4KL1A

Hcn4 cnbd in complex with cgmp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic dinucleotides bind the C-linker of HCN4 to control channel cAMP responsiveness.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 60
structure length 192
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4kl1A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kl1A02
4ZU4A 5JSPA 4I02A 1SFNA 4LEJA 1YWKA 2BEOA 2BNOA 3KMHA 1WA4A 2GAUA 5JSRA 4WBBA 3QACA 3BU7A 5LEKA 4MV2A 3E5XA 4AXOA 3NJZA 1J58A 1ZX5A 3IIAA 4TLFA 1ZZ8A 2HKXA 2O8QA 2IXLA 3CO2A 4XFHA 4MGYE 5FDBA 4MGIE 1LB2A 3E5UA 1FXZA 2ET1A 1QXRA 4JV4A 1EY2A 2GH2A 3H50A 4MX3A 1FI2A 1QWRA 3I7DA 1CAVA 3IWZA 3ES4A 1XRUA 2WFPA 3ELNA 5CU1A 3MDPA 4O9GA 5FLIA 1RC6A 4FT8A 1DZTA 4IEOA 4N9IA 4Q29A 1U12A 3ZDSA 2QNKA 4I09A 4KU7A 3NW4A 3ACLA 1LKNA 1EYBA 1ZZ7A 2GU9A 2UYAA 3L2HA 3UKNA 3HQXA 4JTOA 2B8MA 4O9EA 4QGLA 5FCCA 2OZ6A 1VJ2A 4AVAA 3PVBB 4XFCA 1O5UA 1YFUA 1RUNA 3WW3A 3OD0A 3RDIA 3E6DA 4ZU7A 2XGXA 1YLLA 3HT2A 2H6CA 2ATFA 1XE8A 5FPXA 4BYYA 3ETQA 1WGPA 2BYVE 2GC3A 2QDRA 3E5QA 3DN7A 1EPZA 2GC1A 3BALA 3NKTA 4UBGA 1J3PA 2UY9A 5C8WA 3H1WA 1ZRCA 4EROA 5I0SA 1ZRFA 1ZNPA 5EFUA 1XE7A 5C6CA 4YYOA 5KHIA 3EBRA 3LWCA 4BIFA 1O7FA 3KCCA 4MZUA 5JR7B 1IPJA 2XLGA 2Z69A 3RZZA 3PLQA 2PAKA 3ES1A 3D0SA 3PNAA 2Q1ZB 2PYTA 2V09A 4JVAA 1O3SA 2D93A 4MUVA 5LRRA 3SCHA 2BGCA 4L2NA 4J1WA 1J59A 5K8SA 1O3TA 4RD7A 4QM9A 2C0ZA 4PJYA 4UXAA 3H1MA 3MZHA 4NVPA 2ZCWA 1HW5A 2B9UA 2CV6A 4X6QB 4Z82A 3USSA 3CEWA 3LOIA 5I0TA 2BNMA 2IXKA 4EV0A 4LTAA 2XLAA 4HZFA 2QVSB 4A2UA 4ZU5A 1ZREA 5I8YA 1CAVB 3LA2A 2E9QA 1WLTA 5J48A 3EHKA 4IEQA 1OI6A 4IEYA 4OFGA 2D40A 3LA7A 2GC0A 4Q0VA 1O4TA 4XF0A 1L3JA 5KHGA 4IETA 1DGRA 3U0ZA 1ZZ9A 2ETEA 1YFYA 3NSTA 5JSOA 3KGZA 3OF1A 5CVRA 3H9AA 3O14A 5AVPA 1IPKA 4XEZA 3S7IA 4WVZA 1VR3A 5BY5A 1G6NA 5LEJA 5JAXA 4F7ZA 1Q43A 1PM7A 4Z07A 4PIYA 4IEXA 4XFAA 5I91A 1NZCA 4IEPA 4H7LA 1NE6A 3E6BA 4KWKA 4XFBA 2B5HA 2XKOA 4F8AA 2N7GA 1O3QA 1O3RA 2EA7A 3GBFA 5D1IA 2K9ZA 4EWEA 3EQEA 5KHKA 1NE4A 1RL3A 3I59B 4KWLA 3G7DA 3SMHA 2CGPA 4YNIA 4Q0SA 2D5FA 4D7SA 4CYDA 1ZZBA 3MPBA 1CX4A 2XKPA 1EP0A 4QGMA 3HIFA 2KXLA 4LUKA 2CAUA 2XL7A 3D0JA 2PA7A 4XF3A 5CADA 4XF1A 1CAWA 3SCGA 5I8TA 3H1YA 4FAGA 4XFFA 1H1IA 1J3QA 2ET7A 1LR5A 3DKWA 4XFIA 3B02A 1JUHA 3IDCB 1CAXB 4AQ2A 2PTMA 3IDBB 3OCPA 5FLJA 4R52A 3UKVA 2PQQA 5J7MA 5I93A 4KL1A 1I6XA 3LAGA 5E1RA 1OD5A 2VPVA 5KHJA 5FQ0A 3M3IA 1UD1A 3H7JA 3RPQA 4E2GA 5FQ0B 2H0VA 3U11A 4ORFA 3OGJA 4IEVA 4I01A 3RNSA 1OFNA 2IC1A 3HT1A 3S7EA 1PMIA 3EO6A 4HVQA 4LA3A 1YHFA 1RTVA 2MNGA 2VQAA 2UY8A 4EWAA 4MH0E 3TNPB 2D5HA 3M70A 5J3UA 2BNNA 4MGZE 2F4PA 3CJXA 2MHFA 4I0BA 2Y0OA 3I54A 3CF6E 4I2OA 4KWJA 5I0UA 3FWEA 2Q0AA 1YFWA 1Y9QA 3BCWA 1FT9A 1OMIA 3VHRA 3N4MA 4HSLA 4KU8A 4HN1A 4D7TA 3MYXA 1ZRDA 3CL1A 3R6SA 3H3ZA 2OA2A 4Q0UA 1ZZ6A 2UYBA 3WW4A 4LULA 5JCTA 4AVCA 4IESA 4B29A 3E6CC 5BXXA 4JTNA 1SEFA 3EJKA 1UPIA 4HN0A 2GC2A 4MGKE 4Q0QA 4X6RB 5I8SA 3CLPA 2PHDA 4I3PA 3RYRA 1GQHA 4N9HA 3FZ3A 2HJIA 4HLTA 1NXMA 3NVCA 1SQ4A 1X7NA 2VECA 3SXWA 3D82A 4XFGA 4HVRA 1ZRRA 4Q0PA 2PHLA 3GYDA 1YUDA 2FQPA 2I45A 2Q4SA 2PAMA 3DL3A 3H3UA 3FFQA 5LRSA 5E16A 2GZWA 3FJSA 1UW8A 4QMAA 4R8HA 2OPKA 3SHRA 3ROUA 5FLHA 4E2QA 2ZKLA 1GQGA 1Y3TA 4I0AA 2QCSB 3TNQA 3BPZA 2XLFA 3FX3A 1LRHA 1I5ZA 2IXJA 4XF4A 2FMYA 3JZVA 4EWDA 1YFXA 1NYWA 4DINB 3SCFA 1Q5OA 2K0GA 1CAWB 4UBHA 3ST7A 1J1LA 1QY4A 4META 4HSJA 4LLOA 4HBNA 4QXKA 5F1RA 4QM8A 4K8FA 1CAXA 3LZZA 3S0MA 4ONUA 4L11A 3BB6A 5I0RA 2DCTA 2Z2SB 4FAHA 1RUOA 1ZZCA 4IEZA 4LA2A 5BV6A 5FPZA 1V70A 1TQ5A 2OYZA 1O5LA 2IXIA 1UIJA 4WZCA 3H8UA 4QX5A 1CAUB 2O1QA 4HMZA 2QJVA 1CGPA 1CAUA 1RGSA 4LUMA 3RYKA 1H1MA 4P9GA 3NL1A 4BH9A 2MPFA 2OZJA 4E2SA 2H6BA 4HVOA 3IBMA 3OTFA 3I59A 1QXJA 5KHHA 2WC2A 4AVBA 5BPXA 4QGNA 3QOPA 4IEUA 1DGWA 3H7YA 1ZVFA 5HI0A 3DV8A 1X8EA 5KBFA 4XF9A 2IXHA 1X8MA 3E97A 4FBFA 4BHPA 1J3RA 4YRDA 4PIZA 3WW2A 3C3VA 2P17A 4OLLA 2PAEA 2XL9A 3UKTA 4IERA 2EAAA 3LA3A 4J1XA 1UIKA 4YSFA 3KSCA 4GULA 5BUVA 4IEWA 3FHIB 1Q3EA 1X82A 3RYPA 3WW1A 5T3NA 1VP6A 2EVXA 2Q30A 4PIXA 3U10A 2XHKA 3FE5A 2PFWA 1UCXA 4XETA 1DZRA 3KGLA 5EZWA 4AQ6A 4YARA 2IXCA 2CAVA
chains in the Genus database with same CATH superfamily
3JSNA 2ATKC 1IQDC 1DTOA 4OYUA 3KMHA 5JOYA 3CX5F 2RMKB 5FZKA 4Q8KA 3ASOB 1PNGA 5B66Z 3T1MA 4LF4O 4AXOA 4JI4O 1PNLA 2HWC2 2EIKC 1QGLA 4XFHA 1UAIA 3VZNA 1N3OA 1LOGA 1GR3A 2ET1A 3ZRWB 5DZFA 1EY2A 5A3LA 5A7PA 2QQMA 1WW6A 1JOJA 4H3WA 4FLYA 3RWKX 1HRI2 5C71A 2YU1A 4I9WA 4QAWA 3JAKA 4QQPA 4JYYA 3E22A 3NW4A 3LSQA 1LNSA 4JDOA 5LK7B 3K9AA 2GU9A 3WDTA 3I3BA 2QBXA 3KT4A 1SA0B 1AJQA 3IAQA 5EYYA 3HT2A 2F66C 5L7OA 2AENA 1RUG2 1JMKC 2V1DA 1W9WA 4EZHA 4GB31 4XJWA 1OCRC 3RWNA 2JE7A 2RS31 5K0UB 2WDBA 2QWQB 4DUWA 4O4LB 3BGAA 3RMXA 1CIWA 1DQ2A 4FPLA 3W7TA 4BE3A 1AB3A 2XJTA 2ZAHA 4N7IA 2V09A 2VRZA 1K73W 1E1QG 4LH6A 1RIRA 4IE4A 2YEVA 2NR5A 5IYCO 4KBBA 1QNYA 2QTWB 3L70H 1HB1A 4LOTA 1TVGA 3ZN0A 4V1PA 2KG7A 1YQ8A 1AROP 2EICA 1LHUA 3LOIA 3OE7G 3NJYA 3BIEA 2Y33A 4QNHB 4HZFA 5H9PA 2DYSB 1H2KA 4CDQC 1WMDA 5ANQA 4ZI7A 2E9QA 2ZT9B 4IEQA 4L92A 2XMLA 1IG3A 2FB5A 3JARB 5F8PA 5IY5C 2PQSA 5AVAA 4FMTA 1US2A 5AVPA 5FUPA 2UUCB 4FZ1A 4DRRA 1G8MA 4DUZO 1PM7A 5JXGA 1NCQC 1RMU2 4DR6B 3JBG2 4PIYA 2PZSA 3M3CA 3OOXA 4P9IA 2XJRA 2VL4A 3T4ZA 4A6SA 4B3TB 2VCBA 2XHBA 1RM1C 3T3YA 4PI0A 4CEWB 2QQKA 4RHV2 1BGYH 1FMD1 2RDQA 4GWNA 5LMUB 3EB7A 5CKNA 2GUZA 3ETDA 4BJ0A 4D7SA 1PO22 2NLJC 5CG9A 4QKBA 2PHTA 3FX7A 3GDBA 2YMZA 1U96A 1MG1A 3ABMC 3MFCA 4XFFA 1RMU3 5EC1C 4QX0A 2GNTA 3IDCB 4U2AA 3WNMA 3IDBB 3TAYA 3Q8BA 1XC6A 3AKPA 4WFGA 2ERFA 1RPRA 1K3EA 2D6MA 1KQRA 4QPWA 1FV2A 3EXUA 5FZMA 1LAJA 3V65A 5B1BB 2HH9A 1BYHA 3MF6A 1Z5WA 5HPOA 5J3UA 1YXBA 2F4PA 2LROA 2WSVA 1XHZA 1M56C 1IBKB 3ZYFA 4NHXA 1IHMA 4DV2B 4XHBA 5E6HA 3KV9A 4KU8A 4X62O 1B04A 1A32A 2D3RA 5CBFA 3H1LH 2BFUS 4MGKE 4JYAO 1JZ6A 1W59A 5FYVA 1W8HA 1TME3 3TN91 1UFIA 1Q8PA 3ZX7A 2F95B 1V00A 3POBA 5LA2A 3SNMA 4JGYA 4FFKA 2ZMNA 2QEXV 4XFGA 2G1MA 1CXZB 5FZ4A 1C8M1 3WNKA 4FXKB 4MYEA 1H8TB 1R3LC 3C3TA 2R072 4IDZA 4I5SA 1BQZA 3I2OA 2QWPB 3WT3A 1GK9A 4Q1RA 4J25A 1NYWA 2R042 4R6ZA 1CWPA 3KT1A 2Q1FA 1K8AW 1ENVA 1IBKO 4U36A 3ZBHA 3B5LB 4HSJA 4ZKIA 1GBGA 4BXSV 3ZS8C 1HB2A 4EN9B 4YGCA 3BB6A 3ABTA 4FAHA 5JOZA 3IDAA 3ILNA 1H9PA 1PIV2 2DYCA 3T1LA 3K58A 3WV6A 1D4VB 1NTZH 1RUC3 1FOD1 2HWB3 1W8FA 1BMFG 2KSDA 2J1VA 3NL1A 1VIWB 1GP6A 1NT0A 3MLJA 2ZEXA 4DMIA 2P6JA 3IBMA 5H6QA 4AVBA 4Z2AA 3A0HZ 3X2QB 3CPWU 5IWAO 5LMNB 4JGZB 4PIZA 2EX3A 1W8ZA 4DK1A 4RS5B 4UCTA 1K5MC 4CH3A 2WKKA 1W6MB 1L1FA 5FZCA 3ZHRA 3VZMA 2HWF2 2EAAA 2C9AA 1XB9A 1V6LA 1JZ7A 1TMF3 4Y1YA 2XAQA 4UB8Z 3LDBA 4XETA 3ZYPA 4HK9A 4FFGA 2XNDG 3F7YC 2BEOA 5IYDO 1Z7S2 4WBBA 5C5TA 1L7RA 3QACA 5FXZA 3ZYRA 1OD3A 5JH7B 4Q1PA 3K4DA 1YHQV 4CBCA 3WHTA 2HKXA 5CA0A 4CSWA 1R3KC 2VUDA 4BOWA 1OCCC 3PHMA 3E5UA 3M3EA 1C57A 2BBAA 1VQMV 4P14A 4DY3A 1K34A 5KXCA 1IURA 3POSA 3L71H 3O1OA 4XYXA 2ZDIC 2YPDA 4O9GA 3THDA 3A21A 4W65A 4MVZA 3D3AA 1DZTA 4DRVA 1LU2A 3GALA 4DY5A 4Q5OA 1LKNA 4DR7O 5LL6Y 4JTOA 2BV4A 4X66B 3VBHB 5LZ6A 2LGWA 4FPJA 1YQCA 1BKZA 2BYVE 1UZZA 3ALQA 4CH4A 2HWE2 1AXYA 5C3SA 3VBOA 2PGGA 3OTOO 5JJNB 3V0BA 1YO8A 1FATA 5EFUA 3R05A 2WWUA 4LF8B 4Q4X3 2HWC3 4MZUA 2X6CA 2JDKA 2PAKA 2CL2A 4UF0A 1EUTA 4MUVA 2UWBA 4UF0B 1VE0A 5F5CA 3DXRB 3DXRA 4AE2A 3AG4C 4ES9A 4MVRA 3DYMA 5K8SA 3K3WA 4UXAA 4OPAA 1GM7A 1H6YA 1GANA 2YC4A 1W03A 2V5YA 4CS3A 4J7ZA 4OI0A 3SH5A 4LP8A 2IJHA 1ZREA 1XNRB 1CAVB 1PMHX 2W2IA 4A7KA 2WS91 5FUNA 3CRQA 4P9OA 1RUG3 4HONA 2QZ3A 3TWIA 5A3NA 4PDWB 4JI4B 5A1LA 3RZKA 3K5OA 3WNNA 4JQRA 2ZGRA 3K2OA 4L9BA 3BTYA 4F6RA 4IEXA 1OFSA 3OB8A 2Q0OC 4MXWB 1AR82 1O8SA 3M8AA 3GZEA 3QG5A 4CS4A 2RS33 4Q4V2 1XPWA 2G38A 1RUG1 2CGPA 3J8F3 2BSKB 2HBTA 1VIBA 2Z3YA 5JCOC 3VBFC 3ZM8A 4JI7O 1EP0A 4FP2A 2XL7A 2PA7A 3SJBC 4CDWC 4LE3A 4XJZA 1BS3A 1TNFA 3SCGA 2ZQMA 3I56V 2WLLA 4OI2A 2W5FA 4UXNA 2WLLB 4N43B 3ZXEA 1LULA 1ND3A 3UKVA 2PQQA 1Q7YW 4BCUA 1I6XA 4QHZA 3RVYA 5KHJA 5L3FA 4HK8A 1K5MA 4I01A 1OFNA 1O91A 5FZ9A 2WO3A 1PL0A 1JH5A 4HKOA 3H0OA 3N7LA 3WSOA 4GB32 3SYAA 3WG7C 3CJXA 3N9NA 1OC1A 1H0BA 4Y1UA 3CXHF 3TOJA 4PT6A 4GKXA 2Q6AA 1SQBH 2W92A 2Q7GA 5B1OA 3VQYA 4X6RB 3JD72 1T5EA 2FDGA 1Y7BA 1AR62 1O59A 1SQ4A 1X4TA 2VULA 5A3UA 4EE2A 3FUQA 5EZYA 5CG8A 1MS1A 4MTXA 1LU1A 2JE8A 3VLBB 1YEWA 2I45A 2Q4PA 2DVGA 3UESA 3LPFA 3WP4A 2ZM6B 3FJSA 3HNBM 2JG8A 5BNPC 4Y5Z0 2CDPA 1PGW2 3I2JA 3MIDA 5FPLA 4DR4O 5HXMA 3N7KA 1QF3A 2ID4A 2IXJA 4LO4B 2WNUC 4LBEC 3NO8A 2UUAO 1UNBA 3AMHA 1BSMA 3AG4B 3P32A 5LCWL 3LZZA 3A7QA 4L11A 4JI0O 2AEYA 3OGVA 3J7LA 4LA2A 3O1UA 2GMPA 5A3MA 4YM1A 4QXBA 1H4GA 3FC0A 4HNAB 4D6SA 2DYRC 1JUIA 5K1XA 2JRIA 5J2UA 3DPRC 5BXZA 3F7VC 4W6YA 1GMMA 5CFCC 5HI0A 4GZRB 1UKGA 1W8UA 3CJIA 3WDYA 1XL6A 1HXS2 4G4FA 3TXSA 1WJZA 2HVKC 1WLCA 4N53C 4OZXA 2GDSA 2J1AA 3BOPA 1GWMA 3ZIXA 4LJHA 4E4SA 2IBZH 3W7XA 2ZGPA 4LMFA 1X82A 4OI4A 2B46X 3U10A 1EFRG 2JICA 4DS0A 1T2XA 3VHPA 1GM8A 3VBSA 3JB8A 1GWLA 3PURA 2UURA 1SFNA 4JKKA 1PM4A 2QDOA 5JXHA 5LGTA 2R16A 2Z4FA 4LBNA 5FBJA 1SLAA 3BU7A 1PZ9A 4MVOA 1Q8VA 4Y24A 3V64A 4CDWB 2JS3A 2XOMA 4QX7A 4P08A 2O8QA 1RB8G 3CCJV 3J4UH 2Q7EA 3VBUA 4KXRA 4MGIE 3HAGA 4DR5B 4AI3A 5A7WB 5EHDA 1FV3A 5FY7A 2HWB2 1AILA 1PVC3 4DV0O 3GZTB 5CB4A 3SH4A 2YG0A 5BNOB 2VBDA 4YW1A 4IV1C 1UF2C 1C8M3 4FVVA 4YW4A 1QDCA 4J80A 5L19A 3S5QA 1W6OB 3QVNA 1U12A 4KU7A 2N05A 3ACLA 4X9QA 1FXHA 1YJ9V 4BMBA 4XFCA 1OUXA 3WG4A 2Y8KA 1H8VA 4JGZC 2IH1C 3E83A 5C4WB 5JQGA 3U4XA 3J80N 3MW4A 3MHSC 1N1YA 1WGPA 3ASNB 2QDRA 2Z5UA 1WB7A 5FYSA 3JAWB 5IAVA 3THPA 2ZGQA 3JCZA 4FIPC 2C24A 4BIFA 1X33A 4YZ2A 5JR7B 1IPJA 4BQYA 3UJOA 2W52A 1SACA 1JJ2U 3ICXA 3T0DA 1C5HA 3KB5A 2D93A 3VBBA 5JOXA 4CUGA 4HOOA 5FO7B 2QE7G 3SDLA 3AK2A 1NKGA 2P1BA 4JQTA 1RJ7A 4I4TA 1HXS1 4I4TB 2ZGUA 4LBQA 1OSGA 2JWPA 4D7YA 5KX5A 4EN0A 4QX3A 5FJHA 2CH7A 1LJ7A 3PTRB 5JZGB 2YV8A 5JZGA 1ND2B 3IAYA 1JYIA 3LA7A 1XNKA 3QH7A 4XUOA 5JSOA 1HN1A 1G7YA 3GJAA 3OF1A 5CVRA 1RJ8A 4KBZA 2EJRA 4IW3A 3QH6A 5C3OA 3N9OA 5ACA3 3ZCCA 1LCLA 4GX1A 2LW1A 1OH4A 3I49A 1I5XA 2QE3A 5C9AA 2C6SA 4I3GA 4M3CA 3GXUA 4M3CB 1NLQA 3ZMUA 4KWKA 2DQ3A 1PMJX 5CZKA 1R3JC 1SA0A 4EWEA 1MSDA 3OY8B 1OKQA 3VL9A 3VUOA 5FXXA 1X9TA 4H13B 4JHZA 5L7OB 3VD7A 4QIWF 4LXLA 1V54B 3OGGA 2P5OA 1KECA 1GOFA 3O1RA 1WCSA 5K0UA 3KD4A 4EZ4A 4FTEA 2HWD2 4LCUC 1LR5A 4XFIA 4JHTA 4D69A 1FMD3 3VKMA 2CTVA 1CAXB 1B06A 2DFBA 3VDDA 1MZEA 1AX0A 2RV9A 2XJUA 2W08A 3GHMA 2VE1A 4KWUA 2B5UA 5F6KA 3JD71 2OCCB 4EN6B 3RQ0A 1UD1A 2QWOB 2H0VA 5FYYA 3UGFA 1DYOA 5JMCA 4H55A 1RTVA 1URFA 2D5HA 3I3EA 2IUWA 1NTKH 5FPAA 4I0BA 4L8JA 1BHAA 5EJZB 3FWEA 3T1CA 3ABLB 5BZBA 5JJEB 3AG2B 2Q8DA 4HXCA 1WW7A 2JIJA 5IVCA 5FYZA 4AQYO 4IESA 1RINA 2Q8CA 4B3NA 2QQOA 4CEWC 4AL9A 4O2BB 5LP6C 4YFZA 5FZDA 2Q8OA 1X7NA 1G9BA 4IYHA 2YEVB 1FPOA 5GLWA 5BNNA 4RGAA 3CCVV 3KHCA 4A7YA 2C26A 2BUKA 1EV13 2X53S 3AK0A 3MFAA 5IHRA 3VDDC 3R4DB 1VB4A 1GQGA 1Y3TA 1FNYA 5K7PA 3TNQA 2GUZB 1GOHA 3HN3A 4LR3A 4XCBA 1NR7A 1GAXA 1OPMA 3AMNA 5FZ1A 3BOWA 4LBLA 3JALA 2Y4TA 4DINB 1GP4A 1PGL2 1PK6B 4K8ZA 1FAFA 4NXNO 2RDNA 3IKWA 1XEQA 4PQQA 4QPGA 2WLQA 2VG9A 4QPGB 4B1MA 2NYYA 4LKFA 3RZHA 2FCUA 2XAFA 2G9ZA 4OMCA 3NAPA 4B3RO 1HQWA 4Q4W2 2ZE8A 4YVSA 4YVSB 3CCRV 1DYKA 1HN0A 4QXCA 4XTPA 1W99A 3WNXA 4NPRA 1RFYA 5FZAA 4LIUA 2W6JG 4JC1A 1JZ4A 3BYWA 4OZOA 3OTFA 3K48A 3S3WA 3O9OA 4Y20B 2PHXA 3AK1A 1DGWA 2A3XA 4MT8A 3CC7V 1QJU2 3MIFA 4XF9A 5C70A 1MPXA 4P30A 4X8AA 3U14A 2ARHA 1CVNA 3T4DA 5JI7A 5CFDA 2VZVA 1HR0B 3BVOA 4FI9A 3ZXGA 1XNQO 4FPYA 4YW6A 5F2SA 3JBG3 1K5SA 5A3WA 3FE5A 5EZWA 2YGLA 4M0NA 1C8NA 1RP3B 1TMF1 5FZFA 5F7UA 5JSRA 1RHI2 4AFCA 1RUF1 1XE0A 4TLFA 4PQ9A 4I0XA 2OQ7A 2BVBA 5F6LB 3CP1A 4UFJA 2X6AA 4JI6O 4PBPA 1FX5A 3ZEDA 1G9CA 4UYBA 2QGNA 2YICA 1F9KA 2LQTA 5KMGA 3ES4A 1XRUA 1UO9A 3MDPA 4DV6O 1W9TA 2WQZC 4K40A 1IS6A 1BLZA 3E86A 3AVSA 4DEVA 3HQXA 1J1TA 1HNWO 2XVKA 4J11A 4LLFA 1OCOC 2R043 2K2SA 5C93A 2HJDA 2ZAAA 4BYYA 3QBQA 4A41A 1XQ8A 1ODNA 1DGSA 5KAIZ 3HEIA 1HXS3 1VF7A 5JUVA 2NM1A 2GBOA 3POWA 2KA3A 1EN4A 3WQ1A 4FLVA 3U78A 4FPGA 2SBAA 2HEWF 3PNAA 1SQFA 2ZR3A 2BVVA 3PVNA 5DUVA 1LUVA 3NNMA 3VL8A 1NCRC 4BISA 3ABMB 3ZMZA 3ZLIA 1QH6A 2C0ZA 4PJYA 1PP9H 5JOWA 1T6BX 3VDBA 1LOFA 5DECA 3CBNA 1S0GA 2A7WA 4MSWC 3K5MA 4C90A 1W6NA 1KD7A 3F5WC 4LF7O 3T0AA 3Q9OA 2VMCA 1C8M2 4JCKA 3AXDA 1KFUL 4TQFA 2HWF1 1R093 3BY6A 2UXCB 1G9DA 3ZXLA 4UWDA 1TGOA 1AI5A 3OPZA 3AZXA 3RN4A 4LWSA 4RA0A 1R6TA 3VBUC 2EIGA 1NE6A 2E26A 3K51A 4O4JB 2VZOA 1O3RA 1PVC1 4EYUA 1NE4A 1RL3A 1GZWB 3ACFA 2OT7A 2Y4UA 3VZKA 3EXAA 2CTQA 4WCEV 2VQTA 4UVBA 2JDYA 4XUQA 3WEZA 5A3OA 4B8EA 3D0JA 2RS53 2YHJA 2Y64A 1FXKA 1PGSA 1RVF2 1BHGA 1JUHA 1TUBB 1KU9A 3OR6C 4JTDB 5FLJA 4AQYB 2HYXA 5DAPA 1NVPB 3BA9A 3PJSK 4NIIA 3JD2A 2HEPA 1M5IA 2ZHMA 3RPQA 1POV3 1U5IA 1MA1A 4J41A 4WVWA 2PELA 4YY3B 2JDPA 3LEIA 2IFWA 3K06A 4AWDA 2RJ2A 2OUJA 2F4LA 2VQAA 2O57A 1QHDA 3KCXA 4JGSA 1NLRA 1JYWA 2VMEA 3PIJA 3H42B 2MHFA 4QQHA 4JKLA 1YJWV 4B4RA 1LOBA 2Q0AA 3HNYM 4YVWB 2IH3C 4AHCA 4JI7B 2P34A 4HSLA 4GQ7A 4MVTA 1OCRB 3CHXA 1KUQA 1M9NA 3A23A 3H8OA 4QXHA 1KP3A 2IVJA 2JVDA 4AVCA 1AYM1 1V9U1 3INAA 2GC2A 1Z2GA 2JG9B 1I94O 3R66A 3WQ7A 4HPKB 3B9CA 4O4IA 3AZVA 2JEXA 2VECA 4AFBA 1XMQB 4LF6O 1XMOB 4X89A 1BVVA 1NUKA 3FHQA 5F5IA 4CCJA 4YJ2B 1PO12 1E5RA 2ZEWA 2W1UA 4PDMA 1YJLA 1S2BA 2GZWA 4OHWA 1RUF2 3FAVB 2YU2A 1U5YA 4Y3OA 3WF3A 2HKOA 4CDUA 2E7TA 1IZ3A 4QDQA 4YZ3A 4E8DA 4QE9A 1IOAA 1FKAO 2ZGOA 5JVVA 2ZGKA 2E74B 1QLNA 3DC6A 5A1FA 1A8MA 1XNAA 5A70A 1FJGB 4HBNA 4ZPIA 1XOUA 1GWKA 4IV3B 3PMSA 4CDXC 1H9WA 4OCTA 3LDDA 1P49A 2A6WA 4IEZA 4AEDB 2ITDC 2OYZA 3CMAV 1OZ0A 1K5MB 1C1FA 4DR1O 3VDAA 2P4KA 5T5JA 1C3HA 3ZSJA 3H1JH 5EJ3A 3I59A 5CN0A 2P06A 5IYZA 5KHHA 2HBUA 2WC2A 1JMUB 2QKCA 1ZAUA 3E97A 5IUQA 1I08A 4G27B 2OWOA 4P9WA 1SDWA 3MF9A 2BZDA 2RNBA 3LNMB 2A1XA 4XJAA 1APNA 1UIKA 4XUPA 1B35C 2E31A 2NMNA 2EILB 4AQ6A 3ZFFB 2CAVA 4HKLA 4QPIB 4YW2A 3W58A 4FOWA 1HX6A 1ZBA2 5IFTA 4TYSA 3M4FA 4UFIA 5D2AA 3WX5A 4QJFB 1AYN3 2F23A 3F2ZA 4XVHA 1R1A3 4IHJB 3CRAA 3ZRWA 5KUKA 1SBEA 4HG6B 3DCQA 2WABA 2GH8A 3ASOC 4XABA 3LSDA 3CWBH 3TEXA 1RC6A 1D5NA 2Y38A 3FBMA 2WA3A 3OGCC 3AL5A 4CVUA 5FIXA 4AI9A 2OZ6A 4BQ4A 4CUBA 1QKQA 1CN1A 3PVBB 4FCAA 3K3NA 4HAMA 4QQLA 3WW3A 2XGXA 4PF5A 2VQEO 2E7QA 4X62B 3FKSG 1GOGA 1RUJ2 3QF7A 1SF9A 2B4KA 4KNCA 3LKJA 4PD4F 1IG0A 1COV3 5JJJB 3UO3A 1NBMG 3OUSA 3OUHA 4JTAB 3NRUA 1NH2B 2FZ1A 4OHZA 4AFAA 3EYPA 4ABMA 4M3CF 5L9VA 3W20A 1JYNA 2WBKA 1MVEA 4CDQB 3CQOA 4JI8O 4YG3A 1JR9A 1JYXA 1PVXA 1N47A 4EFBA 1VQ4V 2GTAA 1MEC1 2UWCA 2HWC1 5DEDA 1DZQA 2HLDG 1HW5A 2WLHA 1QOSA 1HLCA 1S55A 4KG0A 5IJ0B 1KP2A 2FCTA 1UZVA 5LB6A 3I3MA 3U07A 1OLMA 4XBQA 4A2UA 3IFXA 1LHOA 3ZHVA 3MLLA 2F43G 1S0JA 3VZLA 2VU9A 3WINE 1L3JA 3ZVXA 2XVLA 2MK3A 1JQ0A 4CEYC 5FY1A 2XAGA 2BTQA 3KG2A 5GZGA 1ASJ2 2VOVA 2BTQB 3GWOA 4XEZA 4MGTA 1G6NA 5JAXA 1KEXA 1I3HA 2A79B 2CDOA 3WDUA 2ZKOA 1NOVA 1D2DA 4J6GA 5F3EA 4TV9B 2ZHLA 3CZUA 2HJFC 3OGRA 3MUZ1 4D6RA 1O3QA 1AJPA 5KAFZ 4CP0A 4KG8A 3RZMA 2VW0A 2WFF1 4FFIA 5J9PC 5JQGB 3O0XA 5FPVA 2P2KA 2V5DA 1G6UA 3OGIB 4XXPA 2XPJA 1QCEA 2FMDA 3ZN5A 1QQCA 1SLTA 5L36A 2ZS6B 1GN6A 5BNPA 5JXIA 4NMIA 2Y69C 2VMGA 2FDJA 1UMZA 5BNOA 4JZRA 2H3OA 1PX4A 3DUIA 5ANNA 3S5AA 2VPVA 1SC5B 5FQ0B 3LGRA 2VBBA 5FPOA 4D0QA 1VF6A 4LA3A 5GW7A 3TNPB 2DFCA 2WO2A 2R073 4JI2O 2A9HA 4E2LA 2ZDIA 1MS8A 4V2WA 1W0PA 4YJ3B 5LA6B 4D7TA 4B4PA 5FP4A 1ZZ6A 2QQUA 2VWKA 3VBFA 3RVHA 4SLIA 4LULA 2VTXA 2YBPA 1XQNA 1P7BA 4RGGA 4ICGA 1VQ6V 1GNYA 1QJZA 1QQP3 4H0LB 5FY8A 4FLTA 3T1HB 4NKGB 5LOVB 1VLNA 3P6BA 4AGVA 2V72A 5C9AB 4A3ZA 5FYIA 1YUDA 2Q1MA 5L3DA 4GWJA 4N53A 3KKYA 1V6OA 5J2TA 3GBWA 4XC9A 1UW8A 4DNYA 4RQPA 3N2GB 4HYOA 3N2GA 1B3QA 3UNPA 3ZYBA 2P6CA 4WM7A 1NH2D 2Y6HA 2W0FC 2XUMA 3LDEA 4Q4Y3 1YFXA 2V7QG 5CNAA 4CXWA 1XSQA 4NTWA 4UBHA 1MEC2 1ODMA 4IGGA 5D5QA 3ZN1A 1S2KA 3LDKA 1WBLA 5AC91 4AG4A 4H37A 1WN7A 1F2NA 4META 5HCAA 5DUUA 1CAXA 2HHHB 3S0MA 4PBOA 5GLVA 4IYIA 4PHZA 3RYCB 2Z2SB 2QTSA 3ZN4A 4RS5C 3USUA 4NHKA 1RPOA 2O1QA 2JE9A 4X1KB 3WF1A 1H1MA 2LALA 1K7DA 2DE0X 4MHRA 3AZWA 1ZBE3 2H6BA 1SLLA 5BY1A 1NX9A 1V0AA 2DU1A 4COYA 4IEUA 3H7YA 1LEMA 1S2EA 4L87A 5FYUA 1LOFC 1W0NA 2RMU3 3NV1A 4YRDA 2WLMA 1VARA 3HD8B 2P17A 4YHHO 2PY5A 1C5IA 3BVCA 4UW6A 3CNAA 3ZFEB 2A06H 2XJQA 1POV1 2PHUA 4UT5A 1U0AA 1SZBA 3OGSA 2EVXA 4B3SO 4JV5O 2DVAA 4PIXA 2YIAA 3BPSA 4AEKA 3LFMA 4DV3O 2CWSA 2E75B 2LW7A 3HOBA 3HQRA 5CEHA 2EIEA 3T0BA 1NR1A 2I2SA 3LSEA 4LEJA 1NQDA 2BNOA 5JCOA 5SV8A 2R062 5IVJA 4GXLA 4NRQA 3I2HA 4DUYO 4JYAB 3X29B 2E6VA 2HVJC 1COWG 2XOKG 3RYFA 1QXRA 1WWYA 1DF0A 3RYFB 3O1MA 1DIWA 1UU5A 4MVMA 4NIDA 1H6XA 1HRI3 1PL4A 5JIAA 4LF6B 5CU1A 3STLC 3NR7A 3RT3C 4GX0A 3O0VA 1W04A 4Q29A 1F5JA 2QNKA 5ABJB 1Y74B 2XG3A 5HXVA 2Y34A 3SH3A 2CGOA 3FLRA 4J7KA 3MW2A 5HCFA 4JI5B 1AR83 3AB0A 1EAH3 4CXXA 3CD6V 3CCMV 3J8F2 1NS1A 2WNUB 1WMEA 5C9AC 2QKDA 3LUTB 1I1EA 4IIJA 4NIAA 5FMOS 2A6XA 4X1YA 3ZXJA 1XE7A 5FREA 2IW5A 1P8JA 3T4VA 1BE3H 1UJWB 2XLGA 2Z69A 4DW1A 1KITA 3LF7A 4FLXA 4JDNA 2VQEB 2QTOA 4XJ8A 5EIBC 4XCAA 5LY2A 2YXSA 3RZGA 2LFRA 3H8XA 1VQPV 2UWAA 2BERA 4NVPA 3TN92 4HZ3A 2QQWA 4LT5A 4Y1XA 4JZGA 1ZL8A 3WD5A 2UUBB 2P5BA 3G4SV 5FWEA 3L72H 3WG3A 4CRQA 1OXCA 3UGGA 2VNOA 1ZZ9A 5DZGA 4BQ3A 1XYPA 1K3IA 1OVPA 2R70A 4BA6A 4RQEA 1AR71 2TEPA 1W28A 4X65O 2X5IC 1Q43A 2VCCA 2FL4A 2QUOA 1M1KW 1VBA1 3KV6A 4XFBA 3BABA 2B5HA 4FOYA 4W8JA 4EB6A 1VBC2 5CKQA 4CDXB 3TB0A 2JG9C 4Z1VA 3A0RA 3SPIA 1WMFA 3POEA 3SQOA 1OF4A 4RUFA 4E27A 2OCCC 3D8CA 5CBLA 3MPBA 4RGKA 4Q8LA 1A3KA 1V6NA 4XF3A 3PU3A 1VRBA 2E33A 5BNNC 1PO11 3JD4A 2YS8A 2QA4V 1VEWA 4XMIA 1Q8IA 5FO8B 2GP5A 5CAZA 2W6IG 1MS5A 1JYTA 3I2GA 1YRZA 3ABKB 3M3IA 1HDJA 3MIGA 2RM22 4X64B 5ABJC 2W47A 1V6MA 1UZ0A 2UY8A 3UKMA 1BMV2 4IV3C 4UOJA 4MGZE 2Z42A 5D5PA 1GQPA 1HNXB 4M3CE 2YZ4A 4DV4O 5I0UA 2YSUB 1LTEA 3CL1A 2OA2A 1DK1A 3B9IA 5LK5A 1J5EO 3W21A 3PVOA 2QQLA 4ZKTB 5LHIA 1PKXA 4N9HA 3T1YB 2D98A 3CC4V 4WBNA 3APBA 5DAWA 1BK1A 4HVRA 3BU0A 2NMOA 2WZ8A 1CP9A 5CFDC 3B4SA 5FZ8A 2X8KA 1Y66A 4O4JA 2UXCO 2Z79A 3C8XA 4AGRA 1GKFA 2UXBO 2TNFA 5A80A 4LFBO 5K1PA 1UY3A 1LUWA 5FYTA 5C8YB 2EAKA 3BCCH 4O7XA 3AK3A 1I5ZA 1PVC2 3QO5A 4BB3A 4LO8A 1QJEA 4PA6A 2WINB 3VKFC 2RJKA 4ES8A 2E63A 3VGIA 3BKZA 4BLIA 3T30A 1OOPC 2PHWA 1BL8A 1HRV1 3KF3A 1ZSPA 1M57B 4K8FA 5IAXA 2J1EA 4DXTA 4XE9A 4P9YA 4H7MA 2VXJA 5FPZA 5BMVA 5E89A 4YWAA 2XJPA 4PA3A 5FAXA 1RGSA 5JZGC 3TRSB 3GVMA 3IZOA 5H9CA 4BH9A 2WIIB 2ZZQA 2BBVA 4PLMA 2LRPA 3AL6A 3LOBA 1GU3A 1HQNA 4ZOLA 4ASKA 2IFRA 1ZVFA 4JGYC 2Q68A 2WZR1 3K59A 1J3RA 5CKMA 4GWMA 1ZBE1 5DAXA 2PAEA 1XNDA 3TXQA 4WFBV 2BE3A 2R32A 4PELA 2QM8A 2O14A 1WA8B 5BUVA 3C2UA 1WA8A 5IVEA 4LFBB 4LNUA 4P02B 1JOPA 1TMF2 1UCXA 3GB7C 4TN7A 2IXCA 2BTVC 1A34A 4I02A 3ZOIA 4IV1A 5DN6G 2D6NA 4BW9A 1YQ6A 2XHNA 4IV1B 4YZ4A 2HFEC 4P5HA 2VZ1A 1F4HA 1WPXA 2VZRA 3WG1A 1WLEA 1OA3A 2RS11 3VBRC 3ILRA 1VBE1 1I94B 4MGYE 1W0OA 2RJZA 2XB6C 1WAZA 4RSUA 1FXZA 3SLIA 2ZX2A 2NP0A 4YVWA 3SJAC 2UXXA 4MX3A 1KDKA 3WNLA 1MZ5A 1AJNA 4FQ4A 4K8XA 2VH9A 4IEOA 2Q7HA 4E4HA 2EIDA 1YIFA 5A7QA 4BR6A 5ISLA 1ZZ7A 3NNJA 4IV3A 1LOEA 2ZGMA 4KUMA 1GRJA 2WJSA 4FPCA 3WNPA 3PVEA 3HBKA 4YIPA 5BNOC 1VQ9V 4F6RB 3O65A 5JVDA 1GP5A 3VKNA 4FFBB 1EPZA 4R4ZA 3I3DA 2RS12 4OHYA 5T5PA 5FNVA 1E79G 1LOCA 5I0SA 3VBOC 1ZNPA 3FL7A 2DBNA 1CIYA 2UU9O 2PXJA 1DLLA 3ZMVA 4YGEA 1VMGA 2FCVA 3ASNC 1F4AA 4JVAA 4ASLA 1O3SA 1H2GA 4KHPB 3ZN6B 1XYOA 3CCLV 2R063 4P9PA 1OQEA 4GKKB 3JB4C 2K46A 3H1IH 1MQTC 2WO1A 5A33A 2G9FA 4LF9O 3CEWA 3DECA 5I0TA 2W1QA 4LPLA 5KX5B 3VV1A 1IQAA 1D2SA 4YY3O 3W5NA 4MSVA 5F32A 4UFLA 2BP6A 5I8YA 3PUAA 1UY1A 1R082 3L75H 1XREA 4XBFA 2EXJA 4Q0VA 3G67A 2PYJA 5FZEA 3SPJA 3WHUA 2ZNIA 2GN7A 3SYCA 2P22C 5F5AA 1BXHA 5BR8B 3IM0A 4Y4YA 3ZHUA 1H38A 3O1SA 2WZR2 4WVMA 1YIJV 4IQPA 1YJKA 2UUBO 4OHVA 1EAH2 3GWKC 2XTAA 5GONA 4H7LA 2LM3A 5H9RA 2VZ3A 1BBT2 2ARAA 3TETA 5D1IA 2K9ZA 1R083 1JVMA 3ZKYA 1YCIA 1K5JA 1RUE3 3BIWE 1OUSA 4E4EA 1R1ZA 2X29A 2X0LA 1UU6A 3NWKA 3FHAA 4QT6A 4XF1A 3O7OA 3URFA 1MOFA 3WG2A 4M00A 5A3TA 1YITV 2ET7A 2VZPA 4XDOA 3B02A 3TK1A 1GH6A 4KH9A 4K35A 4K3AA 3I5DA 1HRI1 1JI6A 3LAGA 2FYUH 2E51A 4RHV3 1FS0G 3U11A 5L9RA 4ORFA 1GFF2 3ILFA 3C3SA 2ZMKA 2Q5TA 4X66O 2BNNA 2EIMC 4FQZA 1NJIW 5DUXA 2W9XA 5IJ0A 4BWOA 1R1A2 2ETNA 2EIJB 3BCWA 1FT9A 3PIGA 4JZ2A 3POIA 2WLKA 1YVWA 5HFLA 3R6SA 5B3SC 2CSGA 2UYBA 3WW4A 2YB7A 4Z1MG 1QBZA 4UFZA 2RDSA 4HN0A 1GM9A 3RYRA 2PHDA 2WQ4A 4ZBMA 4N7UA 2ZE7A 4ASMB 4FPFA 4CDQA 3D82A 4YPJA 4BK5A 5KC5A 3KWVA 5AC92 1ASJ3 2DVFA 3H3UA 4KMQA 3HPLC 4KGQA 4GD4A 1Y43B 1CZVA 3UGHA 2FHRA 3AP9A 1RHI1 3I2DA 2ZGSA 3BPZA 3G6EV 2WL1A 1HR0O 4X20B 4V2VA 4YW7A 1UQXA 1YQ2A 3K3OA 2ZGTA 3JZVA 1XMQO 1R3IC 2UXDB 3CEIA 3VBUB 1CPMA 3ITQA 1VBD1 5CBGA 4RQFA 2XJVA 4QXKA 3C7HA 4O65A 1PGL1 5DDJ2 4FLWA 3P1IA 3VQWA 2C1FA 4Q4Y1 1OH3A 3SPGA 1O5LA 1OHFA 4DUVA 1TG7A 5FZBA 3D5OA 2F6BA 4RR3B 2OYQA 2A3YA 4XQ4A 4CZZA 3LFIA 4OQ8A 2D6OX 2VMHA 1GN4A 2BTOA 4TLGA 1XBFA 3BTZA 5KBFA 3IAPA 4YFWA 4BHPA 4OLLA 2JIZG 1YC61 4IERA 5CB7A 1AHSA 2BCCH 5T3NA 1NY71 5KXBA 1W0KG 3KGLA 4XDPA 2QWRB 1PD3A 1NLSA 5LOVA 3ZKUA 1QU7A 2WLJA 1WA4A 5T55A 1Q6HA 1VQNV 4UCOA 4G9SB 2CWMA 5JPNB 5IK4A 4I0XB 2DBIA 3CS5A 4ATFA 4FPPA 3D36A 4WFEA 4FPOB 1HNWB 4F4LA 3ENRA 3IPVB 2OPWA 1EN6A 1CONA 3ACGA 2WAAA 3KV4A 1D0GA 3ELNA 4BIOA 1VMJA 5FLIA 4NRMA 1UPGA 2XH6A 4LKSA 5LA1A 4IUGA 2BGOA 2KD7A 4I09A 2BOBC 4RFRB 4LHKA 5FZOA 4DV7B 1REDA 1K4DC 1SQPH 3AYAA 2H94A 2BOJA 2VJXA 3ZHQA 5FZ0A 3ZXDA 1OLRA 3ABLC 4ZZ5A 5DMYA 1VQKV 1JJOA 4C1WA 2YC2A 1DDLA 3AMQA 4N53B 3IJ4A 1N3QA 2WUHA 1SCSA 1BHBA 5C8WA 2WPDG 1R6NA 1R092 4ZHQB 4ZHQA 1ZRFA 4XJUA 1ZLZA 2WFF2 4XILA 1IXBA 2EIBA 4WM7B 4TTGA 1NI8A 4OUMA 3D0SA 4UUJC 4D6QA 5FY9A 5B1AC 3ZFEA 3SEEA 3HKCA 3OYWB 5JR2A 2ADPA 3JUUA 4AFDA 2E5LO 4ISQA 4DUXA 3H1MA 2DW4A 3RJ2X 4UCVA 3WDVA 2YBSA 3MI8A 2AREA 2IJJA 4JTCB 3NQHA 1AI6A 1AL0G 1VAMA 5JH7A 2RS52 4YXWG 1JOYA 4YIOA 4A7ZA 1JODA 3GBGA 2XONA 4F6EA 1NCRA 3RYHB 1O4TA 3NNGA 4QX2A 2PN5A 4XF0A 4XJ9A 2HHHO 1B09A 1IBMO 1VQOV 3ZFFC 2JG8C 4JGZA 1NA1C 1OT5A 1CPYA 1Z0HA 1UPSA 1WLWA 1SRYA 2QQNA 2WYFA 4PCRA 3AC0A 4X65B 1RUI3 5CISA 4KI5M 4LF5B 3U4SA 4AYUA 2RS13 1NKDA 1OVSA 3ZPYA 5I0DA 5FRAA 1TAEA 2HWE3 4Y26A 2AH2A 4IIJB 5KLVH 3J81N 1HNXO 4RQPC 5T50A 2ZIOA 1QOTA 4XBLA 1MQTB 4MG2A 5EP9A 3OAAG 1WMXA 3F95A 4CEYA 5J7MA 1SDDB 5DM6V 3U1XA 4DV1O 3UJQA 4GMP1 2BOCC 2VVDA 2BU9A 4LQRA 1Y74A 4IEVA 4AQSA 2LO1A 3HT1A 3H01A 4MLOA 4EWAA 5DAQA 2WZR3 2ZPXA 1QH7A 1XILA 2BFUL 2W1WA 4UI9L 3I54A 2ZEZA 4QPKA 3UV9A 3OW2U 1AYN1 3RI8A 3ACHA 3RFRA 4Q4V1 3R65A 4AVSA 1OHHG 1D4M3 2X5IA 2YY1A 4P5YA 2OS2A 2GMMA 3M3OA 1AXKA 5B5EZ 1ULPA 3OT7A 1S0CA 2Y6GA 4Y20A 1JZ5A 2XBO1 4HANA 3DTUB 3H1HH 3K4ZA 4I3PA 1KFXL 2WWSA 4PDWA 2EIJC 1HRV3 4I55B 4DV5O 1GV9A 2ITCC 4RL7A 1AYN2 3ZIWA 4FXGB 1V54C 1E5SA 1US3A 2WYSA 1Q6UA 3PUHA 4C91A 2HLEA 3GYDA 2VUAA 4S2DA 3JASA 5IWFA 1ZBA3 4FP3A 4AFMA 3UK9A 1TE1B 1VBE3 1U5XA 4R8HA 5CMUA 3ROUA 3JU9A 2ZKLA 1FJGO 4O4HB 4YG0A 2QCSB 2XT9A 4O4HA 3H1KH 3CXCU 3FLTA 5FP3A 5L9BA 4EWDA 2JDMA 3AFKA 2P3YA 1G9AA 4OUEA 2BOIA 4TV8B 1VBD2 4K0KO 4C8DA 4ZXKA 3CRCA 2EIMB 4MW8A 1NQTA 1VQ5V 4Q4W3 3VQXA 1JN2P 1Q8QA 3L2YA 4PA7A 2VCMA 1COV2 2MEV2 3AYCA 1YDXA 2VCAA 1XL4A 1AR63 1KS5A 3AZYA 3ZFEC 1OQ1A 3CJHB 2C9KA 1IGOA 1NVPD 1G86A 3D3IA 5FPBA 1QXJA 3L74H 1R1A1 2R72A 1X8MA 4XIOA 4ZIBA 5FZ7A 4TSFG 4B1LA 5B4NA 4I30A 1HB4A 1L8DA 3JCUZ 3LA3A 4XURA 2VD7A 2IM9A 2JD4A 4IE7A 2Y48A 3FBYA 2NNUA 3POGA 4C1XA 2PHLA 3KF5A 3O5SA 2WNEA 4AHXA 3VQVA 4H44B 4NWWA 3RBZA 5LEKA 3WB1A 4R50A 1DHKB 2HG5C 3MGUA 3WNOA 5ITZA 3T2PA 1KQSU 1NXD1 2IZWA 2QKSA 1KKDA 1ZA4A 5FV3A 1W6PB 1Z7S1 3D6EA 3H50A 4YW3A 3LPGA 4GJYA 2JD9A 3HKDB 4CC6A 2DTYA 5EYPA 3IT8A 2R9AA 1VF6C 1QQP1 2LS6A 4FM0A 5EBMC 3LEMA 4H2AA 4B3MO 5K0UC 3VZOA 4ARYA 4WV8A 3CMGA 5AG2A 5FCCA 1BCCH 3FB7C 4NIHA 4WBNB 4BIZA 3RDIA 4ZY9A 5LA9A 5FPXA 2J7MA 1KGYA 4XOGA 5J36A 3IGAC 4L97A 2EBOA 2OXBA 2VQ0A 2GC1A 5FP7A 4QKFA 1R081 3QLQA 4NR1A 5DN2A 3DGEA 4XACA 2N74A 4MADA 4LHNA 3ZYIB 2JKXA 4YYOA 2ZE5A 1OCOB 3CCUV 2ILMA 1S0BA 1LHWA 2D43A 1RUH2 3MO4A 1EV11 3B93A 2Q67A 3TCUA 1BQ0A 3GGLA 1REFA 4DO0A 2C5DA 4N21A 1UYXA 2VMIA 3VZJA 4U3FH 2PLV1 3C7OA 3CMEV 1MACA 3J9SA 2JGUA 4E4ZA 4W4KA 5FY5A 5GLTA 4ET7A 4LF5O 3K75B 4CXYA 4DR7B 4COUA 1LENA 5FL7G 5LP6B 5LP6A 2BNMA 3KHBA 5EPAA 1JPXA 4DR2B 2VNGA 5ERLA 3W9AA 3MIBA 3FUOA 3GHNA 3ME2A 4GALA 5IT9N 3ABZA 3I8TA 1S0EA 4AEMA 3QNEA 3S57A 1VMHA 1YTFD 2WNVC 4FZ0A 3LB9A 2VUJA 5CB4B 1QEXA 1UXXX 3DC5A 4WVZA 5T54A 2RCVA 2W68A 1YXWA 4TOIA 2ZHKA 4NHYA 3QTCA 1BJQA 5F2WA 1K9MW 4TXWA 4GMP0 2D2CB 4QD2A 1AL22 2IU3A 1EN5A 4ZS3A 1EUUA 2LTNA 5EBLC 1N34B 5DG1A 2AZ0A 1QR9A 2B9VA 1O9GA 1F8VA 4J9YB 1WCDJ 5A7WA 1MEC3 4QDRA 3THOA 1CZSA 2J1RA 4K1YA 3MPPG 2E76B 3LDRA 4LE4A 4UV9A 1J5EB 3ON7A 3WDWA 4CP1A 4MTFA 1XYNA 3DXUA 5C8CC 1W2OA 5FQ0A 5L3CA 3VKOA 2AXTZ 2AUYA 3RNSA 1PMIA 1UKRA 3AJZA 4COZA 1VAVA 1OOPA 5FXVA 5A6YA 4DRXB 4MS2A 2VBPA 1QJU1 3CF6E 5IFPA 1HNZB 1BEV3 2VNVA 3HJRA 3PL0A 4FFBA 3NV4A 1JXNA 4B7KA 4MVSA 4K1ZA 2WSUA 1AXZA 3BEHA 2AHZA 2DN9A 2VTFA 4B29A 1PNFA 2AC1A 2ZXWC 5I8SA 1N0NA 2OVUA 3NV3A 4HLTA 3P3NA 5L7OC 4J9ZB 3ZN6A 4CU8A 3HB3B 3H8RA 1R64A 1YIPA 2VZQA 1M06G 3LE0A 3QD6A 1VPHA 3FFQA 1Z5VA 3LEKA 4DPNA 3ZFFA 4XBNA 4OULA 4RQPB 3RVZA 3AX4A 3LIGA 3BN6A 3OMIB 2RMU2 3TBDA 3E8GA 1ULOA 4NYKA 4RHV1 2Q73A 1ND3B 3JQXA 3RW0A 1BBT3 1ND2A 2CE4A 2HWD3 1J1LA 1QY4A 5LXTA 4EEQA 1VRH1 1N0JA 4JI6B 3OEHG 4PDLA 2R041 4GKJB 1AP5A 2FDKA 1MS3A 1EV12 4WVMB 5A7NA 4YZ5A 1SPPB 3N9QA 4JI8B 4AEJA 1UIJA 3H8UA 2RMU1 3K0DA 4BQ1A 5T5LA 4GH4B 2KM2A 1BBT1 4E2SA 4HVOA 4JDMA 4OGQB 2DWEC 2EF6A 4P9XA 5GTHZ 4QPYA 4NPMA 3ZMSA 3AG1C 5B2GB 2VQFO 1H8EG 3RS6A 1Y76A 3JD73 1Y76B 2C4XA 3IC7A 3AYEA 2XL9A 4K9SA 3AM2A 3ML0A 3W59A 5EZYB 2YROA 2PLV2 1ENRA 3BFRA 2R49A 4JAUA 2DCYA 3W7UA 2ZX0A 1HKDA 3OG2A 1NA1B 1FXVA 3NAPC 2GAUA 1K45A 4NOTA 4KP4A 2WAOA 3CU7A 1DQ1A 3JQWA 1QJU3 2HWD1 1BMV1 2IXLA 3CO2A 1B35B 2MEV3 4XDJA 4GKYA 2OT5A 2EILC 2PLV3 2Y0IA 3M3QA 1XXNA 1UX7A 3APQA 1SLBA 2DF7A 5FP9A 4GA9A 4AEDC 5C4WC 3I7DA 2Q69A 4C7UA 1TNRA 3RI9A 1UXZA 5ABJA 1JW6A 3GF6A 3JATB 4NAOA 2HEVF 3E8BA 1ACCA 2B1IA 4O9EA 4B4QA 2X7RB 3I2IA 2ZBJA 4URTA 1T6GC 1A8DA 5F3CA 4PDRA 3OD0A 4YLZA 3WP6A 5IVYA 1AVBA 5FMCA 5C8CA 1JX9A 3FB8C 1YSCA 2WR9A 1PK6C 2DTWA 3IB3A 3VD3A 4RR3A 1V9PA 3SKVA 2HP8A 5A7SA 3KM5A 5FOBB 3N36A 1ROPA 4TUYA 4B7EA 4TUYB 3ZO0B 4LFCO 2P3JA 4UW3A 5A1AA 2JB8A 1O7FA 3KCCA 5K9YA 1XNQB 4QHBA 2CTPA 1YF2A 3UO2A 3ES1A 4MTOA 3ZDVA 2VVEA 2PI5A 1L7LA 1N36B 4LIVA 2RE9A 4CTEA 5GALA 2WQ8A 3K79A 4BXFA 5FKCA 1E1RG 5LMNO 3CDZB 1HNZO 2DVBA 1J59A 2OIIA 1O3TA 4N90A 4JYCA 3U75A 4QPJA 4LBMA 1UMIA 2CV6A 3OTOB 1EM1A 5FBZA 5KUMA 3WF0A 3Q8FA 5DG2A 5D21A 3LA2A 1WLTA 4OFGA 1VBA2 4AILC 3JBG1 1V6IA 5C3QA 3N7MA 1GO3F 1H2LA 4AGGA 5HV4A 2KR2A 2RN9A 1ULDA 2VC9A 5EYXA 1AR5A 2F93B 4DV6B 3VBFB 4ZHNA 1DGRN 5GLUA 2D3SA 1FPN2 3CRMA 3SR2C 5J98B 3IN9A 1SFPA 5E88A 4BQ2A 2GSMB 3NV2A 3VDCA 3GBFA 3X2QC 2YIBA 1QJFA 1CESA 4JGYB 4BZ4A 3A2FA 1VP7A 1F15A 2VXRA 1AI7A 5C33A 4Y22A 1NCQB 4O2AB 4BW5A 1NCQA 1FXKC 2Q5ZA 1STMA 1H4HA 4D6TH 1QNWA 2VOXA 5LYJB 4CUCA 5LYJA 1W39A 1F31A 4PV1B 2R061 4Y1VA 5LBQA 3KVAA 4AQ2A 1KKCA 5APAA 2GHYA 2PTMA 4LBQD 4FLUA 4JRLA 4R52A 3M1HA 2GNMA 4FLZA 4CCLA 1W05A 3M99B 2AHYA 1IS3A 4G28B 3CCSV 4Q4X1 5GZEA 3KV5A 2VQFB 1IS4A 4DV2O 2D44A 3E2EA 4NHLA 4MH0E 3KCYA 3M70A 1SETA 4DXZA 4W6WA 1VBB3 2YGMA 2Y0OA 2W0XA 1UOBA 1W6NB 2A71A 3IC9A 4HN1A 2EXIA 1MZFA 4LBKA 4ITCA 3ZSEA 4DR4B 1K97A 5JDBA 1QOOA 1NCRB 5JCTA 3BAAA 3NMBA 1I5PA 4JTNA 1SEFA 1RM1B 3SJCC 1GQHA 3ZR6A 1V6JA 3GCXA 3RZLA 4IT5A 3PUIA 3QCWA 5LW9A 3OY8A 4E9KA 1TZOA 4JAVA 2ARBA 5J37A 1ORQC 4XIKA 2Q4SA 2M7WA 4JI0B 5FK8A 3WXPA 2NPIA 1SZTA 5FLHA 1GNZA 4EJRA 3PTYA 5C8YA 3P30A 1M90W 1XNRO 1COV1 2JDZA 3CE2A 5FJKA 2K0GA 4GAZA 3RYHA 4GZ9A 5FZ3A 4IE5A 5F1RA 1JOBA 5E8AA 1MQTA 2YUEA 1RUD3 1TUBA 2CDYA 3AMMA 3DYPA 2Y6FA 2CU5A 2ZZJA 4RYDA 2IWGB 1JU3A 3MIHA 3WLUA 1V70A 3DSQA 1MS4A 1HW7A 3ZIAG 4GT1A 2QJVA 4LUMA 3RYKA 3E35A 4HKWA 2B9ZA 1F4NA 3S30A 1VBB1 3UT5B 2MPFA 2OUHA 3MICA 2VQUA 2DCKA 2RHPA 5FZ6A 4WM8A 4WM8B 1CEZA 4ZOLB 3AYDA 3OBTA 1Q81W 4U3JA 4U3JB 4XW3A 1RUD2 1N1VA 2CAZC 2J22A 3N2KA 3CYOA 1J83A 3N2KB 3OMNB 1I7FA 5J96B 5IATA 5A7OA 1FXKB 4J1XA 2EULA 3KSCA 4GULA 5BNNB 3L9DA 4MVUA 3ETPA 1VP6A 4Q4X2 3DPRB 1RUI2 3HKEA 3DF0A 4FFHA 2KG7B 2KKWA 4AVVA 3GZUC 2VWJA 1XMOO 2UXDO 1HV0A 3AG2C 2Y60A 1PO13 3PDQA 3FMGA 5B3SB 3TEYA 3JALB 4R9DA 1I0HA 1QJX2 2D7FA 1NAEA 2EJ7A 1VQ8V 1RSOA 1I5YA 1QJY3 1KS4A 2GH2A 1ZL8B 1WA6X 1NZIA 2G19A 3NAPB 3K57A 3TJTA 2GV9A 1CAVA 1BT8A 3IWZA 5BNQA 3PJQA 2EINB 2ORXA 3FFZA 4OHXA 2BWAA 1FFTB 3UKNA 3I2FA 4LBJA 4YGBA 4CEWA 4H14A 1V6KA 1C4RA 1SKVA 4GB33 4ZU7A 4TT3G 4RWUA 2L9LA 3TYJA 1XE8A 1ZTEA 4I50B 5IT6A 3N35A 4A42A 4EKWA 3FLPA 5LGUA 1GNHA 5LWBA 5B1BC 1J3PA 4AI0A 4CDXA 2UY9A 4UFMA 4EROA 3Q8AA 4Q20A 1WW5A 3FB6C 3OSDA 1NU1H 2G9GA 5LATA 2D6LX 3OEEG 3RZZA 1RUI1 2ZMLA 5LRRA 2Y26A 3ETEA 2VGDA 2QQVA 3OD4A 1FYUA 3OEBA 4NTYA 5JPMB 4GCZA 3G80A 1MSWD 2B9UA 1H8TA 1KXGA 1WUVA 5KWRA 1JU4A 2E32A 4MTGA 2Y6KA 5IVVA 4JAAA 1WCKA 3AP6A 1LESA 3TGUH 3I97A 5ITZB 2HWE1 1OI6A 1RUJ1 1AJOA 4FOVA 5F5QA 2FZ2A 2ETEA 2DWDC 5DZEA 1DLCA 1IPKA 4DR3B 4LK7A 3S7IA 5DDJ1 5LEJA 2B42B 4AI1A 2UUCO 3MW3A 5HV0A 1UL9A 3BA8A 2ES3A 1Q6IA 3BODA 1R091 4INDA 3ZRXA 4DV3B 3NJXA 4BU2A 3W5MA 1K33A 5D8AB 2N7GA 5D8AA 4OX9O 5KHKA 2R7EB 2WT2A 3SYPA 5F3GA 3WB0A 1D2QA 4CYDA 1ZZBA 4TZDA 2ZE6A 1Q82W 3KS7A 3OUJA 1W2UA 5KR7A 1CAWA 5EJ1B 4AOCA 4LO6B 5FMDA 3H1YA 5H2FZ 1J3QA 3OPWA 2ZACA 1DQ5A 1RYYA 1GZTA 5I93A 1DCSA 2NN4A 4WZFA 1GTOA 4G3YC 1DQ0A 5LBFA 3H3LA 2RM23 2YIDA 1L0NH 4JRAA 2J1SA 4RUEA 3KVBA 4R9CA 5FUIA 3WF4A 5C3RA 1QNMA 1W0JG 5IY5B 4H33A 4GJZA 2BDRA 3OUIA 2QKAA 3B00A 1IKPA 4CCNA 1AX1A 3G6JB 3MYXA 2F17A 2RDCA 1BK0A 4DZGA 2DVDA 1SQXH 1AR81 2PI4A 3B8MA 1WP8A 1IX9A 5GZFA 4LWSB 3E6CC 5BXXA 3AG3B 4CP2A 5KA6A 3HPNA 2QZ2A 2VOWA 1VAKA 1PM9A 2GTSA 3ZPOA 4X8NA 3PUSA 3ZFGB 1QMJA 2HYKA 4CCEA 5BR8O 2UXBB 4GKJO 3ZXAC 3VBOB 1WD3A 2Y69B 1YYNA 4AI8A 1OURA 3V0BB 2WT0A 2EXHA 3WP5A 4GMP3 2X09A 1GZCA 4EQVA 2XLFA 3R4UA 4ATEA 1RVF3 1LRHA 4YM0A 4XF4A 2A3WA 1AL23 2ZKNA 2I07B 1ND2C 3SISA 4LLOA 1YI9A 1OJHA 1BZKA 3VBHA 2WLIA 3K5LA 4ZONA 1JCHA 2LJ2A 4LKEA 1GSLA 5BV6A 4J10A 1QDOA 1VRH3 2A75A 4RFT0 1Y4WA 4HMZA 1CGPA 1CAUA 4TV9A 1WD4A 4QKDA 1V55C 3MV01 1ZA7A 3VD4A 3TEWA 1Z7S3 3QOPA 5K4LA 3DV8A 4YGDA 1XNBA 3JCIA 5JVDB 4O4IB 2QM7A 1NTMH 5FNVB 3MBWA 2WA4A 4BQXA 1KJRA 3RYPA 1F51A 4COVA 3I55V 4JI1B 3K5NA 2RJLA 3AFGA 2ADEA 4XHXA 3CJIC 1RVF1 4ISRA 5DQ0A 4QX8A 3A0NA 1XUQA 1FAYA 2DURA 3O12A 3VN4A 1JA8A 1D0HA 1ZZ8A 3WF2A 1OOPB 4YZ1A 4AHYA 4B3RB 1ZBE2 1LB2A 1JHJA 2YBKA 3IPVA 3D4KA 2RR11 1QWRA 2CTRA 3CC2V 4GLXA 2OW4A 3LSUA 1J84A 1G8WA 4DW0A 3R0RA 2JK5C 2WLNA 4LF9B 3DGTA 1EYBA 2UYAA 5EBWC 1JYCA 2VZUA 2NZ9A 1L0LH 4AVAA 4XZUG 1EZVH 1QU0A 1RUNA 3G71V 3ZJZA 4J42A 4QE7A 2XQRA 4YM2A 3A8TA 2H6CA 2Q8EA 1RUE1 3ETQA 4X1KA 4LHLA 4CPBA 4DUZB 3OPTA 1BEV2 2GC3A 3HKBA 3GNEA 4Z2WA 3HKBB 1PX3A 4U7OA 3OR7C 4U7NA 4CU7A 5KHIA 3EBRA 3WCSA 4JPRA 2P4EA 4FK5C 2V73A 5HCBA 3IDEA 3V0AB 2V4DA 1KBHA 1LOAA 1S77D 1XNCA 1DFQA 3OYWA 4DEQA 5LXTB 1IS5A 2B1GA 3ZMNA 2C2AA 4L2NA 1ZWIC 2QWNB 1D4M2 3VDDB 1OCCB 4WFFA 1SPPA 2ZCWA 3D3QA 1NA1A 1Q8SA 3T2QA 4Z82A 3O1VA 3MIEA 1PHMA 2UUAB 5CA1B 3B3QE 3C7FA 3BRCA 5FR3A 4FVMA 4DXSA 1OBNA 3UCSC 5JLVA 3T4HB 3SC7X 1B35A 2EINC 4CUAA 4LK6A 3FYIB 2RS32 4Q4V3 4JX0A 5TISZ 1BEV1 2GC0A 4IETA 3U0ZA 1ZUQA 1YFYA 5A3PA 4K6BA 4NE9A 5IDJA 2XUEA 3ZYHA 3O14A 3ZSKA 2O8OA 5BY5A 1LEDA 3WDXA 2PHRA 5CBHA 3S3XA 2GSYA 1HRV2 3I2KA 2W94A 4GWIA 4RR3C 4IEPA 5T5OA 2XKOA 3ZMOA 2TBVA 2LW8A 3ZX6A 4O2BA 5J2UB 2EA7A 5GZCA 1KDMA 4FOQA 2ZJCA 1RUE2 2YXLA 3WOGA 2FKXA 4YVSC 4Q0SA 1PO23 4RO2A 2XKPA 4QGMA 2KXLA 4Z8BA 1S4CA 1OCZC 1QVGU 4DYLA 2CGNA 2DJVA 3POFA 2Y6JA 3SGIA 2QQIA 2CY6A 1O8PA 4NJ4A 2R0HA 4C0HA 3OCPA 2WNVA 3SITA 3T2OA 1TEIA 2A3QA 2RR12 2P3IA 4DR1B 5BYNA 4E2GA 1VB2A 3JATA 3A4UA 1PV0A 3O1TA 3ZSMA 3S7EA 3EO6A 1VBE2 3UYJA 3LQCA 4QU2A 4JASA 2R9IA 4I7ZB 4BWAA 1ZM1A 1HP8A 2W39A 4KFMA 3SYOA 2WNUA 1RUJ3 1Y9QA 3SPHA 3CJIB 2DCJA 1OMIA 5IE9A 4CP9B 1W8OA 4CP9A 4A44A 4Q0UA 1JFFB 2A6YA 3WP3A 1EPWA 1JFFA 3LD8A 2UU9B 4P9JA 4Q0QA 2CUGA 2AYHA 4WVVA 1JZ8A 2HJIA 3R4SA 3JSLA 5FMBA 4XQWA 4KGGA 3M7AA 2UXNA 5J1XA 1MZ6A 2YI8A 1ZRRA 1K92A 5IJ9B 3DL3A 4CDWA 4O61A 1VBC3 2YFUA 1CQ9A 1G1XB 1RHI3 2EZPA 1WB8A 4R9AA 1TUEB 1AI4A 1SZXA 2D3OW 3FX3A 2FMYA 4XUTA 4A45A 3BTAA 4BDVB 3MHHC 5LHHA 4IGQA 4JI1O 3W7SA 1IBLO 3G6BA 1JZ2A 5I0RA 1VF5B 3WUDA 2DCTA 2JDHA 1S76D 1RUH1 1XU1A 2PMWB 2ARXA 2ZD9A 2JECA 2IXIA 1DF4A 1JHNA 3HBZA 5B1AB 4YHHB 3LSSA 3K46A 1AL21 2Z0AA 1GYKA 4Q27A 1RUC2 5FZOB 4JI2B 4UVAA 1SG3A 2RDRA 3TEZA 2D3PA 2OKXA 4I0WB 1QR8A 4YW5A 1AUYA 5BPXA 1VBA3 3LCPA 4N43C 1X8EA 5C7GA 4MOAA 5E1AC 4UV8A 4Y22B 3WW2A 3C3VA 1SFYA 1MABG 1RUH3 2A73B 3APOA 1UU4A 4OUSA 3UKTA 5HCHA 1SBFA 4IEWA 1S3JA 2Q30A 4EN7B 5J2TB 1JYVA 2ZM6O 3T08A 4YARA 3HMYA 5FTTC 4LBQB 1THZA 4D94A 3ECQA 1HJGA 2WFF3 4DB5A 3AP7A 1ZX5A 1XSRA 3T09A 2P3KA 3B01A 2AGSA 1DG6A 4FSJA 3J8F1 4QHOA 1W6PA 2K1EA 3B7MA 3Q4HA 2FD8A 4M01A 2PF4E 4FT8A 4S2FA 4Y1ZA 4CCCA 4IXLA 2XASA 3E22B 1O6UA 2VMFA 5FMOL 1TME1 4XDLA 1URXA 2VW2A 3OEAA 2OX0A 1ZRIA 4HL0A 1H2MA 1B6QA 4UW4A 5BMVB 2H8PC 5GLZA 3AJYA 4Q6GA 1G4YB 2YI9A 2X10A 3UT5A 4IGOA 1KB9F 1ZX3A 5FXWA 4FPEA 1ZRCA 2E3CA 2TUNA 1RITA 5C6CA 3SEPA 4YVWC 3PLQA 3A22A 1UOJA 3B09A 2PYTA 4PJ0Z 2RG4A 3M7MX 3MUY1 4CH5A 1PPJH 5LBEA 5KA5A 1DF5A 3HKEB 1U97A 2Q9LA 3FYEB 4RD7A 3AZZA 5CA0B 3M2MA 1AZDA 4X6QB 3A0KA 1SQVH 4EV0A 4LTAA 4XTMA 4JKMA 1FNZA 3EHKA 1PK6A 1X50A 2D40A 1IBMB 2VR4A 2ZCEA 5KHGA 1DGRA 2P90A 4QX1A 1H30A 3JYCA 3ZRSA 4B3MB 3H9AA 5B4XA 1KRIA 5AFBA 4NXMB 4A3XA 3MAQA 3UQ8A 5G04L 5FPUA 3ZYGA 5I91A 2WWWA 2Q8VA 2EALA 1NG0A 2GALA 2ZOEB 1NT2B 3N9PA 3K0GA 4LR4A 4DV7O 4URAA 2GNDA 3G7DA 5JIUA 1EZJA 1F4MA 1OF3A 2A5ZA 2MEV1 3ABKC 1UYYA 2YXYA 1PZ7A 1RUF3 1W9FA 1Q56A 1QXPA 2N04A 3K4AA 4FAGA 2YPJA 4DO2A 4WFHA 2JX9A 4DXWA 4CA9A 2JS5A 4F83A 3WVJA 1N33O 2OTJV 1SLCA 2VMDA 2J1TA 4IGPA 2W91A 1DU3D 3J7HA 1NY72 1XU2A 5EV7A 3OGJA 5F37A 3HWJA 2WT1A 2XWBB 4HVQA 4JI5O 4LO5B 4E4DX 5FY0A 1K12A 2DUQA 2FMLA 4FPHA 3OMAB 3OUFA 2QDNA 2FTKA 4X64O 4I50A 1UY0A 4AR2A 4X1IA 1MVQA 3NXSA 4UAPA 3HN1A 5FZGA 1W9SA 2IJIA 3B2EE 2XBO2 4W4ZA 3WR0A 1V55B 3UETA 5IWAB 3FN9A 4IL7A 3CZJA 1S5LZ 3EJKA 1L7QA 2MW2B 1LGCA 1WLDA 1GKBA 3JAMN 3FZ3A 3NVCA 1S5JA 5A32A 1AF9A 3THTA 5A32B 2BPA2 4NTXA 1OA4A 4Q0PA 2JIGA 2W1SA 3CRRA 1ULEA 2XQXA 4R9BA 2RR13 4QMAA 2VAUA 3VD5A 4QPIA 2BW8A 1POQA 5EIYB 1D5AA 2GNBA 3HR0A 4CU6A 3K77A 2JGDB 4LHSA 2FBEA 2E7AA 3FB5C 4UVCA 5KMGB 3SCFA 1Q5OA 1CAWB 4DV5B 3BUCA 2JDNA 3CSXA 4CCMA 4N8MA 4CZSA 5F2VO 1H2NA 4AK3A 3QO8A 2X6BA 1JZ3A 3Q8EA 1OLQA 4AAXA 2JENA 1TME2 5H9SA 5EYPB 4KHPO 4CCDA 1MMMA 4BPZA 5FWJA 1PGW1 4Y5SA 2DCZA 4WF9V 4GYCB 2R30A 4GH4A 3RWRD 1M4WA 1UOFA 5GONB 4P9GA 1ULGA 4TQDA 3C7EA 4GX2A 4AI2A 5LA0A 1M93A 4MW3A 4QGNA 1N4CA 1BQPA 1W8TA 3IMMA 1WW4A 3PU8A 4FBFA 4PDWC 1IKQA 1AR61 1SERA 5DDJ3 1IDSA 3RYIB 1P7GA 4KQ7A 4YSFA 3VBRA 4JYBA 3VBRB 1US6A 3WW1A 4LF8O 1UY4A 1DGLA 2ZX3A 1HB3A 1CJPA 1LGNA 3ZYJB 4WM7C 4ZU4A 1IPSA 1DQ6A 2BWCA 1PIV3 5IK8A 1BCXA 4Y4RA 4L99A 4DR3O 5JI9A 2PYLA 1K4CC 1R1BA 4P00B 4M4RA 2A6VA 1VALA 3DXTA 1FYJA 2QSAA 2W46A 2Y6LA 4OPHA 2AR6A 2VTXJ 3RMYA 3C90A 5IYBO 4HT1T 4C0BA 2EIKB 1OCZB 4HNAA 1XDCA 3JD1A 1FPN1 2W87A 2DDUA 5LBBA 3UM7A 2R1BA 4N23A 1VJ2A 1YFUA 1N3PA 2ADDA 1OA2A 3OBRA 1UMHA 3DYOA 4RN5A 3E5QA 3DN7A 3SYQA 1W9YA 2FDHA 3NKTA 3NJVA 1DP0A 1VQLV 4UB6Z 3ZHSA 1YQ5A 5IK7A 5A6XA 2LFSA 2DU0A 1F23A 2NN8A 2JJ6A 3LWCA 1ENSA 1IXMA 4NHMA 1JBCA 4X20A 3ZR5A 2JG9A 4HPKA 2R6QA 5EWSA 2QQJA 4DIQA 5M0TA 2IJKA 3RGBA 1J95A 3SJQC 5LMUO 1MS9A 2BGCA 1YZBA 2WRAA 4QWNA 1H8TC 1S0VA 2F4VO 2J1UA 4NROA 3T2TA 1GUIA 3FAVA 2HWF3 3THCA 3USSA 2JDUA 2B7YA 1VQ7V 2D6PA 4CDUB 5EK0A 4ZU5A 4XXAA 3U37A 3KT7A 3GZAA 3T2MA 2WN3A 1TVKB 4IEYA 2DOSA 3HVDA 1TVKA 1W6OA 4DRXA 1ST8A 3P5BA 1W3XA 2P67A 4DR5O 1DBNA 3NSTA 1SS3A 1CZTA 4YG6A 1HV1A 5FLXN 4EFEA 1S0IA 3UT0A 3AEIA 2EXKA 5LGNA 1LNQA 2VW1A 2ZGLA 1AR1B 2WSSG 4YJ2A 1IVSA 1XBLA 5FYBA 4TWTA 4LO7A 4G2KA 1QVFU 4ASUG 3N9LA 3ZRVA 1GLHA 4OX9B 2SLIA 1F5FA 2ZX4A 3POYA 5DAVA 4MXVA 1ZYBA 2XWJB 1X9PA 4GUNA 3I59B 2VUCA 1P84F 3JXSA 4YNIA 2BSKA 3E8FA 2D5FA 4AHZA 5LY1A 4D8MA 1GZ9A 1QHTA 5DXDA 4DXRA 2JEUA 5CADA 1CR7A 4COWA 3P3PA 1PO21 3STZC 3POJA 2XDVA 1Q90D 4PLNA 2AGAA 3WG7B 5KXEA 2HR3A 1FMD2 2LP7A 2YIBD 1UYZA 1OPOA 5E1RA 1W06A 4AEDA 3S6PA 1WNSA 2G4IA 1MS0A 1AYM2 1V9U2 1F7YA 2O0OA 4LFCB 5DUWA 1DQ4A 2V4VA 4L8QA 5FOJB 3RYCA 5FO9B 5IYZB 3AMPA 1WPBA 3B40A 4IHJA 4I2OA 4Y33A 5CA1A 4TWKA 3B77A 1YFWA 4MGSA 3PMEA 1AJKA 4MVQA 3QO7A 2ZABA 3H3ZA 2VO5A 4LITA 5A6QA 3HR9A 1EAH1 1UPIA 2CYFA 3ASIA 2XAHA 1ONAA 1NXMA 3VHNA 4PI2A 2WN2A 4B08A 4QGPA 1LODA 1QJY2 3KZ4C 1S0FA 1LR1A 2UU8A 3B94A 3RRDA 2H0BA 3NKGA 2IU0A 2VVFA 2QR4A 5LRSA 3H9VA 3JD3A 1ZBA1 1FOD2 4O4LA 1H2SB 2R0FA 2Z5WA 3L9JT 2Y0PA 2VOKA 3ATGA 2YFZA 3PN1A 4QB1A 3JAKB 1C1LA 4DV4B 4GIQA 2YC0A 4QM8A 1G9FA 4LKDA 4L0PA 3OBZA 2XBO3 1ZZCA 2OCHA 3WU2Z 1TQ5A 4LBOA 4S2HA 3WFVA 4R8CA 1OV9A 2DWRA 2NLRA 2B39A 2F1MA 3SKJE 5IJRA 3PUQA 1UX6A 1OLME 1WP7A 3T1YO 2CTWA 4NO4A 1KMIZ 1LECA 5IK5A 5G05L 3CKHA 2ZR2A 2PHFA 1QLEC 2R071 2GMEA 2BGPA 4AHWA 4DOUA 1YNAA 4BMEA 3LIHA 2X5IB 5A9GA 1W6QA 1W6QB 1I9RA 2QFEA 4GH4C 2XVGA 3FHIB 2DQ0A 1Q3EA 4NN0A 5L3EA 1VBD3 4D3WA 5AC93 2PFWA 2WNVB 4CEYB 5CFCB 4JI3B 5CFCA 4Y5TA 3RZJA 1YWKA 3AG1B 2VS0A 1AVMA 1N1SA 4BQ5A 1AR91 3JASB 2YXHA 1J58A 3IIAA 2DUOA 4FO9A 5CIRA 4ZI7B 1ENXA 4XQDA 1U5ZA 3AG3C 3AXEA 5CA6A 3JARA 4BM8A 4B3TO 4JV4A 1UN1A 3KQRA 1HIXA 1N1TA 2GN3A 1FI2A 3CB2A 1WCUA 2JKBA 1CX1A 4PA9A 1VBC1 3WQ0A 4NAMA 2ZTNA 4GX5A 5F3IA 3ZXFA 2RM21 3ZFGC 4CC5A 4N9IA 1KYOF 2HEYF 3L73H 1RMU1 3NNLA 2B8MA 1W8WA 5H5NA 2YDEA 4Q4W1 2ZEYA 1AR72 1O5UA 4I55A 4UW5A 3E6DA 1YLLA 2WZEA 5LASA 4LOSA 4CPBD 4A4AA 3BALA 4IE0A 5CFDB 4K8RB 4EB6B 1S72V 1EBOA 1AR92 3N3HA 4J7JA 4ZXEA 4LNVA 1SHWB 3ZXKA 5BNPB 1H8HG 5EC2C 1FFXB 1E5HA 4BQWA 1FFXA 4O2AA 5L3GA 2Q1ZB 2KB1A 4K7JA 3OJBA 4TV8A 3SCHA 4DFSA 1Y6XA 1SMVA 1W2AX 4PF1A 1UYPA 5A2QN 2JXAA 3PJYA 2JDAA 2XJSA 2X05A 1AR93 4EN8B 3W7WA 2KQXA 1SESA 2XLAA 2QVSB 1NZ6A 4YJ3A 5LA6A 4HFSA 4ZS2A 1D4M1 5HBAA 2LGQA 2FDIA 5LHGA 3WZ1A 5D8AC 1GMGA 4QB6A 3OFNG 3Q4HB 4PLOA 3KGZA 5JWPA 1S5HC 1CJDA 1VR3A 4TSVA 3USUB 4M0HA 4NXMO 2DYRB 2EZOA 4W6XA 3T1HO 4DV0B 5EQUA 1Q8OA 5H6RA 2CHHA 2ZA9A 3JD0A 2E5LB 3Q8CA 1AP6A 4KWLA 1LGBA 3SMHA 1SQGA 1PIV1 4YM3A 3BI3A 2ADQB 1R73A 2QM4A 1O4ZA 3HQUA 1CX4A 3WB2A 4RS5A 2A6ZA 2ZX1A 2CAUA 4CCOA 1W6MA 4MHUA 3ZSLA 4NIGA 3HKCB 5I8TA 1VRH2 2WWJA 5H9QA 2ZINA 1H1IA 1XOYA 5JMOA 1QQP2 3DKWA 4R4XA 2BJSA 5KC6A 1QLEB 4OXSA 3HKDA 1NQJA 4KL1A 4XPVA 3ZHTA 3AKSA 2BRTA 1SCRA 1ND3C 1YI7A 4CDUC 5ACA2 3H7JA 3GJBA 4UFKA 3J7MA 1R6KA 2JDIG 1M4UA 2IC1A 3DEMA 1YHFA 2RQ6A 3RSJA 4ZZ8A 1ULCA 2A0LA 3AP4A 5F39A 5HFMA 1A78A 3N7JA 1RXFA 4BAYA 1OKOA 4CU9A 1DYPA 1QJY1 2JB4A 4FJCC 4LFAO 3VHRA 5A6ZA 5C5UA 3N4MA 2RVAA 2VZTA 4K3UA 1ZRDA 1VMFA 3K08A 2WLPA 1HJFA 4XDQA 1GN3A 1XNTA 5FZIA 3CLPA 3N9MA 2VNRA 1KC8W 5GZDA 2JEMA 5L73A 2K9PA 1GZWA 5GM0A 3SXWA 2IVIB 3ACIA 2AW9A 1ENQA 2J42A 2ZIMA 4W50A 3DPRA 5FZHA 1DLBA 1WKYA 2P7TC 4AZZA 4CH6A 2OPKA 1JS9A 1ULFA 1RXGA 4E2QA 4SBVA 4X1YB 3VBHC 1UZWA 4I0AA 4QQOA 3I3QA 1MR5A 1PZ8A 3AVRA 3RJRA 1E57A 1W2TA 3M8LA 2P4VA 4A6OA 3A0BZ 1XHXA 3ST7A 4MO3M 3WCRA 1RSOB 1O9HA 1AYM3 1V9U3 4UFHA 3B8NA 3UL2A 3ORJA 4CS2A 1RUOA 2YUAA 3BHPA 1H1AA 4WZCA 1CAUB 2L6LA 5IW0A 2B45X 1K42A 3OBAA 4DQAA 5C3PA 2D6KA 4LC1A 1O4YA 4K21A 4QPGC 5T52A 1Q86W 5E79Z 1KJLA 2XAJA 2HWB1 3AP5A 2R1DA 4Q26A 3RG0A 3N27A 1N8RW 4F3JA 2IXHA 2DV9A 4UCSA 4FTSA 2ODMA 1QJX1 1FOD3 1UZYA 1PNKA 4LFAB 3VB9A 2ZHNA 4QDSA 3B69A 1YJNV 3E1F1 4XMAA 5F9TA 2XHKA 2AZ2A 4XUNA 5B1NA 4MXWA 2CK3G 5FPRA 2L35A 1DZRA 5FZLA 2VY0A 1M56B 5JSPA 1WZXA 2A7AA 4MGQA 4MV2A 3E5XA 4UCRA 2AEZA 3NJZA 1QJX3 2V4AA 2OIGA 2P6HA 3VOUA 3AKRA 1WBFA 5FDBA 2A70A 3WY6A 1M57C 4PA4A 2ZXWB 4X1IB 3ABUA 1AX2A 2QQPA 2DMXA 4N43A 1D7PM 2OQ6A 2WFPA 2M6YA 5FKBA 3WQBA 3NNFA 3ZDSA 1YTFB 5FK7A 3CJHA 4UCUA 2E53A 1OQDA 3L2HA 3TN93 4S2GA 4BLJA 4JF3A 4GKKO 1W8NA 4QGLA 3KLSA 2D97A 1UOGA 4DUYB 4FTBA 4W4LA 4FPKA 2ATFA 1Y9MA 4XAEA 4AQTA 4CE8A 4LF7B 2W95A 1F35A 3I4IA 3MEPA 4XDKA 1N33B 4UBGA 2WNOA 1DGWX 3MV11 4DK0A 3H1WA 1LHVA 3OM3B 4LORA 1HDKA 3VBSC 2JGDA 1W90A 2AZ5A 3V0AA 2ZNJA 1N36O 2DYSC 3GCWA 3D36C 4FFFA 1X59A 2ARCA 4J1WA 4QM9A 1S1AA 5AFEA 5EXOA 2AACA 3MZHA 5DABA 2RS51 3C7GA 3MLKA 1N32O 2IXKA 4AF9A 4Z92B 1HQLA 4M4PA 3KZIZ 4AW7A 3O1PA 2LUWA 4OVEA 4NPLA 1ALYA 3LNNA 1UY2A 1X36A 3J26N 5J48A 3MD0A 4X8PA 2I74A 1JTZX 3VD9A 5KXDA 1Y4MA 3EFFK 2OTLV 5GJ6A 2VOTA 1BVP1 3RYIA 4IE6A 3DKQA 4F7ZA 5J09A 1AR73 1TA8A 3EVKA 1N34O 4Z07A 3CCEV 2W3JA 3WUCA 4XFAA 4NWVA 1LHNA 4K20A 1NZCA 3E6BA 4F8AA 5ACA1 2ORZA 4P9LA 2OIEA 2JG8B 3EQEA 1WCQA 3AKTA 2BQPA 5C8CB 5SV5A 3ZFGA 3GM8A 5FFOC 1E5IA 4QB2A 3HIFA 4LUKA 4X88A 2VM9A 4A5UB 1N32B 1W3VA 5L3BA 1KD1W 1W2NA 4FM1A