1SZXA 5DAXA 3ABMC 1XOUA 4AVTA 2VECA 2RJKA 5IVYA 1UOBA 4TV8B 2X09A 3PUAA 2GN7A 3LDEA 5LMUO 3B9IA 1JUHA 2EXHA 4GKYA 3QO5A 2Y6KA 3AG7A 3BIWE 3J4UH 2ZEXA 5DAVA 1KKCA 3MI8A 1P7GA 1YDXA 2VU9A 2VNRA 1Y4MA 3B8NA 1WUVA 4XQDA 1RB8G 4HFSA 3X2QC 2W46A 4OUEA 2ZEYA 4MX3A 2ITDC 2CE4A 1OC1A 1QEXA 4G27B 5FAXA 1RVF1 3EVKA 1VRH3 3BU0A 3HIFA 4LF5O 2UUCB 1GH6A 2ZXWB 4XBNA 3M3OA 3L9DA 1WCDJ 2LTNA 4XVHA 3ETQA 4DUYO 3MIEA 4BK5A 3EQEA 2R6QA 5BNOB 4O2AA 3MDPA 1SS3A 1PK6C 2QWQB 4JI8B 5T5OA 2F4VO 4L99A 4C90A 2LRPA 3ZFEB 4X88A 2B9UA 2BSKA 5B1OA 3ABZA 1TNFA 2EIMC 4Q0QA 2DBNA 3P3PA 2J1TA 2WWSA 2VCBA 3B2EE 2D6LX 4AGVA 2OS2A 1SA0A 5IJ9B 3FB6C 2RM21 4AVVA 2YIDA 2X5IC 1QKQA 3MZHA 2BVVA 5CB7A 1AHSA 1XMQB 1NU1H 4AHWA 2OXBA 1HN1A 4JV5B 1FXKC 3AP9A 4N90A 3O1MA 5EC2C 3B3QE 4CUAA 1XYNA 2GHYA 4K1YA 3IB3A 2VOWA 2XJTA 2KG7B 1HNXB 2QQOA 1OCZB 1O3QA 5A7WA 4E8DA 2WLLB 4LNUB 1GYKA 4ZXEA 4WFBV 2B4KA 5B4NA 3KGLA 1S0IA 1S2BA 2CH7B 4DK0A 1AVMA 1R1ZA 4TQDA 5FXVA 1OFNA 5LK5A 4ISQA 5L7OA 5FDBA 4ASLA 5FPZA 4LLFA 4J80A 3ROUA 2Y0IA 4QKFA 3RWRD 4JRLA 1QQCA 1REDA 4B3TB 2GMPA 3T0BA 2D93A 1S0JA 2HVJC 4NUBA 5A6ZA 1AX1A 1CESA 3WY6A 1IVSA 3T1HB 4JX0A 4B7EA 3WDTA 1W3XA 5FIXA 1JX9A 2I07B 3ZXLA 2Z2SB 1QVFU 1NLRA 5IK4A 2OIIA 2HJDA 3FL7A 2V1DA 5KHGA 2RMU3 4RHV1 4PA9A 3N7MA 1EFRG 1HKDA 3B40A 3MHHC 1DLBA 1Q8SA 3T30A 1V6LA 1EUUA 3VDCA 3BTAA 2YSUB 3O1SA 1QMJA 3VBHC 4GUNA 4BHPA 3P30A 2GNTA 2PHLA 3OUJA 4PLMA 2M7WA 3ILFA 4YZ3A 3AMPA 1W03A 4YZ2A 3W20A 2P4KA 3AP4A 1N36B 3LSEA 1MS4A 1UD1A 3VBHB 2QE7G 4XUQA 1L1FA 4QX8A 4KBBA 5JI7A 4DXZA 2GV9A 4O61A 4BM8A 3O1OA 2A6XA 2VNGA 3ABTA 3AKQA 1DHKB 4B3SO 1H8TA 2ZGQA 3BAAA 3DYOA 4IHJB 1O3RA 2ZE5A 2XJSA 1ZAUA 2XAHA 4YJ2A 1SQPH 4LR4A 4MGIE 3ILNA 3AFGA 3JATA 1SMVA 4RN5A 5F5AA 3M2MA 5L73A 5LA6A 4BQWA 1SFYA 4N9HA 1F2NA 1FT9A 2R073 4J41A 1F4AA 4AEDB 3ABLC 1H6YA 4X1KB 4YVWA 2W9XA 2XL9A 1QDOA 5FPXA 3OPZA 1NUKA 3K06A 4TLGA 2PELA 3VHOA 3T0AA 1VBE3 4GT1A 3CE2A 4NWWA 1OQ1A 1CXZB 3JASB 3JARB 3ABLB 4DR4B 3DECA 4XPVA 4IW3A 4HVOA 2VUCA 5EHDA 4XDKA 1NVPD 3M8LA 3JD2A 3GVMA 4JZGA 1LGNA 1M06G 1MACA 1YYNA 1BBT3 3ZSMA 4QXBA 4NIDA 5KXDA 4BDVB 3DN7A 1IPKA 2IH1C 4NRMA 1WMDA 3CMAV 4YNIA 2P6HA 2Z79A 3VB9A 4MZUA 1GFF2 1CAVB 4YGBA 5F3GA 4A6SA 1PIV3 1BZWA 2FZ1A 1NQDA 4DR4O 1AJNA 3SEPA 2G4IA 2XMLA 5FP3A 4DXWA 3UKTA 1ZA4A 3W5NA 3NJVA 2CWMA 2E7TA 3T1YO 2QR4A 1BGYH 2Z5UA 4BU2A 3DPRA 1GWKA 3HQUA 1G8MA 3LNNA 4P9WA 4Q1RA 1ZLZA 4LUKA 2JEUA 5D2AA 4WBBA 2XAGA 1WGPA 3MAQA 4PHZA 1R6KA 3ACHA 2YI8A 2DURA 4JAVA 2PN5A 2VTFA 1IKQA 1VB2A 4IQPA 1N34O 1VJ2A 3BPSA 3G6JB 5DDJ3 1GZCA 3JCZA 3DPRB 1UYZA 4BIFA 5BNOA 3WVJA 4KNCA 2GDSA 4MVQA 1YTFD 1TZOA 4WVVA 2K1EA 5F2VO 4OHZA 4UW6A 5JOXA 1UY0A 1V9U1 1CONA 4OPAA 2A71A 3ZMZA 1ZRIA 1VMGA 2XJRA 2P3IA 3MUY1 2HWE2 3MBWA 2ORZA 4H0LB 3G4SV 4LBNA 4CCEA 2QUOA 1OCCC 2Q68A 5CA1A 3H01A 1WLDA 2P5OA 2P90A 1G9AA 1ST8A 4YGDA 2YPDA 4U3FH 2VZUA 4I09A 4O4LA 1JA8A 3OEAA 4IGPA 4KU8A 4OVEA 4MT8A 4QU1A 1XNAA 1EZJA 4GWIA 1YJ9V 3KZIZ 5CA1B 4LNUA 5CB4B 2XKOA 5IVBA 2HEPA 1UY2A 1RUE2 2VR4A 2W0XA 1S3JA 4ZU4A 1F7YA 5FYVA 2DWRA 2DYRB 3BFRA 4GKKO 3ZRXA 2ES3A 2HKOA 5GONA 2QWOB 4DXRA 1KDMA 1NKDA 1IGOA 2LO1A 1O5LA 2YGLA 2QKSA 1REEA 2PHXA 1M56C 2RMU2 1XNRO 3N7JA 2CTVA 4YXWG 3ZMTA 1OVSA 4HMZA 1IS6A 5CA0B 4PA4A 1C3HA 3EHKA 4PV1B 4GMP0 3AKTA 2V4DA 2BE3A 2UXBO 2QSAA 4WVZA 5FMBA 4E27A 1CEZA 1V55B 3JD72 2GALA 1PVC1 3L2YA 4KBZA 1SRYA 2Y69C 3F7YC 4OHXA 4JKKA 2D98A 1XNRB 2Y6LA 4G3YC 4FM0A 4ZU5A 1D5NA 4SLIA 1GWLA 1W0OA 3WOGA 1R093 1XNKA 3CC4V 1CAXA 1LULA 1W99A 4YFZA 2SLIA 3RVHA 4BQYA 2VCAA 5EJ1B 3VOUA 2IFWA 1O8PA 5JSPA 1DYOA 2FDJA 4M3CA 3L72H 1RMU2 4GXLA 2P5BA 4COUA 1N3QA 1Y9QA 1SACA 1QJX1 3QLQA 1RSOA 1COV1 4LBKA 2A6YA 2BUKA 4EN6B 1VP7A 4FIPC 1PKXA 2EJRA 1AYN3 2Q0OC 2ZIOA 3SYQA 5BXXA 1VMHA 3AZWA 2E6VA 1N36O 4DRXB 3JD3A 1L7RA 3OMAB 4FP3A 3V0AB 5FPBA 2R042 3WB1A 2PLV1 1SQQH 5HV0A 2FDGA 2P4VA 5FY7A 1VQ6V 1D0HA 2RJZA 4IEQA 4IV1B 5CA6A 3JQXA 1HW5A 4TLFA 2PHWA 2AGAA 3I8TA 1RM1C 4K8FA 4I55A 1SEFA 1W0PA 4IE0A 4YARA 2JE8A 3O0WA 5FZ4A 1QU7A 3ES4A 3HD8B 3N35A 1KB9F 4FLYA 3ZFFA 4YRDA 1THZA 2EXIA 2C2AA 2JDIG 1IBMB 2JG9A 1S55A 1YCIA 5CG8A 4C0HA 1AUYA 2WLPA 2D97A 5IDJA 4LUMA 4XF9A 2YC4A 1G4YB 2DFCA 1BHBA 1A32A 1ND3B 3PJQA 4ZZ8A 4QX7A 1NH2D 4ZXKA 2IM9A 4FZ0A 3G67A 4Q4Y1 4N43A 1UOFA 2TNFA 4RL7A 4FM1A 1YFWA 2A70A 4TXWA 3UT5A 3I97A 2CNAA 4Z2AA 2LGWA 3FYEB 4JKMA 1MZ6A 1BKZA 4BMEA 2ETNA 4UW4A 3ETPA 3JB4C 1D2QA 5GALA 2ZDIC 5A6XA 1QBZA 4C8DA 4ONUA 4DFSA 1PM9A 4H2AA 5JCOA 5EC1C 3K51A 1J59A 3THOA 1SPPB 2P34A 3PJYA 3S5AA 2W91A 1BS3A 4Q0VA 3KCYA 4B1MA 1T5EA 1GMGA 2Q7EA 4JGZA 5FY9A 4KH9A 1PNKA 4I0XA 1VAVA 1VLNA 2CTRA 2WBKA 4LT5A 4XXAA 4CP9A 4UCOA 3WNKA 4X6QB 4W65A 3CRMA 3D8CA 1IQAA 1ZYBA 1TVGA 1AZDA 3OR6C 1X4TA 4EWDA 5EJZB 1DDLA 1FMD3 1K5JA 5A1AA 1JH5A 4IESA 1K5SA 1N4CA 4I50A 5DXDA 4I2OA 2JD9A 4BLJA 1VAKA 3RWNA 1YFYA 4WBNB 5I8SA 3FBYA 4NHKA 1Q8QA 3RYRA 4AI1A 5HFMA 3QG5A 2W1WA 2JECA 4ES9A 3FE5A 1PIV2 4PA3A 4QQLA 2OIEA 4O4HB 4LBMA 2IU0A 4IV3A 1ZBE2 4HETA 3SPHA 4YG6A 1QHTA 3J7HA 4HN1A 1WW6A 2RDRA 3TCUA 1W6QA 5FBJA 5T50A 3RYFB 4QPIA 2RNBA 1UJWB 2E3CA 3RYHA 4FFGA 1W28A 1N1YA 2ZE6A 3S30A 4ORFA 1R1A2 3MIFA 1BEV2 1OQDA 3VBUB 3BABA 5FJHA 4IXLA 2QDNA 3GWOA 4KL1A 3WB2A 2XLFA 3T2PA 2CSGA 2VUAA 2O8QA 3FUQA 3VHPA 4UFJA 1L0LH 3CCJV 3BVCA 1HNXO 2WINB 4YGCA 3ZFGB 2E74B 4G2KA 5KAIZ 2R70A 1JTZX 2CTQA 1ACCA 4FJCC 1LEDA 1M5IA 3AG1C 2OYQA 4DR2B 3L71H 1U5YA 4MVSA 4AEJA 4JF3A 5I0SA 3CMEV 2RJLA 3FX7A 1RUG2 2EAAA 1NY72 4QPGC 3OY8B 1A8MA 5FYMA 1B04A 1NQTA 1QXPA 4HONA 4OXSA 3RI9A 2HWC2 4LTAA 3TOJA 2A3XA 2HWD2 3PU3A 1L8DA 3WDXA 4RFRB 4UCTA 1O3SA 4KQ7A 2QQIA 1HDJA 1W05A 3POIA 1R6TA 5HFLA 1DYKA 4Q6GA 4X64B 4Q8LA 3ZM8A 2ETEA 2YBSA 2VW0A 4PJYA 3WQ0A 1J1LA 5T5LA 4IUGA 4Q4X1 1F4NA 3IWZA 5A3LA 1RUD1 2R041 3LWCA 5C8YA 3H1WA 4PDMA 2YI9A 3K08A 3NAPA 2YC2A 2P7TC 3MW2A 1JZ6A 5BY1A 3T4DA 3KD4A 1J83A 4LFBO 1WA4A 2WZR1 2HWF3 4K3UA 1UY4A 1LR1A 1WBLA 1H2SB 3WG2A 1AX2A 3S7EA 5K8SA 3UCSC 4GH4A 3OEHG 2OCCB 2VVFA 2RS52 2XGXA 5A32B 3VBSC 3JBG3 1VIBA 4RYDA 3CX5F 3X2QB 4D7SA 1KITA 5FK8A 4B1LA 4IETA 3MGUA 3WP5A 1Z5VA 2DUQA 1O59A 2BTQA 3NKTA 3PVOA 1YIJV 3O0XA 4QE7A 4GH4B 2Y4TA 4DUYB 3POJA 4CCMA 4V1PA 2NMNA 2ZINA 4UFKA 3AG3B 1NX9A 5JH7A 5AC93 3M3CA 3VDDA 5FPLA 2C9KA 1EY2A 3NQHA 2NLRA 3R05A 4L0PA 5B1AB 4QB2A 4JI7O 1TVKB 5DQ0A 4Y24A 5F5CA 1XYPA 2LP7A 3WG4A 1EPZA 1NR1A 3L74H 1IS4A 3O5SA 3VHRA 3CJHB 1AR5A 2EIMB 2D6KA 3H8UA 1YXBA 5IT9N 2YDEA 4NO4A 5C3PA 4MH0E 1ALYA 4TSVA 1LJ7A 5KC6A 3ZIAG 2WKKA 1OUSA 4LPLA 3K79A 1OFSA 2ZGMA 2AEZA 3O7OA 1UY1A 4GA9A 1RUJ1 1H2KA 2VNOA 3B4SA 3HR0A 5C5UA 2EALA 2IU3A 3J8F1 1ZBE3 2WNUB 4MO3M 1UWWA 2HWF1 2PHRA 1PK6A 4ZBMA 4NRPA 5GM0A 4DXSA 3CRRA 2AYHA 1E5SA 1YHFA 4K40A 1DQ4A 1EM1A 2QQMA 4BQ2A 1HB4A 4QGNA 5DABA 1O5UA 5DUUA 3NXSA 4BW5A 1RXGA 1JHJA 1YQ8A 1G9DA 5DECA 4AVCA 4AWDA 1GK9A 1UL9A 2HWE3 2IXLA 1AJOA 2BTOA 4XFHA 1WW7A 2WLIB 1NS1A 3KT7A 2BSKB 2QQNA 3PIGA 5DZGA 1I94O 3MPPG 3AG2B 1V9PA 4LE4A 1FJGB 4XJ8A 4NWVA 2FQPA 3SJAC 1S0EA 2C26A 2XG3A 3PIJA 4UFIA 2CK3G 1LHWA 2B45X 3JAWB 1QOSA 1AR73 2VZTA 4I50B 4XUTA 1POQA 1W8OA 2ZX2A 3MHZA 1KP2A 1TG7A 4UT5A 4EWEA 3AJYA 3B5LB 4B29A 4LFBB 4TUYA 1W8TA 2WLNA 4NPLA 1DP0A 4XURA 4A5UB 4FPFA 2YEVB 3KM5A 4MGYE 1MS9A 1RC6A 4XZPA 3L70H 2QCSB 1T6GC 1Z7S3 3W7SA 1RUG1 1GAXA 5FYUA 4DRVA 1MOFA 1NCRC 3FFZA 1JPXA 1RP3B 3F2ZA 1LR5A 4LO5B 3URFA 4Q4V1 5IT6A 4F4LA 2JB8A 2BBVA 5H9RA 2VJXA 2VMFA 2YEVA 1XILA 2ZNIA 4MTXA 2UUAB 3K0DA 4JASA 1OBNA 4KWJA 3C7EA 5E1AC 2BQPA 1ENVA 4LOTA 5FZOA 3QBQA 3LPFA 4FPLA 1OH4A 2D6NA 3LSDA 2NZ9A 5FYTA 1UNBA 4KHPO 2XB6C 3ZFGA 2FDHA 2JE7A 5JZGB 4RWUA 4BISA 1TMF2 1VBC1 3AZZA 1NCQA 4PQ9A 3LZZA 1LKNA 2GSMB 2CGNA 3OYWB 4JI0B 3WHUA 1STMA 4JTCB 1N32O 5C9AA 1WKYA 1WW4A 1JI6A 1HB2A 4NB5A 3RZHA 2QKCA 3IIIA 4NTXA 2XASA 1MZEA 5I0UA 5ANNA 2ZT9B 1H8TC 1OA3A 2PYJA 3OY8A 1K34A 5KA5A 3JAWA 4A3XA 2EXJA 2W95A 1GM8A 4P5HA 5LMNB 1TUEB 2IXHA 3A22A 4R8CA 3UKVA 4AGGA 3FB5C 4BXSV 4LO7A 5A3MA 4AYUA 2ZGRA 2DWDC 1AJKA 3V64A 1D0GA 4JI6O 5FUPA 5KHIA 4IEPA 1RFYA 3BB6A 3NV4A 2LJ2A 4WVWA 1C1LA 4R4XA 3VBBA 2Q8EA 2BOCC 2WC2A 3ZYIB 4XW3A 1V6MA 1FXKB 2YU2A 2R32A 2Q5ZA 2TUNA 5SV8A 3PMEA 2NP0A 2D3SA 5J37A 2KD7A 1P7BA 3IM0A 3SJBC 1YQCA 4I5SA 4KGGA 5T3NA 1XB9A 3ZKYA 5LOVA 2A6VA 3WW1A 2LW8A 4H14A 3AJZA 4FT8A 2JDUA 3D0SA 3O9OA 4MGKE 4IE5A 1OPMA 2DOSA 3KT1A 2HHHB 1ULDA 1SLLA 1NA1A 3QOPA 2WNUC 4O2AB 1RUH2 5F2SA 1S0VA 4HAMA 4XYXA 2OT5A 4NMIA 5F5QA 1XEQA 4BR6A 3APQA 3E97A 1AR83 4Q4W1 4N53B 1NCQB 4ZI7B 1H2NA 5IWFA 4MGZE 4S2DA 4COWA 4IYIA 4SBVA 5FZAA 2WT2A 3V65A 3FYIB 1NR7A 1IG0A 2WZEA 5E8AA 5A3WA 4MXWB 5JDBA 2JGUA 3DKQA 5EYYA 2QQLA 4KP4A 4X1YA 1QR8A 1UO9A 1DLLA 4FFKA 4AHZA 1BJQA 3HB3B 1HV1A 4Z82A 2QKAA 4QE9A 2A7WA 4XBLA 5JOWA 4E2GA 1N34B 2IXIA 3IC9A 1ND2A 1JCHA 5H2FZ 4I0WB 2EBOA 1JFFB 5FYYA 3K03A 2FKXA 3A0NA 5I0DA 1M57C 1PP9H 1FPN2 5FTTC 3BTZA 3VZMA 4DUZO 5IATA 3JD0A 3C3VA 3I2DA 4DV5B 2VL4A 3M70A 1AI4A 3H1IH 5FP9A 5DDJ1 1B35C 5B2GB 1PK6B 3ZXAC 4WZFA 1KFUL 3SYPA 1RUI1 4LH6A 4LR3A 4EN7B 3EO6A 5KMGB 2YUAA 2XNDG 1Q86W 3WW3A 3HN3A 3THTA 2Y0OA 3KV4A 1A6CA 4ZY9A 3N2KA 5LRRA 1XE8A 2MEV3 1B35B 3ZYRA 5KAFZ 5A7QA 2YV8A 3NNGA 3OBTA 2HBTA 3SPJA 3B8MA 5HCAA 2QJVA 4LE3A 1PM4A 3WF4A 4AEDA 3O65A 2ZGSA 2BV4A 4NPMA 1LUWA 1TA8A 1BEV3 1O6UA 2AHYA 3I3EA 3CYOA 1NY71 1REFA 1Q8OA 4HK9A 1DQ6A 1V55C 3K5OA 4TWKA 2GU9A 3OGCC 2DV9A 2ARBA 4YM3A 4FPJA 4FLTA 3C7FA 5FY5A 2XQRA 1IG3A 1RUC2 3N9NA 4E2QA 3CXCU 4L11A 1YEWA 3VZLA 2JX9A 2C6SA 4DV7B 4BQ3A 3I54A 4IL7A 3SITA 5FRAA 2EZPA 1JMKC 1HJGA 3TXQA 1YWKA 3AP6A 4RR3B 1VBE1 4P2ZA 4ET7A 5A9GA 1SBFA 1HRV2 2IVIB 1HB1A 1RUH3 3BRCA 5A7WB 1QQP2 3FC0A 3TETA 3LUTB 4IT5A 5A1LA 4P9GA 1XRUA 5LBBA 4DY3A 1PM7A 3WXPA 4FK5C 3ZXFA 2J7MA 2RS51 4X65B 1QNWA 3WV6A 4EN8B 1JOPA 2P6CA 2RS32 4UFMA 3K5NA 2Y0PA 2E5LB 1WMEA 1V6JA 1V00A 1JZ3A 2G9GA 2MNGA 4WBNA 1VALA 1DZQA 1N8RW 1UCXA 3ZMSA 3HNMA 1CJPA 2ZIMA 2OTLV 1WA8B 4FPEA 4CDQC 4IEVA 4I01A 2AENA 2XONA 3ZFEA 1US3A 4FPOB 4LA3A 1AR92 2ADDA 1TME2 2KA3A 5FKBA 2YFZA 3D3IA 2WS92 2ZX1A 4JYYA 1U12A 3DC6A 4O7XA 2PI4A 3JCIA 1SZTA 1J84A 2XOKG 4YW7A 2ZEWA 3SYOA 1W8WA 4UVBA 2G19A 2C1FA 2YXYA 1RUH1 3CCMV 4CH3A 1ND3C 2ERFA 5ERLA 3FFQA 4JI8O 4GAZA 4RUFA 3GJAA 1CPNA 3NR7A 3MF6A 3O1RA 1K3IA 1MS1A 2DCYA 4S2HA 1LOAA 3N2GA 3N9LA