4KLTA

Dna polymerase beta mismatched product complex with mn2+, 30 min
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
326
structure length
314
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTTKQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Observing a DNA polymerase choose right from wrong.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 104
structure length 314
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4kltA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4kltA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4kltA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4kltA03
2HVHA 1TFYA 3WFSC 2ISPA 4ELTA 3ZDDA 4AT9B 2NRXA 2ASLA 8ICKA 1SZPA 3BJYA 1U48A 1L3VA 4DWIA 4P2HA 4QZIA 3THVA 2ZUBA 2FPKA 4M6WB 4KLQA 4ATBB 4WC4A 2JZBB 2V4RA 3GDXA 5IINA 1N48A 2XY5A 2P6RA 1DK3A 1QTMA 3RJHA 2NRZA 2BQRA 8ICJA 3BQ0A 4GLXA 2ZH2A 5CA7A 2XCAA 3ISDA 2VA2A 5KFBA 2JZBA 3MDAA 2JEFA 4M9NA 1WCLA 4PHEA 3JPPA 3PX4A 4ECWA 5HR9A 4XA5A 3QZ8A 1H38A 8ICBA 3LWLA 2DPIA 1S0OA 4IQUA 5BOMA 2Q0ZX 4R8UB 1BVSA 4E7XA 4QWAA 4JUZA 1U49A 2FMQA 4BXOA 5IILA 2ZH4A 1NK7A 2HHSA 1VJ7A 4KN4A 4FHWA 4M04A 2AGPA 2BE3A 3V6JA 1ZQWA 2F1IA 2H5XA 3MGIA 4K4IA 1KNYA 4AT9A 2W9MA 5DDMA 3G6XA 2HHUA 5KFUA 4BXOB 4K4GA 4ATBA 5KFPA 9ICUA 5KG5A 5HRIA 3TI0A 4KLDA 3AQLA 1D9DA 2XGPA 4YVZA 4KLFA 2ZJAA 1X9SA 4J9RA 4DSIA 1ZQBA 4FHXA 4DFKA 4M9GA 1S76D 9ICVA 3OV7A 2V9WA 1JAJA 4QZCA 8ICFA 4O3SA 4YMMA 1LB2B 1QLNA 4Q8EA 4UBCA 4RQ1A 3OGUA 3GIJA 1ZQHA 5KFHA 4KMUA 5KT3A 4R65A 3RH5A 5EWEA 4MFCA 2HHWA 1BPDA 4RQ4A 4J9QA 4B9SA 2KN7A 2J6TA 3RJKA 1CEZA 4EYHB 1ZQZA 3C5FA 4DQSA 3T5JA 1T7PA 2ZH6A 4FHVA 8ICRA 3WFQE 3C2LA 2DR9A 5DB7A 4NLZA 4YR2A 3KHGA 4KN7A 4RUAA 3PX6A 5KT7A 2IBKA 4QW9A 5KFMA 2ZH3A 2FPLA 4FBUA 3N4MB 4PGYA 7ICGA 3H4BA 2NRTA 2IA6A 3ZD9A 9ICFA 4F2RA 5J2BA 3OHBA 1X9WA 9ICRA 2BCUA 3JPQA 4EBJA 5J0YA 3OHAA 3HX0A 5HRFA 3RH4A 4ECZA 1TFWA 4PHAA 4Q44A 3TQ1A 2BGWA 5DECA 5DLFA 4AT8A 2PFQA 3SV3A 1S0VA 7ICEA 9ICIA 5KFEA 2HVIA 7ICNA 2M2WA 3HIYA 9ICLA 2W9BA 3C2KA 4IR9A 4KLLA 4WC7A 5J0QA 4NKTA 2J6SA 3TFSA 4GXJA 5IIKA 3M9MB 2BR0A 1BPZA 9ICTA 3V7LA 1UETA 2AU0A 1UT8A 4J9SA 7ICUA 1BNOA 3C5GA 5KFFA 3N97B 3V7KA 3RAXA 4NM2A 4DSJA 4UB5A 3WFOA 3B0YA 4YD2A 9ICOA 3ISBA 4EEYA 1YLQA 5J2DA 2B21A 2ALZA 3E2EA 4F5PA 3RJEA 4X0BA 5DQIA 3PNCA 5J0XA 4B9MA 4E80A 4TQSA 1XSLA 4MFAA 2ZH1A 2UVUA 4PPXA 4Z6EA 2XY7A 1ZQLA 4UD4A 4WBZA 1BGXT 2BPCA 4QZ8A 2M2UA 4PGXA 1ZQEA 3RTVA 4QZGA 2BHNA 5IIMA 2BCSA 2PFOA 1D9FA 4NLGA 2BCVA 4KLIA 3RRHA 4QZFA 4DQRA 4DL3A 8ICNA 5J0RA 4KLGA 4RQ2A 2RFFA 3UXNA 1L3UA 4YFKA 8ICIA 2KFNA 1MQ2A 2JEJA 7ICMA 4I2CA 5KT6A 2ZHBA 4UBBA 2ID1A 1ZQUA 4O9MA 1JXLA 1U4BA 3QZ7A 2C28A 2FPMA 5JUMA 4ECRA 4UQGA 1TAUA 1X9MA 3K4GA 3ZD8A 1Q79A 3GV8B 1D8YA 5D49A 2VANA 2PFPA 3HT3A 1NO5A 1NK8A 2OWOA 2FLNA 2AQ0A 5KFDA 1X2IA 3MFHA 1WOTA 4F4ZA 1OU5A 4B9UA 4X4NA 1ZQMA 1Z00A 4DSEA 1UA1A 2XCPA 4X4RA 4R8UA 1KSPA 4RQ5A 5J2EA 4C8NA 4IRKA 1ZJMA 1D8LA 2BDPA 9ICAA 3T3FA 3M8SA 5KFLA 2ZTEA 2MUTB 4MF2A 4QZAA 7ICRA 1JXEA 2ZJ5A 1Z00B 9ICHA 4EZ6A 8ICXA 1R89A 3AQNA 5EWFA 4ED3A 2C2EA 5HREA 3AU6A 3Q8SB 4X4SA 1XWLA 3MFIA 3C2MA 3RJGA 2BKEA 5DB6A 5J0PA 9ICQA 2ZH7A 5KG1A 4O3NA 4KLUA 4ED8A 4RQ6A 1RXVA 1ZQNA 4FH5A 1Y88A 3LWMA 4GXKA 3ETLA 4ED6A 4DSKA 8ICMA 1V9PA 3RJJA 4UAWA 3K75D 3SZ2A 9ICXA 4F5NA 3RB6A 3V6KA 2KP7A 1ZQPA 4RWNA 2NRWA 3B0XA 1KFSA 4LT6A 4O0IA 4O3OA 2R8IA 5KG3A 1IXRA 8ICPA 1HJPA 5DB9A 3C66A 3UPSA 2Y1JA 2NRVA 4WC1A 2JEGA 1NK4A 4PH5A 3GQCA 1XU4A 3H39A 2XGQA 2ZHAA 4HYKA 4RQ7A 4Q43A 4F50A 1BPYA 3BDPA 8ICYA 4X0AA 5J2HA 5DG7A 4DFJA 4F4YA 5BPCA 4NLKA 7ICIA 7ICPA 5DDYA 4F4XA 4YR0A 3T5KA 2BPGA 5J0OA 4P4OA 5CHGA 2IHMA 8ICSA 4DSFA 5DBCA 3TANA 2NRKA 2ZH5A 1WCNA 4ECYA 1B22A 1A77A 2BQ3A 4JWMA 2DRAA 4X4VA 3BQTA 2XO7A 4XQ7A 1B43A 4I2EA 4S3NA 4F92B 7ICHA 3RAQA 4X5VA 4B9TA 3M9OB 4I2GA 2LYHA 4RZRA 1XS9D 3GV5B 4MF8A 4JV2A 4E0DA 4I2BA 4YXMA 4ECSA 1ZQOA 2FLPA 4WCWA 5KG7A 4EP7A 1Q78A 3PW5A 4AT8B 3HWTA 4I2HA 4B9VA 1A76A 2UVWA 3JPRA 5J29A 5EOZA 2W9BB 1ZQCA 5J2GA 5DKWA 4QZ9A 5DG9A 1RYSA 4F4KA 5J0TA 1ZQVA 4EYIB 2R8KA 3HJ4A 4AT7A 3L9DA 1ZQQA 4M9LA 2JEIA 4DQQA 4JV0A 5KG2A 5J2JA 4RT2A 4MEXA 4ECUA 3JPOA 3RB0A 4CCHA 4NXZA 4DS4A 5HRDA 2M2VA 2O1PA 4F5RA 4LVSA 1ZQXA 3LQCB 4ED0A 5L1IA 3H7IA 4B9NA 4Z6CA 4XQ8A 3RB4A 4I2DA 3PR5B 1RXWA 1S0MA 2RDJA 1ZJNA 1SKWA 1KRPA 3PW4A 4EBCA 4KLTA 5KFNA 2R8HA 1TV9A 1ZQKA 3PMLA 4J9KA 3TARA 4C8KA 1QSYA 4MFFA 9ICPA 4M0AA 4IG8A 2HHXA 4IRDA 4EZ9A 5DQHA 5J2KA 2ISOA 2BCRA 7ICQA 4DOBA 1ZQSA 4KLEA 8ICWA 4DL7A 2DVIA 4Q45A 4X4QA 4C8OA 1DOQA 3MR3A 4LZGA 3OUYB 3UPQA 4DOAA 5L1KA 4ECTA 5HRBA 4ED2A 3KTQA 1NJXA 4XUSA 5DLGA 3JPNA 3Q8PB 4GC7A 2HHPA 5KG6A 4AT7B 5KFWA 4X4UA 1R8AA 1TFRA 1S10A 2ZH9A 7ICLA 1KDHA 3OSNA 4M9JA 4DFMA 3OVSA 4LZDA 2C22A 4YN4A 1ZQDA 8ICOA 1PX5A 4RWPA 3Q8LA 5DBAA 3MR6A 4IRCA 5KTQA 5CWRA 1Z3EB 5EWGA 4P4PA 4KLSA 8ICZA 4IQTA 5HRHA 7ICFA 1UT5A 3MDCA 4EBEA 1ZQRA 2IHNA 3WFRE 4F4WA 4TQRA 4ECXA 2XC9A 5DQGA 1T4GA 1TK5A 4I2JA 3QE9Y 2DRBA 3HP6A 1BNPA 1KFDA 5TZVA 1MQ3A 5IIIA 2ATLA 1JX4A 2R8JA 4BDPA 8ICTA 1MIYA 3H8JA 1RPLA 4UAZA 2C2DA 2DPJA 3JPSA 3PR4A 1ZQGA 8ICGA 3C23A 5KFIA 5D4BA 3OUYA 3H8SA 1NK0A 2W9CB 4DQIA 2M9NA 4BGDA 3RR8A 2PI5A 7ICSA 7ICVA 4ED7A 1S77D 4BWMA 3GV7B 4EBDA 4F5OA 4RNNA 1L3SA 1TK8A 2R8GA 4M2YA 9ICJA 1XO1A 3AU2A 3M8RA 5KFRA 3EYZA 4ZH4A 1NKCA 1SL2A 4F93B 3HPOA 4NY8A 8ICCA 4RNOA 3QEAZ 3GIIA 4KLOA 3PW2A 2ZTCA 1SL0A 8ICLA 3AQMA 1IM4A 3MR2A 3PW0A 1SKSA 4M5DA 3IHQB 1ZQFA 1R8CA 4DS5A 1TAQA 3H8WA 2ZH8A 3H4DA 5HC9A 1ZQIA 3T5LA 4KLMA 4O5KA 5J0WA 5J2AA 2PI4A 1COOA 4IQVA 3RH6A 4QWEA 1XSNA 4F2SA 1UEUA 5DGBA 4I2FA 5KFOA 4QWCA 4RQ8A 4FS1A 5J2CA 1KLNA 1S9FA 3H3AA 2V4QA 1ZQTA 4RNMA 4TUPA 2M2TA 1BPBA 2ZTDA 1JIHA 5HHHA 3GIKA 4DOCA 3KHLA 9ICBA 3UXPA 3RBDA 3TFRA 2ASDA 4E8FA 4RT3A 4IR1A 1ZQAA 4YCXA 2AJQA 2BCQA 4KITB 5L1JA 4FO6A 1U47A 4R63A 3UQ0A 5KFCA 2A1JA 2MAXA 3EZ5A 2AGQA 2I1QA 4RPXA 1JMSA 1NJZA 4C8MA 3OJSA 1K1SA 4RQ3A 3AUOA 1ZQJA 4M9HA 2DR5A 2KZMA 3JPTA 1T8EA 4F91B 4KLHA 1U9LA 1CUKA 9ICWA 3JZ0A 3V6HA 4FH3A 4QW8A 5KG4A 2A1JB 4Z6FA 5HNKA 3BQ2A 4J9MA 4J9OA 1NK5A 1NK6A 5CB1A 1L3TA 4KLJA 2P6UA 8ICVA 9ICGA 3C1YA 4UB3A 5HHIA 3ORYA 8ICHA 3EW9A 2PFNA 3GILA 4YP3A 4O3PA 2HW3A 7ICKA 4UD5A 4YQWA 1S0NA 4FHYA 4WC3A 3V72A 4PHPA 4XRHA 3BQ1A 4F5QA 1TVAA 3GFKB 4F8RA 4RWQA 5F9NA 4ECQA 3T5HA 1RYRA 2I9GA 1F5AA 4DQPA 3HW8A 2C2RA 2HHVA 4O3QA 4F3OA 4RUCA 3H40A 3V7JA 2IMWP 3Q8KA 2UVVA 3ZDCA 3RJIA 4C8LA 1VFGA 4DEZA 3PX0A 4J9LA 4J9PA 2P66A 4GXIA 4UAYA 2W8KA 2W8LA 4RU9A 2FMSA 2KZZA 3PO4A 4ECVA 4JV1A 1SKRA 3EPIA 4JWNA 4QWBA 2AGOA 3H37A 5J2FA 4QZDA 2HHQA 2MUTA 4YMOA 3RR7A 4FBTA 5KFZA 3ISCA 1QSLA 9ICCA 3Q8RB 2PXIA 4DSLA 3MBYA 4WBYA 3SYZA 1QSSA 4RWOA 3TAPA 3OVBA 9ICKA 4IQWA 3WFPA 3ZDBA 4DLEA 4DL4A 3MABA 4O5CA 2KTQA 3PVXA 5DB8A 2VA3A 1KTQA 3JYYA 4I29A 3LK9A 2F1JA 1ZETA 3SI8A 4O3RA 4TURA 5KFVA 5CP2A 3MGHA 2PBEA 4MEYA 4QWDA 3EPGA 1UA0A 2J6UA 5HRLA 1BPXA 1MSWD 4UB2A 3NGDA 5DBBA 5L1LA 3TAQA 4WC6A 5KFTA 4ELUA 2BPFA 4NLNA 4WC5A 4X4TA 4DLGA 4PGQA 4YG2A 1RZTA 4DF8A 8ICEA 8ICQA 4FHPA 3NTUA 5HMLA 5KT4A 4NKUA 4UB4A 4B9LA 4X4PA 4BWJA 3RBEA 1T3NA 4YR3A 1LV5A 2FLLA 4DL6A 3PO5A 4PHDA 5F2VO 4YXJA 5KT2A 4I27A 4I2IA 3Q8QB 9ICNA 3PMNA 4EBKA 3IM1A 3SV4A 2ASJA 1S97A 3NYBA 4YMNA 4DO9A 4R64A 5KT5A 1NK9A 1EXNA 2KZ3A 4Q8FA 2DFLA 5KFJA 8ICUA 4R66A 5KFSA 4GC6A 4DFPA 2Y1IA 4I28A 3PV8A 2XY6A 1NJYA 5DEDA 1U45A 4RPYA 2ZUDA 5HRGA 3MR5A 1N56A 3QEBZ 7ICOA 4TUQA 1HUZA 5HMMA 1FA0A 1MIVA 5BOLA 4FS2A 5F9LA 3RRGA 1UEVA 3ZDAA 5IIJA 5CJ7A 3PY8A 3KHHA 2ZJ8A 3PW7A 2VA8A 1SL1A 4X4OA 2DR7A 4G3IA 4YD1A 1JQRA 2HHTA 2BQUA 3GIMA 1HUOA 4P4MA 1NOMA 3RB3A 1C7YA 1MIWA 3H38A 1NKEA 1BPEA 3FDSA 3RJFA 5L9XA 4QZBA 4ELVA 9ICEA 5HRKA 5HP4A 4QZHA 1XSPA 2RDIA 3EWAA 1JN3A 3LDAA 4K4HA 5J0SA 3G6YA 3M9NB 4DL5A 3OSPA 1TKDA 4KTQA 5C5JA 1K1QA 3OVAA 3FYHA 3UQ2A 1NJWA 5KFAA 5J2IA 4M47A 1AROP 1L5UA 5J0UA 2O5AA 2ZUCA 4DL2A 4QZEA 2F1HA 4DF4A 2AQ4A 1ZYQA 2DR8A 2WTFA 2GWSA 3C21A 4JK1A 2Q66A 4I2AA 3C18A 5DGAA 2KFZA 4Z6DA 1V4AA 5D46A 3G6VA 1XC9A 4NM1A 9ICMA 1NZPA 1R8BA 5KFXA 7ICTA 7ICJA 1KEJA 3C1ZA 2W9CA 3Q8MA 1DK2A 4WC0A 4WC2A 5KFGA 5KFQA 3OJUA 4ED1A 4RQ0A 2FMPA 2UVRA 1KFTA 1PZNA 1ZQYA 2W9AA 5CR0A 3KHRA 8ICAA 4J9NA 3AQKA 5KFKA 1NKBA 1TK0A 3HJ1A 4RPZA 4O5EA 5KFYA 5DG8A 1DGSA 4M6WA 3UXOA 5KG0A 1MC8A 5IIOA 4UB1A 3ZDEA 4TUSA 9ICSA
chains in the Genus database with same CATH superfamily
3WFSC 2ISPA 5ALWA 4NV0A 8ICKA 1WG8A 3EF2A 2ZUBA 3KKAC 4M6WB 2E1FA 4ATBB 3ERCC 5IINA 1N48A 1DK3A 2P35A 1KQQA 8ICJA 1FFVA 2ZIUB 1HEKA 2ESEA 2F76X 3ISDA 5KFBA 3MDAA 2JEFA 5KL8B 3PX4A 5HR9A 2KJ8A 1SV0C 4E7XA 4EEKA 4QWAA 3VC8A 1X6JA 3NRZA 1NK7A 1VJ7A 4KN4A 4FHWA 2AGPA 5A0LA 2HHUA 4K97A 2YMPA 3QUTA 5GTHU 3AQLA 3TI0A 2XGPA 4DSIA 4FHXA 2JV3A 2V9WA 1JAJA 8ICFA 4O3SA 1ED1A 4YMMA 2K4PA 4RQ1A 3OGUA 1ZQHA 3RH5A 3SR6A 3UMCA 2KN7A 3RJKA 2JGAA 1T7PA 2ODGA 5DB7A 4NLZA 4KN7A 2HBKA 2ZH3A 3R9KA 2IA6A 1ECWA 5EE3A 5J2BA 3BQ7A 2BCUA 5ALFA 1Z19A 3MCRA 2JXJA 3RH4A 1TFWA 4Q44A 4CGZA 5DECA 5DLFA 3SV3A 1RM6C 3HIYA 2W9BA 4IR9A 5J0QA 2J6SA 4GXJA 2LHTA 1BPZA 1UETA 2AU0A 7ICUA 2AXTU 4DSJA 3E0FA 4NM2A 3WFOA 3ZI4A 4EEYA 1X40A 3E2EA 3PHZA 3RJEA 2XI9A 3GZFA 1WUDA 1S8OA 1ZQLA 4WBZA 2BPCA 4QZGA 5EE0A 1GPJA 2R18A 2DKZA 5AKJA 5ALDA 2KSOB 2JEJA 4I2CA 5KT6A 2PMZC 5H2FU 1ZQUA 1JXLA 3QZ7A 4OO1J 3AMZA 2E1EA 5B66U 4ICAA 1NK8A 2OWOA 1X2IA 4Y2XA 1C20A 4X4NA 1ZQMA 1Z00A 1PK1A 5ALVA 3LYSA 5AI6A 3M6ZA 1ZJMA 9ICAA 3AQEA 1JXEA 9ICHA 1Z00B 2KVSA 5EWFA 5HREA 2BKEA 5DB6A 4KLUA 3NVZA 3RJJA 4UARA 3AEVA 1N62A 2G09A 3WKBA 1ZQPA 2NRWA 1N63A 5G5HA 2Y1JA 2NRVA 2JEGA 2GH1A 2XGQA 4RQ7A 4KMOB 4F50A 4ACOA 3ONNA 4LEWA 4F4YA 4NLKA 2FDRA 1V38A 1VDVA 2BPGA 5J0OA 5DBCA 2G07A 4JWMA 4XQ7A 1B43A 4F92B 5ALSA 4RZRA 1XS9D 4MF8A 4JV2A 4PL2A 2FLPA 4AT8B 4I2HA 4B9VA 4NLBA 3WKDA 1OUQA 5J29A 3HJEA 5J0TA 3JCFA 3WKEA 2RLTA 4EYIB 3HJ4A 4M9LA 4JV0A 3JPOA 2KK0A 4NXZA 5HRDA 5ALKA 2O1PA 2KKPA 3GU3A 3H7IA 2KHVA 1X42A 4KLTA 1SKWA 4IG8A 3PMLA 2WF8A 1SIJA 2HHXA 4IRDA 5AM3A 7ICQA 4DOBA 4Q45A 3MR3A 4LZGA 4F71A 2Y9UA 4DOAA 4WC6A 1NJXA 3JPNA 4GC7A 2Y0SC 4AT7B 4EV6A 5KFWA 1R8AA 1TFRA 3F2BA 3KFUF 2DUYA 4LZDA 1PX5A 4YN4A 1L8OA 4IRCA 1L7NA 2BBHA 4KLSA 4EBEA 2IHNA 4FE3A 1T4GA 4WJ3B 1JROA 4I2JA 3NVWA 3HP6A 1BNPA 1KFDA 1L7OA 1VJ5A 4KB6A 2VIXA 4K9AA 3J81j 1QH9A 3H8JA 2C2DA 1FFUA 3JPSA 3C23A 2DGZA 1NK0A 4DQIA 2M9NA 3PSFA 7ICSA 2ZH7A 3GV7B 4EBDA 9ICJA 4EENA 5KFRA 3HPOA 8ICCA 3NASA 3QEAZ 3L3FX 2ZTCA 4CE6A 8ICLA 1SKSA 3QNMA 3H8WA 3H4DA 5HC9A 5J2AA 3SAGA 2KHQA 1ZD5A 5DGBA 5KFOA 4QWCA 4RQ8A 2D8CA 4I2FA 4FS1A 2EAPA 1S5LU 1ZQTA 4TUPA 2ZTDA 1JIHA 5HHHA 3GIKA 1FIQA 2QKQA 1KW4A 3TFRA 3RBDA 1Z1BA 4RT3A 2W43A 1ZQAA 2IUBA 5FP0A 5KFCA 2F3NA 3N28A 4C8MA 2DR5A 4QW8A 4J9MA 4AYBF 4UB3A 5EE9A 2HOFA 5ALMA 3SEIA 1TVAA 2W3SA 1N60A 2E8MA 1DGJA 2N1RA 5ALHA 1L7MA 3T5HA 1RYRA 2I9GA 4DQPA 2G08A 1B4FA 3QUCA 2HHVA 3V7JA 4C8LA 2DF4B 2MSNA 4UAYA 4RU9A 2AGOA 4HAIA 3LVWA 4UASA 4QZDA 5HR7A 2WAQC 2MUTA 4YMOA 3RR7A 4FBTA 4DSLA 1WWUA 4RWOA 3OVBA 2W7PA 1F44A 2HDOA 5B5EU 4FFDA 1ZXIA 1KTQA 3JYYA 4I29A 3SI8A 2VKQA 2EAOA 1DXSA 5CP2A 3EPGA 5CEHA 3UMBA 1BPXA 4UB2A 3UMGA 4XJEA 5DBBA 4X4TA 4DLGA 8ICEA 5HMLA 4NKUA 4X4PA 3FM9A 2BZFA 5F2VO 4YXJA 3Q8QB 5AKEA 1N2XA 2KD1A 4DO9A 4R64A 5KT5A 2QB0A 4Q8FA 3PSPA 5KFJA 8ICUA 4DFPA 2XY6A 2ZIXA 4OJLA 2GAFD 2LYBA 4ZOHC 2BDUA 7ICOA 3L9DA 1HUZA 1FA0A 5CFSA 3HJ1A 5F9LA 4JLXA 3PW7A 4X4OA 4G3IA 3WK5A 2Y9TA 1HUOA 1C7YA 5HRKA 1XSPA 1RQLA 3OTQA 1JN3A 4DCCA 3TACB 5CHEA 5K4LA 4Y2VA 5C5JA 1NJWA 1D8BA 5KFAA 2YMQA 1L5UA 5J0UA 5D61A 4DL2A 2F1HA 3C21A 4JK1A 2EANA 4K8VA 2G5HB 1KEJA 3Q8MA 4WC0A 4UAUA 4WC2A 4ED1A 2UVRA 4RQ0A 2FMPA 2EZYA 2ZG6A 1ZQYA 3IG5A 3KHRA 5DG8A 3UXOA 4TUSA 1B0XA 3KOOA 4AT9B 3BJYA 1U48A 3L4PA 1L3VA 4P2HA 4QZIA 3THVA 3QU7A 4P0QB 4UATA 2YMMA 2XY5A 5ALPA 1QTMA 1J97A 2BQRA 1PK3A 1SV0A 4GLXA 2ZH2A 4PL1A 4MKPA 4XA5A 3QZ8A 3LWLA 4IQUA 2ZIVA 4R8UB 3SAFA 1U49A 3ED5A 2KICA 5IILA 2ZH4A 5ALRA 3V6JA 1ZQWA 5AM0A 3MGIA 1TE2A 5EE1A 1F0MA 4LJXA 4O68A 4OAFA 4EGWA 4G9BA 5KFUA 2LM1A 4CDGA 5KG5A 4KLDA 3PZPA 1X9SA 1S76D 4M9GA 3OV7A 3DDHA 4Y2SA 2WB1C 4R65A 5KL1B 3E58A 2E8OA 2J6TA 4CF4A 5AIAA 1ZQZA 5F3XB 4FHVA 5AM1A 3ICXA 3C2LA 2HCFA 4AP9A 4YR2A 4RUAA 3S6JA 2FPLA 3ZD9A 9ICFA 3N7RC 3OHAA 2EZXA 1S0VA 7ICEA 9ICIA 2HVIA 2NO5A 1RG6A 9ICLA 2VJ4A 4NKTA 5IIKA 2RP5A 1BNOA 5KNIA 5AK3A 4UB5A 4P0PA 2D3DA 5J2DA 4O69A 4B9MA 4E80A 5AI8A 1LKYA 1L6NA 3HILA 2UVUA 3QU4A 4Z6EA 2XY7A 4UD4A 4QZ8A 4PGXA 1ZQEA 5IIMA 3H0MB 5D62A 2PFOA 3K7DA 2BCVA 3RRHA 2K4EA 4KLGA 8ICIA 2KFNA 1MN8A 7ICMA 1ZRNA 2EQYA 4UBBA 1KL9A 4UB6U 5AKIA 2C28A 3U26A 2HN2A 1TAUA 5ALNA 2PFPA 1NO5A 2LYAA 2FLNA 5KFDA 4DSEA 4R8UA 3HKZC 2A19A 3M7DA 4IRKA 1D8LA 4DFDA 5HR6A 3T3FA 5KFLA 2ZTEA 2MUTB 4MF2A 7ICRA 4OJ6A 4K9BA 3Q8SB 2B0CA 1XWLA 3MFIA 4I0UA 3RJGA 2CN1A 5KG1A 4O3NA 4ED8A 1RXVA 1Y88A 8ICMA 2GA9D 4UAWA 3SZ2A 4CRXA 4RWNA 3B0XA 3DV9A 8ICPA 1HJPA 1JRPA 3GQCA 5ALLA 3H39A 5AKYA 2HBJA 5JTIA 4DFJA 7ICIA 5BPCA 3TADC 7ICPA 3TANA 2MA1A 4QJFB 3WKAA 2DRAA 3BQTA 5ALTA 3C28A 3RAQA 3M9OB 1UCVA 4E0DA 4YXMA 2D6FC 3PW5A 2W54A 5AHXA 3JPRA 2W9BB 1ZQCA 5J2GA 1RYSA 5DG9A 1MA7A 2GLEA 4AT7A 2JEIA 5AKZA 4DQQA 2H3VA 3HKZF 4MEXA 4ECUA 2KIWA 4DS4A 2M2VA 5AM2A 2LMRA 5L1IA 4LEVA 4B9NA 7ICHA 1S0MA 2DWQA 2R8HA 1SZHA 1TV9A 1ZQKA 2W11A 1QSYA 3F53A 5J2KA 1N5XA 8ICWA 2DVIA 1L7PA 3UPQA 5AK6A 1GO3F 5DLGA 4XUSA 3Q8PB 2ZH9A 7ICLA 1KDHA 5ALEA 4KM5A 4DFMA 3OVSA 8ICOA 3D2SA 4FZLA 3H0LB 5EWGA 4WQKA 5HRHA 3MDCA 4F4WA 5DQGA 2DRBA 4QIWF 5TZVA 1MQ3A 2R8JA 3AL0B 4BDPA 5JU5A 1MIYA 2B51A 4UAZA 3PR4A 3RFAA 5KFIA 3OUYA 3H8SA 7ICVA 2EZZA 4F5OA 4M2YA 2R8GA 3NVVA 3M8RA 3TADA 2K4IA 4C4RA 3LVVA 4RNOA 2M0NA 3PW2A 3PW0A 3IHQB 1ZQFA 1A0PA 1R8CA 2ZH8A 5AK4A 2ES6A 1COOA 4IQVA 1WYGA 3AM9A 1XNSA 5T14A 1S9FA 2I5HA 2V4QA 2M2TA 4K99A 4E8FA 4B6JA 4UW9A 4IR1A 1U47A 2A1JA 3EZ5A 1JMSA 1JUDA 3OJSA 4RQ3A 4M9HA 4US8A 5HNKA 2A1JB 2IOFK 4J9OA 2F77X 2P6UA 5HHIA 8ICHA 3PSTA 4O3PA 7ICKA 1S0NA 5ALZA 4F5QA 3HW8A 4O3QA 4U7CA 4RUCA 2HMXA 5ALJA 3Q8KA 3RJIA 3PX0A 4OAIZ 2W8KA 2FMSA 1ZD4A 4JV1A 4QWBA 3H37A 3ISCA 1QSLA 3ER9B 3TAPA 4IQWA 4DLEA 4DL4A 4O5CA 3PVXA 2VA3A 3LK9A 3CP8A 4OAHA 3M1YA 5KFVA 2XIDA 4QWDA 4JMUA 2EDUA 5KFTA 2PKEA 4ELUA 4YG2A 8ICQA 5AK5A 4UB4A 2EH9A 2H3IA 3N7PD 4PHDA 2IOFA 4I2IA 2F8LA 9ICNA 2YTUA 2ASJA 3NKUA 1KN5A 1NNLA 4O3MA 3QXGA 2LPEA 4R66A 5KFSA 4GC6A 4I28A 5DEDA 1NJYA 1PVRA 3QEBZ 1PVQA 3ZDAA 3PY8A 3KHHA 1UHUA 4FZMA 2ZIXB 2DR7A 1JQRA 1BPEA 3FDSA 4ELVA 5L9XA 9ICEA 5HP4A 4QZHA 4USAA 2HBMA 3EWAA 3G6YA 3OSPA 1TKDA 3OVAA 4Y2YA 2RQ5A 4M47A 4C7YA 3BS5A 2NV3A 2AQ4A 1ZYQA 2DR8A 1P7DA 1V4AA 3G6VA 4NM1A 1Q8KA 1R8BA 4NJ8A 7ICTA 7ICJA 3C1ZA 2W9CA 1DK2A 5KFGA 3OJUA 2AH5A 1PZNA 3KZXA 8ICAA 3WU2U 3CRXA 4J9NA 5KFKA 1NKBA 1VLBA 4O5EA 5KFYA 1DGSA 2G06A 4UB1A 2KEYA 1MC8A 1RQNA 2HSZA 4U6PA 2Y0SF 2EWRA 3WKCA 2JZBB 3GDXA 3UM9A 4Y2QA 3RJHA 2OH2A 1SGGA 2KG5A 5D63A 3L5KA 3BQ0A 5C0YA 4WQLA 5CA7A 1IV8A 2NO4A 2XCAA 1L8LA 2JZBA 4M9NA 1WCLA 4PHEA 2W7OA 8ICBA 1UQVA 2DPIA 2F2AB 2Q0ZX 1BVSA 1CRXA 4NWIA 2FMQA 4BXOA 5JTGA 2HHSA 2K8AA 4K4IA 2W9MA 2ZIVB 5J8YA 5B3PA 4NXUA 4BXOB 4ATBA 3WK4A 9ICUA 5HRIA 1D9DA 4JLZA 4YVZA 2YB1A 3QX7A 4CF5A 4WOYA 4DFKA 9ICVA 4QZCA 4QNLA 4Q8EA 5KFHA 5EWEA 1SB3C 4RQ4A 4J9QA 4OJPA 1CEZA 2YB4A 3NS1A 4DQSA 8ICRA 2DR9A 1OXJA 3KHGA 2IBKA 4QW9A 5KFMA 4FBUA 4OAGA 2CPRA 4PGYA 5AKLA 3H4BA 3IV6A 2NRTA 3F2DA 5GTIU 2OXOA 1X9WA 2WB1F 9ICRA 3JPQA 2A3VA 4EBJA 5J0YA 1PUZA 5HRFA 3TQ1A 4EEDA 7ICNA 2M2WA 4WC7A 5AM4A 2OEHA 2LI6A 3M9MB 9ICTA 1SV4A 3V7LA 1UT8A 4F72A 3IDWA 3IRUA 3B0YA 5AKHA 1YLQA 2YN4A 2B21A 3KKAA 4F5PA 3PNCA 5J0XA 2W03A 2B56A 4TQSA 1BGXT 2M2UA 2CXYA 3RTVA 2BHNA 4NLGA 4QZFA 8ICNA 4C4SA 5J0RA 2RFFA 1L3UA 2GOLA 3O0FA 3C29A 2WHEA 5L1MA 2ID1A 4O9MA 1U4BA 5JUMA 4ECRA 4UQGA 1Q79A 3GV8B 2VANA 3HT3A 1Q3VA 2AQ0A 3QUQA 4F4ZA 1OU5A 5AI9A 4B9UA 1UA1A 2XCPA 3QUBA 3H8MA 2BDPA 1X66A 4QZAA 1TFYA 2DBYA 2B4VA 1M6YA 2YMLA 3AU6A 2O6KA 3C2MA 5J0PA 1ZQNA 4FH5A 2E8PA 3LWMA 4GXKA 4DSKA 3ETLA 3NWIA 9ICXA 4F5NA 3V6KA 5AM5A 3CNHA 1KFSA 4LT6A 4LEZA 4O3OA 2R8IA 1IXRA 3UPSA 4WC1A 2RHFA 1NK4A 1XU4A 4Q43A 8ICYA 5J2HA 1N61A 3QU5A 5DDYA 4F4XA 4P4OA 3SD7A 5CHGA 2NRKA 4HX0A 1B22A 1A77A 2QB0B 2BQ3A 2XO7A 3HRDD 4I2EA 3FC4A 4S3NA 4X5VA 4B9TA 3AN1A 3GV5B 4I2BA 4ECSA 1ZQOA 4EP7A 1Q78A 4QIWC 1IG6A 3I1YA 3KD3A 1ZQVA 2R8KA 4NL9A 4RT2A 4RQMA 2DL0A 1ZQXA 5AI4A 4ED0A 2L5YA 3BS5B 4I2DA 3RB4A 1RXWA 4EBCA 2JH1A 2QARB 4MFFA 1JALA 2WF5A 4EZ9A 2ISOA 2BCRA 1ZQSA 4KLEA 4DL7A 2HI0A 4X4QA 1DOQA 4RQNA 3TKAA 5TISU 4OD0A 4O67A 2B6GA 3CYMA 1DRGA 3KTQA 3SENA 5KG6A 4M9JA 2C22A 1ZQDA 3Q8LA 3MR6A 2K8CB 5KTQA 5CWRA 2JR5A 4P4PA 8ICZA 4IQTA 1XO0A 1ZQRA 4EEBA 5AKGA 4ECXA 4BJQA 1T94A 2XC9A 1TK5A 2E3TA 3QE9Y 4NXTA 2WF6A 5IIIA 8ICTA 1RPLA 1ZQGA 3OPXA 5ALOA 8ICGA 5D4BA 2W9CB 4BGDA 2PI5A 2MRLA 4ED7A 1L3SA 3SMVA 4RNNA 1TK8A 1SL2A 4NY8A 3KZIU 3EYZA 4ZH4A 1NKCA 1KKXA 2K89A 3MC1A 4F93B 3GIIA 4KLOA 3NVOA 3QU9A 3AQMA 3MR2A 4M5DA 4DS5A 1TAQA 1KBUA 4KLMA 3T5LA 1Q46A 2KE7A 4QWEA 4UAVA 3RH6A 1XSNA 2EAMA 2H3ZA 1KLNA 5JRTA 4RNMA 3NRWA 3WK7A 4DOCA 3KHLA 9ICBA 3UXPA 2DQNB 2FI1A 4JB3A 2BCQA 4KITB 5L1JA 4P0PB 4FO6A 1Z4NA 4NL9C 2MAXA 4RPXA 1NJZA 1ZQ1C 3NVYA 2KZMA 3JPTA 4KLHA 2OYYA 3V6HA 4FH3A 1RYUA 4Z6FA 3BQ2A 4LEYA 1NK5A 1NK6A 5CB1A 3C1YA 1CI4A 3EW9A 1Q3UA 2PFNA 4EX7A 2W04A 4PHPA 4XRHA 4F8RA 3GFKB 3CK6A 4RWQA 1A6SA 2HN1A 4F3OA 3H40A 1VFGA 2IMWP 2UVVA 3A0HU 1COKA 4DEZA 2PMZF 4A8EA 2KKVA 2P66A 2QLTA 2KZZA 4ECVA 1FEZA 3EPIA 1SKRA 4JWNA 5AICA 5J2FA 2KIVA 5KFZA 1LKYB 3I76A 9ICCA 3Q8RB 4WBYA 3MBYA 3F5AA 9ICKA 4Y2UA 3ZDBA 5DB8A 4O3RA 3WK8A 4TURA 2FE9A 3F5EA 2PBEA 3K1RB 1UA0A 2J6UA 5HRLA 3NGDA 2DKXA 2BPFA 4PGQA 1RZTA 4DF8A 4FHPA 5KT4A 4B9LA 3BS7A 3H0RB 4BWJA 4C4TA 2JRZA 1T3NA 4YR3A 1LV5A 3PO5A 4EBKA 3IM1A 3SV4A 1S97A 3NYBA 1NK9A 2IHOA 1EXNA 1J2MA 1HIWA 2Y1IA 4GFJA 2ZUDA 5HRGA 1AQ6A 3MR5A 1N56A 1URJA 1UEVA 5HMMA 3RRGA 2OM6A 2VA8A 4YD1A 1ZOLA 2BQUA 4P4MA 1NOMA 3H38A 5ALYA 1QCKA 4QZBA 4NXWA 5E79U 3LDAA 4K4HA 1NI3A 4KTQA 1K1QA 3SAHA 3FYHA 3RF9A 3A0BU 1AROP 2BBJA 3D2QA 4QZEA 1YZ6A 4I2AA 2KFZA 4Z6DA 5D46A 1XC9A 5AKXA 1X6IA 5KFQA 1KFTA 2OHFA 5CR0A 4KX3A 3HWTA 2HVHA 4ELTA 3ZDDA 2ZIWA 2NRXA 4IC9A 2ASLA 1SZPA 4DWIA 2FPKA 4KLQA 1UPHA 4WC4A 2W55A 2V4RA 2P6RA 5G5GA 3ER8C 2NRZA 2ZIWB 2VA2A 2I6XA 3JPPA 4ECWA 3NUQA 1H38A 1NZBA 3IP4B 1S0OA 5BOMA 2MU2A 2WF9A 4BX9C 4JUZA 1QQ7A 1V85A 4M04A 2BE3A 1T3QA 2F1IA 2H5XA 1KNYA 4AT9A 5AKKA 5DDMA 3G6XA 2KMDA 4P0QA 4K4GA 1SXEA 5KFPA 4KLFA 2ZJAA 4J9RA 1ZQBA 4K98A 1LB2B 1QLNA 2F44A 2G0AA 4UBCA 3GIJA 5KT3A 4KMUA 4MFCA 2HHWA 1BPDA 4B9SA 1YT3A 4EYHB 3C5FA 3T5JA 3WFQE 2ZH6A 2E8NA 3N7SC 2YY6A 2OCEA 2QARA 3PX6A 5KT7A 4IS7A 1O03A 5KAIU 3N4MB 7ICGA 3B9JA 4F2RA 1ZD3A 2XVTA 3OHBA 3HX0A 1ZRMA 4ECZA 4PHAA 2BGWA 4AT8A 2PFQA 4Y2JA 5KFEA 3C2KA 4KLLA 4NXVA 5B3QA 2ZXIA 3TFSA 2Z7JA 3MGVA 2BR0A 2VJ5A 4J9SA 3C5GA 5KFFA 3N97B 3V7KA 3RAXA 3D6JA 4YD2A 2XICA 9ICOA 3ISBA 2ALZA 4X0BA 5DQIA 4GIBA 1N5WA 1XSLA 1X9XA 4MFAA 2ZH1A 4PPXA 4OCZA 2BCSA 1D9FA 4KLIA 2JHDA 4DQRA 4DL3A 5ALQA 4RQ2A 3UXNA 3I28A 4YFKA 2G5IB 1MQ2A 2ZHBA 3BZCA 2KJ5A 4NXXA 4C0ZA 2FPMA 5AI0A 4N7RA 2H3FA 1X9MA 3K4GA 3ZD8A 1D8YA 5D49A 2WF7A 4C7ZA 3MFHA 1WOTA 3QYPA 5KAFU 5AIBA 4X4RA 1KSPA 4RQ5A 5J2EA 4C8NA 4AYBC 3M8SA 1SWVA 5CFUA 2ZJ5A 8ICXA 1R89A 4EZ6A 3AQNA 4ED3A 2C2EA 4X4SA 4FO1A 9ICQA 2NYVA 4RQ6A 4ED6A 2JMGA 1V9PA 3K75D 3RB6A 2KV2A 2KP7A 4O0IA 5KG3A 5DB9A 3C66A 2KJ9A 4Y2RA 4PH5A 2HOIA 2ZHAA 4HYKA 1BPYA 4X0AA 3BDPA 1Z4OA 5DG7A 3T5KA 4YR0A 2LKYA 8ICSA 2IHMA 4MHVA 4DSFA 2ZH5A 1WCNA 4ECYA 4PZOA 2K4HA 4X4VA 2F8KA 4I2GA 2LYHA 4WCWA 5KG7A 1A76A 2UVWA 5ALIA 5EOZA 5AI5A 5DKWA 4F4KA 4QZ9A 2WFAA 1ZQQA 2HBLA 5KG2A 5J2JA 2AHOB 4K96A 3RB0A 4CCHA 2E5SA 4F5RA 4LVSA 3LQCB 1JI7A 4XQ8A 4Z6CA 3PR5B 2RDJA 1ZJNA 1KRPA 3PW4A 3ALRA 5KFNA 4C8KA 4J9KA 3TARA 9ICPA 4M0AA 4KX5A 2A1AA 3KBBA 1K5OA 5DQHA 1F5SA 3EUB2 4C8OA 3OUYB 5L1KA 4ECTA 5HRBA 4ED2A 4X4UA 2HHPA 1S10A 1PVPA 3OSNA 3OWGA 4BUGA 4RWPA 5DBAA 1Z3EB 7ICFA 1UT5A 3T79A 1WWVA 3WFRE 4TQRA 2JH7A 4Y2PA 1JX4A 2ATLA 2YX8A 2DPJA 2RRDA 3RR8A 2H3QA 1S77D 2IOHA 4BWMA 1XO1A 2KVCA 3AU2A 2YQEA 1SL0A 1IM4A 1ZQIA 3VCBA 1Z1VA 5J0WA 4O5KA 2PI4A 1UEUA 4F2SA 5J2CA 2CRXA 3H3AA 2FJ6A 2KNJA 1BPBA 2ASDA 2AJQA 4YCXA 4R63A 3UQ0A 3CW2C 2AGQA 1YZ7A 4FZNA 2K60A 2I1QA 1OW5A 1QQ5A 1K1SA 3AUOA 1ZQJA 4NLCA 1SXDA 1V97A 1T8EA 3K1ZA 4F91B 1U9LA 1CUKA 9ICWA 3JZ0A 5KG4A 1TAMA 3IG8A 1L3TA 4KLJA 9ICGA 8ICVA 3ORYA 3GILA 4YP3A 2HW3A 4WC3A 2LBOA 4UD5A 4YQWA 4FHYA 3V72A 3BQ1A 5CRXA 2FCLA 2KOBA 4Y2TA 5F9NA 4ECQA 1F5AA 2C2RA 3ZDCA 2Q4TA 1ZD2P 4J9LA 4J9PA 2ZXHA 4GXIA 1PK1B 2WAQF 2W8LA 3PO4A 3WK6A 2ZIUA 3D2NA 2HHQA 2GO7A 1FO4A 1RDFA 2PXIA 3SYZA 1QSSA 4WH5A 3WFPA 3MABA 3WK9A 2KTQA 4PZNA 2F1JA 1ZETA 3QU2A 3MGHA 4MEYA 4J03A 1MSWD 3TAQA 5L1LA 4WC5A 4NLNA 3NTUA 4OJ5A 3DEEA 3RBEA 5ALXA 2FLLA 4DL6A 5ALGA 5KT2A 4I27A 4C80A 5J8YC 3F2CA 4YMNA 5ALUA 2KZ3A 2DFLA 1IIPA 5CFTA 3PV8A 3AQFA 1U45A 4RPYA 1J2NA 2W3RA 4TUQA 1LVHA 1MIVA 5BOLA 4FS2A 5IIJA 5CJ7A 4IL6U 2LM4A 2ZJ8A 4OJOA 3M6KA 1SL1A 3BZKA 4O6AA 2HHTA 3GIMA 3RB3A 1MIWA 1NKEA 3RJFA 2HOQA 2RDIA 2K8BB 2KSOA 5J0SA 3M9NB 4DL5A 3UQ2A 1QQ6A 4EX6A 5J2IA 4PJ0U 4CNQA 2O5AA 2ZUCA 1SWWA 3PSIA 3SQIA 4DF4A 2WTFA 2GWSA 2Q66A 3C18A 5DGAA 9ICMA 1NZPA 1O08A 5KFXA 4EELA 3ETRA 4US9A 3IN5A 2W9AA 3AQKA 3FAHA 4CF3A 1TK0A 4RPZA 9ICSA 4M6WA 5IIOA 5KG0A 3ZDEA 3PMNA 2QB1A 4UB8U
chains in the Genus database with same CATH topology
2HVHA 1TFYA 3WFSC 2ISPA 4ELTA 3ZDDA 4AT9B 2NRXA 2ASLA 8ICKA 1SZPA 3BJYA 1U48A 1L3VA 4DWIA 4P2HA 4QZIA 3THVA 2ZUBA 2FPKA 4M6WB 4KLQA 4ATBB 4WC4A 2JZBB 2V4RA 3GDXA 5IINA 1N48A 2XY5A 2P6RA 1DK3A 1QTMA 3RJHA 2NRZA 2BQRA 8ICJA 3BQ0A 4GLXA 2ZH2A 5CA7A 2XCAA 3ISDA 2VA2A 5KFBA 2JZBA 3MDAA 2JEFA 4M9NA 1WCLA 4PHEA 3JPPA 3PX4A 4ECWA 5HR9A 4XA5A 3QZ8A 1H38A 8ICBA 3LWLA 2DPIA 1S0OA 4IQUA 5BOMA 2Q0ZX 4R8UB 1BVSA 4E7XA 4QWAA 4JUZA 1U49A 2FMQA 4BXOA 5IILA 2ZH4A 1NK7A 2HHSA 1VJ7A 4KN4A 4FHWA 4M04A 2AGPA 2BE3A 3V6JA 1ZQWA 2F1IA 2H5XA 3MGIA 4K4IA 1KNYA 4AT9A 2W9MA 5DDMA 3G6XA 2HHUA 5KFUA 4BXOB 4K4GA 4ATBA 5KFPA 9ICUA 5KG5A 5HRIA 3TI0A 4KLDA 3AQLA 1D9DA 2XGPA 4YVZA 4KLFA 2ZJAA 1X9SA 4J9RA 4DSIA 1ZQBA 4FHXA 4DFKA 4M9GA 1S76D 9ICVA 3OV7A 2V9WA 1JAJA 4QZCA 8ICFA 4O3SA 4YMMA 1LB2B 1QLNA 4Q8EA 4UBCA 4RQ1A 3OGUA 3GIJA 1ZQHA 5KFHA 4KMUA 5KT3A 4R65A 3RH5A 5EWEA 4MFCA 2HHWA 1BPDA 4RQ4A 4J9QA 4B9SA 2KN7A 2J6TA 3RJKA 1CEZA 4EYHB 1ZQZA 3C5FA 4DQSA 3T5JA 1T7PA 2ZH6A 4FHVA 8ICRA 3WFQE 3C2LA 2DR9A 5DB7A 4NLZA 4YR2A 3KHGA 4KN7A 4RUAA 3PX6A 5KT7A 2IBKA 4QW9A 5KFMA 2ZH3A 2FPLA 4FBUA 3N4MB 4PGYA 7ICGA 3H4BA 2NRTA 2IA6A 3ZD9A 9ICFA 4F2RA 5J2BA 3OHBA 1X9WA 9ICRA 2BCUA 3JPQA 4EBJA 5J0YA 3OHAA 3HX0A 5HRFA 3RH4A 4ECZA 1TFWA 4PHAA 4Q44A 3TQ1A 2BGWA 5DECA 5DLFA 4AT8A 2PFQA 3SV3A 1S0VA 7ICEA 9ICIA 5KFEA 2HVIA 7ICNA 2M2WA 3HIYA 9ICLA 2W9BA 3C2KA 4IR9A 4KLLA 4WC7A 5J0QA 4NKTA 2J6SA 3TFSA 4GXJA 5IIKA 3M9MB 2BR0A 1BPZA 9ICTA 3V7LA 1UETA 2AU0A 1UT8A 4J9SA 7ICUA 1BNOA 3C5GA 5KFFA 3N97B 3V7KA 3RAXA 4NM2A 4DSJA 4UB5A 3WFOA 3B0YA 4YD2A 9ICOA 3ISBA 4EEYA 1YLQA 5J2DA 2B21A 2ALZA 3E2EA 4F5PA 3RJEA 4X0BA 5DQIA 3PNCA 5J0XA 4B9MA 4E80A 4TQSA 1XSLA 4MFAA 2ZH1A 2UVUA 4PPXA 4Z6EA 2XY7A 1ZQLA 4UD4A 4WBZA 1BGXT 2BPCA 4QZ8A 2M2UA 4PGXA 1ZQEA 3RTVA 4QZGA 2BHNA 5IIMA 2BCSA 2PFOA 1D9FA 4NLGA 2BCVA 4KLIA 3RRHA 4QZFA 4DQRA 4DL3A 8ICNA 5J0RA 4KLGA 4RQ2A 2RFFA 3UXNA 1L3UA 4YFKA 8ICIA 2KFNA 1MQ2A 2JEJA 7ICMA 4I2CA 5KT6A 2ZHBA 4UBBA 2ID1A 1ZQUA 4O9MA 1JXLA 1U4BA 3QZ7A 2C28A 2FPMA 5JUMA 4ECRA 4UQGA 1TAUA 1X9MA 3K4GA 3ZD8A 1Q79A 3GV8B 1D8YA 5D49A 2VANA 2PFPA 3HT3A 1NO5A 1NK8A 2OWOA 2FLNA 2AQ0A 5KFDA 1X2IA 3MFHA 1WOTA 4F4ZA 1OU5A 4B9UA 4X4NA 1ZQMA 1Z00A 4DSEA 1UA1A 2XCPA 4X4RA 4R8UA 1KSPA 4RQ5A 5J2EA 4C8NA 4IRKA 1ZJMA 1D8LA 2BDPA 9ICAA 3T3FA 3M8SA 5KFLA 2ZTEA 2MUTB 4MF2A 4QZAA 7ICRA 1JXEA 2ZJ5A 1Z00B 9ICHA 4EZ6A 8ICXA 1R89A 3AQNA 5EWFA 4ED3A 2C2EA 5HREA 3AU6A 3Q8SB 4X4SA 1XWLA 3MFIA 3C2MA 3RJGA 2BKEA 5DB6A 5J0PA 9ICQA 2ZH7A 5KG1A 4O3NA 4KLUA 4ED8A 4RQ6A 1RXVA 1ZQNA 4FH5A 1Y88A 3LWMA 4GXKA 3ETLA 4ED6A 4DSKA 8ICMA 1V9PA 3RJJA 4UAWA 3K75D 3SZ2A 9ICXA 4F5NA 3RB6A 3V6KA 2KP7A 1ZQPA 4RWNA 2NRWA 3B0XA 1KFSA 4LT6A 4O0IA 4O3OA 2R8IA 5KG3A 1IXRA 8ICPA 1HJPA 5DB9A 3C66A 3UPSA 2Y1JA 2NRVA 4WC1A 2JEGA 1NK4A 4PH5A 3GQCA 1XU4A 3H39A 2XGQA 2ZHAA 4HYKA 4RQ7A 4Q43A 4F50A 1BPYA 3BDPA 8ICYA 4X0AA 5J2HA 5DG7A 4DFJA 4F4YA 5BPCA 4NLKA 7ICIA 7ICPA 5DDYA 4F4XA 4YR0A 3T5KA 2BPGA 5J0OA 4P4OA 5CHGA 2IHMA 8ICSA 4DSFA 5DBCA 3TANA 2NRKA 2ZH5A 1WCNA 4ECYA 1B22A 1A77A 2BQ3A 4JWMA 2DRAA 4X4VA 3BQTA 2XO7A 4XQ7A 1B43A 4I2EA 4S3NA 4F92B 7ICHA 3RAQA 4X5VA 4B9TA 3M9OB 4I2GA 2LYHA 4RZRA 1XS9D 3GV5B 4MF8A 4JV2A 4E0DA 4I2BA 4YXMA 4ECSA 1ZQOA 2FLPA 4WCWA 5KG7A 4EP7A 1Q78A 3PW5A 4AT8B 3HWTA 4I2HA 4B9VA 1A76A 2UVWA 3JPRA 5J29A 5EOZA 2W9BB 1ZQCA 5J2GA 5DKWA 4QZ9A 5DG9A 1RYSA 4F4KA 5J0TA 1ZQVA 4EYIB 2R8KA 3HJ4A 4AT7A 3L9DA 1ZQQA 4M9LA 2JEIA 4DQQA 4JV0A 5KG2A 5J2JA 4RT2A 4MEXA 4ECUA 3JPOA 3RB0A 4CCHA 4NXZA 4DS4A 5HRDA 2M2VA 2O1PA 4F5RA 4LVSA 1ZQXA 3LQCB 4ED0A 5L1IA 3H7IA 4B9NA 4Z6CA 4XQ8A 3RB4A 4I2DA 3PR5B 1RXWA 1S0MA 2RDJA 1ZJNA 1SKWA 1KRPA 3PW4A 4EBCA 4KLTA 5KFNA 2R8HA 1TV9A 1ZQKA 3PMLA 4J9KA 3TARA 4C8KA 1QSYA 4MFFA 9ICPA 4M0AA 4IG8A 2HHXA 4IRDA 4EZ9A 5DQHA 5J2KA 2ISOA 2BCRA 7ICQA 4DOBA 1ZQSA 4KLEA 8ICWA 4DL7A 2DVIA 4Q45A 4X4QA 4C8OA 1DOQA 3MR3A 4LZGA 3OUYB 3UPQA 4DOAA 5L1KA 4ECTA 5HRBA 4ED2A 3KTQA 1NJXA 4XUSA 5DLGA 3JPNA 3Q8PB 4GC7A 2HHPA 5KG6A 4AT7B 5KFWA 4X4UA 1R8AA 1TFRA 1S10A 2ZH9A 7ICLA 1KDHA 3OSNA 4M9JA 4DFMA 3OVSA 4LZDA 2C22A 4YN4A 1ZQDA 8ICOA 1PX5A 4RWPA 3Q8LA 5DBAA 3MR6A 4IRCA 5KTQA 5CWRA 1Z3EB 5EWGA 4P4PA 4KLSA 8ICZA 4IQTA 5HRHA 7ICFA 1UT5A 3MDCA 4EBEA 1ZQRA 2IHNA 3WFRE 4F4WA 4TQRA 4ECXA 2XC9A 5DQGA 1T4GA 1TK5A 4I2JA 3QE9Y 2DRBA 3HP6A 1BNPA 1KFDA 5TZVA 1MQ3A 5IIIA 2ATLA 1JX4A 2R8JA 4BDPA 8ICTA 1MIYA 3H8JA 1RPLA 4UAZA 2C2DA 2DPJA 3JPSA 3PR4A 1ZQGA 8ICGA 3C23A 5KFIA 5D4BA 3OUYA 3H8SA 1NK0A 2W9CB 4DQIA 2M9NA 4BGDA 3RR8A 2PI5A 7ICSA 7ICVA 4ED7A 1S77D 4BWMA 3GV7B 4EBDA 4F5OA 4RNNA 1L3SA 1TK8A 2R8GA 4M2YA 9ICJA 1XO1A 3AU2A 3M8RA 5KFRA 3EYZA 4ZH4A 1NKCA 1SL2A 4F93B 3HPOA 4NY8A 8ICCA 4RNOA 3QEAZ 3GIIA 4KLOA 3PW2A 2ZTCA 1SL0A 8ICLA 3AQMA 1IM4A 3MR2A 3PW0A 1SKSA 4M5DA 3IHQB 1ZQFA 1R8CA 4DS5A 1TAQA 3H8WA 2ZH8A 3H4DA 5HC9A 1ZQIA 3T5LA 4KLMA 4O5KA 5J0WA 5J2AA 2PI4A 1COOA 4IQVA 3RH6A 4QWEA 1XSNA 4F2SA 1UEUA 5DGBA 4I2FA 5KFOA 4QWCA 4RQ8A 4FS1A 5J2CA 1KLNA 1S9FA 3H3AA 2V4QA 1ZQTA 4RNMA 4TUPA 2M2TA 1BPBA 2ZTDA 1JIHA 5HHHA 3GIKA 4DOCA 3KHLA 9ICBA 3UXPA 3RBDA 3TFRA 2ASDA 4E8FA 4RT3A 4IR1A 1ZQAA 4YCXA 2AJQA 2BCQA 4KITB 5L1JA 4FO6A 1U47A 4R63A 3UQ0A 5KFCA 2A1JA 2MAXA 3EZ5A 2AGQA 2I1QA 4RPXA 1JMSA 1NJZA 4C8MA 3OJSA 1K1SA 4RQ3A 3AUOA 1ZQJA 4M9HA 2DR5A 2KZMA 3JPTA 1T8EA 4F91B 4KLHA 1U9LA 1CUKA 9ICWA 3JZ0A 3V6HA 4FH3A 4QW8A 5KG4A 2A1JB 4Z6FA 5HNKA 3BQ2A 4J9MA 4J9OA 1NK5A 1NK6A 5CB1A 1L3TA 4KLJA 2P6UA 8ICVA 9ICGA 3C1YA 4UB3A 5HHIA 3ORYA 8ICHA 3EW9A 2PFNA 3GILA 4YP3A 4O3PA 2HW3A 7ICKA 4UD5A 4YQWA 1S0NA 4FHYA 4WC3A 3V72A 4PHPA 4XRHA 3BQ1A 4F5QA 1TVAA 3GFKB 4F8RA 4RWQA 5F9NA 4ECQA 3T5HA 1RYRA 2I9GA 1F5AA 4DQPA 3HW8A 2C2RA 2HHVA 4O3QA 4F3OA 4RUCA 3H40A 3V7JA 2IMWP 3Q8KA 2UVVA 3ZDCA 3RJIA 4C8LA 1VFGA 4DEZA 3PX0A 4J9LA 4J9PA 2P66A 4GXIA 4UAYA 2W8KA 2W8LA 4RU9A 2FMSA 2KZZA 3PO4A 4ECVA 4JV1A 1SKRA 3EPIA 4JWNA 4QWBA 2AGOA 3H37A 5J2FA 4QZDA 2HHQA 2MUTA 4YMOA 3RR7A 4FBTA 5KFZA 3ISCA 1QSLA 9ICCA 3Q8RB 2PXIA 4DSLA 3MBYA 4WBYA 3SYZA 1QSSA 4RWOA 3TAPA 3OVBA 9ICKA 4IQWA 3WFPA 3ZDBA 4DLEA 4DL4A 3MABA 4O5CA 2KTQA 3PVXA 5DB8A 2VA3A 1KTQA 3JYYA 4I29A 3LK9A 2F1JA 1ZETA 3SI8A 4O3RA 4TURA 5KFVA 5CP2A 3MGHA 2PBEA 4MEYA 4QWDA 3EPGA 1UA0A 2J6UA 5HRLA 1BPXA 1MSWD 4UB2A 3NGDA 5DBBA 5L1LA 3TAQA 4WC6A 5KFTA 4ELUA 2BPFA 4NLNA 4WC5A 4X4TA 4DLGA 4PGQA 4YG2A 1RZTA 4DF8A 8ICEA 8ICQA 4FHPA 3NTUA 5HMLA 5KT4A 4NKUA 4UB4A 4B9LA 4X4PA 4BWJA 3RBEA 1T3NA 4YR3A 1LV5A 2FLLA 4DL6A 3PO5A 4PHDA 5F2VO 4YXJA 5KT2A 4I27A 4I2IA 3Q8QB 9ICNA 3PMNA 4EBKA 3IM1A 3SV4A 2ASJA 1S97A 3NYBA 4YMNA 4DO9A 4R64A 5KT5A 1NK9A 1EXNA 2KZ3A 4Q8FA 2DFLA 5KFJA 8ICUA 4R66A 5KFSA 4GC6A 4DFPA 2Y1IA 4I28A 3PV8A 2XY6A 1NJYA 5DEDA 1U45A 4RPYA 2ZUDA 5HRGA 3MR5A 1N56A 3QEBZ 7ICOA 4TUQA 1HUZA 5HMMA 1FA0A 1MIVA 5BOLA 4FS2A 5F9LA 3RRGA 1UEVA 3ZDAA 5IIJA 5CJ7A 3PY8A 3KHHA 2ZJ8A 3PW7A 2VA8A 1SL1A 4X4OA 2DR7A 4G3IA 4YD1A 1JQRA 2HHTA 2BQUA 3GIMA 1HUOA 4P4MA 1NOMA 3RB3A 1C7YA 1MIWA 3H38A 1NKEA 1BPEA 3FDSA 3RJFA 5L9XA 4QZBA 4ELVA 9ICEA 5HRKA 5HP4A 4QZHA 1XSPA 2RDIA 3EWAA 1JN3A 3LDAA 4K4HA 5J0SA 3G6YA 3M9NB 4DL5A 3OSPA 1TKDA 4KTQA 5C5JA 1K1QA 3OVAA 3FYHA 3UQ2A 1NJWA 5KFAA 5J2IA 4M47A 1AROP 1L5UA 5J0UA 2O5AA 2ZUCA 4DL2A 4QZEA 2F1HA 4DF4A 2AQ4A 1ZYQA 2DR8A 2WTFA 2GWSA 3C21A 4JK1A 2Q66A 4I2AA 3C18A 5DGAA 2KFZA 4Z6DA 1V4AA 5D46A 3G6VA 1XC9A 4NM1A 9ICMA 1NZPA 1R8BA 5KFXA 7ICTA 7ICJA 1KEJA 3C1ZA 2W9CA 3Q8MA 1DK2A 4WC0A 4WC2A 5KFGA 5KFQA 3OJUA 4ED1A 4RQ0A 2FMPA 2UVRA 1KFTA 1PZNA 1ZQYA 2W9AA 5CR0A 3KHRA 8ICAA 4J9NA 3AQKA 5KFKA 1NKBA 1TK0A 3HJ1A 4RPZA 4O5EA 5KFYA 5DG8A 1DGSA 4M6WA 3UXOA 5KG0A 1MC8A 5IIOA 4UB1A 3ZDEA 4TUSA 9ICSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVH A;  1TFY A;  3WFS C;  2ISP A;  4ELT A;  3ZDD A;  4AT9 B;  2NRX A;  2ASL A;  8ICK A;  1SZP A;  3BJY A;  1U48 A;  1L3V A;  4DWI A;  4P2H A;  4QZI A;  3THV A;  2ZUB A;  2FPK A;  4M6W B;  4KLQ A;  4ATB B;  4WC4 A;  2JZB B;  2V4R A;  3GDX A;  5IIN A;  1N48 A;  2XY5 A;  2P6R A;  1DK3 A;  1QTM A;  3RJH A;  2NRZ A;  2BQR A;  8ICJ A;  3BQ0 A;  4GLX A;  2ZH2 A;  5CA7 A;  2XCA A;  3ISD A;  2VA2 A;  5KFB A;  2JZB A;  3MDA A;  2JEF A;  4M9N A;  1WCL A;  4PHE A;  3JPP A;  3PX4 A;  4ECW A;  5HR9 A;  4XA5 A;  3QZ8 A;  1H38 A;  8ICB A;  3LWL A;  2DPI A;  1S0O A;  4IQU A;  5BOM A;  2Q0Z X;  4R8U B;  1BVS A;  4E7X A;  4QWA A;  4JUZ A;  1U49 A;  2FMQ A;  4BXO A;  5IIL A;  2ZH4 A;  1NK7 A;  2HHS A;  1VJ7 A;  4KN4 A;  4FHW A;  4M04 A;  2AGP A;  2BE3 A;  3V6J A;  1ZQW A;  2F1I A;  2H5X A;  3MGI A;  4K4I A;  1KNY A;  4AT9 A;  2W9M A;  5DDM A;  3G6X A;  2HHU A;  5KFU A;  4BXO B;  4K4G A;  4ATB A;  5KFP A;  9ICU A;  5KG5 A;  5HRI A;  3TI0 A;  4KLD A;  3AQL A;  1D9D A;  2XGP A;  4YVZ A;  4KLF A;  2ZJA A;  1X9S A;  4J9R A;  4DSI A;  1ZQB A;  4FHX A;  4DFK A;  4M9G A;  1S76 D;  9ICV A;  3OV7 A;  2V9W A;  1JAJ A;  4QZC A;  8ICF A;  4O3S A;  4YMM A;  1LB2 B;  1QLN A;  4Q8E A;  4UBC A;  4RQ1 A;  3OGU A;  3GIJ A;  1ZQH A;  5KFH A;  4KMU A;  5KT3 A;  4R65 A;  3RH5 A;  5EWE A;  4MFC A;  2HHW A;  1BPD A;  4RQ4 A;  4J9Q A;  4B9S A;  2KN7 A;  2J6T A;  3RJK A;  1CEZ A;  4EYH B;  1ZQZ A;  3C5F A;  4DQS A;  3T5J A;  1T7P A;  2ZH6 A;  4FHV A;  8ICR A;  3WFQ E;  3C2L A;  2DR9 A;  5DB7 A;  4NLZ A;  4YR2 A;  3KHG A;  4KN7 A;  4RUA A;  3PX6 A;  5KT7 A;  2IBK A;  4QW9 A;  5KFM A;  2ZH3 A;  2FPL A;  4FBU A;  3N4M B;  4PGY A;  7ICG A;  3H4B A;  2NRT A;  2IA6 A;  3ZD9 A;  9ICF A;  4F2R A;  5J2B A;  3OHB A;  1X9W A;  9ICR A;  2BCU A;  3JPQ A;  4EBJ A;  5J0Y A;  3OHA A;  3HX0 A;  5HRF A;  3RH4 A;  4ECZ A;  1TFW A;  4PHA A;  4Q44 A;  3TQ1 A;  2BGW A;  5DEC A;  5DLF A;  4AT8 A;  2PFQ A;  3SV3 A;  1S0V A;  7ICE A;  9ICI A;  5KFE A;  2HVI A;  7ICN A;  2M2W A;  3HIY A;  9ICL A;  2W9B A;  3C2K A;  4IR9 A;  4KLL A;  4WC7 A;  5J0Q A;  4NKT A;  2J6S A;  3TFS A;  4GXJ A;  5IIK A;  3M9M B;  2BR0 A;  1BPZ A;  9ICT A;  3V7L A;  1UET A;  2AU0 A;  1UT8 A;  4J9S A;  7ICU A;  1BNO A;  3C5G A;  5KFF A;  3N97 B;  3V7K A;  3RAX A;  4NM2 A;  4DSJ A;  4UB5 A;  3WFO A;  3B0Y A;  4YD2 A;  9ICO A;  3ISB A;  4EEY A;  1YLQ A;  5J2D A;  2B21 A;  2ALZ A;  3E2E A;  4F5P A;  3RJE A;  4X0B A;  5DQI A;  3PNC A;  5J0X A;  4B9M A;  4E80 A;  4TQS A;  1XSL A;  4MFA A;  2ZH1 A;  2UVU A;  4PPX A;  4Z6E A;  2XY7 A;  1ZQL A;  4UD4 A;  4WBZ A;  1BGX T;  2BPC A;  4QZ8 A;  2M2U A;  4PGX A;  1ZQE A;  3RTV A;  4QZG A;  2BHN A;  5IIM A;  2BCS A;  2PFO A;  1D9F A;  4NLG A;  2BCV A;  4KLI A;  3RRH A;  4QZF A;  4DQR A;  4DL3 A;  8ICN A;  5J0R A;  4KLG A;  4RQ2 A;  2RFF A;  3UXN A;  1L3U A;  4YFK A;  8ICI A;  2KFN A;  1MQ2 A;  2JEJ A;  7ICM A;  4I2C A;  5KT6 A;  2ZHB A;  4UBB A;  2ID1 A;  1ZQU A;  4O9M A;  1JXL A;  1U4B A;  3QZ7 A;  2C28 A;  2FPM A;  5JUM A;  4ECR A;  4UQG A;  1TAU A;  1X9M A;  3K4G A;  3ZD8 A;  1Q79 A;  3GV8 B;  1D8Y A;  5D49 A;  2VAN A;  2PFP A;  3HT3 A;  1NO5 A;  1NK8 A;  2OWO A;  2FLN A;  2AQ0 A;  5KFD A;  1X2I A;  3MFH A;  1WOT A;  4F4Z A;  1OU5 A;  4B9U A;  4X4N A;  1ZQM A;  1Z00 A;  4DSE A;  1UA1 A;  2XCP A;  4X4R A;  4R8U A;  1KSP A;  4RQ5 A;  5J2E A;  4C8N A;  4IRK A;  1ZJM A;  1D8L A;  2BDP A;  9ICA A;  3T3F A;  3M8S A;  5KFL A;  2ZTE A;  2MUT B;  4MF2 A;  4QZA A;  7ICR A;  1JXE A;  2ZJ5 A;  1Z00 B;  9ICH A;  4EZ6 A;  8ICX A;  1R89 A;  3AQN A;  5EWF A;  4ED3 A;  2C2E A;  5HRE A;  3AU6 A;  3Q8S B;  4X4S A;  1XWL A;  3MFI A;  3C2M A;  3RJG A;  2BKE A;  5DB6 A;  5J0P A;  9ICQ A;  2ZH7 A;  5KG1 A;  4O3N A;  4KLU A;  4ED8 A;  4RQ6 A;  1RXV A;  1ZQN A;  4FH5 A;  1Y88 A;  3LWM A;  4GXK A;  3ETL A;  4ED6 A;  4DSK A;  8ICM A;  1V9P A;  3RJJ A;  4UAW A;  3K75 D;  3SZ2 A;  9ICX A;  4F5N A;  3RB6 A;  3V6K A;  2KP7 A;  1ZQP A;  4RWN A;  2NRW A;  3B0X A;  1KFS A;  4LT6 A;  4O0I A;  4O3O A;  2R8I A;  5KG3 A;  1IXR A;  8ICP A;  1HJP A;  5DB9 A;  3C66 A;  3UPS A;  2Y1J A;  2NRV A;  4WC1 A;  2JEG A;  1NK4 A;  4PH5 A;  3GQC A;  1XU4 A;  3H39 A;  2XGQ A;  2ZHA A;  4HYK A;  4RQ7 A;  4Q43 A;  4F50 A;  1BPY A;  3BDP A;  8ICY A;  4X0A A;  5J2H A;  5DG7 A;  4DFJ A;  4F4Y A;  5BPC A;  4NLK A;  7ICI A;  7ICP A;  5DDY A;  4F4X A;  4YR0 A;  3T5K A;  2BPG A;  5J0O A;  4P4O A;  5CHG A;  2IHM A;  8ICS A;  4DSF A;  5DBC A;  3TAN A;  2NRK A;  2ZH5 A;  1WCN A;  4ECY A;  1B22 A;  1A77 A;  2BQ3 A;  4JWM A;  2DRA A;  4X4V A;  3BQT A;  2XO7 A;  4XQ7 A;  1B43 A;  4I2E A;  4S3N A;  4F92 B;  7ICH A;  3RAQ A;  4X5V A;  4B9T A;  3M9O B;  4I2G A;  2LYH A;  4RZR A;  1XS9 D;  3GV5 B;  4MF8 A;  4JV2 A;  4E0D A;  4I2B A;  4YXM A;  4ECS A;  1ZQO A;  2FLP A;  4WCW A;  5KG7 A;  4EP7 A;  1Q78 A;  3PW5 A;  4AT8 B;  3HWT A;  4I2H A;  4B9V A;  1A76 A;  2UVW A;  3JPR A;  5J29 A;  5EOZ A;  2W9B B;  1ZQC A;  5J2G A;  5DKW A;  4QZ9 A;  5DG9 A;  1RYS A;  4F4K A;  5J0T A;  1ZQV A;  4EYI B;  2R8K A;  3HJ4 A;  4AT7 A;  3L9D A;  1ZQQ A;  4M9L A;  2JEI A;  4DQQ A;  4JV0 A;  5KG2 A;  5J2J A;  4RT2 A;  4MEX A;  4ECU A;  3JPO A;  3RB0 A;  4CCH A;  4NXZ A;  4DS4 A;  5HRD A;  2M2V A;  2O1P A;  4F5R A;  4LVS A;  1ZQX A;  3LQC B;  4ED0 A;  5L1I A;  3H7I A;  4B9N A;  4Z6C A;  4XQ8 A;  3RB4 A;  4I2D A;  3PR5 B;  1RXW A;  1S0M A;  2RDJ A;  1ZJN A;  1SKW A;  1KRP A;  3PW4 A;  4EBC A;  4KLT A;  5KFN A;  2R8H A;  1TV9 A;  1ZQK A;  3PML A;  4J9K A;  3TAR A;  4C8K A;  1QSY A;  4MFF A;  9ICP A;  4M0A A;  4IG8 A;  2HHX A;  4IRD A;  4EZ9 A;  5DQH A;  5J2K A;  2ISO A;  2BCR A;  7ICQ A;  4DOB A;  1ZQS A;  4KLE A;  8ICW A;  4DL7 A;  2DVI A;  4Q45 A;  4X4Q A;  4C8O A;  1DOQ A;  3MR3 A;  4LZG A;  3OUY B;  3UPQ A;  4DOA A;  5L1K A;  4ECT A;  5HRB A;  4ED2 A;  3KTQ A;  1NJX A;  4XUS A;  5DLG A;  3JPN A;  3Q8P B;  4GC7 A;  2HHP A;  5KG6 A;  4AT7 B;  5KFW A;  4X4U A;  1R8A A;  1TFR A;  1S10 A;  2ZH9 A;  7ICL A;  1KDH A;  3OSN A;  4M9J A;  4DFM A;  3OVS A;  4LZD A;  2C22 A;  4YN4 A;  1ZQD A;  8ICO A;  1PX5 A;  4RWP A;  3Q8L A;  5DBA A;  3MR6 A;  4IRC A;  5KTQ A;  5CWR A;  1Z3E B;  5EWG A;  4P4P A;  4KLS A;  8ICZ A;  4IQT A;  5HRH A;  7ICF A;  1UT5 A;  3MDC A;  4EBE A;  1ZQR A;  2IHN A;  3WFR E;  4F4W A;  4TQR A;  4ECX A;  2XC9 A;  5DQG A;  1T4G A;  1TK5 A;  4I2J A;  3QE9 Y;  2DRB A;  3HP6 A;  1BNP A;  1KFD A;  5TZV A;  1MQ3 A;  5III A;  2ATL A;  1JX4 A;  2R8J A;  4BDP A;  8ICT A;  1MIY A;  3H8J A;  1RPL A;  4UAZ A;  2C2D A;  2DPJ A;  3JPS A;  3PR4 A;  1ZQG A;  8ICG A;  3C23 A;  5KFI A;  5D4B A;  3OUY A;  3H8S A;  1NK0 A;  2W9C B;  4DQI A;  2M9N A;  4BGD A;  3RR8 A;  2PI5 A;  7ICS A;  7ICV A;  4ED7 A;  1S77 D;  4BWM A;  3GV7 B;  4EBD A;  4F5O A;  4RNN A;  1L3S A;  1TK8 A;  2R8G A;  4M2Y A;  9ICJ A;  1XO1 A;  3AU2 A;  3M8R A;  5KFR A;  3EYZ A;  4ZH4 A;  1NKC A;  1SL2 A;  4F93 B;  3HPO A;  4NY8 A;  8ICC A;  4RNO A;  3QEA Z;  3GII A;  4KLO A;  3PW2 A;  2ZTC A;  1SL0 A;  8ICL A;  3AQM A;  1IM4 A;  3MR2 A;  3PW0 A;  1SKS A;  4M5D A;  3IHQ B;  1ZQF A;  1R8C A;  4DS5 A;  1TAQ A;  3H8W A;  2ZH8 A;  3H4D A;  5HC9 A;  1ZQI A;  3T5L A;  4KLM A;  4O5K A;  5J0W A;  5J2A A;  2PI4 A;  1COO A;  4IQV A;  3RH6 A;  4QWE A;  1XSN A;  4F2S A;  1UEU A;  5DGB A;  4I2F A;  5KFO A;  4QWC A;  4RQ8 A;  4FS1 A;  5J2C A;  1KLN A;  1S9F A;  3H3A A;  2V4Q A;  1ZQT A;  4RNM A;  4TUP A;  2M2T A;  1BPB A;  2ZTD A;  1JIH A;  5HHH A;  3GIK A;  4DOC A;  3KHL A;  9ICB A;  3UXP A;  3RBD A;  3TFR A;  2ASD A;  4E8F A;  4RT3 A;  4IR1 A;  1ZQA A;  4YCX A;  2AJQ A;  2BCQ A;  4KIT B;  5L1J A;  4FO6 A;  1U47 A;  4R63 A;  3UQ0 A;  5KFC A;  2A1J A;  2MAX A;  3EZ5 A;  2AGQ A;  2I1Q A;  4RPX A;  1JMS A;  1NJZ A;  4C8M A;  3OJS A;  1K1S A;  4RQ3 A;  3AUO A;  1ZQJ A;  4M9H A;  2DR5 A;  2KZM A;  3JPT A;  1T8E A;  4F91 B;  4KLH A;  1U9L A;  1CUK A;  9ICW A;  3JZ0 A;  3V6H A;  4FH3 A;  4QW8 A;  5KG4 A;  2A1J B;  4Z6F A;  5HNK A;  3BQ2 A;  4J9M A;  4J9O A;  1NK5 A;  1NK6 A;  5CB1 A;  1L3T A;  4KLJ A;  2P6U A;  8ICV A;  9ICG A;  3C1Y A;  4UB3 A;  5HHI A;  3ORY A;  8ICH A;  3EW9 A;  2PFN A;  3GIL A;  4YP3 A;  4O3P A;  2HW3 A;  7ICK A;  4UD5 A;  4YQW A;  1S0N A;  4FHY A;  4WC3 A;  3V72 A;  4PHP A;  4XRH A;  3BQ1 A;  4F5Q A;  1TVA A;  3GFK B;  4F8R A;  4RWQ A;  5F9N A;  4ECQ A;  3T5H A;  1RYR A;  2I9G A;  1F5A A;  4DQP A;  3HW8 A;  2C2R A;  2HHV A;  4O3Q A;  4F3O A;  4RUC A;  3H40 A;  3V7J A;  2IMW P;  3Q8K A;  2UVV A;  3ZDC A;  3RJI A;  4C8L A;  1VFG A;  4DEZ A;  3PX0 A;  4J9L A;  4J9P A;  2P66 A;  4GXI A;  4UAY A;  2W8K A;  2W8L A;  4RU9 A;  2FMS A;  2KZZ A;  3PO4 A;  4ECV A;  4JV1 A;  1SKR A;  3EPI A;  4JWN A;  4QWB A;  2AGO A;  3H37 A;  5J2F A;  4QZD A;  2HHQ A;  2MUT A;  4YMO A;  3RR7 A;  4FBT A;  5KFZ A;  3ISC A;  1QSL A;  9ICC A;  3Q8R B;  2PXI A;  4DSL A;  3MBY A;  4WBY A;  3SYZ A;  1QSS A;  4RWO A;  3TAP A;  3OVB A;  9ICK A;  4IQW A;  3WFP A;  3ZDB A;  4DLE A;  4DL4 A;  3MAB A;  4O5C A;  2KTQ A;  3PVX A;  5DB8 A;  2VA3 A;  1KTQ A;  3JYY A;  4I29 A;  3LK9 A;  2F1J A;  1ZET A;  3SI8 A;  4O3R A;  4TUR A;  5KFV A;  5CP2 A;  3MGH A;  2PBE A;  4MEY A;  4QWD A;  3EPG A;  1UA0 A;  2J6U A;  5HRL A;  1BPX A;  1MSW D;  4UB2 A;  3NGD A;  5DBB A;  5L1L A;  3TAQ A;  4WC6 A;  5KFT A;  4ELU A;  2BPF A;  4NLN A;  4WC5 A;  4X4T A;  4DLG A;  4PGQ A;  4YG2 A;  1RZT A;  4DF8 A;  8ICE A;  8ICQ A;  4FHP A;  3NTU A;  5HML A;  5KT4 A;  4NKU A;  4UB4 A;  4B9L A;  4X4P A;  4BWJ A;  3RBE A;  1T3N A;  4YR3 A;  1LV5 A;  2FLL A;  4DL6 A;  3PO5 A;  4PHD A;  5F2V O;  4YXJ A;  5KT2 A;  4I27 A;  4I2I A;  3Q8Q B;  9ICN A;  3PMN A;  4EBK A;  3IM1 A;  3SV4 A;  2ASJ A;  1S97 A;  3NYB A;  4YMN A;  4DO9 A;  4R64 A;  5KT5 A;  1NK9 A;  1EXN A;  2KZ3 A;  4Q8F A;  2DFL A;  5KFJ A;  8ICU A;  4R66 A;  5KFS A;  4GC6 A;  4DFP A;  2Y1I A;  4I28 A;  3PV8 A;  2XY6 A;  1NJY A;  5DED A;  1U45 A;  4RPY A;  2ZUD A;  5HRG A;  3MR5 A;  1N56 A;  3QEB Z;  7ICO A;  4TUQ A;  1HUZ A;  5HMM A;  1FA0 A;  1MIV A;  5BOL A;  4FS2 A;  5F9L A;  3RRG A;  1UEV A;  3ZDA A;  5IIJ A;  5CJ7 A;  3PY8 A;  3KHH A;  2ZJ8 A;  3PW7 A;  2VA8 A;  1SL1 A;  4X4O A;  2DR7 A;  4G3I A;  4YD1 A;  1JQR A;  2HHT A;  2BQU A;  3GIM A;  1HUO A;  4P4M A;  1NOM A;  3RB3 A;  1C7Y A;  1MIW A;  3H38 A;  1NKE A;  1BPE A;  3FDS A;  3RJF A;  5L9X A;  4QZB A;  4ELV A;  9ICE A;  5HRK A;  5HP4 A;  4QZH A;  1XSP A;  2RDI A;  3EWA A;  1JN3 A;  3LDA A;  4K4H A;  5J0S A;  3G6Y A;  3M9N B;  4DL5 A;  3OSP A;  1TKD A;  4KTQ A;  5C5J A;  1K1Q A;  3OVA A;  3FYH A;  3UQ2 A;  1NJW A;  5KFA A;  5J2I A;  4M47 A;  1ARO P;  1L5U A;  5J0U A;  2O5A A;  2ZUC A;  4DL2 A;  4QZE A;  2F1H A;  4DF4 A;  2AQ4 A;  1ZYQ A;  2DR8 A;  2WTF A;  2GWS A;  3C21 A;  4JK1 A;  2Q66 A;  4I2A A;  3C18 A;  5DGA A;  2KFZ A;  4Z6D A;  1V4A A;  5D46 A;  3G6V A;  1XC9 A;  4NM1 A;  9ICM A;  1NZP A;  1R8B A;  5KFX A;  7ICT A;  7ICJ A;  1KEJ A;  3C1Z A;  2W9C A;  3Q8M A;  1DK2 A;  4WC0 A;  4WC2 A;  5KFG A;  5KFQ A;  3OJU A;  4ED1 A;  4RQ0 A;  2FMP A;  2UVR A;  1KFT A;  1PZN A;  1ZQY A;  2W9A A;  5CR0 A;  3KHR A;  8ICA A;  4J9N A;  3AQK A;  5KFK A;  1NKB A;  1TK0 A;  3HJ1 A;  4RPZ A;  4O5E A;  5KFY A;  5DG8 A;  1DGS A;  4M6W A;  3UXO A;  5KG0 A;  1MC8 A;  5IIO A;  4UB1 A;  3ZDE A;  4TUS A;  9ICS A; 
#chains in the Genus database with same CATH topology
 3WFS C;  2ISP A;  5ALW A;  4NV0 A;  8ICK A;  1WG8 A;  3EF2 A;  2ZUB A;  3KKA C;  4M6W B;  2E1F A;  4ATB B;  3ERC C;  5IIN A;  1N48 A;  1DK3 A;  2P35 A;  1KQQ A;  8ICJ A;  1FFV A;  2ZIU B;  1HEK A;  2ESE A;  2F76 X;  3ISD A;  5KFB A;  3MDA A;  2JEF A;  5KL8 B;  3PX4 A;  5HR9 A;  2KJ8 A;  1SV0 C;  4E7X A;  4EEK A;  4QWA A;  3VC8 A;  1X6J A;  3NRZ A;  1NK7 A;  1VJ7 A;  4KN4 A;  4FHW A;  2AGP A;  5A0L A;  2HHU A;  4K97 A;  2YMP A;  3QUT A;  5GTH U;  3AQL A;  3TI0 A;  2XGP A;  4DSI A;  4FHX A;  2JV3 A;  2V9W A;  1JAJ A;  8ICF A;  4O3S A;  1ED1 A;  4YMM A;  2K4P A;  4RQ1 A;  3OGU A;  1ZQH A;  3RH5 A;  3SR6 A;  3UMC A;  2KN7 A;  3RJK A;  2JGA A;  1T7P A;  2ODG A;  5DB7 A;  4NLZ A;  4KN7 A;  2HBK A;  2ZH3 A;  3R9K A;  2IA6 A;  1ECW A;  5EE3 A;  5J2B A;  3BQ7 A;  2BCU A;  5ALF A;  1Z19 A;  3MCR A;  2JXJ A;  3RH4 A;  1TFW A;  4Q44 A;  4CGZ A;  5DEC A;  5DLF A;  3SV3 A;  1RM6 C;  3HIY A;  2W9B A;  4IR9 A;  5J0Q A;  2J6S A;  4GXJ A;  2LHT A;  1BPZ A;  1UET A;  2AU0 A;  7ICU A;  2AXT U;  4DSJ A;  3E0F A;  4NM2 A;  3WFO A;  3ZI4 A;  4EEY A;  1X40 A;  3E2E A;  3PHZ A;  3RJE A;  2XI9 A;  3GZF A;  1WUD A;  1S8O A;  1ZQL A;  4WBZ A;  2BPC A;  4QZG A;  5EE0 A;  1GPJ A;  2R18 A;  2DKZ A;  5AKJ A;  5ALD A;  2KSO B;  2JEJ A;  4I2C A;  5KT6 A;  2PMZ C;  5H2F U;  1ZQU A;  1JXL A;  3QZ7 A;  4OO1 J;  3AMZ A;  2E1E A;  5B66 U;  4ICA A;  1NK8 A;  2OWO A;  1X2I A;  4Y2X A;  1C20 A;  4X4N A;  1ZQM A;  1Z00 A;  1PK1 A;  5ALV A;  3LYS A;  5AI6 A;  3M6Z A;  1ZJM A;  9ICA A;  3AQE A;  1JXE A;  9ICH A;  1Z00 B;  2KVS A;  5EWF A;  5HRE A;  2BKE A;  5DB6 A;  4KLU A;  3NVZ A;  3RJJ A;  4UAR A;  3AEV A;  1N62 A;  2G09 A;  3WKB A;  1ZQP A;  2NRW A;  1N63 A;  5G5H A;  2Y1J A;  2NRV A;  2JEG A;  2GH1 A;  2XGQ A;  4RQ7 A;  4KMO B;  4F50 A;  4ACO A;  3ONN A;  4LEW A;  4F4Y A;  4NLK A;  2FDR A;  1V38 A;  1VDV A;  2BPG A;  5J0O A;  5DBC A;  2G07 A;  4JWM A;  4XQ7 A;  1B43 A;  4F92 B;  5ALS A;  4RZR A;  1XS9 D;  4MF8 A;  4JV2 A;  4PL2 A;  2FLP A;  4AT8 B;  4I2H A;  4B9V A;  4NLB A;  3WKD A;  1OUQ A;  5J29 A;  3HJE A;  5J0T A;  3JCF A;  3WKE A;  2RLT A;  4EYI B;  3HJ4 A;  4M9L A;  4JV0 A;  3JPO A;  2KK0 A;  4NXZ A;  5HRD A;  5ALK A;  2O1P A;  2KKP A;  3GU3 A;  3H7I A;  2KHV A;  1X42 A;  4KLT A;  1SKW A;  4IG8 A;  3PML A;  2WF8 A;  1SIJ A;  2HHX A;  4IRD A;  5AM3 A;  7ICQ A;  4DOB A;  4Q45 A;  3MR3 A;  4LZG A;  4F71 A;  2Y9U A;  4DOA A;  4WC6 A;  1NJX A;  3JPN A;  4GC7 A;  2Y0S C;  4AT7 B;  4EV6 A;  5KFW A;  1R8A A;  1TFR A;  3F2B A;  3KFU F;  2DUY A;  4LZD A;  1PX5 A;  4YN4 A;  1L8O A;  4IRC A;  1L7N A;  2BBH A;  4KLS A;  4EBE A;  2IHN A;  4FE3 A;  1T4G A;  4WJ3 B;  1JRO A;  4I2J A;  3NVW A;  3HP6 A;  1BNP A;  1KFD A;  1L7O A;  1VJ5 A;  4KB6 A;  2VIX A;  4K9A A;  3J81 j;  1QH9 A;  3H8J A;  2C2D A;  1FFU A;  3JPS A;  3C23 A;  2DGZ A;  1NK0 A;  4DQI A;  2M9N A;  3PSF A;  7ICS A;  2ZH7 A;  3GV7 B;  4EBD A;  9ICJ A;  4EEN A;  5KFR A;  3HPO A;  8ICC A;  3NAS A;  3QEA Z;  3L3F X;  2ZTC A;  4CE6 A;  8ICL A;  1SKS A;  3QNM A;  3H8W A;  3H4D A;  5HC9 A;  5J2A A;  3SAG A;  2KHQ A;  1ZD5 A;  5DGB A;  5KFO A;  4QWC A;  4RQ8 A;  2D8C A;  4I2F A;  4FS1 A;  2EAP A;  1S5L U;  1ZQT A;  4TUP A;  2ZTD A;  1JIH A;  5HHH A;  3GIK A;  1FIQ A;  2QKQ A;  1KW4 A;  3TFR A;  3RBD A;  1Z1B A;  4RT3 A;  2W43 A;  1ZQA A;  2IUB A;  5FP0 A;  5KFC A;  2F3N A;  3N28 A;  4C8M A;  2DR5 A;  4QW8 A;  4J9M A;  4AYB F;  4UB3 A;  5EE9 A;  2HOF A;  5ALM A;  3SEI A;  1TVA A;  2W3S A;  1N60 A;  2E8M A;  1DGJ A;  2N1R A;  5ALH A;  1L7M A;  3T5H A;  1RYR A;  2I9G A;  4DQP A;  2G08 A;  1B4F A;  3QUC A;  2HHV A;  3V7J A;  4C8L A;  2DF4 B;  2MSN A;  4UAY A;  4RU9 A;  2AGO A;  4HAI A;  3LVW A;  4UAS A;  4QZD A;  5HR7 A;  2WAQ C;  2MUT A;  4YMO A;  3RR7 A;  4FBT A;  4DSL A;  1WWU A;  4RWO A;  3OVB A;  2W7P A;  1F44 A;  2HDO A;  5B5E U;  4FFD A;  1ZXI A;  1KTQ A;  3JYY A;  4I29 A;  3SI8 A;  2VKQ A;  2EAO A;  1DXS A;  5CP2 A;  3EPG A;  5CEH A;  3UMB A;  1BPX A;  4UB2 A;  3UMG A;  4XJE A;  5DBB A;  4X4T A;  4DLG A;  8ICE A;  5HML A;  4NKU A;  4X4P A;  3FM9 A;  2BZF A;  5F2V O;  4YXJ A;  3Q8Q B;  5AKE A;  1N2X A;  2KD1 A;  4DO9 A;  4R64 A;  5KT5 A;  2QB0 A;  4Q8F A;  3PSP A;  5KFJ A;  8ICU A;  4DFP A;  2XY6 A;  2ZIX A;  4OJL A;  2GAF D;  2LYB A;  4ZOH C;  2BDU A;  7ICO A;  3L9D A;  1HUZ A;  1FA0 A;  5CFS A;  3HJ1 A;  5F9L A;  4JLX A;  3PW7 A;  4X4O A;  4G3I A;  3WK5 A;  2Y9T A;  1HUO A;  1C7Y A;  5HRK A;  1XSP A;  1RQL A;  3OTQ A;  1JN3 A;  4DCC A;  3TAC B;  5CHE A;  5K4L A;  4Y2V A;  5C5J A;  1NJW A;  1D8B A;  5KFA A;  2YMQ A;  1L5U A;  5J0U A;  5D61 A;  4DL2 A;  2F1H A;  3C21 A;  4JK1 A;  2EAN A;  4K8V A;  2G5H B;  1KEJ A;  3Q8M A;  4WC0 A;  4UAU A;  4WC2 A;  4ED1 A;  2UVR A;  4RQ0 A;  2FMP A;  2EZY A;  2ZG6 A;  1ZQY A;  3IG5 A;  3KHR A;  5DG8 A;  3UXO A;  4TUS A;  1B0X A;  3KOO A;  4AT9 B;  3BJY A;  1U48 A;  3L4P A;  1L3V A;  4P2H A;  4QZI A;  3THV A;  3QU7 A;  4P0Q B;  4UAT A;  2YMM A;  2XY5 A;  5ALP A;  1QTM A;  1J97 A;  2BQR A;  1PK3 A;  1SV0 A;  4GLX A;  2ZH2 A;  4PL1 A;  4MKP A;  4XA5 A;  3QZ8 A;  3LWL A;  4IQU A;  2ZIV A;  4R8U B;  3SAF A;  1U49 A;  3ED5 A;  2KIC A;  5IIL A;  2ZH4 A;  5ALR A;  3V6J A;  1ZQW A;  5AM0 A;  3MGI A;  1TE2 A;  5EE1 A;  1F0M A;  4LJX A;  4O68 A;  4OAF A;  4EGW A;  4G9B A;  5KFU A;  2LM1 A;  4CDG A;  5KG5 A;  4KLD A;  3PZP A;  1X9S A;  1S76 D;  4M9G A;  3OV7 A;  3DDH A;  4Y2S A;  2WB1 C;  4R65 A;  5KL1 B;  3E58 A;  2E8O A;  2J6T A;  4CF4 A;  5AIA A;  1ZQZ A;  5F3X B;  4FHV A;  5AM1 A;  3ICX A;  3C2L A;  2HCF A;  4AP9 A;  4YR2 A;  4RUA A;  3S6J A;  2FPL A;  3ZD9 A;  9ICF A;  3N7R C;  3OHA A;  2EZX A;  1S0V A;  7ICE A;  9ICI A;  2HVI A;  2NO5 A;  1RG6 A;  9ICL A;  2VJ4 A;  4NKT A;  5IIK A;  2RP5 A;  1BNO A;  5KNI A;  5AK3 A;  4UB5 A;  4P0P A;  2D3D A;  5J2D A;  4O69 A;  4B9M A;  4E80 A;  5AI8 A;  1LKY A;  1L6N A;  3HIL A;  2UVU A;  3QU4 A;  4Z6E A;  2XY7 A;  4UD4 A;  4QZ8 A;  4PGX A;  1ZQE A;  5IIM A;  3H0M B;  5D62 A;  2PFO A;  3K7D A;  2BCV A;  3RRH A;  2K4E A;  4KLG A;  8ICI A;  2KFN A;  1MN8 A;  7ICM A;  1ZRN A;  2EQY A;  4UBB A;  1KL9 A;  4UB6 U;  5AKI A;  2C28 A;  3U26 A;  2HN2 A;  1TAU A;  5ALN A;  2PFP A;  1NO5 A;  2LYA A;  2FLN A;  5KFD A;  4DSE A;  4R8U A;  3HKZ C;  2A19 A;  3M7D A;  4IRK A;  1D8L A;  4DFD A;  5HR6 A;  3T3F A;  5KFL A;  2ZTE A;  2MUT B;  4MF2 A;  7ICR A;  4OJ6 A;  4K9B A;  3Q8S B;  2B0C A;  1XWL A;  3MFI A;  4I0U A;  3RJG A;  2CN1 A;  5KG1 A;  4O3N A;  4ED8 A;  1RXV A;  1Y88 A;  8ICM A;  2GA9 D;  4UAW A;  3SZ2 A;  4CRX A;  4RWN A;  3B0X A;  3DV9 A;  8ICP A;  1HJP A;  1JRP A;  3GQC A;  5ALL A;  3H39 A;  5AKY A;  2HBJ A;  5JTI A;  4DFJ A;  7ICI A;  5BPC A;  3TAD C;  7ICP A;  3TAN A;  2MA1 A;  4QJF B;  3WKA A;  2DRA A;  3BQT A;  5ALT A;  3C28 A;  3RAQ A;  3M9O B;  1UCV A;  4E0D A;  4YXM A;  2D6F C;  3PW5 A;  2W54 A;  5AHX A;  3JPR A;  2W9B B;  1ZQC A;  5J2G A;  1RYS A;  5DG9 A;  1MA7 A;  2GLE A;  4AT7 A;  2JEI A;  5AKZ A;  4DQQ A;  2H3V A;  3HKZ F;  4MEX A;  4ECU A;  2KIW A;  4DS4 A;  2M2V A;  5AM2 A;  2LMR A;  5L1I A;  4LEV A;  4B9N A;  7ICH A;  1S0M A;  2DWQ A;  2R8H A;  1SZH A;  1TV9 A;  1ZQK A;  2W11 A;  1QSY A;  3F53 A;  5J2K A;  1N5X A;  8ICW A;  2DVI A;  1L7P A;  3UPQ A;  5AK6 A;  1GO3 F;  5DLG A;  4XUS A;  3Q8P B;  2ZH9 A;  7ICL A;  1KDH A;  5ALE A;  4KM5 A;  4DFM A;  3OVS A;  8ICO A;  3D2S A;  4FZL A;  3H0L B;  5EWG A;  4WQK A;  5HRH A;  3MDC A;  4F4W A;  5DQG A;  2DRB A;  4QIW F;  5TZV A;  1MQ3 A;  2R8J A;  3AL0 B;  4BDP A;  5JU5 A;  1MIY A;  2B51 A;  4UAZ A;  3PR4 A;  3RFA A;  5KFI A;  3OUY A;  3H8S A;  7ICV A;  2EZZ A;  4F5O A;  4M2Y A;  2R8G A;  3NVV A;  3M8R A;  3TAD A;  2K4I A;  4C4R A;  3LVV A;  4RNO A;  2M0N A;  3PW2 A;  3PW0 A;  3IHQ B;  1ZQF A;  1A0P A;  1R8C A;  2ZH8 A;  5AK4 A;  2ES6 A;  1COO A;  4IQV A;  1WYG A;  3AM9 A;  1XNS A;  5T14 A;  1S9F A;  2I5H A;  2V4Q A;  2M2T A;  4K99 A;  4E8F A;  4B6J A;  4UW9 A;  4IR1 A;  1U47 A;  2A1J A;  3EZ5 A;  1JMS A;  1JUD A;  3OJS A;  4RQ3 A;  4M9H A;  4US8 A;  5HNK A;  2A1J B;  2IOF K;  4J9O A;  2F77 X;  2P6U A;  5HHI A;  8ICH A;  3PST A;  4O3P A;  7ICK A;  1S0N A;  5ALZ A;  4F5Q A;  3HW8 A;  4O3Q A;  4U7C A;  4RUC A;  2HMX A;  5ALJ A;  3Q8K A;  3RJI A;  3PX0 A;  4OAI Z;  2W8K A;  2FMS A;  1ZD4 A;  4JV1 A;  4QWB A;  3H37 A;  3ISC A;  1QSL A;  3ER9 B;  3TAP A;  4IQW A;  4DLE A;  4DL4 A;  4O5C A;  3PVX A;  2VA3 A;  3LK9 A;  3CP8 A;  4OAH A;  3M1Y A;  5KFV A;  2XID A;  4QWD A;  4JMU A;  2EDU A;  5KFT A;  2PKE A;  4ELU A;  4YG2 A;  8ICQ A;  5AK5 A;  4UB4 A;  2EH9 A;  2H3I A;  3N7P D;  4PHD A;  2IOF A;  4I2I A;  2F8L A;  9ICN A;  2YTU A;  2ASJ A;  3NKU A;  1KN5 A;  1NNL A;  4O3M A;  3QXG A;  2LPE A;  4R66 A;  5KFS A;  4GC6 A;  4I28 A;  5DED A;  1NJY A;  1PVR A;  3QEB Z;  1PVQ A;  3ZDA A;  3PY8 A;  3KHH A;  1UHU A;  4FZM A;  2ZIX B;  2DR7 A;  1JQR A;  1BPE A;  3FDS A;  4ELV A;  5L9X A;  9ICE A;  5HP4 A;  4QZH A;  4USA A;  2HBM A;  3EWA A;  3G6Y A;  3OSP A;  1TKD A;  3OVA A;  4Y2Y A;  2RQ5 A;  4M47 A;  4C7Y A;  3BS5 A;  2NV3 A;  2AQ4 A;  1ZYQ A;  2DR8 A;  1P7D A;  1V4A A;  3G6V A;  4NM1 A;  1Q8K A;  1R8B A;  4NJ8 A;  7ICT A;  7ICJ A;  3C1Z A;  2W9C A;  1DK2 A;  5KFG A;  3OJU A;  2AH5 A;  1PZN A;  3KZX A;  8ICA A;  3WU2 U;  3CRX A;  4J9N A;  5KFK A;  1NKB A;  1VLB A;  4O5E A;  5KFY A;  1DGS A;  2G06 A;  4UB1 A;  2KEY A;  1MC8 A;  1RQN A;  2HSZ A;  4U6P A;  2Y0S F;  2EWR A;  3WKC A;  2JZB B;  3GDX A;  3UM9 A;  4Y2Q A;  3RJH A;  2OH2 A;  1SGG A;  2KG5 A;  5D63 A;  3L5K A;  3BQ0 A;  5C0Y A;  4WQL A;  5CA7 A;  1IV8 A;  2NO4 A;  2XCA A;  1L8L A;  2JZB A;  4M9N A;  1WCL A;  4PHE A;  2W7O A;  8ICB A;  1UQV A;  2DPI A;  2F2A B;  2Q0Z X;  1BVS A;  1CRX A;  4NWI A;  2FMQ A;  4BXO A;  5JTG A;  2HHS A;  2K8A A;  4K4I A;  2W9M A;  2ZIV B;  5J8Y A;  5B3P A;  4NXU A;  4BXO B;  4ATB A;  3WK4 A;  9ICU A;  5HRI A;  1D9D A;  4JLZ A;  4YVZ A;  2YB1 A;  3QX7 A;  4CF5 A;  4WOY A;  4DFK A;  9ICV A;  4QZC A;  4QNL A;  4Q8E A;  5KFH A;  5EWE A;  1SB3 C;  4RQ4 A;  4J9Q A;  4OJP A;  1CEZ A;  2YB4 A;  3NS1 A;  4DQS A;  8ICR A;  2DR9 A;  1OXJ A;  3KHG A;  2IBK A;  4QW9 A;  5KFM A;  4FBU A;  4OAG A;  2CPR A;  4PGY A;  5AKL A;  3H4B A;  3IV6 A;  2NRT A;  3F2D A;  5GTI U;  2OXO A;  1X9W A;  2WB1 F;  9ICR A;  3JPQ A;  2A3V A;  4EBJ A;  5J0Y A;  1PUZ A;  5HRF A;  3TQ1 A;  4EED A;  7ICN A;  2M2W A;  4WC7 A;  5AM4 A;  2OEH A;  2LI6 A;  3M9M B;  9ICT A;  1SV4 A;  3V7L A;  1UT8 A;  4F72 A;  3IDW A;  3IRU A;  3B0Y A;  5AKH A;  1YLQ A;  2YN4 A;  2B21 A;  3KKA A;  4F5P A;  3PNC A;  5J0X A;  2W03 A;  2B56 A;  4TQS A;  1BGX T;  2M2U A;  2CXY A;  3RTV A;  2BHN A;  4NLG A;  4QZF A;  8ICN A;  4C4S A;  5J0R A;  2RFF A;  1L3U A;  2GOL A;  3O0F A;  3C29 A;  2WHE A;  5L1M A;  2ID1 A;  4O9M A;  1U4B A;  5JUM A;  4ECR A;  4UQG A;  1Q79 A;  3GV8 B;  2VAN A;  3HT3 A;  1Q3V A;  2AQ0 A;  3QUQ A;  4F4Z A;  1OU5 A;  5AI9 A;  4B9U A;  1UA1 A;  2XCP A;  3QUB A;  3H8M A;  2BDP A;  1X66 A;  4QZA A;  1TFY A;  2DBY A;  2B4V A;  1M6Y A;  2YML A;  3AU6 A;  2O6K A;  3C2M A;  5J0P A;  1ZQN A;  4FH5 A;  2E8P A;  3LWM A;  4GXK A;  4DSK A;  3ETL A;  3NWI A;  9ICX A;  4F5N A;  3V6K A;  5AM5 A;  3CNH A;  1KFS A;  4LT6 A;  4LEZ A;  4O3O A;  2R8I A;  1IXR A;  3UPS A;  4WC1 A;  2RHF A;  1NK4 A;  1XU4 A;  4Q43 A;  8ICY A;  5J2H A;  1N61 A;  3QU5 A;  5DDY A;  4F4X A;  4P4O A;  3SD7 A;  5CHG A;  2NRK A;  4HX0 A;  1B22 A;  1A77 A;  2QB0 B;  2BQ3 A;  2XO7 A;  3HRD D;  4I2E A;  3FC4 A;  4S3N A;  4X5V A;  4B9T A;  3AN1 A;  3GV5 B;  4I2B A;  4ECS A;  1ZQO A;  4EP7 A;  1Q78 A;  4QIW C;  1IG6 A;  3I1Y A;  3KD3 A;  1ZQV A;  2R8K A;  4NL9 A;  4RT2 A;  4RQM A;  2DL0 A;  1ZQX A;  5AI4 A;  4ED0 A;  2L5Y A;  3BS5 B;  4I2D A;  3RB4 A;  1RXW A;  4EBC A;  2JH1 A;  2QAR B;  4MFF A;  1JAL A;  2WF5 A;  4EZ9 A;  2ISO A;  2BCR A;  1ZQS A;  4KLE A;  4DL7 A;  2HI0 A;  4X4Q A;  1DOQ A;  4RQN A;  3TKA A;  5TIS U;  4OD0 A;  4O67 A;  2B6G A;  3CYM A;  1DRG A;  3KTQ A;  3SEN A;  5KG6 A;  4M9J A;  2C22 A;  1ZQD A;  3Q8L A;  3MR6 A;  2K8C B;  5KTQ A;  5CWR A;  2JR5 A;  4P4P A;  8ICZ A;  4IQT A;  1XO0 A;  1ZQR A;  4EEB A;  5AKG A;  4ECX A;  4BJQ A;  1T94 A;  2XC9 A;  1TK5 A;  2E3T A;  3QE9 Y;  4NXT A;  2WF6 A;  5III A;  8ICT A;  1RPL A;  1ZQG A;  3OPX A;  5ALO A;  8ICG A;  5D4B A;  2W9C B;  4BGD A;  2PI5 A;  2MRL A;  4ED7 A;  1L3S A;  3SMV A;  4RNN A;  1TK8 A;  1SL2 A;  4NY8 A;  3KZI U;  3EYZ A;  4ZH4 A;  1NKC A;  1KKX A;  2K89 A;  3MC1 A;  4F93 B;  3GII A;  4KLO A;  3NVO A;  3QU9 A;  3AQM A;  3MR2 A;  4M5D A;  4DS5 A;  1TAQ A;  1KBU A;  4KLM A;  3T5L A;  1Q46 A;  2KE7 A;  4QWE A;  4UAV A;  3RH6 A;  1XSN A;  2EAM A;  2H3Z A;  1KLN A;  5JRT A;  4RNM A;  3NRW A;  3WK7 A;  4DOC A;  3KHL A;  9ICB A;  3UXP A;  2DQN B;  2FI1 A;  4JB3 A;  2BCQ A;  4KIT B;  5L1J A;  4P0P B;  4FO6 A;  1Z4N A;  4NL9 C;  2MAX A;  4RPX A;  1NJZ A;  1ZQ1 C;  3NVY A;  2KZM A;  3JPT A;  4KLH A;  2OYY A;  3V6H A;  4FH3 A;  1RYU A;  4Z6F A;  3BQ2 A;  4LEY A;  1NK5 A;  1NK6 A;  5CB1 A;  3C1Y A;  1CI4 A;  3EW9 A;  1Q3U A;  2PFN A;  4EX7 A;  2W04 A;  4PHP A;  4XRH A;  4F8R A;  3GFK B;  3CK6 A;  4RWQ A;  1A6S A;  2HN1 A;  4F3O A;  3H40 A;  1VFG A;  2IMW P;  2UVV A;  3A0H U;  1COK A;  4DEZ A;  2PMZ F;  4A8E A;  2KKV A;  2P66 A;  2QLT A;  2KZZ A;  4ECV A;  1FEZ A;  3EPI A;  1SKR A;  4JWN A;  5AIC A;  5J2F A;  2KIV A;  5KFZ A;  1LKY B;  3I76 A;  9ICC A;  3Q8R B;  4WBY A;  3MBY A;  3F5A A;  9ICK A;  4Y2U A;  3ZDB A;  5DB8 A;  4O3R A;  3WK8 A;  4TUR A;  2FE9 A;  3F5E A;  2PBE A;  3K1R B;  1UA0 A;  2J6U A;  5HRL A;  3NGD A;  2DKX A;  2BPF A;  4PGQ A;  1RZT A;  4DF8 A;  4FHP A;  5KT4 A;  4B9L A;  3BS7 A;  3H0R B;  4BWJ A;  4C4T A;  2JRZ A;  1T3N A;  4YR3 A;  1LV5 A;  3PO5 A;  4EBK A;  3IM1 A;  3SV4 A;  1S97 A;  3NYB A;  1NK9 A;  2IHO A;  1EXN A;  1J2M A;  1HIW A;  2Y1I A;  4GFJ A;  2ZUD A;  5HRG A;  1AQ6 A;  3MR5 A;  1N56 A;  1URJ A;  1UEV A;  5HMM A;  3RRG A;  2OM6 A;  2VA8 A;  4YD1 A;  1ZOL A;  2BQU A;  4P4M A;  1NOM A;  3H38 A;  5ALY A;  1QCK A;  4QZB A;  4NXW A;  5E79 U;  3LDA A;  4K4H A;  1NI3 A;  4KTQ A;  1K1Q A;  3SAH A;  3FYH A;  3RF9 A;  3A0B U;  1ARO P;  2BBJ A;  3D2Q A;  4QZE A;  1YZ6 A;  4I2A A;  2KFZ A;  4Z6D A;  5D46 A;  1XC9 A;  5AKX A;  1X6I A;  5KFQ A;  1KFT A;  2OHF A;  5CR0 A;  4KX3 A;  3HWT A;  2HVH A;  4ELT A;  3ZDD A;  2ZIW A;  2NRX A;  4IC9 A;  2ASL A;  1SZP A;  4DWI A;  2FPK A;  4KLQ A;  1UPH A;  4WC4 A;  2W55 A;  2V4R A;  2P6R A;  5G5G A;  3ER8 C;  2NRZ A;  2ZIW B;  2VA2 A;  2I6X A;  3JPP A;  4ECW A;  3NUQ A;  1H38 A;  1NZB A;  3IP4 B;  1S0O A;  5BOM A;  2MU2 A;  2WF9 A;  4BX9 C;  4JUZ A;  1QQ7 A;  1V85 A;  4M04 A;  2BE3 A;  1T3Q A;  2F1I A;  2H5X A;  1KNY A;  4AT9 A;  5AKK A;  5DDM A;  3G6X A;  2KMD A;  4P0Q A;  4K4G A;  1SXE A;  5KFP A;  4KLF A;  2ZJA A;  4J9R A;  1ZQB A;  4K98 A;  1LB2 B;  1QLN A;  2F44 A;  2G0A A;  4UBC A;  3GIJ A;  5KT3 A;  4KMU A;  4MFC A;  2HHW A;  1BPD A;  4B9S A;  1YT3 A;  4EYH B;  3C5F A;  3T5J A;  3WFQ E;  2ZH6 A;  2E8N A;  3N7S C;  2YY6 A;  2OCE A;  2QAR A;  3PX6 A;  5KT7 A;  4IS7 A;  1O03 A;  5KAI U;  3N4M B;  7ICG A;  3B9J A;  4F2R A;  1ZD3 A;  2XVT A;  3OHB A;  3HX0 A;  1ZRM A;  4ECZ A;  4PHA A;  2BGW A;  4AT8 A;  2PFQ A;  4Y2J A;  5KFE A;  3C2K A;  4KLL A;  4NXV A;  5B3Q A;  2ZXI A;  3TFS A;  2Z7J A;  3MGV A;  2BR0 A;  2VJ5 A;  4J9S A;  3C5G A;  5KFF A;  3N97 B;  3V7K A;  3RAX A;  3D6J A;  4YD2 A;  2XIC A;  9ICO A;  3ISB A;  2ALZ A;  4X0B A;  5DQI A;  4GIB A;  1N5W A;  1XSL A;  1X9X A;  4MFA A;  2ZH1 A;  4PPX A;  4OCZ A;  2BCS A;  1D9F A;  4KLI A;  2JHD A;  4DQR A;  4DL3 A;  5ALQ A;  4RQ2 A;  3UXN A;  3I28 A;  4YFK A;  2G5I B;  1MQ2 A;  2ZHB A;  3BZC A;  2KJ5 A;  4NXX A;  4C0Z A;  2FPM A;  5AI0 A;  4N7R A;  2H3F A;  1X9M A;  3K4G A;  3ZD8 A;  1D8Y A;  5D49 A;  2WF7 A;  4C7Z A;  3MFH A;  1WOT A;  3QYP A;  5KAF U;  5AIB A;  4X4R A;  1KSP A;  4RQ5 A;  5J2E A;  4C8N A;  4AYB C;  3M8S A;  1SWV A;  5CFU A;  2ZJ5 A;  8ICX A;  1R89 A;  4EZ6 A;  3AQN A;  4ED3 A;  2C2E A;  4X4S A;  4FO1 A;  9ICQ A;  2NYV A;  4RQ6 A;  4ED6 A;  2JMG A;  1V9P A;  3K75 D;  3RB6 A;  2KV2 A;  2KP7 A;  4O0I A;  5KG3 A;  5DB9 A;  3C66 A;  2KJ9 A;  4Y2R A;  4PH5 A;  2HOI A;  2ZHA A;  4HYK A;  1BPY A;  4X0A A;  3BDP A;  1Z4O A;  5DG7 A;  3T5K A;  4YR0 A;  2LKY A;  8ICS A;  2IHM A;  4MHV A;  4DSF A;  2ZH5 A;  1WCN A;  4ECY A;  4PZO A;  2K4H A;  4X4V A;  2F8K A;  4I2G A;  2LYH A;  4WCW A;  5KG7 A;  1A76 A;  2UVW A;  5ALI A;  5EOZ A;  5AI5 A;  5DKW A;  4F4K A;  4QZ9 A;  2WFA A;  1ZQQ A;  2HBL A;  5KG2 A;  5J2J A;  2AHO B;  4K96 A;  3RB0 A;  4CCH A;  2E5S A;  4F5R A;  4LVS A;  3LQC B;  1JI7 A;  4XQ8 A;  4Z6C A;  3PR5 B;  2RDJ A;  1ZJN A;  1KRP A;  3PW4 A;  3ALR A;  5KFN A;  4C8K A;  4J9K A;  3TAR A;  9ICP A;  4M0A A;  4KX5 A;  2A1A A;  3KBB A;  1K5O A;  5DQH A;  1F5S A;  3EUB 2;  4C8O A;  3OUY B;  5L1K A;  4ECT A;  5HRB A;  4ED2 A;  4X4U A;  2HHP A;  1S10 A;  1PVP A;  3OSN A;  3OWG A;  4BUG A;  4RWP A;  5DBA A;  1Z3E B;  7ICF A;  1UT5 A;  3T79 A;  1WWV A;  3WFR E;  4TQR A;  2JH7 A;  4Y2P A;  1JX4 A;  2ATL A;  2YX8 A;  2DPJ A;  2RRD A;  3RR8 A;  2H3Q A;  1S77 D;  2IOH A;  4BWM A;  1XO1 A;  2KVC A;  3AU2 A;  2YQE A;  1SL0 A;  1IM4 A;  1ZQI A;  3VCB A;  1Z1V A;  5J0W A;  4O5K A;  2PI4 A;  1UEU A;  4F2S A;  5J2C A;  2CRX A;  3H3A A;  2FJ6 A;  2KNJ A;  1BPB A;  2ASD A;  2AJQ A;  4YCX A;  4R63 A;  3UQ0 A;  3CW2 C;  2AGQ A;  1YZ7 A;  4FZN A;  2K60 A;  2I1Q A;  1OW5 A;  1QQ5 A;  1K1S A;  3AUO A;  1ZQJ A;  4NLC A;  1SXD A;  1V97 A;  1T8E A;  3K1Z A;  4F91 B;  1U9L A;  1CUK A;  9ICW A;  3JZ0 A;  5KG4 A;  1TAM A;  3IG8 A;  1L3T A;  4KLJ A;  9ICG A;  8ICV A;  3ORY A;  3GIL A;  4YP3 A;  2HW3 A;  4WC3 A;  2LBO A;  4UD5 A;  4YQW A;  4FHY A;  3V72 A;  3BQ1 A;  5CRX A;  2FCL A;  2KOB A;  4Y2T A;  5F9N A;  4ECQ A;  1F5A A;  2C2R A;  3ZDC A;  2Q4T A;  1ZD2 P;  4J9L A;  4J9P A;  2ZXH A;  4GXI A;  1PK1 B;  2WAQ F;  2W8L A;  3PO4 A;  3WK6 A;  2ZIU A;  3D2N A;  2HHQ A;  2GO7 A;  1FO4 A;  1RDF A;  2PXI A;  3SYZ A;  1QSS A;  4WH5 A;  3WFP A;  3MAB A;  3WK9 A;  2KTQ A;  4PZN A;  2F1J A;  1ZET A;  3QU2 A;  3MGH A;  4MEY A;  4J03 A;  1MSW D;  3TAQ A;  5L1L A;  4WC5 A;  4NLN A;  3NTU A;  4OJ5 A;  3DEE A;  3RBE A;  5ALX A;  2FLL A;  4DL6 A;  5ALG A;  5KT2 A;  4I27 A;  4C80 A;  5J8Y C;  3F2C A;  4YMN A;  5ALU A;  2KZ3 A;  2DFL A;  1IIP A;  5CFT A;  3PV8 A;  3AQF A;  1U45 A;  4RPY A;  1J2N A;  2W3R A;  4TUQ A;  1LVH A;  1MIV A;  5BOL A;  4FS2 A;  5IIJ A;  5CJ7 A;  4IL6 U;  2LM4 A;  2ZJ8 A;  4OJO A;  3M6K A;  1SL1 A;  3BZK A;  4O6A A;  2HHT A;  3GIM A;  3RB3 A;  1MIW A;  1NKE A;  3RJF A;  2HOQ A;  2RDI A;  2K8B B;  2KSO A;  5J0S A;  3M9N B;  4DL5 A;  3UQ2 A;  1QQ6 A;  4EX6 A;  5J2I A;  4PJ0 U;  4CNQ A;  2O5A A;  2ZUC A;  1SWW A;  3PSI A;  3SQI A;  4DF4 A;  2WTF A;  2GWS A;  2Q66 A;  3C18 A;  5DGA A;  9ICM A;  1NZP A;  1O08 A;  5KFX A;  4EEL A;  3ETR A;  4US9 A;  3IN5 A;  2W9A A;  3AQK A;  3FAH A;  4CF3 A;  1TK0 A;  4RPZ A;  9ICS A;  4M6W A;  5IIO A;  5KG0 A;  3ZDE A;  3PMN A;  2QB1 A;  4UB8 U; 
#chains in the Genus database with same CATH homology
 2HVH A;  1TFY A;  3WFS C;  2ISP A;  4ELT A;  3ZDD A;  4AT9 B;  2NRX A;  2ASL A;  8ICK A;  1SZP A;  3BJY A;  1U48 A;  1L3V A;  4DWI A;  4P2H A;  4QZI A;  3THV A;  2ZUB A;  2FPK A;  4M6W B;  4KLQ A;  4ATB B;  4WC4 A;  2JZB B;  2V4R A;  3GDX A;  5IIN A;  1N48 A;  2XY5 A;  2P6R A;  1DK3 A;  1QTM A;  3RJH A;  2NRZ A;  2BQR A;  8ICJ A;  3BQ0 A;  4GLX A;  2ZH2 A;  5CA7 A;  2XCA A;  3ISD A;  2VA2 A;  5KFB A;  2JZB A;  3MDA A;  2JEF A;  4M9N A;  1WCL A;  4PHE A;  3JPP A;  3PX4 A;  4ECW A;  5HR9 A;  4XA5 A;  3QZ8 A;  1H38 A;  8ICB A;  3LWL A;  2DPI A;  1S0O A;  4IQU A;  5BOM A;  2Q0Z X;  4R8U B;  1BVS A;  4E7X A;  4QWA A;  4JUZ A;  1U49 A;  2FMQ A;  4BXO A;  5IIL A;  2ZH4 A;  1NK7 A;  2HHS A;  1VJ7 A;  4KN4 A;  4FHW A;  4M04 A;  2AGP A;  2BE3 A;  3V6J A;  1ZQW A;  2F1I A;  2H5X A;  3MGI A;  4K4I A;  1KNY A;  4AT9 A;  2W9M A;  5DDM A;  3G6X A;  2HHU A;  5KFU A;  4BXO B;  4K4G A;  4ATB A;  5KFP A;  9ICU A;  5KG5 A;  5HRI A;  3TI0 A;  4KLD A;  3AQL A;  1D9D A;  2XGP A;  4YVZ A;  4KLF A;  2ZJA A;  1X9S A;  4J9R A;  4DSI A;  1ZQB A;  4FHX A;  4DFK A;  4M9G A;  1S76 D;  9ICV A;  3OV7 A;  2V9W A;  1JAJ A;  4QZC A;  8ICF A;  4O3S A;  4YMM A;  1LB2 B;  1QLN A;  4Q8E A;  4UBC A;  4RQ1 A;  3OGU A;  3GIJ A;  1ZQH A;  5KFH A;  4KMU A;  5KT3 A;  4R65 A;  3RH5 A;  5EWE A;  4MFC A;  2HHW A;  1BPD A;  4RQ4 A;  4J9Q A;  4B9S A;  2KN7 A;  2J6T A;  3RJK A;  1CEZ A;  4EYH B;  1ZQZ A;  3C5F A;  4DQS A;  3T5J A;  1T7P A;  2ZH6 A;  4FHV A;  8ICR A;  3WFQ E;  3C2L A;  2DR9 A;  5DB7 A;  4NLZ A;  4YR2 A;  3KHG A;  4KN7 A;  4RUA A;  3PX6 A;  5KT7 A;  2IBK A;  4QW9 A;  5KFM A;  2ZH3 A;  2FPL A;  4FBU A;  3N4M B;  4PGY A;  7ICG A;  3H4B A;  2NRT A;  2IA6 A;  3ZD9 A;  9ICF A;  4F2R A;  5J2B A;  3OHB A;  1X9W A;  9ICR A;  2BCU A;  3JPQ A;  4EBJ A;  5J0Y A;  3OHA A;  3HX0 A;  5HRF A;  3RH4 A;  4ECZ A;  1TFW A;  4PHA A;  4Q44 A;  3TQ1 A;  2BGW A;  5DEC A;  5DLF A;  4AT8 A;  2PFQ A;  3SV3 A;  1S0V A;  7ICE A;  9ICI A;  5KFE A;  2HVI A;  7ICN A;  2M2W A;  3HIY A;  9ICL A;  2W9B A;  3C2K A;  4IR9 A;  4KLL A;  4WC7 A;  5J0Q A;  4NKT A;  2J6S A;  3TFS A;  4GXJ A;  5IIK A;  3M9M B;  2BR0 A;  1BPZ A;  9ICT A;  3V7L A;  1UET A;  2AU0 A;  1UT8 A;  4J9S A;  7ICU A;  1BNO A;  3C5G A;  5KFF A;  3N97 B;  3V7K A;  3RAX A;  4NM2 A;  4DSJ A;  4UB5 A;  3WFO A;  3B0Y A;  4YD2 A;  9ICO A;  3ISB A;  4EEY A;  1YLQ A;  5J2D A;  2B21 A;  2ALZ A;  3E2E A;  4F5P A;  3RJE A;  4X0B A;  5DQI A;  3PNC A;  5J0X A;  4B9M A;  4E80 A;  4TQS A;  1XSL A;  4MFA A;  2ZH1 A;  2UVU A;  4PPX A;  4Z6E A;  2XY7 A;  1ZQL A;  4UD4 A;  4WBZ A;  1BGX T;  2BPC A;  4QZ8 A;  2M2U A;  4PGX A;  1ZQE A;  3RTV A;  4QZG A;  2BHN A;  5IIM A;  2BCS A;  2PFO A;  1D9F A;  4NLG A;  2BCV A;  4KLI A;  3RRH A;  4QZF A;  4DQR A;  4DL3 A;  8ICN A;  5J0R A;  4KLG A;  4RQ2 A;  2RFF A;  3UXN A;  1L3U A;  4YFK A;  8ICI A;  2KFN A;  1MQ2 A;  2JEJ A;  7ICM A;  4I2C A;  5KT6 A;  2ZHB A;  4UBB A;  2ID1 A;  1ZQU A;  4O9M A;  1JXL A;  1U4B A;  3QZ7 A;  2C28 A;  2FPM A;  5JUM A;  4ECR A;  4UQG A;  1TAU A;  1X9M A;  3K4G A;  3ZD8 A;  1Q79 A;  3GV8 B;  1D8Y A;  5D49 A;  2VAN A;  2PFP A;  3HT3 A;  1NO5 A;  1NK8 A;  2OWO A;  2FLN A;  2AQ0 A;  5KFD A;  1X2I A;  3MFH A;  1WOT A;  4F4Z A;  1OU5 A;  4B9U A;  4X4N A;  1ZQM A;  1Z00 A;  4DSE A;  1UA1 A;  2XCP A;  4X4R A;  4R8U A;  1KSP A;  4RQ5 A;  5J2E A;  4C8N A;  4IRK A;  1ZJM A;  1D8L A;  2BDP A;  9ICA A;  3T3F A;  3M8S A;  5KFL A;  2ZTE A;  2MUT B;  4MF2 A;  4QZA A;  7ICR A;  1JXE A;  2ZJ5 A;  1Z00 B;  9ICH A;  4EZ6 A;  8ICX A;  1R89 A;  3AQN A;  5EWF A;  4ED3 A;  2C2E A;  5HRE A;  3AU6 A;  3Q8S B;  4X4S A;  1XWL A;  3MFI A;  3C2M A;  3RJG A;  2BKE A;  5DB6 A;  5J0P A;  9ICQ A;  2ZH7 A;  5KG1 A;  4O3N A;  4KLU A;  4ED8 A;  4RQ6 A;  1RXV A;  1ZQN A;  4FH5 A;  1Y88 A;  3LWM A;  4GXK A;  3ETL A;  4ED6 A;  4DSK A;  8ICM A;  1V9P A;  3RJJ A;  4UAW A;  3K75 D;  3SZ2 A;  9ICX A;  4F5N A;  3RB6 A;  3V6K A;  2KP7 A;  1ZQP A;  4RWN A;  2NRW A;  3B0X A;  1KFS A;  4LT6 A;  4O0I A;  4O3O A;  2R8I A;  5KG3 A;  1IXR A;  8ICP A;  1HJP A;  5DB9 A;  3C66 A;  3UPS A;  2Y1J A;  2NRV A;  4WC1 A;  2JEG A;  1NK4 A;  4PH5 A;  3GQC A;  1XU4 A;  3H39 A;  2XGQ A;  2ZHA A;  4HYK A;  4RQ7 A;  4Q43 A;  4F50 A;  1BPY A;  3BDP A;  8ICY A;  4X0A A;  5J2H A;  5DG7 A;  4DFJ A;  4F4Y A;  5BPC A;  4NLK A;  7ICI A;  7ICP A;  5DDY A;  4F4X A;  4YR0 A;  3T5K A;  2BPG A;  5J0O A;  4P4O A;  5CHG A;  2IHM A;  8ICS A;  4DSF A;  5DBC A;  3TAN A;  2NRK A;  2ZH5 A;  1WCN A;  4ECY A;  1B22 A;  1A77 A;  2BQ3 A;  4JWM A;  2DRA A;  4X4V A;  3BQT A;  2XO7 A;  4XQ7 A;  1B43 A;  4I2E A;  4S3N A;  4F92 B;  7ICH A;  3RAQ A;  4X5V A;  4B9T A;  3M9O B;  4I2G A;  2LYH A;  4RZR A;  1XS9 D;  3GV5 B;  4MF8 A;  4JV2 A;  4E0D A;  4I2B A;  4YXM A;  4ECS A;  1ZQO A;  2FLP A;  4WCW A;  5KG7 A;  4EP7 A;  1Q78 A;  3PW5 A;  4AT8 B;  3HWT A;  4I2H A;  4B9V A;  1A76 A;  2UVW A;  3JPR A;  5J29 A;  5EOZ A;  2W9B B;  1ZQC A;  5J2G A;  5DKW A;  4QZ9 A;  5DG9 A;  1RYS A;  4F4K A;  5J0T A;  1ZQV A;  4EYI B;  2R8K A;  3HJ4 A;  4AT7 A;  3L9D A;  1ZQQ A;  4M9L A;  2JEI A;  4DQQ A;  4JV0 A;  5KG2 A;  5J2J A;  4RT2 A;  4MEX A;  4ECU A;  3JPO A;  3RB0 A;  4CCH A;  4NXZ A;  4DS4 A;  5HRD A;  2M2V A;  2O1P A;  4F5R A;  4LVS A;  1ZQX A;  3LQC B;  4ED0 A;  5L1I A;  3H7I A;  4B9N A;  4Z6C A;  4XQ8 A;  3RB4 A;  4I2D A;  3PR5 B;  1RXW A;  1S0M A;  2RDJ A;  1ZJN A;  1SKW A;  1KRP A;  3PW4 A;  4EBC A;  4KLT A;  5KFN A;  2R8H A;  1TV9 A;  1ZQK A;  3PML A;  4J9K A;  3TAR A;  4C8K A;  1QSY A;  4MFF A;  9ICP A;  4M0A A;  4IG8 A;  2HHX A;  4IRD A;  4EZ9 A;  5DQH A;  5J2K A;  2ISO A;  2BCR A;  7ICQ A;  4DOB A;  1ZQS A;  4KLE A;  8ICW A;  4DL7 A;  2DVI A;  4Q45 A;  4X4Q A;  4C8O A;  1DOQ A;  3MR3 A;  4LZG A;  3OUY B;  3UPQ A;  4DOA A;  5L1K A;  4ECT A;  5HRB A;  4ED2 A;  3KTQ A;  1NJX A;  4XUS A;  5DLG A;  3JPN A;  3Q8P B;  4GC7 A;  2HHP A;  5KG6 A;  4AT7 B;  5KFW A;  4X4U A;  1R8A A;  1TFR A;  1S10 A;  2ZH9 A;  7ICL A;  1KDH A;  3OSN A;  4M9J A;  4DFM A;  3OVS A;  4LZD A;  2C22 A;  4YN4 A;  1ZQD A;  8ICO A;  1PX5 A;  4RWP A;  3Q8L A;  5DBA A;  3MR6 A;  4IRC A;  5KTQ A;  5CWR A;  1Z3E B;  5EWG A;  4P4P A;  4KLS A;  8ICZ A;  4IQT A;  5HRH A;  7ICF A;  1UT5 A;  3MDC A;  4EBE A;  1ZQR A;  2IHN A;  3WFR E;  4F4W A;  4TQR A;  4ECX A;  2XC9 A;  5DQG A;  1T4G A;  1TK5 A;  4I2J A;  3QE9 Y;  2DRB A;  3HP6 A;  1BNP A;  1KFD A;  5TZV A;  1MQ3 A;  5III A;  2ATL A;  1JX4 A;  2R8J A;  4BDP A;  8ICT A;  1MIY A;  3H8J A;  1RPL A;  4UAZ A;  2C2D A;  2DPJ A;  3JPS A;  3PR4 A;  1ZQG A;  8ICG A;  3C23 A;  5KFI A;  5D4B A;  3OUY A;  3H8S A;  1NK0 A;  2W9C B;  4DQI A;  2M9N A;  4BGD A;  3RR8 A;  2PI5 A;  7ICS A;  7ICV A;  4ED7 A;  1S77 D;  4BWM A;  3GV7 B;  4EBD A;  4F5O A;  4RNN A;  1L3S A;  1TK8 A;  2R8G A;  4M2Y A;  9ICJ A;  1XO1 A;  3AU2 A;  3M8R A;  5KFR A;  3EYZ A;  4ZH4 A;  1NKC A;  1SL2 A;  4F93 B;  3HPO A;  4NY8 A;  8ICC A;  4RNO A;  3QEA Z;  3GII A;  4KLO A;  3PW2 A;  2ZTC A;  1SL0 A;  8ICL A;  3AQM A;  1IM4 A;  3MR2 A;  3PW0 A;  1SKS A;  4M5D A;  3IHQ B;  1ZQF A;  1R8C A;  4DS5 A;  1TAQ A;  3H8W A;  2ZH8 A;  3H4D A;  5HC9 A;  1ZQI A;  3T5L A;  4KLM A;  4O5K A;  5J0W A;  5J2A A;  2PI4 A;  1COO A;  4IQV A;  3RH6 A;  4QWE A;  1XSN A;  4F2S A;  1UEU A;  5DGB A;  4I2F A;  5KFO A;  4QWC A;  4RQ8 A;  4FS1 A;  5J2C A;  1KLN A;  1S9F A;  3H3A A;  2V4Q A;  1ZQT A;  4RNM A;  4TUP A;  2M2T A;  1BPB A;  2ZTD A;  1JIH A;  5HHH A;  3GIK A;  4DOC A;  3KHL A;  9ICB A;  3UXP A;  3RBD A;  3TFR A;  2ASD A;  4E8F A;  4RT3 A;  4IR1 A;  1ZQA A;  4YCX A;  2AJQ A;  2BCQ A;  4KIT B;  5L1J A;  4FO6 A;  1U47 A;  4R63 A;  3UQ0 A;  5KFC A;  2A1J A;  2MAX A;  3EZ5 A;  2AGQ A;  2I1Q A;  4RPX A;  1JMS A;  1NJZ A;  4C8M A;  3OJS A;  1K1S A;  4RQ3 A;  3AUO A;  1ZQJ A;  4M9H A;  2DR5 A;  2KZM A;  3JPT A;  1T8E A;  4F91 B;  4KLH A;  1U9L A;  1CUK A;  9ICW A;  3JZ0 A;  3V6H A;  4FH3 A;  4QW8 A;  5KG4 A;  2A1J B;  4Z6F A;  5HNK A;  3BQ2 A;  4J9M A;  4J9O A;  1NK5 A;  1NK6 A;  5CB1 A;  1L3T A;  4KLJ A;  2P6U A;  8ICV A;  9ICG A;  3C1Y A;  4UB3 A;  5HHI A;  3ORY A;  8ICH A;  3EW9 A;  2PFN A;  3GIL A;  4YP3 A;  4O3P A;  2HW3 A;  7ICK A;  4UD5 A;  4YQW A;  1S0N A;  4FHY A;  4WC3 A;  3V72 A;  4PHP A;  4XRH A;  3BQ1 A;  4F5Q A;  1TVA A;  3GFK B;  4F8R A;  4RWQ A;  5F9N A;  4ECQ A;  3T5H A;  1RYR A;  2I9G A;  1F5A A;  4DQP A;  3HW8 A;  2C2R A;  2HHV A;  4O3Q A;  4F3O A;  4RUC A;  3H40 A;  3V7J A;  2IMW P;  3Q8K A;  2UVV A;  3ZDC A;  3RJI A;  4C8L A;  1VFG A;  4DEZ A;  3PX0 A;  4J9L A;  4J9P A;  2P66 A;  4GXI A;  4UAY A;  2W8K A;  2W8L A;  4RU9 A;  2FMS A;  2KZZ A;  3PO4 A;  4ECV A;  4JV1 A;  1SKR A;  3EPI A;  4JWN A;  4QWB A;  2AGO A;  3H37 A;  5J2F A;  4QZD A;  2HHQ A;  2MUT A;  4YMO A;  3RR7 A;  4FBT A;  5KFZ A;  3ISC A;  1QSL A;  9ICC A;  3Q8R B;  2PXI A;  4DSL A;  3MBY A;  4WBY A;  3SYZ A;  1QSS A;  4RWO A;  3TAP A;  3OVB A;  9ICK A;  4IQW A;  3WFP A;  3ZDB A;  4DLE A;  4DL4 A;  3MAB A;  4O5C A;  2KTQ A;  3PVX A;  5DB8 A;  2VA3 A;  1KTQ A;  3JYY A;  4I29 A;  3LK9 A;  2F1J A;  1ZET A;  3SI8 A;  4O3R A;  4TUR A;  5KFV A;  5CP2 A;  3MGH A;  2PBE A;  4MEY A;  4QWD A;  3EPG A;  1UA0 A;  2J6U A;  5HRL A;  1BPX A;  1MSW D;  4UB2 A;  3NGD A;  5DBB A;  5L1L A;  3TAQ A;  4WC6 A;  5KFT A;  4ELU A;  2BPF A;  4NLN A;  4WC5 A;  4X4T A;  4DLG A;  4PGQ A;  4YG2 A;  1RZT A;  4DF8 A;  8ICE A;  8ICQ A;  4FHP A;  3NTU A;  5HML A;  5KT4 A;  4NKU A;  4UB4 A;  4B9L A;  4X4P A;  4BWJ A;  3RBE A;  1T3N A;  4YR3 A;  1LV5 A;  2FLL A;  4DL6 A;  3PO5 A;  4PHD A;  5F2V O;  4YXJ A;  5KT2 A;  4I27 A;  4I2I A;  3Q8Q B;  9ICN A;  3PMN A;  4EBK A;  3IM1 A;  3SV4 A;  2ASJ A;  1S97 A;  3NYB A;  4YMN A;  4DO9 A;  4R64 A;  5KT5 A;  1NK9 A;  1EXN A;  2KZ3 A;  4Q8F A;  2DFL A;  5KFJ A;  8ICU A;  4R66 A;  5KFS A;  4GC6 A;  4DFP A;  2Y1I A;  4I28 A;  3PV8 A;  2XY6 A;  1NJY A;  5DED A;  1U45 A;  4RPY A;  2ZUD A;  5HRG A;  3MR5 A;  1N56 A;  3QEB Z;  7ICO A;  4TUQ A;  1HUZ A;  5HMM A;  1FA0 A;  1MIV A;  5BOL A;  4FS2 A;  5F9L A;  3RRG A;  1UEV A;  3ZDA A;  5IIJ A;  5CJ7 A;  3PY8 A;  3KHH A;  2ZJ8 A;  3PW7 A;  2VA8 A;  1SL1 A;  4X4O A;  2DR7 A;  4G3I A;  4YD1 A;  1JQR A;  2HHT A;  2BQU A;  3GIM A;  1HUO A;  4P4M A;  1NOM A;  3RB3 A;  1C7Y A;  1MIW A;  3H38 A;  1NKE A;  1BPE A;  3FDS A;  3RJF A;  5L9X A;  4QZB A;  4ELV A;  9ICE A;  5HRK A;  5HP4 A;  4QZH A;  1XSP A;  2RDI A;  3EWA A;  1JN3 A;  3LDA A;  4K4H A;  5J0S A;  3G6Y A;  3M9N B;  4DL5 A;  3OSP A;  1TKD A;  4KTQ A;  5C5J A;  1K1Q A;  3OVA A;  3FYH A;  3UQ2 A;  1NJW A;  5KFA A;  5J2I A;  4M47 A;  1ARO P;  1L5U A;  5J0U A;  2O5A A;  2ZUC A;  4DL2 A;  4QZE A;  2F1H A;  4DF4 A;  2AQ4 A;  1ZYQ A;  2DR8 A;  2WTF A;  2GWS A;  3C21 A;  4JK1 A;  2Q66 A;  4I2A A;  3C18 A;  5DGA A;  2KFZ A;  4Z6D A;  1V4A A;  5D46 A;  3G6V A;  1XC9 A;  4NM1 A;  9ICM A;  1NZP A;  1R8B A;  5KFX A;  7ICT A;  7ICJ A;  1KEJ A;  3C1Z A;  2W9C A;  3Q8M A;  1DK2 A;  4WC0 A;  4WC2 A;  5KFG A;  5KFQ A;  3OJU A;  4ED1 A;  4RQ0 A;  2FMP A;  2UVR A;  1KFT A;  1PZN A;  1ZQY A;  2W9A A;  5CR0 A;  3KHR A;  8ICA A;  4J9N A;  3AQK A;  5KFK A;  1NKB A;  1TK0 A;  3HJ1 A;  4RPZ A;  4O5E A;  5KFY A;  5DG8 A;  1DGS A;  4M6W A;  3UXO A;  5KG0 A;  1MC8 A;  5IIO A;  4UB1 A;  3ZDE A;  4TUS A;  9ICS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...