4KL1A

Hcn4 cnbd in complex with cgmp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
193
structure length
192
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic dinucleotides bind the C-linker of HCN4 to control channel cAMP responsiveness.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 60
structure length 192
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4kl1A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kl1A02
4AXOA 3HQXA 3SXWA 4AVAA 5HI0A 3SMHA 4BHPA 2E9QA 5BUVA 1JUHA 2ET7A 3MPBA 4FT8A 5E1RA 5I8YA 1YWKA 1ZZ8A 3FE5A 4QGMA 4D7SA 2DCTA 3WW2A 2ET1A 1ZX5A 2PAKA 2KXLA 2ZCWA 3BB6A 3EQEA 3LA3A 5T3NA 4HSLA 3KSCA 4X6QB 3WW3A 2FMYA 3LAGA 2FQPA 3DV8A 3ES4A 4KWLA 2PHDA 2H0VA 1J3RA 1ZZBA 3GYDA 4Q0VA 3BALA 4LUKA 5FLJA 2D93A 1NZCA 1ZZCA 4XF9A 4IEVA 5LEJA 5AVPA 1ZRFA 3RPQA 1OMIA 3RNSA 4FBFA 4HN1A 4B29A 1Q3EA 4HSJA 4Q0PA 1ZZ7A 1NXMA 5JAXA 2Z2SB 1O3QA 4YNIA 1RC6A 2D5HA 3LOIA 4Z07A 5C6CA 1LKNA 3ACLA 2IC1A 3PLQA 4AQ6A 2GZWA 3H7YA 1HW5A 4O9EA 4PIZA 1VP6A 3JZVA 4QXKA 4KWKA 3SCHA 1I6XA 1YUDA 4QM8A 1QXJA 4EWEA 3USSA 2OA2A 3FX3A 4QMAA 3CLPA 4I0BA 2H6BA 4YRDA 1RL3A 4D7TA 2IXIA 2B8MA 3NKTA 1RUOA 4MGZE 5I0TA 2BNNA 3CEWA 2GC3A 4YYOA 4QGNA 2VPVA 3KCCA 3ELNA 1SEFA 1CGPA 5FQ0B 5I0RA 1NYWA 3H50A 3LA2A 4WZCA 3WW4A 2Q30A 3HT2A 2QDRA 3WW1A 3FZ3A 4HMZA 2XLFA 4XF3A 4HVOA 1UPIA 3CL1A 4KL1A 4MGYE 4RD7A 3RDIA 3FWEA 3GBFA 5FPZA 1VR3A 2XLGA 4TLFA 3D82A 2B9UA 2PAEA 3H8UA 2CGPA 1O5LA 4XFHA 4MUVA 3I59B 1SQ4A 1XE8A 5EFUA 1L3JA 3H1WA 4MGKE 1UIKA 4R8HA 3U10A 4UXAA 5FLIA 3IWZA 2HJIA 5FDBA 3EJKA 2WC2A 2XKPA 1CX4A 5D1IA 3R6SA 3DL3A 2XKOA 3KMHA 4H7LA 3M70A 4XFFA 3UKVA 1Q43A 4JTOA 1IPKA 2IXLA 3BCWA 5CADA 2IXJA 1ZRCA 4BH9A 3H7JA 4HN0A 1V70A 1O3SA 4IEWA 1Q5OA 2Q1ZB 4QX5A 1Y3TA 4J1XA 4BIFA 4IEUA 1OI6A 3C3VA 1ZREA 3NJZA 4BYYA 4META 5FQ0A 5EZWA 1DZRA 4YARA 3O14A 2BYVE 1UW8A 2UY9A 3UKTA 5BY5A 3N4MA 2XL7A 5FCCA 3OGJA 1OFNA 4FAHA 4I09A 1YHFA 5JCTA 4Z82A 5CU1A 1OD5A 1NE6A 3LWCA 4IEOA 4JTNA 1YFXA 1YLLA 4IERA 1J58A 2IXCA 1CAXA 4MX3A 2GC0A 2BNOA 2QCSB 1ZRDA 3OTFA 2MHFA 2K0GA 1EY2A 4R52A 2OZ6A 5JR7B 4Q0UA 4XF0A 5JSPA 4EWDA 1DZTA 2ZKLA 1CAWA 1LRHA 3LA7A 1J3QA 2PFWA 2PTMA 2MNGA 3BPZA 4LULA 5I0SA 1UD1A 2OZJA 2PHLA 3NL1A 2Q4SA 3TNQA 1U12A 4I3PA 2MPFA 1CAWB 3CJXA 3I54A 3KGLA 4XFAA 3FJSA 3OF1A 3D0JA 4KU8A 5KHJA 3NSTA 3ES1A 3VHRA 4ONUA 2ETEA 4XFGA 4LLOA 3MZHA 3FFQA 1FXZA 4JV4A 4I02A 4F8AA 3I7DA 4MV2A 1LB2A 1J59A 4L11A 5E16A 3MDPA 3H1MA 4I2OA 3EO6A 1QY4A 3HIFA 4MZUA 2BGCA 1O4TA 5I91A 1WA4A 1CAUA 2VECA 4HVRA 3ETQA 4E2SA 5J48A 2EAAA 3RYPA 3D0SA 2IXHA 1XRUA 2XLAA 4Q0SA 4HLTA 4A2UA 5I8TA 5I8SA 4HZFA 2GC2A 1YFWA 2D5FA 4MH0E 3TNPB 2IXKA 4EROA 3E6BA 4OLLA 1YFYA 2HKXA 3QACA 4K8FA 3ST7A 2Y0OA 4X6RB 3I59A 3IDBB 4I0AA 2B5HA 4KU7A 3ROUA 5LEKA 5LRSA 4IEYA 3EBRA 2GC1A 3RYRA 4N9HA 4ZU4A 3EHKA 4OFGA 5KHHA 1J3PA 4AVBA 3PNAA 5J3UA 4XFCA 4N9IA 1EP0A 2UYAA 2XGXA 2UY8A 5KHKA 4L2NA 4Q0QA 1O3TA 2N7GA 3DKWA 3S7IA 3H3UA 5BV6A 4ZU5A 5C8WA 4XETA 4PIXA 2OPKA 4KWJA 4F7ZA 4HBNA 1ZVFA 2QJVA 4PIYA 1GQGA 4IEPA 4XFBA 2D40A 5CVRA 2O1QA 4LEJA 4XFIA 1DGWA 1VJ2A 4AVCA 2OYZA 1ZNPA 4CYDA 3SHRA 3CF6E 3NVCA 4O9GA 1Y9QA 2XHKA 1I5ZA 4FAGA 1UIJA 3MYXA 3IIAA 3NW4A 1QWRA 2WFPA 2ATFA 2C0ZA 3S7EA 1G6NA 4IEXA 4MGIE 4EV0A 1RTVA 1X8EA 3IBMA 3PVBB 1XE7A 1WLTA 4LA3A 2Q0AA 2V09A 1J1LA 4AQ2A 1ZZ9A 5KHGA 4E2QA 1ZZ6A 4HVQA 2PYTA 1LR5A 3M3IA 1WGPA 2CAVA 5KBFA 5BXXA 3S0MA 3L2HA 4YSFA 1PMIA 2H6CA 1EPZA 4ZU7A 4E2GA 1IPJA 3G7DA 2K9ZA 4WVZA 3CO2A 4XF4A 2VQAA 4UBGA 3E97A 3E5XA 3H1YA 4ORFA 1QXRA 1EYBA 4IEQA 4DINB 2CV6A 2GH2A 2CAUA 2PQQA 2XL9A 1X8MA 3E6DA 2P17A 2QNKA 1SFNA 1CAUB 4IESA 4J1WA 4I01A 3SCGA 5FLHA 3ZDSA 3BU7A 1X7NA 2QVSB 3QOPA 4LTAA 1DGRA 5K8SA 5JSRA 3FHIB 1H1IA 1TQ5A 1GQHA 3E5UA 3LZZA 4XF1A 5LRRA 4QGLA 2GU9A 1PM7A 1O7FA 3KGZA 4GULA 2BEOA 1O5UA 1UCXA 3H9AA 2EVXA 4EWAA 3SCFA 1FT9A 1CAVA 1X82A 4NVPA 3U11A 4XEZA 1RGSA 2O8QA 4PJYA 5I0UA 4UBHA 4JVAA 5J7MA 1YFUA 4IETA 4LA2A 3OCPA 2UYBA 1CAXB 2BNMA 3OD0A 5FPXA 3E6CC 1FI2A 1O3RA 2GAUA 4WBBA 1H1MA 3HT1A 4P9GA 3RYKA 2I45A 1ZRRA 2PA7A 5KHIA 3H3ZA 4Q29A 4QM9A 2PAMA 3DN7A 1RUNA 2Z69A 4LUMA 2EA7A 3IDCB 5JSOA 3UKNA 1NE4A 5I93A 4IEZA 1CAVB 5BPXA 3E5QA 2F4PA 5F1RA 3U0ZA 3RZZA 3B02A
chains in the Genus database with same CATH superfamily
4Z8BA 2WLMA 2JKXA 2B4KA 3I2GA 4UV8A 4AVAA 4E4HA 1FOD3 4FPEA 3BKZA 5J2UB 1GNHA 4DY5A 1YWKA 2PXJA 2AEZA 1LJ7A 5T3NA 3QVNA 3VBHA 3AM2A 2ZAAA 3NNJA 3VDBA 1UKRA 4IUGA 4CP9A 2H0VA 5FOBB 3AL6A 1K5JA 1AJQA 4XF9A 1QHTA 4JCKA 2OQ6A 3HNMA 5FO9B 2M7WA 3RPQA 3SNMA 3U07A 1D4VB 3NKGA 4RQPA 5A7QA 4H37A 3OGSA 1NA1B 3U1XA 1W0OA 2ILMA 2WR9A 4B4PA 3ZXDA 1VP6A 3V0BB 3D8CA 4HKWA 3THOA 1TAEA 1MZFA 2OA2A 2QUOA 2GMEA 4WFEA 3GDBA 2ZHLA 2WWUA 1IG3A 4EQVA 2R49A 2HEVF 1SESA 3PHMA 1I0HA 3OPWA 1QJU3 4LBLA 4NRQA 2VOWA 2E76B 2P22C 5A1LA 3VZMA 5JMOA 4HVOA 1EZVH 3C7OA 3GBFA 1CQ9A 1UX6A 1WD3A 2D3OW 5FY9A 5LGUA 3C7GA 3MIDA 4YW5A 4YZ5A 3ZHRA 1MS1A 1H2NA 3AP9A 3I56V 2UXXA 4XIKA 1EN5A 1LOCA 3MIGA 3H0OA 3AP6A 3LDDA 1FMD1 2PHFA 1QDOA 5B1BB 3UK9A 1GICA 3VKNA 4IGPA 4H13B 2VMIA 1OFNA 3OGJA 3VBFC 5EIBC 1K34A 5KWRA 1NCRC 2ZE5A 3VLBB 3GGLA 3LWCA 4EB6A 1F35A 2RG4A 4DR3O 3ABLC 5E89A 2G4IA 2CE4A 2GC0A 1KGYA 1Z7S2 5F3GA 3M3QA 3TOJA 3AG3B 1AJNA 3WVJA 1C5IA 2CUGA 2PFWA 1K9MW 1GMGA 3LDRA 1URFA 4BQWA 3WXPA 1JPXA 2Z5WA 1TG7A 3VZLA 4XJZA 3TYJA 2XQRA 1HN0A 3J81N 4X66B 3E8FA 3MF9A 1FXZA 3WQ1A 5H9SA 5J2UA 4KG0A 4GMP3 5C3OA 4I02A 1MEC1 4E2LA 2EXKA 5I91A 2XXZA 3FC0A 4RHV1 5J48A 3D0SA 3BVCA 2BUKA 3MO4A 3L72H 5JR2A 1OLQA 2RV9A 1MSWD 4PBPA 5BY1A 1RIRA 3ACIA 1POV0 5FJKA 1UY0A 3JARA 4WBNA 3J7LA 1WPXA 5A7WA 2FDFA 2UXBB 3RGBA 1JR9A 2B45X 3GB7C 3H8OA 4DXSA 1YI7A 2W47A 3HR9A 4F7ZA 4A45A 4I50B 5FZ4A 1S2EA 1VF6A 4XFBA 4A44A 2J1VA 1L0LH 3ZFGC 3NJXA 3T4ZA 1PGW1 4LF7B 3CF6E 2ADPA 2BV4A 2OWOA 5J2TB 2QEXV 3B09A 3KHBA 1MS5A 1EM1A 1VMFA 2BU9A 3SJBC 3WT3A 4NMIA 1LUVA 5KBFA 3IDEA 2XJSA 5H5NA 2VCMA 4QQLA 1FXKA 1H2MA 2P6CA 2A3WA 4YJ2B 3VOUA 5GJ6A 1O4ZA 3FB7C 1G8MA 4IL6Z 4IV1A 2DVGA 4DV0O 2D6MA 1PO11 3QOPA 4V2VA 3T2PA 4XUOA 2G9ZA 5JSRA 4EB6B 4LLFA 1PNMA 1XNTA 3HN3A 1BK1A 3KGZA 4J25A 4QHBA 3K06A 1UCXA 2VQTA 3ILRA 5FFOC 4IYIA 3EB7A 1UXZA 4JTAB 4BIUA 1QCEA 3TBDA 3ZXEA 4MTGA 2QDNA 1SBFA 4R4ZA 5H2FZ 2E7TA 1H1MA 5EBWC 5KHIA 1YF2A 1UOBA 3ZIXA 4JHTA 2V5DA 5IVJA 1WCQA 2ZX2A 2DQ3A 4SBVA 4PDWB 4IEZA 5IK8A 2AHYA 5FY0A 3KG2A 2KM2A 4EYUA 4AFBA 4UT5A 2NMOA 4AEJA 3KM5A 2YZ4A 2ZABA 1MS0A 2HEPA 2Q9LA 2ZCWA 3STLC 2ARBA 5J09A 4JI8O 1UYPA 1NKGA 2RR13 4YXWG 3N7KA 4JAUA 2FQPA 4KWLA 2NP0A 2ZBJA 2IH3C 1DQ4A 5J1XA 5AG2A 2ZDIA 4YGCA 5EJ3A 3N7MA 1CZTA 3ICXA 4OI2A 4PDWA 4LJHA 4IV1C 2HWB3 2RJZA 2HWE2 1NI8A 3AKPA 1WLDA 2WLNA 4MTXA 2H8PC 2EIJC 2X6CA 1G8WA 5GTIZ 4PJ0Z 3H7YA 1JOJA 4YIPA 4DR4B 1KP2A 3BOPA 2ZHKA 1I6XA 5FZ3A 2D43A 2X10A 5FNVB 4RS5A 2AYHA 3WHUA 1D2SA 5GZEA 4LF8O 2OCHA 3ZR5A 1JZ4A 5BMVA 1N8RW 4XJAA 2Q1MA 1ND2B 1REEA 4K8ZA 1QOOA 2VQFO 1FOD2 3WW4A 5FKCA 2KB1A 1YHQV 4TZDA 2CDYA 4KGQA 5LA9A 5FZGA 1XYNA 3AKQA 1GUIA 4QPGB 3KQ4B 5A3LA 1XDCA 4DB5A 1YRZA 1IGOA 2YFZA 2A1XA 2FDIA 3VB9A 2Q4PA 3ZN0A 3VBHB 2P3YA 5JVDA 3IM0A 2CYFA 4M0NA 4P9JA 3N2KB 5DN6G 2AUYA 4B3RB 4QXBA 2PHUA 3CMGA 2F43G 2FTKA 1W28A 2XQXA 4GWJA 4P5YA 3UNPA 4C1XA 1R6KA 3D36A 3ETGA 2WLLB 4Y5SA 1DGSA 1UW8A 4Q8LA 1MA1A 4NAOA 2CU5A 5AFEA 4PT6A 5JCTA 1ZM1A 3PIJA 1FYJA 1QU0A 1C28A 5FK7A 1L0NH 4J7KA 3Q9OA 3D3IA 4IERA 2RM22 4AYUA 4LITA 4BQ2A 2EXHA 3MHSC 3RYCA 3RS6A 2DYRB 4XBFA 5C8CA 5LY2A 4J41A 1LOFC 4XF0A 5JSPA 1RUD3 2YROA 4CEYC 3K79A 1W8OA 5CB4B 4R9DA 5JCOA 1OCZB 3K3NA 3G6BA 5IFPA 1G9DA 3OSDA 1HQLA 1W9WA 2YY1A 4X64O 1XNQO 1VAVA 3FJSA 4O2AA 2D6PA 4ONUA 3G6EV 4ITCA 2JIZG 2WNUA 4D6QA 4X88A 2VZSA 1WLEA 4OGQB 1RUE2 1K4DC 3HIFA 4JKMA 3RYPA 2X5IC 3KKYA 4P9LA 4C0HA 1N32B 4NTXA 5IT9N 4FIPC 3OUFA 2OIEA 2D5FA 3W5NA 1BJQA 1HLCA 3EMRA 1GZ9A 1V6MA 5LYJA 4AF9A 3CB2A 3OT7A 4TQDA 3I59A 2VZ1A 4CP1A 2XBO2 4JI4B 2EINC 4ICGA 3WDWA 1PGW2 3G67A 5FYVA 4KMQA 3UGGA 5J3UA 4XCAA 3VBUB 4P30A 3S7IA 4YHHB 4LWSB 3N9OA 1XMOO 4XVHA 3EFFK 4LBKA 2B9ZA 3H8XA 2F4VO 2A7AA 2RJLA 3NNMA 1SA0A 1EV13 2YYOA 2VUJA 3SHRA 4FZ0A 1Y4MA 3N9PA 1PVC1 4RUFA 1Q6HA 3OBZA 4M3CB 3JAWB 1NU1H 2DBIA 3T0BA 4RGGA 5DEDA 4DR7O 1V54C 4X89A 5FZ7A 4MW8A 4UW5A 4BW5A 1X9PA 4BIOA 2DWRA 4B1LA 4RQPC 5BXXA 1MEC2 3ZRSA 2B46X 4YFZA 4ZXKA 4AVSA 4W50A 1S0EA 1DQ2A 4RSUA 3GXUA 1EYBA 1XMOB 5KC6A 5CKQA 3U37A 4L97A 5LOVA 1AYN1 4XACA 3MDSA 5L3CA 1VAMA 2YDEA 3CMEV 4IESA 2WPDG 5ACA2 2RDNA 1YQ5A 1OHFA 1RUE3 1LEDA 5K8SA 3SYCA 1I08A 2VQUA 3WCSA 4TT3G 4GULA 2FD8A 1FAYA 1S0DA 4PI2A 4RS5C 1AHSA 3VKOA 3DXUA 3RYHB 4RN5A 4NVPA 4DR7B 4HPKB 1ASJ2 4K3AA 4WM7C 1PIV1 2J1SA 1YDXA 3B9IA 1AR72 4CP0A 1Y74B 5GW7A 3HKBA 5KX5B 1PMJX 1AR1B 2BNMA 1D2DA 1Q90D 2PA7A 1RM1B 2BTVC 4XDQA 3E86A 1AX2A 3AG2C 5IYZA 1CAVB 1L7RA 3QD6A 4LT5A 5FMBA 1QJX1 2OCCC 3QLQA 2JG8A 4WFGA 3WG7B 3K5MA 1RYYA 2LUWA 1NA1A 1XNAA 2PHXA 4JKKA 1S5HC 3B77A 4OCTA 1UWWA 4UYBA 4DYLA 5JXGA 3X29B 2W1WA 3AJYA 1CVNA 3ZYHA 4QGMA 4DEVA 3T1MA 5K0UA 5FP4A 4NWWA 1K3EA 3D36C 1SDDB 1UU4A 5D5PA 1SACA 1BVP1 4BQ1A 4N7UA 4QB1A 2Z5UA 5DPNA 4LO8A 1JTZX 4LKFA 4Y1ZA 5LEJA 5B1AC 1E1QG 3OEHG 2CTPA 2QQMA 3PTRB 1K42A 1KD7A 4ISQA 1LKNA 3S5AA 1RUJ1 5H9PA 4NPMA 5CB7A 3VBHC 2GDFA 4CH5A 4QMAA 4U3JA 1HKDA 3RJ2X 4DV6B 1NKDA 1WBLA 1NTKH 3FL7A 3HNYM 3B01A 3J8F3 4NIAA 2G19A 3NNFA 5FPZA 2WT0A 4HKLA 4URAA 4FLUA 2ZXWB 1K5MA 4LF8B 4ATFA 5FLIA 1LOGA 5A7SA 3WQ7A 3R6SA 2ZAHA 2O57A 2QQJA 2IXLA 4RL7A 4W6WA 1NS1A 2YIBA 2N74A 3DGEA 3JAKB 1J1TA 4IEWA 1ULEA 3VZKA 4AVVA 2Q67A 5CFDC 3S6PA 1VMGA 1CR7A 2FL4A 2RNBA 2ZE6A 1Y9MA 4H0LB 2D6LX 4PA4A 1WN7A 5BY5A 1SPPA 1CZSA 3N4MA 2JDNA 5ITZA 3THTA 4O4HB 4EZHA 4MGTA 3D6EA 3NNGA 1JOYA 1LAJA 1E79G 2RMKB 3VZOA 4OXSA 1OH4A 2P1BA 3HKCB 5J96B 3JD1A 3OTFA 2I07B 1EY2A 4R52A 4Q0UA 1DZTA 1W6OB 1IPSA 2Q8CA 2EX3A 5F5CA 1ZLZA 4I3PA 3CCUV 3ZXAC 4XFAA 1SFPA 4PDLA 3X2QC 1GKBA 1V6KA 2JEXA 3MZHA 1EV12 1CPMA 5HCFA 4W65A 3E8HA 3POWA 1OKOA 3O0VA 2JE9A 1NY72 2XLAA 3POSA 3TCUA 1YI2V 1DQ1A 3S3WA 3GZEA 2O8OA 2RN9A 4HL0A 1GNZA 2EULA 5LRSA 3L2YA 1K8AW 5CISA 4P9WA 4QU1A 3CRQA 4OFGA 2WN3A 4C91A 1MACA 2Y69C 4IV1B 2E63A 4AL9A 1RJ8A 5AVAA 3DXTA 3ZS8C 1TZOA 2WAAA 1S4CA 1QLNA 1SERA 1H8EG 4I0WB 4KWJA 4OZOA 1W8WA 4HBNA 2Q73A 1ENVA 2VH9A 4PA6A 3PVEA 4CS2A 4AVCA 1PO12 3HBKA 3EXUA 3SC7X 2DU1A 3CMAV 1DLCA 3IIAA 5B1AB 4M01A 1OQ1A 3WNKA 3MI8A 4YVSB 5LHIA 2P37A 3KHCA 4RQPB 5H9RA 1RTVA 2X8KA 4E9KA 2V09A 1AR83 1FXKB 1TUBB 3LEKA 2WNEA 1AR71 2HKOA 4YSFA 1EPZA 3JD73 4Y20A 1SQPH 1GRJA 3K2OA 4MS2A 2VQAA 5GZCA 3RWNA 3OEBA 2BGPA 4A7YA 4C7UA 2VMEA 3W7WA 3K57A 1N1TA 4JI2B 1DQ6A 4ES9A 4B4QA 5DN2A 5I0DA 5FMCA 2CTWA 3A21A 1S72V 3EVKA 4D94A 2P4KA 3H9AA 1FNYA 4FFIA 1V0AA 1S3JA 4O4IA 4TYSA 3MFAA 5IWAB 4UBHA 2PF4E 1YXWA 1HXS2 4NPRA 1KS5A 4AEDC 5CBHA 3RQ0A 1DLLA 5FZ6A 4GX1A 5D5QA 1NOVA 1JFFA 4TV9B 4CUAA 1VQ4V 4LK6A 1DYPA 3MV01 1HR0B 1RUF3 2F23A 2ZHNA 3ETDA 4COWA 1P8JA 1ENRA 4DUZB 4Q4Y3 3B93A 3WF4A 4RHV2 2LP7A 4B3SB 2NQYA 2ZMLA 2HEWF 3APQA 1YIFA 5FPLA 2EAKA 2EF6A 2HWC3 1QNMA 1Q8QA 4QX1A 2FMYA 5BMVB 2F95B 2BFUL 2R70A 2ZHMA 5LBEA 4JGZA 5FLJA 3D5OA 1AI4A 5B1BC 2XBO1 3WG1A 4DV3B 1UY1A 2ZGRA 1NQDA 1QJZA 5GALA 3B3QE 5IFTA 3T30A 4YNIA 4AFCA 1SLIA 1W99A 3EYPA 2Y4UA 2J1RA 1H2LA 1N1YA 2VW0A 2YBSA 1QLEC 1IKPA 3WOGA 1DQ5A 4XQWA 2PGGA 1T5EA 3EXAA 1XREA 1W2TA 2DOSA 1U97A 1YC61 4TWTA 4PQQA 4CCNA 3OYWA 2DURA 2LS6A 3E83A 3LDCA 1RVF3 5CFDB 5CAZA 4KBBA 4AEDA 4BOWA 2ADQB 2NN4A 4ZI7B 5JLVA 3HT2A 5A7WB 4TUYB 4JDMA 4C1WA 5LXTA 4NHLA 4XF3A 4Y1VA 3PIGA 1NQJA 4JASA 2XBO3 4BQ3A 3LSSA 5DXDA 2PAEA 2Q5TA 4R8CA 2CTQA 1OC1A 3BTAA 4JPRA 3I2DA 2DW4A 3W5MA 4AGGA 4QNHB 3LNNA 4H7LA 3N9NA 2J7MA 3DF0A 4DR2B 4PA3A 4ZS3A 2BCCH 3O9OA 5F6KA 2ZGMA 4HN0A 3M99B 3B94A 1HNWO 4K35A 1LU1A 5KXEA 5A6YA 5LHGA 1AR62 3H42B 4META 4CDXA 1D4M1 3SJQC 3O14A 1I94O 3RWKX 4W8JA 1SQGA 3CRRA 2ZQMA 1XHXA 2BTQA 3U75A 1NE6A 5IYCO 5ITZB 5A7OA 4DV2O 1S77D 2X5IB 4CU9A 2MHFA 3ZMNA 3NAPB 1H8TB 4AFDA 5JOWA 1VRBA 2ZDIC 3CCQV 4L0PA 2A06H 2WLHA 3N36A 1LOAA 4JTDB 2HWB2 2ZT9B 2F66C 2XVLA 3ITQA 1HRI2 4UF0B 2WYSA 5KHJA 3ES1A 1H8HG 4A6SA 4AZZA 3GBWA 2GMMA 4F8AA 1LB2A 4QPJA 2HLDG 4X1KA 3ZVXA 3MLLA 4G4FA 1RHI3 4M00A 1Z0HA 1JZ6A 2Z42A 1RUH2 4MVOA 1N34B 1AR82 2YC2A 4YVWB 2FBEA 5FBZA 1Z5WA 1PGL1 1AR73 3JASA 4BXFA 4LHSA 1C8M3 1SF9A 5A3MA 5LA2A 2CWSA 1SPPB 4ZS2A 2W52A 1VBA2 3R4DB 2ZM6O 5E79Z 1Q8PA 4XZPA 3RSJA 2Y48A 1EUTA 3K9SA 3FD9A 3I3QA 3PVOA 4BR6A 1ENQA 3SLIA 4BLJA 2RS33 2XB6C 5B3SB 4IGOA 3S57A 3DEMA 2VD7A 3ABKB 4XMIA 2HYXA 3D3AA 4JV5O 1YVWA 4GALA 1BMV2 2B1GA 3HKDB 4AQTA 2ZXQA 5JJNB 5JZGC 1DQ0A 1W90A 3RZJA 4OUSA 2CAZC 2JG8C 2FYUH 1LNSA 1RVF1 1IBKO 3WNPA 4TSVA 4DUYO 1PZ7A 2LRPA 5C9AC 3DSQA 1OPOA 2RMU2 4QWNA 5GZGA 4F83A 2H3OA 1N36B 2BERA 5EK0A 4MXWB 1XL4A 3SQOA 2K9ZA 3EHBB 2XJRA 2BDRA 1KU9A 2X53S 4ORFA 5LBQA 1OCZC 4DINB 2CAUA 3KS7A 1AB3A 1AROP 3NAPC 1PMHX 3CC4V 3UV9A 2EIKB 2A5ZA 3JD3A 2R9AA 4DUWA 1OF4A 3ZN4A 3K46A 4J7ZA 5J36A 2GBOA 2Y69B 2Y6KA 3LZZA 4QGLA 3DC6A 4B7EA 3I2IA 3J7MA 3T4HB 5CNAA 3RYIB 1DGWX 3D4KA 3AYCA 3JCZA 3U11A 4CDUA 3P3PA 2ZA9A 1VF5B 1VQOV 4X20A 4DUYB 5IJ0A 5J7MA 1C8M2 1TUEB 5BNQA 1KUQA 4P9IA 2TEPA 5T55A 1AXKA 2Y6LA 1UJWB 1F23A 3OPZA 5KA5A 1EAH3 2JRIA 2QWNB 5CA0B 4COUA 5LB6A 3ZM8A 4N53A 1JCHA 1K3IA 2HWD3 4PA9A 4J9ZB 5FYMA 3OGVA 1WW6A 2DVFA 5CZKA 5LK7B 3DTUB 4L87A 3OPTA 3TETA 3AMMA 5CKMA 1I9RA 4EE2A 2P3JA 4B3NA 3T1HO 3ZN6A 1OVSA 2VOXA 2AEYA 2HJDA 3KD4A 3ZMZA 4AHZA 5FZ1A 4HFSA 2ET1A 4COVA 5DZEA 4LIVA 3C8XA 3ZFEC 2EIGA 1CPNA 4GJYA 3ES4A 1HJFA 2PHDA 4G28B 4PF1A 1RSOB 1OCRC 3BVOA 4W6YA 3RI9A 1F9KA 3ZRWB 1JX9A 1GZWB 1OFSA 4UVBA 3DECA 1Q3EA 4HSJA 2IU0A 3KCXA 1MEC3 3WINE 5IE9A 4TV8A 2JEMA 3OUJA 5KMGB 3ORJA 4XUTA 3PDQA 2K46A 4UXNA 1YUDA 2A6WA 2QE7G 1VBE3 2Q8DA 3W7XA 1PM4A 1XUQA 2A73B 3WNXA 1R3KC 2ZGUA 1JXNA 5KAIZ 4I0XA 1JHJA 1W8TA 4OQ9A 5E1AC 2A7WA 5FYZA 1JYIA 1REDA 4UFHA 4YVSC 3HKEB 1OXCA 1F4MA 1WNSA 4JI6B 3OY8A 3FWEA 4OQ8A 4UUJC 4CXXA 4MUVA 2OQ7A 4LBMA 1JBCA 3KV6A 2IXJA 1W0JG 2QQUA 4CBCA 3VL9A 2WJSA 3GM8A 4B1MA 2X09A 2JGDB 5FYSA 1IS6A 4L9BA 2B5UA 4DV1O 1NXD1 3TEYA 3RYCB 4E27A 2ZE7A 2UUAO 1IOAA 4PD4F 2FCVA 5BNNA 1IS3A 4KI5M 1HWYA 4AGRA 1E57A 3KV4A 1K4CC 2NPIA 1BVVA 5JI9A 3ASOC 1XXNA 4EFBA 3RT3C 1YJLA 1AJOA 3BOWA 5FXVA 3KZ4C 1QJU1 2W95A 1IBMB 3IJ4A 4FXGB 1SS3A 1B06A 3JD72 4FZ1A 2UXDB 4ZIBA 3NJYA 2J1AA 1US2A 5JIUA 4OPAA 2OZJA 2PHLA 1UZ0A 1W04A 2MPFA 5JVVA 4R9BA 1O9HA 4K40A 3R4SA 3FN9A 3P1IA 3OF1A 2O14A 2VNRA 3MLKA 5IJ9A 3M3CA 2TUNA 1IX9A 3QF7A 5BYNA 1YNAA 3VQVA 4GJZA 3J9SA 3POIA 4Q4V1 1FXKC 5GZFA 2BE3A 3UT5A 4L8QA 1FAFA 4FPOB 1VBE2 3K4DA 1ND3B 3VZJA 1TE1B 4JI1B 4LF5O 3LSUA 5ABJA 4AAXA 5A1AA 3E6BA 5C70A 3SR2C 1KFXL 1QVGU 4QX8A 3CPWU 3ZFGA 3H1KH 3T4VA 2FZ2A 4EEQA 2Y0OA 3MUZ1 3TN91 1SLAA 2R0FA 3L70H 5EJ1B 4NR1A 4IL7A 3RYRA 3PUSA 4NRPA 4HNAB 1ZSPA 4GZRB 4AW7A 1RUF2 5HCBA 4X8AA 1NCQA 4UB6Z 5A80A 1YXBA 4O61A 2RQ6A 3BYWA 2QJVA 3APOA 3O1OA 5A3OA 4MG2A 1W3XA 3BFRA 5JPNB 1NH2B 1I94B 4XFIA 1IG0A 4GKJO 5KUMA 1ZNPA 5K9YA 1XQNA 2XOKG 2VQFB 1W6NA 1XNQB 2WQ8A 3JD0A 2CWMA 1APNA 4O65A 5F5AA 4MGIE 4Y3OA 1K12A 1X8EA 4XBNA 4BJ0A 5F3EA 1GOGA 3WU2Z 2N04A 1NG0A 2WT1A 2WDBA 1ULCA 4QKFA 4TV8B 3RRDA 5KAFZ 1ZZ9A 2D7FA 1QU7A 4HVQA 3A8TA 1HDKA 5H6QA 3WNNA 2DMXA 2CAVA 5CKNA 4O4HA 1CN1A 3WX5A 2KSDA 1CP9A 4PBOA 2VZRA 2CSGA 3M4FA 2AZ2A 1V6OA 1OKQA 1FX5A 2RS53 4GUNA 2CV6A 3CJHA 4CU8A 5FPUA 3OE7G 2DCYA 4DEQA 1D7PM 4A3ZA 1GM8A 4MGSA 3PU8A 2C1FA 5A9GA 4Y5Z0 2QDOA 4I55B 4RAIA 5IUQA 3FHIB 5HCHA 1K5MB 4FOWA 4RA0A 2AH2A 1ZAUA 3FYEB 4EWAA 3ACGA 1SDWA 1VB2A 1SZBA 4UCTA 5AC93 4AI2A 1DIWA 4LA2A 1P7GA 1CAXB 5FPXA 1FI2A 4PLOA 4MTFA 1UYZA 5JPMB 5IJ0B 5CA1B 4NYKA 2BVVA 3PMEA 3HAGA 1NQTA 1QNWA 1MS3A 2A6VA 4FSJA 3RZZA 1TME2 2F6BA 2UXBO 1RMU2 2W94A 1EN6A 4FFHA 2EBOA 2HFEC 2JE7A 1R082 3B69A 1FJGO 2I74A 1QLEB 3C7FA 1PGL2 1AP6A 3O1VA 3KVBA 2Q5ZA 3ZXFA 3NV3A 3TEXA 1M4UA 1ZX5A 5FY8A 2KXLA 3AZWA 4FPFA 4OI4A 1W2UA 1FV3A 3WW3A 1E5IA 2RDSA 4DR2O 1J3RA 3AG1C 5TSWA 4Q0VA 2TNFA 4ZPIA 5C8CC 3RVYA 1ASJ1 3E89A 4CEYA 1ULFA 1GV9A 3IZOA 2O0OA 1MVEA 1LULA 3OBRA 4DUVA 3AYEA 1B04A 3O1RA 4NROA 3DCQA 5D2AA 4LFAO 4AQ6A 5F9TA 2JVDA 1HNZO 3JZVA 1F4HA 2P3IA 3FX3A 2E31A 4IE0A 3CLPA 3K4AA 2GTAA 3A4UA 4XUQA 2IWGB 2VNOA 2ORXA 3RVHA 3A0BZ 3ACHA 3URFA 1RUOA 5DMYA 1XNRB 1U5ZA 4XURA 2YU2A 4DS0A 2YG0A 2GNDA 3QCWA 1ZRIA 1KYOF 1EN4A 2QDRA 3FZ3A 3RDIA 4KXRA 1W9FA 1Q8IA 1AJKA 1SQ4A 1L3JA 5E6HA 1QJFA 1QH7A 5CFCB 1WCSA 1YJNV 1KJRA 1FNZA 4FLVA 5A70A 2OT7A 4XFFA 1GQPA 1PHMA 5CFCA 2AXTZ 2ZXWC 4BH9A 1RUG3 1HRV1 3OMIB 3VQWA 3KQRA 4B08A 1NX9A 5K7PA 3ZPOA 2BOCC 2X29A 1N34O 1X36A 4DUZO 4YJ2A 1V9U3 4YM2A 4DXZA 4W4ZA 5LA0A 4YARA 1M06G 1I5YA 5GM0A 3N2GA 2UY9A 3A23A 2QKSA 1RINA 2XT9A 4D6TH 5GLWA 3RZHA 4W4LA 3TEWA 3HKBB 5B3SC 5KX5A 1VRH3 1CAXA 2RR12 4XABA 4XJWA 3J8F2 2K0GA 2V73A 4XYXA 2WO1A 3JQWA 4QX2A 4YZ1A 2OX0A 3LA7A 2F4VB 1YQ2A 1FXVA 4WFFA 1AI7A 3OBAA 2QKDA 3NL1A 1U12A 4RUEA 1A3KA 1IQDC 4K1ZA 4S2DA 1RUC2 2ZIOA 3A0KA 4QB6A 5H6RA 5F5QA 4RR3A 4Y1UA 3PN1A 1GOHA 1O9GA 1RUC1 3CCSV 2ZTNA 1MABG 2BGOA 2R72A 2JICA 3VDCA 4DV5B 3RYFB 4Y26A 1SKVA 5EIBD 4Q4X1 2YSUB 4GH4C 3AG2B 1JU4A 3FKSG 3THPA 1IDSA 4XDLA 3IB3A 5ACA1 2G38A 2VOVA 3AX4A 1BQPA 3AKTA 4ZU4A 5KC5A 2GP3A 5EC1C 4P5HA 2HHHO 4CDQC 3PNAA 4W6XA 1PIV2 3CRAA 4XHXA 4FQ4A 3DKWA 4P9PA 4LNUA 3H9VA 5FUIA 3CRCA 5EP9A 4R50A 3ZN5A 2WNOA 4ZZ5A 4ZKTB 3CJIC 4EZ4A 1AYM3 3CYOA 3VBSC 3U4XA 5LMNO 2JE8A 2O1QA 1K97A 4DV0B 5FV3A 1VJ2A 4ZXEA 1OQEA 1ZBE3 1LOEA 2JDYA 4H2AA 4U7NA 1O8PA 4AQSA 4MVUA 3MEPA 3PUAA 2FDGA 1HXS3 1VBC3 3WG3A 5K1XA 5DDJ2 3J80N 4QHZA 1WGPA 3AP4A 2ZEWA 2WS93 3L2HA 1NT2B 2R6QA 1RUD2 5KA6A 3F2ZA 1KDMA 2QM8A 2Y4TA 3TJTA 1ODMA 5C3SA 1OVPA 1W8HA 2W39A 3C7HA 5BNOB 2DWDC 3K08A 1L7QA 2QGNA 4RHV3 1H8TA 2AC1A 1AR5A 2GH2A 3AG4C 1HRI3 5FWJA 2FB5A 2JDUA 2C6SA 3CE2A 2UWAA 2VVFA 4I01A 4LHKA 3BEHA 1PZ9A 2ENRA 1UZYA 1EPWA 2XOMA 4DFSA 1F2NA 1GQHA 1NR1A 2WZEA 4NB5A 1H30A 4WVVA 2Y33A 2VM9A 4LBJA 2WL1A 3A0NA 3CX5F 1ORQC 2W68A 4Q27A 1ACCA 2ODMA 1DYOA 4A4AA 4KNCA 4FTEA 1YFUA 4IETA 4WM8C 3VBRB 3WD5A 1UOGA 3POBA 1H0BA 2Y6JA 3ZDVA 1ZL8B 4KP4A 2I45A 2J1TA 4U3JB 3DN7A 5FP7A 3OFNG 1FMD2 2Z69A 1A32A 4Q26A 5DAQA 1OCOB 5FZOA 1C57A 4LE3A 3HPLC 1PM9A 2JDAA 5F1RA 3U0ZA 1GAXA 2ARCA 1RUH1 3UYJA 2GNMA 1HB4A 1IBLB 5IW0A 1XQ8A 1JZ7A 3RWRD 4EN7B 3WG4A 3H01A 3CSXA 4NN0A 5B1OA 5BUVA 4BWAA 3SPHA 5E1RA 1XSRA 2Z4FA 4DK1A 3OBTA 3JSLA 1BT8A 2PAKA 3BB6A 2W91A 1V00A 1P84F 4GKJB 4IHJA 1BMV1 3M1HA 1WPBA 1A8DA 2QQKA 3LAGA 4XILA 4ZBMA 1N0NA 5CA1A 1PP9H 2HG5C 2JDKA 3RVZA 1MQTB 3OGRA 4I55A 4DY3A 1ZRFA 1R6TA 3RNSA 4OMDA 4QDQA 2Z2SB 2JENA 2WT2A 2HR3A 4L8JA 3RMYA 3X2QB 4K9SA 2VWJA 4PLNA 3FHAA 3L9JT 4EFEA 3ALQA 1YZBA 2HYKA 3OUHA 4KWKA 3SCHA 5JCOC 2YBPA 4YVWA 4QM8A 1BQZA 4NE9A 3USSA 3ABUA 4UCOA 3FB6C 1K7DA 3AG3C 4CEWC 3O65A 2W6IG 5I0TA 4IIJB 3PUQA 4BIZA 3JBG1 4QPIA 4RFRB 2R32A 3ELNA 3W20A 4TOIA 3AMQA 4AHCA 5A1FA 4UW3A 4YJ3B 3UT0A 1IZ3A 3CL1A 1BEV3 4MGYE 2JB8A 3ZMUA 5EPAA 1GBGA 2E51A 2VAUA 4XFHA 4AR2A 2D2CB 4DXTA 4LHLA 1M57C 4R8HA 5LY1A 5FDBA 1CX4A 3GHNA 3FHQA 1W8NA 2DYCA 1ZRCA 3VQXA 4M0HA 4XDOA 4BDVB 1BLZA 4CEYB 1K5QA 5EJZB 3AK3A 1ROPA 4TWKA 4N43A 1HR0O 5FQ0A 3QO5A 1ZWIC 2BYVE 5L3DA 2Q7GA 4N8MA 4DOUA 1D0GA 2A75A 1H38A 4Z82A 1OD5A 5A33B 1SQXH 1OA4A 3BI3A 1BEV1 4FLYA 4MVTA 1FYUA 1SC5B 3PL0A 3WF2A 4H3WA 5DUWA 2VNGA 4Q6GA 4QX0A 5CFDA 4I9WA 1E5SA 4EWDA 1F4NA 4CDUB 2ZNIA 1TGOA 2IBZH 3OUIA 3MBWA 1S0BA 4Y5TA 3TRSB 5EBLC 1KQSU 5KMGA 4B4RA 5L9RA 1KKDA 1HB1A 3R0RA 3V0AB 2VNVA 3VBFA 5IAXA 1UYXA 4XFGA 1YI9A 3ZRXA 1FKAO 3BABA 5C7GA 1CONA 1CPYA 2OVUA 4CCKA 1U5IA 1KB9F 2KKWA 4MZUA 1CAUA 4E2SA 1V9U2 5A3TA 4JI7O 5L7OB 3MICA 5CBLA 4HLTA 5I8SA 4CCEA 3VBSB 1RUI2 5FPVA 1HQNA 4OLLA 3WDVA 1OH3A 2WKKA 1B3QA 3T1YO 4LQRA 2EXJA 2EICA 5IK5A 3CDZB 2A9HA 5LOVB 1M5IA 2P2KA 5AFBA 1WD4A 2WINB 3VUOA 2D3SA 2XHBA 5A3UA 4L2NA 1GM7A 1Q8OA 4LC1A 4NKGB 1XBFA 1RMU3 4CPBA 2RDCA 3WEZA 1XI1A 4BCUA 1AL0G 4Q4Y2 4CCDA 4UWDA 5A6ZA 2GDSA 4LEJA 1UPSA 4JI0O 3VBOC 3MFCA 3C2UA 1OQDA 5ISLA 2ZMKA 4IE5A 3KT4A 3JB8A 3SPCA 1UIJA 1W9TA 4MHRA 3AG4B 1QWRA 2JGDA 3AKRA 2CTRA 3OEAA 1POV3 2ATFA 2C0ZA 3AYDA 2NLRA 5LP6A 1VQ9V 5F7UA 2UURA 1X50A 4IE7A 1XE7A 2D44A 2ZINA 1S0IA 3AXEA 3ASIA 3TXSA 2PYTA 5A32B 3KCYA 4JI2O 4DMIA 2ZX1A 5LATA 5HBAA 3M7AA 2LW7A 1KD1W 4GMP0 2QKCA 1SZTA 3JBG2 5D8AC 1R093 4XMAA 3ZYBA 4IW3A 2D3PA 1AYN3 4WBNB 2YB7A 3DPRA 2YFUA 1X9TA 1UY4A 4DV6O 1XNKA 2D6NA 3UESA 1RM1C 2WA3A 5BNNB 4J1WA 4QKNA 2RHPA 2NLJC 3DXRA 4U2AA 4DR1O 4LP8A 4AG4A 3PURA 5IK4A 1SRYA 1O8SA 3ZX6A 1O5UA 4LOSA 3SCFA 5LMNB 1X82A 2B39A 4LKSA 5GTHZ 4O7XA 1EUUA 4BA6A 3I2KA 3OG2A 3MIHA 1GP6A 2KQXA 3LEGA 2DUQA 2WFF1 5IY5B 2J42A 5JVDB 1AYM1 4JI3B 5BPXA 5SV5A 1BCCH 3E5QA 2QJ1A 1Y76B 3ZKYA 3TEZA 1PGSA 4HETA 2HEYF 1JVMA 5LWBA 5T5OA 3I4IA 2XMLA 4H55A 1WUVA 4RQEA 2Q8EA 1MZEA 5ACA3 1F7YA 4LFBO 3EQEA 1SCSA 3IPVA 3PJSK 2FMDA 5DUUA 1JZ8A 2V4AA 1BYHA 3JCUZ 3KWVA 2NZ9A 4BE3A 4P9OA 4B3MO 4ET7A 4XCBA 3ZXGA 4AQYO 4FPYA 2JEUA 1OPMA 4GKKB 2YXYA 3T2OA 3L75H 1MS9A 1N33B 1LGCA 4ATEA 5CBFA 1MR5A 5JXIA 3UETA 5F37A 4LXLA 4ARXA 4MYEA 5DABA 4K3UA 4KBZA 3CXCU 3ETPA 1VBD3 3POYA 5IK7A 4PELA 5LA6B 1GZTA 4LO4B 1W2BU 1NAEA 4K8XA 2X5IA 2OUJA 4YGBA 4M3CA 2G9FA 4QGNA 4UV9A 4DNYA 1RUD1 1JA8A 4HXCA 4A3XA 1WA8A 3WW1A 1Z7S3 2VL4A 4HG6B 3A7QA 1V9PA 1R64A 1J84A 4LFCB 2BFUS 1XMQB 2RS11 1NH2D 4GQ7A 1UKGA 1UAIA 2GUZB 1L1FA 2IH1C 2LO1A 2D98A 3OR7C 4IHJB 4CS3A 5FZOB 4AOCA 5JUVA 3HNBM 2CK3G 4QX5A 2QQLA 1FXHA 1WW7A 1AVBA 1VP7A 2RS12 3O7OA 2QWPB 3C3VA 3KVAA 2DCZA 4BYYA 1D4M2 2OS2A 1HIXA 1N0JA 3ZX7A 2WO2A 1WW5A 2VUCA 4QX3A 3JXSA 1IBKB 2OKXA 4RR3B 4YM0A 2Q0OC 1MMMA 2CTVA 5F2VO 1D0HA 4KFMA 3K4ZA 5F2WA 4YM1A 3CCJV 2BNOA 4LMFA 1ZRDA 4FM1A 2OZ6A 1KKCA 1S0CA 1GWLA 4ISRA 2W2IA 3B40A 3ZMTA 5HCAA 4PLMA 5JXHA 5C8CB 2DVBA 5C4WC 4MO3M 2ZNJA 4NIDA 2Q4SA 3K5OA 3ZSEA 1W59A 1QR9A 4CH6A 4GCZA 4QPGA 3NSTA 3TXQA 3VHRA 5L3EA 1JFFB 4TV9A 1XHZA 3TAYA 4K7JA 1W6QB 3K48A 4LH6A 3H1JH 1STMA 3WB2A 1J59A 3A2FA 2KG7A 3S30A 3E8GA 2VECA 1ENXA 2E26A 2VU9A 1XU2A 2EAAA 4HNAA 4Q0SA 4AEDB 4J6GA 2P3KA 5CG9A 4X64B 3SPIA 4EKWA 3WR0A 1YFYA 1W6QA 2QM4A 4P14A 2Y0IA 3BRCA 1GWKA 2HWE1 4CP2A 4X6RB 2FDKA 3IDBB 5LK5A 2IJHA 4QXCA 2QZ2A 3VKFC 1LR1A 2PI4A 4K8RB 1XB9A 1YJWV 2OTJV 1LEMA 2HWF2 1KRIA 2UYAA 5T54A 1R1A2 3LFIA 2WABA 1T6BX 5L3GA 3GWOA 4ZU5A 4WCEV 2X05A 2R071 5DZFA 1OOPB 3S3XA 4XOGA 3NJVA 4O4JA 2E6VA 1BBT2 3CP1A 3TWIA 2VQEO 4LF4B 1B35B 1C3HA 4XTPA 1Y9QA 1NUKA 4DPNA 3VBRA 3MIEA 5AC91 1KS4A 3RFRA 4DW1A 2R063 4ASLA 4CXYA 3O0WA 1TMF3 1YCIA 3JAWA 3CWBH 4QPGC 3SJAC 2AZ5A 1AXZA 1OURA 1LOBA 2WZR2 4X8NA 3VBSA 5EC2C 5LA6A 4E2GA 3BY6A 3KV9A 5CIRA 4LO5B 3LDBA 1JMKC 4AI9A 2RDRA 2RS51 1F51A 3ZJZA 3GZUC 1PO23 2MEV1 1G9BA 1LGNA 1SFNA 1CAUB 4Q1RA 4M3CF 1LHUA 4DO0A 5FZLA 4Q4W1 1DBNA 5EV7A 2EIDA 4YLZA 3GZAA 4IDZA 1NTZH 3OAAG 4K0KB 4FP3A 1GTOA 5GLZA 1KXGA 1JZ5A 5BNOC 1IS4A 1K5MC 5FP8A 3KLSA 5KXCA 3WSOA 2UYBA 2WLKA 3K3OA 3LCPA 4NUBA 4P9GA 3HT1A 3RYKA 4JGZB 4F6RB 1OA2A 2VOKA 2CH7A 1N1VA 2VZ3A 5EBMC 4FP2A 1NE4A 5JZGA 2A3YA 1VQPV 3GHMA 4Z1MG 2W0XA 4B3TB 1CEZA 3U78A 1Y66A 3HWJA 2LJ2A 1KC8W 1SQBH 1AYN2 2BPA2 1R1BA 5CG8A 3ML0A 1CD3G 1JUHA 3AFGA 3ZHSA 4WFHA 4FPKA 5FUPA 3WW2A 3J7NA 3LA3A 3HVDA 4MSWC 5JJEB 4CDXC 2X0LA 3P32A 1US6A 4DR4O 1JQ0A 1KBHA 1ZUQA 5HXVA 5FLXN 2H94A 3ZIAG 3T09A 1VBC2 3PMSA 2XWJB 3SPGA 4GX2A 3GJBA 5ANNA 5BNNC 1W9SA 4INDA 1OA3A 5CN0A 2SLIA 3RYIA 4JRLA 1YIJV 1QQP2 2QQOA 1BXHA 1Y67A 1RUI1 1MS4A 4UW6A 1XNCA 1HW5A 1PVC2 4PIZA 3NQHA 5B4XA 5JOXA 1KP3A 1QQP1 5DAPA 1MQTA 3RYFA 3HQRA 4HT1T 3JSNA 2LALA 2D3RA 2FDJA 3M7MX 4CDUC 3ECQA 4KGGA 4N23A 4P00B 1WP7A 2IXIA 4MGZE 4PF5A 3UT5B 1HX6A 1IHMA 2PLV2 3QG5A 5FR3A 3KCCA 1SEFA 2PUSA 5I0RA 3WF1A 2VBBA 2HWF1 4D69A 4RO2A 4YG3A 4K20A 4D7YA 1IXBA 4RD7A 2QWOB 4TLFA 3LE0A 1XOYA 2CGPA 1G7YA 3I59B 1XE8A 2V72A 2GV9A 4MGKE 2WNUB 4IT5A 3IWZA 5FXXA 4DXRA 3AFKA 3N2GB 1RP3B 3UKVA 4WZFA 4JTOA 1N33O 2YBKA 1NVPD 1EAH2 5L7OA 4DK0A 1BSMA 4TSFG 3UCSC 2YU1A 1XOUA 1HNZB 4BIFA 1W0PA 1P49A 3VKMA 5F3IA 3HKCA 3T0DA 3NJZA 4HZ3A 3WNOA 1NA1C 4AEMA 1RUH3 2JD4A 3CCLV 4LF4O 1KFUL 2DF7A 2ERFA 1HRI1 5FYBA 1POV1 4I09A 1OCCB 3O1TA 4JYAB 3UQ8A 2PHTA 1ZA7A 3FLPA 4JQTA 1OCCC 4U3FH 4H33A 5L7OC 1OT5A 3HB3B 2HWF3 5JQGB 4Q4W2 4JZRA 4XJ9A 5JR7B 3LSDA 1MSDA 2OUHA 3V0AA 1WAZA 1W6PB 1PK6B 2MEV2 1UMZA 3ZO0B 1M90W 4BMBA 3D0JA 3UGFA 1ZBE1 2K1EA 1JMUB 2WLIA 4UI9L 1DF0A 1ZBE2 1Z78A 4BMEA 1VPHA 4I2OA 3EO6A 5EQUA 1WLCA 3I8TA 4R7CA 5T5PA 4MLOA 4W4KA 5FOJB 1SLCA 3DGTA 4HZFA 1D4M3 1WA8B 4LE4A 2IVIB 4EROA 1RUJ2 5DDJ3 3IFXA 4ZKIA 4OHZA 2YEVA 3AVRA 3ST7A 2CY6A 2VG9A 2VMHA 4Y4RA 2F93B 4YZ4A 1DDLA 3P6BA 4WM8B 4A5UB 1AR93 4HK8A 2P34A 2GSMB 2P5OA 4YJ3A 4AI0A 4AVBA 1FOD1 3AL5A 4YWAA 3ETEA 2LM3A 3JARB 4CRQA 4QE9A 1SA0B 3WUCA 4N7IA 3RYHA 3OEEG 4GKYA 3AG1B 1ZX3A 5B66Z 4OUMA 1XU1A 3PUHA 1G6UA 1K92A 1SHWB 3IC7A 4O9GA 1HNWB 4KH9A 4CXWA 2DTYA 1X33A 3VGIA 2ATKC 2E53A 2GSYA 4COZA 3ZYGA 4FOQA 2A3QA 2E33A 4OX9O 5FZ9A 3VD3A 1N3QA 3ZHTA 1LR5A 3E2EA 2BWAA 4HYOA 3HJRA 3S0MA 1VF6C 2NMNA 4NIIA 4AHXA 2VTXA 1CXZB 2JJ6A 3IAPA 4CSWA 3AMHA 3QO7A 3RMXA 3ASNC 2E75B 3AMPA 3CO2A 2GP5A 1QJY1 4E8DA 2A6YA 3FX7A 3FBMA 2QWQB 1LODA 4BQ5A 1F5JA 3NR7A 2G1MA 2QTOA 2ADDA 1X7NA 2X7RB 5C71A 1OOPA 2GU9A 4ZHQA 4IV3B 3Q4HB 3ZFGB 2RDQA 1AL21 4IE6A 3O12A 1XJAA 2WFF2 2ZIMA 2BRTA 3L9DA 1G1XB 3TB0A 1RUF1 5JDBA 4Y4YA 4CE8A 4E4EA 4XIOA 3KT1A 3P5BA 2ZGSA 5T5JA 3CD6V 2FMLA 2GAUA 3BU0A 4FK5C 1NT0A 2YEVB 5M0TA 3Q8CA 4YGDA 2EA7A 2ZPXA 4UFLA 5JSOA 5I93A 5IHRA 1AF9A 1MPXA 2F4PA 2RS31 2VE1A 3N27A 1XE0A 3ACFA 4NOTA 3AG7A 1VMJA 3ZXJA 3B5LB 4OMCA 4OPHA 2ZACA 2HBTA 5EHDA 4PCRA 4J42A 2BOBC 1WA6X 5FZIA 5FPRA 2DCKA 5T52A 4Q4V2 5D8AB 4HSLA 3MF6A 5J9PC 3J7AU 5FXWA 2VY0A 4UFIA 4CU6A 5L3BA 1ZZBA 2VULA 1XL6A 1H8TC 3VDDA 2J1EA 5B4NA 3NAPA 1RHI1 1ASJ3 3JD71 4DRXB 1QOSA 5JAXA 1BK0A 5EYPA 1JJ2U 1VAKA 5C6CA 4DRXA 1W06A 2K9PA 4UCRA 4O9EA 3GZTB 4GX0A 2DUPA 4X66O 1LOFA 1AILA 4S2HA 1Q81W 1WZXA 3I5DA 2ZS6B 3NRUA 3NKTA 3WCRA 3DPRB 5IY5C 4E4ZA 1CGPA 2QQWA 3WUDA 3H50A 4WZCA 4LCUC 2AREA 2JG8B 2YS8A 3ZMOA 2XLFA 3ENRA 3WF3A 1PKXA 2YICA 2PQSA 3H1IH 2PZSA 4BQYA 1K73W 1VR3A 3AP5A 1O5LA 3JD4A 5EFUA 1Y6XA 1UIKA 2HJIA 3N7JA 4OHYA 4AFAA 1RXGA 3QH7A 3AXDA 5CADA 4XW3A 4XDPA 3BIEA 4JI0B 3GCWA 2RS32 3IGAC 3H7JA 5CB4A 1O3SA 4LNUB 3N9LA 4AI8A 5C4WA 2BP6A 4KHPB 1VBC1 1HV1A 1PNKA 2IVJA 1UFIA 2AGAA 4NJ4A 2CDOA 2EIMC 2FDHA 2VUAA 3CC2V 3SYPA 4H7MA 1QR8A 1N3OA 4JC1A 1GOFA 2VWKA 1YLLA 4M4PA 2Y6FA 1UF2C 5EYYA 4TLGA 4Z2AA 4YW7A 4HANA 4YIOA 3VKLA 1K33A 3P3NA 2QCSB 4Y22A 3WB1A 1Z7S1 4NO4A 4CS4A 2Y6GA 4QKDA 1MS8A 1CAWA 1UZVA 4JZGA 4Q1PA 3H8RA 2BVBA 3CZUA 3NXSA 1K45A 3CJXA 3BHPA 2JG9B 3NV1A 2BBVA 2JECA 5FIXA 4KU8A 2B9VA 1GH6A 2YGMA 1JYWA 2H0BA 1HNXO 4BW9A 4Y22B 1X4TA 3VZNA 3ZN6B 3K51A 4I4TA 5C9AB 4FMTA 4LWSA 4UCVA 3SH4A 2BTQB 4HVRA 2WIIB 4C90A 2V4DA 4I7ZB 4X20B 1BCXA 3BTZA 1YFWA 3K04A 3ZXKA 3T2MA 4P9XA 2IXKA 2FKXA 4FLWA 2Q7HA 5HFMA 2Y26A 1W8UA 2ZGTA 4Z92B 3G4SV 3IPVB 5FZBA 1VB4A 2B5HA 1PV0A 4M3CE 3ZYFA 4N9HA 3G80A 1H4GA 4JI1O 1PPJH 1NCQB 3KF5A 3ZRWA 4FTSA 1ZL8A 4N43C 3QH6A 5KHKA 4XXAA 5FPBA 3T1CA 2LGQA 2DVDA 2XONA 3ZYJB 5JQGA 4AI3A 2QM7A 4XBLA 5FMOS 2AW9A 3LUTB 1UPGA 3O1MA 4IEPA 2VZUA 3RW0A 2QA4V 2YUEA 1R081 1W6NB 5CVRA 4JI8B 2LQTA 1FV2A 4C0BA 4NPLA 5IYDO 4A7KA 2L9LA 1QGLA 1HB3A 1VBB2 4GAZA 1WCDJ 2WFF3 1WMDA 1FFXB 3ZBHA 3OW2U 5C5TA 4CCMA 1XEQA 3M8AA 3IBMA 1XPWA 3PVBB 4GA9A 1QMJA 5KHGA 3I97A 4E2QA 1N47A 1RUJ3 4QPYA 3TN93 3I3DA 4JYAO 1IKQA 3K0DA 4MVZA 1VMHA 4XXPA 1HRV3 4WVZA 1QJY2 4XF4A 3E97A 1DF4A 5L19A 2JDZA 2TBVA 2LGWA 4FFFA 4OHWA 2E3CA 1ZTEA 4GZ9A 4CVUA 2B7YA 4BQXA 5GKAC 5FMOL 2QVSB 2B42B 2VMCA 3ABTA 1N36O 3SEEA 2ZZJA 2UUAB 4ARYA 1W39A 3UKMA 3LF7A 4R6ZA 2V7QG 1GN6A 1QJEA 3ASOB 4BQ4A 1S0GA 1S55A 1RGSA 2VCCA 1ND3A 4LF9B 3N2KA 2YXHA 1MG1A 3H1HH 4ZONA 1UYYA 2ZGQA 3USUB 4B3SO 3OCPA 3AB0A 3OUSA 3I2JA 3B2EE 2UUBO 3LOBA 1YTFD 1VBA3 3AYAA 4QM9A 3VHOA 5B5EZ 2WAOA 4YY3O 1A34A 5G05L 1HNXB 4G9SB 4ASUG 4JX0A 1R1A3 2BTOA 1WCUA 4A6OA 1BBT3 4CZSA 4OHXA 2OTLV 1AZDA 5BNOA 3FB5C 1NJIW 1NLQA 4FT8A 2ET7A 3MPBA 1JN2P 3FE5A 4D7SA 4X65O 1BHGA 3TGUH 2DBNA 2HVJC 2VMFA 2AHZA 4WF9V 4X6QB 1C8NA 4DO2A 4B8EA 2UUCB 3UL2A 4QQHA 1BE3H 2JDHA 4Q8KA 1FPN3 4NIHA 1ZZCA 5IYZB 3ZFFB 4IEVA 4N53B 5LGNA 1TEIA 4QIWF 1ZZ7A 2ZE8A 1Q8VA 4LF6O 2WS92 3OM3B 4COYA 4BAYA 4A7ZA 2D5HA 3LOIA 2RS13 3PLQA 3APBA 1JH5A 3FUOA 1VARA 2LROA 4XC9A 1BZWA 3VHPA 1VBE1 4AFMA 4LNVA 3JATA 1BMFG 1DG6A 2H6BA 1RL3A 4O4LA 4X1KB 3B7MA 1GO3F 2RM23 4X65B 1R083 4LORA 1PK6A 2YXSA 1JU3A 5F39A 2HWC2 1VBD1 4LPLA 1SQQH 3WP3A 2XLGA 3D82A 1AR92 2DUOA 2R9RB 2VOTA 4BK5A 5FZFA 4AI1A 1FATA 4DIQA 2QE3A 4X1IB 3EJKA 2VC9A 1ULGA 5D1IA 1SQFA 2GN3A 2ZMNA 2XKOA 3MPPG 4X62B 1Q43A 4X1IA 4LBNA 3DKQA 1RSOA 1N3PA 1W8FA 4XE9A 4G27B 5DG2A 1OZ0A 1REFA 1JYXA 4ASMB 1PZ8A 2BSKB 2EIKC 4NHXA 1PK6C 2XJVA 1YITV 1DZRA 3FUQA 3ABZA 3UKTA 3I55V 2L6LA 2NR5A 1TNFA 3ILNA 2XPJA 1P4RA 1YEWA 5IVBA 2R30A 3I2OA 1H6XA 1LCLA 3SGIA 4GWNA 5CU1A 1WB8A 4C8DA 3FBYA 5IVEA 4BZ4A 3ZFEA 4B7KA 3LB9A 2P6JA 2XG3A 2M6YA 4GXLA 2QFEA 4FM2A 1Y9GA 4QPIB 2XJUA 1Z5VA 3IN9A 2VCBA 1J3QA 3JBG3 1OBNA 2GHYA 2W5FA 2VMDA 4L99A 2XTAA 1IS5A 2DFCA 2P4EA 5IT6A 4ES8A 4AEKA 4O2BB 5DUVA 1FFTB 2QQPA 1XNDA 3RN4A 5LP6B 3ZYRA 3FMGA 5BNPA 4LFAB 2VR4A 1MVQA 2D6OX 4YPJA 3ABMC 5BNPB 1TMF2 3HN1A 3IKWA 4QPWA 4CDWB 2R042 1JZ2A 4MH0E 1AL22 4AILC 4YW3A 4Z1VA 2ZEXA 2HKXA 2WYFA 4DR6O 1W8ZA 4CDWC 2BQPA 2CH7B 1G86A 3AZYA 1QOTA 3LNMB 2RJKA 4IEYA 4RGAA 4JGYB 2V4VA 1EP0A 3BTYA 4I5SA 4BISA 5C8WA 2Z79A 2VCAA 3J26N 1COV2 4KWUA 2R0HA 5K0UB 2UXNA 1G4YB 1UO9A 3O5SA 4CDWA 3FAVB 4Y1YA 3CU7A 4LBEC 2XJTA 2XHKA 1W2OA 3USUA 3VL8A 2Q7EA 5FYUA 2ITCC 1NCRA 4LBOA 4CDXB 5A6QA 1YJKA 2JD9A 2AGSA 3U14A 2NNUA 5GLVA 1FD9A 5DZGA 3RZKA 3CJHB 1ZZ6A 1RMU1 4GLXA 4B3MB 1D2QA 1C1LA 2DDUA 3G71V 3NV4A 1RUE1 4JF3A 2A79B 3VBOA 2JG9A 1QIQA 2OIIA 4GT1A 4UBGA 2RVAA 2UU9O 5CEHA 3OMAB 1XNRO 4FPJA 3UJOA 3M2MA 3BTXA 2WZR1 3GF6A 1XC6A 3E35A 1JI6A 2P7TC 4GH4A 3B8MA 1TNRA 5LMUO 3JATB 1KQRA 2ZX0A 4YW1A 1GKFA 2LTNA 1TME1 4G3YC 4DRRA 1DGRA 4CC5A 4GD4A 5LRRA 1XMQO 3HOBA 1PM7A 1QVFU 2PHRA 2BEOA 4WM7B 3IIIA 2EVXA 3ABLB 3I3BA 3RI8A 2C2AA 5EYPB 4GH4B 4PJYA 2PYLA 1CWPA 2WNVB 5HFLA 2CGNA 1FFXA 1M4WA 2VZPA 3E6CC 2YI9A 1Y74A 2CDPA 1T6GC 1SG3A 5KXDA 1GANA 1U96A 3GALA 1RUNA 1RITA 1JYCA 3PJYA 5F6LB 2HWD1 5E8AA 4QXHA 1V6IA 3QBQA 2W1UA 3VDDC 1KITA 2GMPA 5TISZ 1QJX2 1UMIA 3OGGA 2PLV3 4YHHO 5G04L 4MGQA 4GKKO 2CNAA 3POFA 1BEV2 4QQ2A 1WMXA 1X59A 2YC0A 5C93A 3KSCA 2JG9C 4XQ4A 2Y64A 1DCSA 3OYWB 3KT7A 3AK2A 3J4UH 2JWPA 4RQFA 4BB3A 1DK1A 5JH7B 4JI5O 2VBDA 4ABMA 1COV1 3AP7A 3IC9A 3ZSMA 3LEMA 2QBXA 4TQFA 3WV6A 3N9MA 4B29A 1AX1A 5GLTA 1HB2A 1FS0G 2XHNA 4TN7A 1NXMA 3ZFFA 4LIUA 5APAA 3RZMA 1RC6A 4QHOA 1RUC3 2GTSA 1EAH1 3ACLA 1WCKA 3WZ1A 5JIAA 2VQEB 4P9YA 2Z0AA 3CQOA 4EWEA 3POEA 5FL7G 2D97A 4I0BA 2OPWA 3POGA 2XR4A 4R4XA 2B8MA 1GNYA 1Q86W 2VVDA 1DFQA 3VDAA 4IXLA 3N7LA 2X6BA 3CEWA 1AVMA 3R66A 5GONA 4A42A 5EZYA 4QDRA 1DP0A 3OMNB 2EIBA 3ZR6A 2Y38A 4HMZA 5JWPA 3WLUA 4J10A 1UPIA 1JOPA 3IMMA 3CXHF 1IQAA 5H9QA 3UM7A 1UZZA 2PI5A 1BZKA 4MHUA 5DG1A 3MHHC 2VZQA 1LHVA 2WC2A 4LBQB 2UXCO 1SQVH 3AZXA 1CJDA 3AZVA 1O4YA 4XDJA 1OLME 1V70A 1JS9A 3K5NA 1AJPA 2JX9A 1AYM2 5ANQA 1Y3TA 4IEUA 2PLV1 1L7LA 1TME3 1SLLA 1HP8A 1RUG1 1J83A 4JGZC 2KA3A 1W6MA 4YW2A 5DUXA 5E88A 4CDQB 4UW4A 2DJVA 2G9GA 1VE0A 1CESA 2E5LB 5CBGA 4NHMA 3IMNA 5A6XA 4WFBV 1UY3A 2L35A 1H2GA 4QQPA 4JTNA 4OULA 3HEIA 2DCJA 2ZX4A 3CJIB 2Q8VA 1BQ0A 1YYNA 3ZPYA 3H3LA 5L9BA 4FOYA 3SKJE 2GNBA 2JIGA 4RFT0 1C1FA 1QHDA 1XYOA 2EILC 5FZEA 2XJPA 3LSQA 4FFGA 1WKYA 2LFRA 2YMZA 3R4UA 2IM9A 3ZSKA 2Z3YA 2QR4A 2W9XA 4U36A 4N21A 4XBQA 3I7DA 1I5PA 5D8AA 1QY4A 5FZDA 4DZGA 3FYIB 5C8YA 4F4LA 1JHNA 5I8TA 3I2FA 2WLPA 5FNVA 4RS5B 3ZYIB 3BA8A 4AK3A 4JI6O 3K75B 4K8FA 2Y34A 5L73A 5DAXA 1YSCA 1NLSA 3I3MA 3MIFA 2C9AA 1BL8A 2CHHA 1OLRA 5EWSA 4FFBB 4LOTA 3ROUA 2MW2B 4K21A 2VXRA 5LXTB 2XJQA 1J3PA 4GWMA 3S5QA 1UL9A 5SV8A 2XGXA 3ZRVA 2WS91 3LIGA 2UY8A 3UO3A 2N7GA 5FYTA 3H3UA 5BV6A 3W9AA 3HPNA 3ZOIA 2OPKA 3ABMB 2R7EB 1ZVFA 1SLTA 4CUCA 1HXS1 2IFWA 1M9NA 4WM8A 3WP6A 4K1YA 4NRMA 5LZ6A 3WNMA 2P67A 4ZI7A 4FAGA 1H4HA 5IVYA 4BWOA 5BR8B 1JYNA 3A0RA 4R9AA 1V6LA 2WLJA 1GZWA 4YG0A 2HVKC 4UOJA 3NV2A 4AQYB 1KDKA 4XUPA 4JGYA 5LASA 1XILA 3KB5A 5F5IA 1RUI3 1WBFA 1B6QA 4JQRA 2ZJCA 5BNPC 3AK0A 2QTWB 3G7DA 1GWMA 3WB0A 2E7AA 1ND3C 3CCVV 4IEQA 1LGBA 1SZXA 4JYBA 2LW8A 2AACA 4GB32 2XL9A 5IJRA 3RBZA 3SCGA 1COV3 4LTAA 2JDIG 4IIJA 4YY3B 5JMCA 4XF1A 3W21A 1VALA 2R072 4MT8A 1QNYA 5FO8B 1VQ5V 5EIYB 3VBUC 5FTTC 1EFRG 1VQ8V 2QQVA 1AX0A 1GK9A 4Q4Y1 5FZCA 3ZEDA 1ZRRA 1MZ6A 3Q4HA 2WQ4A 4LUMA 3LGRA 1F5FA 5FAXA 4DRVA 5LBCA 1VRH1 4Q20A 1OUSA 5C33A 3VBUA 5F3CA 2Q6AA 2WN2A 3ZSLA 1WLWA 5I8YA 3BPSA 1AR91 2JXAA 4BLIA 5FXZA 1TVGA 2DCTA 1ONAA 4YFWA 1TVKA 4LBQA 3VBRC 2WNVC 1JW6A 4UCSA 1V9U1 3POJA 2QQNA 3JAKA 4OI0A 3K0GA 4CTEA 3GYDA 4XAEA 2GNTA 4LFCO 1DGRN 2F4LA 2YGLA 2WAMA 2DWEC 3GNEA 3MW4A 2WZR3 3K5LA 2RMU3 3VDDB 5JJJB 1P7BA 3OTOO 1F4AA 5CYYA 1GN4A 4Z07A 4E4DX 2RM21 4OZXA 4WVMA 1Q6UA 3OOXA 5FY4A 1UOJA 4QXKA 4RGKA 3KV5A 4DR3B 1KJLA 3WY6A 1QF3A 1M93A 4DR6B 2BNNA 3ZHQA 1AR81 2ORZA 4YGEA 3OTOB 4YYOA 1QJX3 2DV9A 4FPHA 2WRAA 2VPVA 2VO5A 3DYPA 4OX9B 1LTEA 2R073 5A7PA 1ST8A 3SH3A 2ARAA 1VBA1 4CA9A 4FLTA 2Q8OA 1H6YA 2BBAA 4EN8B 4CCJA 1OUXA 3H1WA 3QNEA 2UUBB 4OHVA 1VIBA 3U10A 3QTCA 4H14A 3ZFEB 1COWG 3VD4A 3AMNA 1IPKA 1SBDA 3R65A 4X1YA 1EBOA 5FYCA 4CEWB 4UAPA 5JXJA 3T2QA 3ZIWA 1FMD3 2Q1ZB 3SYOA 5FYHA 2W87A 2HJFC 3I49A 4DV2B 2BOJA 5FP9A 4PA7A 1OI6A 4EN6B 1WMFA 4CUGA 4QU2A 4MVMA 4IV3A 2ZEYA 1QBZA 3JQXA 1UXXX 5IYBO 3V56A 4R9CA 1Q82W 3WDXA 2XVGA 4Q2FA 3WDTA 5LBFA 4JYYA 1KMIZ 2FZ1A 1WP8A 2R16A 3K03A 4DQAA 4H44B 1PIV3 3VHNA 2XAJA 4D6SA 5C3QA 5FYYA 2UUCO 3BIWE 4FPCA 2UXCB 3TNQA 2VGDA 3OB8A 4Q5OA 5T50A 3WP5A 2ZEZA 3ZSJA 1UQXA 4YVSA 2OCCB 5FZAA 1VQKV 1RB8G 4S2FA 4FQZA 5E16A 2BGCA 1O4TA 2R062 4F3JA 4O4JB 2HHHB 2IXHA 4AWDA 1KECA 2DYSB 1CJPA 4QPIC 2VW1A 1CIWA 2FCTA 4UFZA 4NXMB 1UY2A 4DV7B 5FZ8A 2X6AA 1S5LZ 1QEXA 2WO7A 3JD2A 1N4CA 1DZQA 5DM6V 1AI6A 1VQLV 2ZKOA 3HR0A 4MXVA 1VRH2 4DV4O 1E1RG 3W7SA 5LP6C 4XAAA 4QPKA 3SDLA 4DV5O 4GB33 1VQ7V 1ODNA 2AR6A 4NTWA 5C3PA 3ME2A 2P06A 4PIXA 1S0FA 3FAVA 1JYTA 3GJAA 4WVWA 1HW7A 3JB4C 2VRZA 4MW3A 2EALA 3AK1A 1S0JA 3NVCA 4HOOA 1I5ZA 3SYAA 4AHYA 1O6UA 2WFPA 4AGVA 3W7UA 2VMGA 1DU3D 1BS3A 2DQ0A 2WLIB 1G6NA 3OGCC 1PVXA 3LIHA 2IU3A 1J1LA 2W08A 4AQ2A 3SPJA 2WSSG 2W92A 1S0VA 4J9YB 3M3IA 1XSQA 1LUWA 2ZGLA 2ZR2A 2XUEA 4GB31 2NN8A 1PMIA 1R73A 3CS5A 1OHHG 2IJJA 1IPJA 4CCOA 2WSVA 4G2KA 2ZZQA 4JAVA 2MEV3 1I7FA 2QWRB 3N35A 4KHPO 4EN0A 3THCA 2D6KA 3E6DA 2QNKA 3CNAA 1HN1A 4BPZA 4YW4A 3J8F1 2ZOEB 1H1IA 1Z2GA 4J11A 3E5UA 2YHJA 1OLMA 1YO8A 5A32A 2GN7A 2WZPP 2WUHA 1UOFA 1TMF1 4CUBA 5JI7A 2OYQA 2DYRC 1Q56A 1O59A 3I3EA 2XAQA 4JVAA 5LA1A 1S1AA 4CZZA 1BBT1 4HPKA 1U5XA 1DLBA 5IVFA 4WBBA 3MLJA 3H3ZA 5IAVA 2PAMA 4WV8A 5FP3A 1R1A1 3UKNA 3ZN1A 2NYYA 5EZYB 4RWUA 2RE9A 1HRV2 3T1LA 3B02A 4EJRA 1N32O 1H9PA 1DF5A 4LF5B 4XPVA 3T3YA 4BHPA 2BZDA 1UNBA 1QJU2 2EILB 1IURA 4NXMO 2OXBA 5FO7B 4XJUA 5JZGB 2PMWB 2XNDG 5DECA 4YZ3A 1C8M1 3VD9A 1TUBA 4LO7A 3CC7V 5HXMA 3U4SA 2XAGA 1NZCA 2DE0X 4DR1B 4BM8A 5KLVH 1PL4A 4PDVA 3ZYPA 1OMIA 5IDJA 1QKQA 2UWCA 4Q0PA 1J95A 3C3TA 1GMMA 3ZHVA 4FPPA 4LR4A 5FYIA 3T2TA 4GX5A 2VZTA 1IVSA 1SFYA 2JDPA 2WBKA 2Y60A 4MVQA 4SLIA 1BKZA 1B35A 4Y20B 2PELA 3MW2A 4X8PA 3B4SA 2IZWA 1GFF2 1RFYA 1PX4A 4YRDA 2WSUA 5A7NA 5CA0A 4D7TA 4V2WA 3I2HA 2YXLA 1V55C 2P5BA 2EXIA 4O4LB 1BGYH 4DV4B 5FKBA 1HDJA 4E8CA 1W3VA 3T1HB 5DAWA 4XQDA 2YUAA 2VS0A 1EV11 3CKHA 5ABJC 1YIPA 2HLEA 3W59A 4LK7A 5F8PA 3KMHA 4FXKB 1N1SA 4RYDA 1Y4WA 5C8YB 3PU3A 1Q5OA 3M8LA 4J1XA 1O91A 2ZCEA 3LD8A 5KR7A 4TXWA 3NWKA 4CC6A 3GBGA 1NCRB 3CCEV 2Q1FA 4QT6A 3VBFB 2IFRA 1A78A 2VBPA 4PDWC 2IJIA 1S76D 5EXOA 4FAHA 1U5YA 1W6PA 4IEOA 2VVEA 1YQ6A 2VTFA 1Q6IA 2V5YA 2W1SA 4P2ZA 3RZLA 5F32A 3MD0A 4Y33A 1SBEA 1OV9A 4FFKA 2BW8A 4X1YB 1B35C 3FFZA 2PYJA 3DYOA 4GWIA 2HH9A 1LRHA 2MNGA 4YZ2A 1NLRA 4LF7O 4QE7A 1PO22 5DQ0A 2EIJB 1B09A 5FY7A 3OJBA 1OD3A 1PO13 5IVVA 3VQYA 4JTCB 2ZGPA 1W6OA 4K6BA 3INAA 2W3JA 3MDPA 4MTOA 3GVMA 2C5DA 4B3RO 4LF9O 4A2UA 5IATA 5BR8O 2EZPA 4BXSV 2GC2A 4EN9B 3P30A 4Y1XA 4MXWA 3MAQA 1GN3A 1GZCA 2OT5A 1R6NA 1D5NA 3LDEA 2AZ0A 1KEXA 5EYXA 3T4DA 1H1AA 5JOYA 5LEKA 3EBRA 3RG0A 3WFVA 3HD8B 4HONA 1ND2C 3JUUA 3B8NA 3NO8A 5FZMA 3EHKA 4V1PA 5KHHA 4QJFB 3HBZA 4XFCA 4DXWA 4N9IA 2HWD2 4Q0QA 1ZBA2 1JYVA 4IV3C 1JUIA 3LPGA 1GLHA 1QH6A 4PIYA 1VEWA 5FPOA 3O1SA 3LFMA 2OW4A 4MVRA 3AZZA 1V6JA 1QQCA 1W6MB 4KQ7A 4CYDA 2IW5A 4JYCA 3SISA 5B2GB 1NTMH 2SBAA 4DUXA 4CCCA 2QZ3A 5CMUA 1H9WA 4JDOA 4J80A 4IEXA 5L9VA 1JJOA 1XYPA 4QD2A 1RPOA 3K58A 1AUYA 3JAMN 4CH3A 4QKBA 3DUIA 3ZKUA 3GCXA 2H6CA 1Y43B 3KF3A 1LESA 1A6CA 5DDJ1 3SJCC 4CH4A 1YQ8A 2F1MA 3ON7A 4QB2A 5JOZA 3CCRV 4ZY9A 1PX3A 5GONB 1F15A 4D8MA 4MOAA 4ZHNA 2P17A 3V64A 2Y0PA 1YJ9V 4J7JA 2ID4A 1JOBA 4PQ9A 4OI1A 3ZDSA 4ZHQB 2CGOA 1I5XA 1TQ5A 4Q4X2 5C5UA 2VTXJ 2GH8A 4CDQA 4Y24A 3OD4A 1OF3A 2JGUA 1GU3A 4KUMA 3BN6A 1H2SB 3Q8FA 4MVSA 2ZGNA 4NWVA 4DV7O 2JJ1G 2ARXA 2WNVA 5HV0A 3O0XA 4Z2WA 1VQNV 2A3XA 4XTMA 1G9AA 3B9CA 4UFKA 1XBLA 2XAHA 2HWB1 3SKVA 3MHZA 1DTOA 1R092 4AXOA 3HQXA 2VW2A 4FPLA 5K4LA 4JGYC 3SXWA 1XNBA 3FLTA 3OY8B 2F17A 4WM7A 3SMHA 5C3RA 3FB8C 5FRAA 2WLQA 4I4TB 2RR11 5C9AA 4I3GA 4FVMA 2A6ZA 3LPFA 1ZZ8A 3CHXA 1F31A 1PNGA 4JI3O 4JZ2A 1JZ3A 3GWKC 2DU0A 2MK3A 5F2SA 4CEWA 1S5JA 1W2NA 3BALA 4LUKA 2DTWA 2D93A 3PVNA 1YQCA 5LBBA 2WWJA 3CCMV 1AR61 1THZA 3HQUA 2BSKA 4HN1A 3NNLA 4FBFA 2C9KA 3JALA 1LHNA 1W03A 1LNQA 3MV11 3SH5A 2IC1A 2LW1A 4GYCB 1QJY3 2ADEA 3C90A 3OGIB 5KUKA 3OR6C 4JI5B 4YM3A 3ASNB 1GN2A 3JCIA 3ABKC 1QXJA 1E5RA 4F6RA 1OJHA 1W2AX 3G6JB 1E5HA 2IJKA 5B1NA 5A2QN 5T5LA 4F6EA 4ASKA 1AL23 1ULPA 1ZBA1 3RZGA 4N43B 5FQ0B 2W0FC 3QO8A 4HAMA 4KL1A 3MUY1 3AEIA 5KXBA 2EZOA 4PDRA 4PHZA 2DFBA 1MOFA 4XJ8A 2DYSC 4JHZA 2JDMA 2XKPA 4AAPA 2FCUA 2JS5A 3M70A 2W6JG 3V0BA 4FLZA 3BCWA 3K77A 4TUYA 2Y8KA 3L74H 4CP9B 1OSGA 1HJGA 3A22A 1LECA 5K0UC 3TK1A 4I30A 3SITA 1R3IC 2XASA 2A0LA 1RHI2 4LR3A 1ZREA 1IBMO 2WWSA 1J5EB 2LFSA 1LHOA 3WG7C 4O2AB 2HWC1 5IJ9B 1A8MA 2JS3A 1PO21 1NCQC 2E7QA 2VZVA 3F5TA 2ZGKA 1YHFA 1FPOA 2EIEA 2YPDA 3MGUA 1URXA 2ZKNA 4UF0A 1J58A 2IXCA 2HP8A 4MX3A 3DYMA 3CEIA 5IVCA 1UU5A 5HPOA 2ZKLA 3RJRA 3ZMVA 5LL6Y 3BPZA 4LULA 5L3FA 5I0SA 1UD1A 3L71H 5A33A 1AXYA 3LDKA 3D3QA 4DR5B 3UO2A 4CPBD 1QXPA 3I54A 2R061 2WA4A 4LKDA 5FMDA 4OVEA 3N9QA 2ITDC 3JASB 2E74B 1RUG2 1VBB3 3WF0A 4BU2A 3R05A 3Q8EA 3W58A 1GM9A 2V1DA 3MW3A 1AR63 1XRUA 5L36A 3TNPB 3DPRC 2C26A 5JH7A 3IAQA 4QX7A 2BOIA 1WB7A 4K0KO 2EINB 2QQIA 4I0AA 3WQ0A 4PDMA 4NAMA 4GMP1 4KU7A 2JB4A 1MZ5A 2GC1A 4PV1B 1HQWA 1PNLA 3HKEA 4YG6A 1AI5A 4P02B 1O3TA 4LKEA 1M56C 1VQ6V 4NXNB 4E4SA 3IAYA 1GQGA 3T1YB 2GALA 2D40A 4NHKA 1DGWA 3T08A 3C3SA 3B00A 2OYZA 2A70A 4N53C 5LW9A 2ZD9A 2PN5A 5CA3A 3MYXA 5FZKA 3NW4A 5C4WB 1OCRB 2UU9B 1NVPB 4LA3A 2Q0AA 2EJ7A 4MADA 4JAAA 1NZ6A 2YPJA 3WDUA 5LMUB 1ENSA 4UFJA 1CX1A 2HWE3 3WHTA 4FCAA 4LHNA 5FWEA 4I9QA 2BJSA 2C4XA 3LKJA 5A3NA 2YC4A 3BAAA 2Q69A 4NIGA 3STZC 1Y7BA 4P08A 3E22B 4B3TO 1QDCA 1US3A 2J1UA 2PQQA 5FPAA 4UCUA 3ATGA 4AE2A 2R1BA 1RVF2 5FLHA 3WP4A 4NHYA 3AKSA 3F95A 2WWWA 1S2KA 3MIBA 1UX7A 4IE4A 1O7FA 2ZGOA 2QSAA 2YIDA 2ZX3A 4X9QA 1FT9A 3HMYA 1WWYA 3O1UA 3N3HA 4JKLA 3BGAA 4FTBA 1NBMG 1QQP3 4AVTA 3OD0A 1O3RA 3JU9A 5J37A 5IYYA 1PVC3 3CBNA 3TN92 1LENA 1UU6A 3J7HA 2YIAA 2NM1A 3IDCB 1Y76A 3PTYA 1UZWA 1PD3A 2FHRA 1TVKB 3KZIZ 4QDSA 1Q7YW 4FJCC 2OIGA 2WO3A 1D5AA 2W1QA 4IGQA 4A41A 4FI9A 4JI7B 3W7TA 4WFAV 3BCCH 3M3EA 5HI0A 2IUWA 1R3JC 2P6HA 5ABJB 2EJRA 2E9QA 2WLLA 1S2BA 3V65A 2ETNA 2KG7B 1LHWA 3E1F1 4HK9A 4FVVA 2VQ0A 5GLUA 3DV8A 4WVMB 4HKOA 1AP5A 4Q4X3 5FZHA 1G9CA 2XUMA 2YIBD 1GP5A 4FO9A 3O1PA 1RXFA 4OYUA 5CA6A 3VN4A 5AVPA 5DAVA 1AR4A 2EIMB 4JI4O 4LFBB 1O3QA 2XWBB 1POQA 5FK8A 4QQOA 2RJ2A 4XDKA 2JIJA 2GZWA 4UVAA 2PHWA 5A3WA 1OOPC 2E5LO 3K59A 4RR3C 4ZOLB 1UN1A 1ZA4A 1CZVA 5LYJB 4XZUG 3VD7A 1L8DA 2GC3A 3L73H 2Y6HA 2R041 4UVCA 5FZ0A 1DYKA 4FPGA 1NYWA 3ZHUA 4XUNA 3LA2A 2Q30A 2CL2A 4Q4W3 4O4IB 1MNGA 1IBLO 1VLNA 3ZMSA 5K1PA 1V54B 2B9UA 1ULOA 3H8UA 2DN9A 2KR2A 3THDA 2R1DA 3WDYA 4UXAA 1NR7A 3DL3A 5LGTA 1FPN2 1R1ZA 4ZOLA 5IWAO 1C5HA 5BXZA 2GUZA 1DGLA 3K3WA 5FUNA 3UGHA 2WZ8A 2JKBA 1FPN1 2QKAA 1W0NA 3C7EA 1ALYA 2VJXA 1V55B 2VXJA 3ZLIA 1ND2A 5A3PA 3ZCCA 3VV1A 2AENA 3FLRA 4N90A 3JALB 2W46A 2C24A 2XDVA 2YV8A 5EZWA 3M3OA 3WNLA 5H9CA 4O2BA 1VQMV 1W0KG 4X62O 1SETA 2E32A 2XL7A 5FCCA 3HKDA 4QGPA 3PUIA 2XAFA 3DC5A 4Q4V3 4DR5O 5D21A 5ERLA 1M56B 1FJGB 1YTFB 1YFXA 3AC0A 5CFCC 5FREA 2J22A 4YW6A 4QAWA 3T0AA 4S2GA 3SYQA 1HV0A 1RPRA 1CIYA 4FLXA 1MQTC 2P4VA 2PTMA 1I3HA 2I2SA 4DW0A 5FJHA 4JV5B 3F5WC 1V6NA 1CAWB 1T2XA 1SLBA 4ZZ8A 3ZFFC 1C4RA 4UFMA 3KGLA 3JYCA 1OCOC 2R9IA 3DXRB 2ETEA 3WG2A 3Q8BA 4LLOA 1W05A 1SMVA 3FFQA 2DVAA 4NTYA 4LF6B 2KD7A 3E22A 1PNFA 2RCVA 4JV4A 1VBD2 4JDNA 1Q8SA 1J5EO 4GIQA 4MV2A 4L11A