4KL1A

Hcn4 cnbd in complex with cgmp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
193
structure length
192
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic dinucleotides bind the C-linker of HCN4 to control channel cAMP responsiveness.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 60
structure length 192
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4kl1A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kl1A02
3KMHA 5LEJA 1LRHA 2BGCA 5J3UA 3UKVA 2QDRA 1XRUA 2CAVA 2ZCWA 3H3UA 5CU1A 3LA3A 4K8FA 1ZZCA 3H50A 2Q0AA 4IEVA 3BALA 3BPZA 3NSTA 1ZZ9A 5E1RA 4XFCA 3ES4A 3CO2A 4EWEA 3H7JA 2FMYA 4HN1A 2PAEA 1ZNPA 4D7SA 1XE8A 4BIFA 2MNGA 2P17A 3D0JA 4XF0A 1VP6A 3HT2A 4MZUA 1PM7A 4I0AA 4MGZE 3B02A 4FBFA 1CAXB 1YHFA 1ZZ7A 4N9IA 5BXXA 2WC2A 4I3PA 2F4PA 1FT9A 3O14A 3ROUA 1Q5OA 3H8UA 3IBMA 1YFUA 1LB2A 4AVCA 3IDBB 5HI0A 5KHHA 1CAVA 5JR7B 5KHKA 3G7DA 1G6NA 2D40A 3CLPA 5I0TA 5FPXA 3U0ZA 1X82A 4Q0PA 4FAGA 3E6DA 3E97A 3ELNA 5KBFA 1EYBA 5I0UA 1UPIA 1YUDA 1YFXA 5FLJA 2PQQA 3QACA 5E16A 2BEOA 2PA7A 4HVQA 3I59A 5BUVA 4HZFA 2O8QA 4YYOA 1O7FA 5JSOA 4MGIE 3VHRA 3IIAA 4LUKA 5K8SA 3CL1A 2DCTA 1Y9QA 2MPFA 4MGKE 1Q43A 4JVAA 3NVCA 2B8MA 4LULA 4FT8A 1OD5A 2QVSB 4E2QA 3ES1A 2QCSB 2UY8A 5C6CA 3KSCA 1LR5A 3MYXA 5JSPA 1OI6A 3D0SA 5AVPA 4D7TA 3RYPA 1ZRDA 4I0BA 4H7LA 5I8TA 4IEUA 4KWLA 4BYYA 3RDIA 1CAUA 4Q0UA 3DL3A 4EWAA 4KU8A 2B5HA 1DZRA 1ZVFA 5FCCA 3FZ3A 4IESA 4LLOA 1O3TA 2D93A 4XETA 1I6XA 2IXKA 3FE5A 3I7DA 4HN0A 4IEZA 4DINB 1IPJA 1ZZBA 2XLAA 1O3SA 4AVAA 5J48A 2H6BA 1IPKA 2OPKA 3FHIB 1X8EA 3NJZA 4MUVA 3EBRA 3RNSA 2HKXA 3WW4A 2D5FA 1Y3TA 4F8AA 1RUNA 5KHIA 1YFWA 5LRRA 2GU9A 1ZRCA 2XKOA 4XFBA 5FLIA 5FLHA 4XFIA 2KXLA 3KCCA 5CVRA 4PIZA 1X8MA 3OTFA 3FWEA 1RUOA 1HW5A 1CAWA 4LUMA 3BCWA 2CV6A 2IXIA 3OD0A 2XHKA 4ORFA 5T3NA 1NZCA 4KWKA 2Q4SA 3WW3A 4IEQA 3PVBB 3SCFA 1O4TA 1GQGA 4UXAA 4L11A 1ZZ8A 1V70A 3U10A 4BHPA 2GC2A 2OZJA 4A2UA 3RYRA 2XGXA 4QXKA 1JUHA 2GC3A 2PTMA 4Z07A 4XEZA 2O1QA 4HVRA 3MPBA 2XKPA 3H1YA 1UIKA 1EP0A 3CJXA 4YRDA 3M3IA 2UYBA 1CAVB 3LWCA 4IEYA 4EWDA 4NVPA 3OF1A 4AQ2A 4HMZA 5KHJA 4KU7A 4EROA 1CAXA 3EJKA 1YWKA 4JV4A 3PLQA 3S0MA 4ZU4A 4META 5I8YA 4GULA 4PIYA 3SCHA 3RYKA 4XF1A 4WVZA 3BU7A 3I59B 5I93A 3KGZA 3ZDSA 3NKTA 4IEXA 3WW2A 2OZ6A 3LAGA 1RC6A 4EV0A 2ZKLA 4Z82A 4J1XA 1QXRA 5KHGA 4N9HA 4CYDA 2FQPA 2IC1A 2E9QA 1DZTA 1CGPA 4ONUA 4MX3A 1WGPA 4AVBA 2BNMA 4OLLA 4HSLA 4ZU5A 2UYAA 3H7YA 3UKTA 3LZZA 1J59A 5BY5A 1DGWA 4XFFA 4MV2A 1U12A 3LA2A 1CAUB 4YNIA 2BNNA 1Q3EA 1NE4A 1ZRFA 3SMHA 2V09A 3OCPA 4IEPA 4Q0SA 2WFPA 4YSFA 4XFHA 4QGMA 1OFNA 4MGYE 2BNOA 1ZRRA 4QM8A 4FAHA 1NYWA 1QWRA 1J3RA 4QMAA 3KGLA 3IDCB 4X6RB 3L2HA 2PAKA 5EZWA 1PMIA 1O3QA 1QXJA 2PHLA 5J7MA 5CADA 1DGRA 3FJSA 2OA2A 2OYZA 3E5XA 5LRSA 1FXZA 4Q29A 4I02A 4ZU7A 4TLFA 3R6SA 1NXMA 1EY2A 1UIJA 2N7GA 1TQ5A 1WA4A 5I0RA 3E5QA 2ET7A 3LA7A 3NL1A 4HLTA 2GZWA 1J3QA 4RD7A 5BPXA 2HJIA 1J1LA 2MHFA 3FFQA 4O9EA 3I54A 1NE6A 2XL9A 4IEOA 2XLFA 5D1IA 4Q0QA 1VR3A 3E5UA 1GQHA 5FQ0A 3TNPB 3NW4A 1SQ4A 4AQ6A 2H6CA 1CAWB 3RPQA 3ST7A 1YLLA 3H9AA 3SCGA 2GC0A 2GH2A 1RGSA 2D5HA 4J1WA 4E2SA 4HVOA 4XF4A 3U11A 1H1MA 1L3JA 1ZREA 2VPVA 4I09A 4HSJA 2QNKA 2IXHA 2ATFA 4I2OA 3EHKA 3ETQA 4E2GA 2K0GA 1OMIA 4WBBA 5EFUA 3QOPA 4QGLA 2ETEA 4Q0VA 1RL3A 2EA7A 2IXJA 1SFNA 3JZVA 3GYDA 4PIXA 2GC1A 4O9GA 4JTOA 2Q1ZB 3CEWA 4IERA 3C3VA 2IXCA 1O5LA 1J3PA 3DV8A 2IXLA 4AXOA 3S7EA 1UD1A 1UW8A 5I91A 2XL7A 2EAAA 2Z2SB 3RZZA 3EQEA 3ACLA 4QM9A 5I8SA 1H1IA 3CF6E 1VJ2A 4X6QB 3H1MA 4P9GA 1ZZ6A 1UCXA 5F1RA 5JAXA 3E6BA 2BYVE 1J58A 2CGPA 1XE7A 2PFWA 1QY4A 2I45A 4XFGA 3OGJA 3WW1A 4HBNA 3IWZA 1O5UA 5FPZA 5LEKA 4KWJA 4XF9A 2ET1A 1RTVA 4YARA 2QJVA 5I0SA 2VECA 3MZHA 1I5ZA 2Z69A 4PJYA 2CAUA 4XF3A 3HIFA 3UKNA 3FX3A 4BH9A 2K9ZA 1X7NA 1YFYA 3DKWA 3M70A 2Y0OA 4QGNA 4L2NA 4XFAA 1WLTA 4LEJA 3H1WA 4B29A 1LKNA 3N4MA 3USSA 5JCTA 3EO6A 3HT1A 3DN7A 3BB6A 4OFGA 4KL1A 3H3ZA 2UY9A 4WZCA 3D82A 3MDPA 4MH0E 4I01A 4IEWA 4R52A 4R8HA 5JSRA 2C0ZA 3PNAA 5FDBA 3E6CC 2VQAA 1CX4A 4LA3A 2B9UA 1O3RA 3GBFA 1SEFA 2PAMA 2H0VA 1EPZA 4F7ZA 2XLGA 1ZX5A 4LTAA 3S7IA 4LA2A 5FQ0B 4JTNA 5C8WA 2EVXA 4QX5A 3SHRA 2PHDA 2GAUA 4UBGA 5BV6A 4UBHA 1FI2A 3HQXA 3SXWA 3TNQA 3LOIA 2PYTA 4IETA 2Q30A
chains in the Genus database with same CATH superfamily
1DCSA 2DUQA 1YSCA 4YHHO 1BQ0A 1GP5A 3DPRA 1VPHA 4K3UA 1TG7A 5LHHA 3H7JA 2WWSA 4LPLA 3D0JA 3Q4HB 4IUGA 3HT2A 4MZUA 2JGUA 3ZHUA 3NAPA 2LFRA 1QJZA 2ZX3A 1FT9A 3ZFEB 3O14A 3IBMA 2VGDA 5LA1A 4UVBA 3AVSA 1XL6A 1SQGA 3VBRC 4A45A 2R9AA 2MK3A 1UMIA 2A73B 4GZ9A 4LBQD 2DYRC 5LP6C 5B4XA 1W8FA 2V4VA 2G4IA 4IGQA 2CYFA 3KCXA 4XIOA 3FLTA 1RHI2 4LUKA 4FZ0A 4B08A 2UXXA 1JH5A 4B1LA 1UFIA 5FPVA 2D98A 2E7TA 5KX5B 5FMOS 4K8ZA 4E2QA 3SJCC 1H2MA 3FYIB 3LGRA 1VMFA 3IAQA 4DV3O 4YWAA 3JARA 2OUJA 5L9BA 5B66Z 3MF6A 1DQ6A 1RUD2 1F8VA 1I6XA 2IXKA 3ZPOA 1TNRA 3OBRA 3F5WC 4O4LB 5L9RA 5CA1A 2NN4A 2KQXA 4DEVA 4XBQA 1UXZA 3LSQA 2DN9A 2RDRA 1GZWB 4FFFA 1S77D 2WZEA 3AG4B 3FWEA 4WFAV 1PL0A 3LDDA 5LMUO 3BCWA 2E76B 1O59A 5HFLA 2QZ2A 5IVBA 2RG4A 4DRVA 1ND3C 4BHPA 2GC2A 2A6ZA 4Q4X3 2RR11 4MLOA 3RQ0A 4DQAA 2D44A 2C4XA 4IV1B 4HOOA 3VGIA 1LOEA 3LNNA 4IEYA 2WDBA 3QD6A 3D4KA 1E57A 4LKEA 5ERLA 4QNHB 5FZEA 4META 3KB5A 4DY3A 3VKMA 1YIFA 1I7FA 2M6YA 4B1MA 1G7YA 2OQ7A 4K1ZA 2FCUA 3SJAC 1JJ2U 4PCRA 2W92A 5A9GA 2PLV1 4JTAB 5FPLA 1CGPA 3JB8A 2CNAA 2ZR2A 4OLLA 2VWJA 3JBG3 1CEZA 3UKTA 2ZM6O 4YM3A 1H8TB 2ORZA 4CP0A 1N0NA 2UWAA 2C6SA 4IE4A 3VDAA 1S0IA 4I55A 1KDMA 4OPAA 4QPKA 1NYWA 4U2AA 1NQTA 4X1KB 2J1TA 3POBA 3L2HA 5L3EA 2AEYA 3AMQA 1O3QA 1KMIZ 1ZTEA 1CQ9A 4ZY9A 2BZDA 1W59A 3N36A 4IIJA 5JWPA 4TN7A 1YJKA 3FB5C 4J10A 4HLTA 5EPAA 4CDWC 2H0BA 2QWNB 4PF5A 2HJIA 3GCWA 5TISZ 3BPSA 1RINA 1LHWA 2XLFA 2C9KA 1UZWA 5DUUA 4QPWA 2XJSA 2WFF2 4L9BA 4EN9B 3SCGA 1RM1B 5L7OA 1POQA 1GZTA 1XNQO 1OOPA 3VD4A 2NZ9A 3J7MA 2OTJV 2V4AA 3AG7A 4HSJA 2ATFA 1NUKA 3ETQA 1UAIA 3ZS8C 3ZXGA 2CH7A 3KT7A 3BI3A 5FREA 2DQ0A 2YB7A 1O91A 2ZZJA 4Q0VA 1SFNA 4FLXA 2Q1ZB 5A80A 4DV0B 1QJFA 4NXMO 2JWPA 3GBGA 3ACHA 3HKCA 5I91A 2R042 5CB7A 2A6WA 2YIDA 2QR4A 2JDMA 1LODA 3RZJA 4DK1A 4X6QB 1F4MA 4A6SA 2PHTA 3AC0A 1JVMA 3O1UA 3AG1B 3D3QA 3P32A 4EZ4A 1QJU1 1KQSU 5FPZA 1GP6A 3ZFGA 5ACA2 4YARA 2FDIA 2QJVA 5FMBA 3AJZA 5FZAA 2A6XA 2EIEA 1W9SA 3PJSK 1QQP1 1QJY1 2DURA 3CSXA 2W91A 4BH9A 3B77A 3WG7B 3N9PA 1UJWB 5J36A 3JQWA 4DK0A 3R4SA 1W6QA 2ZGUA 1YHQV 2WNUC 4FP2A 1HJGA 1R1A1 2XWBB 3WNPA 4PA4A 1Q82W 1GOHA 2VQAA 5GTHZ 4LA3A 5JZGC 1UU6A 1GBGA 4XILA 2EIJC 2VAUA 4P9JA 5JUVA 1ASJ3 1RJ8A 1RUH1 1UL9A 1KITA 4QD2A 4UCVA 2RDCA 1H9WA 3VHPA 5IYZA 2AHZA 1DQ0A 5CB4B 1LNQA 1XUQA 4R6ZA 4Y4YA 3AZZA 2PAEA 3ZMTA 4B3MO 1AX2A 3SYAA 2MNGA 1JOBA 2F1MA 2J1EA 3A22A 2Y6JA 5K4LA 2LROA 2Q8OA 1N3QA 1CAVA 5JR7B 3KF3A 1CJDA 1W9TA 3CLPA 4ZHQB 4K0KO 3HNBM 3O0XA 4Q0PA 2X29A 5FZ1A 4QWNA 1V55B 1BS3A 1UOBA 3USUA 1YFXA 4I3GA 5E16A 5DZGA 2B42B 1XOUA 5IDJA 3B69A 3VHRA 1JOJA 3DYMA 1AP6A 1N4CA 2YIBD 1J1TA 2WWUA 4RQFA 2BW8A 4AFCA 3OUHA 4G28B 3MYXA 2ORXA 3B2EE 5F3EA 4ZKTB 5ITZA 2V73A 4KWLA 3JD0A 1XDCA 3O12A 2A70A 3ZN4A 3WEZA 4HZ3A 1AYM1 4CEWC 1OCRB 3KQRA 5DECA 3L71H 3H9VA 1RIRA 3UGHA 4LFBB 3I7DA 4IEZA 3RFRA 4DINB 5IWAB 4BQ5A 3VD5A 1FJGO 2V5DA 1SZBA 5LY2A 3AKQA 3R05A 5A1AA 2Q5TA 1RFYA 5FBJA 3RGBA 2FZ1A 4TUYA 1Y3TA 5KHIA 2WLQA 1NY72 1K5MA 2B45X 3N3HA 3O7OA 2HWE1 3ZXEA 2UXNA 5C9AC 3OTFA 3WQBA 2IXIA 1FXKC 2A6YA 1Q6IA 1JBCA 1J95A 1NT0A 3UJQA 4UCSA 3N9MA 4N7IA 1EV13 2X6CA 2CHHA 1ND2A 3ZMNA 2PY5A 3CJIA 2AXTZ 2Y8KA 3DXUA 2YSUB 5DDJ2 4DV7B 5APAA 3PLQA 4UVCA 5IYYA 3VHOA 4XUPA 1TMF1 3OBTA 1GNHA 3JASB 2GH8A 5K1XA 1NCRA 1SQFA 3VZKA 3TGUH 1FOD1 2G9FA 1LOAA 2BRTA 4N9HA 5FYTA 1XSRA 4JYAB 4YVSA 1K45A 1RUJ1 1UU5A 1W99A 4DR7B 3HQRA 4CXXA 3MW3A 4LFCB 1ZBA2 4I7ZB 3B09A 5LBEA 5BXZA 1OCOB 5K7PA 4YJ3B 1PIV1 3A0RA 2P3IA 3JAKA 3D36C 5GM0A 2OKXA 4OI4A 4LWSA 1C5HA 1A34A 3MO4A 3WXPA 3V0BA 2BNOA 4QM8A 3FFZA 1J3RA 4B4RA 4YVWB 5LBBA 2D3OW 3IDCB 2VW2A 3TN92 3Q9OA 4FLVA 4RSUA 5FYMA 2ZM6B 3D6EA 4JYBA 4AG4A 5AFBA 2QDNA 4P9IA 5BNQA 4G9SB 4O4IB 3J7LA 3ZOIA 1GH6A 3AJYA 1EY2A 2P7TC 1R091 3ZHTA 1BSMA 3ZYPA 4GJYA 2Q68A 3WVJA 3N2GA 3VBUC 1JYTA 1AR61 3R66A 4AAPA 2Y6HA 1WBLA 1QQCA 1TME1 5HCHA 1VRH3 4XMIA 2H6CA 2BOBC 5L3CA 1VB2A 3CCRV 2CTVA 3VD9A 2YZ4A 1AXKA 4HVOA 2EIDA 2F23A 1EUTA 2YFZA 3WP5A 4COVA 2IXHA 4NN0A 2RHPA 1ZSPA 4FK5C 2ATKC 2K0GA 2W2IA 2Q7EA 2WBKA 3ASOB 5JOYA 4IQPA 4GLXA 1N1YA 1Q6UA 2ETEA 1RL3A 2W0XA 1J3PA 3Q8BA 1H0BA 1JYWA 3WQ1A 1WCSA 4Y1XA 3H1MA 4HYOA 2CDYA 3ABMC 1CVNA 3FN9A 2WLNA 5I0SA 3KT1A 1KEXA 2AACA 2JG9C 2F6BA 2Y6GA 3ZM8A 4PJYA 1NA1A 5ABJB 4MVQA 4V2VA 3VBOC 4RUFA 3IDEA 1MR5A 3T0DA 3C3TA 4XIKA 1TA8A 3UGGA 3L2YA 1VLNA 4KXRA 2VZ3A 5FIXA 2PI4A 3KG2A 4JI4B 1XPWA 4JC1A 1N3PA 4LF7O 5GZEA 4QQOA 4KNCA 1AR92 2E31A 2RMU2 3BTXA 2RM23 3ALQA 3HT1A 1OLMA 2QKDA 3B5LB 4AFMA 3K04A 2X5IB 3OGRA 2XJTA 2JIGA 4R52A 4AEDA 5FDBA 4MGQA 5CNAA 4F6RA 1U96A 5F3GA 1SF9A 4ASMB 1XSQA 5DUXA 3ABUA 4WF9V 4RQPC 2WZR2 4BK4A 5JCOA 2DCJA 3VQXA 1HRI3 4K35A 1YVWA 4AE2A 2VQTA 4DUYO 2XH6A 3GB7C 3W5NA 3ABTA 4EKWA 2VO5A 5CA3A 5F39A 1URFA 1P7GA 3H50A 4P5HA 1RUE1 2IJIA 2KKWA 4YGEA 2HWD3 3VL8A 5A32B 4QPYA 4XF0A 1VP6A 2PZSA 2YICA 3UV9A 4KHPB 4COWA 5BNOA 3WF0A 2WS93 3NWKA 1BZWA 4AEKA 5AFEA 2BGPA 3ZXFA 2LW1A 5FOBB 1W2AX 1EYBA 2DOSA 5H9SA 3J8F2 4DY5A 3HAGA 3WUCA 1VRBA 5FZLA 5C3RA 4LMFA 3ETGA 3IJ4A 4QHZA 4DW1A 1EZJA 2YUAA 4ES9A 3CL1A 2MPFA 4B7EA 2E75B 4NTWA 2QQLA 4EFBA 4YM0A 5EZYB 1HQNA 1C57A 4AAXA 4H2AA 4FOQA 5FYCA 4W6YA 1W2OA 5KR7A 4LR4A 1EN6A 5HXVA 2HWB1 1S0JA 4DR4B 2BWCA 3QF7A 1CAUA 1LNSA 4OX9O 5FPRA 3POEA 4DFSA 4LHNA 4UI9L 1IBLB 5L3FA 3M99B 3ZKYA 3HKDB 3PJYA 4NWWA 1F7YA 4KG8A 5JLVA 1A8DA 1KD7A 2XONA 3VKFC 1AJOA 2IVJA 5C3PA 2JXAA 3NJZA 1PV0A 2VZSA 1QJX1 4H33A 3M8AA 1XC6A 1RUNA 4LIUA 4XFBA 1B35B 1SFPA 2A71A 4GZRB 1AUYA 1MEC2 1US6A 4MTGA 3OD0A 4CC6A 5FY9A 1LOFA 1U5YA 1I9RA 2DCZA 3B8MA 4QB6A 4DIQA 3LSUA 2CGNA 2PTMA 1VMGA 3KLSA 3KV4A 4OZXA 1OV9A 2IW5A 3ABLC 3LWCA 2L35A 1HB3A 3AG3C 1QJEA 4QJFB 2EXIA 4M3CB 1CAXA 2ADEA 2V4DA 4N21A 4ZZ5A 4IXLA 4HL0A 5JXJA 4XXAA 1W03A 3DF0A 4GH4A 5B5EZ 2ZTNA 2ZHKA 5LXTA 1K12A 2WLMA 3I49A 4J1XA 3ZJZA 5DZFA 1N1SA 4XHBA 1RUI1 5LGTA 4MVUA 4XTPA 1BGYH 1Y76A 4YW2A 4GB32 1GN6A 1XXNA 3OAAG 4I4TB 3AKTA 1OCZC 4XTMA 2HG5C 5B3SB 3T2MA 3I3BA 5J2UA 1P8JA 1Q3EA 1CN1A 4FPLA 1G9FA 1JXNA 2Y48A 1AYN2 2EIKC 2ARCA 2ARXA 3ZXJA 1C8M2 2VH9A 4FAHA 4DMIA 2YV8A 4QMAA 1YDXA 2X6BA 2PAKA 1V54B 2PHLA 3E5XA 2UWBA 4DZGA 2LQTA 4RR3A 5JQGB 1NXMA 1DYPA 1WBFA 4WFBV 4CC5A 5HBAA 1SESA 2ID4A 3FBYA 2F93B 4RA0A 2VZTA 1JFFA 4J9ZB 4O9EA 2GP5A 3AXDA 4QB2A 4X20A 3E5UA 2JB4A 1GKBA 4WM7B 1SQ4A 4J9YB 1WLWA 2B4KA 1B06A 2XASA 1FX5A 4IGPA 1DIWA 1RGSA 1IS5A 2OWOA 4BWAA 3U37A 4NHKA 3CX5F 2KB1A 3DYPA 3HN3A 2BOIA 2YC0A 4DV5B 1BXHA 1CZVA 4SLIA 4W65A 1RHI1 2UXDO 1POV0 3WF3A 4AXOA 1UD1A 4K3AA 4P9OA 1W39A 3ZRSA 2RV9A 4MGSA 1OUSA 2VMIA 5LBCA 2RDSA 1KDKA 3C7FA 2CGPA 5FZDA 3V65A 4GKKB 4CEYB 1OFSA 4MHUA 3X2QB 1RUD1 3I3QA 2VECA 4JYCA 2BVVA 3DUIA 4NRPA 4NPMA 4UFIA 1HR0B 3JAMN 5JH7A 2K9ZA 4WM8A 1YO8A 4QGNA 3N9LA 4L2NA 3OR7C 1DGSA 5EIYB 2P6JA 1NT2B 4IGGA 4B29A 1ENXA 2G9ZA 5CA6A 3ATGA 2H3OA 5A3OA 3RN4A 1V9U3 5DG2A 4KL1A 3SEPA 3K59A 4ZONA 3D82A 5FY7A 2WSSG 2BCCH 4FFKA 5JMOA 3IM0A 2WO1A 4YG3A 4RYDA 4YJ2A 3QNEA 2FCVA 5IVCA 1TUBA 4NXNO 2XPJA 3VDDA 4RS5B 4XW3A 4JTNA 1W8TA 4GUNA 3STZC 4XJUA 2P3YA 3KMHA 2A3WA 3UKVA 4CCKA 3T4DA 1JZ5A 3EHBB 1GRJA 1IBKB 1NLQA 3A7QA 2YPDA 1RUF3 4UFLA 2GUZA 5BXXA 3WDYA 1IVSA 3V0AB 3H8UA 4NAMA 2ENRA 3KS7A 5IW0A 4CP2A 1EUUA 1K5QA 3DXRB 1UO9A 2WO2A 2K1EA 3HN1A 4KWUA 2HBTA 5B1AB 4ZOLB 5I0UA 4JI5O 5FZ7A 1KS5A 4H44B 1LOBA 1GNYA 2E63A 4HT1T 3ASNC 3PU8A 5K8SA 5A1LA 1AL23 1G9BA 3ZN1A 1NLSA 2OT7A 1YXBA 2UU9O 3O1TA 1WLCA 5IFPA 1ZRDA 3X29B 4BYYA 3BIEA 1URXA 3RDIA 1ULOA 4QX7A 2WFF1 2VOXA 4CUAA 1DFQA 2OQ6A 2RCVA 2KG7B 4QPGB 3MD0A 4LXLA 3ZMSA 4WCEV 3AM2A 4E8DA 3FUOA 2DTYA 1B6QA 3A23A 3LFMA 4CU8A 2E51A 4LBKA 3SJQC 3EBRA 5FAXA 5KUKA 1M56C 2AGSA 1JZ6A 2FTKA 1OJHA 1U97A 2GU9A 3FL7A 5IJ0B 2HR3A 5CYYA 5EHDA 3AP9A 4DR1B 3ZFFC 2R041 1SDWA 2LFSA 2R30A 2VZUA 4LUMA 3RT3C 1W9YA 4MSVA 4XCAA 3SCFA 5IJ9B 4JI6B 5LOVB 4L11A 5L3DA 4EB6A 3U10A 4QIWF 2L9LA 3RYRA 3GF6A 2RE9A 5ACA1 4TLGA 4X65O 1W6NB 3H1IH 2RJ2A 1OBNA 1CONA 3L72H 2XKPA 3JBG2 3VBSC 4RFRB 3M2MA 1E5RA 1OA4A 4HMZA 5DM6V 4BQ2A 2E74B 1PNFA 2Y6LA 3R4DB 1H38A 2VNOA 1CPYA 2I07B 5DAPA 4AQYB 1LHUA 1NKGA 1GMMA 3RZHA 1JCHA 4LO4B 3NKTA 4IV1C 2PYJA 1NCRC 3GALA 2IFRA 2RNBA 4TWTA 2JDNA 1QH6A 3WDTA 1PNLA 1N36O 3H7YA 3G67A 1ZL8B 5LB6A 4FLUA 4PA6A 3UO2A 3F5TA 4OUSA 1BVP1 1XQ8A 3M3EA 3ZIAG 1AR83 4COUA 3K5NA 4L87A 3CMGA 3ZO0B 3OUFA 3MGUA 2ZHLA 3QO5A 3H1HH 1VQOV 3KGLA 5C8YB 3LCPA 4FPEA 5GONA 1H8TC 4PF1A 3WV6A 1GP4A 1RVF3 4IV3B 4Y5TA 4TT3G 3VZJA 1G6UA 5LGUA 1Q8PA 2WT1A 3LA7A 4MT8A 5ANQA 3SISA 4RD7A 4URAA 1OQEA 4LO5B 5F7UA 2RS53 2P34A 3ZMOA 2ZMNA 3POWA 5C4WA 2G1MA 4XVHA 1GFF2 4YY3O 4UCUA 1I08A 5KXEA 4DPNA 2H94A 1PO23 3ZR5A 4HKWA 1AZDA 1LU2A 1OVPA 1QOSA 4MXWB 2A0LA 5H9PA 1T6GC 2R16A 3CWBH 4AQSA 2E7AA 4XOGA 3Q4HA 2FDGA 4JTOA 2DYRB 5LP6B 4U36A 4DV6O 4WVMB 5FZ9A 2ZE5A 1RM1C 2FDKA 3W59A 1KKCA 4QM9A 3ZFEA 2DWEC 1NTKH 1VJ2A 4CDQA 4E2LA 1US3A 3LDEA 2ZGOA 1ZZ6A 3T1YB 4E9KA 1BHAA 2Q8EA 1SACA 5FZ3A 3PL0A 1J58A 4XDPA 1XE7A 5CAZA 4G2KA 3VZOA 3ZMUA 1H2NA 5EC1C 3CYOA 4R4XA 4UF0A 2XTAA 1ZAUA 3T1LA 3UKNA 3VV1A 5DPNA 3ZHRA 4KI5M 3WNMA 1YJNV 1PX4A 5KX5A 2VW1A 1XHZA 3BVOA 1XU1A 4JGSA 1LKNA 1ASJ2 3D8CA 1NY71 3MHHC 4JGYC 3WF4A 2WT0A 1JYNA 1S0CA 5FZIA 4NHYA 4KFMA 3LF7A 2HLDG 2JDPA 5D2AA 1A32A 1UYZA 1W6MB 4UT5A 2NMNA 2G38A 4O4LA 2EX3A 3MIBA 2H0VA 2VZPA 1GWMA 1WCUA 4LA2A 4HXCA 2WLLA 4YGCA 2YFUA 1TE1B 2GAUA 3C2UA 3INAA 5FV3A 1YTFD 1FI2A 1ULDA 5BNNC 4EQVA 1W0KG 1VAVA 3WT3A 2P1BA 3I2OA 1SHWB 4NYKA 5FRAA 1OH3A 5DDJ1 3THPA 2EBOA 2FDJA 4LK7A 3C90A 1HQWA 3MIDA 3OUIA 2ZABA 1R6KA 2NP0A 1EN5A 4GKJB 4FI9A 1KU9A 2JJ2G 2WPDG 3A0HZ 4ZI7B 1ZZ7A 3NV3A 3SPIA 4MOAA 4UFMA 2PQSA 2VL4A 2WABA 1S0BA 3ROUA 3WX5A 2RDNA 1GN3A 1ZBA1 4AVCA 3DYOA 5JPNB 2VMEA 1H1AA 1BBT2 1M57C 1XBLA 1X82A 3E97A 3ELNA 4NIGA 2VOVA 5L36A 2P5BA 1UPIA 4O2BA 3VL9A 5FWJA 1L0LH 4TV8A 4M01A 4HZFA 3TN91 1NJIW 1CJPA 1HXS3 5JSOA 1EFRG 3FC0A 3ZHSA 2DMXA 4JI7O 3PIJA 2XMLA 2DCKA 4HONA 1GANA 1A8MA 3HKBB 5T5OA 2HEWF 5LL6Y 2QVSB 3GJAA 4CZSA 3OE7G 1V55C 1R6NA 4GWMA 3ZYIB 4D7TA 2B5UA 1HDKA 2RR13 4P9XA 4M0HA 4AI1A 4LBQA 3FZ3A 2RS32 1O3TA 1GM7A 2YPJA 4CU9A 1NKDA 1RSOB 4LO8A 3QH7A 4X1KA 1Q8SA 5F37A 1SZTA 3CMEV 4QQLA 3ZSEA 1DYOA 4J42A 1ORQC 5DN6G 2O14A 5KAFZ 1W3VA 3KV6A 4PDWC 3SKJE 5C3OA 5CVRA 2PLV3 3E86A 3ITQA 5F3IA 2J1SA 2AZ0A 3NNLA 4W6WA 1ULGA 3W9AA 3OM3B 4Q4W2 4KWKA 5D8AC 3UGFA 1LGCA 3TJTA 4UXAA 3EFFK 3JXSA 3MUY1 1ZZ8A 3GZTB 1Y7BA 1XB9A 1YQCA 1POV1 1IS3A 3AYAA 2XJQA 4PHZA 1YTFB 4OMDA 4YW3A 1HNXB 5CFCB 4O65A 3RZLA 2AUYA 3OW2U 3RYKA 4X65B 2AEZA 3K5MA 3K57A 3JAWB 1JU4A 3GHMA 2Q8DA 4AI0A 1LECA 4AHZA 1M4WA 3ZDSA 5LA6B 1AR91 2RMU1 3B9CA 1DF4A 4EV0A 4Z82A 3TYJA 4CYDA 2HHHO 1FAFA 3D3AA 1E1QG 2WT2A 4I50B 1Q8OA 1F15A 2WNUB 5F8PA 5CFDB 4HSLA 2IU0A 4YXWG 1DGWA 3OB8A 1O8SA 1WPXA 1KB9F 1W6PA 3RJ2X 5BR8B 1R083 5LHIA 3OY8B 3ETPA 3JQXA 2CWSA 1XL4A 3WUDA 3ZYHA 5B2GB 3F95A 2WZR1 1VRH2 5JZGB 1YF2A 2WLIB 1ZRRA 3K0DA 2DQ3A 2JEXA 2IH3C 4PQQA 2EIJB 4X1YA 3C7EA 3BVCA 1DQ1A 4C8DA 4JQRA 1DBNA 1OCOC 4K20A 1K92A 4L99A 4YM1A 2ET7A 1W6OA 3RWKX 1J1LA 3FFQA 1OUXA 1D0GA 1OT5A 5K1PA 2D6MA 3I4IA 3W7XA 4DEQA 2EXKA 1BZKA 4C90A 4JI8B 3VB9A 1QJY3 3G71V 1I5YA 4GX0A 4OYUA 1YJLA 2IJHA 1K5SA 4XDJA 4AVTA 3WINE 1V00A 4E2GA 4DV1O 3J8F1 3A0NA 3PVOA 2CK3G 4ABMA 4DV4O 3TBDA 2Y6FA 3RBZA 3AK0A 4BU2A 4LHKA 2J1AA 5K0UC 1JA8A 2XL7A 2EAAA 2BP6A 4J11A 4MVOA 5L73A 2P37A 3S5AA 3CF6E 2WR9A 1DQ4A 1UY1A 2WRAA 1XREA 2WNVB 1UCXA 4DUXA 1F51A 2BYVE 4BPZA 2W47A 3OGJA 2ZGSA 2YXSA 2GALA 2QEXV 5FJHA 3ZR6A 1GM8A 3VOUA 4OUEA 4FFBB 2DFCA 4CEWB 5C70A 2NNUA 3LKJA 3CHXA 1REEA 3M70A 1SLCA 5FP9A 1FYJA 2D6PA 4H55A 5A3UA 3TXSA 5LMNB 1HDJA 1VQMV 3NJVA 4WM8C 2JEMA 3USSA 1VARA 2XWJB 3S3XA 5IYBO 3IZOA 3VN4A 3M7MX 3RYFB 4P9YA 2UXCB 1MEC1 4Y1UA 4WZCA 5KUMA 3VQYA 4I01A 1MZ6A 5C9AB 5FP7A 3AMNA 1ZX3A 4LBMA 5FNVA 5H9QA 2Z5WA 1FXKB 2XLGA 3J7AU 3ZXLA 2JKXA 4UBGA 4DR5O 2BERA 2WS92 2X5IC 3K03A 1FPN3 2DYCA 3I2DA 1T6BX 1UY3A 2XT9A 2VJXA 2L6LA 3U78A 2VBPA 3OGGA 4KP4A 4GMP3 4EWEA 3CXCU 2XUEA 2VNVA 4D7SA 2W0FC 4FM1A 1XE8A 3WNOA 1FATA 1AYM3 5GZFA 3CCMV 1WW7A 1Q8QA 4B4QA 2P6HA 1G1XB 1I5PA 3T09A 2E5LB 1SPPB 4GB31 4Y5SA 4W4ZA 5KHKA 1FNYA 4GX2A 3OUJA 2D40A 4JAVA 3OTOO 1KKDA 3UT5B 2M7WA 2OW4A 3EYPA 3CU7A 1Q90D 3OG2A 4FAGA 4YW6A 3HEIA 2JEUA 1Q86W 1AYN1 1Q8VA 1ALYA 4DUZB 2R073 1C8M1 3QACA 2PA7A 3RYCA 3JD4A 2QTWB 3VKLA 1JODA 3LE0A 3G6BA 2HWE3 1O6UA 5FFOC 4B3TO 1KD1W 2CSGA 4LJHA 1RXFA 3K58A 1K9MW 2XHNA 4FT8A 4MTOA 3KSCA 4AEMA 2R6QA 3N2KA 5DXDA 5AVPA 4YJ3A 3JCUZ 4OGQB 4RL7A 4FOWA 2R7EB 2X0LA 1AL0G 2GTSA 4QX8A 1F5JA 2AZ2A 1W06A 4ARXA 1MA1A 2PHUA 4YVWA 3VBUB 3MFAA 3FE5A 1VBA2 2VMFA 3W21A 3IN9A 3W7SA 5L3BA 3ILFA 4GWIA 3SH5A 4O4IA 5BY1A 1MS4A 2XXZA 2YIBA 1O9HA 3BOPA 1SBFA 3O1PA 3R65A 4F8AA 1FOD3 2QJ1A 4X1IB 1MVEA 1QMJA 5F32A 1CD3G 4XFIA 1LAJA 4FPYA 1QCEA 3KCYA 4ZHNA 3A2FA 2HVKC 1D2SA 4LFAB 2HWC2 2XJUA 4F4LA 4Y20B 1IQDC 3FX7A 3ZRWB 4NHXA 1JYXA 3APQA 1WZXA 5FK7A 4PDMA 3UO3A 3CKHA 1B35C 2YGMA 3ABMB 4KMQA 5E88A 4QHBA 4YRDA 1BVVA 2ZGTA 4PA7A 4KU7A 1YWKA 4K8RB 1COV1 2BV4A 4ZU4A 1JW6A 3S0MA 2BE3A 5I8YA 1LUWA 2W39A 4GULA 4D7YA 4AILC 3VBOB 1LU1A 2P2KA 1R3IC 1NH2D 4DR6B 3CCVV 1AR63 3WW2A 1HB4A 3J9SA 4Q8LA 4D3WA 2VMCA 5CN0A 4JI0O 1WGPA 2BNMA 2ZCEA 1JR9A 2ZE6A 1OD3A 3GNEA 1KBHA 3WQ7A 5ABJA 1CPMA 1GWLA 5DABA 4CDUA 3B7MA 2W46A 1QNYA 1XMQO 3QCWA 3THCA 1OFNA 5IY5B 1D0HA 1KS4A 1QWRA 1XOYA 4CE8A 3LD8A 4COZA 4RQPB 4J80A 1QXJA 4NIAA 3ZSLA 3WP4A 3H01A 1SERA 4KBZA 2FD8A 3T4HB 5FP8A 3WD5A 4WBNB 4XZPA 2JG8C 4FLWA 4LK6A 5KC6A 1TQ5A 2EIMB 3AYCA 1G86A 2JJ1G 4IW3A 2N05A 1FMD2 1JS9A 4JI2O 3ST7A 1W8NA 5A3PA 4GJZA 1H1MA 1W8UA 1WJZA 1JHJA 2QQNA 1OQ1A 4HETA 1R1ZA 4I09A 3WP6A 3GXUA 1N34B 4B3RO 5G05L 3OMNB 2ZXWC 2B9VA 5A32A 3C3VA 3SGIA 1MQTA 3IAYA 4XCBA 3DSQA 4COYA 3ML0A 1O8PA 4QU1A 4Y1YA 2FZ2A 1RITA 3RVHA 1FS0G 3IC7A 4P9GA 4BWOA 5F1RA 5CG8A 1GWKA 3N35A 5EC2C 2HEYF 4CDQC 1T2XA 3N9NA 1K34A 4NIIA 3TEWA 3H0OA 5LEKA 4CS2A 3AYEA 4DR3B 3FX3A 5KMGA 2IUWA 1OA2A 1X7NA 4IE6A 4O4HB 3CZUA 4Q4X1 1BYHA 2ZIMA 1RYYA 1QHTA 2G19A 4DB5A 4GWNA 5DAQA 3N4MA 2A3YA 3WU2Z 1KYOF 1NH2B 4OMCA 2CUGA 1G9DA 5CA1B 3MLJA 3J7NA 4CS3A 2JDHA 4FPFA 5JPMB 2VZVA 4R8HA 1NTZH 1XYPA 1IKQA 3HKDA 1CX4A 1HJFA 3MW2A 1N33B 2B9ZA 4FMTA 3GBFA 2PAMA 3WR0A 4DO2A 2EZOA 2YXHA 3S7IA 4CUCA 1MS8A 2W1QA 2RS12 4N43A 1Z7S2 2DWRA 2KSDA 3OEBA 3JBG1 4BQ4A 2BGCA 2VULA 4AHWA 1V0AA 3N27A 4UVAA 4CZZA 4K8FA 2FMLA 4KGQA 3T4VA 4I0WB 1AJKA 4XBNA 3ABLB 2VUDA 3NSTA 3IAPA 4NIHA 5CKNA 3AG3B 2C26A 3RW0A 2HWB3 3JCIA 4N53A 2QKSA 2OCCB 4I0AA 1AL22 1GO3F 2E53A 1C8NA 1W9WA 4JHTA 4LE4A 2ZA9A 3BY6A 4D0QA 1OXCA 4M00A 2A5ZA 4U7NA 4AI3A 2BPA2 2VOKA 4OHZA 5FR3A 1F23A 1OCZB 1JZ8A 5JXGA 4H13B 4Y33A 2BEOA 1VEWA 2UUBB 5L9VA 3IIAA 1VBC2 3TETA 1Q43A 3SR2C 2IVIB 3NVCA 1WB7A 3ES1A 1YQ8A 3CE2A 1UZVA 2GV9A 1DZQA 5HCBA 2LALA 2JD9A 1US2A 3KF5A 1HN0A 3PUIA 4KU8A 5IAXA 3THDA 5C8CC 4YZ3A 2ZS6B 5DAXA 2XHBA 3RZKA 2H6BA 1NXD1 4LR3A 4Q8KA 1DGWX 4GX1A 3E22B 5JQGA 1IS6A 4C0BA 4TZDA 3ENRA 2ZAAA 4WFGA 5L7OB 4QPGC 4IE5A 4DV2B 3AFKA 3JCZA 5EJ1B 4WM7A 2BBAA 1X8MA 2WLPA 4LF6B 1AR4A 1HNZB 2CV6A 2WLHA 2CH7B 2XAGA 4FSJA 5A1FA 2VVFA 4ZPIA 2WYFA 4K6BA 5FXVA 4XJAA 2QQPA 4BZ4A 2XGXA 3KZ4C 1L8DA 1Q8IA 4HKLA 5A7QA 2O1QA 1WNSA 4AL9A 2ZX0A 4UW5A 2HKOA 1YJ9V 1WW5A 2UYBA 4YW4A 3CBNA 2DUOA 2DYSB 4CCLA 5B1BB 3OF1A 2YMZA 1S4CA 2P3JA 2UUAB 4GX5A 1S3JA 4GXLA 1F4AA 4LHSA 1ASJ1 4LH7A 5LBQA 1UPSA 2OZ6A 3LAGA 1SQPH 3FBMA 4CEYA 3LSSA 3OGVA 5IHRA 1AI5A 4NUBA 4AI2A 1N32B 5FMOL 1NLRA 1RVF2 5T50A 3T1CA 1J59A 1HWYA 1K3IA 3ILNA 3SNMA 3S57A 2ZGLA 1PL4A 1DG6A 1NE4A 2EINC 3U1XA 2RS52 2HBUA 4JZ2A 3SITA 1FFTB 3MIGA 4JI0B 2F4VB 1UMZA 2V5YA 5EZWA 1ODNA 1TUEB 3KV5A 3ZYBA 1XYOA 1Y43B 5GKAC 5IVYA 1PO22 2QTOA 1A78A 3TXQA 3SQOA 2BOCC 4CCOA 5E79Z 1XMQB 3RMYA 4JKMA 3GZAA 5ANNA 4E4EA 4CCMA 2QQOA 2GNTA 2MHFA 2Y0IA 1YJWV 4RS5A 2UXBB 3ZN5A 4X62O 5H9CA 4H0LB 4QKNA 1HKDA 4JF3A 1SRYA 1IS4A 5A6QA 1LTEA 3RPQA 3D5OA 1WP8A 4KUMA 1NR7A 5EK0A 2JDYA 4IV3C 1UMHA 1S5JA 2XBO2 1BBT1 1RP3B 3NNJA 1VQ9V 4NO4A 3T0AA 1WA6X 1RPRA 1QR9A 2R062 1AILA 2YROA 4ZKIA 4PQ9A 3CEWA 5EYPA 1WMXA 1CXZB 3P30A 2ZDIA 1VE0A 1LEMA 1BMFG 4UCRA 3ASNB 1QGLA 5GZDA 3BA8A 2LW7A 2WLKA 2X05A 3HOBA 2Z0AA 2HH9A 2ZT9B 1GN2A 1PZ7A 3AKPA 3WW1A 4HBNA 4ZOLA 2GMMA 2RS31 1B04A 2RJLA 3IFXA 2JKBA 5A7SA 3NKGA 1R1BA 4JGZA 3FHQA 5ITZB 1D4M3 4WFFA 5H5NA 1M5IA 4MXVA 1I5XA 3BYWA 4XFAA 3NNFA 4L8JA 4F83A 3I3DA 1XMOO 3RWRD 3ZRVA 2FDFA 4CCJA 1J5EB 3C7HA 1MG1A 2VE1A 4LP8A 4FXKB 4BQ1A 4G3YC 2VQEB 3APOA 2VCAA 4LQRA 2XNDG 4DR2B 4AQTA 1W2UA 3H3ZA 1M56B 3KVAA 4PLMA 1AB3A 4Q4W1 4LNUB 1H6YA 2QQJA 1FFXB 3ZFFB 1HNWO 1MS9A 4X64B 3A0KA 1K5MB 4DXRA 5EIBC 1MZEA 1EPZA 2ZGRA 3ZLIA 5F6KA 1NCQC 4JRLA 2ZINA 3RWNA 4MW3A 1R73A 4K21A 3LOIA 2CY6A 2PYTA 1LR1A 4BQYA 1XNBA 4LF8B 1I94O 3E8HA 1HLCA 2E7QA 2ZCWA 1SA0A 4Z92B 1OZ0A 2Q8VA 2HEVF 4M3CE 2Q0AA 3VBSB 2VMHA 4GQ7A 5BNPA 3T08A 3ES4A 3MDSA 1ND2B 5LOVA 1RMU3 1WUVA 3CJIB 1HXS2 1YITV 4BLJA 2ERFA 4FPKA 1Q6HA 3CRCA 1FYUA 4AHYA 3Q8EA 1V6OA 1XNRO 1EPWA 1NCRB 5LGNA 5FPXA 5J96B 4QPIC 3CJHA 1D5NA 3PMSA 4BQ3A 4YVSB 1VRH1 2Y4UA 1L7RA 2PQQA 1Q56A 4QQPA 5IT6A 1NS1A 4GKXA 3JAKB 5G04L 1W05A 2WAAA 2YC4A 4WFHA 4HG6B 2B8MA 3UQ8A 2QTSA 3TWIA 3OJBA 5ISLA 1ZL8A 3OYWA 2X8KA 1DF5A 1PGL2 3RYPA 4I0BA 3ORJA 1IBMO 5HXMA 4SBVA 1UYYA 4OVEA 1BKZA 4Y1VA 2W52A 5A6XA 2D7FA 3LEKA 4AVSA 2LRPA 3CEIA 1O3SA 4XABA 4FM2A 5J09A 3BIWE 1LGBA 3AZYA 2K9PA 3SC7X 2FHRA 1FAYA 2R9IA 3BTZA 1HV1A 4JI1B 4H14A 4MUVA 4OULA 4K9SA 4BMEA 5FPOA 4LO6B 1YFWA 5FZ4A 3TAYA 4UAPA 3K48A 2AZ5A 5A7PA 1J83A 3TEZA 3GWOA 2TEPA 3VUOA 4NAOA 2EJRA 2ZEZA 2VRZA 4S2HA 5KA5A 1NZCA 3OPTA 1VQPV 1CESA 1GQGA 1W04A 3VBFA 1VBE2 5GTIZ 3LPFA 1BL8A 2RM21 3I97A 4XBLA 1DGRN 2IFWA 2GC3A 3VBRA 4HPKB 4JDMA 1M90W 2XJRA 3FHAA 5LP6A 3AK3A 2Z4FA 2AGAA 3R0RA 2P5OA 1R082 2YU1A 3QG5A 1UZYA 4CVUA 4D69A 3ZXAC 2ZIOA 3HKEA 3GBWA 3H42B 3BU7A 4CCDA 4OI1A 5GLUA 3EB7A 4UFHA 1OSGA 3JD3A 1QXRA 5CFCC 2VY0A 4DS0A 4IHJB 1SCRA 4MX3A 4CS4A 4IL7A 4JGYB 4M0NA 1YI2V 2VC9A 5FZ6A 4D6QA 4NIDA 3CS5A 4JTCB 1ONAA 4IEPA 1VBD3 4JHZA 1G4YB 4LF9O 1OF3A 5FJKA 4BIUA 2WS91 4F6RB 1V6NA 1VQ8V 5CFDC 1E1RG 4G4FA 1LOCA 2XAFA 5BNNB 4X8NA 5A6ZA 1W6MA 2I2SA 4AW7A 5KA6A 2UUCB 3NV1A 3ZN6B 4Q0QA 4DO0A 5L3GA 4TSVA 1VAKA 1GQHA 3TNPB 3PVEA 3I2KA 4O2AA 3BCCH 3H9AA 5M0TA 1X36A 3C7OA 4NB5A 1ND3A 4OHXA 2D5HA 1RUG2 2I74A 4DUWA 3JD72 3ME2A 4LF4O 2VD7A 5LCWL 3J7HA 1ACCA 1OQDA 1S5LZ 3W5MA 3H1JH 2JDKA 4WBBA 4PBOA 4AZZA 3PIGA 1H2KA 1M57B 4NHLA 1EN4A 4G27B 4ZI7A 2IXLA 1ST8A 1K33A 4XJ9A 5GJ6A 4GCZA 5FZ8A 4YHHB 3OOXA 1UOFA 1TVKB 2YBPA 1C1FA 1N0JA 3Q8AA 4J6GA 5F9TA 2LJ2A 4Z1VA 2ZX4A 4LBEC 3KM5A 4XF3A 1VBA1 5C33A 1Z0HA 4D6SA 5DDJ3 4JI3O 2WNVC 4U3FH 3HKBA 1IXMA 5IATA 1ENQA 4PD4F 2F4LA 3APBA 4P14A 2DU0A 5KC5A 1QOOA 1THZA 1FPN2 2B46X 3ASIA 2MW2B 1W0JG 3JALB 3WB2A 3CNAA 4PDWB 4CDWA 3RYIB 3UNPA 1ZBA3 1EAH2 2HWC1 2JVDA 3K06A 2VQFO 3WSOA 4BB3A 4DV3B 1KP3A 3M4FA 5D8AB 3L75H 3UT0A 2F95B 4QX5A 1F2NA 1LEDA 2PHDA 2A1XA 2PGGA 3TN93 3GVMA 3POSA 4Q4Y3 4N8MA 4B3SO 1XNTA 3UL2A 4N43C 1L0NH 1ZM1A 1RB8G 3OSDA 3JYCA 2RVAA 1XRUA 2W5FA 1OKOA 2XQRA 3H3UA 1S2EA 2RJKA 2QWPB 3O1RA 5E1RA 4AK3A 3SH3A 2R072 1N3OA 4XDOA 1ZNPA 4BIFA 3POFA 2P90A 2Z5UA 3ZSMA 5KXCA 3KZIZ 3N7KA 5AC93 2OIIA 3TEYA 1CAXB 1HV0A 1YQ6A 4XQWA 5LBFA 1BT8A 3ZX7A 3BFRA 5LMUB 1Q5OA 5HI0A 3OPZA 4GH4B 1G6NA 3N7JA 5LXTB 2QFEA 3A4UA 3K08A 4YG0A 1W0OA 4R9BA 1FPOA 3AFGA 3CCUV 1MOFA 4A4AA 3IC9A 3WB1A 3JAWA 3NJYA 4L0PA 3J81N 4MGIE 1NQJA 2QA4V 5J2UB 1M9NA 1AR72 1FV3A 1K4CC 2ZNJA 2WNUA 3LPGA 5DAWA 4CU6A 2X53S 3B00A 1AXYA 5LA2A 1F31A 4CBCA 3B4SA 3FAVB 3OY8A 1MNGA 2EULA 1FMD1 3DL3A 3MV01 2OCHA 1POV3 3PURA 4YFZA 2DVGA 1ZWIC 5JZGA 2WLIA 2WQZC 1P4RA 1T5EA 4IYIA 5DUVA 2ZEXA 2Y4TA 1IPJA 2YY1A 1S2KA 2SBAA 4X20B 1VQ4V 1QOTA 2OPKA 2WSUA 2Z42A 3FHIB 5FYZA 3VBHA 2D5FA 4MVTA 2WNOA 4UCOA 3K9AA 1KGYA 1QXPA 1HW5A 3WHTA 1Y9GA 3QLQA 5T3NA 2NMOA 4OQ8A 3WW3A 5K0UB 3EVKA 2XVGA 4B3NA 2VCBA 3PMEA 1CWPA 3POIA 3WFVA 4JKKA 2PHFA 3V56A 4HVRA 2ZMLA 4CH5A 2KD7A 1PK6C 2E33A 1UIKA 5DG1A 3M3IA 4XE9A 1VBB3 1XNQB 4Q1PA 3EJKA 3RYHB 1BCCH 4ZBMA 3AP7A 3HD8B 3C7GA 4QQHA 4XF1A 1JYVA 1IOAA 1JJOA 4RHV2 4NMIA 1V6MA 1DYKA 4CUBA 4NXMB 3TK1A 5JH7B 5FP4A 1NR1A 4WM8B 4BA6A 4E4SA 1ZBE3 1ENSA 2ZNIA 4AVBA 4FFBA 5IK7A 5H6QA 5BY5A 1RPOA 4CEWA 2YI8A 2B1IA 3RJRA 4JKLA 4XUOA 4Q5OA 1DLLA 3J8F3 4FPPA 2RS11 3OEEG 4Q1RA 1Z7S1 3AZWA 4YSFA 1Y66A 4AVVA 3HB3B 3UK9A 1NX9A 5CADA 1DGRA 1TUBB 5LRSA 4AF9A 4JAAA 2B39A 3AZVA 5GLTA 1Y67A 4PDVA 5C9AA 4CH3A 3NL1A 1ZLZA 5IY5C 3VQVA 1VR3A 1AL21 3MUZ1 2CTPA 1YLLA 2VWKA 2GH2A 2NPIA 4J1WA 2OX0A 5FO9B 3J80N 4FTBA 4Q4V3 4A6OA 1TVGA 4CDXC 4R9AA 1F4HA 2EIMC 1LESA 5JMCA 2GMPA 2GUZB 1GN4A 2VG9A 3BTAA 2C9AA 3I2JA 2DUPA 4Q26A 3DPRC 3P1IA 4C0HA 2IJJA 1YIPA 4UW6A 1VBC1 2VUJA 1STMA 4K1YA 5FZKA 5T55A 1UW8A 5EYYA 4CCNA 1N1TA 2ZAHA 4JPRA 1VQNV 3HMYA 3NAPC 2GN3A 3TB0A 3E83A 2JK5C 5LA9A 2QGNA 4B3MB 3JB4C 3UT5A 2Y60A 5FP3A 1O4YA 4D6TH 4IGOA 3OGIB 2Z79A 2VZQA 4DUVA 3D36A 3O1VA 1JMKC 4ISRA 4QXHA 3LNMB 3JSLA 3FUQA 5EYXA 1MVQA 4XDLA 4K0KB 5CBFA 4GMP0 1OPOA 2Q5ZA 4JV5O 3A21A 1SQXH 4QE7A 3RI8A 1YI7A 3K5LA 5FUPA 5JCTA 2WWWA 3RRDA 4ZS2A 5A7WB 4AGGA 3G6EV 2DVBA 3AG2B 1WW4A 3VD7A 1Z5VA 3CRAA 4PLNA 4GB33 3VBUA 2BGOA 1J84A 1SQQH 3FYEB 3ZN0A 2W1WA 4FPOB 2IZWA 3I2FA 1U5ZA 4YW1A 3AKRA 1C8M3 2X7RB 5C8WA 3UYJA 5BV6A 3HQXA 2BFUS 3LOBA 4CH4A 4DV0O 4XQDA 1LRHA 3DTUB 3ETEA 3LDKA 1P84F 4MW8A 1FJGB 4EN0A 3WG3A 1Y6XA 2R49A 1M4UA 4C1WA 3BPZA 3M3QA 2BSKA 4MGTA 4ZIBA 1K3EA 3SJBC 5LA0A 4W4KA 2P17A 2QQKA 5A3NA 3ZRWA 5BNPC 4MGZE 1YHFA 3K51A 3RSJA 3B94A 3AK1A 4U3JB 4I3PA 3ABKC 5HPOA 1OC1A 1RVF1 1LJ7A 1CIWA 3IDBB 5LK7B 4R9DA 4P2ZA 1LOGA 3G7DA 3PTRB 4RFT0 2EIGA 1WPBA 2JG9A 2CE4A 3E6DA 3BU0A 2ILMA 2ZBJA 2RS51 5I0DA 3BKZA 2OCCC 3WQ0A 1ULEA 3VBOA 1W9FA 4JAUA 1OVSA 4GYCB 1VB4A 1Y9QA 5J2TB 5CBLA 2Q6AA 1ROPA 1PO21 4OXSA 2YDEA 1V6KA 2QCSB 5E89A 4FPJA 3P3NA 1FXVA 5I8TA 4JTDB 2PHRA 2JG8B 4Y22A 4EWAA 2XJPA 1H2SB 1DZRA 4AGVA 3MIFA 4ASKA 2YG0A 3MF9A 2JECA 2F66C 4ASUG 1E79G 3MBWA 1B09A 2XBO1 3RVYA 4RQPA 4E4DX 5FPBA 5GW7A 2VOTA 5A2QN 2D6LX 5JOZA 2FMDA 3ZKUA 3RI9A 4WBNA 4UOJA 4P08A 1OA3A 3P3PA 5C4WB 1Y4WA 2R061 3WW4A 2YEVB 5HCFA 1YQ5A 2KXLA 1H6XA 3B93A 2ZXWB 1F4NA 5JJEB 4J25A 4NHMA 1H8HG 2A3XA 1M93A 3POGA 3I3EA 1RUC2 3AXEA 5A70A 2Q7GA 1C3HA 3LIHA 1E5IA 1YQ2A 2JDAA 1QU7A 5L7OC 2PF4E 3VBFC 3U4SA 1Z78A 1OOPC 4CCEA 2BU9A 1WD3A 4CDQB 5H9RA 3SEEA 2WLJA 3CJXA 1S72V 3Q8CA 1HP8A 4QKBA 4K8XA 3O0WA 2ZEWA 2JGDA 5T5JA 2NR5A 4UF0B 1JOYA 1OKQA 2OYQA 2Y69C 4FTSA 3FLRA 5IWFA 1UKGA 3KGZA 1IHMA 1NZ6A 2QM7A 1XNCA 5KHGA 4DRXB 2FQPA 5A7OA 3I55V 5DN2A 1UOGA 2VXJA 3WY6A 4A7KA 2DYSC 2MEV3 5B1BC 2GP3A 4LFBO 3E8GA 5IWAO 5IYDO 3VDCA 3ZFGC 3UCSC 4O4HA 4TV9A 1UQXA 3E35A 1COV2 2B7YA 4Q0SA 1S1AA 2CU5A 4UUJC 1EM1A 1QEXA 3WZ1A 4FVVA 3NNMA 3LQCA 3FKSG 2XB6C 4PLOA 4ZU7A 2VMDA 2WLLB 2N7GA 1WKYA 1MS1A 4Q27A 5F5AA 2WA4A 5LYJB 5BPXA 3IGAC 4LF7B 5CA0B 1HXS1 3IPVB 1WD4A 4AI9A 4ZS3A 4H3WA 2OPWA 2XR4A 3ZPYA 5C71A 3U11A 1PO13 3DGTA 4DV7O 4QB1A 3OEAA 1MSDA 1SLBA 1ZREA 3K77A 1WLEA 1HRV3 5FKCA 2QNKA 1G9AA 4YFWA 4FM0A 3GHNA 3NO8A 5BMVA 5EBWC 2BJSA 2GC1A 4DUYB 3DV8A 3VZLA 4JYAO 2ZE7A 1D4M2 3EQEA 1DK1A 4DR7O 1NBMG 4JYYA 4LFCO 1WB8A 2PHWA 4O2BB 2LGQA 1IPSA 2FYUH 4TV8B 1QLEB 1PGL1 3ZSKA 3B01A 3IDAA 2WYSA 4M3CF 4KWJA 4XF9A 2WKKA 1GKFA 1AVBA 1ZYBA 2EJ7A 2J1VA 5DMYA 4RWUA 5C8CB 2Q8CA 3C3SA 4O4JB 2JE8A 4LBQB 4KH9A 4YW7A 2C5DA 5LASA 3VKNA 2ITCC 4IL6Z 3KWVA 5FYHA 3BB6A 1SBEA 3FLPA 3KVBA 2VU9A 4JV5B 1OF4A 2YBSA 2C0ZA 3L74H 4TWKA 4Y3OA 3W7UA 3IB3A 2SLIA 1VBE1 1RMU2 5C3QA 4LKSA 4I0XA 2Q4PA 3E22A 3OEHG 3B9IA 4Q4X2 4DRRA 4OX9B 3SXWA 3HJRA 1S5HC 3DECA 2ZOEB 5J3UA 1R081 1REFA 4XURA 1YIJV 1APNA 1K5MC 2JICA 4QKFA 1ZZ9A 3SPHA 4LCUC 3IMNA 2WO3A 2WZPP 1F5FA 4MSWC 3I3MA 1HIXA 2F4PA 4HNAB 5GLZA 1KFUL 1JU3A 4OQ9A 5A33B 2Q67A 2QQMA 1CPNA 2QM4A 1IQAA 4Q2FA 2E32A 1O4ZA 5GZCA 2IU3A 1ND2C 3U0ZA 1L1FA 3CJIC 4N7UA 4JI4O 4XQ4A 4DW0A 5EIBD 2BOJA 4HVQA 2DWDC 1SLIA 4XBFA 5FZ0A 3L9JT 5FMDA 1W6PB 2EINB 2E6VA 2DCTA 3JSNA 3K3OA 4CXWA 4A41A 2QQVA 3VKOA 3ZX6A 1ENRA 3NQHA 4YVSC 4J7KA 3D0SA 2EXHA 3GGLA 3TRSB 4X1YB 2LTNA 1GUIA 4PV1B 4FQ4A 2B5HA 3N9QA 4LLOA 3RZMA 1RUG1 5FXXA 4CTEA 3JD71 1W6OB 1ZZBA 2BWAA 1W0NA 5GLVA 3THTA 1UX6A 2HWF3 5LY1A 1NTMH 1OURA 2QKAA 5IFTA 1BK0A 3AYDA 1IGOA 1PVC3 4HK9A 2CGOA 2XKOA 3T2QA 3VBHC 4KHPO 3TCUA 1KP2A 2WIIB 4UW4A 4P30A 1GQPA 4DXZA 4NPLA 2N04A 4BAYA 3OGSA 3J26N 3K4ZA 1JOPA 4LKDA 3LEIA 4A5UB 2ARHA 2O57A 3WNLA 5EJ3A 3W7TA 2FB5A 2WN3A 1JUHA 3PTYA 1I0HA 5JJNB 3CB2A 3K0GA 1VQLV 3WB0A 3NRUA 2IJKA 2EILC 2QWOB 1BHBA 1E5SA 4UFJA 3M3CA 2ES3A 4PIYA 4LHLA 1VBD2 3E2EA 2A6VA 4DR4O 4IEXA 1FPN1 2UXDB 2JDUA 2W08A 1BEV3 1WMEA 3T1HO 1MZ5A 1DZTA 4FO9A 5E1AC 1IBLO 1EAH1 4GMP1 4ZU5A 2C24A 2W94A 1BBT3 2P06A 1F9KA 4HAMA 1NA1C 5L19A 2VOWA 2GBOA 1E5HA 1H4HA 5F5CA 3OGCC 1ULFA 4EN6B 4J7ZA 1JHNA 1JUIA 5J7MA 1NCQB 5FNVB 4AFAA 2PI5A 2LGWA 1V6LA 1BLZA 3R6SA 4LNUA 2QKCA 1FFXA 2R071 1IKPA 3ZFFA 2BTQB 4MVRA 1UY0A 3BGAA 4AEDC 4Y24A 4RGAA 1BQZA 2CDPA 3RMXA 3ZHVA 4R50A 4UXNA 2RS33 1CAWB 5JIUA 5FYBA 1W2BU 5KXDA 1GZWA 1PNKA 5JCOC 3CP1A 4WVWA 1GYKA 1H2LA 2JE7A 2VPVA 3I5DA 4NXNB 2OS2A 3EHKA 1FXHA 3U75A 3VBSA 4I2OA 1GOGA 1ZA4A 4QPIB 2EA7A 3JZVA 4IERA 1WCQA 1U5IA 2K2SA 2ZGKA 4DOUA 1AR71 1W2TA 4Q4W3 2JS3A 1KRIA 4YIOA 4IV1A 3RYCB 5HV4A 1PP9H 4M4RA 5BNOC 2AHYA 1M06G 1VQ5V 2TNFA 2R32A 3MHZA 2F17A 3K3WA 3O0VA 3STLC 2A3QA 4FFGA 1V6JA 4P9LA 3MZHA 3F7YC 1I5ZA 5JR2A 3JATB 3CPWU 3N2KB 4MHRA 5J9PC 1W0PA 4DNYA 4PI2A 2X09A 4M4PA 1KUQA 3GWKC 3T2PA 4BOWA 4JDNA 2ADQB 1CIYA 4JI5B 1K4DC 1H8TA 4Q4Y2 1JZ4A 3DXTA 3EO6A 4NKGB 2X10A 4CP9B 1AXZA 2PUSA 2ZKNA 4MVMA 2UU9B 3E6CC 1S0VA 1JMUB 1BQPA 3T2OA 4E4HA 2W9XA 5B1OA 1GTOA 1ZX5A 5AC92 4LTAA 1MZFA 4DV5O 1UKRA 1Q7YW 1VALA 3DC6A 1GZ9A 1EV12 1VF5B 2NQYA 5JVDB 1ZA7A 1QVGU 2XVKA 5CISA 3CD6V 2CAVA 4ZXKA 1HW7A 1VF6A 2VM9A 3BALA 2QWRB 2GNDA 1PGW2 4FOYA 2BQPA 3AEIA 5J1XA 4NE9A 1MS5A 4RHV1 1WCDJ 1LOFC 4GKKO 1XJAA 3B02A 3DCQA 1W8ZA 5FZOB 3O9OA 5LATA 4HPKA 1HR0O 1FNZA 4A3XA 5FTTC 3WDVA 1OPMA 3LDRA 1UY2A 4O7XA 2P4KA 5BUVA 2ZHMA 1O7FA 4NTYA 5IVJA 3T0BA 4LOTA 1AP5A 4CDUB 4GH4C 4IHJA 4JGYA 2VCCA 5FYIA 3HPNA 1LR5A 5A3MA 1OI6A 4X9QA 3OMIB 3ZYGA 4RO2A 4UW3A 5GALA 4XAAA 4XUTA 1WAZA 2XDVA 5FCCA 4MG2A 3I2GA 2D93A 4YW5A 2C2AA 4BQXA 1N36B 4S2GA 4YLZA 2WAOA 3SYOA 1R3LC 2LW8A 2W3JA 2ZJCA 5BNNA 4X8PA 5J48A 2Y34A 1IBKO 1WMDA 5FY1A 2OIGA 3I2IA 3K2OA 4B8EA 1JPXA 4CCCA 2D3PA 4RR3C 5EBLC 3ZN6A 5FLHA 1QJU3 4CPBD 3KCCA 4LLFA 1VBB2 4OPHA 4BXFA 3NNGA 4ORFA 2E3CA 2YXYA 1QQP3 3AKSA 1K5JA 5J37A 4UFKA 1LHNA 5A3TA 3K5OA 5FXZA 2ZD9A 1SLLA 3ZMVA 1V9PA 1MQTB 2ZACA 4A2UA 5CB4A 1DHKB 4XEZA 1ZBE2 4XXPA 2XQXA 3AB0A 3G4SV 3H1YA 3T30A 3QBQA 2ZHNA 4PI0A 1R1A3 4AQ2A 4YY3B 1GMGA 1W8OA 1JTZX 3CZJA 3SCHA 4QT6A 1Y74B 1TVKA 3MLLA 3BRCA 5AG2A 1GICA 3I59B 5I93A 2VBDA 2UU8A 1F35A 4ZHQA 4MADA 5C5TA 2ZKLA 5KMGB 4LORA 4DV6B 3BOWA 2RM22 1OCCC 1VQ6V 2ZR3A 5J98B 4PDLA 1RUH3 4H37A 1RJ7A 1D5AA 3LZZA 3SYPA 4OI0A 1X59A 1UYXA 1KJLA 2LO1A 2Q7HA 2D3RA 3W20A 4S2DA 2VZOA 1ZRFA 3OCPA 2Y26A 1GM9A 4FFHA 3T1HB 3BA9A 4PA3A 1HRI2 3E89A 4DR1O 3Q8FA 4Q4V2 3JALA 3AVRA 4LBLA 1FXZA 4Q29A 2ZGQA 4PDWA 3RYIA 1WLDA 4JCKA 4N43B 3FB7C 5I0RA 1JZ7A 4LF5O 4JI6O 3RVZA 2HWD2 4QX0A 3I54A 1AX0A 1NE6A 5D1IA 5D8AA 3G80A 4WZFA 3U07A 3NW4A 4JZGA 2GC0A 1PMJX 3WP3A 1VBA3 3VDDC 4TXWA 4IT5A 3FB6C 4N53B 1L3JA 5D21A 5F5IA 5A3LA 1K8AW 3AP6A 3SH4A 4AQYO 2DDUA 5JVVA 1BCXA 1LHVA 4PIXA 4O9GA 5IJRA 3ACFA 2VBBA 5JIAA 5T5LA 2LP7A 2FCTA 1PNGA 3M8LA 4UCTA 3IIIA 2Y38A 5JXHA 2Z2SB 3LSEA 1SZXA 1S0EA 4D8MA 4PDRA 2HWC3 1QDOA 3MAQA 4INDA 2D97A 5JAXA 1A6CA 3WF2A 1AVMA 4F6EA 2Y0PA 2ET1A 3RS6A 3NXSA 4ATEA 2ODMA 1OHFA 3JASA 4C91A 1VIBA 2YBKA 1COWG 2Z69A 2AH2A 3WDUA 3S6PA 2WQ8A 4UV8A 1DQ5A 5CBHA 1C28A 1FKAO 4TSFG 4WV8A 2W1UA 2XAQA 2DBIA 4B4PA 1SLAA 1WA8B 3FAVA 3MW4A 3B40A 1JZ2A 1XBFA 3AX4A 4Y4RA 3ZEDA 4JI7B 3ACGA 1YCIA 1VAMA 2Q9LA 2Z3YA 3QTCA 4C7UA 1S0DA 1RUC1 4Q6GA 1LHOA 3WNXA 1OLQA 5FQ0B 1TMF3 4BR6A 2EVXA 3MEPA 4IDZA 4QX1A 3SHRA 4UYBA 3LIGA 2BVBA 4QX2A 3AG2C 1N8RW 1QBZA 4LE3A 4IETA 4NTXA 2ZX2A 1PZ8A 4MS2A 1RUJ3 4BW5A 5H2FZ 5CU1A 1PK6B 1SFYA 5GLWA 4A44A 4XFCA 4Z2WA 5JJJB 3T1YO 3TEXA 2Q1MA 2YUEA 5K0UA 4YM2A 3ZXDA 1PIV3 1GSLA 2WNEA 4YZ1A 1FMD3 1PM7A 1RXGA 2D43A 4A7ZA 1BE3H 5DEDA 3EXUA 1YFUA 2OVUA 5FMCA 5KHHA 2AR6A 5I0TA 1AR1B 3RYHA 4BE3A 2VVEA 4OHVA 1QU0A 1R093 1YUDA 4NRQA 1OLME 3RG0A 2GNMA 1NAEA 4UB6Z 5F3CA 5FYVA 2GSYA 2YI9A 3ZMZA 4WVVA 1TME3 4BLIA 1C1LA 2QQIA 5FYUA 3WDWA 5LWBA 3SKVA 2A06H 2A75A 1VP7A 4NROA 1VQ7V 5FPUA 1B3QA 5CG9A 1ZVFA 5FZCA 2HHHB 3ZYRA 4A3ZA 5F6LB 1X4TA 4NJ4A 3FMGA 2A9HA 1IZ3A 3B3QE 3ZDVA 4WFEA 4AVAA 1M1KW 4X66O 4UWDA 3ZBHA 5FKBA 2X5IA 4FVMA 4BQWA 4ITCA 1IDSA 4CDXB 2J1UA 4AYUA 4GKJO 2HKXA 2DV9A 4LBNA 3S5QA 3ZXKA 1QNWA 1KQRA 4XHXA 1D4M1 2FDHA 4JDOA 3DPRB 3JU9A 4O61A 3GM8A 2XHKA 2W6JG 3UM7A 3OR6C 3LB9A 2IM9A 5C4WC 5EYPB 1YXWA 1DLCA 2Q0OC 1IURA 2RS13 3NAPB 2TBVA 1Z7S3 5FZBA 4PT6A 1QLNA 3HQUA 4QXKA 4GA9A 2MEV2 3S30A 3O1OA 4CH6A 2JD4A 3JUUA 4XZUG 4EROA 5KHJA 1YZBA 3NMBA 4NWVA 3S3WA 1X50A 2JS5A 4DV1B 5DUWA 1QVFU 4J7JA 1S2BA 4DV4B 2JDZA 2R9RB 4JGZB 3ZFEC 1RC6A 5BYNA 3OFNG 2JIJA 2DJVA 1V9U2 3VHNA 2E9QA 4EJRA 4XPVA 4ONUA 3I2HA 2RDQA 4URTA 2UYAA 1SQBH 4XFFA 4OHWA 3ZYFA 2OTLV 5FZFA 4GKYA 1RMU1 3JARB 2NM1A 2FBEA 4FPCA 4KG0A 2BNNA 5EZYA 3PHMA 4ZXEA 1RUE3 3SMHA 1DDLA 3OD4A 3QO8A 2WFPA 2HVJC 2AREA 4MGYE 1AI7A 1XI1A 1VBC3 1U0AA 1PO12 2OYZA 2CDOA 5A7WA 5DQ0A 1HRV2 1IX9A 3CC4V 5CMUA 1WA4A 3R4UA 2WL1A 2NYYA 3M3OA 2UURA 4XUNA 1UWWA 2R1BA 3CCEV 5F5QA 1SA0B 1RUF2 5BNPB 4DXWA 5KAIZ 2VUAA 1HNXO 1NU1H 4LF5B 5K9YA 1B35A 3ABKB 1N47A 1NZIA 2QUOA 1BJQA 3CQOA 4GT1A 3ZHQA 5FZMA 3AG4C 3PUQA 4QGLA 2XAJA 5DZEA 4P00B 4DR5B 2Y33A 4HKOA 1P7BA 4JRAA 5JI7A 1WCKA 3CJHB 2WQ4A 4U3JA 4LBOA 3T1MA 3ZIXA 3M7AA 5BR8O 3CIHA 1X33A 3ON7A 4M3CA 2IBZH 5IT9N 1PMHX 2QE3A 3G6JB 4BM8A 3IWZA 4BIZA 2YU2A 1QJX3 3ZVXA 1RTVA 1FD9A 4AFBA 1U5XA 2CAUA 3OYWB 3M1HA 2HP8A 5J2TA 2JB8A 1TAEA 3OTOB 1QLEC 4BISA 1R6TA 1WLTA 2GDSA 1SDDB 4I55B 3I8TA 4ICGA 4I4TA 4TTGA 1NI8A 3CXHF 5EBMC 2JG8A 4B3TB 4FJCC 1SG3A 2UY9A 1BMV2 2YC2A 2YYOA 4IIJB 4JI8O 2W6IG 4IEWA 3PNAA 2EALA 1XEQA 2QE7G 1KJRA 3AP5A 5FK8A 3H8OA 2P67A 2YIAA 4F7ZA 5HCAA 4MVSA 4ASLA 1UZ0A 2YEVA 4UB8Z 1W3XA 3MLKA 1PGSA 4EYUA 2WUHA 3O5SA 5LEJA 3VBFB 3MHSC 1OOPB 2QDRA 1RUI3 2KR2A 5T54A 4OHYA 4L92A 3MIHA 3VBRB 1SQVH 1VBD1 4D94A 1YRZA 4HN1A 2FMYA 1PD3A 4AWDA 3VDBA 2WJSA 3KHCA 3PUAA 1VF6C 3SYCA 3LSDA 2QBXA 3HKCB 1LCLA 4N9IA 2Y69B 4XDQA 1NOVA 2QQUA 2F43G 1XILA 3HKEB 3QVNA 2XBO3 3LEMA 3AL6A 4B7KA 5DAVA 1UXXX 5FLXN 4EEQA 3L9DA 4NPRA 3POYA 1UZZA 2R063 3HPLC 2TUNA 5LMNO 3ZFGB 1HB2A 5FLJA 4BCUA 1AR82 4F3JA 1Z2GA 1K97A 5C7GA 2WINB 2UXCO 4DRXA 4MGKE 3AG1C 1JI6A 3ACIA 2BBVA 3WHUA 2WWJA 2HWF2 4FOVA 2UY8A 3WF1A 1V6IA 2ZXQA 5C6CA 2R72A 3H1LH 1W6QB 4IEUA 1PHMA 4IYHA 1PVC2 2KM2A 4Q0UA 2P4EA 3ZSJA 4LT5A 1MSWD 1O9GA 5IK8A 4CRQA 3WG7C 1KFXL 1RHI3 1S76D 4HN0A 2JENA 2XLAA 5E6HA 3E1F1 1IPKA 4O2AB 3MV11 4MTFA 1WMFA 4LBJA 1ULCA 1ND3B 1QH7A 4FPHA 5LYJA 1DGLA 3DGEA 2HEPA 5CA0A 4CXYA 2EF6A 1GNZA 3IPVA 4DXSA 5IYZB 4QHOA 4XYXA 1RUOA 4X66B 1RUD3 3ZRXA 5LZ6A 1X9TA 2E5LO 4AFDA 4QDRA 3C8XA 2Q4SA 4MYEA 3PVBB 3ZCCA 4W50A 1O4TA 1SKVA 3HWJA 3NR7A 2OZJA 4DUZO 2HLEA 2A7AA 1JN2P 1BEV2 3N9OA 2ZZQA 1W8HA 2VS0A 5FY8A 4JI2B 2D6KA 1AF9A 3O1SA 1EP0A 3JD1A 1CAVB 1JX9A 3ICXA 1UYPA 4OCTA 3PUHA 5EXOA 4B3RB 3V0AA 1PPJH 3USUB 4WVZA 3WG2A 5FZHA 1H2GA 4UFZA 1ZRIA 4Q4Y1 4PA9A 3DXRA 3IKWA 3BODA 2CAZC 1HB1A 2WSVA 3GDBA 4ISQA 2IC1A 3UETA 4FZ1A 4NRMA 1QDCA 1UX7A 2XAHA 1MS3A 5C8CA 2VTXA 3CCJV 2UWCA 2DE0X 4YNIA 5AC91 3KD4A 1LENA 4O4JA 4CDWB 2ARBA 1EV11 3E8FA 4X6RB 2XUMA 1PMIA 5FY4A 4XC9A 3BAAA 5EV7A 4CSWA 1BHGA 4E4ZA 5HV0A 3VD3A 1UY4A 1REDA 4A42A 2KG7A 4TLFA 4QPGA 4LFAO 1PGW1 5SV5A 4Y1ZA 1OCRC 4TUYB 1PZ9A 2DFBA 2P3KA 2VZ1A 2GZWA 1J3QA 3PDQA 1QNMA 3B8NA 3GJBA 4IEOA 2BTVC 4QU2A 2YGLA 4NOTA 2WA3A 4AQ6A 3N7MA 4ARYA 2ZPXA 4V1PA 3OBZA 2ZGMA 5IJ0A 3HR0A 3CRQA 3UJOA 2EIBA 3PJQA 4Z2AA 4YZ2A 4A7YA 1ENVA 3CCSV 4ES8A 4EFEA 2DVAA 2CTQA 2R1DA 1AJNA 5SV8A 2QZ3A 5IJ9A 4DR6O 3GYDA 2PXJA 3CC7V 2IXCA 4P9WA 1UN1A 3S7EA 2WFF3 5CEHA 1AHSA 4Z1MG 3ACLA 4XJ8A 1W6NA 5I8SA 4MO3M 4HNAA 2XOKG 3PVNA 3HVDA 5A33A 4K40A 1PM9A 4Y26A 1VBE3 3E6BA 4TQDA 4YIPA 1W28A 1SMVA 2RR12 5IYCO 1O5UA 4RUEA 2O0OA 4EN7B 3A0BZ 3GCXA 1L7LA 2WAMA 3SDLA 1S0GA 3WG1A 2R043 4LWSB 1K73W 1PVXA 1AR5A 3DC5A 3CC2V 3V0BB 4FLZA 5FWEA 3QO7A 2XOMA 2JDIG 4YZ4A 4YGDA 1CZTA 1A3KA 1DF0A 1VBB1 4BJ0A 4OFGA 2DW4A 1XQNA 5ACA3 5B4NA 2Q69A 2ZMKA 2QDOA 2PLV2 3VLBB 4MH0E 1QIQA 1R3KC 3MICA 3VBHB 5C8YA 4AI8A 3CMAV 4L97A 1TGOA 1XYNA 1AI4A 3N2GB 4YVWC 3LUTB 2HYXA 2FL4A 1N34O 3H1KH 4IV3A 4KGGA 4EN8B 1ZBE1 2VQUA 4UBHA 1LUVA 3K3NA 1YC61 2Q30A 2A7WA 3A8TA 5D5QA 5EQUA 3ZYJB 3LA3A 5C3SA 1ZZCA 2WN2A 3IMMA 4QDSA 3SPCA 1OLRA 2EILB 2J42A 3F2ZA 3SLIA 4N23A 2GTAA 2KA3A 4FBFA 5FBZA 2PHXA 4MXWA 3CCQV 2WC2A 2BTOA 4RGGA 5FYYA 1RUG3 3H8XA 3WCSA 2VVDA 3ILRA 3U4XA 2IH1C 4LO7A 1W90A 3JD73 3MFCA 3CDZB 4Z8BA 4DR3O 2AW9A 3ASOC 2VTXJ 5GZGA 4WVMA 4AHCA 1AROP 1GU3A 1VIWB 2NLJC 4CUGA 5KBFA 4NR1A 3LDCA 4KBBA 1DLBA 1HRI1 3IT8A 5CZKA 2O8QA 4YYOA 4K7JA 1NA1B 1UNBA 1YI9A 2JJ6A 3BHPA 4Q4V1 1D7PM 2ZKOA 5EWSA 4UV9A 3CCLV 3VBBA 5IE9A 2W95A 5FUNA 2YHJA 4FLTA 1X9PA 3OPWA 1N33O 2HWD1 4H7LA 3TOJA 2AENA 3P6BA 4E27A 5ABJC 1QJU2 1XNAA 1HX6A 1Y4MA 4LKFA 4ZZ8A 4IESA 3AMPA 1G9CA 4CDUC 1IG3A 4XETA 3HNYM 4AEDB 4QE9A 1QQP2 1NCQA 1QJY2 1JYIA 5C5UA 3HBKA 4LNVA 4GD4A 1QHDA 2VZRA 2YS8A 1X8EA 3CRRA 2BTQA 1Z5WA 3ECQA 5LRRA 3W7WA 1ZRCA 2EXJA 5D5PA 4PIZA 4PJ0Z 1R1A2 1CR7A 2GN7A 1CAWA 4RGKA 2VW0A 4Y5Z0 1EAH3 1Q81W 4J41A 5EP9A 3NV2A 4IEQA 2JX9A 2RQ6A 4P9PA 1YNAA 1V70A 1N1VA 4X8AA 4X62B 4CU7A 5BNOB 4Z07A 4P5YA 2UUBO 5A7NA 4QPIA 2OT5A 1RUH2 1QR8A 2QWQB 2ZE8A 5TSWA 4EWDA 1SLTA 2QSAA 3MPPG 4JV4A 4X88A 4QXBA 2DBNA 1MQTC 3NV4A 1GAXA 4QQ2A 2IWGB 4QXCA 1LGNA 3K4DA 1H8EG 2PMWB 2BUKA 4D6RA 2LUWA 4ATFA 1WW6A 1XNDA 3K79A 3U14A 3WNKA 2J22A 5C93A 3AZXA 3DKQA 3JATA 1VMHA 2DTWA 3AMMA 3T3YA 3GZUC 1WWYA 3VQWA 4MV2A 1U12A 2V1DA 5CBGA 3LA2A 1CAUB 3WG4A 4YG6A 3K9SA 5IAVA 2PELA 3BTYA 1EBOA 2GNBA 1K7DA 1TEIA 4FIPC 4XFHA 5F2SA 2HJDA 4OI2A 3LDBA 4QPJA 3KQ4B 4AHXA 2QQWA 4FP3A 1MPXA 2ETNA 2B1GA 3KV9A 5CKQA 4DV2O 2GMEA 1AR73 3J4UH 1GV9A 3FJSA 5H6RA 4LF6O 1W2NA 1SETA 1HNZO 4CP9A 1TZOA 1NQDA 3EMRA 2CWMA 4V2WA 1RSOA 5FY0A 1XMOB 3K75B 4R7CA 2G9GA 1I3HA 2E26A 3VZNA 2EAKA 2ADDA 2XL9A 2ZX1A 4YGBA 1VMJA 1AYM2 5IVFA 5FL7G 2BSKB 1D2QA 2O8OA 2P6CA 4QKDA 3T2TA 5JVDA 1HNWB 3CRMA 4RN5A 4R4ZA 1GK9A 1XE0A 2GSMB 3N7LA 2LM3A 2UUAO 3SPJA 3WOGA 2VXRA 4TQFA 1C5IA 1R3JC 1XU2A 2GDFA 1JZ3A 2V72A 3URFA 1GR3A 1D2DA 2YXLA 2HWE2 2XVLA 1AJPA 1I94B 5FZOA 2JG9B 3RZZA 5JI9A 3SYQA 4N53C 1N32O 2ZQMA 1I1EA 1W8WA 1H1IA 1VF7A 5FYSA 4CA9A 2EZPA 3UKMA 1H4GA 1WN7A 4HK8A 5CFCA 4LH6A 4I9QA 4OZOA 5JXIA 2VQ0A 4RAIA 2ZGPA 1OHHG 2ITDC 2F4VO 2AYHA 2VR4A 1Y76B 5BZBA 1FV2A 4XDKA 3HIFA 5LA6A 1G8WA 1XNRB 4AGRA 3LFIA 2EICA 4Y22B 1NVPD 2Y0OA 2DCYA 1KXGA 4I50A 2D3SA 4W4LA 5CFDA 1TMF2 4GIQA 1MABG 4LEJA 3HBZA 3BABA 4YZ5A 5IK4A 1CX1A 4RHV3 2J1RA 5A3WA 3AK2A 1FOD2 2UXBO 4HFSA 3DN7A 5B3SC 1DU3D 1RUJ2 3H8RA 2HJFC 4RR3B 3MDPA 1AX1A 5KLVH 1GZCA 2VUCA 4FCAA 2B9UA 1PIV2 1JFFB 1IBMB 5IVEA 3E8BA 1Y9MA 4LC1A 3P5BA 1V54C 2R70A 3D3IA 3MI8A 2D6NA 4JQTA 2MEV1 2VTFA 4ET7A 1H30A 2GHYA 3FB8C 1KECA 1AR93 2RMU3 5FZGA 3W58A 5CIRA 1VQKV 1KC8W 5KWRA 2XJVA 1NG0A 2XG3A 5JDBA 5FO7B 3KHBA 2VNGA 2Q73A 4IEVA 4IE7A 2N74A 3CO2A 1R092 4WM7C 1MMMA 1H9PA 3POJA 4QX3A 1LULA 2A79B 1AR62 2Y6KA 2QM8A 3ABZA 2WZR3 3K46A 1TME2 2DU1A 2RMKB 2JGDB 1V9U1 4EE2A 3AL5A 5KXBA 2K46A 4XACA 1AJQA 5B1NA 1LB2A 3THOA 1EZVH 1SS3A 1OCCB 1IG0A 2ADPA 5F2WA 4XJWA 4FFIA 4HANA 5JOWA 3PU3A 3I56V 4X89A 4IE0A 1K42A 3BEHA 3T4ZA 4QDQA 1Y74A 1J5EO 5IUQA 1MS0A 3I59A 2WNVA 1UPGA 2VQEO 2RN9A 4I5SA 4DR2O 1PO11 2HYKA 4FPGA 4R9CA 4TV9B 2WZ8A 4JVAA 3WCRA 3OBAA 1HRV1 4LULA 1OD5A 4L8QA 2DF7A 4CEYC 2DVFA 5FPAA 3X2QC 5JSPA 4LOSA 4X64O 4QAWA 1ZUQA 5FUIA 1SCSA 2H8PC 1RUF1 2RJZA 2D2CB 4CP1A 1PKXA 1IXBA 1CZSA 4FXGB 2PYLA 1D4VB 4LF8O 4LITA 3RYFA 4YJ2B 2X6AA 5HFMA 4BXSV 1SBDA 3VDDB 5CKMA 1NVPB 4BW9A 5FXWA 1DP0A 4JZRA 3RNSA 4LF9B 2BFUL 1QKQA 3H3LA 5FLIA 1FXKA 4MTXA 1YEWA 4FTEA 1WP7A 3QH6A 3OT7A 3WNNA 5FOJB 4AR2A 2W68A 4RS5C 5BMVB 5JOXA 4AOCA 2W87A 1JYCA 4OUMA 4XJZA 3UESA 1CP9A 2PN5A 4XUQA 3MPBA 3HNMA 1XNKA 1R64A 4PELA 4NVPA 1UOJA 1PX3A 4LF4B 1MEC3 5T5PA 3BN6A 4MVZA 1OH4A 2VCMA 4CPBA 3MIEA 3V64A 3O65A 2P22C 3RZGA 1RUE2 2ZDIC 1SPPA 1YYNA 1SC5B 4GAZA 1AI6A 5FY5A 4BIOA 4RQEA 1H8VA 1QF3A 1JQ0A 4LIVA 2EIKB 3ZIWA 4YPJA 2R0FA 4XMAA 4W8JA 3SPGA 1BMV1 1ULPA 2VMGA 1HN1A 3BUCA 3OMAB