4KLTA

Dna polymerase beta mismatched product complex with mn2+, 30 min
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
326
structure length
314
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTTKQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Observing a DNA polymerase choose right from wrong.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 104
structure length 314
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4kltA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4kltA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4kltA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4kltA03
3NTUA 7ICOA 1NJZA 4O3OA 3Q8SB 5L1LA 3IHQB 4RPYA 3UXPA 3GQCA 4FS2A 1T3NA 1ZQGA 1JXEA 2R8IA 4QWBA 4R65A 3E2EA 4TUSA 4AT8A 1X9SA 4QZHA 1F5AA 1S97A 5KTQA 2FMSA 3T5HA 1QSLA 4C8LA 2ID1A 9ICQA 4J9OA 9ICHA 4UAWA 3GV7B 5DG9A 3WFSC 5KFOA 2F1JA 2XGPA 4ELVA 3RB0A 4O3QA 1MQ2A 3BJYA 5C5JA 5KG7A 3HIYA 3N4MB 4Z6DA 4EYIB 4GC7A 4DOBA 4M2YA 4GLXA 2J6SA 2ZH5A 1RYSA 3RBEA 4M9NA 1OU5A 4O3NA 1U48A 1TFWA 2W8LA 5KFHA 1ZQNA 1BNOA 5HRDA 3JZ0A 4PHPA 4DFJA 5KFSA 3V7JA 1JMSA 2V4RA 3Q8MA 3RAXA 3UXNA 4YFKA 4RQ7A 3MBYA 3OSPA 3RJKA 4CCHA 4J9PA 1UETA 4YMOA 1COOA 4RNOA 3HX0A 1ZQKA 4ECVA 1NOMA 2AQ4A 4TUPA 4EP7A 4PGYA 1Z3EB 4X0AA 1DK3A 3KHLA 5J2EA 4E7XA 4K4GA 4YD1A 2R8GA 3WFPA 1RXWA 1SKRA 1QTMA 2FLPA 8ICKA 4WC2A 3PW2A 4O3RA 1KLNA 1QSSA 1V4AA 2WTFA 3PVXA 4R66A 1C7YA 4RQ0A 4DS4A 4UB2A 4QZAA 2ASLA 4DSIA 4KLGA 4I2BA 4AT9A 2ZTEA 3LDAA 9ICSA 5L1JA 3QEAZ 4DSLA 4M0AA 4M47A 3MR5A 1NO5A 1D8YA 2BQUA 4ECXA 4RQ2A 3LQCB 2FPMA 4WBYA 4NXZA 1UT5A 4YN4A 3EYZA 4J9MA 3T5LA 2RFFA 4UD4A 3OVAA 7ICEA 4P4MA 3QZ7A 2ATLA 1S0NA 1S77D 4FHXA 3RR7A 3ISDA 1TVAA 4DQPA 3H4DA 2HVHA 1NK6A 5KG6A 4LZGA 2I1QA 4YG2A 5KG5A 4UQGA 1VFGA 5J2JA 3L9DA 4FH3A 2W9CB 2FLNA 4RQ6A 4I2CA 1JAJA 4LVSA 3M8RA 4G3IA 3LWLA 3RRGA 4DO9A 4KLLA 4F92B 1NZPA 4M9GA 5KFTA 2ALZA 4X4UA 5EWEA 1S0OA 5HRFA 4P4PA 1MIYA 1NK5A 3EW9A 4Z6FA 8ICVA 5KFXA 4UAZA 2DR5A 3V7LA 3BQTA 1KEJA 9ICEA 1VJ7A 2KZZA 1ZQUA 1T7PA 4XQ7A 5DQHA 4F5QA 4EBKA 3V72A 1NK9A 2VA8A 4F4YA 4YR0A 5IINA 8ICEA 3TARA 5CR0A 2BCVA 2HHQA 4F2RA 2KZMA 1TK0A 5EWGA 3PW4A 5KG3A 4IQUA 4NY8A 4QW9A 1ZQWA 3HWTA 4XUSA 3OHAA 3RBDA 2FMQA 3RJJA 2ZH2A 1BPXA 3AQKA 4FHPA 4DSEA 1K1QA 3C66A 3HW8A 5DDYA 1XWLA 4YXMA 2AGPA 3C2LA 2UVUA 4XA5A 4BDPA 4F5RA 4DL6A 4O9MA 4AT7A 2XY6A 1ZETA 3H8JA 4DL5A 3RB3A 2ZJAA 2JEIA 2W8KA 1ZQSA 5HRIA 4J9LA 3RB4A 3MGIA 4DFPA 3TAQA 8ICLA 4JWMA 4QZFA 7ICPA 3HT3A 3JPNA 3T5JA 4X4NA 3C5FA 9ICCA 4RQ3A 4I2JA 3M9OB 4I2AA 4F50A 4RUAA 5KFZA 4ELUA 4QW8A 3C1ZA 4ED2A 4MEYA 5DBAA 3BQ0A 4GXKA 8ICRA 1UEUA 4RQ8A 5CWRA 3JPPA 1NKEA 3RJIA 3MR3A 2XC9A 3TQ1A 4C8KA 4PPXA 4M5DA 3WFQE 2ZUBA 4KLQA 9ICIA 3H8SA 4RQ4A 4F5NA 2FPLA 4UBBA 5HHIA 3GIIA 2GWSA 5HRHA 2HHPA 4EZ6A 4I27A 4KLSA 2HHWA 4HYKA 4GXIA 3H4BA 2J6UA 3EPIA 3ZDBA 4ED0A 3PX6A 9ICJA 4K4IA 8ICZA 1DGSA 3C21A 1S0MA 2VA2A 4DF4A 4ECYA 2A1JA 4RZRA 5DQIA 8ICIA 4PH5A 3RR8A 2XCAA 1KFSA 7ICFA 1D8LA 2C28A 4R8UA 2UVWA 3RJGA 4QWEA 5JUMA 7ICUA 4XQ8A 3RRHA 2BHNA 4YVZA 4QZ8A 1BPZA 2ZH9A 5KFEA 7ICVA 1R8BA 3IM1A 3UPQA 2KFZA 4DEZA 2ZUDA 4DQIA 2NRWA 4FHYA 5KFPA 4YMMA 4TQRA 4B9MA 4YCXA 4DSFA 2IHMA 5KFVA 3UXOA 3V6JA 3H40A 4M9JA 7ICNA 4ATBA 4QZ9A 3PW7A 2A1JB 4F2SA 1MSWD 3H38A 4QWDA 3GDXA 1CEZA 2IHNA 3LWMA 4M9LA 3V6HA 3MFIA 3THVA 1RYRA 2ZJ8A 2KP7A 3ETLA 5HRKA 5KFUA 9ICXA 1Z00A 2DPIA 5CP2A 4BWJA 5KT2A 4J9RA 3GILA 4B9NA 4TURA 5HRLA 4O5KA 1XU4A 2BPGA 4BXOB 1ZQPA 3V7KA 2M2TA 3RJFA 4R8UB 5KFNA 2O1PA 3AQMA 4O5EA 2NRVA 4Q45A 3BQ2A 3RB6A 1S10A 1SL2A 3C1YA 4BWMA 3QZ8A 2AU0A 2PFPA 1ZQXA 1A77A 8ICHA 4QWAA 1MIWA 4JV0A 2NRKA 3HPOA 4KLJA 1FA0A 9ICKA 1DK2A 4Q43A 2M9NA 1S0VA 3PX4A 1XS9D 1BPYA 4P2HA 4WCWA 5HMMA 4C8OA 2XCPA 9ICNA 3WFRE 4I29A 2XY5A 1NK8A 1L3SA 2BCUA 3RJHA 2ZH7A 3PR5B 4ECTA 1HUOA 1B43A 5J0QA 1V9PA 5J0WA 4GXJA 1NJXA 2F1HA 2ISPA 4EBDA 3HJ4A 1NK0A 4B9SA 4FHVA 1JN3A 5F2VO 2H5XA 4X5VA 4PGXA 4BXOA 1KDHA 3B0XA 4KLEA 5HP4A 8ICGA 5J2IA 1ZQLA 5J2GA 4NKTA 3PY8A 1NK4A 1BPEA 5EOZA 1NJYA 3TI0A 1RXVA 1Q78A 4I2DA 3MFHA 2DFLA 4IQTA 5J0UA 1MQ3A 3JPTA 1ZQHA 4NLNA 8ICSA 3GFKB 3PO4A 2RDJA 5KG4A 4K4HA 9ICPA 4C8MA 4ECUA 8ICTA 1Z00B 3AU2A 3PMLA 4B9LA 1TKDA 4X4PA 2NRXA 5J0SA 1Q79A 3OUYB 2JZBB 1UT8A 5DB7A 3K4GA 3Q8KA 2DR8A 2AGQA 3Q8QB 5HR9A 3PV8A 5KFRA 1L3UA 1ZQIA 3QEBZ 1D9DA 4JWNA 7ICJA 1NK7A 5DLGA 1EXNA 3SZ2A 5D4BA 2KFNA 4WC0A 3GV5B 1R8AA 5HC9A 2VANA 1U49A 2JEGA 4KLHA 4EZ9A 3Q8PB 4QWCA 4Q8FA 1MC8A 4UAYA 2FLLA 3RJEA 2ZH6A 5J0PA 5J0RA 4YXJA 4F5PA 2JEFA 3NYBA 1TK5A 5DG7A 5KFQA 2ZUCA 1XO1A 3T5KA 1BNPA 5KT7A 5DEDA 2DRAA 4R64A 2BGWA 2BDPA 2NRZA 5KFDA 1NJWA 4DWIA 3RTVA 2W9MA 4KMUA 3ZDEA 2BE3A 4LT6A 4WC7A 4IR9A 1JX4A 3GV8B 4R63A 3TFRA 1U45A 4I2HA 3WFOA 4RQ1A 4WC4A 3ZD8A 3C23A 5KFYA 5CJ7A 2PFNA 4ED7A 4UB4A 5IIMA 3OSNA 4LZDA 4RNMA 5J2AA 4O3SA 5KFBA 7ICQA 4IRDA 8ICCA 4M04A 4YD2A 5DDMA 4NM1A 2ZH4A 1S9FA 2PFQA 2ZH8A 5HRGA 4KLOA 9ICGA 2VA3A 4KLMA 3EZ5A 4MFAA 1WCLA 1ZQTA 4UBCA 3UQ0A 4ATBB 9ICFA 1ZQQA 4F93B 2J6TA 1TFYA 5J0TA 3FDSA 4F91B 3C2KA 2W9AA 1N48A 4Z6CA 5IILA 5L1IA 5HREA 2V4QA 1R89A 5TZVA 4IR1A 4J9KA 4X4QA 2XY7A 4FH5A 5BPCA 3ISBA 3UQ2A 4TUQA 3AQLA 4KITB 4UD5A 9ICWA 1ZQMA 3OJSA 1D9FA 5DLFA 1ZQYA 4UB5A 3SI8A 3MDAA 2AGOA 4DFMA 1AROP 3OVBA 1U9LA 3HP6A 4RWNA 3SYZA 5HNKA 2MUTB 2R8HA 1LB2B 1HUZA 5L1KA 1KSPA 4ED3A 8ICFA 5DECA 2C2RA 4O5CA 1ZQAA 4Z6EA 2B21A 4DLEA 4GC6A 3PW5A 5J2FA 1TAQA 2Q0ZX 1B22A 4AT8B 1JIHA 1ZQZA 5KFAA 2PXIA 4AT9B 4S3NA 2I9GA 4X4OA 4ZH4A 4PHDA 4FBTA 3ZDDA 4EEYA 4QZBA 4I28A 1Y88A 4P4OA 3AU6A 7ICMA 4YR2A 4JK1A 7ICLA 2FMPA 4NLZA 2BCSA 4KLUA 3C2MA 1NKCA 3HJ1A 4QZCA 5J2DA 4ECRA 4WC6A 1A76A 5J2HA 1SZPA 1KFDA 2W9BB 3KTQA 2R8KA 2M2UA 5KFKA 1BPBA 5KT4A 2ZH1A 4ECQA 3LK9A 2XO7A 4DOAA 1XSPA 5KT3A 9ICMA 8ICYA 3C18A 4NLKA 5KFGA 1SL0A 5BOMA 4C8NA 3PR4A 2M2WA 1L5UA 3KHGA 3ZD9A 7ICKA 3OUYA 1KFTA 3Q8RB 2MAXA 3MABA 3PMNA 4M9HA 4EYHB 4DS5A 2Y1JA 4JUZA 5DBCA 4RPZA 1S76D 4WBZA 5J0YA 3ISCA 5HHHA 7ICGA 3RH5A 4ED8A 4E0DA 1JQRA 3RH6A 1T4GA 5F9NA 2W9BA 4FO6A 5KG1A 4DL4A 2PI4A 4X0BA 2ZHBA 1ZJNA 5J2CA 2AJQA 2ZHAA 3PNCA 4KN7A 4F4WA 2PI5A 5KG0A 4JV2A 9ICTA 2BCQA 1H38A 3NGDA 8ICQA 9ICAA 3M8SA 5IIOA 5CB1A 4FHWA 5DGBA 1ZQCA 1SKSA 4YP3A 4KLIA 4RWQA 4X4TA 1K1SA 4DSJA 2HHVA 3V6KA 3SV4A 4O0IA 1T8EA 4F8RA 2KN7A 4WC5A 5D46A 5KFMA 2IA6A 2M2VA 4KLDA 3JPSA 2BKEA 3TANA 1L3TA 4MFCA 1U4BA 4UB3A 4YMNA 2HHUA 1MIVA 3C5GA 4E8FA 3PX0A 2PFOA 3ZDCA 3JYYA 4RPXA 4Q8EA 4BGDA 1ZYQA 2Q66A 8ICUA 4PHEA 4JV1A 4DL3A 3QE9Y 5DB9A 5J0XA 4IRCA 8ICXA 2ASJA 4QZDA 2HW3A 4TQSA 5BOLA 3K75D 4KTQA 7ICRA 1XSNA 4M6WA 5L9XA 1DOQA 4RT3A 2P6UA 1UA0A 1SKWA 2ISOA 1TAUA 1ZQDA 3GIJA 1WOTA 4AT7B 5HMLA 4E80A 5J2BA 2BPFA 3BDPA 1BPDA 2RDIA 5D49A 4RT2A 4MF8A 8ICJA 4F4ZA 3H3AA 1QSYA 4DQQA 4KN4A 3MR6A 9ICVA 4IG8A 4J9SA 1L3VA 2HHXA 2O5AA 1ZQBA 2BR0A 4KLTA 2W9CA 5KFWA 7ICIA 1X2IA 5DBBA 3OGUA 3MGHA 2IBKA 2ZH3A 4ECWA 4ECZA 4PHAA 5KT6A 3ZDAA 8ICWA 2PBEA 2BQ3A 1ZJMA 8ICBA 3OV7A 2DPJA 2F1IA 4RU9A 3JPQA 3TAPA 5J29A 5DGAA 2ZTDA 3G6VA 2LYHA 3Q8LA 1XC9A 3H8WA 1CUKA 3G6YA 2C2EA 2ZTCA 2OWOA 4ECSA 5KFLA 4DF8A 5KT5A 9ICOA 4J9NA 5DG8A 4KLFA 3H37A 4B9TA 3GIKA 3OVSA 3M9NB 4NKUA 2FPKA 4F4KA 4I2IA 5IIKA 1RPLA 4M6WB 4ED6A 3PW0A 1ZQRA 7ICHA 1R8CA 3M9MB 2V9WA 4YQWA 1UA1A 3UPSA 2DRBA 2UVVA 5DQGA 2NRTA 4DFKA 2C22A 4IRKA 1TFRA 4UB1A 2IMWP 9ICLA 2DVIA 5CA7A 1X9WA 2JZBA 5IIJA 5EWFA 3JPOA 1XSLA 1UEVA 1N56A 1X9MA 3EPGA 4DLGA 4ELTA 5DKWA 1KRPA 4F3OA 4DL2A 2BPCA 4WC3A 3B0YA 3KHHA 3KHRA 2MUTA 1IXRA 4EBCA 2DR9A 5J2KA 3MDCA 2AQ0A 3N97B 3H39A 4RUCA 1BVSA 4YR3A 4I2GA 4O3PA 4I2EA 4I2FA 4NLGA 3RAQA 4RWPA 4NM2A 2HVIA 8ICAA 4J9QA 4B9UA 1JXLA 4B9VA 5KG2A 1U47A 3RH4A 4MFFA 3TFSA 3OHBA 4DL7A 7ICTA 1WCNA 3EWAA 7ICSA 5F9LA 5KFJA 1LV5A 2HHTA 3AQNA 5CHGA 5J0OA 2XGQA 1NKBA 1PX5A 8ICOA 1YLQA 1ZQEA 3H7IA 4EBEA 9ICBA 5KFCA 2DR7A 3ORYA 1KTQA 5IIIA 2P6RA 2BCRA 1BGXT 4ED1A 1ZQFA 4IQWA 2C2DA 3JPRA 4XRHA 1HJPA 2UVRA 8ICNA 1KNYA 2P66A 4RNNA 3MR2A 3GIMA 8ICMA 9ICUA 4FS1A 4QZGA 3OJUA 4F4XA 4X4RA 4PGQA 4F5OA 2BQRA 3BQ1A 3AUOA 3SV3A 1IM4A 1QLNA 2KZ3A 2R8JA 9ICRA 1ZQOA 1ZQVA 4Q44A 2JEJA 4X4SA 3PO5A 1RZTA 3T3FA 1SL1A 4X4VA 5DB8A 5HRBA 2ASDA 4FBUA 2ZJ5A 4QZIA 4RQ5A 4IQVA 4DSKA 2KTQA 5DB6A 5KFIA 4QZEA 1PZNA 4DOCA 4EBJA 2Y1IA 4MF2A 5KFFA 8ICPA 3FYHA 3G6XA 1TK8A 4WC1A 4RWOA 1ZQJA 4DQSA 1TV9A 4MEXA 4DQRA 2HHSA
chains in the Genus database with same CATH superfamily
3IHQB 3KZXA 3UXPA 1JXEA 4G9BA 4QWBA 4R65A 4AT8A 1X9SA 2FMSA 2F8KA 9ICQA 2CXYA 4O3QA 1JROA 2EAMA 2ZH5A 4AYBF 2J6SA 1RYSA 4M9NA 4JLXA 1J2NA 2W8LA 4MKPA 4WH5A 5KFHA 1BNOA 4PHPA 5KFSA 4RQ7A 1UETA 3MBYA 2DKZA 4TUPA 1DK3A 5J2EA 3ICXA 2FLPA 8ICKA 4WC2A 3PW2A 4CF3A 2WTFA 1Q8KA 3BS5A 9ICSA 1QQ6A 1D8YA 4RQ2A 1WWUA 3EYZA 3QZ7A 1S0NA 1L7NA 3BS5B 3TKAA 5D63A 5ALTA 1VFGA 4UAUA 5ALZA 1JAJA 2VJ4A 5AIBA 4G3IA 4DO9A 2YB1A 4EEKA 4M9GA 5KFTA 3EF2A 2OEHA 5ALXA 1NK5A 4UAZA 2DR5A 3BQTA 1VJ7A 1ZD5A 5DQHA 4YR0A 2N1RA 3C28A 4F2RA 5ALQA 5EWGA 3PW4A 5KG3A 4QW9A 2OHFA 5TISU 4XUSA 5AM5A 3OHAA 4FHPA 4DSEA 1AQ6A 4YXMA 2UVUA 3KFUF 1GO3F 3U26A 4O69A 1ZETA 3H8JA 3RB3A 2JEIA 1ZQSA 5HRIA 3MGIA 4K9AA 4JWMA 3JPNA 1F5SA 5AKHA 4NL9A 4I2AA 4RUAA 2JGAA 4C4TA 5AK3A 2ZIUA 3E58A 8ICRA 1UEUA 1NKEA 2XC9A 3WFQE 4RQ4A 4F5NA 3GIIA 5HRHA 4EZ6A 4KLSA 2J6UA 3PX6A 5H2FU 4K98A 4K4IA 1Q3UA 1DGSA 3C21A 2VA2A 1X66A 5DQIA 1KFSA 3RJGA 1T94A 5A0LA 2BHNA 4YVZA 2QLTA 3HRDD 3SAFA 5KL1B 4DQIA 4FHYA 5AM2A 3RFAA 2IHMA 3UXOA 3NWIA 4F2SA 2A1JB 4QWDA 3K7DA 4M9LA 4UW9A 5ALSA 5KFUA 5CP2A 3JCFA 2KV2A 4TURA 2H3VA 5HRLA 4O5KA 1XU4A 3V7KA 1ZOLA 4R8UB 1L7PA 2O1PA 3BQ2A 3RB6A 1B0XA 4BWMA 2AU0A 2NRKA 4K96A 1FA0A 3E0FA 1SXDA 4Q43A 2VJ5A 4P2HA 1FO4A 2XCPA 4I29A 1L3SA 2G0AA 2ZH7A 4GXJA 1NJXA 5J0WA 5JU5A 2F1HA 2ISPA 3ER9B 3HJ4A 4B9SA 2E1EA 1X40A 4BXOA 5CFSA 1NK4A 5FP0A 3TI0A 2KVSA 5J0UA 9ICPA 4NLNA 2PMZC 1SWVA 4ECUA 3M6KA 3M6ZA 3PMLA 3QUBA 4X4PA 2JR5A 5AM1A 1UPHA 3Q8QB 3PV8A 1ZQIA 4JWNA 2KFNA 3SZ2A 4WC0A 1R8AA 4HX0A 2VANA 5JTGA 3Q8PB 4YXJA 1XO1A 3PHZA 4Y2RA 1NJWA 5KFDA 4EEDA 4WC7A 3F2DA 1JX4A 3TFRA 2LM1A 4I2HA 5KFYA 5CJ7A 2PFNA 1N62A 4NV0A 2KOBA 4LZDA 5J2AA 2IOFK 2KE7A 2LKYA 2AH5A 4NM1A 2PFQA 5HR7A 9ICGA 4UBCA 9ICFA 1K5OA 4F93B 4JMUA 1TFYA 4HAIA 4Z6CA 5IILA 4LJXA 5TZVA 4IR1A 4X4QA 5AK6A 4TUQA 5DLFA 3SI8A 2EANA 2Y0SC 3OVBA 1U9LA 5HNKA 2R8HA 1LB2B 2Q4TA 1KSPA 2WAQF 5DECA 1L8LA 2RHFA 1TAQA 2Q0ZX 5E79U 4X4OA 4ZH4A 1KW4A 5EE0A 7ICMA 7ICLA 1SV4A 1A76A 4ICAA 1KFDA 2W9BB 3KTQA 2M2UA 5KFKA 1RDFA 2ZH1A 4ECQA 2ZXHA 4NLKA 1SL0A 4C8NA 4QNLA 3ZD9A 1CRXA 4PZNA 1KFTA 3UMGA 2WB1F 2MAXA 3MABA 5ALRA 4DS5A 2XI9A 4JUZA 5DBCA 5HHHA 1TAMA 4E0DA 1JQRA 4X0BA 5F9NA 4DL4A 1DGJA 1ZJNA 4JV2A 1H38A 2LBOA 3MC1A 3NS1A 1K1SA 3V6KA 1QQ5A 2KN7A 3NASA 1URJA 3JPSA 1U4BA 2QARB 3PX0A 2KIWA 4DL3A 5DB9A 8ICXA 2CN1A 1TAUA 1DOQA 2B0CA 2P6UA 1WOTA 3UM9A 4RT2A 3H3AA 3AL0B 1JRPA 3F5EA 4IG8A 1ZD3A 2HHXA 2O5AA 1PUZA 2BR0A 4KLTA 2ZIVA 3KD3A 4ECZA 5KT6A 8ICWA 2PBEA 2BQ3A 5AHXA 3OV7A 2F1IA 3C29A 1F0MA 2D8CA 5KT5A 4J9NA 3GIKA 3M9NB 2G08A 5IIKA 1RPLA 4M6WB 4ED6A 7ICHA 4DFKA 9ICLA 1TFRA 4OCZA 5IIJA 1UEVA 1XSLA 1N56A 4DLGA 4DL2A 3B0YA 2MUTA 2AQ0A 3H39A 4RUCA 1BVSA 4I2FA 3RAQA 2B6GA 4NM2A 2HVIA 8ICAA 3K1ZA 5KG2A 5D62A 3TFSA 3OHBA 7ICTA 4F72A 3WU2U 5B3QA 1ZXIA 2K8CB 1ZQEA 9ICBA 2DR7A 1LKYA 3ORYA 2BCRA 4ED1A 4OJLA 2IOFA 2H3IA 2HI0A 4F5OA 1QLNA 2R8JA 3F2CA 9ICRA 3SENA 3AEVA 2JXJA 1ZQVA 3QUTA 1SL1A 4X4VA 5DB8A 2KTQA 5KFIA 1PZNA 3FYHA 2K8AA 3G6XA 4WC1A 3FC4A 1YZ6A 4DQRA 2NYVA 4DFDA 7ICOA 3Q8SB 5L1LA 4RPYA 3GQCA 1Z4NA 3E2EA 5ALDA 1UHUA 3N28A 5AKIA 1QSLA 2ID1A 4J9OA 9ICHA 1SGGA 3BJYA 3WK6A 1PVPA 3HIYA 4EYIB 5ALHA 1TFWA 2YQEA 4O3NA 4NXWA 1ZQNA 5HRDA 4C7YA 5JTIA 3V7JA 1JMSA 3Q8MA 3RJKA 1OXJA 3OSPA 1COOA 1FEZA 3WK4A 4EP7A 2HBLA 3SD7A 4PGYA 1Z3EB 3KHLA 4K4GA 4YD1A 2R8GA 1SB3C 4Y2YA 4RQMA 3FM9A 3PVXA 2B4VA 3WKEA 4AT9A 3K1RB 4M47A 1NO5A 2BQUA 3LQCB 5T14A 1UT5A 4YN4A 7ICEA 2O6KA 2G06A 3IRUA 1TVAA 1GPJA 4DQPA 1NK6A 4K99A 2W9CB 4WOYA 2QKQA 5GTHU 4FFDA 3M8RA 3LWLA 3RRGA 4F92B 2OH2A 4X4UA 1S0OA 2OM6A 3WK8A 1MIYA 4Z6FA 8ICVA 3V7LA 4PL1A 2LYAA 3V72A 1NK9A 4UASA 4F4YA 5IINA 2BCVA 2KZMA 4PL2A 2HOFA 2EH9A 4IQUA 4NY8A 3RJJA 3RBDA 2E8PA 2FMQA 2ZH2A 3NVVA 3AQKA 3C66A 5DDYA 2XVTA 5ALWA 4XA5A 4F5RA 3H0RB 4DL6A 4O9MA 2XY6A 2W8KA 4J9LA 7ICPA 4EELA 4O68A 4I2JA 5ALVA 2CPRA 4MEYA 5EE3A 4GXKA 3OWGA 5GTIU 2KHQA 3RJIA 3AQFA 2ZUBA 4KLQA 4UBBA 3VCBA 4HYKA 2W03A 3EPIA 4ED0A 9ICJA 1JI7A 4DF4A 2A1JA 5KAFU 3A0BU 4PH5A 5AKEA 3DEEA 4R8UA 5ALUA 1L7MA 1ZQ1C 2L5YA 2ZH9A 3NVYA 5KFEA 3IM1A 2KFZA 2ZUDA 4GFJA 1WYGA 3QU5A 4YMMA 4TQRA 2KMDA 4YCXA 4DSFA 3QUQA 5KFVA 3H40A 4M9JA 7ICNA 4QZ9A 3GDXA 1RYRA 2KIVA 3QXGA 3ETLA 3AN1A 3IG5A 5KT2A 3GILA 1ZQPA 5KFNA 5C0YA 3I1YA 2IHOA 2NRVA 4Q45A 1SL2A 5AI4A 3C1YA 3PSIA 3QZ8A 1ZQXA 8ICHA 4KLJA 4Y2JA 2HSZA 5AK5A 2NO4A 2M9NA 1XS9D 2OXOA 4OAGA 1NK8A 3PR5B 1V9PA 4EX6A 2YX8A 2JMGA 1NK0A 4QIWC 2H5XA 1L6NA 1KDHA 2LHTA 2E8NA 4FZNA 3PY8A 3MFHA 3AM9A 3FAHA 4IQTA 1MQ3A 8ICSA 3JPTA 4EV6A 3GFKB 5KG4A 4K4HA 2Z7JA 2G5IB 4C8MA 8ICTA 3AU2A 4B9LA 2DQNB 3OUYB 1UT8A 2AGQA 2K8BB 5HR9A 5KFRA 1L3UA 3QEBZ 4O3MA 7ICJA 3KKAA 5DLGA 4N7RA 5HC9A 3F2BA 3J81j 1VJ5A 4Q8FA 1MC8A 3RJEA 1FFVA 5J0RA 1IIPA 1TK5A 2HOIA 4U6PA 4KMOB 5KT7A 4R64A 2NRZA 2W9MA 4CGZA 3GV8B 1U45A 4CDGA 4RQ1A 1ZD2P 2WF9A 4RNMA 4O3SA 4CF5A 4YD2A 4US9A 2ZH4A 1S9FA 2QB1A 4A8EA 4KLMA 2EAOA 4MFAA 2JH1A 3CRXA 2WF6A 2J6TA 5J0TA 2W9AA 5HREA 1L7OA 2V4QA 2F77X 1KBUA 2W55A 3D2SA 1M6YA 3UQ2A 3OJSA 3HKZC 1D9FA 3R9KA 1ZQYA 4UB5A 3MDAA 4DFMA 3HP6A 4RWNA 2F2AB 1HUZA 4AP9A 1QQ7A 4Z6EA 2B21A 4DLEA 2HBJA 5J2FA 2HDOA 1ZQZA 5KFAA 2PXIA 4S3NA 4FBTA 3AU6A 4YR2A 3PSTA 1NKCA 4KLUA 2LI6A 5J2DA 2YMMA 4WC6A 1DRGA 2W7PA 5KT4A 4DOAA 5KT3A 3SMVA 2WF8A 3OUYA 3PMNA 4M9HA 2BBJA 4K8VA 4EYHB 2Y1JA 2DGZA 4ED8A 1T4GA 2K4EA 3PNCA 5KG0A 3SEIA 9ICTA 2H3ZA 2BCQA 4P0QB 8ICQA 2E8MA 2ZIVB 9ICAA 3M8SA 4K97A 2KG5A 4KLIA 1S5LU 3MCRA 5KFMA 2IA6A 4MHVA 4KLDA 3ZI4A 2BKEA 2RP5A 1L8OA 3LVVA 2YN4A 3JYYA 4RPXA 4BGDA 5AKLA 2Q66A 8ICUA 4PHEA 4JV1A 3QE9Y 2VKQA 2ASJA 4QZDA 2HW3A 4TQSA 5BOLA 1Q46A 4M6WA 1SKWA 4RT3A 1UA0A 1ZQDA 4E80A 5ALOA 4F4ZA 3GU3A 1ZD4A 1V85A 4KN4A 9ICVA 3CW2C 4OAFA 4B6JA 2D6FC 5AM0A 5B5EU 4PHAA 1ZJMA 4RU9A 5DGAA 2MRLA 4ACOA 1D8BA 1XC9A 3G6YA 4OD0A 1VLBA 5ALYA 2ZTCA 2C2EA 2OWOA 5KFLA 5DG8A 4KLFA 4B9TA 2FPKA 1R8CA 1NNLA 3UPSA 2DRBA 2C22A 2IMWP 3JPOA 1J97A 5DKWA 2BPCA 4K9BA 3KHRA 2DR9A 1IXRA 2F3NA 5AKJA 4NLGA 2B56A 5ALFA 5AKZA 4MFFA 4DL7A 5KFJA 2FI1A 1ECWA 5EE1A 3WKAA 3AQNA 5CFTA 5CHGA 1PX5A 4CE6A 3H7IA 4EBEA 5KFCA 5IIIA 2P6RA 4IQWA 1RQNA 1HJPA 1KNYA 4RNNA 1YZ7A 3N7RC 8ICMA 4X4RA 4QZGA 3OJUA 3AUOA 3SV3A 2EZZA 2MA1A 1IM4A 2KZ3A 4Q44A 2JEJA 4X4SA 3PO5A 3QU7A 5EE9A 3IV6A 1SIJA 5HRBA 3QUCA 4FBUA 2ZJ5A 4RQ5A 4IQVA 1SV0A 4Y2UA 1WWVA 5DB6A 2ESEA 4DSKA 4QZEA 2Y1IA 4MF2A 8ICPA 5ALLA 2W54A 1VDVA 4OAHA 1TV9A 2ZIXB 4AYBC 3SQIA 4JB3A 3NTUA 1NJZA 1ZQGA 2E3TA 1T3NA 4C7ZA 4TUSA 4QZHA 3LVWA 3IG8A 3H8MA 4UAWA 3GV7B 5KFOA 2F1JA 3NVZA 1MQ2A 5ALNA 1OUQA 4DOBA 4GC7A 2KKVA 1X6JA 3RBEA 1OU5A 2CRXA 3JZ0A 2DVIA 4CCHA 4J9PA 4YMOA 2W7OA 3HX0A 1ZQKA 4ECVA 3IDWA 2A1AA 2KNJA 4X0AA 1RM6C 2ES6A 4E7XA 3WFPA 2WHEA 1RXWA 1SKRA 1QTMA 3NUQA 4C4SA 4JLZA 1V4AA 4R66A 4RQ0A 4QZAA 2ZTEA 3LDAA 5L1JA 4NXZA 4J9MA 2RFFA 1X42A 4UD4A 1IV8A 2GO7A 4FHXA 3RR7A 1WG8A 3ISDA 2JRZA 5KG6A 2I1QA 5J2JA 4FH3A 1O08A 2FLNA 4LVSA 4NL9C 4EX7A 4KLLA 4Y2PA 1X6IA 1NZPA 2HOQA 1HEKA 4BUGA 5KFXA 5AKXA 4XQ7A 4EBKA 2EAPA 5CR0A 2HHQA 3A0HU 1ZQWA 2ZIUB 2LYBA 1COKA 1K1QA 1LKYB 3HW8A 3TADA 3C2LA 2QB0A 2DBYA 3BQ7A 2KK0A 4DL5A 2ZJAA 8ICLA 4QZFA 2VIXA 3T5JA 4X4NA 2LPEA 4RQ3A 5L1MA 3M9OB 4QW8A 3C1ZA 4ED2A 3BQ0A 4FZMA 2P35A 5CWRA 4RQ8A 3JPPA 3MR3A 3TQ1A 4C8KA 2KKPA 2FPLA 5B66U 2HHPA 3MGVA 2HHWA 4GXIA 3H4BA 5KAIU 3O0FA 2AXTU 4RZRA 3L4PA 3RR8A 2UVWA 2F8LA 4QWEA 5JUMA 5AI0A 3OPXA 4XQ8A 4QZ8A 2GAFD 4DEZA 2NRWA 3CP8A 4NXUA 5AM3A 1KQQA 4O67A 4UB6U 3PW7A 5ALPA 2ODGA 4WQKA 2IHNA 5ALKA 3PZPA 2KP7A 1SV0C 2ZJ8A 9ICXA 2G09A 1ED1A 2OCEA 4UARA 2NO5A 2GA9D 4NJ8A 4BXOB 2M2TA 3PSPA 4O5EA 2PFPA 1MIWA 5ALGA 4QWAA 4JV0A 5AKYA 3HPOA 1S0VA 3EUB2 3PX4A 2G07A 2ZIXA 4C8OA 9ICNA 2XY5A 4NWIA 2BCUA 3RJHA 1HUOA 1B43A 4ZOHC 4NLBA 4EBDA 3CK6A 1JN3A 4X5VA 4Y2XA 2KICA 8ICGA 4KLEA 4NKTA 1ZQLA 3N7SC 1BPEA 1NJYA 1NZBA 4LEVA 1Z00B 4O6AA 2NRXA 5J0SA 1Q79A 5DB7A 1XO0A 3K4GA 2DR8A 2YMLA 5D61A 4NXXA 1NK7A 1EXNA 1HIWA 3GV5B 1U49A 2JEGA 3QYPA 4EZ9A 4UB8U 4QWCA 2KJ8A 2FLLA 2PMZF 5J0PA 3H0LB 5DG7A 2ZUCA 2PKEA 5DEDA 2DRAA 5G5GA 2BDPA 4KMUA 3L5KA 3ZDEA 4LT6A 4IR9A 4R63A 4BX9C 4WC4A 3ZD8A 3C23A 5HR6A 4UB4A 3T79A 2W3RA 4M04A 2I6XA 5DDMA 2G5HB 5K4LA 4CNQA 2ZH8A 1PK1A 4KLOA 2VA3A 3EZ5A 4NLCA 3NVWA 5J8YC 3UQ0A 2WAQC 1RG6A 1ZQQA 1PK1B 1N48A 3RF9A 4C0ZA 1R89A 4J9KA 4FH5A 5BPCA 4FZLA 4FO1A 3ETRA 2EDUA 4UD5A 9ICWA 1ZQMA 4IL6U 2GH1A 2JHDA 1QCKA 2K4PA 8ICFA 2C2RA 4O5CA 1ZQAA 3IN5A 4GC6A 1B22A 1JIHA 4CF4A 4AT9B 1Z1VA 1WUDA 4PHDA 2RQ5A 3QX7A 4EEYA 4QZBA 4I28A 2FJ6A 1Y88A 4JK1A 2WB1C 2FMPA 4NLZA 2BCSA 2Y0SF 3C2MA 3HJ1A 4QZCA 2NV3A 2FCLA 2M0NA 3UMCA 2XO7A 1XSPA 2BDUA 1RQLA 9ICMA 8ICYA 3C18A 3QU2A 5KFGA 5BOMA 2BBHA 3PR4A 7ICKA 2Y9TA 3OTQA 4WBZA 5J0YA 3ISCA 7ICGA 3RH5A 3NVOA 2WFAA 2ZHBA 2ZHAA 5AI9A 2PI5A 4BJQA 1IG6A 4OO1J 3NGDA 5CB1A 4FHWA 1ZQCA 2ZXIA 1B4FA 1T8EA 2HMXA 4WC5A 1P7DA 5D46A 3TANA 1L3TA 4MFCA 4P0PA 4YMNA 2H3QA 2HHUA 3C5GA 2PFOA 2W04A 3ZDCA 3TACB 1N5WA 4IRCA 3K75D 5L9XA 1LVHA 2LM4A 3GIJA 5HMLA 2BPFA 3BDPA 1BPDA 8ICJA 1QSYA 2KSOA 5B3PA 4J9SA 1L3VA 4OAIZ 1MN8A 7ICIA 2ZH3A 5DBBA 5ALIA 2QARA 4LEYA 3F53A 4QJFB 2DPJA 2ZTDA 3G6VA 3H8WA 5CHEA 2K4HA 4ECSA 4DF8A 9ICOA 3OVSA 3H37A 3WKDA 3WKCA 4I2IA 1ZQRA 3N7PD 2UVVA 5DQGA 2NRTA 4UB1A 5CA7A 1X9WA 2JZBA 2WF7A 2RLTA 2H3FA 2K60A 4ELTA 1KRPA 4F3OA 2DF4B 1KN5A 3KHHA 4EBCA 3MDCA 2W11A 3N97B 4I2GA 2GOLA 4I2EA 4J9QA 1JXLA 2XIDA 3BZKA 3RH4A 1U47A 5F3XB 5F9LA 2WF5A 1LV5A 2HCFA 4C4RA 3L3FX 2XGQA 1YLQA 2KD1A 5KL8B 1Z4OA 2C2DA 3JPRA 2UVRA 8ICNA 2P66A 3NRZA 3MR2A 9ICUA 3ED5A 4FS1A 4F4XA 2YMQA 1SWWA 2BQRA 3BQ1A 2AHOB 3M7DA 4Y2TA 2Y9UA 4EGWA 1CI4A 1RZTA 3D2QA 4KX5A 3WK5A 4P0PB 3DDHA 3CNHA 4EBJA 5JRTA 5KFFA 5AI8A 2HBKA 2FDRA 1XNSA 2EZXA 1ZQJA 4DQSA 1SXEA 4MEXA 4O3OA 4FS2A 3D2NA 2R8IA 3ERCC 3ONNA 5AKGA 1OW5A 1F5AA 1S97A 5KTQA 4C8LA 3T5HA 3WK7A 5DG9A 3WFSC 3D6JA 2XGPA 4ELVA 3RB0A 4DCCA 5CRXA 5C5JA 5KG7A 4WQLA 1QH9A 3N4MB 4Z6DA 4OJ5A 4P0QA 4M2YA 4GLXA 1V97A 1Z19A 1U48A 2RRDA 2HN2A 2LMRA 1O03A 4DFJA 2V4RA 3RAXA 3UXNA 4YFKA 1FFUA 4RNOA 2A3VA 2HN1A 1NOMA 2EZYA 2AQ4A 5AKKA 2E5SA 4O3RA 1KLNA 1QSSA 2W43A 1C7YA 3KZIU 4DS4A 4UB2A 1RYUA 2ASLA 4DSIA 4KLGA 4I2BA 3I28A 3QEAZ 3IP4B 4DSLA 4M0AA 3MR5A 3F5AA 4ECXA 4WBYA 2FPMA 5J8YA 3T5LA 3OVAA 3LYSA 4P4MA 2ATLA 1S77D 1X9XA 1PK3A 3H4DA 2HVHA 4LZGA 4YG2A 5KG5A 4UQGA 3AQEA 1DXSA 3ALRA 3GZFA 3L9DA 4RQ6A 4I2CA 2QB0B 5CEHA 4Y2QA 2ALZA 5EWEA 5HRFA 4P4PA 4KX3A 3EW9A 1KEJA 9ICEA 2KZZA 1ZQUA 1T7PA 4F5QA 2VA8A 8ICEA 3TARA 1TK0A 3NKUA 1F44A 4C80A 3HWTA 5AM4A 2OYYA 3H0MB 1BPXA 1XWLA 2AGPA 4BDPA 1C20A 3BS7A 4AT7A 1N60A 3RB4A 4DFPA 3TAQA 1PVQA 3HT3A 3HJEA 3C5FA 9ICCA 4F50A 4ELUA 5KFZA 1MA7A 5DBAA 2ZIWB 4M5DA 4PPXA 9ICIA 4J03A 3H8SA 1JUDA 5HHIA 2GWSA 4I27A 2ZIWA 1A0PA 3ZDBA 8ICZA 1S0MA 8ICIA 4ECYA 7ICFA 2XCAA 1D8LA 2C28A 2EWRA 4F71A 2YB4A 4PZOA 1TE2A 7ICUA 3M1YA 3RRHA 1BPZA 7ICVA 1R8BA 3UPQA 5KFPA 4B9MA 3V6JA 4ATBA 1ZRNA 1MSWD 3H38A 1CEZA 2KHVA 1V38A 3LWMA 3WKBA 3V6HA 3THVA 3MFIA 3QNMA 5HRKA 1Z00A 2DPIA 4BWJA 4J9RA 4B9NA 5CFUA 2BPGA 3RJFA 4QIWF 4U7CA 3AQMA 2KJ5A 4Y2SA 1S10A 2BZFA 1A77A 4PJ0U 9ICKA 1DK2A 2K89A 1BPYA 3KKAC 4WCWA 5HMMA 3I76A 3SAHA 2YTUA 5ALJA 3WFRE 4ECTA 5AIAA 5J0QA 1ZRMA 2B51A 3B9JA 4FHVA 5F2VO 4PGXA 4NXVA 3B0XA 5HP4A 5J2IA 1J2MA 5J2GA 4CRXA 5EOZA 1RXVA 1Q78A 1N5XA 4I2DA 2DFLA 4US8A 2GLEA 1ZQHA 3PO4A 2RDJA 2I5HA 1TKDA 2JZBB 4LEZA 3Q8KA 2DUYA 2XICA 1D9DA 1UCVA 5D4BA 1N61A 4Y2VA 3SR6A 4OJOA 4KLHA 1KKXA 1UQVA 4UAYA 3S6JA 2ZH6A 4F5PA 2JEFA 3NYBA 3SAGA 5KFQA 2KVCA 3T5KA 3QU9A 1BNPA 3KOOA 2BGWA 4DWIA 3RTVA 2BE3A 3WFOA 4ED7A 5IIMA 3OSNA 5KFBA 7ICQA 4IRDA 3DV9A 5HRGA 1PVRA 1WCLA 1FIQA 1ZQTA 4ATBB 2DL0A 3WK9A 3FDSA 4F91B 3C2KA 5L1IA 5AI5A 2D3DA 2XY7A 1Q3VA 3AQLA 3ISBA 4KITB 3QU4A 2HBMA 2AGOA 4EEBA 1AROP 1N2XA 3SYZA 2MUTB 5L1KA 2MU2A 4RQNA 4ED3A 5AICA 3PW5A 4AT8B 3HILA 2I9GA 3ZDDA 4P4OA 2IUBA 3HKZF 2MSNA 3AMZA 3KBBA 2K4IA 4ECRA 5J2HA 1SZPA 2R8KA 1BPBA 3LK9A 2F76X 2M2WA 5ALEA 3KHGA 1L5UA 3TADC 3Q8RB 4UAVA 2A19A 4I0UA 1S76D 4EENA 4RPZA 3CYMA 4IS7A 5KNIA 3RH6A 3UMBA 2W9BA 4FO6A 2PI4A 5KG1A 1N63A 2AJQA 5J2CA 4KN7A 4F4WA 4GIBA 2KEYA 5IIOA 5DGBA 4FE3A 4OJPA 1SKSA 4YP3A 4RWQA 4X4TA 2HHVA 4DSJA 3SV4A 4O0IA 4F8RA 2KJ9A 1NI3A 2M2VA 2KSOB 4UB3A 1MIVA 4E8FA 4Q8EA 1ZYQA 2FE9A 5J0XA 4KTQA 5AK4A 7ICRA 1XSNA 8ICCA 2ISOA 3ER8C 4AT7B 5J2BA 2RDIA 5D49A 4MF8A 4DQQA 3MR6A 1Z1BA 5ALMA 1ZQBA 2W9CA 5KFWA 3MGHA 1X2IA 3OGUA 1S8OA 1T3QA 2IBKA 4ECWA 3ZDAA 2E8OA 8ICBA 3JPQA 3TAPA 5J29A 2LYHA 2E1FA 4USAA 3Q8LA 1CUKA 4KM5A 4OJ6A 4NKUA 4F4KA 2YMPA 4UATA 3PW0A 2W3SA 3M9MB 2V9WA 4IC9A 4YQWA 1UA1A 4IRKA 5G5HA 5EWFA 2F44A 2YY6A 1X9MA 3EPGA 1YT3A 4WC3A 4XJEA 5J2KA 4YR3A 4RWPA 4O3PA 2DKXA 3PSFA 4B9UA 4B9VA 2R18A 3VC8A 1JALA 1WCNA 3EWAA 7ICSA 2HHTA 4LEWA 3BZCA 5J0OA 1NKBA 4WJ3B 8ICOA 1SZHA 1KTQA 1BGXT 1A6SA 1ZQFA 3NRWA 2DWQA 4XRHA 2JH7A 3GIMA 2IOHA 5AI6A 4PGQA 1KL9A 4KB6A 4NXTA 1ZQOA 2JV3A 3T3FA 2ASDA 4QZIA 4DOCA 1TK8A 4RWOA 2EQYA 2ZG6A 2HHSA
chains in the Genus database with same CATH topology
3NTUA 7ICOA 1NJZA 4O3OA 3Q8SB 5L1LA 3IHQB 4RPYA 3UXPA 3GQCA 4FS2A 1T3NA 1ZQGA 1JXEA 2R8IA 4QWBA 4R65A 3E2EA 4TUSA 4AT8A 1X9SA 4QZHA 1F5AA 1S97A 5KTQA 2FMSA 3T5HA 1QSLA 4C8LA 2ID1A 9ICQA 4J9OA 9ICHA 4UAWA 3GV7B 5DG9A 3WFSC 5KFOA 2F1JA 2XGPA 4ELVA 3RB0A 4O3QA 1MQ2A 3BJYA 5C5JA 5KG7A 3HIYA 3N4MB 4Z6DA 4EYIB 4GC7A 4DOBA 4M2YA 4GLXA 2J6SA 2ZH5A 1RYSA 3RBEA 4M9NA 1OU5A 4O3NA 1U48A 1TFWA 2W8LA 5KFHA 1ZQNA 1BNOA 5HRDA 3JZ0A 4PHPA 4DFJA 5KFSA 3V7JA 1JMSA 2V4RA 3Q8MA 3RAXA 3UXNA 4YFKA 4RQ7A 3MBYA 3OSPA 3RJKA 4CCHA 4J9PA 1UETA 4YMOA 1COOA 4RNOA 3HX0A 1ZQKA 4ECVA 1NOMA 2AQ4A 4TUPA 4EP7A 4PGYA 1Z3EB 4X0AA 1DK3A 3KHLA 5J2EA 4E7XA 4K4GA 4YD1A 2R8GA 3WFPA 1RXWA 1SKRA 1QTMA 2FLPA 8ICKA 4WC2A 3PW2A 4O3RA 1KLNA 1QSSA 1V4AA 2WTFA 3PVXA 4R66A 1C7YA 4RQ0A 4DS4A 4UB2A 4QZAA 2ASLA 4DSIA 4KLGA 4I2BA 4AT9A 2ZTEA 3LDAA 9ICSA 5L1JA 3QEAZ 4DSLA 4M0AA 4M47A 3MR5A 1NO5A 1D8YA 2BQUA 4ECXA 4RQ2A 3LQCB 2FPMA 4WBYA 4NXZA 1UT5A 4YN4A 3EYZA 4J9MA 3T5LA 2RFFA 4UD4A 3OVAA 7ICEA 4P4MA 3QZ7A 2ATLA 1S0NA 1S77D 4FHXA 3RR7A 3ISDA 1TVAA 4DQPA 3H4DA 2HVHA 1NK6A 5KG6A 4LZGA 2I1QA 4YG2A 5KG5A 4UQGA 1VFGA 5J2JA 3L9DA 4FH3A 2W9CB 2FLNA 4RQ6A 4I2CA 1JAJA 4LVSA 3M8RA 4G3IA 3LWLA 3RRGA 4DO9A 4KLLA 4F92B 1NZPA 4M9GA 5KFTA 2ALZA 4X4UA 5EWEA 1S0OA 5HRFA 4P4PA 1MIYA 1NK5A 3EW9A 4Z6FA 8ICVA 5KFXA 4UAZA 2DR5A 3V7LA 3BQTA 1KEJA 9ICEA 1VJ7A 2KZZA 1ZQUA 1T7PA 4XQ7A 5DQHA 4F5QA 4EBKA 3V72A 1NK9A 2VA8A 4F4YA 4YR0A 5IINA 8ICEA 3TARA 5CR0A 2BCVA 2HHQA 4F2RA 2KZMA 1TK0A 5EWGA 3PW4A 5KG3A 4IQUA 4NY8A 4QW9A 1ZQWA 3HWTA 4XUSA 3OHAA 3RBDA 2FMQA 3RJJA 2ZH2A 1BPXA 3AQKA 4FHPA 4DSEA 1K1QA 3C66A 3HW8A 5DDYA 1XWLA 4YXMA 2AGPA 3C2LA 2UVUA 4XA5A 4BDPA 4F5RA 4DL6A 4O9MA 4AT7A 2XY6A 1ZETA 3H8JA 4DL5A 3RB3A 2ZJAA 2JEIA 2W8KA 1ZQSA 5HRIA 4J9LA 3RB4A 3MGIA 4DFPA 3TAQA 8ICLA 4JWMA 4QZFA 7ICPA 3HT3A 3JPNA 3T5JA 4X4NA 3C5FA 9ICCA 4RQ3A 4I2JA 3M9OB 4I2AA 4F50A 4RUAA 5KFZA 4ELUA 4QW8A 3C1ZA 4ED2A 4MEYA 5DBAA 3BQ0A 4GXKA 8ICRA 1UEUA 4RQ8A 5CWRA 3JPPA 1NKEA 3RJIA 3MR3A 2XC9A 3TQ1A 4C8KA 4PPXA 4M5DA 3WFQE 2ZUBA 4KLQA 9ICIA 3H8SA 4RQ4A 4F5NA 2FPLA 4UBBA 5HHIA 3GIIA 2GWSA 5HRHA 2HHPA 4EZ6A 4I27A 4KLSA 2HHWA 4HYKA 4GXIA 3H4BA 2J6UA 3EPIA 3ZDBA 4ED0A 3PX6A 9ICJA 4K4IA 8ICZA 1DGSA 3C21A 1S0MA 2VA2A 4DF4A 4ECYA 2A1JA 4RZRA 5DQIA 8ICIA 4PH5A 3RR8A 2XCAA 1KFSA 7ICFA 1D8LA 2C28A 4R8UA 2UVWA 3RJGA 4QWEA 5JUMA 7ICUA 4XQ8A 3RRHA 2BHNA 4YVZA 4QZ8A 1BPZA 2ZH9A 5KFEA 7ICVA 1R8BA 3IM1A 3UPQA 2KFZA 4DEZA 2ZUDA 4DQIA 2NRWA 4FHYA 5KFPA 4YMMA 4TQRA 4B9MA 4YCXA 4DSFA 2IHMA 5KFVA 3UXOA 3V6JA 3H40A 4M9JA 7ICNA 4ATBA 4QZ9A 3PW7A 2A1JB 4F2SA 1MSWD 3H38A 4QWDA 3GDXA 1CEZA 2IHNA 3LWMA 4M9LA 3V6HA 3MFIA 3THVA 1RYRA 2ZJ8A 2KP7A 3ETLA 5HRKA 5KFUA 9ICXA 1Z00A 2DPIA 5CP2A 4BWJA 5KT2A 4J9RA 3GILA 4B9NA 4TURA 5HRLA 4O5KA 1XU4A 2BPGA 4BXOB 1ZQPA 3V7KA 2M2TA 3RJFA 4R8UB 5KFNA 2O1PA 3AQMA 4O5EA 2NRVA 4Q45A 3BQ2A 3RB6A 1S10A 1SL2A 3C1YA 4BWMA 3QZ8A 2AU0A 2PFPA 1ZQXA 1A77A 8ICHA 4QWAA 1MIWA 4JV0A 2NRKA 3HPOA 4KLJA 1FA0A 9ICKA 1DK2A 4Q43A 2M9NA 1S0VA 3PX4A 1XS9D 1BPYA 4P2HA 4WCWA 5HMMA 4C8OA 2XCPA 9ICNA 3WFRE 4I29A 2XY5A 1NK8A 1L3SA 2BCUA 3RJHA 2ZH7A 3PR5B 4ECTA 1HUOA 1B43A 5J0QA 1V9PA 5J0WA 4GXJA 1NJXA 2F1HA 2ISPA 4EBDA 3HJ4A 1NK0A 4B9SA 4FHVA 1JN3A 5F2VO 2H5XA 4X5VA 4PGXA 4BXOA 1KDHA 3B0XA 4KLEA 5HP4A 8ICGA 5J2IA 1ZQLA 5J2GA 4NKTA 3PY8A 1NK4A 1BPEA 5EOZA 1NJYA 3TI0A 1RXVA 1Q78A 4I2DA 3MFHA 2DFLA 4IQTA 5J0UA 1MQ3A 3JPTA 1ZQHA 4NLNA 8ICSA 3GFKB 3PO4A 2RDJA 5KG4A 4K4HA 9ICPA 4C8MA 4ECUA 8ICTA 1Z00B 3AU2A 3PMLA 4B9LA 1TKDA 4X4PA 2NRXA 5J0SA 1Q79A 3OUYB 2JZBB 1UT8A 5DB7A 3K4GA 3Q8KA 2DR8A 2AGQA 3Q8QB 5HR9A 3PV8A 5KFRA 1L3UA 1ZQIA 3QEBZ 1D9DA 4JWNA 7ICJA 1NK7A 5DLGA 1EXNA 3SZ2A 5D4BA 2KFNA 4WC0A 3GV5B 1R8AA 5HC9A 2VANA 1U49A 2JEGA 4KLHA 4EZ9A 3Q8PB 4QWCA 4Q8FA 1MC8A 4UAYA 2FLLA 3RJEA 2ZH6A 5J0PA 5J0RA 4YXJA 4F5PA 2JEFA 3NYBA 1TK5A 5DG7A 5KFQA 2ZUCA 1XO1A 3T5KA 1BNPA 5KT7A 5DEDA 2DRAA 4R64A 2BGWA 2BDPA 2NRZA 5KFDA 1NJWA 4DWIA 3RTVA 2W9MA 4KMUA 3ZDEA 2BE3A 4LT6A 4WC7A 4IR9A 1JX4A 3GV8B 4R63A 3TFRA 1U45A 4I2HA 3WFOA 4RQ1A 4WC4A 3ZD8A 3C23A 5KFYA 5CJ7A 2PFNA 4ED7A 4UB4A 5IIMA 3OSNA 4LZDA 4RNMA 5J2AA 4O3SA 5KFBA 7ICQA 4IRDA 8ICCA 4M04A 4YD2A 5DDMA 4NM1A 2ZH4A 1S9FA 2PFQA 2ZH8A 5HRGA 4KLOA 9ICGA 2VA3A 4KLMA 3EZ5A 4MFAA 1WCLA 1ZQTA 4UBCA 3UQ0A 4ATBB 9ICFA 1ZQQA 4F93B 2J6TA 1TFYA 5J0TA 3FDSA 4F91B 3C2KA 2W9AA 1N48A 4Z6CA 5IILA 5L1IA 5HREA 2V4QA 1R89A 5TZVA 4IR1A 4J9KA 4X4QA 2XY7A 4FH5A 5BPCA 3ISBA 3UQ2A 4TUQA 3AQLA 4KITB 4UD5A 9ICWA 1ZQMA 3OJSA 1D9FA 5DLFA 1ZQYA 4UB5A 3SI8A 3MDAA 2AGOA 4DFMA 1AROP 3OVBA 1U9LA 3HP6A 4RWNA 3SYZA 5HNKA 2MUTB 2R8HA 1LB2B 1HUZA 5L1KA 1KSPA 4ED3A 8ICFA 5DECA 2C2RA 4O5CA 1ZQAA 4Z6EA 2B21A 4DLEA 4GC6A 3PW5A 5J2FA 1TAQA 2Q0ZX 1B22A 4AT8B 1JIHA 1ZQZA 5KFAA 2PXIA 4AT9B 4S3NA 2I9GA 4X4OA 4ZH4A 4PHDA 4FBTA 3ZDDA 4EEYA 4QZBA 4I28A 1Y88A 4P4OA 3AU6A 7ICMA 4YR2A 4JK1A 7ICLA 2FMPA 4NLZA 2BCSA 4KLUA 3C2MA 1NKCA 3HJ1A 4QZCA 5J2DA 4ECRA 4WC6A 1A76A 5J2HA 1SZPA 1KFDA 2W9BB 3KTQA 2R8KA 2M2UA 5KFKA 1BPBA 5KT4A 2ZH1A 4ECQA 3LK9A 2XO7A 4DOAA 1XSPA 5KT3A 9ICMA 8ICYA 3C18A 4NLKA 5KFGA 1SL0A 5BOMA 4C8NA 3PR4A 2M2WA 1L5UA 3KHGA 3ZD9A 7ICKA 3OUYA 1KFTA 3Q8RB 2MAXA 3MABA 3PMNA 4M9HA 4EYHB 4DS5A 2Y1JA 4JUZA 5DBCA 4RPZA 1S76D 4WBZA 5J0YA 3ISCA 5HHHA 7ICGA 3RH5A 4ED8A 4E0DA 1JQRA 3RH6A 1T4GA 5F9NA 2W9BA 4FO6A 5KG1A 4DL4A 2PI4A 4X0BA 2ZHBA 1ZJNA 5J2CA 2AJQA 2ZHAA 3PNCA 4KN7A 4F4WA 2PI5A 5KG0A 4JV2A 9ICTA 2BCQA 1H38A 3NGDA 8ICQA 9ICAA 3M8SA 5IIOA 5CB1A 4FHWA 5DGBA 1ZQCA 1SKSA 4YP3A 4KLIA 4RWQA 4X4TA 1K1SA 4DSJA 2HHVA 3V6KA 3SV4A 4O0IA 1T8EA 4F8RA 2KN7A 4WC5A 5D46A 5KFMA 2IA6A 2M2VA 4KLDA 3JPSA 2BKEA 3TANA 1L3TA 4MFCA 1U4BA 4UB3A 4YMNA 2HHUA 1MIVA 3C5GA 4E8FA 3PX0A 2PFOA 3ZDCA 3JYYA 4RPXA 4Q8EA 4BGDA 1ZYQA 2Q66A 8ICUA 4PHEA 4JV1A 4DL3A 3QE9Y 5DB9A 5J0XA 4IRCA 8ICXA 2ASJA 4QZDA 2HW3A 4TQSA 5BOLA 3K75D 4KTQA 7ICRA 1XSNA 4M6WA 5L9XA 1DOQA 4RT3A 2P6UA 1UA0A 1SKWA 2ISOA 1TAUA 1ZQDA 3GIJA 1WOTA 4AT7B 5HMLA 4E80A 5J2BA 2BPFA 3BDPA 1BPDA 2RDIA 5D49A 4RT2A 4MF8A 8ICJA 4F4ZA 3H3AA 1QSYA 4DQQA 4KN4A 3MR6A 9ICVA 4IG8A 4J9SA 1L3VA 2HHXA 2O5AA 1ZQBA 2BR0A 4KLTA 2W9CA 5KFWA 7ICIA 1X2IA 5DBBA 3OGUA 3MGHA 2IBKA 2ZH3A 4ECWA 4ECZA 4PHAA 5KT6A 3ZDAA 8ICWA 2PBEA 2BQ3A 1ZJMA 8ICBA 3OV7A 2DPJA 2F1IA 4RU9A 3JPQA 3TAPA 5J29A 5DGAA 2ZTDA 3G6VA 2LYHA 3Q8LA 1XC9A 3H8WA 1CUKA 3G6YA 2C2EA 2ZTCA 2OWOA 4ECSA 5KFLA 4DF8A 5KT5A 9ICOA 4J9NA 5DG8A 4KLFA 3H37A 4B9TA 3GIKA 3OVSA 3M9NB 4NKUA 2FPKA 4F4KA 4I2IA 5IIKA 1RPLA 4M6WB 4ED6A 3PW0A 1ZQRA 7ICHA 1R8CA 3M9MB 2V9WA 4YQWA 1UA1A 3UPSA 2DRBA 2UVVA 5DQGA 2NRTA 4DFKA 2C22A 4IRKA 1TFRA 4UB1A 2IMWP 9ICLA 2DVIA 5CA7A 1X9WA 2JZBA 5IIJA 5EWFA 3JPOA 1XSLA 1UEVA 1N56A 1X9MA 3EPGA 4DLGA 4ELTA 5DKWA 1KRPA 4F3OA 4DL2A 2BPCA 4WC3A 3B0YA 3KHHA 3KHRA 2MUTA 1IXRA 4EBCA 2DR9A 5J2KA 3MDCA 2AQ0A 3N97B 3H39A 4RUCA 1BVSA 4YR3A 4I2GA 4O3PA 4I2EA 4I2FA 4NLGA 3RAQA 4RWPA 4NM2A 2HVIA 8ICAA 4J9QA 4B9UA 1JXLA 4B9VA 5KG2A 1U47A 3RH4A 4MFFA 3TFSA 3OHBA 4DL7A 7ICTA 1WCNA 3EWAA 7ICSA 5F9LA 5KFJA 1LV5A 2HHTA 3AQNA 5CHGA 5J0OA 2XGQA 1NKBA 1PX5A 8ICOA 1YLQA 1ZQEA 3H7IA 4EBEA 9ICBA 5KFCA 2DR7A 3ORYA 1KTQA 5IIIA 2P6RA 2BCRA 1BGXT 4ED1A 1ZQFA 4IQWA 2C2DA 3JPRA 4XRHA 1HJPA 2UVRA 8ICNA 1KNYA 2P66A 4RNNA 3MR2A 3GIMA 8ICMA 9ICUA 4FS1A 4QZGA 3OJUA 4F4XA 4X4RA 4PGQA 4F5OA 2BQRA 3BQ1A 3AUOA 3SV3A 1IM4A 1QLNA 2KZ3A 2R8JA 9ICRA 1ZQOA 1ZQVA 4Q44A 2JEJA 4X4SA 3PO5A 1RZTA 3T3FA 1SL1A 4X4VA 5DB8A 5HRBA 2ASDA 4FBUA 2ZJ5A 4QZIA 4RQ5A 4IQVA 4DSKA 2KTQA 5DB6A 5KFIA 4QZEA 1PZNA 4DOCA 4EBJA 2Y1IA 4MF2A 5KFFA 8ICPA 3FYHA 3G6XA 1TK8A 4WC1A 4RWOA 1ZQJA 4DQSA 1TV9A 4MEXA 4DQRA 2HHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NTU A;  7ICO A;  1NJZ A;  4O3O A;  3Q8S B;  5L1L A;  3IHQ B;  4RPY A;  3UXP A;  3GQC A;  4FS2 A;  1T3N A;  1ZQG A;  1JXE A;  2R8I A;  4QWB A;  4R65 A;  3E2E A;  4TUS A;  4AT8 A;  1X9S A;  4QZH A;  1F5A A;  1S97 A;  5KTQ A;  2FMS A;  3T5H A;  1QSL A;  4C8L A;  2ID1 A;  9ICQ A;  4J9O A;  9ICH A;  4UAW A;  3GV7 B;  5DG9 A;  3WFS C;  5KFO A;  2F1J A;  2XGP A;  4ELV A;  3RB0 A;  4O3Q A;  1MQ2 A;  3BJY A;  5C5J A;  5KG7 A;  3HIY A;  3N4M B;  4Z6D A;  4EYI B;  4GC7 A;  4DOB A;  4M2Y A;  4GLX A;  2J6S A;  2ZH5 A;  1RYS A;  3RBE A;  4M9N A;  1OU5 A;  4O3N A;  1U48 A;  1TFW A;  2W8L A;  5KFH A;  1ZQN A;  1BNO A;  5HRD A;  3JZ0 A;  4PHP A;  4DFJ A;  5KFS A;  3V7J A;  1JMS A;  2V4R A;  3Q8M A;  3RAX A;  3UXN A;  4YFK A;  4RQ7 A;  3MBY A;  3OSP A;  3RJK A;  4CCH A;  4J9P A;  1UET A;  4YMO A;  1COO A;  4RNO A;  3HX0 A;  1ZQK A;  4ECV A;  1NOM A;  2AQ4 A;  4TUP A;  4EP7 A;  4PGY A;  1Z3E B;  4X0A A;  1DK3 A;  3KHL A;  5J2E A;  4E7X A;  4K4G A;  4YD1 A;  2R8G A;  3WFP A;  1RXW A;  1SKR A;  1QTM A;  2FLP A;  8ICK A;  4WC2 A;  3PW2 A;  4O3R A;  1KLN A;  1QSS A;  1V4A A;  2WTF A;  3PVX A;  4R66 A;  1C7Y A;  4RQ0 A;  4DS4 A;  4UB2 A;  4QZA A;  2ASL A;  4DSI A;  4KLG A;  4I2B A;  4AT9 A;  2ZTE A;  3LDA A;  9ICS A;  5L1J A;  3QEA Z;  4DSL A;  4M0A A;  4M47 A;  3MR5 A;  1NO5 A;  1D8Y A;  2BQU A;  4ECX A;  4RQ2 A;  3LQC B;  2FPM A;  4WBY A;  4NXZ A;  1UT5 A;  4YN4 A;  3EYZ A;  4J9M A;  3T5L A;  2RFF A;  4UD4 A;  3OVA A;  7ICE A;  4P4M A;  3QZ7 A;  2ATL A;  1S0N A;  1S77 D;  4FHX A;  3RR7 A;  3ISD A;  1TVA A;  4DQP A;  3H4D A;  2HVH A;  1NK6 A;  5KG6 A;  4LZG A;  2I1Q A;  4YG2 A;  5KG5 A;  4UQG A;  1VFG A;  5J2J A;  3L9D A;  4FH3 A;  2W9C B;  2FLN A;  4RQ6 A;  4I2C A;  1JAJ A;  4LVS A;  3M8R A;  4G3I A;  3LWL A;  3RRG A;  4DO9 A;  4KLL A;  4F92 B;  1NZP A;  4M9G A;  5KFT A;  2ALZ A;  4X4U A;  5EWE A;  1S0O A;  5HRF A;  4P4P A;  1MIY A;  1NK5 A;  3EW9 A;  4Z6F A;  8ICV A;  5KFX A;  4UAZ A;  2DR5 A;  3V7L A;  3BQT A;  1KEJ A;  9ICE A;  1VJ7 A;  2KZZ A;  1ZQU A;  1T7P A;  4XQ7 A;  5DQH A;  4F5Q A;  4EBK A;  3V72 A;  1NK9 A;  2VA8 A;  4F4Y A;  4YR0 A;  5IIN A;  8ICE A;  3TAR A;  5CR0 A;  2BCV A;  2HHQ A;  4F2R A;  2KZM A;  1TK0 A;  5EWG A;  3PW4 A;  5KG3 A;  4IQU A;  4NY8 A;  4QW9 A;  1ZQW A;  3HWT A;  4XUS A;  3OHA A;  3RBD A;  2FMQ A;  3RJJ A;  2ZH2 A;  1BPX A;  3AQK A;  4FHP A;  4DSE A;  1K1Q A;  3C66 A;  3HW8 A;  5DDY A;  1XWL A;  4YXM A;  2AGP A;  3C2L A;  2UVU A;  4XA5 A;  4BDP A;  4F5R A;  4DL6 A;  4O9M A;  4AT7 A;  2XY6 A;  1ZET A;  3H8J A;  4DL5 A;  3RB3 A;  2ZJA A;  2JEI A;  2W8K A;  1ZQS A;  5HRI A;  4J9L A;  3RB4 A;  3MGI A;  4DFP A;  3TAQ A;  8ICL A;  4JWM A;  4QZF A;  7ICP A;  3HT3 A;  3JPN A;  3T5J A;  4X4N A;  3C5F A;  9ICC A;  4RQ3 A;  4I2J A;  3M9O B;  4I2A A;  4F50 A;  4RUA A;  5KFZ A;  4ELU A;  4QW8 A;  3C1Z A;  4ED2 A;  4MEY A;  5DBA A;  3BQ0 A;  4GXK A;  8ICR A;  1UEU A;  4RQ8 A;  5CWR A;  3JPP A;  1NKE A;  3RJI A;  3MR3 A;  2XC9 A;  3TQ1 A;  4C8K A;  4PPX A;  4M5D A;  3WFQ E;  2ZUB A;  4KLQ A;  9ICI A;  3H8S A;  4RQ4 A;  4F5N A;  2FPL A;  4UBB A;  5HHI A;  3GII A;  2GWS A;  5HRH A;  2HHP A;  4EZ6 A;  4I27 A;  4KLS A;  2HHW A;  4HYK A;  4GXI A;  3H4B A;  2J6U A;  3EPI A;  3ZDB A;  4ED0 A;  3PX6 A;  9ICJ A;  4K4I A;  8ICZ A;  1DGS A;  3C21 A;  1S0M A;  2VA2 A;  4DF4 A;  4ECY A;  2A1J A;  4RZR A;  5DQI A;  8ICI A;  4PH5 A;  3RR8 A;  2XCA A;  1KFS A;  7ICF A;  1D8L A;  2C28 A;  4R8U A;  2UVW A;  3RJG A;  4QWE A;  5JUM A;  7ICU A;  4XQ8 A;  3RRH A;  2BHN A;  4YVZ A;  4QZ8 A;  1BPZ A;  2ZH9 A;  5KFE A;  7ICV A;  1R8B A;  3IM1 A;  3UPQ A;  2KFZ A;  4DEZ A;  2ZUD A;  4DQI A;  2NRW A;  4FHY A;  5KFP A;  4YMM A;  4TQR A;  4B9M A;  4YCX A;  4DSF A;  2IHM A;  5KFV A;  3UXO A;  3V6J A;  3H40 A;  4M9J A;  7ICN A;  4ATB A;  4QZ9 A;  3PW7 A;  2A1J B;  4F2S A;  1MSW D;  3H38 A;  4QWD A;  3GDX A;  1CEZ A;  2IHN A;  3LWM A;  4M9L A;  3V6H A;  3MFI A;  3THV A;  1RYR A;  2ZJ8 A;  2KP7 A;  3ETL A;  5HRK A;  5KFU A;  9ICX A;  1Z00 A;  2DPI A;  5CP2 A;  4BWJ A;  5KT2 A;  4J9R A;  3GIL A;  4B9N A;  4TUR A;  5HRL A;  4O5K A;  1XU4 A;  2BPG A;  4BXO B;  1ZQP A;  3V7K A;  2M2T A;  3RJF A;  4R8U B;  5KFN A;  2O1P A;  3AQM A;  4O5E A;  2NRV A;  4Q45 A;  3BQ2 A;  3RB6 A;  1S10 A;  1SL2 A;  3C1Y A;  4BWM A;  3QZ8 A;  2AU0 A;  2PFP A;  1ZQX A;  1A77 A;  8ICH A;  4QWA A;  1MIW A;  4JV0 A;  2NRK A;  3HPO A;  4KLJ A;  1FA0 A;  9ICK A;  1DK2 A;  4Q43 A;  2M9N A;  1S0V A;  3PX4 A;  1XS9 D;  1BPY A;  4P2H A;  4WCW A;  5HMM A;  4C8O A;  2XCP A;  9ICN A;  3WFR E;  4I29 A;  2XY5 A;  1NK8 A;  1L3S A;  2BCU A;  3RJH A;  2ZH7 A;  3PR5 B;  4ECT A;  1HUO A;  1B43 A;  5J0Q A;  1V9P A;  5J0W A;  4GXJ A;  1NJX A;  2F1H A;  2ISP A;  4EBD A;  3HJ4 A;  1NK0 A;  4B9S A;  4FHV A;  1JN3 A;  5F2V O;  2H5X A;  4X5V A;  4PGX A;  4BXO A;  1KDH A;  3B0X A;  4KLE A;  5HP4 A;  8ICG A;  5J2I A;  1ZQL A;  5J2G A;  4NKT A;  3PY8 A;  1NK4 A;  1BPE A;  5EOZ A;  1NJY A;  3TI0 A;  1RXV A;  1Q78 A;  4I2D A;  3MFH A;  2DFL A;  4IQT A;  5J0U A;  1MQ3 A;  3JPT A;  1ZQH A;  4NLN A;  8ICS A;  3GFK B;  3PO4 A;  2RDJ A;  5KG4 A;  4K4H A;  9ICP A;  4C8M A;  4ECU A;  8ICT A;  1Z00 B;  3AU2 A;  3PML A;  4B9L A;  1TKD A;  4X4P A;  2NRX A;  5J0S A;  1Q79 A;  3OUY B;  2JZB B;  1UT8 A;  5DB7 A;  3K4G A;  3Q8K A;  2DR8 A;  2AGQ A;  3Q8Q B;  5HR9 A;  3PV8 A;  5KFR A;  1L3U A;  1ZQI A;  3QEB Z;  1D9D A;  4JWN A;  7ICJ A;  1NK7 A;  5DLG A;  1EXN A;  3SZ2 A;  5D4B A;  2KFN A;  4WC0 A;  3GV5 B;  1R8A A;  5HC9 A;  2VAN A;  1U49 A;  2JEG A;  4KLH A;  4EZ9 A;  3Q8P B;  4QWC A;  4Q8F A;  1MC8 A;  4UAY A;  2FLL A;  3RJE A;  2ZH6 A;  5J0P A;  5J0R A;  4YXJ A;  4F5P A;  2JEF A;  3NYB A;  1TK5 A;  5DG7 A;  5KFQ A;  2ZUC A;  1XO1 A;  3T5K A;  1BNP A;  5KT7 A;  5DED A;  2DRA A;  4R64 A;  2BGW A;  2BDP A;  2NRZ A;  5KFD A;  1NJW A;  4DWI A;  3RTV A;  2W9M A;  4KMU A;  3ZDE A;  2BE3 A;  4LT6 A;  4WC7 A;  4IR9 A;  1JX4 A;  3GV8 B;  4R63 A;  3TFR A;  1U45 A;  4I2H A;  3WFO A;  4RQ1 A;  4WC4 A;  3ZD8 A;  3C23 A;  5KFY A;  5CJ7 A;  2PFN A;  4ED7 A;  4UB4 A;  5IIM A;  3OSN A;  4LZD A;  4RNM A;  5J2A A;  4O3S A;  5KFB A;  7ICQ A;  4IRD A;  8ICC A;  4M04 A;  4YD2 A;  5DDM A;  4NM1 A;  2ZH4 A;  1S9F A;  2PFQ A;  2ZH8 A;  5HRG A;  4KLO A;  9ICG A;  2VA3 A;  4KLM A;  3EZ5 A;  4MFA A;  1WCL A;  1ZQT A;  4UBC A;  3UQ0 A;  4ATB B;  9ICF A;  1ZQQ A;  4F93 B;  2J6T A;  1TFY A;  5J0T A;  3FDS A;  4F91 B;  3C2K A;  2W9A A;  1N48 A;  4Z6C A;  5IIL A;  5L1I A;  5HRE A;  2V4Q A;  1R89 A;  5TZV A;  4IR1 A;  4J9K A;  4X4Q A;  2XY7 A;  4FH5 A;  5BPC A;  3ISB A;  3UQ2 A;  4TUQ A;  3AQL A;  4KIT B;  4UD5 A;  9ICW A;  1ZQM A;  3OJS A;  1D9F A;  5DLF A;  1ZQY A;  4UB5 A;  3SI8 A;  3MDA A;  2AGO A;  4DFM A;  1ARO P;  3OVB A;  1U9L A;  3HP6 A;  4RWN A;  3SYZ A;  5HNK A;  2MUT B;  2R8H A;  1LB2 B;  1HUZ A;  5L1K A;  1KSP A;  4ED3 A;  8ICF A;  5DEC A;  2C2R A;  4O5C A;  1ZQA A;  4Z6E A;  2B21 A;  4DLE A;  4GC6 A;  3PW5 A;  5J2F A;  1TAQ A;  2Q0Z X;  1B22 A;  4AT8 B;  1JIH A;  1ZQZ A;  5KFA A;  2PXI A;  4AT9 B;  4S3N A;  2I9G A;  4X4O A;  4ZH4 A;  4PHD A;  4FBT A;  3ZDD A;  4EEY A;  4QZB A;  4I28 A;  1Y88 A;  4P4O A;  3AU6 A;  7ICM A;  4YR2 A;  4JK1 A;  7ICL A;  2FMP A;  4NLZ A;  2BCS A;  4KLU A;  3C2M A;  1NKC A;  3HJ1 A;  4QZC A;  5J2D A;  4ECR A;  4WC6 A;  1A76 A;  5J2H A;  1SZP A;  1KFD A;  2W9B B;  3KTQ A;  2R8K A;  2M2U A;  5KFK A;  1BPB A;  5KT4 A;  2ZH1 A;  4ECQ A;  3LK9 A;  2XO7 A;  4DOA A;  1XSP A;  5KT3 A;  9ICM A;  8ICY A;  3C18 A;  4NLK A;  5KFG A;  1SL0 A;  5BOM A;  4C8N A;  3PR4 A;  2M2W A;  1L5U A;  3KHG A;  3ZD9 A;  7ICK A;  3OUY A;  1KFT A;  3Q8R B;  2MAX A;  3MAB A;  3PMN A;  4M9H A;  4EYH B;  4DS5 A;  2Y1J A;  4JUZ A;  5DBC A;  4RPZ A;  1S76 D;  4WBZ A;  5J0Y A;  3ISC A;  5HHH A;  7ICG A;  3RH5 A;  4ED8 A;  4E0D A;  1JQR A;  3RH6 A;  1T4G A;  5F9N A;  2W9B A;  4FO6 A;  5KG1 A;  4DL4 A;  2PI4 A;  4X0B A;  2ZHB A;  1ZJN A;  5J2C A;  2AJQ A;  2ZHA A;  3PNC A;  4KN7 A;  4F4W A;  2PI5 A;  5KG0 A;  4JV2 A;  9ICT A;  2BCQ A;  1H38 A;  3NGD A;  8ICQ A;  9ICA A;  3M8S A;  5IIO A;  5CB1 A;  4FHW A;  5DGB A;  1ZQC A;  1SKS A;  4YP3 A;  4KLI A;  4RWQ A;  4X4T A;  1K1S A;  4DSJ A;  2HHV A;  3V6K A;  3SV4 A;  4O0I A;  1T8E A;  4F8R A;  2KN7 A;  4WC5 A;  5D46 A;  5KFM A;  2IA6 A;  2M2V A;  4KLD A;  3JPS A;  2BKE A;  3TAN A;  1L3T A;  4MFC A;  1U4B A;  4UB3 A;  4YMN A;  2HHU A;  1MIV A;  3C5G A;  4E8F A;  3PX0 A;  2PFO A;  3ZDC A;  3JYY A;  4RPX A;  4Q8E A;  4BGD A;  1ZYQ A;  2Q66 A;  8ICU A;  4PHE A;  4JV1 A;  4DL3 A;  3QE9 Y;  5DB9 A;  5J0X A;  4IRC A;  8ICX A;  2ASJ A;  4QZD A;  2HW3 A;  4TQS A;  5BOL A;  3K75 D;  4KTQ A;  7ICR A;  1XSN A;  4M6W A;  5L9X A;  1DOQ A;  4RT3 A;  2P6U A;  1UA0 A;  1SKW A;  2ISO A;  1TAU A;  1ZQD A;  3GIJ A;  1WOT A;  4AT7 B;  5HML A;  4E80 A;  5J2B A;  2BPF A;  3BDP A;  1BPD A;  2RDI A;  5D49 A;  4RT2 A;  4MF8 A;  8ICJ A;  4F4Z A;  3H3A A;  1QSY A;  4DQQ A;  4KN4 A;  3MR6 A;  9ICV A;  4IG8 A;  4J9S A;  1L3V A;  2HHX A;  2O5A A;  1ZQB A;  2BR0 A;  4KLT A;  2W9C A;  5KFW A;  7ICI A;  1X2I A;  5DBB A;  3OGU A;  3MGH A;  2IBK A;  2ZH3 A;  4ECW A;  4ECZ A;  4PHA A;  5KT6 A;  3ZDA A;  8ICW A;  2PBE A;  2BQ3 A;  1ZJM A;  8ICB A;  3OV7 A;  2DPJ A;  2F1I A;  4RU9 A;  3JPQ A;  3TAP A;  5J29 A;  5DGA A;  2ZTD A;  3G6V A;  2LYH A;  3Q8L A;  1XC9 A;  3H8W A;  1CUK A;  3G6Y A;  2C2E A;  2ZTC A;  2OWO A;  4ECS A;  5KFL A;  4DF8 A;  5KT5 A;  9ICO A;  4J9N A;  5DG8 A;  4KLF A;  3H37 A;  4B9T A;  3GIK A;  3OVS A;  3M9N B;  4NKU A;  2FPK A;  4F4K A;  4I2I A;  5IIK A;  1RPL A;  4M6W B;  4ED6 A;  3PW0 A;  1ZQR A;  7ICH A;  1R8C A;  3M9M B;  2V9W A;  4YQW A;  1UA1 A;  3UPS A;  2DRB A;  2UVV A;  5DQG A;  2NRT A;  4DFK A;  2C22 A;  4IRK A;  1TFR A;  4UB1 A;  2IMW P;  9ICL A;  2DVI A;  5CA7 A;  1X9W A;  2JZB A;  5IIJ A;  5EWF A;  3JPO A;  1XSL A;  1UEV A;  1N56 A;  1X9M A;  3EPG A;  4DLG A;  4ELT A;  5DKW A;  1KRP A;  4F3O A;  4DL2 A;  2BPC A;  4WC3 A;  3B0Y A;  3KHH A;  3KHR A;  2MUT A;  1IXR A;  4EBC A;  2DR9 A;  5J2K A;  3MDC A;  2AQ0 A;  3N97 B;  3H39 A;  4RUC A;  1BVS A;  4YR3 A;  4I2G A;  4O3P A;  4I2E A;  4I2F A;  4NLG A;  3RAQ A;  4RWP A;  4NM2 A;  2HVI A;  8ICA A;  4J9Q A;  4B9U A;  1JXL A;  4B9V A;  5KG2 A;  1U47 A;  3RH4 A;  4MFF A;  3TFS A;  3OHB A;  4DL7 A;  7ICT A;  1WCN A;  3EWA A;  7ICS A;  5F9L A;  5KFJ A;  1LV5 A;  2HHT A;  3AQN A;  5CHG A;  5J0O A;  2XGQ A;  1NKB A;  1PX5 A;  8ICO A;  1YLQ A;  1ZQE A;  3H7I A;  4EBE A;  9ICB A;  5KFC A;  2DR7 A;  3ORY A;  1KTQ A;  5III A;  2P6R A;  2BCR A;  1BGX T;  4ED1 A;  1ZQF A;  4IQW A;  2C2D A;  3JPR A;  4XRH A;  1HJP A;  2UVR A;  8ICN A;  1KNY A;  2P66 A;  4RNN A;  3MR2 A;  3GIM A;  8ICM A;  9ICU A;  4FS1 A;  4QZG A;  3OJU A;  4F4X A;  4X4R A;  4PGQ A;  4F5O A;  2BQR A;  3BQ1 A;  3AUO A;  3SV3 A;  1IM4 A;  1QLN A;  2KZ3 A;  2R8J A;  9ICR A;  1ZQO A;  1ZQV A;  4Q44 A;  2JEJ A;  4X4S A;  3PO5 A;  1RZT A;  3T3F A;  1SL1 A;  4X4V A;  5DB8 A;  5HRB A;  2ASD A;  4FBU A;  2ZJ5 A;  4QZI A;  4RQ5 A;  4IQV A;  4DSK A;  2KTQ A;  5DB6 A;  5KFI A;  4QZE A;  1PZN A;  4DOC A;  4EBJ A;  2Y1I A;  4MF2 A;  5KFF A;  8ICP A;  3FYH A;  3G6X A;  1TK8 A;  4WC1 A;  4RWO A;  1ZQJ A;  4DQS A;  1TV9 A;  4MEX A;  4DQR A;  2HHS A; 
#chains in the Genus database with same CATH topology
 3IHQ B;  3KZX A;  3UXP A;  1JXE A;  4G9B A;  4QWB A;  4R65 A;  4AT8 A;  1X9S A;  2FMS A;  2F8K A;  9ICQ A;  2CXY A;  4O3Q A;  1JRO A;  2EAM A;  2ZH5 A;  4AYB F;  2J6S A;  1RYS A;  4M9N A;  4JLX A;  1J2N A;  2W8L A;  4MKP A;  4WH5 A;  5KFH A;  1BNO A;  4PHP A;  5KFS A;  4RQ7 A;  1UET A;  3MBY A;  2DKZ A;  4TUP A;  1DK3 A;  5J2E A;  3ICX A;  2FLP A;  8ICK A;  4WC2 A;  3PW2 A;  4CF3 A;  2WTF A;  1Q8K A;  3BS5 A;  9ICS A;  1QQ6 A;  1D8Y A;  4RQ2 A;  1WWU A;  3EYZ A;  3QZ7 A;  1S0N A;  1L7N A;  3BS5 B;  3TKA A;  5D63 A;  5ALT A;  1VFG A;  4UAU A;  5ALZ A;  1JAJ A;  2VJ4 A;  5AIB A;  4G3I A;  4DO9 A;  2YB1 A;  4EEK A;  4M9G A;  5KFT A;  3EF2 A;  2OEH A;  5ALX A;  1NK5 A;  4UAZ A;  2DR5 A;  3BQT A;  1VJ7 A;  1ZD5 A;  5DQH A;  4YR0 A;  2N1R A;  3C28 A;  4F2R A;  5ALQ A;  5EWG A;  3PW4 A;  5KG3 A;  4QW9 A;  2OHF A;  5TIS U;  4XUS A;  5AM5 A;  3OHA A;  4FHP A;  4DSE A;  1AQ6 A;  4YXM A;  2UVU A;  3KFU F;  1GO3 F;  3U26 A;  4O69 A;  1ZET A;  3H8J A;  3RB3 A;  2JEI A;  1ZQS A;  5HRI A;  3MGI A;  4K9A A;  4JWM A;  3JPN A;  1F5S A;  5AKH A;  4NL9 A;  4I2A A;  4RUA A;  2JGA A;  4C4T A;  5AK3 A;  2ZIU A;  3E58 A;  8ICR A;  1UEU A;  1NKE A;  2XC9 A;  3WFQ E;  4RQ4 A;  4F5N A;  3GII A;  5HRH A;  4EZ6 A;  4KLS A;  2J6U A;  3PX6 A;  5H2F U;  4K98 A;  4K4I A;  1Q3U A;  1DGS A;  3C21 A;  2VA2 A;  1X66 A;  5DQI A;  1KFS A;  3RJG A;  1T94 A;  5A0L A;  2BHN A;  4YVZ A;  2QLT A;  3HRD D;  3SAF A;  5KL1 B;  4DQI A;  4FHY A;  5AM2 A;  3RFA A;  2IHM A;  3UXO A;  3NWI A;  4F2S A;  2A1J B;  4QWD A;  3K7D A;  4M9L A;  4UW9 A;  5ALS A;  5KFU A;  5CP2 A;  3JCF A;  2KV2 A;  4TUR A;  2H3V A;  5HRL A;  4O5K A;  1XU4 A;  3V7K A;  1ZOL A;  4R8U B;  1L7P A;  2O1P A;  3BQ2 A;  3RB6 A;  1B0X A;  4BWM A;  2AU0 A;  2NRK A;  4K96 A;  1FA0 A;  3E0F A;  1SXD A;  4Q43 A;  2VJ5 A;  4P2H A;  1FO4 A;  2XCP A;  4I29 A;  1L3S A;  2G0A A;  2ZH7 A;  4GXJ A;  1NJX A;  5J0W A;  5JU5 A;  2F1H A;  2ISP A;  3ER9 B;  3HJ4 A;  4B9S A;  2E1E A;  1X40 A;  4BXO A;  5CFS A;  1NK4 A;  5FP0 A;  3TI0 A;  2KVS A;  5J0U A;  9ICP A;  4NLN A;  2PMZ C;  1SWV A;  4ECU A;  3M6K A;  3M6Z A;  3PML A;  3QUB A;  4X4P A;  2JR5 A;  5AM1 A;  1UPH A;  3Q8Q B;  3PV8 A;  1ZQI A;  4JWN A;  2KFN A;  3SZ2 A;  4WC0 A;  1R8A A;  4HX0 A;  2VAN A;  5JTG A;  3Q8P B;  4YXJ A;  1XO1 A;  3PHZ A;  4Y2R A;  1NJW A;  5KFD A;  4EED A;  4WC7 A;  3F2D A;  1JX4 A;  3TFR A;  2LM1 A;  4I2H A;  5KFY A;  5CJ7 A;  2PFN A;  1N62 A;  4NV0 A;  2KOB A;  4LZD A;  5J2A A;  2IOF K;  2KE7 A;  2LKY A;  2AH5 A;  4NM1 A;  2PFQ A;  5HR7 A;  9ICG A;  4UBC A;  9ICF A;  1K5O A;  4F93 B;  4JMU A;  1TFY A;  4HAI A;  4Z6C A;  5IIL A;  4LJX A;  5TZV A;  4IR1 A;  4X4Q A;  5AK6 A;  4TUQ A;  5DLF A;  3SI8 A;  2EAN A;  2Y0S C;  3OVB A;  1U9L A;  5HNK A;  2R8H A;  1LB2 B;  2Q4T A;  1KSP A;  2WAQ F;  5DEC A;  1L8L A;  2RHF A;  1TAQ A;  2Q0Z X;  5E79 U;  4X4O A;  4ZH4 A;  1KW4 A;  5EE0 A;  7ICM A;  7ICL A;  1SV4 A;  1A76 A;  4ICA A;  1KFD A;  2W9B B;  3KTQ A;  2M2U A;  5KFK A;  1RDF A;  2ZH1 A;  4ECQ A;  2ZXH A;  4NLK A;  1SL0 A;  4C8N A;  4QNL A;  3ZD9 A;  1CRX A;  4PZN A;  1KFT A;  3UMG A;  2WB1 F;  2MAX A;  3MAB A;  5ALR A;  4DS5 A;  2XI9 A;  4JUZ A;  5DBC A;  5HHH A;  1TAM A;  4E0D A;  1JQR A;  4X0B A;  5F9N A;  4DL4 A;  1DGJ A;  1ZJN A;  4JV2 A;  1H38 A;  2LBO A;  3MC1 A;  3NS1 A;  1K1S A;  3V6K A;  1QQ5 A;  2KN7 A;  3NAS A;  1URJ A;  3JPS A;  1U4B A;  2QAR B;  3PX0 A;  2KIW A;  4DL3 A;  5DB9 A;  8ICX A;  2CN1 A;  1TAU A;  1DOQ A;  2B0C A;  2P6U A;  1WOT A;  3UM9 A;  4RT2 A;  3H3A A;  3AL0 B;  1JRP A;  3F5E A;  4IG8 A;  1ZD3 A;  2HHX A;  2O5A A;  1PUZ A;  2BR0 A;  4KLT A;  2ZIV A;  3KD3 A;  4ECZ A;  5KT6 A;  8ICW A;  2PBE A;  2BQ3 A;  5AHX A;  3OV7 A;  2F1I A;  3C29 A;  1F0M A;  2D8C A;  5KT5 A;  4J9N A;  3GIK A;  3M9N B;  2G08 A;  5IIK A;  1RPL A;  4M6W B;  4ED6 A;  7ICH A;  4DFK A;  9ICL A;  1TFR A;  4OCZ A;  5IIJ A;  1UEV A;  1XSL A;  1N56 A;  4DLG A;  4DL2 A;  3B0Y A;  2MUT A;  2AQ0 A;  3H39 A;  4RUC A;  1BVS A;  4I2F A;  3RAQ A;  2B6G A;  4NM2 A;  2HVI A;  8ICA A;  3K1Z A;  5KG2 A;  5D62 A;  3TFS A;  3OHB A;  7ICT A;  4F72 A;  3WU2 U;  5B3Q A;  1ZXI A;  2K8C B;  1ZQE A;  9ICB A;  2DR7 A;  1LKY A;  3ORY A;  2BCR A;  4ED1 A;  4OJL A;  2IOF A;  2H3I A;  2HI0 A;  4F5O A;  1QLN A;  2R8J A;  3F2C A;  9ICR A;  3SEN A;  3AEV A;  2JXJ A;  1ZQV A;  3QUT A;  1SL1 A;  4X4V A;  5DB8 A;  2KTQ A;  5KFI A;  1PZN A;  3FYH A;  2K8A A;  3G6X A;  4WC1 A;  3FC4 A;  1YZ6 A;  4DQR A;  2NYV A;  4DFD A;  7ICO A;  3Q8S B;  5L1L A;  4RPY A;  3GQC A;  1Z4N A;  3E2E A;  5ALD A;  1UHU A;  3N28 A;  5AKI A;  1QSL A;  2ID1 A;  4J9O A;  9ICH A;  1SGG A;  3BJY A;  3WK6 A;  1PVP A;  3HIY A;  4EYI B;  5ALH A;  1TFW A;  2YQE A;  4O3N A;  4NXW A;  1ZQN A;  5HRD A;  4C7Y A;  5JTI A;  3V7J A;  1JMS A;  3Q8M A;  3RJK A;  1OXJ A;  3OSP A;  1COO A;  1FEZ A;  3WK4 A;  4EP7 A;  2HBL A;  3SD7 A;  4PGY A;  1Z3E B;  3KHL A;  4K4G A;  4YD1 A;  2R8G A;  1SB3 C;  4Y2Y A;  4RQM A;  3FM9 A;  3PVX A;  2B4V A;  3WKE A;  4AT9 A;  3K1R B;  4M47 A;  1NO5 A;  2BQU A;  3LQC B;  5T14 A;  1UT5 A;  4YN4 A;  7ICE A;  2O6K A;  2G06 A;  3IRU A;  1TVA A;  1GPJ A;  4DQP A;  1NK6 A;  4K99 A;  2W9C B;  4WOY A;  2QKQ A;  5GTH U;  4FFD A;  3M8R A;  3LWL A;  3RRG A;  4F92 B;  2OH2 A;  4X4U A;  1S0O A;  2OM6 A;  3WK8 A;  1MIY A;  4Z6F A;  8ICV A;  3V7L A;  4PL1 A;  2LYA A;  3V72 A;  1NK9 A;  4UAS A;  4F4Y A;  5IIN A;  2BCV A;  2KZM A;  4PL2 A;  2HOF A;  2EH9 A;  4IQU A;  4NY8 A;  3RJJ A;  3RBD A;  2E8P A;  2FMQ A;  2ZH2 A;  3NVV A;  3AQK A;  3C66 A;  5DDY A;  2XVT A;  5ALW A;  4XA5 A;  4F5R A;  3H0R B;  4DL6 A;  4O9M A;  2XY6 A;  2W8K A;  4J9L A;  7ICP A;  4EEL A;  4O68 A;  4I2J A;  5ALV A;  2CPR A;  4MEY A;  5EE3 A;  4GXK A;  3OWG A;  5GTI U;  2KHQ A;  3RJI A;  3AQF A;  2ZUB A;  4KLQ A;  4UBB A;  3VCB A;  4HYK A;  2W03 A;  3EPI A;  4ED0 A;  9ICJ A;  1JI7 A;  4DF4 A;  2A1J A;  5KAF U;  3A0B U;  4PH5 A;  5AKE A;  3DEE A;  4R8U A;  5ALU A;  1L7M A;  1ZQ1 C;  2L5Y A;  2ZH9 A;  3NVY A;  5KFE A;  3IM1 A;  2KFZ A;  2ZUD A;  4GFJ A;  1WYG A;  3QU5 A;  4YMM A;  4TQR A;  2KMD A;  4YCX A;  4DSF A;  3QUQ A;  5KFV A;  3H40 A;  4M9J A;  7ICN A;  4QZ9 A;  3GDX A;  1RYR A;  2KIV A;  3QXG A;  3ETL A;  3AN1 A;  3IG5 A;  5KT2 A;  3GIL A;  1ZQP A;  5KFN A;  5C0Y A;  3I1Y A;  2IHO A;  2NRV A;  4Q45 A;  1SL2 A;  5AI4 A;  3C1Y A;  3PSI A;  3QZ8 A;  1ZQX A;  8ICH A;  4KLJ A;  4Y2J A;  2HSZ A;  5AK5 A;  2NO4 A;  2M9N A;  1XS9 D;  2OXO A;  4OAG A;  1NK8 A;  3PR5 B;  1V9P A;  4EX6 A;  2YX8 A;  2JMG A;  1NK0 A;  4QIW C;  2H5X A;  1L6N A;  1KDH A;  2LHT A;  2E8N A;  4FZN A;  3PY8 A;  3MFH A;  3AM9 A;  3FAH A;  4IQT A;  1MQ3 A;  8ICS A;  3JPT A;  4EV6 A;  3GFK B;  5KG4 A;  4K4H A;  2Z7J A;  2G5I B;  4C8M A;  8ICT A;  3AU2 A;  4B9L A;  2DQN B;  3OUY B;  1UT8 A;  2AGQ A;  2K8B B;  5HR9 A;  5KFR A;  1L3U A;  3QEB Z;  4O3M A;  7ICJ A;  3KKA A;  5DLG A;  4N7R A;  5HC9 A;  3F2B A;  3J81 j;  1VJ5 A;  4Q8F A;  1MC8 A;  3RJE A;  1FFV A;  5J0R A;  1IIP A;  1TK5 A;  2HOI A;  4U6P A;  4KMO B;  5KT7 A;  4R64 A;  2NRZ A;  2W9M A;  4CGZ A;  3GV8 B;  1U45 A;  4CDG A;  4RQ1 A;  1ZD2 P;  2WF9 A;  4RNM A;  4O3S A;  4CF5 A;  4YD2 A;  4US9 A;  2ZH4 A;  1S9F A;  2QB1 A;  4A8E A;  4KLM A;  2EAO A;  4MFA A;  2JH1 A;  3CRX A;  2WF6 A;  2J6T A;  5J0T A;  2W9A A;  5HRE A;  1L7O A;  2V4Q A;  2F77 X;  1KBU A;  2W55 A;  3D2S A;  1M6Y A;  3UQ2 A;  3OJS A;  3HKZ C;  1D9F A;  3R9K A;  1ZQY A;  4UB5 A;  3MDA A;  4DFM A;  3HP6 A;  4RWN A;  2F2A B;  1HUZ A;  4AP9 A;  1QQ7 A;  4Z6E A;  2B21 A;  4DLE A;  2HBJ A;  5J2F A;  2HDO A;  1ZQZ A;  5KFA A;  2PXI A;  4S3N A;  4FBT A;  3AU6 A;  4YR2 A;  3PST A;  1NKC A;  4KLU A;  2LI6 A;  5J2D A;  2YMM A;  4WC6 A;  1DRG A;  2W7P A;  5KT4 A;  4DOA A;  5KT3 A;  3SMV A;  2WF8 A;  3OUY A;  3PMN A;  4M9H A;  2BBJ A;  4K8V A;  4EYH B;  2Y1J A;  2DGZ A;  4ED8 A;  1T4G A;  2K4E A;  3PNC A;  5KG0 A;  3SEI A;  9ICT A;  2H3Z A;  2BCQ A;  4P0Q B;  8ICQ A;  2E8M A;  2ZIV B;  9ICA A;  3M8S A;  4K97 A;  2KG5 A;  4KLI A;  1S5L U;  3MCR A;  5KFM A;  2IA6 A;  4MHV A;  4KLD A;  3ZI4 A;  2BKE A;  2RP5 A;  1L8O A;  3LVV A;  2YN4 A;  3JYY A;  4RPX A;  4BGD A;  5AKL A;  2Q66 A;  8ICU A;  4PHE A;  4JV1 A;  3QE9 Y;  2VKQ A;  2ASJ A;  4QZD A;  2HW3 A;  4TQS A;  5BOL A;  1Q46 A;  4M6W A;  1SKW A;  4RT3 A;  1UA0 A;  1ZQD A;  4E80 A;  5ALO A;  4F4Z A;  3GU3 A;  1ZD4 A;  1V85 A;  4KN4 A;  9ICV A;  3CW2 C;  4OAF A;  4B6J A;  2D6F C;  5AM0 A;  5B5E U;  4PHA A;  1ZJM A;  4RU9 A;  5DGA A;  2MRL A;  4ACO A;  1D8B A;  1XC9 A;  3G6Y A;  4OD0 A;  1VLB A;  5ALY A;  2ZTC A;  2C2E A;  2OWO A;  5KFL A;  5DG8 A;  4KLF A;  4B9T A;  2FPK A;  1R8C A;  1NNL A;  3UPS A;  2DRB A;  2C22 A;  2IMW P;  3JPO A;  1J97 A;  5DKW A;  2BPC A;  4K9B A;  3KHR A;  2DR9 A;  1IXR A;  2F3N A;  5AKJ A;  4NLG A;  2B56 A;  5ALF A;  5AKZ A;  4MFF A;  4DL7 A;  5KFJ A;  2FI1 A;  1ECW A;  5EE1 A;  3WKA A;  3AQN A;  5CFT A;  5CHG A;  1PX5 A;  4CE6 A;  3H7I A;  4EBE A;  5KFC A;  5III A;  2P6R A;  4IQW A;  1RQN A;  1HJP A;  1KNY A;  4RNN A;  1YZ7 A;  3N7R C;  8ICM A;  4X4R A;  4QZG A;  3OJU A;  3AUO A;  3SV3 A;  2EZZ A;  2MA1 A;  1IM4 A;  2KZ3 A;  4Q44 A;  2JEJ A;  4X4S A;  3PO5 A;  3QU7 A;  5EE9 A;  3IV6 A;  1SIJ A;  5HRB A;  3QUC A;  4FBU A;  2ZJ5 A;  4RQ5 A;  4IQV A;  1SV0 A;  4Y2U A;  1WWV A;  5DB6 A;  2ESE A;  4DSK A;  4QZE A;  2Y1I A;  4MF2 A;  8ICP A;  5ALL A;  2W54 A;  1VDV A;  4OAH A;  1TV9 A;  2ZIX B;  4AYB C;  3SQI A;  4JB3 A;  3NTU A;  1NJZ A;  1ZQG A;  2E3T A;  1T3N A;  4C7Z A;  4TUS A;  4QZH A;  3LVW A;  3IG8 A;  3H8M A;  4UAW A;  3GV7 B;  5KFO A;  2F1J A;  3NVZ A;  1MQ2 A;  5ALN A;  1OUQ A;  4DOB A;  4GC7 A;  2KKV A;  1X6J A;  3RBE A;  1OU5 A;  2CRX A;  3JZ0 A;  2DVI A;  4CCH A;  4J9P A;  4YMO A;  2W7O A;  3HX0 A;  1ZQK A;  4ECV A;  3IDW A;  2A1A A;  2KNJ A;  4X0A A;  1RM6 C;  2ES6 A;  4E7X A;  3WFP A;  2WHE A;  1RXW A;  1SKR A;  1QTM A;  3NUQ A;  4C4S A;  4JLZ A;  1V4A A;  4R66 A;  4RQ0 A;  4QZA A;  2ZTE A;  3LDA A;  5L1J A;  4NXZ A;  4J9M A;  2RFF A;  1X42 A;  4UD4 A;  1IV8 A;  2GO7 A;  4FHX A;  3RR7 A;  1WG8 A;  3ISD A;  2JRZ A;  5KG6 A;  2I1Q A;  5J2J A;  4FH3 A;  1O08 A;  2FLN A;  4LVS A;  4NL9 C;  4EX7 A;  4KLL A;  4Y2P A;  1X6I A;  1NZP A;  2HOQ A;  1HEK A;  4BUG A;  5KFX A;  5AKX A;  4XQ7 A;  4EBK A;  2EAP A;  5CR0 A;  2HHQ A;  3A0H U;  1ZQW A;  2ZIU B;  2LYB A;  1COK A;  1K1Q A;  1LKY B;  3HW8 A;  3TAD A;  3C2L A;  2QB0 A;  2DBY A;  3BQ7 A;  2KK0 A;  4DL5 A;  2ZJA A;  8ICL A;  4QZF A;  2VIX A;  3T5J A;  4X4N A;  2LPE A;  4RQ3 A;  5L1M A;  3M9O B;  4QW8 A;  3C1Z A;  4ED2 A;  3BQ0 A;  4FZM A;  2P35 A;  5CWR A;  4RQ8 A;  3JPP A;  3MR3 A;  3TQ1 A;  4C8K A;  2KKP A;  2FPL A;  5B66 U;  2HHP A;  3MGV A;  2HHW A;  4GXI A;  3H4B A;  5KAI U;  3O0F A;  2AXT U;  4RZR A;  3L4P A;  3RR8 A;  2UVW A;  2F8L A;  4QWE A;  5JUM A;  5AI0 A;  3OPX A;  4XQ8 A;  4QZ8 A;  2GAF D;  4DEZ A;  2NRW A;  3CP8 A;  4NXU A;  5AM3 A;  1KQQ A;  4O67 A;  4UB6 U;  3PW7 A;  5ALP A;  2ODG A;  4WQK A;  2IHN A;  5ALK A;  3PZP A;  2KP7 A;  1SV0 C;  2ZJ8 A;  9ICX A;  2G09 A;  1ED1 A;  2OCE A;  4UAR A;  2NO5 A;  2GA9 D;  4NJ8 A;  4BXO B;  2M2T A;  3PSP A;  4O5E A;  2PFP A;  1MIW A;  5ALG A;  4QWA A;  4JV0 A;  5AKY A;  3HPO A;  1S0V A;  3EUB 2;  3PX4 A;  2G07 A;  2ZIX A;  4C8O A;  9ICN A;  2XY5 A;  4NWI A;  2BCU A;  3RJH A;  1HUO A;  1B43 A;  4ZOH C;  4NLB A;  4EBD A;  3CK6 A;  1JN3 A;  4X5V A;  4Y2X A;  2KIC A;  8ICG A;  4KLE A;  4NKT A;  1ZQL A;  3N7S C;  1BPE A;  1NJY A;  1NZB A;  4LEV A;  1Z00 B;  4O6A A;  2NRX A;  5J0S A;  1Q79 A;  5DB7 A;  1XO0 A;  3K4G A;  2DR8 A;  2YML A;  5D61 A;  4NXX A;  1NK7 A;  1EXN A;  1HIW A;  3GV5 B;  1U49 A;  2JEG A;  3QYP A;  4EZ9 A;  4UB8 U;  4QWC A;  2KJ8 A;  2FLL A;  2PMZ F;  5J0P A;  3H0L B;  5DG7 A;  2ZUC A;  2PKE A;  5DED A;  2DRA A;  5G5G A;  2BDP A;  4KMU A;  3L5K A;  3ZDE A;  4LT6 A;  4IR9 A;  4R63 A;  4BX9 C;  4WC4 A;  3ZD8 A;  3C23 A;  5HR6 A;  4UB4 A;  3T79 A;  2W3R A;  4M04 A;  2I6X A;  5DDM A;  2G5H B;  5K4L A;  4CNQ A;  2ZH8 A;  1PK1 A;  4KLO A;  2VA3 A;  3EZ5 A;  4NLC A;  3NVW A;  5J8Y C;  3UQ0 A;  2WAQ C;  1RG6 A;  1ZQQ A;  1PK1 B;  1N48 A;  3RF9 A;  4C0Z A;  1R89 A;  4J9K A;  4FH5 A;  5BPC A;  4FZL A;  4FO1 A;  3ETR A;  2EDU A;  4UD5 A;  9ICW A;  1ZQM A;  4IL6 U;  2GH1 A;  2JHD A;  1QCK A;  2K4P A;  8ICF A;  2C2R A;  4O5C A;  1ZQA A;  3IN5 A;  4GC6 A;  1B22 A;  1JIH A;  4CF4 A;  4AT9 B;  1Z1V A;  1WUD A;  4PHD A;  2RQ5 A;  3QX7 A;  4EEY A;  4QZB A;  4I28 A;  2FJ6 A;  1Y88 A;  4JK1 A;  2WB1 C;  2FMP A;  4NLZ A;  2BCS A;  2Y0S F;  3C2M A;  3HJ1 A;  4QZC A;  2NV3 A;  2FCL A;  2M0N A;  3UMC A;  2XO7 A;  1XSP A;  2BDU A;  1RQL A;  9ICM A;  8ICY A;  3C18 A;  3QU2 A;  5KFG A;  5BOM A;  2BBH A;  3PR4 A;  7ICK A;  2Y9T A;  3OTQ A;  4WBZ A;  5J0Y A;  3ISC A;  7ICG A;  3RH5 A;  3NVO A;  2WFA A;  2ZHB A;  2ZHA A;  5AI9 A;  2PI5 A;  4BJQ A;  1IG6 A;  4OO1 J;  3NGD A;  5CB1 A;  4FHW A;  1ZQC A;  2ZXI A;  1B4F A;  1T8E A;  2HMX A;  4WC5 A;  1P7D A;  5D46 A;  3TAN A;  1L3T A;  4MFC A;  4P0P A;  4YMN A;  2H3Q A;  2HHU A;  3C5G A;  2PFO A;  2W04 A;  3ZDC A;  3TAC B;  1N5W A;  4IRC A;  3K75 D;  5L9X A;  1LVH A;  2LM4 A;  3GIJ A;  5HML A;  2BPF A;  3BDP A;  1BPD A;  8ICJ A;  1QSY A;  2KSO A;  5B3P A;  4J9S A;  1L3V A;  4OAI Z;  1MN8 A;  7ICI A;  2ZH3 A;  5DBB A;  5ALI A;  2QAR A;  4LEY A;  3F53 A;  4QJF B;  2DPJ A;  2ZTD A;  3G6V A;  3H8W A;  5CHE A;  2K4H A;  4ECS A;  4DF8 A;  9ICO A;  3OVS A;  3H37 A;  3WKD A;  3WKC A;  4I2I A;  1ZQR A;  3N7P D;  2UVV A;  5DQG A;  2NRT A;  4UB1 A;  5CA7 A;  1X9W A;  2JZB A;  2WF7 A;  2RLT A;  2H3F A;  2K60 A;  4ELT A;  1KRP A;  4F3O A;  2DF4 B;  1KN5 A;  3KHH A;  4EBC A;  3MDC A;  2W11 A;  3N97 B;  4I2G A;  2GOL A;  4I2E A;  4J9Q A;  1JXL A;  2XID A;  3BZK A;  3RH4 A;  1U47 A;  5F3X B;  5F9L A;  2WF5 A;  1LV5 A;  2HCF A;  4C4R A;  3L3F X;  2XGQ A;  1YLQ A;  2KD1 A;  5KL8 B;  1Z4O A;  2C2D A;  3JPR A;  2UVR A;  8ICN A;  2P66 A;  3NRZ A;  3MR2 A;  9ICU A;  3ED5 A;  4FS1 A;  4F4X A;  2YMQ A;  1SWW A;  2BQR A;  3BQ1 A;  2AHO B;  3M7D A;  4Y2T A;  2Y9U A;  4EGW A;  1CI4 A;  1RZT A;  3D2Q A;  4KX5 A;  3WK5 A;  4P0P B;  3DDH A;  3CNH A;  4EBJ A;  5JRT A;  5KFF A;  5AI8 A;  2HBK A;  2FDR A;  1XNS A;  2EZX A;  1ZQJ A;  4DQS A;  1SXE A;  4MEX A;  4O3O A;  4FS2 A;  3D2N A;  2R8I A;  3ERC C;  3ONN A;  5AKG A;  1OW5 A;  1F5A A;  1S97 A;  5KTQ A;  4C8L A;  3T5H A;  3WK7 A;  5DG9 A;  3WFS C;  3D6J A;  2XGP A;  4ELV A;  3RB0 A;  4DCC A;  5CRX A;  5C5J A;  5KG7 A;  4WQL A;  1QH9 A;  3N4M B;  4Z6D A;  4OJ5 A;  4P0Q A;  4M2Y A;  4GLX A;  1V97 A;  1Z19 A;  1U48 A;  2RRD A;  2HN2 A;  2LMR A;  1O03 A;  4DFJ A;  2V4R A;  3RAX A;  3UXN A;  4YFK A;  1FFU A;  4RNO A;  2A3V A;  2HN1 A;  1NOM A;  2EZY A;  2AQ4 A;  5AKK A;  2E5S A;  4O3R A;  1KLN A;  1QSS A;  2W43 A;  1C7Y A;  3KZI U;  4DS4 A;  4UB2 A;  1RYU A;  2ASL A;  4DSI A;  4KLG A;  4I2B A;  3I28 A;  3QEA Z;  3IP4 B;  4DSL A;  4M0A A;  3MR5 A;  3F5A A;  4ECX A;  4WBY A;  2FPM A;  5J8Y A;  3T5L A;  3OVA A;  3LYS A;  4P4M A;  2ATL A;  1S77 D;  1X9X A;  1PK3 A;  3H4D A;  2HVH A;  4LZG A;  4YG2 A;  5KG5 A;  4UQG A;  3AQE A;  1DXS A;  3ALR A;  3GZF A;  3L9D A;  4RQ6 A;  4I2C A;  2QB0 B;  5CEH A;  4Y2Q A;  2ALZ A;  5EWE A;  5HRF A;  4P4P A;  4KX3 A;  3EW9 A;  1KEJ A;  9ICE A;  2KZZ A;  1ZQU A;  1T7P A;  4F5Q A;  2VA8 A;  8ICE A;  3TAR A;  1TK0 A;  3NKU A;  1F44 A;  4C80 A;  3HWT A;  5AM4 A;  2OYY A;  3H0M B;  1BPX A;  1XWL A;  2AGP A;  4BDP A;  1C20 A;  3BS7 A;  4AT7 A;  1N60 A;  3RB4 A;  4DFP A;  3TAQ A;  1PVQ A;  3HT3 A;  3HJE A;  3C5F A;  9ICC A;  4F50 A;  4ELU A;  5KFZ A;  1MA7 A;  5DBA A;  2ZIW B;  4M5D A;  4PPX A;  9ICI A;  4J03 A;  3H8S A;  1JUD A;  5HHI A;  2GWS A;  4I27 A;  2ZIW A;  1A0P A;  3ZDB A;  8ICZ A;  1S0M A;  8ICI A;  4ECY A;  7ICF A;  2XCA A;  1D8L A;  2C28 A;  2EWR A;  4F71 A;  2YB4 A;  4PZO A;  1TE2 A;  7ICU A;  3M1Y A;  3RRH A;  1BPZ A;  7ICV A;  1R8B A;  3UPQ A;  5KFP A;  4B9M A;  3V6J A;  4ATB A;  1ZRN A;  1MSW D;  3H38 A;  1CEZ A;  2KHV A;  1V38 A;  3LWM A;  3WKB A;  3V6H A;  3THV A;  3MFI A;  3QNM A;  5HRK A;  1Z00 A;  2DPI A;  4BWJ A;  4J9R A;  4B9N A;  5CFU A;  2BPG A;  3RJF A;  4QIW F;  4U7C A;  3AQM A;  2KJ5 A;  4Y2S A;  1S10 A;  2BZF A;  1A77 A;  4PJ0 U;  9ICK A;  1DK2 A;  2K89 A;  1BPY A;  3KKA C;  4WCW A;  5HMM A;  3I76 A;  3SAH A;  2YTU A;  5ALJ A;  3WFR E;  4ECT A;  5AIA A;  5J0Q A;  1ZRM A;  2B51 A;  3B9J A;  4FHV A;  5F2V O;  4PGX A;  4NXV A;  3B0X A;  5HP4 A;  5J2I A;  1J2M A;  5J2G A;  4CRX A;  5EOZ A;  1RXV A;  1Q78 A;  1N5X A;  4I2D A;  2DFL A;  4US8 A;  2GLE A;  1ZQH A;  3PO4 A;  2RDJ A;  2I5H A;  1TKD A;  2JZB B;  4LEZ A;  3Q8K A;  2DUY A;  2XIC A;  1D9D A;  1UCV A;  5D4B A;  1N61 A;  4Y2V A;  3SR6 A;  4OJO A;  4KLH A;  1KKX A;  1UQV A;  4UAY A;  3S6J A;  2ZH6 A;  4F5P A;  2JEF A;  3NYB A;  3SAG A;  5KFQ A;  2KVC A;  3T5K A;  3QU9 A;  1BNP A;  3KOO A;  2BGW A;  4DWI A;  3RTV A;  2BE3 A;  3WFO A;  4ED7 A;  5IIM A;  3OSN A;  5KFB A;  7ICQ A;  4IRD A;  3DV9 A;  5HRG A;  1PVR A;  1WCL A;  1FIQ A;  1ZQT A;  4ATB B;  2DL0 A;  3WK9 A;  3FDS A;  4F91 B;  3C2K A;  5L1I A;  5AI5 A;  2D3D A;  2XY7 A;  1Q3V A;  3AQL A;  3ISB A;  4KIT B;  3QU4 A;  2HBM A;  2AGO A;  4EEB A;  1ARO P;  1N2X A;  3SYZ A;  2MUT B;  5L1K A;  2MU2 A;  4RQN A;  4ED3 A;  5AIC A;  3PW5 A;  4AT8 B;  3HIL A;  2I9G A;  3ZDD A;  4P4O A;  2IUB A;  3HKZ F;  2MSN A;  3AMZ A;  3KBB A;  2K4I A;  4ECR A;  5J2H A;  1SZP A;  2R8K A;  1BPB A;  3LK9 A;  2F76 X;  2M2W A;  5ALE A;  3KHG A;  1L5U A;  3TAD C;  3Q8R B;  4UAV A;  2A19 A;  4I0U A;  1S76 D;  4EEN A;  4RPZ A;  3CYM A;  4IS7 A;  5KNI A;  3RH6 A;  3UMB A;  2W9B A;  4FO6 A;  2PI4 A;  5KG1 A;  1N63 A;  2AJQ A;  5J2C A;  4KN7 A;  4F4W A;  4GIB A;  2KEY A;  5IIO A;  5DGB A;  4FE3 A;  4OJP A;  1SKS A;  4YP3 A;  4RWQ A;  4X4T A;  2HHV A;  4DSJ A;  3SV4 A;  4O0I A;  4F8R A;  2KJ9 A;  1NI3 A;  2M2V A;  2KSO B;  4UB3 A;  1MIV A;  4E8F A;  4Q8E A;  1ZYQ A;  2FE9 A;  5J0X A;  4KTQ A;  5AK4 A;  7ICR A;  1XSN A;  8ICC A;  2ISO A;  3ER8 C;  4AT7 B;  5J2B A;  2RDI A;  5D49 A;  4MF8 A;  4DQQ A;  3MR6 A;  1Z1B A;  5ALM A;  1ZQB A;  2W9C A;  5KFW A;  3MGH A;  1X2I A;  3OGU A;  1S8O A;  1T3Q A;  2IBK A;  4ECW A;  3ZDA A;  2E8O A;  8ICB A;  3JPQ A;  3TAP A;  5J29 A;  2LYH A;  2E1F A;  4USA A;  3Q8L A;  1CUK A;  4KM5 A;  4OJ6 A;  4NKU A;  4F4K A;  2YMP A;  4UAT A;  3PW0 A;  2W3S A;  3M9M B;  2V9W A;  4IC9 A;  4YQW A;  1UA1 A;  4IRK A;  5G5H A;  5EWF A;  2F44 A;  2YY6 A;  1X9M A;  3EPG A;  1YT3 A;  4WC3 A;  4XJE A;  5J2K A;  4YR3 A;  4RWP A;  4O3P A;  2DKX A;  3PSF A;  4B9U A;  4B9V A;  2R18 A;  3VC8 A;  1JAL A;  1WCN A;  3EWA A;  7ICS A;  2HHT A;  4LEW A;  3BZC A;  5J0O A;  1NKB A;  4WJ3 B;  8ICO A;  1SZH A;  1KTQ A;  1BGX T;  1A6S A;  1ZQF A;  3NRW A;  2DWQ A;  4XRH A;  2JH7 A;  3GIM A;  2IOH A;  5AI6 A;  4PGQ A;  1KL9 A;  4KB6 A;  4NXT A;  1ZQO A;  2JV3 A;  3T3F A;  2ASD A;  4QZI A;  4DOC A;  1TK8 A;  4RWO A;  2EQY A;  2ZG6 A;  2HHS A; 
#chains in the Genus database with same CATH homology
 3NTU A;  7ICO A;  1NJZ A;  4O3O A;  3Q8S B;  5L1L A;  3IHQ B;  4RPY A;  3UXP A;  3GQC A;  4FS2 A;  1T3N A;  1ZQG A;  1JXE A;  2R8I A;  4QWB A;  4R65 A;  3E2E A;  4TUS A;  4AT8 A;  1X9S A;  4QZH A;  1F5A A;  1S97 A;  5KTQ A;  2FMS A;  3T5H A;  1QSL A;  4C8L A;  2ID1 A;  9ICQ A;  4J9O A;  9ICH A;  4UAW A;  3GV7 B;  5DG9 A;  3WFS C;  5KFO A;  2F1J A;  2XGP A;  4ELV A;  3RB0 A;  4O3Q A;  1MQ2 A;  3BJY A;  5C5J A;  5KG7 A;  3HIY A;  3N4M B;  4Z6D A;  4EYI B;  4GC7 A;  4DOB A;  4M2Y A;  4GLX A;  2J6S A;  2ZH5 A;  1RYS A;  3RBE A;  4M9N A;  1OU5 A;  4O3N A;  1U48 A;  1TFW A;  2W8L A;  5KFH A;  1ZQN A;  1BNO A;  5HRD A;  3JZ0 A;  4PHP A;  4DFJ A;  5KFS A;  3V7J A;  1JMS A;  2V4R A;  3Q8M A;  3RAX A;  3UXN A;  4YFK A;  4RQ7 A;  3MBY A;  3OSP A;  3RJK A;  4CCH A;  4J9P A;  1UET A;  4YMO A;  1COO A;  4RNO A;  3HX0 A;  1ZQK A;  4ECV A;  1NOM A;  2AQ4 A;  4TUP A;  4EP7 A;  4PGY A;  1Z3E B;  4X0A A;  1DK3 A;  3KHL A;  5J2E A;  4E7X A;  4K4G A;  4YD1 A;  2R8G A;  3WFP A;  1RXW A;  1SKR A;  1QTM A;  2FLP A;  8ICK A;  4WC2 A;  3PW2 A;  4O3R A;  1KLN A;  1QSS A;  1V4A A;  2WTF A;  3PVX A;  4R66 A;  1C7Y A;  4RQ0 A;  4DS4 A;  4UB2 A;  4QZA A;  2ASL A;  4DSI A;  4KLG A;  4I2B A;  4AT9 A;  2ZTE A;  3LDA A;  9ICS A;  5L1J A;  3QEA Z;  4DSL A;  4M0A A;  4M47 A;  3MR5 A;  1NO5 A;  1D8Y A;  2BQU A;  4ECX A;  4RQ2 A;  3LQC B;  2FPM A;  4WBY A;  4NXZ A;  1UT5 A;  4YN4 A;  3EYZ A;  4J9M A;  3T5L A;  2RFF A;  4UD4 A;  3OVA A;  7ICE A;  4P4M A;  3QZ7 A;  2ATL A;  1S0N A;  1S77 D;  4FHX A;  3RR7 A;  3ISD A;  1TVA A;  4DQP A;  3H4D A;  2HVH A;  1NK6 A;  5KG6 A;  4LZG A;  2I1Q A;  4YG2 A;  5KG5 A;  4UQG A;  1VFG A;  5J2J A;  3L9D A;  4FH3 A;  2W9C B;  2FLN A;  4RQ6 A;  4I2C A;  1JAJ A;  4LVS A;  3M8R A;  4G3I A;  3LWL A;  3RRG A;  4DO9 A;  4KLL A;  4F92 B;  1NZP A;  4M9G A;  5KFT A;  2ALZ A;  4X4U A;  5EWE A;  1S0O A;  5HRF A;  4P4P A;  1MIY A;  1NK5 A;  3EW9 A;  4Z6F A;  8ICV A;  5KFX A;  4UAZ A;  2DR5 A;  3V7L A;  3BQT A;  1KEJ A;  9ICE A;  1VJ7 A;  2KZZ A;  1ZQU A;  1T7P A;  4XQ7 A;  5DQH A;  4F5Q A;  4EBK A;  3V72 A;  1NK9 A;  2VA8 A;  4F4Y A;  4YR0 A;  5IIN A;  8ICE A;  3TAR A;  5CR0 A;  2BCV A;  2HHQ A;  4F2R A;  2KZM A;  1TK0 A;  5EWG A;  3PW4 A;  5KG3 A;  4IQU A;  4NY8 A;  4QW9 A;  1ZQW A;  3HWT A;  4XUS A;  3OHA A;  3RBD A;  2FMQ A;  3RJJ A;  2ZH2 A;  1BPX A;  3AQK A;  4FHP A;  4DSE A;  1K1Q A;  3C66 A;  3HW8 A;  5DDY A;  1XWL A;  4YXM A;  2AGP A;  3C2L A;  2UVU A;  4XA5 A;  4BDP A;  4F5R A;  4DL6 A;  4O9M A;  4AT7 A;  2XY6 A;  1ZET A;  3H8J A;  4DL5 A;  3RB3 A;  2ZJA A;  2JEI A;  2W8K A;  1ZQS A;  5HRI A;  4J9L A;  3RB4 A;  3MGI A;  4DFP A;  3TAQ A;  8ICL A;  4JWM A;  4QZF A;  7ICP A;  3HT3 A;  3JPN A;  3T5J A;  4X4N A;  3C5F A;  9ICC A;  4RQ3 A;  4I2J A;  3M9O B;  4I2A A;  4F50 A;  4RUA A;  5KFZ A;  4ELU A;  4QW8 A;  3C1Z A;  4ED2 A;  4MEY A;  5DBA A;  3BQ0 A;  4GXK A;  8ICR A;  1UEU A;  4RQ8 A;  5CWR A;  3JPP A;  1NKE A;  3RJI A;  3MR3 A;  2XC9 A;  3TQ1 A;  4C8K A;  4PPX A;  4M5D A;  3WFQ E;  2ZUB A;  4KLQ A;  9ICI A;  3H8S A;  4RQ4 A;  4F5N A;  2FPL A;  4UBB A;  5HHI A;  3GII A;  2GWS A;  5HRH A;  2HHP A;  4EZ6 A;  4I27 A;  4KLS A;  2HHW A;  4HYK A;  4GXI A;  3H4B A;  2J6U A;  3EPI A;  3ZDB A;  4ED0 A;  3PX6 A;  9ICJ A;  4K4I A;  8ICZ A;  1DGS A;  3C21 A;  1S0M A;  2VA2 A;  4DF4 A;  4ECY A;  2A1J A;  4RZR A;  5DQI A;  8ICI A;  4PH5 A;  3RR8 A;  2XCA A;  1KFS A;  7ICF A;  1D8L A;  2C28 A;  4R8U A;  2UVW A;  3RJG A;  4QWE A;  5JUM A;  7ICU A;  4XQ8 A;  3RRH A;  2BHN A;  4YVZ A;  4QZ8 A;  1BPZ A;  2ZH9 A;  5KFE A;  7ICV A;  1R8B A;  3IM1 A;  3UPQ A;  2KFZ A;  4DEZ A;  2ZUD A;  4DQI A;  2NRW A;  4FHY A;  5KFP A;  4YMM A;  4TQR A;  4B9M A;  4YCX A;  4DSF A;  2IHM A;  5KFV A;  3UXO A;  3V6J A;  3H40 A;  4M9J A;  7ICN A;  4ATB A;  4QZ9 A;  3PW7 A;  2A1J B;  4F2S A;  1MSW D;  3H38 A;  4QWD A;  3GDX A;  1CEZ A;  2IHN A;  3LWM A;  4M9L A;  3V6H A;  3MFI A;  3THV A;  1RYR A;  2ZJ8 A;  2KP7 A;  3ETL A;  5HRK A;  5KFU A;  9ICX A;  1Z00 A;  2DPI A;  5CP2 A;  4BWJ A;  5KT2 A;  4J9R A;  3GIL A;  4B9N A;  4TUR A;  5HRL A;  4O5K A;  1XU4 A;  2BPG A;  4BXO B;  1ZQP A;  3V7K A;  2M2T A;  3RJF A;  4R8U B;  5KFN A;  2O1P A;  3AQM A;  4O5E A;  2NRV A;  4Q45 A;  3BQ2 A;  3RB6 A;  1S10 A;  1SL2 A;  3C1Y A;  4BWM A;  3QZ8 A;  2AU0 A;  2PFP A;  1ZQX A;  1A77 A;  8ICH A;  4QWA A;  1MIW A;  4JV0 A;  2NRK A;  3HPO A;  4KLJ A;  1FA0 A;  9ICK A;  1DK2 A;  4Q43 A;  2M9N A;  1S0V A;  3PX4 A;  1XS9 D;  1BPY A;  4P2H A;  4WCW A;  5HMM A;  4C8O A;  2XCP A;  9ICN A;  3WFR E;  4I29 A;  2XY5 A;  1NK8 A;  1L3S A;  2BCU A;  3RJH A;  2ZH7 A;  3PR5 B;  4ECT A;  1HUO A;  1B43 A;  5J0Q A;  1V9P A;  5J0W A;  4GXJ A;  1NJX A;  2F1H A;  2ISP A;  4EBD A;  3HJ4 A;  1NK0 A;  4B9S A;  4FHV A;  1JN3 A;  5F2V O;  2H5X A;  4X5V A;  4PGX A;  4BXO A;  1KDH A;  3B0X A;  4KLE A;  5HP4 A;  8ICG A;  5J2I A;  1ZQL A;  5J2G A;  4NKT A;  3PY8 A;  1NK4 A;  1BPE A;  5EOZ A;  1NJY A;  3TI0 A;  1RXV A;  1Q78 A;  4I2D A;  3MFH A;  2DFL A;  4IQT A;  5J0U A;  1MQ3 A;  3JPT A;  1ZQH A;  4NLN A;  8ICS A;  3GFK B;  3PO4 A;  2RDJ A;  5KG4 A;  4K4H A;  9ICP A;  4C8M A;  4ECU A;  8ICT A;  1Z00 B;  3AU2 A;  3PML A;  4B9L A;  1TKD A;  4X4P A;  2NRX A;  5J0S A;  1Q79 A;  3OUY B;  2JZB B;  1UT8 A;  5DB7 A;  3K4G A;  3Q8K A;  2DR8 A;  2AGQ A;  3Q8Q B;  5HR9 A;  3PV8 A;  5KFR A;  1L3U A;  1ZQI A;  3QEB Z;  1D9D A;  4JWN A;  7ICJ A;  1NK7 A;  5DLG A;  1EXN A;  3SZ2 A;  5D4B A;  2KFN A;  4WC0 A;  3GV5 B;  1R8A A;  5HC9 A;  2VAN A;  1U49 A;  2JEG A;  4KLH A;  4EZ9 A;  3Q8P B;  4QWC A;  4Q8F A;  1MC8 A;  4UAY A;  2FLL A;  3RJE A;  2ZH6 A;  5J0P A;  5J0R A;  4YXJ A;  4F5P A;  2JEF A;  3NYB A;  1TK5 A;  5DG7 A;  5KFQ A;  2ZUC A;  1XO1 A;  3T5K A;  1BNP A;  5KT7 A;  5DED A;  2DRA A;  4R64 A;  2BGW A;  2BDP A;  2NRZ A;  5KFD A;  1NJW A;  4DWI A;  3RTV A;  2W9M A;  4KMU A;  3ZDE A;  2BE3 A;  4LT6 A;  4WC7 A;  4IR9 A;  1JX4 A;  3GV8 B;  4R63 A;  3TFR A;  1U45 A;  4I2H A;  3WFO A;  4RQ1 A;  4WC4 A;  3ZD8 A;  3C23 A;  5KFY A;  5CJ7 A;  2PFN A;  4ED7 A;  4UB4 A;  5IIM A;  3OSN A;  4LZD A;  4RNM A;  5J2A A;  4O3S A;  5KFB A;  7ICQ A;  4IRD A;  8ICC A;  4M04 A;  4YD2 A;  5DDM A;  4NM1 A;  2ZH4 A;  1S9F A;  2PFQ A;  2ZH8 A;  5HRG A;  4KLO A;  9ICG A;  2VA3 A;  4KLM A;  3EZ5 A;  4MFA A;  1WCL A;  1ZQT A;  4UBC A;  3UQ0 A;  4ATB B;  9ICF A;  1ZQQ A;  4F93 B;  2J6T A;  1TFY A;  5J0T A;  3FDS A;  4F91 B;  3C2K A;  2W9A A;  1N48 A;  4Z6C A;  5IIL A;  5L1I A;  5HRE A;  2V4Q A;  1R89 A;  5TZV A;  4IR1 A;  4J9K A;  4X4Q A;  2XY7 A;  4FH5 A;  5BPC A;  3ISB A;  3UQ2 A;  4TUQ A;  3AQL A;  4KIT B;  4UD5 A;  9ICW A;  1ZQM A;  3OJS A;  1D9F A;  5DLF A;  1ZQY A;  4UB5 A;  3SI8 A;  3MDA A;  2AGO A;  4DFM A;  1ARO P;  3OVB A;  1U9L A;  3HP6 A;  4RWN A;  3SYZ A;  5HNK A;  2MUT B;  2R8H A;  1LB2 B;  1HUZ A;  5L1K A;  1KSP A;  4ED3 A;  8ICF A;  5DEC A;  2C2R A;  4O5C A;  1ZQA A;  4Z6E A;  2B21 A;  4DLE A;  4GC6 A;  3PW5 A;  5J2F A;  1TAQ A;  2Q0Z X;  1B22 A;  4AT8 B;  1JIH A;  1ZQZ A;  5KFA A;  2PXI A;  4AT9 B;  4S3N A;  2I9G A;  4X4O A;  4ZH4 A;  4PHD A;  4FBT A;  3ZDD A;  4EEY A;  4QZB A;  4I28 A;  1Y88 A;  4P4O A;  3AU6 A;  7ICM A;  4YR2 A;  4JK1 A;  7ICL A;  2FMP A;  4NLZ A;  2BCS A;  4KLU A;  3C2M A;  1NKC A;  3HJ1 A;  4QZC A;  5J2D A;  4ECR A;  4WC6 A;  1A76 A;  5J2H A;  1SZP A;  1KFD A;  2W9B B;  3KTQ A;  2R8K A;  2M2U A;  5KFK A;  1BPB A;  5KT4 A;  2ZH1 A;  4ECQ A;  3LK9 A;  2XO7 A;  4DOA A;  1XSP A;  5KT3 A;  9ICM A;  8ICY A;  3C18 A;  4NLK A;  5KFG A;  1SL0 A;  5BOM A;  4C8N A;  3PR4 A;  2M2W A;  1L5U A;  3KHG A;  3ZD9 A;  7ICK A;  3OUY A;  1KFT A;  3Q8R B;  2MAX A;  3MAB A;  3PMN A;  4M9H A;  4EYH B;  4DS5 A;  2Y1J A;  4JUZ A;  5DBC A;  4RPZ A;  1S76 D;  4WBZ A;  5J0Y A;  3ISC A;  5HHH A;  7ICG A;  3RH5 A;  4ED8 A;  4E0D A;  1JQR A;  3RH6 A;  1T4G A;  5F9N A;  2W9B A;  4FO6 A;  5KG1 A;  4DL4 A;  2PI4 A;  4X0B A;  2ZHB A;  1ZJN A;  5J2C A;  2AJQ A;  2ZHA A;  3PNC A;  4KN7 A;  4F4W A;  2PI5 A;  5KG0 A;  4JV2 A;  9ICT A;  2BCQ A;  1H38 A;  3NGD A;  8ICQ A;  9ICA A;  3M8S A;  5IIO A;  5CB1 A;  4FHW A;  5DGB A;  1ZQC A;  1SKS A;  4YP3 A;  4KLI A;  4RWQ A;  4X4T A;  1K1S A;  4DSJ A;  2HHV A;  3V6K A;  3SV4 A;  4O0I A;  1T8E A;  4F8R A;  2KN7 A;  4WC5 A;  5D46 A;  5KFM A;  2IA6 A;  2M2V A;  4KLD A;  3JPS A;  2BKE A;  3TAN A;  1L3T A;  4MFC A;  1U4B A;  4UB3 A;  4YMN A;  2HHU A;  1MIV A;  3C5G A;  4E8F A;  3PX0 A;  2PFO A;  3ZDC A;  3JYY A;  4RPX A;  4Q8E A;  4BGD A;  1ZYQ A;  2Q66 A;  8ICU A;  4PHE A;  4JV1 A;  4DL3 A;  3QE9 Y;  5DB9 A;  5J0X A;  4IRC A;  8ICX A;  2ASJ A;  4QZD A;  2HW3 A;  4TQS A;  5BOL A;  3K75 D;  4KTQ A;  7ICR A;  1XSN A;  4M6W A;  5L9X A;  1DOQ A;  4RT3 A;  2P6U A;  1UA0 A;  1SKW A;  2ISO A;  1TAU A;  1ZQD A;  3GIJ A;  1WOT A;  4AT7 B;  5HML A;  4E80 A;  5J2B A;  2BPF A;  3BDP A;  1BPD A;  2RDI A;  5D49 A;  4RT2 A;  4MF8 A;  8ICJ A;  4F4Z A;  3H3A A;  1QSY A;  4DQQ A;  4KN4 A;  3MR6 A;  9ICV A;  4IG8 A;  4J9S A;  1L3V A;  2HHX A;  2O5A A;  1ZQB A;  2BR0 A;  4KLT A;  2W9C A;  5KFW A;  7ICI A;  1X2I A;  5DBB A;  3OGU A;  3MGH A;  2IBK A;  2ZH3 A;  4ECW A;  4ECZ A;  4PHA A;  5KT6 A;  3ZDA A;  8ICW A;  2PBE A;  2BQ3 A;  1ZJM A;  8ICB A;  3OV7 A;  2DPJ A;  2F1I A;  4RU9 A;  3JPQ A;  3TAP A;  5J29 A;  5DGA A;  2ZTD A;  3G6V A;  2LYH A;  3Q8L A;  1XC9 A;  3H8W A;  1CUK A;  3G6Y A;  2C2E A;  2ZTC A;  2OWO A;  4ECS A;  5KFL A;  4DF8 A;  5KT5 A;  9ICO A;  4J9N A;  5DG8 A;  4KLF A;  3H37 A;  4B9T A;  3GIK A;  3OVS A;  3M9N B;  4NKU A;  2FPK A;  4F4K A;  4I2I A;  5IIK A;  1RPL A;  4M6W B;  4ED6 A;  3PW0 A;  1ZQR A;  7ICH A;  1R8C A;  3M9M B;  2V9W A;  4YQW A;  1UA1 A;  3UPS A;  2DRB A;  2UVV A;  5DQG A;  2NRT A;  4DFK A;  2C22 A;  4IRK A;  1TFR A;  4UB1 A;  2IMW P;  9ICL A;  2DVI A;  5CA7 A;  1X9W A;  2JZB A;  5IIJ A;  5EWF A;  3JPO A;  1XSL A;  1UEV A;  1N56 A;  1X9M A;  3EPG A;  4DLG A;  4ELT A;  5DKW A;  1KRP A;  4F3O A;  4DL2 A;  2BPC A;  4WC3 A;  3B0Y A;  3KHH A;  3KHR A;  2MUT A;  1IXR A;  4EBC A;  2DR9 A;  5J2K A;  3MDC A;  2AQ0 A;  3N97 B;  3H39 A;  4RUC A;  1BVS A;  4YR3 A;  4I2G A;  4O3P A;  4I2E A;  4I2F A;  4NLG A;  3RAQ A;  4RWP A;  4NM2 A;  2HVI A;  8ICA A;  4J9Q A;  4B9U A;  1JXL A;  4B9V A;  5KG2 A;  1U47 A;  3RH4 A;  4MFF A;  3TFS A;  3OHB A;  4DL7 A;  7ICT A;  1WCN A;  3EWA A;  7ICS A;  5F9L A;  5KFJ A;  1LV5 A;  2HHT A;  3AQN A;  5CHG A;  5J0O A;  2XGQ A;  1NKB A;  1PX5 A;  8ICO A;  1YLQ A;  1ZQE A;  3H7I A;  4EBE A;  9ICB A;  5KFC A;  2DR7 A;  3ORY A;  1KTQ A;  5III A;  2P6R A;  2BCR A;  1BGX T;  4ED1 A;  1ZQF A;  4IQW A;  2C2D A;  3JPR A;  4XRH A;  1HJP A;  2UVR A;  8ICN A;  1KNY A;  2P66 A;  4RNN A;  3MR2 A;  3GIM A;  8ICM A;  9ICU A;  4FS1 A;  4QZG A;  3OJU A;  4F4X A;  4X4R A;  4PGQ A;  4F5O A;  2BQR A;  3BQ1 A;  3AUO A;  3SV3 A;  1IM4 A;  1QLN A;  2KZ3 A;  2R8J A;  9ICR A;  1ZQO A;  1ZQV A;  4Q44 A;  2JEJ A;  4X4S A;  3PO5 A;  1RZT A;  3T3F A;  1SL1 A;  4X4V A;  5DB8 A;  5HRB A;  2ASD A;  4FBU A;  2ZJ5 A;  4QZI A;  4RQ5 A;  4IQV A;  4DSK A;  2KTQ A;  5DB6 A;  5KFI A;  4QZE A;  1PZN A;  4DOC A;  4EBJ A;  2Y1I A;  4MF2 A;  5KFF A;  8ICP A;  3FYH A;  3G6X A;  1TK8 A;  4WC1 A;  4RWO A;  1ZQJ A;  4DQS A;  1TV9 A;  4MEX A;  4DQR A;  2HHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...