4KL1A

Hcn4 cnbd in complex with cgmp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic dinucleotides bind the C-linker of HCN4 to control channel cAMP responsiveness.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 60
structure length 192
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4kl1A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kl1A02
3NW4A 3RDIA 1YFYA 4KU8A 3NVCA 5J48A 3LA7A 3UKNA 4D7TA 1RUNA 4X6QB 1O5UA 4O9GA 3GBFA 2B9UA 5CADA 2EVXA 4R52A 3IDCB 4KWLA 5JAXA 1O5LA 4P9GA 1OD5A 3CEWA 4TLFA 1UIJA 3RYRA 2OPKA 3MYXA 3D0SA 1OMIA 3PVBB 4CYDA 2B5HA 2P17A 4QX5A 4UBGA 1J3PA 4HVRA 2BNNA 4IETA 5I0TA 1EPZA 3KGLA 1CAWB 2I45A 4IESA 2O8QA 2UYAA 4OLLA 4MZUA 1XE7A 4IEWA 3RPQA 2VPVA 2BGCA 4EWEA 3LOIA 1J3RA 3M70A 2DCTA 4LA3A 2XL9A 1ZX5A 5BV6A 2H6BA 1OFNA 1ZZ8A 4QM9A 4META 1NYWA 4HVOA 2XKPA 5FCCA 3LA3A 2GU9A 4K8FA 1TQ5A 1LRHA 3E6BA 5JCTA 1H1IA 4XFAA 3I59A 1XE8A 1IPKA 1ZZ6A 3UKVA 1RTVA 5JR7B 4FT8A 3H1YA 2D5HA 3IIAA 4D7SA 2ZCWA 1CAXB 2PAKA 5E16A 3E97A 3FHIB 5FLHA 2HJIA 5I0UA 4HLTA 1ZRFA 1Q3EA 1CAUB 3H50A 4NVPA 2XHKA 4XF1A 2MHFA 3WW4A 3KCCA 4ZU7A 2D5FA 1WLTA 3WW2A 2PFWA 5I0SA 1EYBA 1L3JA 4Q0QA 3WW3A 4PIXA 1VP6A 2D93A 3NJZA 4UXAA 4LTAA 4ONUA 1SQ4A 3LZZA 4WZCA 1J1LA 2CAUA 4ORFA 3BU7A 1ZRDA 4XFHA 3OD0A 4JVAA 3HQXA 2PYTA 2XKOA 4MH0E 3I7DA 1O3RA 2GC2A 2EAAA 2OZJA 3OGJA 1H1MA 3H1WA 1SFNA 2BYVE 1ZZ7A 1RGSA 5JSOA 1CAVA 2OZ6A 4IEQA 3ST7A 4EWDA 3IWZA 1O4TA 1X8MA 2IXHA 4QM8A 4L2NA 3RNSA 3CF6E 3GYDA 5FDBA 3FJSA 1NE6A 1QXRA 4HVQA 5I91A 4HN1A 3NSTA 2QDRA 2V09A 4BYYA 1JUHA 1CGPA 4Z07A 1X7NA 3H1MA 4Q0SA 5C6CA 4ZU4A 4XF4A 4YSFA 5I93A 5LEJA 1ZVFA 5LEKA 4I2OA 2F4PA 2ETEA 4QGMA 4IEUA 1ZREA 3BALA 1YFXA 3ES4A 4R8HA 3BCWA 4KL1A 4KWKA 1RC6A 3KMHA 2IXCA 2QJVA 3USSA 4I0AA 4E2QA 1LKNA 1ZZBA 3FWEA 4Z82A 3JZVA 2VQAA 4Q0UA 4RD7A 4X6RB 4N9IA 4QMAA 1VJ2A 4IEYA 3EQEA 3HT1A 3TNQA 4XF3A 4PIYA 2PAEA 1O3SA 2FMYA 3SMHA 2GC0A 3FZ3A 4ZU5A 3PLQA 2GZWA 5FQ0A 1Q43A 3ROUA 4MUVA 3OCPA 2IXKA 5FLIA 5BXXA 5F1RA 3OF1A 3EBRA 2GH2A 5J7MA 1YLLA 1J3QA 1V70A 1GQGA 1YHFA 4MGKE 3E5UA 2Q30A 3WW1A 2ET1A 2ZKLA 2PHDA 1YFWA 3H7YA 4BIFA 1ZZCA 4KU7A 3ELNA 4B29A 3FE5A 3SCHA 3D0JA 4IEVA 2O1QA 2XLAA 4N9HA 4E2GA 1YFUA 3LA2A 3UKTA 2E9QA 4LULA 4XFIA 2CGPA 4EV0A 3I59B 2XL7A 4J1WA 1O3TA 2VECA 1LB2A 2ATFA 1X8EA 4YARA 3SCGA 3E5XA 5CVRA 2UY9A 4O9EA 1FI2A 2OA2A 3TNPB 4YNIA 4XFGA 4XFCA 4IEOA 4IEZA 3H3UA 4JV4A 1ZRCA 1FXZA 2CV6A 4AVBA 5LRSA 3DV8A 3U10A 5KHKA 3SXWA 3H3ZA 4IEPA 3MPBA 3OTFA 3O14A 1DGRA 2KXLA 1UPIA 1DZTA 5I8TA 3B02A 3H7JA 3IDBB 4QXKA 4JTNA 3RYKA 2QNKA 4HMZA 4EWAA 2N7GA 2PHLA 4I09A 1WGPA 1UD1A 2Z69A 4F8AA 4BHPA 2GC3A 3H9AA 1WA4A 3ACLA 4Q0PA 4A2UA 1Y3TA 2XLFA 4QGLA 5BPXA 2IXIA 3BB6A 5K8SA 1FT9A 5JSRA 2FQPA 3ZDSA 3LWCA 4JTOA 2ET7A 2CAVA 4H7LA 2IC1A 3MZHA 3S7EA 1CAVB 3FFQA 4FAHA 1HW5A 3RYPA 2IXLA 2UY8A 5CU1A 4MX3A 1YUDA 2XGXA 4I01A 2HKXA 3H8UA 5KHJA 3FX3A 1QY4A 1NE4A 3M3IA 4I02A 1U12A 5BUVA 4I3PA 3I54A 3HIFA 4XETA 1NZCA 4QGNA 3DL3A 2BNOA 4XF9A 3LAGA 5HI0A 4I0BA 3L2HA 4E2SA 3NL1A 2MPFA 5C8WA 1RUOA 1Q5OA 3E6CC 5LRRA 4UBHA 2PQQA 2OYZA 5FPXA 1I6XA 5T3NA 4LUKA 3U0ZA 3EHKA 1PM7A 1O7FA 2K9ZA 2WC2A 3QOPA 1PMIA 2XLGA 4GULA 3CO2A 1CAWA 1QWRA 2QVSB 2BEOA 4AVCA 1Y9QA 1OI6A 5I8SA 4AQ2A 3E6DA 1QXJA 2EA7A 1EP0A 3G7DA 4IERA 3ETQA 1IPJA 4MGZE 5FQ0B 4F7ZA 5KHGA 4XF0A 2Q4SA 3S7IA 4XFBA 3R6SA 3VHRA 3U11A 3KSCA 4Q29A 5I8YA 4AVAA 1ZRRA 2IXJA 3N4MA 3D82A 4WBBA 3SHRA 1J58A 2WFPA 4OFGA 4LLOA 1ZNPA 3KGZA 2B8MA 3S0MA 3NKTA 1NXMA 5AVPA 4KWJA 4LEJA 1CAXA 4AXOA 4BH9A 3DN7A 3C3VA 3BPZA 1YWKA 4L11A 2PA7A 5JSPA 3QACA 1CAUA 5J3UA 5KHHA 4EROA 1ZZ9A 1UIKA 1X82A 2Q1ZB 2H0VA 4HN0A 1I5ZA 3SCFA 5E1RA 4HZFA 3EJKA 4MGIE 2K0GA 2Y0OA 1GQHA 2UYBA 3E5QA 5KBFA 4PIZA 1SEFA 4HSLA 5KHIA 5EFUA 4PJYA 5EZWA 1UW8A 2GC1A 4J1XA 1G6NA 4HBNA 1EY2A 4Q0VA 4YYOA 1DGWA 2GAUA 3HT2A 5BY5A 4MGYE 5D1IA 4WVZA 4MV2A 3CJXA 1DZRA 2D40A 5FPZA 3CLPA 2QCSB 2C0ZA 2MNGA 1VR3A 1O3QA 1CX4A 4XFFA 4FAGA 3PNAA 4FBFA 1J59A 2Q0AA 1LR5A 3ES1A 1XRUA 3RZZA 1UCXA 3EO6A 4IEXA 4XEZA 2Z2SB 5FLJA 2PTMA 3MDPA 5I0RA 3CL1A 3DKWA 4AQ6A 4LA2A 4LUMA 4HSJA 3IBMA 1RL3A 2BNMA 2H6CA 4YRDA 4DINB 2PAMA
chains in the Genus database with same CATH superfamily
5D8AC 1GMMA 1AXKA 5ACA3 2WQZC 4LF7O 2BUKA 4QT6A 3VBOA 2BDRA 2P3YA 5JXIA 5L3DA 2R49A 1AR1B 2FDHA 1EAH1 1OD5A 2P1BA 4P9IA 1AP6A 2WINB 3UGHA 3CCQV 5K9YA 3PN1A 2C4XA 3B9IA 4HVRA 2Z5WA 2VU9A 1FD9A 2FCUA 2OIGA 4KGQA 3CXCU 3K4ZA 1XE7A 1HB4A 3ZRSA 1PK6B 2P37A 4KXRA 2XL9A 4MW8A 1NT0A 1GO3F 1CP9A 4EN8B 2ARBA 2BCCH 1JI6A 3ON7A 3BUCA 1H1IA 3WNLA 2QKCA 1OC1A 3ASIA 4RS5B 4LH7A 2HBTA 3CMGA 4NRMA 4V2VA 3AP6A 4LWSA 5EJ3A 4MVUA 3T2QA 1BSMA 4COVA 4AEJA 4YM3A 2DN9A 2CYFA 2NLRA 3CBNA 4LF6O 1UZVA 3M3EA 1LODA 3UGFA 3Q8AA 3JAWB 4O4IB 2RMU3 1SA0A 1XMOB 5LZ6A 4FVMA 5AC92 3JU9A 2CTWA 5DZFA 4MHRA 1LU2A 1Q8VA 2WJSA 1ENRA 4NN0A 4M01A 2ZE6A 5DM6V 4OHWA 1Z2GA 3RVYA 4KFMA 3OB8A 3SEEA 1G4YB 3MW3A 2IFRA 2ORZA 3KT1A 1GM9A 3I49A 3N3HA 4RQPB 3NSTA 2VCBA 2V09A 4FZ0A 4XDJA 5IVCA 1I9RA 4SLIA 4ET7A 3NAPC 3O1OA 4W50A 1ZVFA 4GT1A 5KXCA 4X1KB 1DQ1A 1RFYA 5CZKA 1V6OA 4Q4X1 1US2A 1VBD1 3ZFEC 1EFRG 4YGDA 3ZXJA 4CEWA 1WPBA 1QDOA 5GZDA 1PPJH 2JJ2G 1CR7A 1VJ2A 4IEYA 2UU8A 4LLFA 1T6BX 3KVAA 1H8TC 3NNGA 3JSLA 4U3JB 3OF1A 5IAXA 5A3MA 1C5IA 1GQGA 4PDVA 2NPIA 5FYHA 3E5UA 2X10A 1J5EB 3LE0A 1I08A 4J1WA 3CCMV 1SKVA 4UI9L 2HHHO 4GKYA 4O9EA 1QQP3 3DSQA 3TNPB 4FPOB 4BK5A 4FFKA 5FY5A 2V4AA 5CKNA 2CV6A 1GN6A 3DV8A 5FK7A 1RHI3 2FD8A 2WLKA 5CN0A 3OTFA 4LK6A 1R6NA 4K6BA 4KP4A 2JS3A 4PI0A 2WKKA 2DWEC 4DV6O 5A70A 4A5UB 2Z69A 5JZGB 4BHPA 2VM9A 2CH7B 2AEYA 2YC2A 4LFBB 3KV4A 1X50A 3RG0A 1NTMH 4YGBA 5C70A 3RI9A 2E75B 1S0GA 5A7NA 1KYOF 2RDCA 2UY8A 2UXCO 2ZPXA 3AEIA 1AX1A 2GDFA 4FVVA 2JDKA 4P9YA 5DAWA 1OQEA 3SPIA 3PVEA 3JAKB 3OEBA 3BA9A 2HLDG 3AL6A 1CWPA 5KWRA 4YZ5A 3VLBB 1D4M2 4DOUA 2BNOA 5ABJC 1GFF2 1RUOA 4DV4O 2WAOA 3CCUV 5IATA 4AK3A 1S76D 1L7QA 1XE0A 3D3QA 3EHKA 1TNRA 5A3LA 1O7FA 2K9ZA 3QOPA 3SDLA 3WP4A 3IFXA 1R1A2 4A7ZA 4YZ3A 2E31A 2YV8A 3AG4C 1W3VA 1H6XA 1K42A 3WXPA 1PK6A 5IFTA 4CP0A 5KLVH 1H8HG 2F4LA 2ES3A 1D0GA 1KJRA 1P8JA 1AR4A 3Q4HB 4G27B 4AGGA 4ATFA 3EFFK 4RS5A 2WWWA 3UT0A 2XMLA 4QE7A 4BK4A 5F3CA 3GCXA 2AGSA 2J1UA 4LEJA 1BT8A 3RZLA 4AI9A 4MVTA 5GKAC 1ZL8B 2ZBJA 1RVF1 2Q68A 3OW2U 4CXYA 4L92A 3CCVV 1AR73 3CB2A 4CDWC 3PJQA 1OVPA 3FX7A 3QO7A 1US6A 4AL9A 2WZR1 3JAWA 3L74H 1SQFA 4O4IA 2X0LA 1S72V 4HXCA 5EZWA 4O2AB 3DGTA 5IY5C 1G6NA 2YY1A 4E8DA 4YYOA 2BU9A 3AXEA 5KMGB 3CLPA 3NV4A 4MSVA 4XFFA 1K73W 1AR83 4WF9V 1XRUA 2Q8CA 1ASJ1 3ATGA 1AI4A 1VBE1 3R4SA 1YNAA 5F5QA 1A8DA 4JI3O 1V6JA 1RUF3 4K35A 3CJIB 3MHHC 5E8AA 1NA1C 1G6UA 5IVBA 3B4SA 4A41A 1K3IA 4O4JA 5G04L 4B4QA 4ZXKA 1KD7A 1N0JA 3LF7A 2BNNA 2QQOA 3KGLA 2P4VA 4U3JA 4CBCA 1UQXA 5EHDA 2JDYA 4UFMA 4EWEA 1KP2A 4M3CF 1LHUA 2UWBA 2Q9LA 3VD4A 4UFLA 1XEQA 4I0WB 1N32O 1DP0A 2HBUA 1UOFA 4FPCA 1OQDA 2DDUA 1XC6A 1OV9A 4Y22B 4O4LB 2ZR2A 1EV11 3WVJA 1MPXA 2QSAA 1W8OA 2XVGA 3IIAA 2YU1A 2ZNIA 2W47A 5GLWA 1W0NA 2ZNJA 2YDEA 3ILNA 3SH5A 1REFA 1RB8G 4YVWC 1FPOA 3CZUA 3POYA 4UCOA 3N9PA 4B7KA 2D98A 4WCEV 1WMDA 2YEVA 3HKCB 2ZX2A 5L9BA 1WMEA 5BR8B 4DV0O 2FMDA 2QQNA 4XDQA 3ZX6A 1EYBA 4S2FA 1JZ3A 1SQ4A 5JZGA 3WG2A 4BQXA 1ZRDA 2CH7A 3EYPA 1NT2B 3KKYA 2ARXA 5LBCA 4FFBB 1HXS3 3I7DA 5FIXA 5EZYB 5A80A 1NQJA 2Y69C 1SFNA 3OPWA 3AM2A 1UX7A 2AHZA 4LNUB 1HB3A 2OZ6A 2WSUA 3PDQA 2G38A 4BQ5A 1WP7A 1PP9H 4HVQA 1ULOA 3J4UH 1O9HA 4I9WA 2R041 5LBQA 1JXNA 3JAKA 3K9SA 1YZBA 5F2WA 3IKWA 2YPDA 4C0BA 1QCEA 1AVMA 3SJQC 5JPMB 1LGNA 4LHNA 5A3UA 5T54A 1IOAA 5A33A 4P9WA 4FK5C 4KGGA 1GM7A 3AKPA 1HRI2 2BTQB 5JVDA 1HQNA 1F31A 3MEPA 4COYA 2RMU2 4N9IA 2VMGA 2VQEB 2YYOA 1I1EA 2FDKA 1ZTEA 2Y4UA 5F5IA 3IJ4A 1OLRA 1V70A 1QJEA 4LH6A 3W58A 5K1PA 5FYCA 3CS5A 2AYHA 4O7XA 2JIZG 3Q4HA 4AR2A 4PBOA 4XYXA 5C8CC 3T2PA 3CCRV 3W7WA 3FHQA 4EV0A 2XAJA 1Z78A 1NY72 4RN5A 2HEVF 3ZXDA 3E5XA 1ZL8A 2YBSA 4WZFA 1FI2A 4RGGA 2WLJA 2I2SA 5FK8A 1JZ2A 3MBWA 3LEKA 5DG2A 3TOJA 3O14A 1JYCA 1DZTA 2X8KA 1SQXH 4LORA 4W4LA 1RJ8A 3C7HA 2QQIA 1TVKB 4KHPB 3QO8A 4O2AA 2A3XA 2D3SA 1PKXA 1MNGA 4JGZB 2GC3A 4CP2A 4RUFA 4B3TO 3ETEA 3VBRB 1I94B 3ABLB 2FZ1A 1YC61 2EICA 4COZA 4MVOA 1SQGA 2LFSA 5BPXA 5HPOA 1LEMA 1TA8A 4WFGA 4AF9A 3MZHA 1XHXA 3S7EA 3ZSKA 2E76B 3OTOO 1HW5A 1QMJA 2C24A 2HWE1 2UXBB 4X62B 4I01A 2DYRB 5GTHZ 1MR5A 1OCRB 4J7JA 2DUOA 2QM8A 5CG8A 5IFPA 2IFWA 3E89A 3K0GA 4BIZA 1Q8IA 5H9SA 2NMOA 3HKDB 3HIFA 4BZ4A 1K7DA 1POV3 1NZCA 1ULFA 4NXNB 3CMEV 3LAGA 4FXGB 2WA3A 5HI0A 2WUHA 3MLLA 1Q5OA 3ZHQA 3K08A 3SJCC 2IUWA 2PQQA 4LBQB 4BA6A 3H01A 2WR9A 4AVCA 4S2GA 2WAMA 4UF0B 1TME2 3AL5A 4YZ2A 4Q2FA 1DLCA 4NMIA 3ZMSA 5BNOB 2B39A 4JZGA 1CZTA 2Q5TA 1RPOA 1XQ8A 2CSGA 2RQ6A 5LY2A 4TOIA 3A21A 2IXJA 2RMKB 3RGBA 1TGOA 4Y22A 2VULA 3IDEA 3I56V 2DCJA 3K46A 2VD7A 1KITA 2DU1A 1PIV3 1WW7A 3OEHG 2AUYA 2H94A 4AWDA 4CDQB 4PJ0Z 3HWJA 5IVJA 3WG7C 2PXJA 3HKCA 1R3LC 5AFBA 1PNKA 1V6MA 4E4EA 4K8ZA 2LS6A 4YG3A 4DEVA 5E1RA 2FHRA 1BKZA 1H8VA 4FMTA 3WZ1A 5EFUA 4PJYA 1Z5VA 4FFBA 1MZFA 5EZYA 3HAGA 5EBWC 1R1A1 1NH2B 1Q7YW 5EPAA 1M4UA 4Y1UA 1DGWA 5SV8A 2ZM6B 5D1IA 4BE3A 5FPZA 4LNUA 3BVOA 4K21A 3J8F3 1MMMA 4UW3A 3MDSA 4AVTA 4FFGA 1PO23 1GKFA 1NQTA 4NB5A 5G05L 1IKQA 4ZHQB 5F3GA 3CL1A 5FZ0A 1O6UA 4LF8B 3IBMA 3BPSA 4DV1O 2PAMA 2PHFA 2QE7G 1JYNA 1D0HA 1SLIA 3PTYA 1LESA 1TG7A 4JYAB 4R4XA 4PLOA 3W59A 2EIJC 3CCEV 2Q1MA 4OGQB 3J7AU 4GYCB 3S30A 2DFCA 4UBGA 4J7ZA 4BQYA 3E2EA 1OZ0A 2OIIA 3SR2C 2E7TA 5DECA 1JU4A 1U0AA 1W8HA 5FUIA 2LFRA 3RT3C 1NI8A 2G1MA 3AZWA 2B9ZA 5J2UB 2VUJA 5CFCB 3RWKX 3M70A 2RCVA 4LA3A 4YZ4A 1P84F 3ZMUA 4V1PA 3J9SA 3PUIA 1XSRA 1CPMA 5H9CA 5ANNA 4IYHA 4K8FA 2P2KA 2ZGLA 1RUF2 3WNKA 1G9BA 1ZZ6A 2DVFA 5LGNA 1MEC3 1HN0A 1NR1A 2DWDC 1OLQA 2PHRA 3E97A 4G9SB 2TBVA 4OI1A 5D5PA 3ACIA 1E5IA 3ZFGC 4JI6B 2DUQA 2AZ5A 4EN0A 4HLTA 1RUH1 4FQ4A 4N7UA 3VDCA 2MHFA 4ZU7A 1J1TA 5E89A 1TVKA 1WP8A 5EYPA 2AW9A 3WW3A 2D93A 1PO12 4JGZA 3OR6C 4ORFA 3QG5A 1TEIA 3VBRA 4UFZA 1UOGA 4MGSA 1LUVA 4BQ4A 3RZHA 5EWSA 1RUI1 4MOAA 4QPJA 4C8DA 5FBJA 3NV2A 5J37A 2VNGA 2DVGA 5JJJB 5DAPA 1W0JG 2XWJB 2EIMB 4CP9B 2Z3YA 2RS31 1DG6A 4HN1A 3LEIA 3CIHA 2PYJA 5DAXA 2BV4A 3FUOA 4Z07A 1PNFA 2XJSA 1M5IA 1N33O 5ACA1 1YQ5A 2HP8A 4P9PA 5IDJA 2F4PA 3ML0A 4LF4B 4QGMA 1LOFC 4IEUA 1ZREA 1V0AA 1YQ6A 4X88A 4LBQA 5FYBA 3ZFFC 3GNEA 5A9GA 5CIRA 5L7OC 4UF0A 4RWUA 1ULEA 1GM8A 1WB8A 4ZU5A 3SISA 5BNOA 3VBHC 1OFSA 1R64A 1VALA 4DUYB 2V5YA 1XMOO 1J3QA 1YF2A 1SFYA 5EBLC 5FZDA 1YRZA 2OIEA 3FE5A 3TK1A 1AP5A 1Y9MA 3VD9A 2OW4A 1VBB3 1KQRA 3NNFA 1PMHX 3IC7A 4QJFB 1OHFA 2QTOA 4CDQA 5B1OA 4M0HA 5FY7A 4CU7A 4AFMA 1VRH2 2ZEZA 5LHIA 5LRSA 3U10A 1NAEA 3JXSA 1W59A 2CTRA 1L7LA 1FYUA 1Z0HA 1K4DC 5FYTA 2RS13 2EULA 3H7JA 2XJUA 4JTNA 5IHRA 4GH4B 1G8WA 1THZA 4A4AA 2RMU1 2LQTA 1EUUA 5J36A 3MIGA 1HV1A 5FREA 1Q6UA 1KUQA 2E63A 4JTOA 3ZHUA 1JFFB 3T2OA 5BNNB 3PMSA 4XUQA 1CIYA 1RJ7A 2W08A 4ZHQA 2UXNA 3MHSC 3HNYM 2VVFA 3H8UA 5KHJA 4LBEC 1R093 4QX8A 4XHXA 1SBEA 3CC4V 1ZX3A 1J5EO 2JG8B 4H7MA 2Q7GA 3KLSA 3QNEA 4UAPA 5CB4B 3I97A 3M3IA 3FLRA 5F9TA 1NY71 1C8M3 3J26N 2VGDA 3N2GB 5IYBO 1WLEA 1PVXA 1MQTC 1SDWA 4QPIA 4LUKA 3LEMA 3VZLA 3ZN5A 2DQ3A 2ZAHA 5C5UA 1Y9QA 4CRQA 3ZXLA 4QX3A 3WNMA 2Q8DA 5J2UA 2VZ3A 4J80A 5HCFA 3MFAA 3EMRA 4C0HA 4AVAA 3BIEA 4QD2A 4PF5A 4U36A 3R4UA 2AREA 4LLOA 4LT5A 1VQ4V 4MVQA 4BDVB 1DLBA 4JYYA 5LASA 3VHNA 3JD73 1PZ8A 2CTQA 1QQP1 1F5JA 3BTZA 3OSDA 5FWJA 4CCKA 3J7HA 4BQWA 3NJVA 1X82A 3GVMA 1RHI1 3WDXA 1US3A 2GP3A 3WNOA 4JI2B 4A6OA 3JSNA 1NZ6A 1AL23 2VUDA 2W1SA 4N53B 2HFEC 4BM8A 3JQWA 1S2EA 2ILMA 4BMBA 1ZBE3 4AQYB 4BB3A 5LP6B 1WW4A 1QJX3 4TLGA 1RUG2 3HT2A 3G67A 2OYQA 5FNVB 5H6QA 3ZPYA 4NROA 1DZRA 3M3OA 3STLC 1N34B 1SCSA 4LBOA 5A6YA 3HNBM 3T0BA 3O1MA 1KRIA 1RUJ3 4OHZA 4CP9A 5A3NA 3ZN4A 4PDWB 3F95A 4XTMA 1RUC2 4IV1B 4GZ9A 2YIAA 1B04A 5GLVA 1A3KA 1KD1W 3S5QA 1HRV3 4E4DX 4X1YA 3JCUZ 5FZEA 1W9FA 4ARYA 4OYUA 2PN5A 3SJBC 3K04A 2XUMA 1VQOV 4EQVA 1FAYA 3S3XA 1ZM1A 2B5HA 3GGLA 4QX5A 1B35C 2RR12 1IXBA 5I0TA 2F17A 1YI2V 1W6QA 1HW7A 5DAQA 3WQ0A 2RJLA 3A2FA 3HQRA 5FMOL 5LCWL 2EZOA 1QH6A 3QBQA 4CH3A 5KXEA 1PZ9A 3LDRA 1NYWA 4RR3B 3SQOA 4EN6B 2WT1A 4DB5A 3E6BA 3W20A 1G8MA 4LBKA 3ENRA 1CESA 4NIDA 2XBO3 2IJJA 4CCCA 4DXSA 2R063 2W0FC 3C2UA 3TEYA 2VBDA 2QWOB 3CRAA 2PAKA 1ND3C 3ABKC 2X6AA 3ZM8A 1Q3EA 4XF1A 1AR71 4X65B 4MTOA 4DMIA 4KBZA 5DDJ3 3T09A 1PL4A 4CXXA 4GH4A 4A42A 2W9XA 5CNAA 2P7TC 1NVPB 3MIFA 5A3OA 5K0UC 1LGBA 4CS4A 2DYSB 5D8AB 3H9VA 3F2ZA 4PQQA 3KZIZ 2BVBA 2HR3A 1X36A 2DOSA 5IJRA 3TAYA 1OOPC 2B45X 1LHNA 5BNNA 2C9AA 4FJCC 1AR81 4CCNA 5FZGA 3ZOIA 3BEHA 2WLMA 2EXKA 2IXHA 4IE4A 1HP8A 3WT3A 2R0HA 2F95B 1DYPA 2D97A 1KDMA 3UT5B 1GUIA 2JG8A 5T5OA 3OGCC 4UVCA 1UZ0A 4X64B 5CB4A 1X7NA 1SESA 1R3JC 1TMF3 4QPGC 1RUF1 4LBJA 1GZWB 3N2GA 3V65A 3RYFA 4YM1A 3ZLIA 1FMD3 2VZPA 1W6NB 3PUHA 3K59A 1BL8A 1N4CA 3WSOA 2YUEA 3MIEA 1LENA 3O1SA 3OYWB 4JI0B 3FYIB 3OCPA 1UPSA 3KM5A 2ZA9A 1SHWB 4NIHA 1OBNA 2BBVA 1OKQA 5DUWA 1QXPA 3WW1A 2RDQA 3ZYGA 1C1LA 3CU7A 3SCHA 3HNMA 4LR3A 4E2GA 2Y0PA 5L9RA 3PJSK 5EC1C 1SZTA 2NMNA 5BYNA 4YGEA 1AJNA 4D69A 4DNYA 1QJU3 4IV3B 3M3QA 4DXTA 4N8MA 3U75A 4XW3A 2CGNA 3RYCA 3MIBA 1VRBA 4JYBA 4QHOA 4TT3G 1NKDA 5JOYA 4N53A 5A7PA 3E8GA 3ZVXA 3LFMA 2I07B 1JX9A 2HWD2 3AVRA 3NAPB 1HXS1 5L3EA 3ASNC 2VQEO 3KD4A 5FNVA 3TN91 4BOWA 3LOBA 4A2UA 5LA2A 4JI5B 1WJZA 4OUEA 3ZFEB 2YBPA 4PDWA 1VBB2 4CDUC 2JE7A 4IV1A 2VR4A 2D6MA 1RIRA 3RZGA 3TGUH 1X9TA 4YIOA 2ZHKA 4OQ9A 3DGEA 1H8TB 4P02B 3UV9A 4Z8BA 3IAPA 1GP4A 3N35A 1BEV3 1PL0A 3VDDC 5T3NA 1AX0A 4WVWA 4ZS3A 1E5RA 3BVCA 1OI6A 4KHPO 5FPOA 5EBMC 4BWOA 4X9QA 1IS5A 4RHV2 2YI9A 1H2KA 4FZ1A 4HPKB 1N3QA 4GX5A 4PBPA 1PM4A 1YO8A 2OCCC 4BPZA 1IQDC 3JASB 1IBMO 4JDMA 4E4HA 2X6BA 1VQ8V 4M3CB 1K45A 2UXBO 4PT6A 1KKDA 3WP3A 1BS3A 4E2LA 1YDXA 1NCQB 2Y34A 3T08A 1F23A 1YWKA 4MYEA 3KF5A 2R30A 5JSPA 4P08A 2E53A 3QACA 3CYOA 1WZXA 1GZCA 2A9HA 2XOKG 4CZZA 3E8FA 3ZYJB 5A32B 1AVBA 2WZ8A 3OPZA 1UOJA 2ZX4A 5KHIA 1FJGB 5D8AA 2EX3A 4AOCA 3JUUA 5JIUA 4FLXA 3FL7A 2W46A 1AJQA 4TQFA 1OH4A 4Q4V3 3AG2B 1VQ7V 5A7WB 3CJXA 4JTAB 5ABJB 2PHUA 4YPJA 2F4VO 1A32A 2Q0AA 4XUNA 1RMU3 4EN7B 3FLPA 4K20A 3UT5A 3MF9A 4JRLA 1VBC2 3M8AA 2Z2SB 2WNUC 2EJRA 3AG4B 4HSJA 4YRDA 5FXXA 1HJFA 1SF9A 2UUBB 4X6QB 1POV1 1BCCH 4JI1O 3HQUA 1W3XA 3MW4A 4H14A 1W04A 3AP4A 4AVVA 1UIJA 3A0RA 1ZBE2 3K5OA 5FYMA 2QUOA 1LTEA 5IWAB 3OYWA 2O8QA 2UYAA 1IVSA 1RUJ2 1W9YA 2VNRA 1WMXA 4XDOA 4CDWB 3SKVA 1W2BU 4ASLA 1IDSA 5BV6A 1OFNA 1VLNA 3I2FA 2XKPA 4HVOA 1LR1A 4Z1VA 1LRHA 1IXMA 4QB6A 3OEAA 4RFRB 5E88A 2E51A 3FMGA 1VPHA 1OCZC 5IY5B 1H2GA 5BNQA 3SH3A 1LHOA 4EJRA 1PIV1 1DF0A 4LF8O 4IGQA 4PELA 2RDNA 1LGCA 2DMXA 2OQ7A 1OKOA 2JDAA 3WG4A 4CCLA 4B3SB 1B06A 3VD5A 4DYLA 1AI5A 2XQXA 1ZRFA 3A0NA 2E7QA 4UVBA 1ULCA 1YIPA 2BVVA 1N36B 1L3JA 3WF3A 3NAPA 1J1LA 2JD4A 2B7YA 1VQ6V 1XDCA 3N2KA 2YXLA 4OULA 1MS5A 4NAMA 4YWAA 1YI7A 3OGJA 1NA1B 5KC5A 4YY3B 3I2DA 2R32A 3J8F1 1UY1A 4A6SA 4AGVA 3VD7A 4EB6A 3DKQA 1X8MA 5F6LB 1PO21 3F5TA 3AG3C 1NE6A 4KI5M 2XBO2 3W7SA 4BYYA 2R062 2KG7B 1H1AA 2XONA 4UFJA 2JK5C 1REEA 1JUIA 1WD3A 3S5AA 3FB8C 1XMQO 4JGSA 4GWNA 3OE7G 2PI5A 4KWKA 1W6PB 1SFPA 1RC6A 5DDJ2 2XVKA 5DMYA 1LKNA 1FAFA 4HONA 4NIIA 2XT9A 3V0BB 4UCUA 3K3OA 4PIYA 5A1FA 4NTYA 5FO9B 4NHMA 4FSJA 4YVWB 1XL4A 4AW7A 1Q56A 2WQ8A 3AJZA 3N27A 3T2MA 2W91A 1DGWX 3ELNA 1SACA 4CUCA 1UYPA 4TWKA 3DC6A 2VWKA 2HWC2 1I5YA 4M3CA 2O57A 4H3WA 2F1MA 3LCPA 2IW5A 2X09A 1MEC1 2ATFA 4TTGA 4LBQD 3ZR6A 2WO1A 5DUVA 2Y69B 3N7MA 4JZ2A 3C3TA 3H3UA 4JV4A 1BZKA 1JTZX 1H4HA 4DR2O 3I4IA 1KS4A 3MI8A 3VBUB 3SYAA 2CU5A 4QXKA 3RYKA 3KV5A 4JHZA 2ZE5A 5F7UA 3OBRA 4LK7A 5A7WA 1PGL1 4LNVA 4R9BA 1UN1A 4B3MB 2YFZA 1XU1A 5ABJA 1JH5A 2X53S 3FAVB 3WDVA 1KMIZ 1YYNA 3IM0A 4ZZ8A 4XBFA 1XBFA 3GALA 5FBZA 1YUDA 1G9FA 2JE9A 2CWSA 3FX3A 3BGAA 4JV5O 3ZKYA 3KV6A 3VL8A 5LXTB 1WAZA 2UWAA 3PVOA 1XSQA 3NNJA 4YHHB 3G71V 2V7QG 3NXSA 2YC4A 3NQHA 1N3OA 1OJHA 1NH2D 3FB5C 1AR63 2V73A 4UBHA 5H5NA 4DR3O 3ZN6B 5FKCA 3U0ZA 4DUZO 1X4TA 2LW8A 2OKXA 3PU3A 2A6VA 4W6XA 2R1BA 3G7DA 2YGMA 3RI8A 3L73H 1EUTA 3D82A 4OCTA 4OFGA 4TV8B 5FP3A 2MEV3 1VBB1 4HL0A 2WO7A 1HNXB 3ZXKA 3N9OA 3CP1A 5T55A 1NXMA 4FFIA 5B2GB 3LIGA 3GZAA 4URTA 1VMFA 5LB6A 3WF2A 2E5LB 4OVEA 3AX4A 5C9AA 1UIKA 4BQ3A 2JGUA 1D4VB 4IE6A 4XPVA 3GHNA 2RS11 3WDYA 2ZACA 1S0JA 4JZRA 1AYN3 4UXNA 2BOJA 1QH7A 1N3PA 2XVLA 2WLHA 4PA7A 1DLLA 2C26A 4LF5O 1NA1A 2GMEA 3D6EA 2UU9O 1AYM2 4YJ2B 1OQ1A 5BMVA 1Y74A 2K1EA 2PHWA 3DYPA 3WUCA 3EB7A 1R091 1QR9A 1TE1B 4Q1RA 1WD4A 3AYAA 4NR1A 1XQNA 3PURA 1C8M1 3L2YA 3NVCA 1Q8OA 4UW6A 3FC0A 1HJGA 2ZIMA 4LOSA 4IDZA 4R52A 3H3LA 2D6LX 3CEWA 5C8YB 2PMWB 2RJKA 3LNNA 1KDKA 3V0BA 4IE7A 4Q4V2 2I45A 2RJ2A 4YVWA 3CCSV 2O0OA 3WG7B 4CDXC 1UU5A 3T1YO 1J3RA 1E79G 4KUMA 4DR1B 4GLXA 1RMU2 4LKDA 1YJ9V 2H6BA 2LGQA 1AJOA 4GX1A 1QOTA 4GB32 5FCCA 4J7KA 1SZBA 1CZVA 3PU8A 2J1RA 4QXBA 3UKVA 1RTVA 2P34A 2K46A 3JD71 4FLVA 2AACA 5IK5A 4PA9A 1S4CA 3W21A 2WLQA 4URAA 1JQ0A 4Y1VA 4J42A 3KCXA 4JDOA 3H50A 5FPRA 5J98B 4YVSC 4UT5A 4FO9A 3IB3A 1UYYA 1XOUA 4JI4B 1AL21 2P3IA 1W2OA 5FXVA 4WZCA 1V55C 4IUGA 3MLJA 1P7GA 2XKOA 4UFIA 2JIGA 3IPVB 1QJX1 3AMNA 4ISRA 4P9XA 5FUNA 1Z7S2 2EAAA 2XPJA 3FAVA 1MOFA 5FMDA 4BW9A 3JD2A 2FYUH 1F35A 2EIJB 2QQUA 1RUJ1 1IBLO 3HN1A 2BP6A 5JOZA 3BHPA 1WCDJ 3JB4C 1ONAA 2DWRA 1VF6C 4QU1A 1VIBA 2A3WA 5FPUA 1VAVA 4K8RB 5LK7B 2Q67A 4DO0A 4GX0A 4TSFG 2JGDB 5LXTA 1HRV1 4Q0SA 1DQ0A 4FPGA 3HKBB 4CCJA 1M56B 1QJY2 4Y3OA 5C8CA 2W87A 4RFT0 1GR3A 4Z82A 3AKSA 2E7AA 4P9LA 4EEQA 1DGLA 3TEWA 3PIJA 4X6RB 2EIGA 2QTWB 3SMHA 2ZMLA 1VMHA 3WHTA 1VMGA 2PY5A 1NKGA 2GALA 1TUBB 4LO4B 2WFF3 2ET1A 4H13B 2QKSA 4ZOLB 3A0BZ 5FYIA 4TV8A 2ZDIA 2Y6JA 3LA2A 4LULA 1QHDA 2O14A 4ES8A 4FTSA 4UV9A 4QPIC 4X64O 4HG6B 2W1QA 2R061 1APNA 1Y67A 4IEPA 3ZSMA 1PVC3 1O8PA 1D5AA 1KXGA 3G80A 2QNKA 5E1AC 5IVFA 4HMZA 2JDHA 2OTJV 3BU0A 1WA4A 3MUY1 4YJ2A 2DW4A 3S57A 3CX5F 2B42B 1BMFG 1M9NA 4L8QA 2A7AA 2V5DA 2XLFA 2F6BA 2LALA 1IURA 3LWCA 4I0XA 1NUKA 1C5HA 4CPBA 3ZFFB 4JKMA 1NQDA 3WCRA 3B69A 2BQPA 2HWF2 3VN4A 1K33A 5L7OB 1L7RA 2W1UA 1KJLA 5FY8A 4TUYB 2XJPA 3VBHB 1RUE2 4UUJC 3DXRA 1TMF1 1W05A 1U12A 4QPWA 3IMNA 1MS8A 1UWWA 1W9WA 3HD8B 4ZI7B 5C8YA 3OM3B 1FMD1 1WNSA 5FZ3A 1I6XA 1PMIA 1D2QA 4PD4F 1NXD1 1OURA 3D8CA 1YJNV 3RZMA 1OUXA 3ZYRA 1EP0A 2YI8A 4J9YB 1YQCA 3J80N 2DBIA 3R6SA 2PLV3 5I8YA 2DU0A 4JI5O 2R072 3NO8A 1D2DA 1BHAA 4DV7B 5AC93 1W8FA 4MXWB 1NCRC 2D6OX 2ERFA 2B8MA 4WFEA 3CEIA 5AVPA 1QJU1 1NTKH 1HLCA 2UXDB 1QDCA 1UMIA 2ODMA 3AYEA 2OPWA 5J3UA 3LNMB 3EXUA 3WLUA 2H0VA 3WNPA 4NTWA 4IIJB 1Y6XA 3VKLA 3GZUC 1PNLA 3LDEA 3OUHA 1MSWD 3IPVA 4J1XA 1EY2A 3K77A 2Q7EA 1Q82W 2GMMA 2PF4E 2JX9A 3N7LA 2OUHA 3CNAA 5FPVA 2ARAA 1VR3A 1CX4A 3HPNA 4E27A 3GWKC 2AZ2A 1UCXA 3EO6A 2WLLB 1GP6A 3AMHA 4GJYA 3RQ0A 2JGDA 3ZHTA 3HJRA 4JQRA 1W2NA 5A2QN 2YXYA 1LOAA 3T2TA 3LA7A 1NVPD 1RUNA 1RUD2 3ZYFA 5C4WC 1BEV1 3AMQA 2EVXA 3CWBH 3F7VC 5ITZA 1DU3D 4M4PA 2WO2A 1AYN2 2CDPA 3ZXGA 2W3JA 2ZE7A 4UCSA 3WDUA 5T5PA 1TUBA 3JBG2 1GV9A 5HCAA 2CY6A 2W52A 3ZFGA 3M99B 3H8XA 5HBAA 3LDBA 2VOTA 4X66B 5CA3A 4DW1A 1EN4A 4TN7A 4K0KB 2RDSA 1D7PM 1PGW1 4CEYC 2HEWF 1RINA 1EZVH 1AL0G 5DABA 3C3SA 3RYHB 3AKTA 1SRYA 4C1XA 3MLKA 5L36A 1UU4A 4OX9B 5C3RA 4IXLA 1YEWA 2Q5ZA 3RW0A 1QHTA 5FZCA 1JYXA 5TSWA 4DO2A 3WW4A 1F4MA 2D7FA 2D5FA 1WLTA 1XYPA 3WW2A 2PFWA 3J7LA 1D4M3 3IDAA 2Q69A 1VQNV 4LTAA 3AZZA 4XCAA 4AI0A 2VZTA 3OD0A 4XZPA 2ZABA 3R66A 3HQXA 4HKLA 1W90A 1LOFA 3AFGA 4Q4V1 3VQXA 1SA0B 5L3FA 1BQPA 3ICXA 2IH1C 3FHAA 1SBDA 4JAAA 3ST7A 3AMMA 2ZKOA 5GLUA 2WO3A 2R70A 1RMU1 2OVUA 5EC2C 1B35B 2ENRA 1JOJA 4TUYA 1JUHA 3VBHA 1XYNA 4ITCA 1POV0 3H1MA 4XF4A 4PDRA 1DQ6A 1ZRIA 1JJ2U 1WMFA 1U96A 4XVHA 3BALA 3ES4A 4JDNA 3I3DA 5J1XA 1MG1A 4I0AA 4E4ZA 1ZZBA 3JZVA 2VQAA 1QJFA 3SYOA 3I55V 1XNQO 2RDRA 1N36O 3KZ4C 5IVVA 1F4AA 2ZTNA 3BTXA 2IXKA 1ND3B 1UZYA 3ABKB 4LXLA 3PUAA 3NJXA 3OR7C 1SLBA 5DXDA 4YY3O 5GZFA 4B29A 2MK3A 4TSVA 2XLAA 2SBAA 2NN4A 4OI2A 2ARHA 1NLRA 1DGRN 5K0UB 2BPA2 2ZXQA 1U5IA 5JMOA 3ABMC 4QQLA 1X8EA 4YARA 4DR4O 2ZT9B 3DXTA 1Q6HA 1OOPB 4CH6A 1JMKC 1IG3A 4IIJA 2VQFO 2CL2A 4O61A 1HDJA 1Z5WA 1ZSPA 4LHLA 2B9VA 1NU1H 1ULDA 3VDBA 1COV2 4G2KA 4OZXA 3AK0A 4QPGB 2WFF2 3OBZA 2DUPA 2B1GA 5KAFZ 1ND2A 5GTIZ 1MQTA 4I9QA 3AYCA 5K7PA 3K5NA 2WLLA 2EIKC 2WABA 4A45A 2GV9A 5JQGB 2XGXA 4PF1A 4JAUA 3FKSG 2JG9C 5FZMA 5H6RA 1JCHA 3RFRA 5IVEA 4HK9A 4DRVA 1PVC2 5F3IA 2E6VA 4XF9A 5FYZA 4YW5A 2VY0A 5C8WA 3D4KA 1S0VA 4RSUA 2PUSA 2XLGA 4GULA 1AJPA 2R9IA 2EBOA 1QXJA 2A6YA 2CAZC 4IERA 3MICA 4MGZE 4EE2A 5C3OA 2JDIG 3LB9A 4Y5TA 4Q29A 3WG3A 4HANA 4OI0A 1Y43B 1R082 4C1WA 1F4NA 3OAAG 1OPOA 4QGPA 4PDMA 1ZNPA 2EXHA 1F7YA 2HG5C 2LO1A 2BSKA 2N74A 3ACFA 3RYHA 3ASNB 4L87A 2NZ9A 1BVP1 4BH9A 3C3VA 3VQYA 4DR6B 3H8RA 1WBLA 5C5TA 3ZRXA 3R65A 1ZBA1 4HZFA 4ZKIA 1BMV2 1GWLA 1HRI3 4LHSA 2UURA 1GSLA 3SGIA 1NZIA 2D6PA 5FZ6A 1BBT2 2PLV2 1TNFA 2LGWA 4XMIA 3CRCA 4BQ2A 3SPCA 2C0ZA 3VDDB 3C7OA 2XNDG 4AHXA 1B35A 3UESA 4IEXA 3INAA 5C33A 3K5LA 4Q26A 4XURA 2VQTA 4UVAA 3K51A 5KX5B 1SERA 4GMP0 1NTZH 3THCA 3MHZA 3N9MA 1HX6A 4Z92B 3GBFA 2VW0A 2OCCB 5LY1A 1AR61 4NPLA 1NLSA 3N7JA 1V54C 3WY6A 2VJXA 2ZGNA 4TLFA 1V6NA 4O4JB 1WW5A 5FP8A 4NWWA 3GDBA 3K4AA 5JDBA 1ND3A 4YW7A 4W6YA 1OVSA 4OPHA 4OMDA 5FMBA 2XHBA 1FNYA 5CBFA 4D3WA 5E6HA 1ZZ8A 4DV2B 4QM9A 2VZUA 3JD4A 3LA3A 5K0UA 5JCTA 4P2ZA 2MEV1 5L73A 4LF7B 2FBEA 5H9QA 3OPTA 4DUXA 1MS4A 5KXBA 3ZRVA 3RVZA 4FLWA 4QDQA 5JMCA 1OOPA 2ARCA 4Y1XA 5IAVA 1K3EA 4XQWA 4UB6Z 4JQTA 2DVDA 4G4FA 2YIBA 1XNTA 1AJKA 3N9LA 2WNUB 2YEVB 4Q0QA 3QTCA 2X05A 4QPGA 4LO7A 3VZMA 4FTBA 3H1WA 3ZSEA 5JJEB 1TME3 1Q8PA 2BOCC 3RYIB 3T4DA 1A6CA 4AAPA 5FYVA 5JQGA 5JUVA 1QXRA 2YUAA 4NXMB 4DXWA 2BW8A 4FOQA 1XNRB 2IVIB 1W2TA 4QXCA 2N05A 4ZU4A 3NWKA 3O5SA 1RM1C 2VZQA 1RSOB 4PA6A 3U07A 4R8HA 2C9KA 1HR0O 1EZJA 3HMYA 2YGLA 2C6SA 3MW2A 5A33B 1B09A 4YG6A 4M4RA 1NBMG 5JVDB 1O3SA 4D6TH 3IN9A 1DTOA 3ROUA 2GH2A 4NO4A 4JX0A 3ZKUA 1XOYA 2ZKLA 4Z1MG 1C8NA 1W8ZA 2ZD9A 4IEVA 4NWVA 4Y1YA 2E9QA 3BOWA 3P30A 1AR91 1W8WA 5K4LA 2ZR3A 1GWMA 3AZXA 4XFGA 4JKKA 4IEZA 3MV11 4PDLA 5GALA 3CC7V 5FYUA 4U2AA 2WDBA 4CCEA 4CDUA 1FXKC 3BIWE 1RXFA 4DXZA 4YFWA 2GTAA 3VGIA 1UPIA 3AG3B 3B02A 1LU1A 5FR3A 3N36A 1R73A 2DVAA 4XUOA 4BWAA 1C1FA 4QKFA 3FBYA 3JCZA 1G9AA 3KWVA 2CE4A 1CVNA 2JVDA 1FT9A 3VDDA 5CKQA 2G9FA 5C3PA 3ALQA 1J84A 1XNKA 1KC8W 1EN5A 4DR5O 5CU1A 3K48A 4MX3A 5C9AC 5KX5A 5FP7A 1GLHA 3P5BA 4GCZA 3ORJA 3QLQA 5HCHA 3POGA 2JENA 4XETA 4NRPA 2HKOA 2WS92 2ZX1A 3MUZ1 4BIUA 5IYYA 4PHZA 1AB3A 2R72A 4DV6B 2R9AA 2NQYA 1MS0A 2WC2A 4C91A 4LOTA 2JB4A 2XWBB 4Y5SA 3ZHSA 4HAMA 3CSXA 4DK0A 3ASOC 3B77A 4AQ2A 4CPBD 2EA7A 3VL9A 3D3AA 2DCYA 3ETQA 1IPJA 2FCVA 4F7ZA 5LGUA 5D5QA 1PO13 1C3HA 2WFF1 2UXCB 3UCSC 4LKEA 2Q73A 1V6LA 5A3TA 4XOGA 1XILA 2VOWA 1LOBA 2O8OA 1UZWA 1MABG 2XB6C 2DV9A 4LBLA 5FJKA 1K34A 4DV4B 2WL1A 3CE2A 4AEKA 4BR6A 4ATEA 4FOVA 1FKAO 3T4ZA 1PVC1 2WNUA 2Y0OA 1UZZA 2VAUA 4C7UA 4COUA 5A3PA 4DRRA 2GTSA 3POJA 1UW8A 2PI4A 4B08A 3MAQA 3VZNA 3VBFC 2EXJA 2A75A 1RXGA 4WVZA 4MV2A 2D40A 3RYIA 4OQ8A 2A70A 2BGOA 4N43C 4GWJA 2RM22 2XAFA 3MDPA 4JPRA 2ZINA 2XAHA 3U4XA 2WT2A 3WU2Z 5CBLA 3NW4A 1GN2A 5LMNB 1YFYA 2UXDO 1RSOA 2AHYA 1JYTA 2XH6A 3ETPA 3NR7A 5CADA 5FP9A 2A06H 5JAXA 4P9OA 3NRUA 2OPKA 3D0SA 1VRH3 2AENA 5LYJB 1GAXA 4CCMA 4XE9A 3QVNA 5SV5A 2W68A 1VBA2 1W8NA 3OMIB 3UYJA 2VZRA 1JPXA 4MW3A 2UUAB 1N1VA 4DRXA 2BGCA 2NR5A 4ABMA 3LOIA 3K2OA 1OLME 3QD6A 3HKEB 1AUYA 4O4HA 4B3RO 5FZOB 1KU9A 2ZZQA 2R6QA 4FI9A 1T6GC 4META 1Y66A 5AC91 3WD5A 3WFVA 4GAZA 3A22A 5FWEA 3O1RA 4FT8A 1UFIA 2G9GA 2ZCWA 3HR9A 4GKJO 3FHIB 3OY8B 4OHXA 4CC6A 5LBEA 3ZMZA 4ES9A 4D6QA 1I7FA 2VZVA 5LGTA 4EN9B 3CHXA 5GZCA 4Y33A 5FZFA 1K5MC 3IMMA 2PELA 1W03A 3WINE 3NJZA 5AFEA 1NOVA 4XFHA 2ORXA 5EYPB 2IJIA 2ZDIC 4I5SA 2ZEYA 3D36C 1N32B 5DAVA 3W5NA 4NAOA 2LW7A 4YG0A 4IEQA 1QNYA 3JD1A 4Q4Y3 5CG9A 2XDVA 2WA4A 3TEXA 4L2NA 5DG1A 5FDBA 5A6ZA 4YW1A 2P6JA 2ETNA 4N7IA 2BTOA 2Y6GA 4CS2A 1PX3A 2ZEWA 4INDA 3ZIAG 2ZZJA 4CDXB 5FYYA 4CS3A 4DV0B 1WB7A 3ZMTA 1GWKA 2WSSG 4TXWA 5EJ1B 2IXCA 4E2QA 4LF9B 2CTVA 3C7GA 2QWNB 1WA8B 4GJZA 5HV0A 2A5ZA 4COWA 4FIPC 3PLQA 4AQTA 1Q43A 4J6GA 2QFEA 4A3ZA 1YLLA 2BFUS 4YXWG 2GP5A 4YVSB 4S2DA 4BIFA 4F3JA 2JKBA 1FV3A 1RUG3 4N9HA 2VTFA 4AFCA 5T50A 2WLPA 1V55B 3UL2A 4GWIA 4Q4X2 3LSQA 3SCGA 1XJAA 5FZ4A 5A3WA 1RUC3 1NS1A 4YNIA 1O4ZA 2HJFC 4B1LA 2N04A 2FZ2A 4LFCO 4DIQA 2WT0A 2R9RB 3I5DA 4ZY9A 1D4M1 3EHBB 3ZXFA 2VNOA 5BNPC 3I2OA 2ADQB 2J1VA 3BODA 5J9PC 4I09A 4F8AA 3DYMA 3ACLA 2IVJA 4OI4A 4F6EA 3I8TA 2RR13 5K8SA 3VUOA 2HWE3 3B01A 3RN4A 1FNZA 1XI1A 1VE0A 1F5FA 5J2TA 2HKXA 3AP9A 3LEGA 3VZKA 2P3KA 3M3CA 2K9PA 3E22B 3FN9A 5DN2A 2VH9A 3G6JB 4J25A 4MADA 4I3PA 1UOBA 5F2SA 2IH3C 1KGYA 1OH3A 1ZA4A 2W95A 4D7YA 3RMYA 4PQ9A 5LYJA 3LUTB 1QWRA 4QPIB 1S0EA 2ZHLA 1XNDA 4FP3A 3UO3A 5KHGA 3OTOB 5F37A 1CX1A 3HKEA 2RVAA 3S7IA 3DCQA 3VHRA 5FZOA 1I5XA 1NX9A 3B93A 4WBNB 2JIJA 3I2JA 4IHJA 3OUSA 1DQ2A 3N4MA 4DUWA 2C5DA 2AR6A 4K8XA 1RP3B 1PV0A 3BAAA 5FJHA 4MVRA 1TVGA 3ZHVA 4AXOA 3JB8A 3OY8A 2GNBA 1M90W 1G7YA 4QE9A 1W9TA 1KQSU 2VW1A 1UF2C 4DUVA 2YS8A 2HVJC 4XUPA 4PIZA 3JD3A 5F32A 4X20B 3POSA 1MSDA 5CA1B 2RJZA 3AK3A 2QA4V 3MFCA 4EYUA 1NR7A 2FDJA 2JS5A 2A71A 3QCWA 4FLYA 1F8VA 3H1LH 4FBFA 1ENVA 1LR5A 1R6KA 4XEZA 1I0HA 4Y24A 1RVF2 3OGIB 2QGNA 1RL3A 2H6CA 3A4UA 3MPPG 4CDXA 3A0KA 4DS0A 5I0DA 2OWOA 3BOPA 1G86A 2A1XA 3I2HA 1GH6A 1IS4A 4QX1A 3ZIWA 3UKNA 4DR6O 3USUA 4X1YB 4K40A 4CCDA 3WNNA 3IDCB 1REDA 5CYYA 2C2AA 2G19A 1NCRB 1BLZA 1WA8A 3I2GA 5IJ0B 1ALYA 1JBCA 4IETA 2QWPB 1JHJA 3T1MA 3LDDA 4IESA 4MZUA 1COWG 2HWD3 3CC2V 1ASJ2 4YVSA 4DPNA 1VBE2 2GMPA 3BYWA 1W6QB 2P90A 3T1CA 2QE3A 3POEA 3NV1A 2GSMB 4DV1B 1D2SA 3SNMA 4AGRA 4LO6B 5FPLA 4D7SA 1PGSA 5HCBA 4WVMA 4FPHA 4QIWF 5C3QA 5FLHA 4GIQA 2X5IC 1ZLZA 4ASUG 5A1LA 2XHKA 1VIWB 4YW2A 5B4XA 1VF6A 2VOKA 4AI1A 1HB1A 3U78A 2PZSA 4QX2A 5I0SA 4FLUA 2JRIA 4DY3A 1HRI1 2D3OW 5A6QA 4MH0E 3OUFA 2ATKC 1DBNA 1VAKA 3AP5A 4RO2A 5C4WB 2WWSA 5CFDC 1EV12 1RGSA 5CBHA 1QNWA 3ZJZA 4EWDA 1H2MA 2K2SA 4RHV3 3CF6E 3FJSA 2XHNA 4NYKA 2DYSC 3E22A 1QLEC 3TBDA 1UO9A 2BBAA 1S0IA 4D94A 2YIBD 4PA3A 5F2VO 5C6CA 2YBKA 4L8JA 4Y20B 1H0BA 4JGYA 1AROP 4JAVA 1QKQA 3B09A 3O9OA 5FZHA 3FWEA 4CEYB 1OD3A 1ND2C 3RYFB 1KS5A 1MACA 2GSYA 3VKOA 3B7MA 4LE3A 3HT1A 1XPWA 3T0DA 5FV3A 1N1YA 3G4SV 4MUVA 5KUMA 3EBRA 4BQ1A 3JARB 3VZJA 3JALB 4WBNA 4Q4Y2 3Q8EA 1YI9A 2R0FA 5CEHA 4I4TB 2WLIB 5JOWA 1ZZCA 2R042 4KU7A 4LFBO 1GU3A 1UPGA 2AC1A 3GBWA 4O2BB 1N33B 3K5MA 4NXMO 2RE9A 2OQ6A 1O3TA 2VECA 5FZAA 1SC5B 1VBC3 1XNRO 5KXDA 3WUDA 5EIBC 2Y26A 3W5MA 5LOVB 5KHKA 3SXWA 1FOD3 3SPHA 2VO5A 4WM7C 4JTDB 4ZS2A 4YIPA 1OCOB 3RYCB 1QQCA 2J7MA 2GN7A 4EWAA 4X20A 5CA1A 5LA6A 4UYBA 4IV3C 2F43G 3ZMNA 3ECQA 5JLVA 1H2NA 4NTXA 2IXIA 1S0CA 1K5QA 1TME1 4HNAB 4V2WA 2VVEA 5F3EA 2VUCA 1PMJX 1WW6A 4SBVA 1LNSA 4YGCA 1WA6X 4HT1T 2DURA 1SLCA 1W6MA 3UO2A 4ZXEA 4OUSA 5FPAA 1XUQA 3WDTA 2YXHA 3U4SA 1L1FA 2MPFA 4XXPA 4TWTA 1NCRA 4KBBA 5IJ0A 2AXTZ 4QKDA 3T30A 2VMDA 3ABMB 3H42B 2CHHA 4XJ8A 4FP2A 3GF6A 2DE0X 2BTVC 3OGRA 4EFEA 3R05A 2FL4A 1CJPA 3WQ1A 2V72A 2HWE2 4XF0A 2YROA 1FXHA 2ZGPA 4XFBA 3T4VA 1X33A 1YTFB 2GDSA 2V4DA 4GKKB 1URFA 4K1ZA 3KHCA 3OBTA 2RS53 3SHRA 4E9KA 2QQKA 4XJUA 3UNPA 4D0QA 4UW5A 1JZ6A 3BTAA 3QH6A 4LP8A 1XHZA 1Q8SA 4XBNA 1A8MA 2WNVC 1DGSA 5IYZB 1JOBA 2EIKB 2K0GA 1CPYA 2XJVA 1V6IA 2PYLA 3E8BA 2DCZA 2ZMNA 3E5QA 5FZLA 3W7XA 5B1AC 2FDGA 1VF7A 2PQSA 4YW6A 1NCQC 2PHXA 2JG9B 1FX5A 4AZZA 2LW1A 4LKSA 3X2QC 1DCSA 4MGYE 5C4WA 1UU6A 3JAMN 5JXJA 2IBZH 1O3QA 3PNAA 1RYYA 1C28A 3K58A 3CRQA 2ZX3A 2A3YA 4LA2A 2HWC3 1IGOA 4Y20A 2XR4A 3AG2C 4BLJA 2G9ZA 4CEYA 4KWLA 1O5LA 1IS3A 4FPYA 3MGUA 4DEQA 1J3PA 1WCQA 5BR8O 1CAWB 1I3HA 3O1PA 1WPXA 3V0AB 3JARA 4OLLA 3SH4A 2VPVA 4GA9A 4FPPA 3JALA 1JZ7A 4BMEA 3CPWU 1PO11 4I4TA 2WLIA 3VOUA 2R16A 2HEPA 3KS7A 4LJHA 4JF3A 4LC1A 3FB6C 5IUQA 4O2BA 2RHPA 5K1XA 2P6HA 1R1ZA 5JCOC 3ZSJA 4LO5B 5JR7B 2D5HA 2ZX0A 1YJLA 3IAQA 1CAXB 5FZIA 3F7YC 5LOVA 1LULA 5LMNO 4LMFA 3FUQA 3M2MA 2KB1A 4HOOA 1WLWA 4CZSA 1BE3H 2A7WA 2GNTA 5ANQA 3WEZA 4ONUA 3BU7A 1QJZA 4Q5OA 3CXHF 1UL9A 2HWB3 3GB7C 3U14A 2DTYA 5EQUA 4G28B 2UUAO 3N2KB 2BYVE 4BXFA 4HNAA 2YZ4A 1TAEA 1PM9A 1V54B 3AG7A 5IK7A 1W0PA 4RQPA 1OCCC 4W4KA 2G4IA 5I91A 2D2CB 4EB6B 5H2FZ 1OHHG 5IT9N 4X1KA 3K9AA 1RUH2 1W2UA 5I93A 3PUSA 1K9MW 2VCAA 1PZ7A 4KL1A 1UMZA 2QZ3A 3JD0A 3R0RA 2ZXWC 4I55B 1VRH1 2JE8A 4LPLA 1QLNA 2E74B 4RL7A 1RUI2 3APOA 4NKGB 4OHVA 3AC0A 2F93B 2ITCC 4DV5B 4DXRA 2Z0AA 4JKLA 5HXVA 2XQRA 3CZJA 2RS32 3GBGA 2Z5UA 4LFAB 1YFWA 3H7YA 4D8MA 1I94O 3FFZA 3AKQA 2O1QA 2XXZA 1AYM3 5C93A 4NHLA 3UKTA 5HV4A 1EM1A 1YCIA 5ACA2 3AVSA 1E5SA 2CGPA 1ORQC 2J42A 3I59B 2WZEA 4NUBA 4X62O 2OA2A 5BXZA 3ZN1A 5IYZA 1ZRCA 1FXZA 3CCJV 4DFSA 3I2IA 3H3ZA 3ME2A 3MPBA 2KXLA 1LHWA 4NXNO 3SYPA 4LF9O 3WF0A 2JG9A 4XTPA 4ZZ5A 5FZKA 1LAJA 3TN93 1GQPA 2DVBA 2RN9A 1WUVA 4Q0PA 1P7BA 2XASA 1RM1B 3BB6A 2JXAA 3GJBA 5FFOC 5BY1A 1S0FA 3TCUA 2ET7A 2IC1A 1U5YA 3APQA 4Q4Y1 3VBUC 4FAHA 5F8PA 2C1FA 5EV7A 1QY4A 3B94A 2VXRA 4GB33 3AFKA 1SQPH 4JI7B 4YW3A 4CC5A 1FOD2 5B3SC 4QGNA 5HXMA 1HB2A 3PTRB 3L2HA 2LJ2A 3E6CC 2VNVA 2OYZA 1SZXA 5GONB 4XAEA 3CKHA 2XJQA 2CWMA 3CO2A 3OFNG 1CAWA 2BEOA 4X8NA 4Q6GA 4AVSA 3V0AA 1DDLA 3KT4A 4HK8A 2YB7A 5FQ0B 1KEXA 3O0VA 5LHHA 1FXKB 4R6ZA 3ZPOA 1TUEB 4P30A 1JZ5A 2ZM6O 2KR2A 1ODNA 2ADEA 1RUG1 1Z7S3 1QBZA 5LBFA 3ZMOA 4Q8LA 4HZ3A 2OT7A 4CH4A 1UXZA 3VBSC 5ISLA 3RWNA 1CAXA 2EALA 2P22C 1RUC1 2QEXV 3ZMVA 3RJ2X 4YZ1A 2EIDA 4Z2WA 1W0OA 4Y4YA 1T5EA 3C7EA 4HN0A 2QQWA 1GP5A 1GKBA 4LBNA 3ZDVA 2F23A 4JYAO 1CN1A 2UYBA 5C9AB 5KA5A 1QJY3 4WFHA 5KMGA 4RQFA 2BWCA 1IPSA 4Q0VA 3PMEA 3FLTA 2RR11 3ZN0A 1IBMB 2RS52 2CK3G 4FAGA 1OA2A 5BMVB 1JODA 1Y74B 1WWYA 4IE0A 3P32A 4CU8A 1QQP2 4R9AA 5T5LA 4IL6Z 1L0LH 3CJIA 3ASOB 3RZJA 4GUNA 5CBGA 3GZTB 3T1LA 5D21A 2Z4FA 1RHI2 4MXVA 1MZ5A 5LHGA 4ISQA 2X7RB 4UCVA 1DQ5A 2NM1A 2BZDA 1E1RG 1EPWA 1QEXA 4LKFA 1S55A 1SQQH 1W06A 2VG9A 4P9GA 4I55A 3DUIA 5FY9A 1K92A 4JI6O 5JWPA 3O7OA 4P5HA 2XTAA 1KKCA 3HB3B 4MS2A 3DECA 5JXHA 1EPZA 2YXSA 1SQVH 1YITV 3RPQA 2E33A 3POFA 2F4VB 2AH2A 1AILA 4UB8Z 5GZEA 1FFXB 4O4LA 3ZO0B 2FKXA 4ZHNA 4BIOA 4AAXA 2GU9A 1M57C 4IGPA 4W65A 4XJZA 4ASKA 1Q8QA 3I59A 1OPMA 4UWDA 3CDZB 1J95A 2FCTA 2HWF3 4AG4A 4JI1B 3MIHA 3VBFB 1G9DA 4AHCA 4QWNA 4LIUA 5I0UA 4IW3A 3LPFA 1RUE3 3KCCA 4N43B 4RUEA 2QM7A 4LF4O 1ENQA 4JRAA 2EAKA 4YJ3B 4UXAA 4MHUA 2CAUA 3M7MX 5FOBB 1F15A 2DTWA 3IGAC 1DK1A 1L8DA 1FATA 2YIDA 2KD7A 4H37A 4D6SA 4DUYO 4W6WA 1H30A 1Y4WA 1VP7A 3Q8BA 4KG0A 2ZMKA 1V00A 3GYDA 3DPRC 4OMCA 3UJQA 4D6RA 5D2AA 2QDRA 5FZ7A 2R073 1IX9A 2KKWA 1AR72 2J1EA 3URFA 5LEKA 2B46X 2BTQA 2ETEA 5LATA 1SS3A 3CRRA 4WM8C 3LFIA 4FPLA 4XILA 5F5AA 5GONA 1OXCA 2QJVA 3HBKA 3UQ8A 2D44A 5C8CB 1YIJV 3OBAA 1EN6A 3H1JH 1ZA7A 3HPLC 2HWB2 4XF3A 3B00A 2FMYA 1UJWB 1AR82 5FQ0A 4AHYA 4XACA 1M56C 3OEEG 5JOXA 1FXKA 2HWD1 5EIYB 3SYQA 4H55A 3OT7A 3S3WA 1W0KG 1K5MB 4L99A 4QQ2A 1C57A 1KFUL 5A7QA 3DYOA 3STZC 1VQ5V 3BKZA 1AHSA 2W94A 2QBXA 1XMQB 4KNCA 1YJWV 1GZ9A 3N7KA 4XFCA 4IGGA 2Q8OA 2ZKNA 4JHTA 2FDFA 4ICGA 2W1WA 3KQRA 4I30A 5B4NA 4GZRB 1DHKB 3P3NA 4AHZA 5JI7A 5BZBA 2XJTA 1RUD3 4WFFA 4DV3B 1FXVA 2P6CA 3TXQA 2XOMA 1WGPA 2CNAA 3A23A 2NYYA 1FFTB 3RJRA 1ZWIC 5JSRA 3SPJA 5E79Z 2ZQMA 4H7LA 1VQLV 3JBG3 5A7SA 1GNHA 3MD0A 2IXLA 2B5UA 4RHV1 3VDAA 4I0XB 4AILC 3LPGA 3HKDA 1PNGA 2Y6FA 4AEDC 4J9ZB 4GMP3 5BUVA 3GHMA 1PD3A 4DR2B 3I54A 1NG0A 1YQ2A 3DL3A 3MF6A 3DXRB 4I0BA 2MW2B 5LRRA 2A73B 1HXS2 4P00B 2YFUA 2ID4A 2X29A 3TN92 5B66Z 1GK9A 2P5BA 3D3IA 3BY6A 1SG3A 3ZBHA 4NJ4A 1QIQA 2J1SA 4JI2O 5I8SA 3E6DA 3GWOA 2GUZB 2WAAA 3JQXA 1UYZA 5B1BC 4Y26A 4QNHB 5F39A 4CH5A 1BQZA 4AQYO 1VEWA 5KC6A 1FFXA 3D5OA 2QM4A 3U11A 2GNDA 3KSCA 3J81N 5EJZB 1T2XA 1ZRRA 4I50B 1J58A 1N34O 4JV5B 5IE9A 3E8HA 2IU0A 5BNPB 4ARXA 3OMNB 2DFBA 4W4ZA 5L3GA 4K3AA 1BK1A 3CD6V 3VBFA 4CP1A 2WZPP 1RITA 2VXJA 1VBC1 4L11A 3L75H 2XAGA 3OMAB 4DR3B 4C90A 4XIKA 4DUZB 5KHHA 4N43A 3AB0A 1FOD1 4JC1A 2RG4A 5CKMA 1IS6A 2JJ6A 3ZX7A 4YJ3A 3ZYHA 1GQHA 4TZDA 2BWAA 2HLEA 5AG2A 4AFBA 1S3JA 2A79B 2EXIA 4CA9A 3RBZA 4HYOA 1ZBE1 3WP6A 5BY5A 4AI8A 2VZ1A 3T0AA 3ZYPA 3W7UA 4FM0A 1F4HA 5EK0A 1ST8A 4GKKO 1IG0A 5FY4A 3QO5A 5FO8B 2B4KA 4MGQA 1MS3A 2ZHNA 2DCKA 3ZSLA 4PI2A 4AQ6A 5CMUA 4NPMA 2BNMA 2QDNA 4DINB 3AYDA 2WNOA 1Q90D 3LIHA 3MV01 1XNAA 1H2SB 3PVNA 4QKBA 2JB8A 1O5UA 4BXSV 2VW2A 3APBA 1UY2A 2H8PC 3MIDA 1O59A 2FMLA 4R50A 4X65O 2P17A 4LF5B 3THTA 3E83A 2UU9B 3SEPA 4XUTA 5ITZB 4B1MA 3B40A 2Q8VA 4F6RB 4MTXA 5CFCA 1SLTA 2QKDA 3LD8A 1W6OB 5KR7A 4B3NA 1COV3 5LMUB 3Q8CA 1VQPV 1G9CA 1ZX5A 1VQKV 2RNBA 1K5MA 3ZFGB 4E8CA 1JN2P 3VBOC 5FZ9A 2RS51 4JGYC 1JYVA 4YFZA 5J09A 1DYOA 3WHUA 1XE8A 1WCUA 3T1HB 2J1AA 5L19A 3D36A 4QB1A 4LITA 3QH7A 2CDYA 2KA3A 1IBKB 4AHWA 1CXZB 1OUSA 2WN3A 2XBO1 2Y6KA 4FM1A 1CAUB 3CRMA 2ZGRA 1QU0A 3UM7A 5FKBA 1GANA 1ROPA 2IZWA 4FPFA 4HFSA 4EZ4A 4RAIA 5FY0A 5DDJ1 3T1YB 2EINC 3AMPA 3LSEA 4JVAA 2A3QA 2PYTA 1LECA 3RS6A 5T5JA 2OZJA 3UJOA 4H0LB 4JI0O 4NOTA 1QR8A 4LQRA 5JSOA 1PIV2 4XZUG 1HNZB 4YM0A 2HEYF 5H9RA 5LA1A 2VBBA 3PL0A 1CGPA 2Z79A 4MLOA 1R083 2Q0OC 4CCOA 2HWC1 2UUCB 2HH9A 1DZQA 5IWFA 2YU2A 1E57A 1AF9A 1OT5A 1YFXA 1QVGU 2JDMA 3ZHRA 4R7CA 2ADPA 1ZAUA 1VAMA 3GZEA 3RSJA 3F5WC 5JIAA 1S1AA 4LIVA 2EILC 1POQA 2DYCA 4QMAA 4ASMB 2GUZA 2PAEA 3J8F2 3GJAA 4QU2A 1HQLA 1XXNA 4QXHA 1DIWA 4ZKTB 5FLIA 5F1RA 1IBLB 1PO22 2WIIB 2X5IB 4U7OA 1N8RW 4XAAA 3K0DA 4MGKE 2Q30A 2VQUA 4I50A 1BBT3 5BNPA 4RGKA 4FLZA 4UCTA 1LEDA 3CMAV 4CEWC 4JCKA 3ABTA 1IQAA 3C7FA 5CVRA 3P3PA 2V4VA 3VZOA 4JTCB 1N1TA 1BYHA 5CFDB 1S0DA 1WCSA 3IZOA 3THOA 1SMVA 3ZYIB 4AVBA 2ZGUA 4OHYA 1BZWA 1B6QA 5HFMA 1V9U3 4TQDA 2L35A 2VUAA 4AQSA 5JVVA 1YTFD 4LR4A 2AEZA 1QLEB 2ZOEB 2PHLA 1UD1A 2VRZA 5FZ1A 4BAYA 1FPN3 2HWB1 4MTFA 4DV5O 1JFFA 1Y3TA 1QF3A 4BW5A 1VQ9V 4OUMA 2IU3A 5FMCA 4LBMA 3HR0A 4FXKB 1M1KW 1W28A 4LFAO 1CAVB 1MEC2 2JD9A 1ND2B 3RYPA 3AXDA 1MQTB 4Q4W3 3HN3A 1W39A 3C8XA 3AG1C 4PCRA 4KWUA 2SLIA 3BABA 2Y60A 1O8SA 2VQ0A 2XUEA 5IT6A 3JYCA 2ZGSA 3AK1A 2OTLV 4E2SA 3HBZA 4DK1A 2ZEXA 5IW0A 1HNWB 3ACGA 3B3QE 5F6KA 3LQCA 2AZ0A 1PM7A 1PGL2 4RQEA 2VMIA 4XJAA 4FOWA 4QQOA 4NE9A 4F6RA 5LA9A 1OA3A 1TZOA 3NV3A 1HIXA 1MVEA 3VKFC 1GZTA 2Q7HA 4MVSA 1W6OA 3WP5A 1HKDA 1S5HC 3RWRD 3TETA 1FJGO 1GBGA 3VKNA 4WM7B 3CJHB 3BA8A 2OUJA 2VC9A 1AYM1 3LSSA 4P14A 3KGZA 5EYYA 1S2BA 3WF1A 5ERLA 3SPGA 3S0MA 4F4LA 1K5SA 3RZKA 3S6PA 2VCMA 3J7NA 1UNBA 4BISA 2BSKB 1YXWA 5JPNB 2DJVA 2PA7A 4JI7O 1PK6C 3U37A 4MG2A 1CAUA 3GXUA 5GW7A 4L97A 4EROA 1O9GA 4FPEA 3KV9A 1F9KA 2UUBO 3EJKA 5LP6A 5KBFA 3O65A 4EFBA 4HSLA 5FZBA 1MVQA 4RS5C 4K3UA 4HBNA 1A78A 3CQOA 5GLTA 3PJYA 5IWAO 4Q8KA 3K3WA 5DQ0A 2MNGA 1R6TA 2WQ4A 4M00A 3K4DA 3N9QA 1FV2A 1J59A 1WLDA 1BXHA 3ES1A 4MGTA 2L9LA 2PTMA 5GLZA 3ZRWB 2VTXA 4IT5A 4GB31 2R7EB 2BERA 1R1BA 4KU8A 5J48A 3BI3A 1W99A 4XHBA 2RS12 4R9DA 3DF0A 1BHGA 5L3CA 2B9UA 3IC9A 4B3SO 3FYEB 3MYXA 4KG8A 1O91A 3NMBA 1XNCA 3I3EA 2W6JG 1UMHA 3BFRA 4RQPC 2TNFA 2D3RA 3OOXA 3FB7C 2WNVB 2X5IA 2ZS6B 3WNXA 1LUWA 4IEWA 4JI8B 4RR3A 1R092 3O12A 4GX2A 2NNUA 4N90A 1Y7BA 1JYWA 1Z7S1 2PGGA 5B1AB 2VVDA 1Y9GA 1C8M2 4XFAA 2W2IA 1IPKA 3TWIA 4B8EA 3H1YA 1XBLA 3KB5A 3X2QB 1OLMA 4PA4A 3WCSA 5CFDA 5E16A 1SCRA 4Y4RA 1S0BA 3KVBA 1U5ZA 1HQWA 3OGVA 5CA0B 5HFLA 1K8AW 5IK8A 1D5NA 4O65A 5IK4A 4TV9B 2QJ1A 1H6YA 1KB9F 2WS93 1JOPA 4PIXA 1VP6A 1QJY1 3LZZA 3FD9A 3NKGA 4LE4A 4GQ7A 4FLTA 4J10A 4KQ7A 1CPNA 2GC2A 2D6KA 3WB0A 1ULPA 1CAVA 3VV1A 1ENXA 2ZJCA 3IWZA 1GNZA 2BJSA 3AZVA 3JD72 4GWMA 3B8NA 1W2AX 2LUWA 2VOVA 2Y33A 1GICA 1GZWA 3G6EV 1XNBA 3HOBA 3WB1A 4B4RA 5JZGC 1JJOA 1LOGA 4YSFA 5LEJA 3UK9A 1QOSA 1UXXX 4I2OA 4EKWA 1UAIA 1AL22 1W6NA 3OUIA 4OXSA 4F83A 5LWBA 3ITQA 4K1YA 1F51A 5IJ9B 5FO7B 3USSA 5B1NA 3VQVA 4NIGA 1QJX2 1S5JA 4K9SA 3VKMA 2Y0IA 5EXOA 3LDCA 4DR7B 3EQEA 3TNQA 4XMAA 1UKRA 2GZWA 4WV8A 2WBKA 5JI9A 1Q86W 5CAZA 4WM7A 2ZGOA 3I3BA 3CJHA 2BOIA 4UCRA 4B3MO 2EJ7A 3WB2A 1HRV2 1YFUA 1AI7A 4HKOA 3IAYA 4IV3A 2BGPA 2VWJA 4HKWA 4UW4A 2XL7A 2P5OA 1LB2A 2HWF1 5FAXA 2Z42A 2UY9A 2YMZA 2GH8A 3UETA 2RM23 5IYDO 4CU9A 3JATB 3GCWA 4QHZA 1R3KC 3BCCH 4MO3M 1XNQB 1OCCB 1MS1A 1RUE1 2QQMA 5FPBA 2OCHA 4YHHO 1YHQV 4AEMA 3IDBB 4CDUB 2JDNA 3A8TA 2WYFA 2E26A 3BRCA 3VBBA 3H9AA 2FB5A 3L72H 4FTEA 1WKYA 4P9JA 3ZFEA 2UXXA 1W9SA 1X59A 4QGLA 2A6XA 1VBA3 5DZGA 3ZDSA 2QWQB 3ZXEA 3CCLV 1V9PA 2ZXWB 5KUKA 1JR9A 2ADDA 4WFBV 1GTOA 1M93A 3LSUA 1H8TA 4DR4B 4ZONA 3ZRWA 2XAQA 2D3PA 2R071 3A0HZ 3ZS8C 2VQFB 1HNXO 2BFUL 4NHYA 1HV0A 2IJKA 1XB9A 3WQ7A 1AXYA 1V9U2 3FBMA 1MS9A 2I74A 5L9VA 2JDZA 1EAH3 1H2LA 4BU2A 2E5LO 1BQ0A 1OSGA 2VMEA 3OJBA 2ZE8A 2HYXA 5CISA 4DV3O 1FPN2 4RYDA 2RV9A 3M1HA 5JR2A 2WNVA 4HPKA 1JZ8A 2WPDG 2HYKA 4FCAA 3CJIC 3JASA 1GN4A 4L9BA 5GJ6A 3ACHA 3PUQA 5GM0A 3THDA 4Q4W2 4WBBA 1YVWA 3POWA 5LW9A 2IJHA 1NCQA 1TMF2 1F2NA 4R8CA 4E4SA 2P67A 3T3YA 1GOFA 3WG1A 1N47A 3DN7A 1FMD2 5DUXA 1JOYA 5A32A 2JWPA 2NN8A 1ZBA3 5CA0A 3UKMA 5FMOS 1ZZ9A 2QQJA 3DEMA 1I5ZA 3SCFA 4TV9A 2WYSA 1RUD1 2J1TA 2DQ0A 1JYIA 2Y64A 2WRAA 2VS0A 2EZPA 4PLMA 2IM9A 1CIWA 4UFKA 1AYN1 5B3SB 2QCSB 4AFDA 1MZEA 2DF7A 5FY1A 3AK2A 4FOYA 2X6CA 1K12A 2WNEA 4CVUA 3JBG1 3LGRA 4Q20A 1QJU2 1UYXA 3RRDA 3SLIA 3RZZA 3RMXA 4DR1O 1P4RA 4J41A 4JASA 3TXSA 3DKWA 1KFXL 1XU2A 3OUJA 3I3MA 5FZ8A 5F5CA 2VL4A 5H9PA 3RDIA 4GMP1 5IVYA 2ZGTA 4D7TA 3L9JT 5IJ9A 4Q4X3 3DTUB 2UWCA 3M4FA 1VBD3 4LF6B 2Y4TA 4NHKA 1QGLA 5JCOA 3RYRA 4CYDA 3M8LA 3P6BA 5AVAA 3VBSB 3MO4A 3POIA 1BK0A 4JI4O 1OCZB 4CDWA 2ZCEA 1JW6A 3B2EE 2XG3A 2Q4PA 4DRXB 4BCUA 3V64A 1Q81W 5FTTC 1TQ5A 2P4EA 4O4HB 5EP9A 4U3FH 3EXAA 5DPNA 4XJ9A 1BEV2 2QZ2A 1M06G 3ZCCA 1UY4A 3JATA 1J83A 2YC0A 5FXWA 3PHMA 4Q27A 2H3OA 3W7TA 5DEDA 3TEZA 3K75B 2L6LA 1JZ4A 1GRJA 4CU6A 1FS0G 1DQ4A 3Q8FA 2TEPA 4GKXA 3WV6A 2YHJA 4OPAA 3SC7X 3G6BA 4X89A 5TISZ 1O3RA 2QKAA 2CDOA 2ZAAA 2IWGB 1PHMA 3DXUA 1PGW2 4QHBA 3IIIA 1ZZ7A 2OXBA 4KH9A 5LMUO 1I5PA 3IT8A 2JDUA 3U1XA 3VB9A 1CONA 1O4TA 5DZEA 4QQPA 3RNSA 4QPYA 2KG7A 1FYJA 1BCXA 4XDKA 4QX0A 3E86A 5IYCO 1G1XB 2HHHB 1GYKA 3B8MA 3T1HO 4JGZC 4QPKA 1A34A 1VMJA 1W6PA 2E3CA 3VBRC 3WOGA 1CQ9A 3WF4A 3TB0A 3ABLC 1IBKO 1QU7A 2JDPA 4FPKA 4ZBMA 3AP7A 4G3YC 5C7GA 5LL6Y 3KMHA 3X29B 1M57B 2DBNA 1Y76B 4XBQA 3J7MA 4RD7A 3ZEDA 3M7AA 4L0PA 2DYRC 1OCRC 2Y8KA 1JU3A 2GC0A 5APAA 3FZ3A 3O0WA 4HETA 3ZXAC 4LO8A 5J7MA 2A6ZA 1COV1 1YHFA 3SKJE 2M6YA 1SDDB 2WLNA 5KAIZ 3D0JA 2JEXA 1AR93 3A7QA 4QX7A 3ZIXA 1OF4A 5CB7A 2TUNA 3ILFA 3VHOA 4NPRA 4XFIA 5KA6A 4IE5A 1HNZO 2BE3A 2JEUA 3ETDA 4XABA 3NNLA 2WWUA 1HR0B 2UUCO 1JS9A 1H4GA 2EIEA 1L0NH 1S2KA 5BNOC 1RVF3 4IEOA 1ZUQA 1YXBA 4X8AA 3VBUA 2VBPA 4IQPA 4RGAA 2J22A 1ODMA 1ZYBA 4LCUC 4S2HA 1XREA 4MVMA 5LBBA 4ZPIA 3DPRB 4I7ZB 2WZR3 4QB2A 4H44B 4WFAV 2N7GA 1IKPA 1MZ6A 4Y1ZA 2VTXJ 5A7OA 2D6NA 1RPRA 4CDQC 1NJIW 4WM8B 1S77D 2OS2A 2ZGQA 2W92A 4P5YA 2P4KA 4CE8A 4CUGA 1B3QA 1ASJ3 2LM3A 1VBE3 1BVVA 1VB4A 3TJTA 4TYSA 1GNYA 4DV7O 2KSDA 4Y5Z0 2ZGMA 1R081 1STMA 1UKGA 3VHPA 5J2TB 4I02A 1CEZA 1U97A 4A7YA 2W6IG 3W9AA 1LOEA 1IZ3A 1H8EG 3ZN6A 4CXWA 3OD4A 3NL1A 2XJRA 5EYXA 3ETGA 4LHKA 2EF6A 2M7WA 5C3SA 3VBSA 3DC5A 1JHNA 4XBLA 4UFHA 2QVSB 2QQLA 1W8TA 1YIFA 3RVHA 1BMV1 1CD3G 1UY0A 4QDRA 1QVFU 1MA1A 4EZHA 4K7JA 1UY3A 2Q4SA 1N1SA 4DR5B 2QQPA 1PX4A 3H0OA 3SITA 1BBT1 5T52A 3O1UA 2PLV1 2WFPA 1VF5B 3R4DB 2FDIA 1DF4A 2JECA 1EV13 4IHJB 2PHTA 4JI3B 3K03A 1E1QG 3NKTA 4IGOA 2F66C 4KWJA 1LHVA 3HVDA 2FTKA 2KM2A 4XDPA 2VE1A 1GMGA 4YLZA 4A3XA 1EAH2 1GOHA 5CFCC 3JCIA 4QAWA 2Q1ZB 1KECA 3OGSA 1V9U1 4R4ZA 4MGIE 2QQVA 1SPPB 4FQZA 3VD3A 1HNWO 3VQWA 1U5XA 1SEFA 4H2AA 2QR4A 3AZYA 4AEDB 2VMCA 5DN6G 3I3QA 2GC1A 2Q6AA 1M4WA 1H9PA 2VMHA 1FPN1 2GAUA 2Y6LA 1Y4MA 2Y6HA 4XQ4A 3B9CA 2BRTA 3K57A 3WDWA 3O1VA 5A6XA 3KF3A 5CA6A 1XYOA 4B7EA 1LNQA 4X66O 4Q4W1 5FLJA 3ABUA 2R043 4X8PA 5FXZA 3SYCA 4K0KO 2B1IA 5B1BB 3LDKA 1K5JA 4AYUA 1SLLA 1ZBA2 3NJYA 3H1KH 4H33A 4XXAA 1NLQA 4O9GA 3BN6A 4W8JA 2Q8EA 4BJ0A 3H1IH 4OX9O 5FUPA 5JH7B 1Y76A 3USUB 2ZHMA 3TRSB 1WN7A 1OMIA 3PVBB 4XDLA 4RA0A 4U7NA 2EIMC 1BHBA 2YICA 1EBOA 2GBOA 5L3BA 4CUAA 1JA8A 4QKNA 4X1IB 2GNMA 1SLAA 4QQHA 2ZIOA 2E32A 2DCTA 2HJDA 5FP4A 1UX6A 2W0XA 5J96B 1YSCA 2VZOA 5C71A 4Q1PA 1KBHA 4AFAA 4DQAA 1WBFA 2HVKC 4YM2A 3WX5A 1AR62 2Y48A 4IYIA 1VARA 1VBD2 2HJIA 4FM2A 4NHXA 1K4CC 4NVPA 2LROA 4WVMB 2BOBC 1WCKA 3Q9OA 2ITDC 2OX0A 4A7KA 3DPRA 3BTYA 4XCBA 3N9NA 5A1AA 3OGGA 4GD4A 1OA4A 1H38A 1JMUB 1HDKA 1WLCA 4B3RB 2VCCA 1H1MA 4WM8A 1S5LZ 1W8UA 4JI8O 2MEV2 2JICA 2WN2A 1AX2A 1IHMA 4QM8A 4PLNA 2JJ1G 3K79A 5FOJB 4GKJB 5FYSA 3HKBA 4GH4C 1CJDA 1SETA 3P1IA 4MT8A 3KQ4B 1DFQA 2NLJC 1ACCA 1AZDA 4DW0A 2W39A 3K06A 3SJAC 3BCWA 4JYCA 3VBOB 1JVMA 3L70H 4JGYB 4XJWA 4FPJA 4Q0UA 5BNNC 2YSUB 1PNMA 3KT7A 2YG0A 3B5LB 3EVKA 3ABZA 2A0LA 1O4YA 3PIGA 4B3TB 4M3CE 4XC9A 4QDSA 2JG8C 5FLXN 1K97A 4AI2A 1C4RA 5BXXA 4I3GA 4ZOLA 1ENSA 3AJYA 3O0XA 2PHDA 2Q1FA 3H1HH 2Y38A 1HN1A 4CUBA 2EINB 4DZGA 2A6WA 1LOCA 1V6KA 1KP3A 3ZR5A 2QDOA 4LWSB 4UOJA 3GM8A 4A44A 1X9PA 3HEIA 4CTEA 3KG2A 1SPPA 1DGRA 2P06A 5EIBD