4KLTA

Dna polymerase beta mismatched product complex with mn2+, 30 min
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
326
structure length
314
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTTKQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Observing a DNA polymerase choose right from wrong.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 104
structure length 314
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4kltA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4kltA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4kltA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4kltA03
1S9FA 4RQ0A 4FHYA 4KITB 3MDCA 2R8JA 1MC8A 3UXOA 2MAXA 4QZBA 8ICIA 1EXNA 4M6WA 1SL1A 1X9SA 4RPZA 4F4KA 2ZHAA 3SI8A 4O3PA 3RR7A 4Q45A 4P4MA 4DOBA 4DFKA 5KFNA 3OV7A 8ICEA 2J6SA 1ZQWA 4QWBA 3JPPA 3GV8B 1S0MA 8ICNA 2DRBA 3T5LA 1XSPA 4NLZA 4AT9B 1BPEA 7ICGA 3FDSA 4IQUA 5IIOA 3MGIA 4ECUA 1ZQCA 4JK1A 4M2YA 9ICLA 4F8RA 2KN7A 1SL2A 2XY6A 2IA6A 8ICGA 8ICYA 4O3NA 2MUTA 3UPSA 2BGWA 3Q8KA 4UAZA 2BQUA 4ECZA 3Q8QB 1Z3EB 4P4OA 5J2DA 4ATBB 1F5AA 4S3NA 2BKEA 3RRHA 2PXIA 3AQKA 4AT9A 3HJ4A 5C5JA 2HVIA 1NK5A 4Z6FA 5DB9A 3M8SA 4UB4A 3T5HA 4YQWA 4XA5A 4FHXA 4JV2A 3MDAA 2W9CB 2NRXA 5DQGA 5CJ7A 4F5OA 4I2EA 4DOAA 3PX4A 5IIMA 1MIWA 3GIKA 4DL2A 3BQTA 2XC9A 1ZQJA 1D9FA 5IIJA 5J2JA 1ZQVA 5F9LA 4R63A 3OJUA 1XSNA 1T3NA 4F2RA 5KFIA 3H38A 3UXPA 3MR5A 5J2IA 2AQ0A 3RB6A 4RT3A 3V7KA 1ZYQA 5KFAA 1LB2B 1SKRA 2P66A 4QW9A 1T4GA 2FPLA 3K4GA 4QWEA 4ED8A 8ICHA 2NRWA 4C8OA 2JZBB 2FLPA 4AT7A 5KFDA 4HYKA 1JXEA 2BR0A 1NKCA 2PFQA 3ZDDA 4IR9A 3IHQB 1BNPA 2HHWA 1MIYA 5J2FA 1JAJA 5HRGA 7ICQA 8ICRA 9ICGA 2ZH9A 4YFKA 4IQWA 4C8LA 5KFUA 3EPIA 2LYHA 4DSEA 5EOZA 4WC1A 5KFQA 5J2EA 3HP6A 4F5RA 4I2HA 1TAUA 4GC6A 4O3OA 3AUOA 4DSFA 4M9HA 9ICRA 1BVSA 5DQIA 7ICTA 1JMSA 1PZNA 4MFFA 5J0OA 4YCXA 2DPIA 3FYHA 1JN3A 4RUCA 3RR8A 4O9MA 1NKBA 3GIMA 4DFPA 3T3FA 4KLIA 2XGQA 4RZRA 2ZH4A 2NRVA 2JZBA 4UB2A 1ZQKA 4I27A 5HRKA 5L1LA 3WFQE 4I2CA 4C8NA 3ETLA 2M9NA 4YD1A 5KFSA 3ZDEA 4IQTA 3HX0A 1L3UA 3H40A 4TUSA 3TFSA 5HHIA 5L1KA 1S97A 4QZFA 2HHUA 3V6JA 1KLNA 3C2MA 2R8KA 4M0AA 2DPJA 2JEIA 3WFPA 3RJJA 1NO5A 4RQ8A 5HRBA 4E0DA 2IHMA 2V9WA 4ELUA 4J9RA 2ALZA 4PPXA 4XQ7A 4JV0A 3H8JA 4M9GA 2DR7A 3C1YA 2M2WA 5KFWA 3ISCA 3V6HA 8ICZA 4O3RA 4TQSA 4DF4A 2NRTA 3JPOA 3PVXA 3TANA 2PBEA 2FPKA 1ZQMA 4YMOA 4XQ8A 2ASLA 4F92B 3QZ7A 4YG2A 5DKWA 4PHEA 4F4WA 1BPBA 1JXLA 8ICPA 5J29A 7ICVA 2ZUBA 4RU9A 2BCQA 2HW3A 4YXJA 1FA0A 4XRHA 4BWJA 7ICHA 4X4QA 1Y88A 2ZH1A 4IQVA 5J2KA 1ZQRA 1ZQTA 4MFCA 1SKSA 4NKTA 4PGQA 2ZUDA 2BHNA 4I2IA 5KFKA 5KFYA 8ICJA 4WC3A 3V7LA 3KHHA 3WFSC 5HMLA 2BCUA 4X4NA 3RJHA 3HWTA 2UVVA 1UEVA 5DBBA 2XY5A 3IM1A 3MABA 4B9UA 4KLFA 5KFJA 4PHPA 4KMUA 1DOQA 3SZ2A 2DR8A 2H5XA 3ZDAA 3M8RA 1L5UA 4YVZA 4JWMA 2M2TA 4KLMA 1NZPA 3G6YA 4WCWA 4QZEA 2HHVA 9ICNA 1X9MA 1NK9A 5L9XA 1TK5A 4DL4A 3TAQA 2W9BA 3H39A 1NK8A 4AT8B 4M47A 1WOTA 4B9LA 4EBKA 1KNYA 3TI0A 5KFBA 5KT5A 4R65A 4J9OA 8ICTA 1R89A 1A76A 4YMMA 1TFRA 2ZH5A 1DK2A 3THVA 4KLUA 1TVAA 5IIKA 1MIVA 3C18A 4RQ5A 2KZZA 2F1IA 5J0TA 2RDJA 1MQ3A 3GQCA 3C66A 4NLKA 4KLHA 4MEYA 5IIIA 4WBZA 4KN7A 1ZQQA 4K4HA 5J2AA 4FHWA 4Z6DA 1NKEA 1X2IA 1UA1A 2FLNA 5DB7A 3Q8LA 4EEYA 4NM2A 4X4VA 2V4RA 2XCAA 1NK0A 3EPGA 9ICMA 5HMMA 1RZTA 2ZHBA 4P4PA 5KT6A 3GV5B 7ICKA 4JUZA 4O3QA 4DF8A 4J9NA 4IRDA 4X0BA 3JPQA 2FMPA 4X0AA 1ZQLA 3OVSA 2NRKA 2AGQA 4I2JA 2Y1JA 1SZPA 3B0YA 3RBDA 1WCLA 5J0QA 2J6UA 2MUTB 2ZJ8A 4YN4A 2UVUA 3Q8PB 3ZDBA 3OHBA 2IHNA 1K1SA 7ICPA 3MR6A 4EBEA 4JWNA 3NYBA 1KFSA 4FHVA 4I2AA 4WC5A 4ED1A 1SKWA 2BPFA 1Q78A 4C8KA 1UA0A 4QZHA 5DLFA 4DSKA 2DR9A 8ICOA 3PR4A 1JIHA 3H4BA 2VA2A 4G3IA 2O5AA 9ICVA 4X5VA 4UAWA 2PFOA 4M04A 3OVAA 1ZJNA 2ZH6A 3C21A 4DSLA 5KTQA 5KFOA 4IRCA 5J2GA 5DQHA 4QZ9A 4EBDA 1KTQA 1TK0A 2UVWA 4LVSA 5KFXA 2BCVA 5D46A 4NLGA 1UETA 4I2BA 1JQRA 5KG3A 4QWDA 2XGPA 4UD5A 2ZH3A 4ZH4A 4KLTA 9ICWA 5DECA 4F5NA 3RJIA 3C2LA 4RPYA 4ECXA 4JV1A 2W9MA 4YP3A 3PR5B 4I2DA 8ICCA 3HJ1A 2FLLA 1NOMA 4LZDA 3TQ1A 8ICXA 2I1QA 5KFZA 1NJXA 2W8LA 4KLEA 9ICJA 2DFLA 5HHHA 3TARA 4DL7A 2R8IA 4EZ6A 5KFGA 2HHTA 4ED0A 3MFIA 4ED6A 1L3TA 1ZJMA 1COOA 4CCHA 3LQCB 4J9MA 2AU0A 2A1JA 2ZUCA 5BOMA 5BPCA 4DSJA 3E2EA 4DS5A 5DDMA 2PFNA 2Q0ZX 4TURA 1T7PA 2IBKA 5HRIA 4M6WB 3PW7A 2AQ4A 4I2FA 2KZMA 4DQPA 5KFMA 3PNCA 3BJYA 3UQ0A 3QE9Y 1TK8A 3SV4A 2BDPA 4B9SA 3OUYB 4B9MA 3EZ5A 5CR0A 4R66A 3AU6A 4KLLA 3HT3A 4Z6CA 2BCRA 5BOLA 1R8CA 4GC7A 3RAQA 3QEAZ 2ZH2A 4GXIA 1ZQGA 3WFOA 1UT5A 4RWQA 4UBCA 3BQ1A 2VA8A 3TFRA 3HIYA 2UVRA 2BPCA 3MR2A 2C2DA 3EWAA 5J2BA 5DGBA 3H8SA 4BXOB 9ICOA 7ICOA 3OHAA 4RQ7A 2BQRA 4Q8EA 2HHXA 5EWGA 2I9GA 2V4QA 1TV9A 4DQIA 5DB8A 4O5CA 3GILA 2ID1A 3AQLA 4WBYA 4RWNA 4YR2A 1TFWA 8ICFA 3MBYA 3AQNA 9ICHA 3RB4A 1A77A 3PV8A 1ZQAA 4F5PA 3RTVA 1PX5A 1UT8A 2A1JB 3NGDA 4KLQA 2HHSA 3ISDA 4J9LA 1BPZA 4ECWA 2AJQA 3LWMA 5HC9A 3ZD9A 2KZ3A 4KTQA 5KFPA 2KTQA 4BGDA 5KFTA 7ICIA 9ICXA 1Z00A 4KLDA 4F5QA 1L3VA 4LT6A 3EW9A 1IM4A 1S0OA 1XU4A 2C2EA 1XS9D 4DWIA 2C2RA 8ICAA 4F4YA 3HW8A 3H3AA 4AT8A 2DRAA 9ICSA 5CA7A 1N56A 1BPDA 4O5KA 4EYHB 4PGXA 1TAQA 4B9NA 8ICQA 3H37A 3RB3A 3MGHA 4KLGA 5CHGA 4FS1A 1U4BA 2PI4A 4M5DA 7ICUA 4UB3A 2ZTCA 4RWPA 3C5FA 3BDPA 1HJPA 3PX6A 1U49A 2ISOA 4QZGA 4I28A 4KLSA 7ICRA 3HPOA 4R8UA 5CB1A 5L1JA 4M9NA 4F4ZA 2KFNA 9ICKA 1VJ7A 1IXRA 3GDXA 3M9OB 4EBCA 2ZTDA 3V6KA 5J0XA 4YD2A 3ZD8A 2HHQA 1KFDA 5HR9A 4MEXA 3PY8A 4Q44A 4E8FA 5J0RA 1ZQUA 8ICKA 3RH4A 2WTFA 1KRPA 1QLNA 4E7XA 5KFFA 2ZH8A 5J0WA 3UPQA 3PW5A 4ELTA 4IR1A 1AROP 1KEJA 1ZETA 4X4TA 1S76D 3ZDCA 5KT2A 7ICNA 2PFPA 1ZQDA 4ECTA 2P6RA 3JYYA 4DLEA 4EZ9A 3LDAA 4DQQA 1BGXT 2BCSA 4QZ8A 3Q8MA 2IMWP 3RH6A 4ELVA 4KLJA 5HRLA 3JZ0A 1D8LA 1HUOA 2J6TA 4PHAA 7ICSA 1NJZA 9ICBA 3LWLA 4YR3A 2R8HA 4F3OA 4J9KA 1HUZA 1KFTA 4WC2A 1X9WA 2W9AA 2ZJAA 1BNOA 2PI5A 1ZQNA 3L9DA 4YMNA 4MF8A 3N4MB 4DL3A 1RPLA 4M9JA 4WC0A 4RNNA 3RB0A 1XO1A 3OSPA 1NK4A 5DGAA 1ZQFA 4BDPA 7ICMA 4RNOA 1ZQZA 4MF2A 1KDHA 5TZVA 1NK7A 2NRZA 4ECQA 2JEFA 3RJEA 4TQRA 5KFRA 2KFZA 4EBJA 3OGUA 3RJGA 4TUQA 5F9NA 5KFEA 4QZAA 2W8KA 2BPGA 4M9LA 4RPXA 4Q43A 4ED7A 3H4DA 2XCPA 1QSYA 1L3SA 3K75D 1CEZA 1TFYA 5J2HA 3PW2A 3OUYA 5KT4A 4K4GA 2XO7A 3RAXA 4QW8A 1MQ2A 4XUSA 3ISBA 3M9NB 8ICWA 2M2VA 4NM1A 4RQ2A 2HHPA 2F1HA 5KG5A 4UBBA 2C22A 1OU5A 3AQMA 4RNMA 1JX4A 2RDIA 1ZQEA 3G6VA 8ICMA 8ICBA 4J9PA 4UB1A 2M2UA 5KT7A 9ICQA 5EWEA 3GV7B 3KHLA 1WCNA 3Q8SB 1RYSA 9ICIA 9ICEA 4LZGA 1QTMA 4I29A 1ZQPA 1UEUA 5IINA 2FPMA 4RQ6A 2JEGA 4J9SA 1C7YA 3WFRE 2ZJ5A 3GFKB 1Z00B 1QSSA 9ICCA 2DR5A 2P6UA 2Y1IA 4B9VA 2BQ3A 1CUKA 3T5KA 4O0IA 1D8YA 4NKUA 3TAPA 4DO9A 4GXJA 4ECRA 1S0NA 4NLNA 4I2GA 1R8BA 5HP4A 5JUMA 4QZIA 4FS2A 5KG6A 3QEBZ 1YLQA 4FHPA 5J0PA 3MR3A 4DLGA 4P2HA 5DDYA 5CP2A 4PH5A 3GIIA 5J2CA 4DOCA 5IILA 3PO4A 3RRGA 1T8EA 3C2KA 1S0VA 9ICPA 2KP7A 4Z6EA 4FH3A 4WC6A 5HRFA 4F91B 3JPNA 5KFHA 1ZQOA 4F50A 4PGYA 3C1ZA 4DSIA 1V9PA 4DL6A 1R8AA 1ZQIA 7ICJA 4RQ3A 5HRHA 1N48A 2C28A 4ECYA 1U48A 3OSNA 5DG9A 4O5EA 3BQ2A 4GXKA 3KHGA 9ICFA 4RQ4A 4YR0A 4R64A 4O3SA 5CWRA 2W9CA 1XSLA 2DVIA 7ICFA 1VFGA 2O1PA 4RQ1A 3Q8RB 4WC7A 3BQ0A 2BE3A 3SYZA 4X4UA 3G6XA 1K1QA 4DS4A 3PX0A 3C23A 4FO6A 1H38A 3AU2A 1D9DA 1MSWD 3N97B 8ICLA 5D49A 4FH5A 4ATBA 8ICVA 1RYRA 3JPRA 2RFFA 2XY7A 4QWCA 2F1JA 1U45A 2B21A 3H8WA 3EYZA 2GWSA 2VANA 1U47A 1BPXA 4IRKA 9ICTA 5DG7A 3M9MB 4UQGA 2AGOA 4IG8A 2VA3A 4DFMA 2FMQA 4EP7A 1DK3A 5D4BA 4C8MA 5L1IA 3KHRA 4J9QA 3H7IA 1XWLA 5KFVA 4R8UB 5J0YA 3V72A 3RBEA 1ZQSA 3LK9A 4ED2A 1NJYA 1RXVA 5J0SA 3B0XA 2R8GA 4F2SA 5DG8A 4UB5A 4KN4A 4DEZA 5DB6A 4X4SA 4NY8A 2FMSA 5DEDA 4F4XA 4DQRA 4DL5A 1ZQBA 2ASDA 1XC9A 4ECVA 1S77D 4X4PA 4UAYA 2ZH7A 4F93B 3PW0A 3RJFA 3C5GA 4BWMA 5J0UA 3JPSA 1B43A 3T5JA 1KSPA 3KTQA 4B9TA 4FBTA 1TKDA 5DBCA 4ECSA 3MFHA 3PW4A 9ICUA 3UQ2A 3RH5A 1B22A 3ORYA 4Q8FA 4AT7B 2AGPA 5KFLA 3QZ8A 5HNKA 3JPTA 7ICEA 3GIJA 1DGSA 4NXZA 5KG2A 5DBAA 5KG0A 1NK6A 3PMLA 1LV5A 4E80A 2ISPA 1Q79A 5F2VO 4X4RA 5DLGA 4PHDA 4QWAA 4RUAA 4MFAA 3PMNA 4K4IA 9ICAA 4RT2A 1ZQHA 8ICSA 2ATLA 1S10A 1NJWA 8ICUA 5HRDA 4RWOA 4X4OA 3NTUA 4EYIB 4DQSA 4YXMA 1RXWA 3RJKA 4FBUA 1ZQXA 1U9LA 4UD4A 5KFCA 7ICLA 4WC4A 4GLXA 4KLOA 3V7JA 2HVHA 1V4AA 4QZDA 3OJSA 2OWOA 1SL0A 5KG7A 4ED3A 4TUPA 4BXOA 2ZTEA 1QSLA 3OVBA 5KG1A 2W9BB 2Q66A 3UXNA 2JEJA 4QZCA 2ASJA 3PO5A 3SV3A 5HREA 4DFJA 1BPYA 5EWFA 5KT3A 1ZQYA 5KG4A
chains in the Genus database with same CATH superfamily
4FHYA 4K99A 4A8EA 8ICIA 2P35A 1J2MA 4M6WA 4F4KA 2ZHAA 4AYBF 4DFKA 5KFNA 1M6YA 5CFSA 4IS7A 4QWBA 3JPPA 3M7DA 1S0MA 2KK0A 3FDSA 1ZQCA 5IIOA 2W11A 4JK1A 1SL2A 1UPHA 2XI9A 2BGWA 4UAZA 4CDGA 2O6KA 3RRHA 4AT9A 3HJ4A 5C5JA 2HVIA 4Z6FA 1RQLA 5DB9A 4YQWA 4XA5A 4F5OA 3PX4A 5IIMA 4QNLA 4BX9C 3BQTA 1ZQVA 4R63A 3H38A 4F71A 5KFIA 3UXPA 2XVTA 5J2IA 4RT3A 3V7KA 5KFAA 1LB2B 1SKRA 3ERCC 4QWEA 1FFUA 4MKPA 2NRWA 4C8OA 2JZBB 5AM0A 1SV0C 2E8PA 3H0LB 5KFDA 1NKCA 4IR9A 2YB4A 2I6XA 4LEVA 4EX6A 2HHWA 1JAJA 4RQNA 4US8A 5HRGA 4C8LA 3EPIA 2LYHA 4DSEA 3QUBA 3HP6A 4F5RA 9ICRA 1JMSA 4QIWF 2YTUA 4MFFA 2WFAA 2KD1A 1JN3A 2ODGA 1NKBA 2XGQA 2ZH4A 4UB2A 1ZQKA 4B6JA 1PVQA 2M9NA 4TUSA 2R8KA 2JEIA 4NLBA 3WFPA 2VIXA 2ALZA 5J8YA 4XQ7A 1UCVA 3I76A 4JV0A 3H8JA 5L1MA 2M2WA 2AHOB 3ISCA 2KOBA 3TANA 2PBEA 1ZQMA 4F92B 5DKWA 5J29A 2BCQA 4XRHA 3CRXA 1WWUA 4X4QA 3NVOA 1SKSA 1SXDA 4NKTA 5FP0A 2BHNA 8ICJA 1P7DA 5AK6A 4WC3A 3V7LA 4C7ZA 1B0XA 3HWTA 2XY5A 3MABA 2K4EA 2EH9A 4B9UA 3HJEA 3HILA 3ZDAA 2OYYA 4YVZA 3F2CA 9ICNA 1TK5A 3TAQA 5CFUA 3IG8A 1WOTA 4EBKA 2K89A 2DKZA 4R65A 4HAIA 5AI0A 5EE1A 2IHOA 1TFRA 3THVA 4RQ5A 5J0TA 2B51A 3C66A 3E0FA 4KLHA 4MEYA 5IIIA 4O3MA 3UMGA 4K4HA 1WYGA 4Z6DA 1X2IA 3PZPA 2BBJA 4LEZA 3M1YA 1NNLA 1NK0A 9ICMA 5HMMA 2ZHBA 5KT6A 7ICKA 4JUZA 4DF8A 3OVSA 4J9NA 4IRDA 2NRKA 4I2JA 2Y1JA 5J0QA 2MUTB 3CK6A 2FJ6A 3Q8PB 3OHBA 4EBEA 4JWNA 1KFSA 2BPFA 4C8KA 1UA0A 2DR9A 3QUCA 1ZRNA 2UVWA 4QZ9A 4LVSA 2PKEA 1UETA 2CPRA 3RJIA 3C2LA 4ECXA 2LHTA 2W9MA 5AM1A 3QX7A 4YP3A 3PR5B 4LZDA 4QJFB 3TARA 4EZ6A 5KFGA 4CF5A 1KQQA 4J9MA 2AU0A 1ZXIA 2A1JA 3DV9A 3NRWA 1S5LU 3AQEA 4NL9A 5DDMA 1T7PA 3PW7A 3BJYA 2Y9TA 3SV4A 4B9MA 5CR0A 4R66A 3HT3A 3ETRA 4Z6CA 3OTQA 5BOLA 5CHEA 3WFOA 3TFRA 3BQ1A 3WK9A 2BPCA 5ALFA 2C2DA 2ZIXB 2I9GA 3MCRA 4O5CA 4RWNA 1RDFA 3JZ0A 1A77A 4F5PA 4P0PB 2A1JB 2WF8A 4ECWA 3D2QA 3ZD9A 5KFTA 4OAGA 4LT6A 1L3VA 3H8MA 4C4TA 1S0OA 1XU4A 2ZXHA 3H3AA 4ICAA 2F3NA 2WF5A 5CA7A 1N61A 3AMZA 4B9NA 3MGHA 2OH2A 4KLGA 1PVPA 4Y2PA 3C5FA 1DGJA 1RM6C 4KLSA 4QZGA 3PSFA 5EE9A 5ALVA 4Y2XA 5L1JA 2KFNA 4O67A 1IXRA 4EBCA 3M9OB 4YD2A 5HR9A 4MEXA 3PY8A 3QU2A 3SD7A 3OWGA 1ZQUA 8ICKA 5KFFA 3UPQA 3PW5A 4LJXA 1O08A 5KT2A 2MA1A 2OEHA 1ZQDA 4ECTA 5JU5A 4DQQA 3NVZA 3GU3A 2J6TA 4PHAA 5AKJA 2JH1A 1HUZA 4WC2A 1ZQNA 3N4MB 1MA7A 4BDPA 1NK4A 1ZQFA 4PL1A 3RJEA 4TQRA 5KFRA 1X66A 2HSZA 4TUQA 5KFEA 2W8KA 4M9LA 4ED7A 3H4DA 2XCPA 5J2HA 5KT4A 2XO7A 5AIAA 4NM1A 2HN1A 2F1HA 4UBBA 3ED5A 2PMZF 3AQMA 4RNMA 1JX4A 3BZCA 8ICBA 2PMZC 5EWEA 3H0MB 3KHLA 3Q8SB 1RYSA 4KB6A 1QTMA 1OXJA 4EX7A 4RQ6A 3HKZC 3SEIA 2ZIVB 3WFRE 3IDWA 5G5GA 3LVWA 1Z00B 2DKXA 4O0IA 3TAPA 4DO9A 4GXJA 1S0NA 4I2GA 5HP4A 5AM5A 2KG5A 5KG6A 5J0PA 5K4LA 5DDYA 5CP2A 5J2CA 3WK6A 1T8EA 2KP7A 1ZD5A 4WC6A 5HRFA 2IOFK 1ZQOA 2EWRA 4F50A 5AI9A 4DL6A 1L7PA 5HRHA 4FO1A 4ECYA 4O5EA 3MC1A 4YR0A 4O3SA 2W9CA 5KNIA 7ICFA 1XO0A 1VFGA 4RQ1A 1QQ7A 3B9JA 3BQ0A 1H38A 3PX0A 2H3IA 8ICLA 2QB0A 4UAUA 2RFFA 3SR6A 2XY7A 4QWCA 1U45A 3EYZA 1YZ6A 9ICTA 2HOFA 2VA3A 1X42A 5D4BA 2E8MA 1XWLA 5KFVA 1ZQSA 3LK9A 1RXVA 5DG8A 5GTHU 4KN4A 2FMSA 2AXTU 1XC9A 4X4PA 4ECVA 1LKYB 4F93B 2W7PA 4BWMA 4FBTA 1TKDA 5AKZA 3RH5A 1X6JA 4AT7B 2AGPA 1RG6A 3UM9A 3GIJA 1NK6A 1N62A 3WKAA 4QWAA 5HRDA 4X4OA 1NJWA 8ICUA 2BBHA 1ZD4A 1SWVA 3UMBA 1ZQXA 3RJKA 4FBUA 3TACB 1V85A 3V7JA 1V4AA 2E5SA 3KZIU 2Q66A 3PO5A 4DFJA 1BPYA 4YR3A 4RQ0A 4KITB 1UHUA 4RPZA 3IRUA 4CF3A 3U26A 3K1RB 3RR7A 4UW9A 4DOBA 2E1FA 2HBKA 8ICEA 2J6SA 2F8KA 1L8OA 4UATA 1XSPA 4AT9B 7ICGA 3JCFA 1ZD2P 4IQUA 4ECUA 4F8RA 4JMUA 4O3NA 4K96A 2R18A 2BQUA 3Q8QB 5J2DA 3AQKA 2D8CA 4WQLA 3M8SA 4Y2UA 4UB4A 3T5HA 4OJLA 3MDAA 2NRXA 4DOAA 1MIWA 1ZQJA 5J2JA 1T3NA 3MR5A 3NRZA 2NV3A 1ZD3A 3VC8A 4QW9A 1T4GA 2FPLA 3K4GA 4ED8A 3EUB2 2ZG6A 2FLPA 4AT7A 4HYKA 2VJ5A 3H0RB 5ALLA 1MIYA 1YZ7A 4J03A 3ALRA 4JLZA 1LKYA 8ICRA 9ICGA 2ZH9A 4IQWA 5KFUA 1A6SA 2CN1A 3DEEA 2YMLA 4I2HA 4GC6A 4O3OA 3AUOA 3QU7A 5DQIA 2GA9D 1PZNA 5ALPA 4K98A 4EV6A 2DPIA 4O9MA 4DFPA 4I27A 5HRKA 2KICA 5JTIA 4OJPA 3F2DA 5KFSA 3HX0A 2N1RA 2WF7A 3V6JA 3C2MA 4M0AA 3RJJA 2E8OA 4RQ8A 4E0DA 2V9WA 3D2SA 5KL1B 2H3FA 5AK3A 3ER9B 2WF6A 3FAHA 2YX8A 4M9GA 1KW4A 5B3QA 4NXTA 4DF4A 3JPOA 1N60A 1UQVA 4OAIZ 3QZ7A 1JXLA 4YG2A 1BPBA 3LVVA 7ICVA 2ZUBA 2HW3A 4YXJA 4C4SA 1ZQTA 2WB1C 4I2IA 3KHHA 4EEDA 5F3XB 5DBBA 5E79U 2Z7JA 2G09A 4PHPA 3M8RA 1L5UA 4WJ3B 3A0BU 2YN4A 5HR7A 3H39A 1VLBA 1NK8A 4AT8B 4CNQA 4B9LA 3D6JA 3TI0A 5KT5A 1A76A 4YMMA 2ZH5A 3C18A 5IIKA 2WHEA 2RDJA 2KIVA 1MQ3A 2B56A 4NLKA 1ZQQA 4X4VA 2XCAA 1QCKA 2W3SA 4P4PA 2CXYA 4O3QA 3JPQA 3KBBA 2JV3A 3RBDA 1FO4A 7ICPA 2IHNA 3MR6A 4FHVA 2Y9UA 1SKWA 5ALNA 8ICOA 3PR4A 2VA2A 3SAHA 2PFOA 2H3VA 2ZH6A 4DSLA 5D62A 3N7PD 4IRCA 4X0BA 5KFXA 5D46A 1N63A 5KG3A 2XGPA 9ICWA 4RPYA 2FLLA 1NOMA 2W43A 5KFZA 4KLEA 9ICJA 2ZH1A 5HHHA 2HHTA 1UEVA 4ED0A 3MFIA 2F2AB 1ZJMA 4CCHA 3LQCB 5BPCA 3E2EA 4FZLA 4M6WB 5KFMA 3PNCA 1TK8A 1TAMA 2W54A 3AU6A 4KLLA 2IUBA 2ZH2A 1ZQGA 1UT5A 4UBCA 5J2BA 3H8SA 3OHAA 4Q8EA 2FCLA 5EWGA 1TV9A 1FEZA 5DB8A 1RYUA 3GILA 1PUZA 5AK4A 9ICHA 3NVVA 3RTVA 1PX5A 5ALXA 2HHSA 5B3PA 1BPZA 2Y0SF 4BGDA 7ICIA 4G9BA 2KSOB 1KKXA 2ZIXA 4DWIA 2C2RA 2A19A 1HEKA 3WKCA 4EYHB 1TAQA 5HR6A 5CHGA 4FS1A 2PI4A 1MN8A 4UB6U 3WK8A 3BDPA 1U49A 4M9NA 4F4ZA 3WKDA 2ZIUA 3R9KA 5AI5A 4USAA 4C80A 4AP9A 1SIJA 4Q44A 2DF4B 4GIBA 2MRLA 1QLNA 2ZH8A 1KEJA 3KD3A 4X4TA 5AKIA 3RFAA 3ZDCA 7ICNA 1QH9A 2P6RA 4DLEA 2BCSA 2K4PA 2IMWP 3RH6A 2ZIWA 1FFVA 2YMPA 5HRLA 2W9AA 2ZJAA 1BNOA 2PI5A 3RB0A 3AL0B 4C0ZA 1D8BA 7ICMA 1SGGA 2GH1A 1Z4OA 1ZQZA 3BS5A 1KDHA 3F2BA 2NRZA 2JEFA 4O68A 1WUDA 2BPGA 2VJ4A 2G0AA 2ZIUB 4RPXA 1QSYA 5C0YA 3K75D 3L4PA 4K4GA 5CFTA 3M9NB 2M2VA 4RQ2A 2C22A 1KBUA 2RDIA 3G6VA 2M2UA 5A0LA 9ICEA 5TISU 3BS7A 1UEUA 2OHFA 2FPMA 4J9SA 9ICCA 2B4VA 2QLTA 1CUKA 3NVWA 3T5KA 2G5IB 5ALTA 1D8YA 4ECRA 3AN1A 4OAFA 4P2HA 3PO4A 3GIIA 1ED1A 1S0VA 3RRGA 5AKEA 4Z6EA 4Y2JA 2Y0SC 2IOHA 2WF9A 5KFHA 3C1ZA 4DSIA 7ICJA 4CE6A 2KIWA 3OSNA 4WQKA 4GXKA 3NKUA 5AI6A 3WKEA 2HBJA 2L5YA 1XSLA 1PVRA 3Q8RB 3SMVA 4FO6A 3AU2A 1L8LA 1KN5A 2WAQC 2W04A 8ICVA 1F5SA 3JPRA 1T3QA 3H8WA 2VANA 1Q46A 1BPXA 4IRKA 2LKYA 3M9MB 4UQGA 2I5HA 4IG8A 4DFMA 4EP7A 5L1IA 3KHRA 2G06A 4J9QA 4R8UB 5J0YA 5J0SA 2EAMA 5D63A 4UB5A 4DEZA 1J2NA 4DQRA 1S77D 4B9TA 3T5JA 2EDUA 5AKXA 2JH7A 9ICUA 3UQ2A 3KKAC 4Q8FA 2AH5A 1N5XA 5AK5A 7ICEA 4NXZA 4OJ6A 2EZZA 3PMLA 1LV5A 1F44A 4RUAA 8ICSA 4RT2A 4RWOA 2YY6A 4OCZA 1VDVA 3NTUA 2RRDA 5KFCA 2HVHA 3OJSA 3UMCA 4ED3A 4TUPA 2ZTEA 1QSLA 4PZNA 3OVBA 3K7DA 5KG1A 1CRXA 1ZQ1C 3UXNA 3PSPA 4QZCA 3SV3A 3DDHA 5KT3A 2H3ZA 1QQ6A 3UXOA 3IP4B 4QZBA 1EXNA 1DXSA 1SL1A 1X9SA 2H3QA 3SI8A 4O3PA 4Q45A 4P4MA 3OV7A 1ZQWA 3BZKA 2DRBA 2LMRA 1FIQA 5ALHA 4NLZA 1IG6A 2F44A 4M2YA 9ICLA 8ICGA 2IA6A 3SQIA 8ICYA 2MUTA 3A0HU 4ECZA 4BJQA 1F5AA 4FZNA 2BKEA 3SAGA 4JV2A 2M0NA 2W9CB 4LEYA 5DQGA 4FE3A 4I2EA 3N28A 1D9FA 5AICA 4F2RA 3QU5A 1XSNA 3RB6A 2P66A 1ZYQA 1MIVA 8ICHA 1JXEA 2BR0A 4OJOA 2PFQA 3ZDDA 3IHQB 3QU9A 1SV0A 7ICQA 3AQFA 4YFKA 2KVSA 5EOZA 4WC1A 5KFQA 1TAUA 4DSFA 3PSTA 4M9HA 2NO5A 4F72A 4NJ8A 4YCXA 4EENA 3RR8A 2ZIVA 1LVHA 5JTGA 4RZRA 4K8VA 3KOOA 4K9AA 4I2CA 3WFQE 2HBLA 2E3TA 3ETLA 1Z1BA 1V97A 2K8BB 4YD1A 4IQTA 1L3UA 3TFSA 5HHIA 5AM4A 4QZFA 5AI4A 3M6KA 2DPJA 2QKQA 2IHMA 4ELUA 2ZIWB 5AIBA 4PPXA 2DR7A 2NRTA 3PVXA 4YMOA 2ASLA 4PHEA 4RU9A 4OO1J 5ALEA 5J2KA 1ZQRA 5KFKA 3WFSC 2KJ8A 2UVVA 3IM1A 4KLFA 5KFJA 4KMUA 3SZ2A 2H5XA 1NI3A 2HOIA 4KLMA 2QARB 5AKLA 4QZEA 2HHVA 2K60A 2EQYA 1X9MA 1NK9A 3HRDD 5L9XA 3K1ZA 2RLTA 1Q3UA 3ICXA 4IL6U 1KNYA 2WAQF 1SWWA 4J9OA 3NWIA 8ICTA 5ALSA 4BUGA 3NUQA 2ES6A 4OJ5A 4KLUA 2KZZA 2F1IA 4WBZA 1ZRMA 4KN7A 5DB7A 3Q8LA 4EEYA 2V4RA 2F76X 1RZTA 3GV5B 2JGAA 1WCLA 2J6UA 2ZJ8A 2KVCA 3ZDBA 1S8OA 1K1SA 3FC4A 4ZOHC 4WC5A 2F77X 5CRXA 4NWIA 4DSKA 4P0PA 5ALUA 2DGZA 9ICVA 4RQMA 4M04A 3OVAA 5ALGA 5J2GA 1KTQA 2BCVA 1NZBA 4K97A 4ZH4A 4KLTA 5DECA 1OW5A 3QUQA 2QARA 8ICCA 3C29A 2QB0B 3TQ1A 8ICXA 2I1QA 1NJXA 4CF4A 2DRAA 5KAFU 2R8IA 4ED6A 2LYAA 5BOMA 8ICPA 4DSJA 1J97A 3NYBA 4DS5A 1X40A 2IBKA 5HRIA 2AQ4A 4I2FA 2KZMA 4DQPA 5ALRA 3UQ0A 4MHVA 2BDPA 4B9SA 3EZ5A 4NXVA 3AM9A 4GC7A 4US9A 2W55A 2UVRA 4BXOB 1C20A 4RQ7A 2BQRA 2HHXA 2V4QA 4DQIA 2KV2A 4YR2A 1TFWA 3MBYA 5AKYA 3RB4A 3PV8A 5ALIA 1ZQAA 3NGDA 4WC4A 4KLQA 5HC9A 4KTQA 5KFPA 2KTQA 4UARA 9ICXA 1Z00A 4KLDA 4F5QA 3EW9A 4IC9A 2EANA 2C2EA 2GO7A 1XS9D 4F4YA 3HW8A 5JRTA 4AT8A 4EEBA 1N2XA 1RQNA 9ICSA 2FDRA 1N56A 1BPDA 4O5KA 8ICQA 4Y2QA 7ICUA 4UB3A 2ESEA 2ISOA 4I28A 5AKGA 2LM1A 9ICKA 2Q4TA 1VJ7A 2ZTDA 3V6KA 3ZD8A 4Y2YA 4E8FA 4GFJA 5J0RA 3LYSA 4E7XA 5J0WA 4ELTA 4C4RA 3L5KA 1PK1B 3S6JA 3LDAA 4QZ8A 1XNSA 3Q8MA 4ELVA 1HUOA 2K8CB 1NJZA 4AYBC 3LWLA 2R8HA 4F3OA 9ICBA 4J9KA 1X9WA 3TKAA 5ALQA 4YMNA 4M9JA 4DL3A 4WC0A 5ALWA 4DCCA 5DGAA 2YMQA 4PL2A 4MF2A 1NK7A 2DBYA 1HIWA 2KFZA 3OGUA 3RJGA 2YMMA 1Q8KA 4C7YA 4Q43A 2DWQA 1CEZA 3PW2A 3QYPA 1JALA 3RAXA 4WH5A 1MQ2A 4XUSA 2HHPA 1YT3A 1SV4A 4CGZA 1SB3C 4J9PA 9ICQA 3HKZF 2FE9A 4LZGA 4I29A 2JEGA 3NASA 4EGWA 1C7YA 5KL8B 2ZJ5A 1QSSA 2GAFD 2BQ3A 4NKUA 2KKVA 1AQ6A 1R8BA 2XIDA 4QZIA 1YLQA 3QEBZ 4FHPA 3MR3A 4DLGA 2JR5A 4PH5A 2O5AA 5IILA 2GOLA 9ICPA 4F91B 3WK7A 1COKA 4PGYA 1V9PA 1R8AA 1ZQIA 1VJ5A 2A1AA 1IV8A 2C28A 1TE2A 2F8LA 1PK3A 5ALJA 2JHDA 3BQ2A 3KHGA 4R64A 5CWRA 2DVIA 2OXOA 2G5HB 3WK5A 3J81j 2BE3A 1KL9A 1MSWD 2HBMA 3N97B 4FH5A 1RYRA 3N7RC 1U47A 3TADA 4UB8U 2EZXA 2A3VA 2AGOA 2FMQA 1L7MA 1DK3A 4C8MA 4KX3A 2B0CA 1NJYA 2R8GA 4F2SA 2KEYA 4NLCA 4X4SA 4NY8A 5DEDA 4F4XA 5CEHA 4UAYA 3PW0A 4I0UA 1KSPA 5J0UA 1ZOLA 2XICA 3KTQA 2D6FC 2LYBA 3F53A 5DBCA 2JMGA 3ORYA 3BS5B 5KFLA 3QZ8A 1DGSA 5KG2A 2D3DA 5G5HA 5KG0A 2RP5A 4EELA 2ISPA 4PHDA 4K4IA 4MFAA 9ICAA 2ATLA 1RXWA 4YXMA 1U9LA 2HN2A 4JLXA 4GLXA 4KLOA 4QZDA 4BXOA 2RQ5A 2JEJA 3F5EA 5EWFA 2JRZA 1ZQYA 5KG4A 2IOFA 1S9FA 1URJA 3MDCA 2BZFA 2R8JA 1MC8A 2MAXA 2GLEA 5EE0A 3NVYA 2KJ9A 1DRGA 3GV8B 4NXUA 8ICNA 3T5LA 1BPEA 4ACOA 3MGIA 2E1EA 4N7RA 2KN7A 4U7CA 2XY6A 5ALZA 3UPSA 4NL9C 3Q8KA 1Z3EB 4P4OA 3QUTA 4ATBB 2PXIA 2HCFA 5ALOA 1NK5A 2DL0A 3KZXA 4FHXA 1QQ5A 5CJ7A 3GIKA 4DL2A 4EEKA 4FFDA 2XC9A 5IIJA 5F9LA 3OJUA 1JRPA 2AQ0A 2LM4A 5ALKA 5T14A 3IG5A 1BNPA 5J2FA 1N5WA 2G08A 5D61A 1V38A 2G07A 5ALMA 4LEWA 5J2EA 3CYMA 1BVSA 7ICTA 5J0OA 2KMDA 3FYHA 4RUCA 3GIMA 3T3FA 4KLIA 2WB1F 4O6AA 2NRVA 2JZBA 5L1LA 4C8NA 2KSOA 3C28A 5J8YC 4P0QB 3ZDEA 3H40A 5L1KA 1S97A 2HHUA 1KLNA 3L3FX 1NO5A 5HRBA 4J9RA 3T79A 3WU2U 2W7OA 3C1YA 3ONNA 4P0QA 5KFWA 3V6HA 1Z4NA 4HX0A 8ICZA 4O3RA 4TQSA 5AKKA 2FPKA 4XQ8A 4F4WA 2JXJA 4Y2SA 1FA0A 4BWJA 7ICHA 1Y88A 4IQVA 4MFCA 2KNJA 4PGQA 2ZUDA 4OAHA 1GPJA 5KFYA 4NXWA 2EAPA 5HMLA 2BCUA 4X4NA 3RJHA 4PZOA 2LI6A 3F5AA 1DOQA 2DR8A 2K4IA 4JWMA 2M2TA 1NZPA 3G6YA 4WCWA 4DL4A 2W9BA 4M47A 5KFBA 1R89A 1DK2A 1TVAA 2OCEA 3GQCA 4PJ0U 3WK4A 3BQ7A 5J2AA 4FHWA 1NKEA 1UA1A 2FLNA 2RHFA 4NM2A 3EPGA 1JUDA 3RF9A 2FI1A 2FMPA 1ZQLA 4X0AA 2AGQA 1SZPA 3B0YA 5B66U 9ICFA 4YN4A 2UVUA 4I2AA 5AHXA 4ED1A 1Q78A 4QZHA 5DLFA 1JIHA 3H4BA 4G3IA 5AKHA 4X5VA 4UAWA 1ZJNA 3C21A 5GTIU 5KTQA 5KFOA 5DQHA 4EBDA 4KMOB 4NLGA 1TK0A 3OPXA 4I2BA 1L7NA 4Y2TA 4QWDA 4UD5A 2ZH3A 4F5NA 3WKBA 4JV1A 3HJ1A 4I2DA 3M6ZA 2B6GA 2W8LA 2DFLA 4DL7A 5ALYA 1L3TA 1O03A 1COOA 4XJEA 2ZUCA 2EZYA 2PFNA 2Q0ZX 4TURA 3QE9Y 3OUYB 4DFDA 1SXEA 2HMXA 1R8CA 2BCRA 2HDOA 3RAQA 3QEAZ 5AM3A 4RWQA 2LBOA 4K9BA 2VA8A 3GZFA 3HIYA 3MR2A 3EWAA 5DGBA 9ICOA 2KKPA 3EF2A 2ID1A 3AQLA 4WBYA 3E58A 8ICFA 3AQNA 3FM9A 2MSNA 1UT8A 2AJQA 7ICOA 3ISDA 4J9LA 3LWMA 1PK1A 2KZ3A 5EE3A 2NYVA 4QIWC 1IM4A 8ICAA 1A0PA 2W03A 1L7OA 1SZHA 3IN5A 4PGXA 3H37A 3RB3A 2OM6A 1U4BA 4M5DA 3KKAA 2ZTCA 4RWPA 2KHVA 1X9XA 2LPEA 1HJPA 2BDUA 3CW2C 3PX6A 7ICRA 3HPOA 4R8UA 5CB1A 1CI4A 3GDXA 5J0XA 2YB1A 2CRXA 2HHQA 4FZMA 1KFDA 3RH4A 2WTFA 1KRPA 4IR1A 1AROP 1ZETA 4CRXA 1S76D 3CNHA 3AEVA 2PFPA 1X6IA 3JYYA 4EZ9A 1BGXT 5AM2A 2E8NA 4KLJA 1WG8A 1D8LA 7ICSA 1KFTA 3L9DA 4UAVA 4KX5A 4MF8A 1RPLA 4NV0A 4RNNA 3SENA 1XO1A 3OSPA 4RNOA 3PHZA 1JROA 5TZVA 4ECQA 4EBJA 2MU2A 5F9NA 1ECWA 4QZAA 2YQEA 1L3SA 1TFYA 1OUQA 3OUYA 1B4FA 4QW8A 3ISBA 8ICWA 4Y2VA 5KG5A 1OU5A 1ZQEA 2EAOA 8ICMA 3SAFA 4UB1A 5KT7A 3GV7B 9ICIA 1WCNA 5KAIU 1ZQPA 4OD0A 5IINA 3GFKB 1L6NA 2DR5A 1T94A 2NO4A 2P6UA 2Y1IA 4B9VA 5H2FU 4NLNA 3TADC 5JUMA 1K5OA 4FS2A 4NXXA 1JQRA 4DOCA 3C2KA 4FH3A 2K4HA 3D2NA 3JPNA 4UASA 3QU4A 4RQ3A 1N48A 5AI8A 1U48A 2VKQA 5DG9A 2KJ5A 4RQ4A 3KFUF 3NS1A 2O1PA 1WWVA 1GO3F 5ALDA 4WC7A 4X4UA 3SYZA 3G6XA 1K1QA 4DS4A 3C23A 3PSIA 2HI0A 1D9DA 3CP8A 3QNMA 4Y2RA 5D49A 4ATBA 1IIPA 2F1JA 3MGVA 3ZI4A 2B21A 4O69A 2DUYA 2GWSA 5DG7A 5B5EU 1JI7A 1Z1VA 2QB1A 3H7IA 3RBEA 4S3NA 3V72A 4ED2A 3B0XA 2KHQA 5DB6A 2W3RA 4DL5A 1ZQBA 3IV6A 2ASDA 2ZH7A 4JB3A 3RJFA 3C5GA 3JPSA 1B43A 2DQNB 1Q3VA 2K8AA 3MFHA 4ECSA 3PW4A 1B22A 2ZXIA 3JPTA 5HNKA 1F0MA 4U6PA 3I1YA 3I28A 3VCBA 5DBAA 4E80A 1Z19A 1Q79A 5F2VO 4X4RA 5DLGA 3PMNA 3N7SC 3QXGA 1ZQHA 1S10A 3O0FA 4EYIB 4DQSA 4UD4A 4KM5A 3ER8C 7ICLA 2OWOA 1SL0A 5KG7A 4WOYA 2W9BB 2HOQA 2ASJA 5HREA 2KE7A 4GXIA
chains in the Genus database with same CATH topology
1S9FA 4RQ0A 4FHYA 4KITB 3MDCA 2R8JA 1MC8A 3UXOA 2MAXA 4QZBA 8ICIA 1EXNA 4M6WA 1SL1A 1X9SA 4RPZA 4F4KA 2ZHAA 3SI8A 4O3PA 3RR7A 4Q45A 4P4MA 4DOBA 4DFKA 5KFNA 3OV7A 8ICEA 2J6SA 1ZQWA 4QWBA 3JPPA 3GV8B 1S0MA 8ICNA 2DRBA 3T5LA 1XSPA 4NLZA 4AT9B 1BPEA 7ICGA 3FDSA 4IQUA 5IIOA 3MGIA 4ECUA 1ZQCA 4JK1A 4M2YA 9ICLA 4F8RA 2KN7A 1SL2A 2XY6A 2IA6A 8ICGA 8ICYA 4O3NA 2MUTA 3UPSA 2BGWA 3Q8KA 4UAZA 2BQUA 4ECZA 3Q8QB 1Z3EB 4P4OA 5J2DA 4ATBB 1F5AA 4S3NA 2BKEA 3RRHA 2PXIA 3AQKA 4AT9A 3HJ4A 5C5JA 2HVIA 1NK5A 4Z6FA 5DB9A 3M8SA 4UB4A 3T5HA 4YQWA 4XA5A 4FHXA 4JV2A 3MDAA 2W9CB 2NRXA 5DQGA 5CJ7A 4F5OA 4I2EA 4DOAA 3PX4A 5IIMA 1MIWA 3GIKA 4DL2A 3BQTA 2XC9A 1ZQJA 1D9FA 5IIJA 5J2JA 1ZQVA 5F9LA 4R63A 3OJUA 1XSNA 1T3NA 4F2RA 5KFIA 3H38A 3UXPA 3MR5A 5J2IA 2AQ0A 3RB6A 4RT3A 3V7KA 1ZYQA 5KFAA 1LB2B 1SKRA 2P66A 4QW9A 1T4GA 2FPLA 3K4GA 4QWEA 4ED8A 8ICHA 2NRWA 4C8OA 2JZBB 2FLPA 4AT7A 5KFDA 4HYKA 1JXEA 2BR0A 1NKCA 2PFQA 3ZDDA 4IR9A 3IHQB 1BNPA 2HHWA 1MIYA 5J2FA 1JAJA 5HRGA 7ICQA 8ICRA 9ICGA 2ZH9A 4YFKA 4IQWA 4C8LA 5KFUA 3EPIA 2LYHA 4DSEA 5EOZA 4WC1A 5KFQA 5J2EA 3HP6A 4F5RA 4I2HA 1TAUA 4GC6A 4O3OA 3AUOA 4DSFA 4M9HA 9ICRA 1BVSA 5DQIA 7ICTA 1JMSA 1PZNA 4MFFA 5J0OA 4YCXA 2DPIA 3FYHA 1JN3A 4RUCA 3RR8A 4O9MA 1NKBA 3GIMA 4DFPA 3T3FA 4KLIA 2XGQA 4RZRA 2ZH4A 2NRVA 2JZBA 4UB2A 1ZQKA 4I27A 5HRKA 5L1LA 3WFQE 4I2CA 4C8NA 3ETLA 2M9NA 4YD1A 5KFSA 3ZDEA 4IQTA 3HX0A 1L3UA 3H40A 4TUSA 3TFSA 5HHIA 5L1KA 1S97A 4QZFA 2HHUA 3V6JA 1KLNA 3C2MA 2R8KA 4M0AA 2DPJA 2JEIA 3WFPA 3RJJA 1NO5A 4RQ8A 5HRBA 4E0DA 2IHMA 2V9WA 4ELUA 4J9RA 2ALZA 4PPXA 4XQ7A 4JV0A 3H8JA 4M9GA 2DR7A 3C1YA 2M2WA 5KFWA 3ISCA 3V6HA 8ICZA 4O3RA 4TQSA 4DF4A 2NRTA 3JPOA 3PVXA 3TANA 2PBEA 2FPKA 1ZQMA 4YMOA 4XQ8A 2ASLA 4F92B 3QZ7A 4YG2A 5DKWA 4PHEA 4F4WA 1BPBA 1JXLA 8ICPA 5J29A 7ICVA 2ZUBA 4RU9A 2BCQA 2HW3A 4YXJA 1FA0A 4XRHA 4BWJA 7ICHA 4X4QA 1Y88A 2ZH1A 4IQVA 5J2KA 1ZQRA 1ZQTA 4MFCA 1SKSA 4NKTA 4PGQA 2ZUDA 2BHNA 4I2IA 5KFKA 5KFYA 8ICJA 4WC3A 3V7LA 3KHHA 3WFSC 5HMLA 2BCUA 4X4NA 3RJHA 3HWTA 2UVVA 1UEVA 5DBBA 2XY5A 3IM1A 3MABA 4B9UA 4KLFA 5KFJA 4PHPA 4KMUA 1DOQA 3SZ2A 2DR8A 2H5XA 3ZDAA 3M8RA 1L5UA 4YVZA 4JWMA 2M2TA 4KLMA 1NZPA 3G6YA 4WCWA 4QZEA 2HHVA 9ICNA 1X9MA 1NK9A 5L9XA 1TK5A 4DL4A 3TAQA 2W9BA 3H39A 1NK8A 4AT8B 4M47A 1WOTA 4B9LA 4EBKA 1KNYA 3TI0A 5KFBA 5KT5A 4R65A 4J9OA 8ICTA 1R89A 1A76A 4YMMA 1TFRA 2ZH5A 1DK2A 3THVA 4KLUA 1TVAA 5IIKA 1MIVA 3C18A 4RQ5A 2KZZA 2F1IA 5J0TA 2RDJA 1MQ3A 3GQCA 3C66A 4NLKA 4KLHA 4MEYA 5IIIA 4WBZA 4KN7A 1ZQQA 4K4HA 5J2AA 4FHWA 4Z6DA 1NKEA 1X2IA 1UA1A 2FLNA 5DB7A 3Q8LA 4EEYA 4NM2A 4X4VA 2V4RA 2XCAA 1NK0A 3EPGA 9ICMA 5HMMA 1RZTA 2ZHBA 4P4PA 5KT6A 3GV5B 7ICKA 4JUZA 4O3QA 4DF8A 4J9NA 4IRDA 4X0BA 3JPQA 2FMPA 4X0AA 1ZQLA 3OVSA 2NRKA 2AGQA 4I2JA 2Y1JA 1SZPA 3B0YA 3RBDA 1WCLA 5J0QA 2J6UA 2MUTB 2ZJ8A 4YN4A 2UVUA 3Q8PB 3ZDBA 3OHBA 2IHNA 1K1SA 7ICPA 3MR6A 4EBEA 4JWNA 3NYBA 1KFSA 4FHVA 4I2AA 4WC5A 4ED1A 1SKWA 2BPFA 1Q78A 4C8KA 1UA0A 4QZHA 5DLFA 4DSKA 2DR9A 8ICOA 3PR4A 1JIHA 3H4BA 2VA2A 4G3IA 2O5AA 9ICVA 4X5VA 4UAWA 2PFOA 4M04A 3OVAA 1ZJNA 2ZH6A 3C21A 4DSLA 5KTQA 5KFOA 4IRCA 5J2GA 5DQHA 4QZ9A 4EBDA 1KTQA 1TK0A 2UVWA 4LVSA 5KFXA 2BCVA 5D46A 4NLGA 1UETA 4I2BA 1JQRA 5KG3A 4QWDA 2XGPA 4UD5A 2ZH3A 4ZH4A 4KLTA 9ICWA 5DECA 4F5NA 3RJIA 3C2LA 4RPYA 4ECXA 4JV1A 2W9MA 4YP3A 3PR5B 4I2DA 8ICCA 3HJ1A 2FLLA 1NOMA 4LZDA 3TQ1A 8ICXA 2I1QA 5KFZA 1NJXA 2W8LA 4KLEA 9ICJA 2DFLA 5HHHA 3TARA 4DL7A 2R8IA 4EZ6A 5KFGA 2HHTA 4ED0A 3MFIA 4ED6A 1L3TA 1ZJMA 1COOA 4CCHA 3LQCB 4J9MA 2AU0A 2A1JA 2ZUCA 5BOMA 5BPCA 4DSJA 3E2EA 4DS5A 5DDMA 2PFNA 2Q0ZX 4TURA 1T7PA 2IBKA 5HRIA 4M6WB 3PW7A 2AQ4A 4I2FA 2KZMA 4DQPA 5KFMA 3PNCA 3BJYA 3UQ0A 3QE9Y 1TK8A 3SV4A 2BDPA 4B9SA 3OUYB 4B9MA 3EZ5A 5CR0A 4R66A 3AU6A 4KLLA 3HT3A 4Z6CA 2BCRA 5BOLA 1R8CA 4GC7A 3RAQA 3QEAZ 2ZH2A 4GXIA 1ZQGA 3WFOA 1UT5A 4RWQA 4UBCA 3BQ1A 2VA8A 3TFRA 3HIYA 2UVRA 2BPCA 3MR2A 2C2DA 3EWAA 5J2BA 5DGBA 3H8SA 4BXOB 9ICOA 7ICOA 3OHAA 4RQ7A 2BQRA 4Q8EA 2HHXA 5EWGA 2I9GA 2V4QA 1TV9A 4DQIA 5DB8A 4O5CA 3GILA 2ID1A 3AQLA 4WBYA 4RWNA 4YR2A 1TFWA 8ICFA 3MBYA 3AQNA 9ICHA 3RB4A 1A77A 3PV8A 1ZQAA 4F5PA 3RTVA 1PX5A 1UT8A 2A1JB 3NGDA 4KLQA 2HHSA 3ISDA 4J9LA 1BPZA 4ECWA 2AJQA 3LWMA 5HC9A 3ZD9A 2KZ3A 4KTQA 5KFPA 2KTQA 4BGDA 5KFTA 7ICIA 9ICXA 1Z00A 4KLDA 4F5QA 1L3VA 4LT6A 3EW9A 1IM4A 1S0OA 1XU4A 2C2EA 1XS9D 4DWIA 2C2RA 8ICAA 4F4YA 3HW8A 3H3AA 4AT8A 2DRAA 9ICSA 5CA7A 1N56A 1BPDA 4O5KA 4EYHB 4PGXA 1TAQA 4B9NA 8ICQA 3H37A 3RB3A 3MGHA 4KLGA 5CHGA 4FS1A 1U4BA 2PI4A 4M5DA 7ICUA 4UB3A 2ZTCA 4RWPA 3C5FA 3BDPA 1HJPA 3PX6A 1U49A 2ISOA 4QZGA 4I28A 4KLSA 7ICRA 3HPOA 4R8UA 5CB1A 5L1JA 4M9NA 4F4ZA 2KFNA 9ICKA 1VJ7A 1IXRA 3GDXA 3M9OB 4EBCA 2ZTDA 3V6KA 5J0XA 4YD2A 3ZD8A 2HHQA 1KFDA 5HR9A 4MEXA 3PY8A 4Q44A 4E8FA 5J0RA 1ZQUA 8ICKA 3RH4A 2WTFA 1KRPA 1QLNA 4E7XA 5KFFA 2ZH8A 5J0WA 3UPQA 3PW5A 4ELTA 4IR1A 1AROP 1KEJA 1ZETA 4X4TA 1S76D 3ZDCA 5KT2A 7ICNA 2PFPA 1ZQDA 4ECTA 2P6RA 3JYYA 4DLEA 4EZ9A 3LDAA 4DQQA 1BGXT 2BCSA 4QZ8A 3Q8MA 2IMWP 3RH6A 4ELVA 4KLJA 5HRLA 3JZ0A 1D8LA 1HUOA 2J6TA 4PHAA 7ICSA 1NJZA 9ICBA 3LWLA 4YR3A 2R8HA 4F3OA 4J9KA 1HUZA 1KFTA 4WC2A 1X9WA 2W9AA 2ZJAA 1BNOA 2PI5A 1ZQNA 3L9DA 4YMNA 4MF8A 3N4MB 4DL3A 1RPLA 4M9JA 4WC0A 4RNNA 3RB0A 1XO1A 3OSPA 1NK4A 5DGAA 1ZQFA 4BDPA 7ICMA 4RNOA 1ZQZA 4MF2A 1KDHA 5TZVA 1NK7A 2NRZA 4ECQA 2JEFA 3RJEA 4TQRA 5KFRA 2KFZA 4EBJA 3OGUA 3RJGA 4TUQA 5F9NA 5KFEA 4QZAA 2W8KA 2BPGA 4M9LA 4RPXA 4Q43A 4ED7A 3H4DA 2XCPA 1QSYA 1L3SA 3K75D 1CEZA 1TFYA 5J2HA 3PW2A 3OUYA 5KT4A 4K4GA 2XO7A 3RAXA 4QW8A 1MQ2A 4XUSA 3ISBA 3M9NB 8ICWA 2M2VA 4NM1A 4RQ2A 2HHPA 2F1HA 5KG5A 4UBBA 2C22A 1OU5A 3AQMA 4RNMA 1JX4A 2RDIA 1ZQEA 3G6VA 8ICMA 8ICBA 4J9PA 4UB1A 2M2UA 5KT7A 9ICQA 5EWEA 3GV7B 3KHLA 1WCNA 3Q8SB 1RYSA 9ICIA 9ICEA 4LZGA 1QTMA 4I29A 1ZQPA 1UEUA 5IINA 2FPMA 4RQ6A 2JEGA 4J9SA 1C7YA 3WFRE 2ZJ5A 3GFKB 1Z00B 1QSSA 9ICCA 2DR5A 2P6UA 2Y1IA 4B9VA 2BQ3A 1CUKA 3T5KA 4O0IA 1D8YA 4NKUA 3TAPA 4DO9A 4GXJA 4ECRA 1S0NA 4NLNA 4I2GA 1R8BA 5HP4A 5JUMA 4QZIA 4FS2A 5KG6A 3QEBZ 1YLQA 4FHPA 5J0PA 3MR3A 4DLGA 4P2HA 5DDYA 5CP2A 4PH5A 3GIIA 5J2CA 4DOCA 5IILA 3PO4A 3RRGA 1T8EA 3C2KA 1S0VA 9ICPA 2KP7A 4Z6EA 4FH3A 4WC6A 5HRFA 4F91B 3JPNA 5KFHA 1ZQOA 4F50A 4PGYA 3C1ZA 4DSIA 1V9PA 4DL6A 1R8AA 1ZQIA 7ICJA 4RQ3A 5HRHA 1N48A 2C28A 4ECYA 1U48A 3OSNA 5DG9A 4O5EA 3BQ2A 4GXKA 3KHGA 9ICFA 4RQ4A 4YR0A 4R64A 4O3SA 5CWRA 2W9CA 1XSLA 2DVIA 7ICFA 1VFGA 2O1PA 4RQ1A 3Q8RB 4WC7A 3BQ0A 2BE3A 3SYZA 4X4UA 3G6XA 1K1QA 4DS4A 3PX0A 3C23A 4FO6A 1H38A 3AU2A 1D9DA 1MSWD 3N97B 8ICLA 5D49A 4FH5A 4ATBA 8ICVA 1RYRA 3JPRA 2RFFA 2XY7A 4QWCA 2F1JA 1U45A 2B21A 3H8WA 3EYZA 2GWSA 2VANA 1U47A 1BPXA 4IRKA 9ICTA 5DG7A 3M9MB 4UQGA 2AGOA 4IG8A 2VA3A 4DFMA 2FMQA 4EP7A 1DK3A 5D4BA 4C8MA 5L1IA 3KHRA 4J9QA 3H7IA 1XWLA 5KFVA 4R8UB 5J0YA 3V72A 3RBEA 1ZQSA 3LK9A 4ED2A 1NJYA 1RXVA 5J0SA 3B0XA 2R8GA 4F2SA 5DG8A 4UB5A 4KN4A 4DEZA 5DB6A 4X4SA 4NY8A 2FMSA 5DEDA 4F4XA 4DQRA 4DL5A 1ZQBA 2ASDA 1XC9A 4ECVA 1S77D 4X4PA 4UAYA 2ZH7A 4F93B 3PW0A 3RJFA 3C5GA 4BWMA 5J0UA 3JPSA 1B43A 3T5JA 1KSPA 3KTQA 4B9TA 4FBTA 1TKDA 5DBCA 4ECSA 3MFHA 3PW4A 9ICUA 3UQ2A 3RH5A 1B22A 3ORYA 4Q8FA 4AT7B 2AGPA 5KFLA 3QZ8A 5HNKA 3JPTA 7ICEA 3GIJA 1DGSA 4NXZA 5KG2A 5DBAA 5KG0A 1NK6A 3PMLA 1LV5A 4E80A 2ISPA 1Q79A 5F2VO 4X4RA 5DLGA 4PHDA 4QWAA 4RUAA 4MFAA 3PMNA 4K4IA 9ICAA 4RT2A 1ZQHA 8ICSA 2ATLA 1S10A 1NJWA 8ICUA 5HRDA 4RWOA 4X4OA 3NTUA 4EYIB 4DQSA 4YXMA 1RXWA 3RJKA 4FBUA 1ZQXA 1U9LA 4UD4A 5KFCA 7ICLA 4WC4A 4GLXA 4KLOA 3V7JA 2HVHA 1V4AA 4QZDA 3OJSA 2OWOA 1SL0A 5KG7A 4ED3A 4TUPA 4BXOA 2ZTEA 1QSLA 3OVBA 5KG1A 2W9BB 2Q66A 3UXNA 2JEJA 4QZCA 2ASJA 3PO5A 3SV3A 5HREA 4DFJA 1BPYA 5EWFA 5KT3A 1ZQYA 5KG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S9F A;  4RQ0 A;  4FHY A;  4KIT B;  3MDC A;  2R8J A;  1MC8 A;  3UXO A;  2MAX A;  4QZB A;  8ICI A;  1EXN A;  4M6W A;  1SL1 A;  1X9S A;  4RPZ A;  4F4K A;  2ZHA A;  3SI8 A;  4O3P A;  3RR7 A;  4Q45 A;  4P4M A;  4DOB A;  4DFK A;  5KFN A;  3OV7 A;  8ICE A;  2J6S A;  1ZQW A;  4QWB A;  3JPP A;  3GV8 B;  1S0M A;  8ICN A;  2DRB A;  3T5L A;  1XSP A;  4NLZ A;  4AT9 B;  1BPE A;  7ICG A;  3FDS A;  4IQU A;  5IIO A;  3MGI A;  4ECU A;  1ZQC A;  4JK1 A;  4M2Y A;  9ICL A;  4F8R A;  2KN7 A;  1SL2 A;  2XY6 A;  2IA6 A;  8ICG A;  8ICY A;  4O3N A;  2MUT A;  3UPS A;  2BGW A;  3Q8K A;  4UAZ A;  2BQU A;  4ECZ A;  3Q8Q B;  1Z3E B;  4P4O A;  5J2D A;  4ATB B;  1F5A A;  4S3N A;  2BKE A;  3RRH A;  2PXI A;  3AQK A;  4AT9 A;  3HJ4 A;  5C5J A;  2HVI A;  1NK5 A;  4Z6F A;  5DB9 A;  3M8S A;  4UB4 A;  3T5H A;  4YQW A;  4XA5 A;  4FHX A;  4JV2 A;  3MDA A;  2W9C B;  2NRX A;  5DQG A;  5CJ7 A;  4F5O A;  4I2E A;  4DOA A;  3PX4 A;  5IIM A;  1MIW A;  3GIK A;  4DL2 A;  3BQT A;  2XC9 A;  1ZQJ A;  1D9F A;  5IIJ A;  5J2J A;  1ZQV A;  5F9L A;  4R63 A;  3OJU A;  1XSN A;  1T3N A;  4F2R A;  5KFI A;  3H38 A;  3UXP A;  3MR5 A;  5J2I A;  2AQ0 A;  3RB6 A;  4RT3 A;  3V7K A;  1ZYQ A;  5KFA A;  1LB2 B;  1SKR A;  2P66 A;  4QW9 A;  1T4G A;  2FPL A;  3K4G A;  4QWE A;  4ED8 A;  8ICH A;  2NRW A;  4C8O A;  2JZB B;  2FLP A;  4AT7 A;  5KFD A;  4HYK A;  1JXE A;  2BR0 A;  1NKC A;  2PFQ A;  3ZDD A;  4IR9 A;  3IHQ B;  1BNP A;  2HHW A;  1MIY A;  5J2F A;  1JAJ A;  5HRG A;  7ICQ A;  8ICR A;  9ICG A;  2ZH9 A;  4YFK A;  4IQW A;  4C8L A;  5KFU A;  3EPI A;  2LYH A;  4DSE A;  5EOZ A;  4WC1 A;  5KFQ A;  5J2E A;  3HP6 A;  4F5R A;  4I2H A;  1TAU A;  4GC6 A;  4O3O A;  3AUO A;  4DSF A;  4M9H A;  9ICR A;  1BVS A;  5DQI A;  7ICT A;  1JMS A;  1PZN A;  4MFF A;  5J0O A;  4YCX A;  2DPI A;  3FYH A;  1JN3 A;  4RUC A;  3RR8 A;  4O9M A;  1NKB A;  3GIM A;  4DFP A;  3T3F A;  4KLI A;  2XGQ A;  4RZR A;  2ZH4 A;  2NRV A;  2JZB A;  4UB2 A;  1ZQK A;  4I27 A;  5HRK A;  5L1L A;  3WFQ E;  4I2C A;  4C8N A;  3ETL A;  2M9N A;  4YD1 A;  5KFS A;  3ZDE A;  4IQT A;  3HX0 A;  1L3U A;  3H40 A;  4TUS A;  3TFS A;  5HHI A;  5L1K A;  1S97 A;  4QZF A;  2HHU A;  3V6J A;  1KLN A;  3C2M A;  2R8K A;  4M0A A;  2DPJ A;  2JEI A;  3WFP A;  3RJJ A;  1NO5 A;  4RQ8 A;  5HRB A;  4E0D A;  2IHM A;  2V9W A;  4ELU A;  4J9R A;  2ALZ A;  4PPX A;  4XQ7 A;  4JV0 A;  3H8J A;  4M9G A;  2DR7 A;  3C1Y A;  2M2W A;  5KFW A;  3ISC A;  3V6H A;  8ICZ A;  4O3R A;  4TQS A;  4DF4 A;  2NRT A;  3JPO A;  3PVX A;  3TAN A;  2PBE A;  2FPK A;  1ZQM A;  4YMO A;  4XQ8 A;  2ASL A;  4F92 B;  3QZ7 A;  4YG2 A;  5DKW A;  4PHE A;  4F4W A;  1BPB A;  1JXL A;  8ICP A;  5J29 A;  7ICV A;  2ZUB A;  4RU9 A;  2BCQ A;  2HW3 A;  4YXJ A;  1FA0 A;  4XRH A;  4BWJ A;  7ICH A;  4X4Q A;  1Y88 A;  2ZH1 A;  4IQV A;  5J2K A;  1ZQR A;  1ZQT A;  4MFC A;  1SKS A;  4NKT A;  4PGQ A;  2ZUD A;  2BHN A;  4I2I A;  5KFK A;  5KFY A;  8ICJ A;  4WC3 A;  3V7L A;  3KHH A;  3WFS C;  5HML A;  2BCU A;  4X4N A;  3RJH A;  3HWT A;  2UVV A;  1UEV A;  5DBB A;  2XY5 A;  3IM1 A;  3MAB A;  4B9U A;  4KLF A;  5KFJ A;  4PHP A;  4KMU A;  1DOQ A;  3SZ2 A;  2DR8 A;  2H5X A;  3ZDA A;  3M8R A;  1L5U A;  4YVZ A;  4JWM A;  2M2T A;  4KLM A;  1NZP A;  3G6Y A;  4WCW A;  4QZE A;  2HHV A;  9ICN A;  1X9M A;  1NK9 A;  5L9X A;  1TK5 A;  4DL4 A;  3TAQ A;  2W9B A;  3H39 A;  1NK8 A;  4AT8 B;  4M47 A;  1WOT A;  4B9L A;  4EBK A;  1KNY A;  3TI0 A;  5KFB A;  5KT5 A;  4R65 A;  4J9O A;  8ICT A;  1R89 A;  1A76 A;  4YMM A;  1TFR A;  2ZH5 A;  1DK2 A;  3THV A;  4KLU A;  1TVA A;  5IIK A;  1MIV A;  3C18 A;  4RQ5 A;  2KZZ A;  2F1I A;  5J0T A;  2RDJ A;  1MQ3 A;  3GQC A;  3C66 A;  4NLK A;  4KLH A;  4MEY A;  5III A;  4WBZ A;  4KN7 A;  1ZQQ A;  4K4H A;  5J2A A;  4FHW A;  4Z6D A;  1NKE A;  1X2I A;  1UA1 A;  2FLN A;  5DB7 A;  3Q8L A;  4EEY A;  4NM2 A;  4X4V A;  2V4R A;  2XCA A;  1NK0 A;  3EPG A;  9ICM A;  5HMM A;  1RZT A;  2ZHB A;  4P4P A;  5KT6 A;  3GV5 B;  7ICK A;  4JUZ A;  4O3Q A;  4DF8 A;  4J9N A;  4IRD A;  4X0B A;  3JPQ A;  2FMP A;  4X0A A;  1ZQL A;  3OVS A;  2NRK A;  2AGQ A;  4I2J A;  2Y1J A;  1SZP A;  3B0Y A;  3RBD A;  1WCL A;  5J0Q A;  2J6U A;  2MUT B;  2ZJ8 A;  4YN4 A;  2UVU A;  3Q8P B;  3ZDB A;  3OHB A;  2IHN A;  1K1S A;  7ICP A;  3MR6 A;  4EBE A;  4JWN A;  3NYB A;  1KFS A;  4FHV A;  4I2A A;  4WC5 A;  4ED1 A;  1SKW A;  2BPF A;  1Q78 A;  4C8K A;  1UA0 A;  4QZH A;  5DLF A;  4DSK A;  2DR9 A;  8ICO A;  3PR4 A;  1JIH A;  3H4B A;  2VA2 A;  4G3I A;  2O5A A;  9ICV A;  4X5V A;  4UAW A;  2PFO A;  4M04 A;  3OVA A;  1ZJN A;  2ZH6 A;  3C21 A;  4DSL A;  5KTQ A;  5KFO A;  4IRC A;  5J2G A;  5DQH A;  4QZ9 A;  4EBD A;  1KTQ A;  1TK0 A;  2UVW A;  4LVS A;  5KFX A;  2BCV A;  5D46 A;  4NLG A;  1UET A;  4I2B A;  1JQR A;  5KG3 A;  4QWD A;  2XGP A;  4UD5 A;  2ZH3 A;  4ZH4 A;  4KLT A;  9ICW A;  5DEC A;  4F5N A;  3RJI A;  3C2L A;  4RPY A;  4ECX A;  4JV1 A;  2W9M A;  4YP3 A;  3PR5 B;  4I2D A;  8ICC A;  3HJ1 A;  2FLL A;  1NOM A;  4LZD A;  3TQ1 A;  8ICX A;  2I1Q A;  5KFZ A;  1NJX A;  2W8L A;  4KLE A;  9ICJ A;  2DFL A;  5HHH A;  3TAR A;  4DL7 A;  2R8I A;  4EZ6 A;  5KFG A;  2HHT A;  4ED0 A;  3MFI A;  4ED6 A;  1L3T A;  1ZJM A;  1COO A;  4CCH A;  3LQC B;  4J9M A;  2AU0 A;  2A1J A;  2ZUC A;  5BOM A;  5BPC A;  4DSJ A;  3E2E A;  4DS5 A;  5DDM A;  2PFN A;  2Q0Z X;  4TUR A;  1T7P A;  2IBK A;  5HRI A;  4M6W B;  3PW7 A;  2AQ4 A;  4I2F A;  2KZM A;  4DQP A;  5KFM A;  3PNC A;  3BJY A;  3UQ0 A;  3QE9 Y;  1TK8 A;  3SV4 A;  2BDP A;  4B9S A;  3OUY B;  4B9M A;  3EZ5 A;  5CR0 A;  4R66 A;  3AU6 A;  4KLL A;  3HT3 A;  4Z6C A;  2BCR A;  5BOL A;  1R8C A;  4GC7 A;  3RAQ A;  3QEA Z;  2ZH2 A;  4GXI A;  1ZQG A;  3WFO A;  1UT5 A;  4RWQ A;  4UBC A;  3BQ1 A;  2VA8 A;  3TFR A;  3HIY A;  2UVR A;  2BPC A;  3MR2 A;  2C2D A;  3EWA A;  5J2B A;  5DGB A;  3H8S A;  4BXO B;  9ICO A;  7ICO A;  3OHA A;  4RQ7 A;  2BQR A;  4Q8E A;  2HHX A;  5EWG A;  2I9G A;  2V4Q A;  1TV9 A;  4DQI A;  5DB8 A;  4O5C A;  3GIL A;  2ID1 A;  3AQL A;  4WBY A;  4RWN A;  4YR2 A;  1TFW A;  8ICF A;  3MBY A;  3AQN A;  9ICH A;  3RB4 A;  1A77 A;  3PV8 A;  1ZQA A;  4F5P A;  3RTV A;  1PX5 A;  1UT8 A;  2A1J B;  3NGD A;  4KLQ A;  2HHS A;  3ISD A;  4J9L A;  1BPZ A;  4ECW A;  2AJQ A;  3LWM A;  5HC9 A;  3ZD9 A;  2KZ3 A;  4KTQ A;  5KFP A;  2KTQ A;  4BGD A;  5KFT A;  7ICI A;  9ICX A;  1Z00 A;  4KLD A;  4F5Q A;  1L3V A;  4LT6 A;  3EW9 A;  1IM4 A;  1S0O A;  1XU4 A;  2C2E A;  1XS9 D;  4DWI A;  2C2R A;  8ICA A;  4F4Y A;  3HW8 A;  3H3A A;  4AT8 A;  2DRA A;  9ICS A;  5CA7 A;  1N56 A;  1BPD A;  4O5K A;  4EYH B;  4PGX A;  1TAQ A;  4B9N A;  8ICQ A;  3H37 A;  3RB3 A;  3MGH A;  4KLG A;  5CHG A;  4FS1 A;  1U4B A;  2PI4 A;  4M5D A;  7ICU A;  4UB3 A;  2ZTC A;  4RWP A;  3C5F A;  3BDP A;  1HJP A;  3PX6 A;  1U49 A;  2ISO A;  4QZG A;  4I28 A;  4KLS A;  7ICR A;  3HPO A;  4R8U A;  5CB1 A;  5L1J A;  4M9N A;  4F4Z A;  2KFN A;  9ICK A;  1VJ7 A;  1IXR A;  3GDX A;  3M9O B;  4EBC A;  2ZTD A;  3V6K A;  5J0X A;  4YD2 A;  3ZD8 A;  2HHQ A;  1KFD A;  5HR9 A;  4MEX A;  3PY8 A;  4Q44 A;  4E8F A;  5J0R A;  1ZQU A;  8ICK A;  3RH4 A;  2WTF A;  1KRP A;  1QLN A;  4E7X A;  5KFF A;  2ZH8 A;  5J0W A;  3UPQ A;  3PW5 A;  4ELT A;  4IR1 A;  1ARO P;  1KEJ A;  1ZET A;  4X4T A;  1S76 D;  3ZDC A;  5KT2 A;  7ICN A;  2PFP A;  1ZQD A;  4ECT A;  2P6R A;  3JYY A;  4DLE A;  4EZ9 A;  3LDA A;  4DQQ A;  1BGX T;  2BCS A;  4QZ8 A;  3Q8M A;  2IMW P;  3RH6 A;  4ELV A;  4KLJ A;  5HRL A;  3JZ0 A;  1D8L A;  1HUO A;  2J6T A;  4PHA A;  7ICS A;  1NJZ A;  9ICB A;  3LWL A;  4YR3 A;  2R8H A;  4F3O A;  4J9K A;  1HUZ A;  1KFT A;  4WC2 A;  1X9W A;  2W9A A;  2ZJA A;  1BNO A;  2PI5 A;  1ZQN A;  3L9D A;  4YMN A;  4MF8 A;  3N4M B;  4DL3 A;  1RPL A;  4M9J A;  4WC0 A;  4RNN A;  3RB0 A;  1XO1 A;  3OSP A;  1NK4 A;  5DGA A;  1ZQF A;  4BDP A;  7ICM A;  4RNO A;  1ZQZ A;  4MF2 A;  1KDH A;  5TZV A;  1NK7 A;  2NRZ A;  4ECQ A;  2JEF A;  3RJE A;  4TQR A;  5KFR A;  2KFZ A;  4EBJ A;  3OGU A;  3RJG A;  4TUQ A;  5F9N A;  5KFE A;  4QZA A;  2W8K A;  2BPG A;  4M9L A;  4RPX A;  4Q43 A;  4ED7 A;  3H4D A;  2XCP A;  1QSY A;  1L3S A;  3K75 D;  1CEZ A;  1TFY A;  5J2H A;  3PW2 A;  3OUY A;  5KT4 A;  4K4G A;  2XO7 A;  3RAX A;  4QW8 A;  1MQ2 A;  4XUS A;  3ISB A;  3M9N B;  8ICW A;  2M2V A;  4NM1 A;  4RQ2 A;  2HHP A;  2F1H A;  5KG5 A;  4UBB A;  2C22 A;  1OU5 A;  3AQM A;  4RNM A;  1JX4 A;  2RDI A;  1ZQE A;  3G6V A;  8ICM A;  8ICB A;  4J9P A;  4UB1 A;  2M2U A;  5KT7 A;  9ICQ A;  5EWE A;  3GV7 B;  3KHL A;  1WCN A;  3Q8S B;  1RYS A;  9ICI A;  9ICE A;  4LZG A;  1QTM A;  4I29 A;  1ZQP A;  1UEU A;  5IIN A;  2FPM A;  4RQ6 A;  2JEG A;  4J9S A;  1C7Y A;  3WFR E;  2ZJ5 A;  3GFK B;  1Z00 B;  1QSS A;  9ICC A;  2DR5 A;  2P6U A;  2Y1I A;  4B9V A;  2BQ3 A;  1CUK A;  3T5K A;  4O0I A;  1D8Y A;  4NKU A;  3TAP A;  4DO9 A;  4GXJ A;  4ECR A;  1S0N A;  4NLN A;  4I2G A;  1R8B A;  5HP4 A;  5JUM A;  4QZI A;  4FS2 A;  5KG6 A;  3QEB Z;  1YLQ A;  4FHP A;  5J0P A;  3MR3 A;  4DLG A;  4P2H A;  5DDY A;  5CP2 A;  4PH5 A;  3GII A;  5J2C A;  4DOC A;  5IIL A;  3PO4 A;  3RRG A;  1T8E A;  3C2K A;  1S0V A;  9ICP A;  2KP7 A;  4Z6E A;  4FH3 A;  4WC6 A;  5HRF A;  4F91 B;  3JPN A;  5KFH A;  1ZQO A;  4F50 A;  4PGY A;  3C1Z A;  4DSI A;  1V9P A;  4DL6 A;  1R8A A;  1ZQI A;  7ICJ A;  4RQ3 A;  5HRH A;  1N48 A;  2C28 A;  4ECY A;  1U48 A;  3OSN A;  5DG9 A;  4O5E A;  3BQ2 A;  4GXK A;  3KHG A;  9ICF A;  4RQ4 A;  4YR0 A;  4R64 A;  4O3S A;  5CWR A;  2W9C A;  1XSL A;  2DVI A;  7ICF A;  1VFG A;  2O1P A;  4RQ1 A;  3Q8R B;  4WC7 A;  3BQ0 A;  2BE3 A;  3SYZ A;  4X4U A;  3G6X A;  1K1Q A;  4DS4 A;  3PX0 A;  3C23 A;  4FO6 A;  1H38 A;  3AU2 A;  1D9D A;  1MSW D;  3N97 B;  8ICL A;  5D49 A;  4FH5 A;  4ATB A;  8ICV A;  1RYR A;  3JPR A;  2RFF A;  2XY7 A;  4QWC A;  2F1J A;  1U45 A;  2B21 A;  3H8W A;  3EYZ A;  2GWS A;  2VAN A;  1U47 A;  1BPX A;  4IRK A;  9ICT A;  5DG7 A;  3M9M B;  4UQG A;  2AGO A;  4IG8 A;  2VA3 A;  4DFM A;  2FMQ A;  4EP7 A;  1DK3 A;  5D4B A;  4C8M A;  5L1I A;  3KHR A;  4J9Q A;  3H7I A;  1XWL A;  5KFV A;  4R8U B;  5J0Y A;  3V72 A;  3RBE A;  1ZQS A;  3LK9 A;  4ED2 A;  1NJY A;  1RXV A;  5J0S A;  3B0X A;  2R8G A;  4F2S A;  5DG8 A;  4UB5 A;  4KN4 A;  4DEZ A;  5DB6 A;  4X4S A;  4NY8 A;  2FMS A;  5DED A;  4F4X A;  4DQR A;  4DL5 A;  1ZQB A;  2ASD A;  1XC9 A;  4ECV A;  1S77 D;  4X4P A;  4UAY A;  2ZH7 A;  4F93 B;  3PW0 A;  3RJF A;  3C5G A;  4BWM A;  5J0U A;  3JPS A;  1B43 A;  3T5J A;  1KSP A;  3KTQ A;  4B9T A;  4FBT A;  1TKD A;  5DBC A;  4ECS A;  3MFH A;  3PW4 A;  9ICU A;  3UQ2 A;  3RH5 A;  1B22 A;  3ORY A;  4Q8F A;  4AT7 B;  2AGP A;  5KFL A;  3QZ8 A;  5HNK A;  3JPT A;  7ICE A;  3GIJ A;  1DGS A;  4NXZ A;  5KG2 A;  5DBA A;  5KG0 A;  1NK6 A;  3PML A;  1LV5 A;  4E80 A;  2ISP A;  1Q79 A;  5F2V O;  4X4R A;  5DLG A;  4PHD A;  4QWA A;  4RUA A;  4MFA A;  3PMN A;  4K4I A;  9ICA A;  4RT2 A;  1ZQH A;  8ICS A;  2ATL A;  1S10 A;  1NJW A;  8ICU A;  5HRD A;  4RWO A;  4X4O A;  3NTU A;  4EYI B;  4DQS A;  4YXM A;  1RXW A;  3RJK A;  4FBU A;  1ZQX A;  1U9L A;  4UD4 A;  5KFC A;  7ICL A;  4WC4 A;  4GLX A;  4KLO A;  3V7J A;  2HVH A;  1V4A A;  4QZD A;  3OJS A;  2OWO A;  1SL0 A;  5KG7 A;  4ED3 A;  4TUP A;  4BXO A;  2ZTE A;  1QSL A;  3OVB A;  5KG1 A;  2W9B B;  2Q66 A;  3UXN A;  2JEJ A;  4QZC A;  2ASJ A;  3PO5 A;  3SV3 A;  5HRE A;  4DFJ A;  1BPY A;  5EWF A;  5KT3 A;  1ZQY A;  5KG4 A; 
#chains in the Genus database with same CATH topology
 4FHY A;  4K99 A;  4A8E A;  8ICI A;  2P35 A;  1J2M A;  4M6W A;  4F4K A;  2ZHA A;  4AYB F;  4DFK A;  5KFN A;  1M6Y A;  5CFS A;  4IS7 A;  4QWB A;  3JPP A;  3M7D A;  1S0M A;  2KK0 A;  3FDS A;  1ZQC A;  5IIO A;  2W11 A;  4JK1 A;  1SL2 A;  1UPH A;  2XI9 A;  2BGW A;  4UAZ A;  4CDG A;  2O6K A;  3RRH A;  4AT9 A;  3HJ4 A;  5C5J A;  2HVI A;  4Z6F A;  1RQL A;  5DB9 A;  4YQW A;  4XA5 A;  4F5O A;  3PX4 A;  5IIM A;  4QNL A;  4BX9 C;  3BQT A;  1ZQV A;  4R63 A;  3H38 A;  4F71 A;  5KFI A;  3UXP A;  2XVT A;  5J2I A;  4RT3 A;  3V7K A;  5KFA A;  1LB2 B;  1SKR A;  3ERC C;  4QWE A;  1FFU A;  4MKP A;  2NRW A;  4C8O A;  2JZB B;  5AM0 A;  1SV0 C;  2E8P A;  3H0L B;  5KFD A;  1NKC A;  4IR9 A;  2YB4 A;  2I6X A;  4LEV A;  4EX6 A;  2HHW A;  1JAJ A;  4RQN A;  4US8 A;  5HRG A;  4C8L A;  3EPI A;  2LYH A;  4DSE A;  3QUB A;  3HP6 A;  4F5R A;  9ICR A;  1JMS A;  4QIW F;  2YTU A;  4MFF A;  2WFA A;  2KD1 A;  1JN3 A;  2ODG A;  1NKB A;  2XGQ A;  2ZH4 A;  4UB2 A;  1ZQK A;  4B6J A;  1PVQ A;  2M9N A;  4TUS A;  2R8K A;  2JEI A;  4NLB A;  3WFP A;  2VIX A;  2ALZ A;  5J8Y A;  4XQ7 A;  1UCV A;  3I76 A;  4JV0 A;  3H8J A;  5L1M A;  2M2W A;  2AHO B;  3ISC A;  2KOB A;  3TAN A;  2PBE A;  1ZQM A;  4F92 B;  5DKW A;  5J29 A;  2BCQ A;  4XRH A;  3CRX A;  1WWU A;  4X4Q A;  3NVO A;  1SKS A;  1SXD A;  4NKT A;  5FP0 A;  2BHN A;  8ICJ A;  1P7D A;  5AK6 A;  4WC3 A;  3V7L A;  4C7Z A;  1B0X A;  3HWT A;  2XY5 A;  3MAB A;  2K4E A;  2EH9 A;  4B9U A;  3HJE A;  3HIL A;  3ZDA A;  2OYY A;  4YVZ A;  3F2C A;  9ICN A;  1TK5 A;  3TAQ A;  5CFU A;  3IG8 A;  1WOT A;  4EBK A;  2K89 A;  2DKZ A;  4R65 A;  4HAI A;  5AI0 A;  5EE1 A;  2IHO A;  1TFR A;  3THV A;  4RQ5 A;  5J0T A;  2B51 A;  3C66 A;  3E0F A;  4KLH A;  4MEY A;  5III A;  4O3M A;  3UMG A;  4K4H A;  1WYG A;  4Z6D A;  1X2I A;  3PZP A;  2BBJ A;  4LEZ A;  3M1Y A;  1NNL A;  1NK0 A;  9ICM A;  5HMM A;  2ZHB A;  5KT6 A;  7ICK A;  4JUZ A;  4DF8 A;  3OVS A;  4J9N A;  4IRD A;  2NRK A;  4I2J A;  2Y1J A;  5J0Q A;  2MUT B;  3CK6 A;  2FJ6 A;  3Q8P B;  3OHB A;  4EBE A;  4JWN A;  1KFS A;  2BPF A;  4C8K A;  1UA0 A;  2DR9 A;  3QUC A;  1ZRN A;  2UVW A;  4QZ9 A;  4LVS A;  2PKE A;  1UET A;  2CPR A;  3RJI A;  3C2L A;  4ECX A;  2LHT A;  2W9M A;  5AM1 A;  3QX7 A;  4YP3 A;  3PR5 B;  4LZD A;  4QJF B;  3TAR A;  4EZ6 A;  5KFG A;  4CF5 A;  1KQQ A;  4J9M A;  2AU0 A;  1ZXI A;  2A1J A;  3DV9 A;  3NRW A;  1S5L U;  3AQE A;  4NL9 A;  5DDM A;  1T7P A;  3PW7 A;  3BJY A;  2Y9T A;  3SV4 A;  4B9M A;  5CR0 A;  4R66 A;  3HT3 A;  3ETR A;  4Z6C A;  3OTQ A;  5BOL A;  5CHE A;  3WFO A;  3TFR A;  3BQ1 A;  3WK9 A;  2BPC A;  5ALF A;  2C2D A;  2ZIX B;  2I9G A;  3MCR A;  4O5C A;  4RWN A;  1RDF A;  3JZ0 A;  1A77 A;  4F5P A;  4P0P B;  2A1J B;  2WF8 A;  4ECW A;  3D2Q A;  3ZD9 A;  5KFT A;  4OAG A;  4LT6 A;  1L3V A;  3H8M A;  4C4T A;  1S0O A;  1XU4 A;  2ZXH A;  3H3A A;  4ICA A;  2F3N A;  2WF5 A;  5CA7 A;  1N61 A;  3AMZ A;  4B9N A;  3MGH A;  2OH2 A;  4KLG A;  1PVP A;  4Y2P A;  3C5F A;  1DGJ A;  1RM6 C;  4KLS A;  4QZG A;  3PSF A;  5EE9 A;  5ALV A;  4Y2X A;  5L1J A;  2KFN A;  4O67 A;  1IXR A;  4EBC A;  3M9O B;  4YD2 A;  5HR9 A;  4MEX A;  3PY8 A;  3QU2 A;  3SD7 A;  3OWG A;  1ZQU A;  8ICK A;  5KFF A;  3UPQ A;  3PW5 A;  4LJX A;  1O08 A;  5KT2 A;  2MA1 A;  2OEH A;  1ZQD A;  4ECT A;  5JU5 A;  4DQQ A;  3NVZ A;  3GU3 A;  2J6T A;  4PHA A;  5AKJ A;  2JH1 A;  1HUZ A;  4WC2 A;  1ZQN A;  3N4M B;  1MA7 A;  4BDP A;  1NK4 A;  1ZQF A;  4PL1 A;  3RJE A;  4TQR A;  5KFR A;  1X66 A;  2HSZ A;  4TUQ A;  5KFE A;  2W8K A;  4M9L A;  4ED7 A;  3H4D A;  2XCP A;  5J2H A;  5KT4 A;  2XO7 A;  5AIA A;  4NM1 A;  2HN1 A;  2F1H A;  4UBB A;  3ED5 A;  2PMZ F;  3AQM A;  4RNM A;  1JX4 A;  3BZC A;  8ICB A;  2PMZ C;  5EWE A;  3H0M B;  3KHL A;  3Q8S B;  1RYS A;  4KB6 A;  1QTM A;  1OXJ A;  4EX7 A;  4RQ6 A;  3HKZ C;  3SEI A;  2ZIV B;  3WFR E;  3IDW A;  5G5G A;  3LVW A;  1Z00 B;  2DKX A;  4O0I A;  3TAP A;  4DO9 A;  4GXJ A;  1S0N A;  4I2G A;  5HP4 A;  5AM5 A;  2KG5 A;  5KG6 A;  5J0P A;  5K4L A;  5DDY A;  5CP2 A;  5J2C A;  3WK6 A;  1T8E A;  2KP7 A;  1ZD5 A;  4WC6 A;  5HRF A;  2IOF K;  1ZQO A;  2EWR A;  4F50 A;  5AI9 A;  4DL6 A;  1L7P A;  5HRH A;  4FO1 A;  4ECY A;  4O5E A;  3MC1 A;  4YR0 A;  4O3S A;  2W9C A;  5KNI A;  7ICF A;  1XO0 A;  1VFG A;  4RQ1 A;  1QQ7 A;  3B9J A;  3BQ0 A;  1H38 A;  3PX0 A;  2H3I A;  8ICL A;  2QB0 A;  4UAU A;  2RFF A;  3SR6 A;  2XY7 A;  4QWC A;  1U45 A;  3EYZ A;  1YZ6 A;  9ICT A;  2HOF A;  2VA3 A;  1X42 A;  5D4B A;  2E8M A;  1XWL A;  5KFV A;  1ZQS A;  3LK9 A;  1RXV A;  5DG8 A;  5GTH U;  4KN4 A;  2FMS A;  2AXT U;  1XC9 A;  4X4P A;  4ECV A;  1LKY B;  4F93 B;  2W7P A;  4BWM A;  4FBT A;  1TKD A;  5AKZ A;  3RH5 A;  1X6J A;  4AT7 B;  2AGP A;  1RG6 A;  3UM9 A;  3GIJ A;  1NK6 A;  1N62 A;  3WKA A;  4QWA A;  5HRD A;  4X4O A;  1NJW A;  8ICU A;  2BBH A;  1ZD4 A;  1SWV A;  3UMB A;  1ZQX A;  3RJK A;  4FBU A;  3TAC B;  1V85 A;  3V7J A;  1V4A A;  2E5S A;  3KZI U;  2Q66 A;  3PO5 A;  4DFJ A;  1BPY A;  4YR3 A;  4RQ0 A;  4KIT B;  1UHU A;  4RPZ A;  3IRU A;  4CF3 A;  3U26 A;  3K1R B;  3RR7 A;  4UW9 A;  4DOB A;  2E1F A;  2HBK A;  8ICE A;  2J6S A;  2F8K A;  1L8O A;  4UAT A;  1XSP A;  4AT9 B;  7ICG A;  3JCF A;  1ZD2 P;  4IQU A;  4ECU A;  4F8R A;  4JMU A;  4O3N A;  4K96 A;  2R18 A;  2BQU A;  3Q8Q B;  5J2D A;  3AQK A;  2D8C A;  4WQL A;  3M8S A;  4Y2U A;  4UB4 A;  3T5H A;  4OJL A;  3MDA A;  2NRX A;  4DOA A;  1MIW A;  1ZQJ A;  5J2J A;  1T3N A;  3MR5 A;  3NRZ A;  2NV3 A;  1ZD3 A;  3VC8 A;  4QW9 A;  1T4G A;  2FPL A;  3K4G A;  4ED8 A;  3EUB 2;  2ZG6 A;  2FLP A;  4AT7 A;  4HYK A;  2VJ5 A;  3H0R B;  5ALL A;  1MIY A;  1YZ7 A;  4J03 A;  3ALR A;  4JLZ A;  1LKY A;  8ICR A;  9ICG A;  2ZH9 A;  4IQW A;  5KFU A;  1A6S A;  2CN1 A;  3DEE A;  2YML A;  4I2H A;  4GC6 A;  4O3O A;  3AUO A;  3QU7 A;  5DQI A;  2GA9 D;  1PZN A;  5ALP A;  4K98 A;  4EV6 A;  2DPI A;  4O9M A;  4DFP A;  4I27 A;  5HRK A;  2KIC A;  5JTI A;  4OJP A;  3F2D A;  5KFS A;  3HX0 A;  2N1R A;  2WF7 A;  3V6J A;  3C2M A;  4M0A A;  3RJJ A;  2E8O A;  4RQ8 A;  4E0D A;  2V9W A;  3D2S A;  5KL1 B;  2H3F A;  5AK3 A;  3ER9 B;  2WF6 A;  3FAH A;  2YX8 A;  4M9G A;  1KW4 A;  5B3Q A;  4NXT A;  4DF4 A;  3JPO A;  1N60 A;  1UQV A;  4OAI Z;  3QZ7 A;  1JXL A;  4YG2 A;  1BPB A;  3LVV A;  7ICV A;  2ZUB A;  2HW3 A;  4YXJ A;  4C4S A;  1ZQT A;  2WB1 C;  4I2I A;  3KHH A;  4EED A;  5F3X B;  5DBB A;  5E79 U;  2Z7J A;  2G09 A;  4PHP A;  3M8R A;  1L5U A;  4WJ3 B;  3A0B U;  2YN4 A;  5HR7 A;  3H39 A;  1VLB A;  1NK8 A;  4AT8 B;  4CNQ A;  4B9L A;  3D6J A;  3TI0 A;  5KT5 A;  1A76 A;  4YMM A;  2ZH5 A;  3C18 A;  5IIK A;  2WHE A;  2RDJ A;  2KIV A;  1MQ3 A;  2B56 A;  4NLK A;  1ZQQ A;  4X4V A;  2XCA A;  1QCK A;  2W3S A;  4P4P A;  2CXY A;  4O3Q A;  3JPQ A;  3KBB A;  2JV3 A;  3RBD A;  1FO4 A;  7ICP A;  2IHN A;  3MR6 A;  4FHV A;  2Y9U A;  1SKW A;  5ALN A;  8ICO A;  3PR4 A;  2VA2 A;  3SAH A;  2PFO A;  2H3V A;  2ZH6 A;  4DSL A;  5D62 A;  3N7P D;  4IRC A;  4X0B A;  5KFX A;  5D46 A;  1N63 A;  5KG3 A;  2XGP A;  9ICW A;  4RPY A;  2FLL A;  1NOM A;  2W43 A;  5KFZ A;  4KLE A;  9ICJ A;  2ZH1 A;  5HHH A;  2HHT A;  1UEV A;  4ED0 A;  3MFI A;  2F2A B;  1ZJM A;  4CCH A;  3LQC B;  5BPC A;  3E2E A;  4FZL A;  4M6W B;  5KFM A;  3PNC A;  1TK8 A;  1TAM A;  2W54 A;  3AU6 A;  4KLL A;  2IUB A;  2ZH2 A;  1ZQG A;  1UT5 A;  4UBC A;  5J2B A;  3H8S A;  3OHA A;  4Q8E A;  2FCL A;  5EWG A;  1TV9 A;  1FEZ A;  5DB8 A;  1RYU A;  3GIL A;  1PUZ A;  5AK4 A;  9ICH A;  3NVV A;  3RTV A;  1PX5 A;  5ALX A;  2HHS A;  5B3P A;  1BPZ A;  2Y0S F;  4BGD A;  7ICI A;  4G9B A;  2KSO B;  1KKX A;  2ZIX A;  4DWI A;  2C2R A;  2A19 A;  1HEK A;  3WKC A;  4EYH B;  1TAQ A;  5HR6 A;  5CHG A;  4FS1 A;  2PI4 A;  1MN8 A;  4UB6 U;  3WK8 A;  3BDP A;  1U49 A;  4M9N A;  4F4Z A;  3WKD A;  2ZIU A;  3R9K A;  5AI5 A;  4USA A;  4C80 A;  4AP9 A;  1SIJ A;  4Q44 A;  2DF4 B;  4GIB A;  2MRL A;  1QLN A;  2ZH8 A;  1KEJ A;  3KD3 A;  4X4T A;  5AKI A;  3RFA A;  3ZDC A;  7ICN A;  1QH9 A;  2P6R A;  4DLE A;  2BCS A;  2K4P A;  2IMW P;  3RH6 A;  2ZIW A;  1FFV A;  2YMP A;  5HRL A;  2W9A A;  2ZJA A;  1BNO A;  2PI5 A;  3RB0 A;  3AL0 B;  4C0Z A;  1D8B A;  7ICM A;  1SGG A;  2GH1 A;  1Z4O A;  1ZQZ A;  3BS5 A;  1KDH A;  3F2B A;  2NRZ A;  2JEF A;  4O68 A;  1WUD A;  2BPG A;  2VJ4 A;  2G0A A;  2ZIU B;  4RPX A;  1QSY A;  5C0Y A;  3K75 D;  3L4P A;  4K4G A;  5CFT A;  3M9N B;  2M2V A;  4RQ2 A;  2C22 A;  1KBU A;  2RDI A;  3G6V A;  2M2U A;  5A0L A;  9ICE A;  5TIS U;  3BS7 A;  1UEU A;  2OHF A;  2FPM A;  4J9S A;  9ICC A;  2B4V A;  2QLT A;  1CUK A;  3NVW A;  3T5K A;  2G5I B;  5ALT A;  1D8Y A;  4ECR A;  3AN1 A;  4OAF A;  4P2H A;  3PO4 A;  3GII A;  1ED1 A;  1S0V A;  3RRG A;  5AKE A;  4Z6E A;  4Y2J A;  2Y0S C;  2IOH A;  2WF9 A;  5KFH A;  3C1Z A;  4DSI A;  7ICJ A;  4CE6 A;  2KIW A;  3OSN A;  4WQK A;  4GXK A;  3NKU A;  5AI6 A;  3WKE A;  2HBJ A;  2L5Y A;  1XSL A;  1PVR A;  3Q8R B;  3SMV A;  4FO6 A;  3AU2 A;  1L8L A;  1KN5 A;  2WAQ C;  2W04 A;  8ICV A;  1F5S A;  3JPR A;  1T3Q A;  3H8W A;  2VAN A;  1Q46 A;  1BPX A;  4IRK A;  2LKY A;  3M9M B;  4UQG A;  2I5H A;  4IG8 A;  4DFM A;  4EP7 A;  5L1I A;  3KHR A;  2G06 A;  4J9Q A;  4R8U B;  5J0Y A;  5J0S A;  2EAM A;  5D63 A;  4UB5 A;  4DEZ A;  1J2N A;  4DQR A;  1S77 D;  4B9T A;  3T5J A;  2EDU A;  5AKX A;  2JH7 A;  9ICU A;  3UQ2 A;  3KKA C;  4Q8F A;  2AH5 A;  1N5X A;  5AK5 A;  7ICE A;  4NXZ A;  4OJ6 A;  2EZZ A;  3PML A;  1LV5 A;  1F44 A;  4RUA A;  8ICS A;  4RT2 A;  4RWO A;  2YY6 A;  4OCZ A;  1VDV A;  3NTU A;  2RRD A;  5KFC A;  2HVH A;  3OJS A;  3UMC A;  4ED3 A;  4TUP A;  2ZTE A;  1QSL A;  4PZN A;  3OVB A;  3K7D A;  5KG1 A;  1CRX A;  1ZQ1 C;  3UXN A;  3PSP A;  4QZC A;  3SV3 A;  3DDH A;  5KT3 A;  2H3Z A;  1QQ6 A;  3UXO A;  3IP4 B;  4QZB A;  1EXN A;  1DXS A;  1SL1 A;  1X9S A;  2H3Q A;  3SI8 A;  4O3P A;  4Q45 A;  4P4M A;  3OV7 A;  1ZQW A;  3BZK A;  2DRB A;  2LMR A;  1FIQ A;  5ALH A;  4NLZ A;  1IG6 A;  2F44 A;  4M2Y A;  9ICL A;  8ICG A;  2IA6 A;  3SQI A;  8ICY A;  2MUT A;  3A0H U;  4ECZ A;  4BJQ A;  1F5A A;  4FZN A;  2BKE A;  3SAG A;  4JV2 A;  2M0N A;  2W9C B;  4LEY A;  5DQG A;  4FE3 A;  4I2E A;  3N28 A;  1D9F A;  5AIC A;  4F2R A;  3QU5 A;  1XSN A;  3RB6 A;  2P66 A;  1ZYQ A;  1MIV A;  8ICH A;  1JXE A;  2BR0 A;  4OJO A;  2PFQ A;  3ZDD A;  3IHQ B;  3QU9 A;  1SV0 A;  7ICQ A;  3AQF A;  4YFK A;  2KVS A;  5EOZ A;  4WC1 A;  5KFQ A;  1TAU A;  4DSF A;  3PST A;  4M9H A;  2NO5 A;  4F72 A;  4NJ8 A;  4YCX A;  4EEN A;  3RR8 A;  2ZIV A;  1LVH A;  5JTG A;  4RZR A;  4K8V A;  3KOO A;  4K9A A;  4I2C A;  3WFQ E;  2HBL A;  2E3T A;  3ETL A;  1Z1B A;  1V97 A;  2K8B B;  4YD1 A;  4IQT A;  1L3U A;  3TFS A;  5HHI A;  5AM4 A;  4QZF A;  5AI4 A;  3M6K A;  2DPJ A;  2QKQ A;  2IHM A;  4ELU A;  2ZIW B;  5AIB A;  4PPX A;  2DR7 A;  2NRT A;  3PVX A;  4YMO A;  2ASL A;  4PHE A;  4RU9 A;  4OO1 J;  5ALE A;  5J2K A;  1ZQR A;  5KFK A;  3WFS C;  2KJ8 A;  2UVV A;  3IM1 A;  4KLF A;  5KFJ A;  4KMU A;  3SZ2 A;  2H5X A;  1NI3 A;  2HOI A;  4KLM A;  2QAR B;  5AKL A;  4QZE A;  2HHV A;  2K60 A;  2EQY A;  1X9M A;  1NK9 A;  3HRD D;  5L9X A;  3K1Z A;  2RLT A;  1Q3U A;  3ICX A;  4IL6 U;  1KNY A;  2WAQ F;  1SWW A;  4J9O A;  3NWI A;  8ICT A;  5ALS A;  4BUG A;  3NUQ A;  2ES6 A;  4OJ5 A;  4KLU A;  2KZZ A;  2F1I A;  4WBZ A;  1ZRM A;  4KN7 A;  5DB7 A;  3Q8L A;  4EEY A;  2V4R A;  2F76 X;  1RZT A;  3GV5 B;  2JGA A;  1WCL A;  2J6U A;  2ZJ8 A;  2KVC A;  3ZDB A;  1S8O A;  1K1S A;  3FC4 A;  4ZOH C;  4WC5 A;  2F77 X;  5CRX A;  4NWI A;  4DSK A;  4P0P A;  5ALU A;  2DGZ A;  9ICV A;  4RQM A;  4M04 A;  3OVA A;  5ALG A;  5J2G A;  1KTQ A;  2BCV A;  1NZB A;  4K97 A;  4ZH4 A;  4KLT A;  5DEC A;  1OW5 A;  3QUQ A;  2QAR A;  8ICC A;  3C29 A;  2QB0 B;  3TQ1 A;  8ICX A;  2I1Q A;  1NJX A;  4CF4 A;  2DRA A;  5KAF U;  2R8I A;  4ED6 A;  2LYA A;  5BOM A;  8ICP A;  4DSJ A;  1J97 A;  3NYB A;  4DS5 A;  1X40 A;  2IBK A;  5HRI A;  2AQ4 A;  4I2F A;  2KZM A;  4DQP A;  5ALR A;  3UQ0 A;  4MHV A;  2BDP A;  4B9S A;  3EZ5 A;  4NXV A;  3AM9 A;  4GC7 A;  4US9 A;  2W55 A;  2UVR A;  4BXO B;  1C20 A;  4RQ7 A;  2BQR A;  2HHX A;  2V4Q A;  4DQI A;  2KV2 A;  4YR2 A;  1TFW A;  3MBY A;  5AKY A;  3RB4 A;  3PV8 A;  5ALI A;  1ZQA A;  3NGD A;  4WC4 A;  4KLQ A;  5HC9 A;  4KTQ A;  5KFP A;  2KTQ A;  4UAR A;  9ICX A;  1Z00 A;  4KLD A;  4F5Q A;  3EW9 A;  4IC9 A;  2EAN A;  2C2E A;  2GO7 A;  1XS9 D;  4F4Y A;  3HW8 A;  5JRT A;  4AT8 A;  4EEB A;  1N2X A;  1RQN A;  9ICS A;  2FDR A;  1N56 A;  1BPD A;  4O5K A;  8ICQ A;  4Y2Q A;  7ICU A;  4UB3 A;  2ESE A;  2ISO A;  4I28 A;  5AKG A;  2LM1 A;  9ICK A;  2Q4T A;  1VJ7 A;  2ZTD A;  3V6K A;  3ZD8 A;  4Y2Y A;  4E8F A;  4GFJ A;  5J0R A;  3LYS A;  4E7X A;  5J0W A;  4ELT A;  4C4R A;  3L5K A;  1PK1 B;  3S6J A;  3LDA A;  4QZ8 A;  1XNS A;  3Q8M A;  4ELV A;  1HUO A;  2K8C B;  1NJZ A;  4AYB C;  3LWL A;  2R8H A;  4F3O A;  9ICB A;  4J9K A;  1X9W A;  3TKA A;  5ALQ A;  4YMN A;  4M9J A;  4DL3 A;  4WC0 A;  5ALW A;  4DCC A;  5DGA A;  2YMQ A;  4PL2 A;  4MF2 A;  1NK7 A;  2DBY A;  1HIW A;  2KFZ A;  3OGU A;  3RJG A;  2YMM A;  1Q8K A;  4C7Y A;  4Q43 A;  2DWQ A;  1CEZ A;  3PW2 A;  3QYP A;  1JAL A;  3RAX A;  4WH5 A;  1MQ2 A;  4XUS A;  2HHP A;  1YT3 A;  1SV4 A;  4CGZ A;  1SB3 C;  4J9P A;  9ICQ A;  3HKZ F;  2FE9 A;  4LZG A;  4I29 A;  2JEG A;  3NAS A;  4EGW A;  1C7Y A;  5KL8 B;  2ZJ5 A;  1QSS A;  2GAF D;  2BQ3 A;  4NKU A;  2KKV A;  1AQ6 A;  1R8B A;  2XID A;  4QZI A;  1YLQ A;  3QEB Z;  4FHP A;  3MR3 A;  4DLG A;  2JR5 A;  4PH5 A;  2O5A A;  5IIL A;  2GOL A;  9ICP A;  4F91 B;  3WK7 A;  1COK A;  4PGY A;  1V9P A;  1R8A A;  1ZQI A;  1VJ5 A;  2A1A A;  1IV8 A;  2C28 A;  1TE2 A;  2F8L A;  1PK3 A;  5ALJ A;  2JHD A;  3BQ2 A;  3KHG A;  4R64 A;  5CWR A;  2DVI A;  2OXO A;  2G5H B;  3WK5 A;  3J81 j;  2BE3 A;  1KL9 A;  1MSW D;  2HBM A;  3N97 B;  4FH5 A;  1RYR A;  3N7R C;  1U47 A;  3TAD A;  4UB8 U;  2EZX A;  2A3V A;  2AGO A;  2FMQ A;  1L7M A;  1DK3 A;  4C8M A;  4KX3 A;  2B0C A;  1NJY A;  2R8G A;  4F2S A;  2KEY A;  4NLC A;  4X4S A;  4NY8 A;  5DED A;  4F4X A;  5CEH A;  4UAY A;  3PW0 A;  4I0U A;  1KSP A;  5J0U A;  1ZOL A;  2XIC A;  3KTQ A;  2D6F C;  2LYB A;  3F53 A;  5DBC A;  2JMG A;  3ORY A;  3BS5 B;  5KFL A;  3QZ8 A;  1DGS A;  5KG2 A;  2D3D A;  5G5H A;  5KG0 A;  2RP5 A;  4EEL A;  2ISP A;  4PHD A;  4K4I A;  4MFA A;  9ICA A;  2ATL A;  1RXW A;  4YXM A;  1U9L A;  2HN2 A;  4JLX A;  4GLX A;  4KLO A;  4QZD A;  4BXO A;  2RQ5 A;  2JEJ A;  3F5E A;  5EWF A;  2JRZ A;  1ZQY A;  5KG4 A;  2IOF A;  1S9F A;  1URJ A;  3MDC A;  2BZF A;  2R8J A;  1MC8 A;  2MAX A;  2GLE A;  5EE0 A;  3NVY A;  2KJ9 A;  1DRG A;  3GV8 B;  4NXU A;  8ICN A;  3T5L A;  1BPE A;  4ACO A;  3MGI A;  2E1E A;  4N7R A;  2KN7 A;  4U7C A;  2XY6 A;  5ALZ A;  3UPS A;  4NL9 C;  3Q8K A;  1Z3E B;  4P4O A;  3QUT A;  4ATB B;  2PXI A;  2HCF A;  5ALO A;  1NK5 A;  2DL0 A;  3KZX A;  4FHX A;  1QQ5 A;  5CJ7 A;  3GIK A;  4DL2 A;  4EEK A;  4FFD A;  2XC9 A;  5IIJ A;  5F9L A;  3OJU A;  1JRP A;  2AQ0 A;  2LM4 A;  5ALK A;  5T14 A;  3IG5 A;  1BNP A;  5J2F A;  1N5W A;  2G08 A;  5D61 A;  1V38 A;  2G07 A;  5ALM A;  4LEW A;  5J2E A;  3CYM A;  1BVS A;  7ICT A;  5J0O A;  2KMD A;  3FYH A;  4RUC A;  3GIM A;  3T3F A;  4KLI A;  2WB1 F;  4O6A A;  2NRV A;  2JZB A;  5L1L A;  4C8N A;  2KSO A;  3C28 A;  5J8Y C;  4P0Q B;  3ZDE A;  3H40 A;  5L1K A;  1S97 A;  2HHU A;  1KLN A;  3L3F X;  1NO5 A;  5HRB A;  4J9R A;  3T79 A;  3WU2 U;  2W7O A;  3C1Y A;  3ONN A;  4P0Q A;  5KFW A;  3V6H A;  1Z4N A;  4HX0 A;  8ICZ A;  4O3R A;  4TQS A;  5AKK A;  2FPK A;  4XQ8 A;  4F4W A;  2JXJ A;  4Y2S A;  1FA0 A;  4BWJ A;  7ICH A;  1Y88 A;  4IQV A;  4MFC A;  2KNJ A;  4PGQ A;  2ZUD A;  4OAH A;  1GPJ A;  5KFY A;  4NXW A;  2EAP A;  5HML A;  2BCU A;  4X4N A;  3RJH A;  4PZO A;  2LI6 A;  3F5A A;  1DOQ A;  2DR8 A;  2K4I A;  4JWM A;  2M2T A;  1NZP A;  3G6Y A;  4WCW A;  4DL4 A;  2W9B A;  4M47 A;  5KFB A;  1R89 A;  1DK2 A;  1TVA A;  2OCE A;  3GQC A;  4PJ0 U;  3WK4 A;  3BQ7 A;  5J2A A;  4FHW A;  1NKE A;  1UA1 A;  2FLN A;  2RHF A;  4NM2 A;  3EPG A;  1JUD A;  3RF9 A;  2FI1 A;  2FMP A;  1ZQL A;  4X0A A;  2AGQ A;  1SZP A;  3B0Y A;  5B66 U;  9ICF A;  4YN4 A;  2UVU A;  4I2A A;  5AHX A;  4ED1 A;  1Q78 A;  4QZH A;  5DLF A;  1JIH A;  3H4B A;  4G3I A;  5AKH A;  4X5V A;  4UAW A;  1ZJN A;  3C21 A;  5GTI U;  5KTQ A;  5KFO A;  5DQH A;  4EBD A;  4KMO B;  4NLG A;  1TK0 A;  3OPX A;  4I2B A;  1L7N A;  4Y2T A;  4QWD A;  4UD5 A;  2ZH3 A;  4F5N A;  3WKB A;  4JV1 A;  3HJ1 A;  4I2D A;  3M6Z A;  2B6G A;  2W8L A;  2DFL A;  4DL7 A;  5ALY A;  1L3T A;  1O03 A;  1COO A;  4XJE A;  2ZUC A;  2EZY A;  2PFN A;  2Q0Z X;  4TUR A;  3QE9 Y;  3OUY B;  4DFD A;  1SXE A;  2HMX A;  1R8C A;  2BCR A;  2HDO A;  3RAQ A;  3QEA Z;  5AM3 A;  4RWQ A;  2LBO A;  4K9B A;  2VA8 A;  3GZF A;  3HIY A;  3MR2 A;  3EWA A;  5DGB A;  9ICO A;  2KKP A;  3EF2 A;  2ID1 A;  3AQL A;  4WBY A;  3E58 A;  8ICF A;  3AQN A;  3FM9 A;  2MSN A;  1UT8 A;  2AJQ A;  7ICO A;  3ISD A;  4J9L A;  3LWM A;  1PK1 A;  2KZ3 A;  5EE3 A;  2NYV A;  4QIW C;  1IM4 A;  8ICA A;  1A0P A;  2W03 A;  1L7O A;  1SZH A;  3IN5 A;  4PGX A;  3H37 A;  3RB3 A;  2OM6 A;  1U4B A;  4M5D A;  3KKA A;  2ZTC A;  4RWP A;  2KHV A;  1X9X A;  2LPE A;  1HJP A;  2BDU A;  3CW2 C;  3PX6 A;  7ICR A;  3HPO A;  4R8U A;  5CB1 A;  1CI4 A;  3GDX A;  5J0X A;  2YB1 A;  2CRX A;  2HHQ A;  4FZM A;  1KFD A;  3RH4 A;  2WTF A;  1KRP A;  4IR1 A;  1ARO P;  1ZET A;  4CRX A;  1S76 D;  3CNH A;  3AEV A;  2PFP A;  1X6I A;  3JYY A;  4EZ9 A;  1BGX T;  5AM2 A;  2E8N A;  4KLJ A;  1WG8 A;  1D8L A;  7ICS A;  1KFT A;  3L9D A;  4UAV A;  4KX5 A;  4MF8 A;  1RPL A;  4NV0 A;  4RNN A;  3SEN A;  1XO1 A;  3OSP A;  4RNO A;  3PHZ A;  1JRO A;  5TZV A;  4ECQ A;  4EBJ A;  2MU2 A;  5F9N A;  1ECW A;  4QZA A;  2YQE A;  1L3S A;  1TFY A;  1OUQ A;  3OUY A;  1B4F A;  4QW8 A;  3ISB A;  8ICW A;  4Y2V A;  5KG5 A;  1OU5 A;  1ZQE A;  2EAO A;  8ICM A;  3SAF A;  4UB1 A;  5KT7 A;  3GV7 B;  9ICI A;  1WCN A;  5KAI U;  1ZQP A;  4OD0 A;  5IIN A;  3GFK B;  1L6N A;  2DR5 A;  1T94 A;  2NO4 A;  2P6U A;  2Y1I A;  4B9V A;  5H2F U;  4NLN A;  3TAD C;  5JUM A;  1K5O A;  4FS2 A;  4NXX A;  1JQR A;  4DOC A;  3C2K A;  4FH3 A;  2K4H A;  3D2N A;  3JPN A;  4UAS A;  3QU4 A;  4RQ3 A;  1N48 A;  5AI8 A;  1U48 A;  2VKQ A;  5DG9 A;  2KJ5 A;  4RQ4 A;  3KFU F;  3NS1 A;  2O1P A;  1WWV A;  1GO3 F;  5ALD A;  4WC7 A;  4X4U A;  3SYZ A;  3G6X A;  1K1Q A;  4DS4 A;  3C23 A;  3PSI A;  2HI0 A;  1D9D A;  3CP8 A;  3QNM A;  4Y2R A;  5D49 A;  4ATB A;  1IIP A;  2F1J A;  3MGV A;  3ZI4 A;  2B21 A;  4O69 A;  2DUY A;  2GWS A;  5DG7 A;  5B5E U;  1JI7 A;  1Z1V A;  2QB1 A;  3H7I A;  3RBE A;  4S3N A;  3V72 A;  4ED2 A;  3B0X A;  2KHQ A;  5DB6 A;  2W3R A;  4DL5 A;  1ZQB A;  3IV6 A;  2ASD A;  2ZH7 A;  4JB3 A;  3RJF A;  3C5G A;  3JPS A;  1B43 A;  2DQN B;  1Q3V A;  2K8A A;  3MFH A;  4ECS A;  3PW4 A;  1B22 A;  2ZXI A;  3JPT A;  5HNK A;  1F0M A;  4U6P A;  3I1Y A;  3I28 A;  3VCB A;  5DBA A;  4E80 A;  1Z19 A;  1Q79 A;  5F2V O;  4X4R A;  5DLG A;  3PMN A;  3N7S C;  3QXG A;  1ZQH A;  1S10 A;  3O0F A;  4EYI B;  4DQS A;  4UD4 A;  4KM5 A;  3ER8 C;  7ICL A;  2OWO A;  1SL0 A;  5KG7 A;  4WOY A;  2W9B B;  2HOQ A;  2ASJ A;  5HRE A;  2KE7 A;  4GXI A; 
#chains in the Genus database with same CATH homology
 1S9F A;  4RQ0 A;  4FHY A;  4KIT B;  3MDC A;  2R8J A;  1MC8 A;  3UXO A;  2MAX A;  4QZB A;  8ICI A;  1EXN A;  4M6W A;  1SL1 A;  1X9S A;  4RPZ A;  4F4K A;  2ZHA A;  3SI8 A;  4O3P A;  3RR7 A;  4Q45 A;  4P4M A;  4DOB A;  4DFK A;  5KFN A;  3OV7 A;  8ICE A;  2J6S A;  1ZQW A;  4QWB A;  3JPP A;  3GV8 B;  1S0M A;  8ICN A;  2DRB A;  3T5L A;  1XSP A;  4NLZ A;  4AT9 B;  1BPE A;  7ICG A;  3FDS A;  4IQU A;  5IIO A;  3MGI A;  4ECU A;  1ZQC A;  4JK1 A;  4M2Y A;  9ICL A;  4F8R A;  2KN7 A;  1SL2 A;  2XY6 A;  2IA6 A;  8ICG A;  8ICY A;  4O3N A;  2MUT A;  3UPS A;  2BGW A;  3Q8K A;  4UAZ A;  2BQU A;  4ECZ A;  3Q8Q B;  1Z3E B;  4P4O A;  5J2D A;  4ATB B;  1F5A A;  4S3N A;  2BKE A;  3RRH A;  2PXI A;  3AQK A;  4AT9 A;  3HJ4 A;  5C5J A;  2HVI A;  1NK5 A;  4Z6F A;  5DB9 A;  3M8S A;  4UB4 A;  3T5H A;  4YQW A;  4XA5 A;  4FHX A;  4JV2 A;  3MDA A;  2W9C B;  2NRX A;  5DQG A;  5CJ7 A;  4F5O A;  4I2E A;  4DOA A;  3PX4 A;  5IIM A;  1MIW A;  3GIK A;  4DL2 A;  3BQT A;  2XC9 A;  1ZQJ A;  1D9F A;  5IIJ A;  5J2J A;  1ZQV A;  5F9L A;  4R63 A;  3OJU A;  1XSN A;  1T3N A;  4F2R A;  5KFI A;  3H38 A;  3UXP A;  3MR5 A;  5J2I A;  2AQ0 A;  3RB6 A;  4RT3 A;  3V7K A;  1ZYQ A;  5KFA A;  1LB2 B;  1SKR A;  2P66 A;  4QW9 A;  1T4G A;  2FPL A;  3K4G A;  4QWE A;  4ED8 A;  8ICH A;  2NRW A;  4C8O A;  2JZB B;  2FLP A;  4AT7 A;  5KFD A;  4HYK A;  1JXE A;  2BR0 A;  1NKC A;  2PFQ A;  3ZDD A;  4IR9 A;  3IHQ B;  1BNP A;  2HHW A;  1MIY A;  5J2F A;  1JAJ A;  5HRG A;  7ICQ A;  8ICR A;  9ICG A;  2ZH9 A;  4YFK A;  4IQW A;  4C8L A;  5KFU A;  3EPI A;  2LYH A;  4DSE A;  5EOZ A;  4WC1 A;  5KFQ A;  5J2E A;  3HP6 A;  4F5R A;  4I2H A;  1TAU A;  4GC6 A;  4O3O A;  3AUO A;  4DSF A;  4M9H A;  9ICR A;  1BVS A;  5DQI A;  7ICT A;  1JMS A;  1PZN A;  4MFF A;  5J0O A;  4YCX A;  2DPI A;  3FYH A;  1JN3 A;  4RUC A;  3RR8 A;  4O9M A;  1NKB A;  3GIM A;  4DFP A;  3T3F A;  4KLI A;  2XGQ A;  4RZR A;  2ZH4 A;  2NRV A;  2JZB A;  4UB2 A;  1ZQK A;  4I27 A;  5HRK A;  5L1L A;  3WFQ E;  4I2C A;  4C8N A;  3ETL A;  2M9N A;  4YD1 A;  5KFS A;  3ZDE A;  4IQT A;  3HX0 A;  1L3U A;  3H40 A;  4TUS A;  3TFS A;  5HHI A;  5L1K A;  1S97 A;  4QZF A;  2HHU A;  3V6J A;  1KLN A;  3C2M A;  2R8K A;  4M0A A;  2DPJ A;  2JEI A;  3WFP A;  3RJJ A;  1NO5 A;  4RQ8 A;  5HRB A;  4E0D A;  2IHM A;  2V9W A;  4ELU A;  4J9R A;  2ALZ A;  4PPX A;  4XQ7 A;  4JV0 A;  3H8J A;  4M9G A;  2DR7 A;  3C1Y A;  2M2W A;  5KFW A;  3ISC A;  3V6H A;  8ICZ A;  4O3R A;  4TQS A;  4DF4 A;  2NRT A;  3JPO A;  3PVX A;  3TAN A;  2PBE A;  2FPK A;  1ZQM A;  4YMO A;  4XQ8 A;  2ASL A;  4F92 B;  3QZ7 A;  4YG2 A;  5DKW A;  4PHE A;  4F4W A;  1BPB A;  1JXL A;  8ICP A;  5J29 A;  7ICV A;  2ZUB A;  4RU9 A;  2BCQ A;  2HW3 A;  4YXJ A;  1FA0 A;  4XRH A;  4BWJ A;  7ICH A;  4X4Q A;  1Y88 A;  2ZH1 A;  4IQV A;  5J2K A;  1ZQR A;  1ZQT A;  4MFC A;  1SKS A;  4NKT A;  4PGQ A;  2ZUD A;  2BHN A;  4I2I A;  5KFK A;  5KFY A;  8ICJ A;  4WC3 A;  3V7L A;  3KHH A;  3WFS C;  5HML A;  2BCU A;  4X4N A;  3RJH A;  3HWT A;  2UVV A;  1UEV A;  5DBB A;  2XY5 A;  3IM1 A;  3MAB A;  4B9U A;  4KLF A;  5KFJ A;  4PHP A;  4KMU A;  1DOQ A;  3SZ2 A;  2DR8 A;  2H5X A;  3ZDA A;  3M8R A;  1L5U A;  4YVZ A;  4JWM A;  2M2T A;  4KLM A;  1NZP A;  3G6Y A;  4WCW A;  4QZE A;  2HHV A;  9ICN A;  1X9M A;  1NK9 A;  5L9X A;  1TK5 A;  4DL4 A;  3TAQ A;  2W9B A;  3H39 A;  1NK8 A;  4AT8 B;  4M47 A;  1WOT A;  4B9L A;  4EBK A;  1KNY A;  3TI0 A;  5KFB A;  5KT5 A;  4R65 A;  4J9O A;  8ICT A;  1R89 A;  1A76 A;  4YMM A;  1TFR A;  2ZH5 A;  1DK2 A;  3THV A;  4KLU A;  1TVA A;  5IIK A;  1MIV A;  3C18 A;  4RQ5 A;  2KZZ A;  2F1I A;  5J0T A;  2RDJ A;  1MQ3 A;  3GQC A;  3C66 A;  4NLK A;  4KLH A;  4MEY A;  5III A;  4WBZ A;  4KN7 A;  1ZQQ A;  4K4H A;  5J2A A;  4FHW A;  4Z6D A;  1NKE A;  1X2I A;  1UA1 A;  2FLN A;  5DB7 A;  3Q8L A;  4EEY A;  4NM2 A;  4X4V A;  2V4R A;  2XCA A;  1NK0 A;  3EPG A;  9ICM A;  5HMM A;  1RZT A;  2ZHB A;  4P4P A;  5KT6 A;  3GV5 B;  7ICK A;  4JUZ A;  4O3Q A;  4DF8 A;  4J9N A;  4IRD A;  4X0B A;  3JPQ A;  2FMP A;  4X0A A;  1ZQL A;  3OVS A;  2NRK A;  2AGQ A;  4I2J A;  2Y1J A;  1SZP A;  3B0Y A;  3RBD A;  1WCL A;  5J0Q A;  2J6U A;  2MUT B;  2ZJ8 A;  4YN4 A;  2UVU A;  3Q8P B;  3ZDB A;  3OHB A;  2IHN A;  1K1S A;  7ICP A;  3MR6 A;  4EBE A;  4JWN A;  3NYB A;  1KFS A;  4FHV A;  4I2A A;  4WC5 A;  4ED1 A;  1SKW A;  2BPF A;  1Q78 A;  4C8K A;  1UA0 A;  4QZH A;  5DLF A;  4DSK A;  2DR9 A;  8ICO A;  3PR4 A;  1JIH A;  3H4B A;  2VA2 A;  4G3I A;  2O5A A;  9ICV A;  4X5V A;  4UAW A;  2PFO A;  4M04 A;  3OVA A;  1ZJN A;  2ZH6 A;  3C21 A;  4DSL A;  5KTQ A;  5KFO A;  4IRC A;  5J2G A;  5DQH A;  4QZ9 A;  4EBD A;  1KTQ A;  1TK0 A;  2UVW A;  4LVS A;  5KFX A;  2BCV A;  5D46 A;  4NLG A;  1UET A;  4I2B A;  1JQR A;  5KG3 A;  4QWD A;  2XGP A;  4UD5 A;  2ZH3 A;  4ZH4 A;  4KLT A;  9ICW A;  5DEC A;  4F5N A;  3RJI A;  3C2L A;  4RPY A;  4ECX A;  4JV1 A;  2W9M A;  4YP3 A;  3PR5 B;  4I2D A;  8ICC A;  3HJ1 A;  2FLL A;  1NOM A;  4LZD A;  3TQ1 A;  8ICX A;  2I1Q A;  5KFZ A;  1NJX A;  2W8L A;  4KLE A;  9ICJ A;  2DFL A;  5HHH A;  3TAR A;  4DL7 A;  2R8I A;  4EZ6 A;  5KFG A;  2HHT A;  4ED0 A;  3MFI A;  4ED6 A;  1L3T A;  1ZJM A;  1COO A;  4CCH A;  3LQC B;  4J9M A;  2AU0 A;  2A1J A;  2ZUC A;  5BOM A;  5BPC A;  4DSJ A;  3E2E A;  4DS5 A;  5DDM A;  2PFN A;  2Q0Z X;  4TUR A;  1T7P A;  2IBK A;  5HRI A;  4M6W B;  3PW7 A;  2AQ4 A;  4I2F A;  2KZM A;  4DQP A;  5KFM A;  3PNC A;  3BJY A;  3UQ0 A;  3QE9 Y;  1TK8 A;  3SV4 A;  2BDP A;  4B9S A;  3OUY B;  4B9M A;  3EZ5 A;  5CR0 A;  4R66 A;  3AU6 A;  4KLL A;  3HT3 A;  4Z6C A;  2BCR A;  5BOL A;  1R8C A;  4GC7 A;  3RAQ A;  3QEA Z;  2ZH2 A;  4GXI A;  1ZQG A;  3WFO A;  1UT5 A;  4RWQ A;  4UBC A;  3BQ1 A;  2VA8 A;  3TFR A;  3HIY A;  2UVR A;  2BPC A;  3MR2 A;  2C2D A;  3EWA A;  5J2B A;  5DGB A;  3H8S A;  4BXO B;  9ICO A;  7ICO A;  3OHA A;  4RQ7 A;  2BQR A;  4Q8E A;  2HHX A;  5EWG A;  2I9G A;  2V4Q A;  1TV9 A;  4DQI A;  5DB8 A;  4O5C A;  3GIL A;  2ID1 A;  3AQL A;  4WBY A;  4RWN A;  4YR2 A;  1TFW A;  8ICF A;  3MBY A;  3AQN A;  9ICH A;  3RB4 A;  1A77 A;  3PV8 A;  1ZQA A;  4F5P A;  3RTV A;  1PX5 A;  1UT8 A;  2A1J B;  3NGD A;  4KLQ A;  2HHS A;  3ISD A;  4J9L A;  1BPZ A;  4ECW A;  2AJQ A;  3LWM A;  5HC9 A;  3ZD9 A;  2KZ3 A;  4KTQ A;  5KFP A;  2KTQ A;  4BGD A;  5KFT A;  7ICI A;  9ICX A;  1Z00 A;  4KLD A;  4F5Q A;  1L3V A;  4LT6 A;  3EW9 A;  1IM4 A;  1S0O A;  1XU4 A;  2C2E A;  1XS9 D;  4DWI A;  2C2R A;  8ICA A;  4F4Y A;  3HW8 A;  3H3A A;  4AT8 A;  2DRA A;  9ICS A;  5CA7 A;  1N56 A;  1BPD A;  4O5K A;  4EYH B;  4PGX A;  1TAQ A;  4B9N A;  8ICQ A;  3H37 A;  3RB3 A;  3MGH A;  4KLG A;  5CHG A;  4FS1 A;  1U4B A;  2PI4 A;  4M5D A;  7ICU A;  4UB3 A;  2ZTC A;  4RWP A;  3C5F A;  3BDP A;  1HJP A;  3PX6 A;  1U49 A;  2ISO A;  4QZG A;  4I28 A;  4KLS A;  7ICR A;  3HPO A;  4R8U A;  5CB1 A;  5L1J A;  4M9N A;  4F4Z A;  2KFN A;  9ICK A;  1VJ7 A;  1IXR A;  3GDX A;  3M9O B;  4EBC A;  2ZTD A;  3V6K A;  5J0X A;  4YD2 A;  3ZD8 A;  2HHQ A;  1KFD A;  5HR9 A;  4MEX A;  3PY8 A;  4Q44 A;  4E8F A;  5J0R A;  1ZQU A;  8ICK A;  3RH4 A;  2WTF A;  1KRP A;  1QLN A;  4E7X A;  5KFF A;  2ZH8 A;  5J0W A;  3UPQ A;  3PW5 A;  4ELT A;  4IR1 A;  1ARO P;  1KEJ A;  1ZET A;  4X4T A;  1S76 D;  3ZDC A;  5KT2 A;  7ICN A;  2PFP A;  1ZQD A;  4ECT A;  2P6R A;  3JYY A;  4DLE A;  4EZ9 A;  3LDA A;  4DQQ A;  1BGX T;  2BCS A;  4QZ8 A;  3Q8M A;  2IMW P;  3RH6 A;  4ELV A;  4KLJ A;  5HRL A;  3JZ0 A;  1D8L A;  1HUO A;  2J6T A;  4PHA A;  7ICS A;  1NJZ A;  9ICB A;  3LWL A;  4YR3 A;  2R8H A;  4F3O A;  4J9K A;  1HUZ A;  1KFT A;  4WC2 A;  1X9W A;  2W9A A;  2ZJA A;  1BNO A;  2PI5 A;  1ZQN A;  3L9D A;  4YMN A;  4MF8 A;  3N4M B;  4DL3 A;  1RPL A;  4M9J A;  4WC0 A;  4RNN A;  3RB0 A;  1XO1 A;  3OSP A;  1NK4 A;  5DGA A;  1ZQF A;  4BDP A;  7ICM A;  4RNO A;  1ZQZ A;  4MF2 A;  1KDH A;  5TZV A;  1NK7 A;  2NRZ A;  4ECQ A;  2JEF A;  3RJE A;  4TQR A;  5KFR A;  2KFZ A;  4EBJ A;  3OGU A;  3RJG A;  4TUQ A;  5F9N A;  5KFE A;  4QZA A;  2W8K A;  2BPG A;  4M9L A;  4RPX A;  4Q43 A;  4ED7 A;  3H4D A;  2XCP A;  1QSY A;  1L3S A;  3K75 D;  1CEZ A;  1TFY A;  5J2H A;  3PW2 A;  3OUY A;  5KT4 A;  4K4G A;  2XO7 A;  3RAX A;  4QW8 A;  1MQ2 A;  4XUS A;  3ISB A;  3M9N B;  8ICW A;  2M2V A;  4NM1 A;  4RQ2 A;  2HHP A;  2F1H A;  5KG5 A;  4UBB A;  2C22 A;  1OU5 A;  3AQM A;  4RNM A;  1JX4 A;  2RDI A;  1ZQE A;  3G6V A;  8ICM A;  8ICB A;  4J9P A;  4UB1 A;  2M2U A;  5KT7 A;  9ICQ A;  5EWE A;  3GV7 B;  3KHL A;  1WCN A;  3Q8S B;  1RYS A;  9ICI A;  9ICE A;  4LZG A;  1QTM A;  4I29 A;  1ZQP A;  1UEU A;  5IIN A;  2FPM A;  4RQ6 A;  2JEG A;  4J9S A;  1C7Y A;  3WFR E;  2ZJ5 A;  3GFK B;  1Z00 B;  1QSS A;  9ICC A;  2DR5 A;  2P6U A;  2Y1I A;  4B9V A;  2BQ3 A;  1CUK A;  3T5K A;  4O0I A;  1D8Y A;  4NKU A;  3TAP A;  4DO9 A;  4GXJ A;  4ECR A;  1S0N A;  4NLN A;  4I2G A;  1R8B A;  5HP4 A;  5JUM A;  4QZI A;  4FS2 A;  5KG6 A;  3QEB Z;  1YLQ A;  4FHP A;  5J0P A;  3MR3 A;  4DLG A;  4P2H A;  5DDY A;  5CP2 A;  4PH5 A;  3GII A;  5J2C A;  4DOC A;  5IIL A;  3PO4 A;  3RRG A;  1T8E A;  3C2K A;  1S0V A;  9ICP A;  2KP7 A;  4Z6E A;  4FH3 A;  4WC6 A;  5HRF A;  4F91 B;  3JPN A;  5KFH A;  1ZQO A;  4F50 A;  4PGY A;  3C1Z A;  4DSI A;  1V9P A;  4DL6 A;  1R8A A;  1ZQI A;  7ICJ A;  4RQ3 A;  5HRH A;  1N48 A;  2C28 A;  4ECY A;  1U48 A;  3OSN A;  5DG9 A;  4O5E A;  3BQ2 A;  4GXK A;  3KHG A;  9ICF A;  4RQ4 A;  4YR0 A;  4R64 A;  4O3S A;  5CWR A;  2W9C A;  1XSL A;  2DVI A;  7ICF A;  1VFG A;  2O1P A;  4RQ1 A;  3Q8R B;  4WC7 A;  3BQ0 A;  2BE3 A;  3SYZ A;  4X4U A;  3G6X A;  1K1Q A;  4DS4 A;  3PX0 A;  3C23 A;  4FO6 A;  1H38 A;  3AU2 A;  1D9D A;  1MSW D;  3N97 B;  8ICL A;  5D49 A;  4FH5 A;  4ATB A;  8ICV A;  1RYR A;  3JPR A;  2RFF A;  2XY7 A;  4QWC A;  2F1J A;  1U45 A;  2B21 A;  3H8W A;  3EYZ A;  2GWS A;  2VAN A;  1U47 A;  1BPX A;  4IRK A;  9ICT A;  5DG7 A;  3M9M B;  4UQG A;  2AGO A;  4IG8 A;  2VA3 A;  4DFM A;  2FMQ A;  4EP7 A;  1DK3 A;  5D4B A;  4C8M A;  5L1I A;  3KHR A;  4J9Q A;  3H7I A;  1XWL A;  5KFV A;  4R8U B;  5J0Y A;  3V72 A;  3RBE A;  1ZQS A;  3LK9 A;  4ED2 A;  1NJY A;  1RXV A;  5J0S A;  3B0X A;  2R8G A;  4F2S A;  5DG8 A;  4UB5 A;  4KN4 A;  4DEZ A;  5DB6 A;  4X4S A;  4NY8 A;  2FMS A;  5DED A;  4F4X A;  4DQR A;  4DL5 A;  1ZQB A;  2ASD A;  1XC9 A;  4ECV A;  1S77 D;  4X4P A;  4UAY A;  2ZH7 A;  4F93 B;  3PW0 A;  3RJF A;  3C5G A;  4BWM A;  5J0U A;  3JPS A;  1B43 A;  3T5J A;  1KSP A;  3KTQ A;  4B9T A;  4FBT A;  1TKD A;  5DBC A;  4ECS A;  3MFH A;  3PW4 A;  9ICU A;  3UQ2 A;  3RH5 A;  1B22 A;  3ORY A;  4Q8F A;  4AT7 B;  2AGP A;  5KFL A;  3QZ8 A;  5HNK A;  3JPT A;  7ICE A;  3GIJ A;  1DGS A;  4NXZ A;  5KG2 A;  5DBA A;  5KG0 A;  1NK6 A;  3PML A;  1LV5 A;  4E80 A;  2ISP A;  1Q79 A;  5F2V O;  4X4R A;  5DLG A;  4PHD A;  4QWA A;  4RUA A;  4MFA A;  3PMN A;  4K4I A;  9ICA A;  4RT2 A;  1ZQH A;  8ICS A;  2ATL A;  1S10 A;  1NJW A;  8ICU A;  5HRD A;  4RWO A;  4X4O A;  3NTU A;  4EYI B;  4DQS A;  4YXM A;  1RXW A;  3RJK A;  4FBU A;  1ZQX A;  1U9L A;  4UD4 A;  5KFC A;  7ICL A;  4WC4 A;  4GLX A;  4KLO A;  3V7J A;  2HVH A;  1V4A A;  4QZD A;  3OJS A;  2OWO A;  1SL0 A;  5KG7 A;  4ED3 A;  4TUP A;  4BXO A;  2ZTE A;  1QSL A;  3OVB A;  5KG1 A;  2W9B B;  2Q66 A;  3UXN A;  2JEJ A;  4QZC A;  2ASJ A;  3PO5 A;  3SV3 A;  5HRE A;  4DFJ A;  1BPY A;  5EWF A;  5KT3 A;  1ZQY A;  5KG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...