4KLTA

Dna polymerase beta mismatched product complex with mn2+, 30 min
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
326
structure length
314
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTTKQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Observing a DNA polymerase choose right from wrong.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 104
structure length 314
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4kltA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4kltA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4kltA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4kltA03
3MR6A 3M9MB 1R8BA 4F4YA 5KFBA 3MGIA 4QWAA 2C2RA 1NO5A 1QLNA 1CEZA 1DGSA 5EWFA 3PMNA 4DL4A 3OSPA 2UVUA 5HRLA 2W8LA 4JV0A 5D46A 2NRVA 2MAXA 7ICGA 4ED1A 3AQNA 5J2JA 3Q8QB 4QZEA 1D8YA 9ICIA 4X4RA 5KG6A 2XCPA 7ICOA 3RR8A 1KFDA 1Z3EB 3C5FA 4C8OA 4WC4A 1T8EA 2DR8A 7ICMA 2ZH2A 5KT5A 1S10A 4J9MA 2Q66A 4EYHB 3GV5B 4B9VA 4PPXA 8ICRA 2FLNA 3GIKA 4ECWA 4O3RA 5DB6A 3TARA 2C22A 1ZJNA 4UB3A 4MFFA 2VA3A 1K1SA 2BKEA 4QWEA 1SKRA 3OVAA 4J9LA 3TFRA 1S76D 5HC9A 5F9LA 3MFHA 1KFTA 1NOMA 3OVBA 3V7LA 2NRWA 1XC9A 3KHLA 5JUMA 4ECUA 2UVRA 2R8IA 1F5AA 1YLQA 5IINA 1L3TA 1BPDA 1NZPA 1RXVA 8ICUA 3N97B 4O5EA 2FMQA 1UETA 3RB6A 4B9NA 4DFKA 4QWDA 2DFLA 5KFNA 1JQRA 4KLDA 3ISBA 2KTQA 1ZQZA 5KFFA 3LK9A 4QW8A 2Y1IA 4RPZA 5J2IA 3QZ8A 1ZETA 4B9SA 4Z6FA 3GILA 4Z6EA 2AU0A 7ICPA 4WC7A 4DEZA 4EBCA 4F93B 2XCAA 1A76A 1TK5A 4KLIA 4I2EA 4NXZA 5DKWA 3SYZA 4IQWA 4J9NA 5KFDA 3SZ2A 1UT5A 5KFLA 3H4BA 2GWSA 9ICHA 3WFOA 1RPLA 2A1JB 2FLPA 1ZQVA 4YN4A 3KHGA 4I2AA 3ZD8A 1LV5A 1KTQA 1UT8A 1R8CA 4ED6A 4E8FA 4J9RA 4PH5A 4KITB 1ZQWA 5HMLA 1BPXA 1Q79A 5KTQA 1NK6A 1UEVA 3OJSA 1ZQYA 2ISPA 1V4AA 5KFTA 3OUYA 3ZDEA 4BGDA 5J2KA 4P4MA 5KFWA 3K4GA 4RQ8A 3M8RA 5KT7A 4B9TA 4NLKA 5J0TA 5J0XA 5DG7A 1XS9D 4I2IA 5TZVA 2WTFA 2J6TA 3AU2A 1NKEA 8ICLA 4UD5A 2BGWA 5KG0A 1ZQAA 4KLSA 5KFUA 5L1LA 2BCQA 9ICBA 5KG5A 2V9WA 7ICRA 4I2GA 4I29A 5DQIA 2PXIA 4ECXA 3H37A 5DGBA 3C2LA 2KZMA 3RAXA 4PHEA 1R89A 4F50A 4B9LA 3E2EA 5HRGA 4RWNA 1T3NA 2W9CA 2MUTB 5J29A 2HHUA 1L3VA 5HHHA 5HR9A 1ZQCA 4DSKA 2M2VA 4FHXA 3PW7A 2JZBB 2BQ3A 4DFJA 3T5KA 5BPCA 4ECTA 1FA0A 4JK1A 3Q8PB 3IM1A 5L1KA 3FDSA 3PR4A 3TAQA 4I28A 4JV1A 4F5RA 5CA7A 4YXMA 3RH4A 9ICSA 1KLNA 2HHXA 2ZHAA 2RFFA 2DR7A 4B9UA 4DSJA 7ICFA 4O0IA 4WBZA 2DPJA 4E0DA 1PX5A 3UPQA 4UBCA 3ETLA 4TUPA 3TI0A 2DPIA 8ICGA 1B43A 9ICJA 4I2HA 3RH6A 1NJYA 1N48A 2BCSA 8ICSA 4E7XA 4PGXA 5J2GA 4DFPA 5EWGA 5KFKA 3JPQA 1U47A 2HHWA 2VA8A 3NTUA 5HNKA 5J0UA 2RDJA 3BJYA 3RB3A 3M9NB 1TK0A 4ECQA 7ICNA 1R8AA 3WFSC 4RUAA 1JXEA 4J9QA 4IG8A 4Q44A 4BDPA 5HRDA 5J2DA 3RRHA 1NKCA 2FLLA 3SV3A 8ICWA 3LDAA 3RR7A 1ZQDA 3WFRE 5DBBA 3SV4A 4C8KA 4ED0A 2JEIA 5KFXA 5KT2A 3UPSA 4IR9A 2I1QA 3MR2A 1S0MA 2ZH1A 2FPMA 1XSPA 4QZDA 2AGOA 4EZ9A 3GIMA 2BQRA 3HW8A 2HHQA 3PX4A 1XSNA 4NY8A 1LB2B 3HT3A 2HVHA 3BQ0A 4F2RA 5C5JA 3RRGA 4GXIA 7ICVA 4YD2A 2A1JA 2V4QA 3MABA 3H8JA 4DSLA 4X4TA 1D9FA 3ZDCA 2W9CB 2PBEA 5D4BA 5J0RA 3JPRA 5CP2A 4F5QA 4S3NA 4Q45A 1TFRA 4PGYA 2Q0ZX 3G6YA 4IRCA 1MSWD 4O3PA 7ICTA 4DL6A 4AT8B 4ED2A 4RUCA 2AQ0A 4P4PA 4TQSA 4FO6A 2BPGA 1MC8A 2KP7A 3HIYA 4X4OA 4RPYA 1T4GA 2W9MA 9ICTA 4AT7A 2AGQA 1ZQOA 4RQ6A 3ZDAA 7ICIA 1KFSA 3PMLA 4PHAA 4QWBA 3C2MA 4TQRA 3V6KA 1KNYA 2NRZA 5J0YA 3PO5A 1ZQKA 3G6XA 2BE3A 1S9FA 4M5DA 1BPYA 3HJ1A 4ED3A 4UB4A 1JX4A 3TFSA 2C2EA 2MUTA 1SZPA 4RZRA 5DB7A 3B0YA 1DOQA 5KFPA 3RBDA 4K4HA 4M9JA 4KLJA 5F2VO 2VANA 5L9XA 1IM4A 2JZBA 5KG2A 2B21A 5KFEA 4YP3A 3EWAA 4DF4A 3RJIA 5HREA 4RWOA 1ZQUA 4P4OA 5DB8A 4YR0A 1BPEA 4UAZA 3QEAZ 4X4SA 4O9MA 4I2DA 5DLGA 4O3QA 4DO9A 4FH3A 4F5OA 4YXJA 3PY8A 4P2HA 3HP6A 4F8RA 4QZ9A 5BOLA 4RT3A 8ICTA 8ICOA 5KFSA 3KHRA 2M2UA 5HRBA 3T5LA 4XA5A 4PGQA 2HHSA 4KLOA 5HMMA 9ICRA 4UQGA 5DG9A 4RU9A 3JPPA 4RQ7A 1T7PA 8ICMA 1OU5A 1VFGA 2ZTDA 3JPOA 3EPIA 2JEFA 4DLGA 3QE9Y 1SL1A 4M9GA 3OHAA 5DQHA 4M04A 2BHNA 4DLEA 2DVIA 2HHPA 3JYYA 2ZJAA 5KFRA 3PR5B 2XGQA 5J2AA 1XU4A 1U4BA 4CCHA 3PW4A 4GC6A 4KLFA 4FHWA 1NK8A 4E80A 3AQKA 1KRPA 5DGAA 1KDHA 1ZQNA 5DEDA 3B0XA 4J9KA 2F1HA 5CR0A 1SL0A 2PFPA 2IA6A 1NK7A 1MIWA 1PZNA 3GIIA 8ICIA 4F5PA 2M2TA 4RQ0A 4F5NA 2DRBA 1BNPA 2BQUA 7ICUA 4TURA 3V6JA 2DRAA 2ZTEA 3GDXA 2XY5A 1ZQTA 4EP7A 2BCVA 1U45A 3EPGA 1TAQA 4IR1A 9ICQA 2M2WA 2ALZA 4IQTA 4FS1A 1JN3A 3FYHA 2ZUBA 4QWCA 2W9AA 3KHHA 2XY7A 8ICCA 1RYRA 3UXNA 4DQQA 2C2DA 3Q8LA 3ZD9A 2P6UA 1COOA 2J6UA 4O3OA 4J9OA 1NKBA 8ICNA 1ZQGA 1CUKA 1RXWA 1ZJMA 3K75D 4RQ3A 3BQ2A 4I2CA 5J0PA 4EYIB 4UB2A 2FPLA 3V72A 3TANA 3MR5A 2ZH8A 1XWLA 4YMMA 1BPBA 4RNOA 2R8KA 3L9DA 3NYBA 4AT8A 4DL7A 5F9NA 4C8MA 3PNCA 4DQRA 1ZQFA 2ATLA 4K4IA 4KLQA 3M8SA 5HRKA 1S0NA 2ZJ5A 4DS5A 4JWNA 4M2YA 9ICKA 4EBJA 5J0OA 1NK4A 5IIJA 4I27A 9ICLA 3M9OB 5DDMA 1L3SA 5D49A 1V9PA 3H8WA 2XY6A 4M9HA 3NGDA 2HVIA 1U49A 4WCWA 8ICFA 4ECYA 3RB0A 3H3AA 3N4MB 4ZH4A 3H40A 1TFWA 1D9DA 5HHIA 4EZ6A 4Q8EA 3LWLA 4QZ8A 4FH5A 4MF8A 5KFYA 2ZH5A 5EOZA 2PFOA 3Q8KA 2KFNA 2OWOA 1BNOA 4KLGA 4PHDA 4J9SA 3ISCA 3RB4A 1JXLA 3C66A 5KG1A 4ELVA 5CWRA 8ICZA 1NJXA 4X0AA 4I2FA 7ICHA 3HJ4A 2AQ4A 4WC6A 1MQ3A 5IIKA 4Q43A 3KTQA 3OJUA 9ICAA 4NKTA 9ICGA 4X4QA 5KG3A 2AGPA 4NLNA 2ZH4A 9ICPA 5DBAA 4FS2A 4F92B 2PFQA 3RJFA 3HPOA 4X4VA 2JEJA 1ZQSA 1ZQHA 4YMOA 4NLZA 1L3UA 4IRDA 3BQ1A 3C21A 2PI5A 5KFOA 4R65A 4XQ7A 1DK2A 9ICEA 8ICAA 3PX6A 2UVWA 5IIOA 4MFAA 4FBUA 5DQGA 1SKSA 1BPZA 7ICQA 2ASJA 3RBEA 4FBTA 9ICFA 4RQ1A 4LZDA 4UB5A 2KN7A 4GC7A 4UB1A 3AU6A 2P6RA 4FHPA 4C8LA 4M9LA 4AT9B 2PFNA 5J2BA 8ICVA 4UBBA 1ZQIA 3PW5A 4IQUA 4O5CA 4BXOB 4I2BA 3AUOA 2XGPA 1S0OA 4DSIA 3RJKA 1NK0A 5DLFA 4IRKA 5KT3A 4M9NA 8ICXA 2ZUCA 2BR0A 3JPSA 2ZH6A 4LT6A 1AROP 1ZQRA 4F4XA 5HRHA 3HX0A 2R8HA 4NM1A 4DQPA 7ICEA 4MF2A 2HHVA 4XUSA 2F1IA 3UQ2A 4KLLA 3OV7A 4JUZA 3V6HA 3TQ1A 1KSPA 2XC9A 2R8JA 4M47A 1UEUA 4X4UA 1JIHA 3RJEA 4KLUA 9ICOA 2KFZA 5IIIA 5KFMA 1XO1A 4EEYA 9ICMA 1B22A 4X0BA 1L5UA 5CJ7A 2V4RA 4WC0A 3BQTA 2IHMA 4NKUA 3OSNA 3UXPA 4KLMA 1EXNA 3OHBA 3MDAA 2BPFA 4F4KA 3Q8RB 1H38A 3ZDDA 3RJHA 4RT2A 2XO7A 2JEGA 4KN7A 4QZHA 3THVA 3SI8A 2IHNA 8ICBA 3WFPA 4R8UB 2W9BB 1HUOA 4GLXA 1DK3A 4FHYA 4I2JA 4KMUA 4J9PA 3AQMA 1Q78A 4QZCA 1HUZA 4RPXA 1ZQEA 4ECRA 4MEXA 3OVSA 4LVSA 2DR5A 3PW2A 4O3NA 3EYZA 3C1ZA 4EBDA 3RAQA 1WCNA 1ZQQA 2BPCA 4Z6DA 3V7JA 3T5HA 4DFMA 3JPNA 2FPKA 1XSLA 5J0QA 5DBCA 8ICKA 4NLGA 4PHPA 1SKWA 9ICNA 4ECZA 1ZQPA 5KFQA 1RZTA 1Y88A 4R63A 4ECSA 3UQ0A 4DS4A 5KG7A 4DOCA 4MEYA 4K4GA 4YVZA 2M9NA 3V7KA 4F4WA 8ICEA 4MFCA 5KFJA 4DF8A 4XQ8A 4YR2A 3PO4A 1JAJA 2AJQA 7ICKA 1X9MA 9ICUA 4AT7B 3H7IA 5DDYA 4TUSA 1UA0A 4DQIA 4GXKA 8ICQA 3C5GA 1A77A 1MIYA 4FHVA 4Z6CA 4BWMA 1WCLA 2F1JA 1TVAA 5L1IA 3RH5A 2P66A 9ICXA 4RNNA 3EW9A 1SL2A 1Z00B 4TUQA 1MQ2A 3RJGA 3C18A 4UD4A 1WOTA 4O5KA 4DL3A 2I9GA 1S77D 1MIVA 3H38A 3AQLA 4XRHA 4DQSA 4DL5A 1X9WA 5KFCA 1RYSA 3BDPA 4KLHA 4YQWA 3H8SA 2J6SA 9ICWA 5DECA 3C2KA 4M6WB 4RQ4A 2Y1JA 4G3IA 1D8LA 3JZ0A 5KT6A 3Q8MA 4ATBB 9ICVA 7ICSA 4AT9A 5L1JA 3QEBZ 5J0WA 4ED7A 2ASDA 3GV7B 5KT4A 3OGUA 1VJ7A 2RDIA 5KFVA 4EBEA 5DG8A 4RQ2A 3MDCA 3H4DA 4DSEA 4BXOA 4QZAA 3PW0A 3EZ5A 3TAPA 4O3SA 4QZGA 1ZQJA 3ISDA 4YMNA 1NK5A 3PVXA 1TKDA 4KLTA 1N56A 1NJZA 5J2FA 3T5JA 1NJWA 2R8GA 4QZFA 4DWIA 4KLEA 4QZBA 2HHTA 4WBYA 2ZH9A 4WC3A 4X4PA 3RTVA 2ZHBA 3PX0A 4KN4A 7ICJA 5HP4A 1TK8A 2ISOA 4RNMA 2VA2A 4WC1A 3PV8A 1ZQXA 2NRTA 2W8KA 4GXJA 3H39A 2ZH7A 2PI4A 3GV8B 1QSSA 2ID1A 1ZQMA 1K1QA 4BWJA 8ICJA 4ECVA 2ZJ8A 4YG2A 4ED8A 2ZH3A 3QZ7A 2ZUDA 4LZGA 4F91B 2O1PA 7ICLA 1JMSA 4C8NA 3MBYA 4QZIA 4X5VA 2BCUA 4JV2A 3GQCA 3C23A 4R8UA 1QSYA 5KFIA 5KG4A 2W9BA 5IILA 4M0AA 1BGXT 4QW9A 3MFIA 1BVSA 3HWTA 1S97A 4EBKA 3LQCB 3WFQE 3RJJA 3C1YA 3UXOA 4R66A 2NRKA 1NK9A 3MGHA 4F4ZA 4Q8FA 2BCRA 2KZZA 1HJPA 1UA1A 4KTQA 4X4NA 2DR9A 1ZQBA 4WC2A 5KFZA 2ASLA 4NM2A 3T3FA 2UVVA 1TFYA 3ORYA 5BOMA 3GIJA 5J2EA 2FMSA 2HW3A 3JPTA 5J0SA 5J2HA 4ELUA 8ICHA 4R64A 2ZTCA 4YD1A 2IBKA 2IMWP 1X2IA 4JWMA 4DOAA 5KFHA 4DSFA 4UAWA 4YCXA 1U48A 4UAYA 5KFAA 2O5AA 4YR3A 4IQVA 2KZ3A 5HRIA 4RWPA 1QTMA 1U9LA 5HRFA 3OUYB 5J2CA 1S0VA 3Q8SB 2H5XA 5CHGA 2FMPA 5CB1A 4RWQA 4ELTA 1IXRA 1Z00A 5DB9A 3MR3A 2C28A 2BDPA 1C7YA 1ZYQA 1QSLA 3GFKB 5IIMA 2NRXA 3IHQB 3G6VA 1TV9A 1TAUA 8ICPA 4WC5A 4DOBA 4B9MA 2LYHA 4M6WA 1KEJA 4F2SA 8ICYA 4ATBA 5KFGA 1ZQLA 3ZDBA 4HYKA 4YFKA 1X9SA 3LWMA 4F3OA 9ICCA 4DL2A 5EWEA 4RQ5A
chains in the Genus database with same CATH superfamily
1NO5A 1ZD2P 1CEZA 5EWFA 4JV0A 5D46A 1IIPA 7ICGA 3AQNA 3PHZA 3C5FA 3DDHA 4EEKA 2Q66A 4EYHB 8ICRA 3WKAA 2FLNA 4O3RA 1K1SA 3LVVA 2KKPA 3CYMA 2RRDA 2ZIUB 4P0QA 3QU2A 4ECUA 4NWIA 5AI6A 2R8IA 1F5AA 1L3TA 1RXVA 1Z4NA 5L1MA 5AKZA 4O5EA 2FMQA 1UETA 4B9NA 2BDUA 4DFKA 1GO3F 3MGVA 4QW8A 4RPZA 3GILA 7ICPA 2EZZA 4DEZA 1TK5A 2XCAA 2ZH1A 1A76A 2DQNB 2FE9A 3SYZA 3E58A 4IQWA 4J9NA 3WK8A 5JTIA 3SZ2A 3CK6A 3H4BA 1RPLA 2KICA 5A0LA 1NZBA 2ZXHA 2A1JB 2I6XA 1ZQVA 1UT8A 2A1AA 1SB3C 3SENA 3CP8A 3TKAA 4EV6A 1V4AA 3OJSA 1FFUA 1O03A 3M8RA 4P4MA 4RQ8A 3UMBA 4WQKA 5J0TA 1XS9D 4AT7B 5TZVA 2WTFA 1NKEA 3ZI4A 1ZQAA 5L1LA 4I2GA 5DQIA 2PXIA 3PSTA 5DGBA 2KZMA 4F50A 3E2EA 4RWNA 1T3NA 4CE6A 2MUTB 5J29A 2HHUA 2BQ3A 3KZIU 3T5KA 5CFSA 2L5YA 3PR4A 2WF8A 1KLNA 2DGZA 2RFFA 7ICFA 4O0IA 5EE3A 2DPJA 1PX5A 3UPQA 3TI0A 3VCBA 2KHQA 4HAIA 4DFPA 4OAFA 3BZKA 2HHWA 1U47A 2LM4A 4NLCA 5J0UA 3RB3A 1F44A 4J9QA 4IG8A 4Q44A 1KL9A 2RQ5A 5J2DA 2WF9A 2FLLA 2E5SA 3WFRE 2RP5A 3LDAA 1ZQDA 4C8KA 2VKQA 3SV4A 4ED0A 2E3TA 1S0MA 1X66A 2NO4A 4QZDA 4EZ9A 3AQEA 3HW8A 2HHQA 5AKLA 4F2RA 2W11A 2AH5A 4GXIA 2DWQA 2F3NA 3F2DA 4OCZA 2W9CB 4GFJA 3WK7A 5D4BA 4F5QA 1MSWD 4AT8B 2Q4TA 2QARA 4RUCA 2AQ0A 2KP7A 4TQSA 4P4PA 5CHEA 1T4GA 9ICTA 4WOYA 4WH5A 4PHAA 1ECWA 4QWBA 1CI4A 2CN1A 5J0YA 3PO5A 2LKYA 1S9FA 4ED3A 4UB4A 1TAUA 4RZRA 5DB7A 5KFPA 1DOQA 4K4HA 4KLJA 2JR5A 5L9XA 5KFEA 5HREA 3NRZA 3MCRA 4RWOA 4X4SA 4UAZA 4ACOA 5DLGA 4O3QA 4FH3A 4FFDA 3HP6A 8ICTA 3KHRA 2HHSA 1J2NA 4RU9A 1VFGA 1JUDA 3JPOA 3QE9Y 1SL1A 1KQQA 4US8A 3F2CA 4CCHA 3PW4A 4KLFA 1KRPA 5AI5A 5DGAA 3B0XA 1SL0A 4O69A 1MIWA 2IA6A 1PK1A 3V6JA 2DRAA 2ZTEA 1U45A 4RQMA 2G09A 1SV0C 2KKVA 3KHHA 8ICCA 1RYRA 3UXNA 2C2DA 2P6UA 2HBKA 4O3OA 1NKBA 3QU9A 1Z4OA 2B6GA 4RQ3A 7ICEA 2DL0A 4EYIB 3TANA 4YMMA 4RNOA 1BPBA 2F8KA 4DL7A 2ATLA 3M8SA 2WF5A 3D2NA 1S0NA 4M2YA 4EBJA 1L7NA 1NK4A 5D49A 3H8WA 5J8YA 1FFVA 4M9HA 8ICFA 3RB0A 3H3AA 3H40A 5ALYA 3WK6A 3QYPA 4Q8EA 4Y2TA 4MF8A 5EOZA 2KFNA 3RB4A 2FCLA 5ALLA 2GOLA 1VLBA 1SZHA 3HJ4A 4NXUA 1MQ3A 5IIKA 4Q43A 4IS7A 4NKTA 3IDWA 1L3UA 5KFOA 4XQ7A 5J8YC 1DK2A 9ICEA 8ICAA 2UVWA 1SKSA 4FBTA 4UB5A 2KN7A 1Q3UA 4AT9B 4QJFB 3NVVA 8ICVA 2LPEA 1XNSA 4BXOB 1KN5A 1N5XA 4O3MA 3JPSA 1AROP 1S8OA 4DQPA 4XUSA 3V6HA 1UEUA 2XVTA 4KLUA 2KFZA 5KFMA 4X0BA 1L5UA 4WC0A 1ZRMA 3OHBA 3MDAA 2BPFA 3ZDDA 3RJHA 2XO7A 2JEGA 1F0MA 4KB6A 2KJ5A 2IHNA 4Y2UA 1HUZA 4RPXA 4MEXA 1MIVA 2LHTA 1Q3VA 2V9WA 1WCNA 4Z6DA 3V7JA 5H2FU 5DBCA 4NLGA 5ALTA 1ZQPA 5KFQA 1RZTA 1Y88A 4DS4A 5ALPA 5KG7A 4K4GA 3V7KA 4F4WA 3SAHA 5D62A 3ED5A 4YR2A 1JAJA 2AJQA 3QU4A 1X9MA 5DDYA 4TUSA 5ALSA 3C5GA 3L4PA 4Z6CA 5AM5A 1WYGA 3EW9A 4RNNA 1Z00B 2YX8A 3RJGA 4DL3A 3A0HU 4UARA 4ZOHC 1X9WA 4DL5A 3BDPA 3H8SA 2Y1JA 4M6WB 4RQ4A 3Q8MA 2KEYA 4ATBB 5KT4A 3OGUA 5KFVA 4EBEA 5DG8A 5AKXA 3ER8C 2OYYA 3EZ5A 4O3SA 4YMNA 1NK5A 1N56A 4DWIA 2ZH9A 1Z19A 4X4PA 2ZHBA 7ICJA 2ISOA 4WC1A 2KG5A 1ZQXA 2G06A 3GV8B 2ID1A 3KBBA 1K1QA 2K4IA 3WK9A 2ZH3A 2ZUDA 4LZGA 4P0QB 7ICLA 2EAOA 3PSPA 3C23A 1ZXIA 4R8UA 9ICQA 1SXDA 2NRKA 1NK9A 4Q8FA 4X4NA 4WC2A 1LKYA 2ASLA 2UVVA 5C0YA 5ALEA 4R64A 4JWMA 5KFHA 4UAYA 5J2CA 3QU7A 3N28A 1IXRA 2PMZF 2NRXA 5D63A 1N60A 8ICPA 1PUZA 2LYHA 4C4SA 2YTUA 4USAA 8ICYA 1FO4A 3AUOA 4DL2A 5EWEA 3LQCB 5DG7A 3MR6A 2JXJA 2D3DA 3PMNA 4DL4A 3L5KA 2UVUA 1OXJA 4ED1A 2VJ4A 5AI0A 3Q8QB 2B56A 4WC4A 1UQVA 1T8EA 2QLTA 5KL1B 1S10A 1FIQA 4B9VA 4PPXA 1ZJNA 5AI8A 1Q46A 1S76D 3FC4A 1KFTA 4K8VA 1YZ7A 3KHLA 2W04A 3CNHA 5AICA 1YLQA 5IINA 1BPDA 2AXTU 1NZPA 3BQ7A 3RB6A 4KLDA 2GH1A 1JROA 1ZQZA 2N1RA 2Y1IA 4Y2RA 4WC7A 5T14A 4I2EA 4KLIA 1K5OA 3OTQA 5DKWA 2MRLA 5KFDA 5KFLA 1ZD5A 9ICHA 2FLPA 4J03A 4I2AA 4JLXA 2B0CA 4J9RA 1Q79A 1ZOLA 1ZQWA 4KITB 3QUCA 1NK6A 1UEVA 1WWUA 3OUYA 4BGDA 3K4GA 4B9TA 5J0XA 8ICLA 2J6TA 3SAFA 2BGWA 3N7PD 1DGJA 1QH9A 9ICBA 7ICRA 2VJ5A 4ECXA 3T79A 4CF3A 4PHEA 5HRGA 3H8MA 2OH2A 3I28A 4PJ0U 1T94A 2M2VA 2KIWA 4FZNA 4KX3A 5BPCA 5ALFA 2E8OA 4I28A 4JV1A 4F5RA 5CA7A 1J2MA 2HHXA 2ZHAA 2IUBA 4B9UA 4F71A 4WJ3B 2DPIA 8ICGA 2HSZA 2ZIWA 4PZNA 3AQFA 8ICSA 3EF2A 3JPQA 3CW2C 3NTUA 2LBOA 5ALJA 5HNKA 2RDJA 1TK0A 1R8AA 3WFSC 2HBJA 7ICNA 5EE1A 4RUAA 1PK1B 5ALWA 8ICWA 4NL9C 2JEIA 5KFXA 5KT2A 4IR9A 2FPMA 4I0UA 4Y2YA 4MHVA 2WFAA 1XSNA 3BQ0A 1F5SA 5KAFU 2V4QA 1D9FA 3JPRA 2KJ8A 2Q0ZX 4O3PA 3SR6A 2JV3A 1VDVA 1MC8A 3CRXA 4RPYA 3GZFA 2WAQF 2AGQA 5KAIU 5EE9A 4OJ6A 4TQRA 4NJ8A 3G6XA 2BE3A 1L8OA 5AK4A 1BPYA 5FP0A 3AL0B 1JX4A 2E8PA 3B0YA 5KNIA 4M9JA 4KMOB 5B3PA 2ESEA 4UASA 4AP9A 4DO9A 4QZ9A 5BOLA 3OWGA 5KFSA 4PGQA 4KLOA 9ICRA 4AYBC 1T7PA 3EPIA 2JEFA 3OHAA 4M04A 2JRZA 1A0PA 4ICAA 3PR5B 2XGQA 5B3QA 4CF4A 1XU4A 5CEHA 2KMDA 4JLZA 1KDHA 5DEDA 4J9KA 4E8FA 3I76A 5ALGA 1PZNA 3GIIA 8ICIA 4TURA 1UHUA 3QU5A 5ALUA 5CRXA 2G07A 2M2WA 4FS1A 2HMXA 2ZUBA 4BX9C 4DQQA 3ZD9A 4B6JA 2J6UA 1KW4A 4J9OA 4NXXA 3KKAA 8ICNA 1RXWA 4I2CA 4UB2A 3MR5A 3NYBA 2R8KA 3L9DA 5F9NA 3PNCA 4DQRA 3F53A 4KLQA 2ZJ5A 3M9OB 1T3QA 2H3QA 1V9PA 2HVIA 5AI4A 2YQEA 4ECYA 1TFWA 1D9DA 4K9BA 4QIWC 2OWOA 4PHDA 3D6JA 1JXLA 5KG1A 4ELVA 3KKAC 8ICZA 3N7RC 3ER9B 4I2FA 1XO0A 3E0FA 3KTQA 4UAUA 3OJUA 2AGPA 4C7ZA 9ICPA 5DBAA 2VIXA 5ALHA 3HKZF 2JEJA 3BQ1A 2PI5A 5HR7A 4R65A 2RLTA 3UMCA 4MFAA 7ICQA 4OAIZ 4LZDA 4FHPA 4UB1A 1SGGA 4M9LA 4I2BA 2QB1A 1S0OA 4IRKA 2PKEA 4DSIA 4OO1J 3M6KA 2ZUCA 2BR0A 2ZH6A 1RM6C 1OW5A 1SV4A 2HHVA 2F1IA 3WU2U 4JUZA 4M47A 2XC9A 2R8JA 1JIHA 2EANA 5IIIA 1XO1A 4EEYA 9ICMA 5CJ7A 4UW9A 1H38A 1L7OA 4RT2A 3THVA 4QZHA 4Y2PA 4R8UB 1DK3A 3AM9A 4J9PA 3AQMA 1Q78A 1ZQEA 1SV0A 4ECRA 2HCFA 3OVSA 1LKYB 4DFMA 5J0QA 4PHPA 1SKWA 1N61A 1FEZA 4R63A 4U7CA 1SWWA 4MEYA 2M9NA 8ICEA 2QB0A 2E8MA 4XQ8A 3H7IA 4GXKA 8ICQA 1MIYA 1WCLA 2F1JA 1SL2A 4TUQA 4UB8U 1S77D 4P0PA 3AQLA 2J6SA 2W3SA 4FE3A 4EEBA 1ZD3A 5L1JA 4ED7A 3FM9A 1VJ7A 2GAFD 3MDCA 1YZ6A 3PW0A 4QZGA 1ZQJA 5J2FA 3T5JA 2R8GA 4WBYA 2JH1A 4Y2XA 3F5EA 4NXVA 3PX0A 4KX5A 4LEWA 4K98A 3NUQA 4RNMA 2VA2A 3PV8A 4QNLA 2FJ6A 1B0XA 2KOBA 4BWJA 1UCVA 2ZJ8A 4YG2A 4F91B 2O1PA 1JMSA 2KNJA 3MBYA 4JB3A 1JI7A 3GQCA 5KG4A 2W9BA 1BGXT 4QW9A 1BVSA 3SQIA 3RJJA 3UXOA 2KVCA 3MGHA 4C4RA 2KZZA 3ETRA 4KTQA 3BZCA 2DR9A 1ZQBA 1J97A 5AK5A 3ORYA 5BOMA 2FMSA 1RYUA 4ELUA 3TACB 4DOAA 3MC1A 3QX7A 4LEYA 4CDGA 2O5AA 5KFAA 4KM5A 3F2BA 4Y2SA 3JCFA 4RWPA 5HRFA 3OUYB 5AKHA 5JU5A 5CHGA 1LVHA 2C28A 2BDPA 5E79U 1QSLA 3GFKB 3DV9A 4B9MA 4F2SA 5KFGA 2EAMA 1ZQLA 4HYKA 4YFKA 3KZXA 4F3OA 1R89A 1R8BA 5KFBA 4QWAA 1DGSA 3OSPA 2K89A 5HRLA 3IP4B 2NRVA 2MAXA 1WG8A 5KL8B 4QZEA 2XCPA 7ICOA 3RR8A 1Z3EB 3SD7A 2ZH2A 5KT5A 2R18A 3DEEA 1RQNA 2HN2A 3F5AA 4DFDA 2GO7A 4ECWA 2C22A 3HRDD 2WB1F 2BKEA 2VA3A 3V7LA 2ZIWB 5JUMA 2HN1A 3RF9A 2UVRA 2HDOA 2D8CA 8ICUA 2OXOA 3BS5B 4LEZA 1A6SA 2KTQA 5KFFA 3LK9A 1ZETA 5J2IA 4B9SA 4IC9A 4Z6FA 4Y2VA 3RFAA 4F93B 4NXZA 1DXSA 2HOIA 1C20A 5AM4A 1LV5A 1KTQA 3AN1A 1R8CA 4ED6A 2W55A 4PH5A 5HMLA 1BPXA 5AHXA 5KTQA 2ISPA 3ZDEA 2YMPA 5KFWA 1UPHA 5ALZA 5KT7A 4I2IA 2MU2A 5JRTA 4OJOA 4KLSA 2BCQA 5KG5A 4I29A 3C2LA 3RAXA 3ONNA 2W9CA 1L3VA 5HR9A 1ZQCA 3PW7A 2Y0SF 3QUBA 5L1KA 3FDSA 4YXMA 3RH4A 2DR7A 4DSJA 2BBJA 4WBZA 4E0DA 4OJPA 4UBCA 3NKUA 9ICJA 3RH6A 1NJYA 1N48A 3S6JA 2F76X 5EWGA 2CPRA 3BJYA 3UM9A 4WQLA 4ECQA 1JXEA 4BDPA 5HRDA 2H3IA 3RRHA 3GU3A 4O68A 3UPSA 2I1QA 3MR2A 4BUGA 1XSPA 5ALXA 1X6IA 2AGOA 3GIMA 3QUTA 4NY8A 5G5GA 5C5JA 3RRGA 7ICVA 4YD2A 3MABA 3H8JA 4DSLA 4X4TA 1PVQA 2K60A 4C7YA 5J0RA 4Q45A 1TFRA 4PGYA 3IN5A 3G6YA 4IRCA 7ICTA 4ED2A 4FO6A 2W9MA 4EX6A 4CF5A 1ZQOA 7ICIA 3NRWA 1NNLA 3C2MA 2NRZA 3IG8A 3NVYA 1ZQKA 3U26A 7ICKA 5B66U 3TAQA 2JZBA 5ALKA 4DF4A 3EWAA 2EQYA 1BPEA 3QEAZ 2K4HA 4I2DA 4F5OA 4K99A 4P2HA 1X40A 4F8RA 2M2UA 3NVOA 2BZFA 5HMMA 4UQGA 5DG9A 3JPPA 8ICMA 4DLGA 5DQHA 4NV0A 4DLEA 2DVIA 3BS7A 2ZJAA 5J2AA 1U4BA 4GC6A 1NK8A 4E80A 2ZG6A 5AM0A 1ZQNA 3OV7A 3OVAA 2F1HA 2PFPA 1NK7A 4F5PA 2M2TA 5ALVA 4RQ0A 2BQUA 7ICUA 2K8BB 2QARB 3HILA 3GDXA 4EP7A 3QUQA 2BCVA 1TAQA 1JN3A 2W03A 4QWCA 2W9AA 5ALIA 5AK3A 1JALA 3Q8LA 5F3XB 1COOA 2LYBA 2HI0A 1ZQGA 1CUKA 1ZJMA 3BQ2A 2FPLA 3V72A 4NL9A 4C8MA 1ZQFA 1WWVA 4K4IA 5HRKA 1HEKA 4JWNA 5J0OA 5IIJA 4I27A 9ICLA 3KFUF 3R9KA 1KKXA 2XY6A 2KJ9A 5AM3A 1U49A 3WKDA 3EUB2 5HHIA 4U6PA 2DKZA 4EZ6A 4QZ8A 1BNOA 4J9SA 3SAGA 5CWRA 1X9XA 2QB0B 2GA9D 4X0AA 2PMZC 2AQ4A 1M6YA 3LYSA 9ICAA 9ICGA 4X4QA 5KG3A 3WK4A 2ZH4A 2OCEA 2CRXA 4FS2A 4F92B 3HJEA 3ALRA 3RJFA 3HPOA 3SMVA 5ALDA 1SWVA 4NLZA 2KD1A 2F8LA 4YMOA 2O6KA 1ZQHA 4FO1A 4X4VA 2ZIXA 2G5IB 4P0PB 1AQ6A 3PX6A 4FBUA 3RBEA 9ICFA 5G5HA 4RQ1A 4K9AA 4GC7A 1O08A 2PFNA 3IV6A 2DBYA 5J2BA 4UBBA 2LM1A 3PW5A 3A0BU 4QIWF 2JHDA 1DRGA 2ZIVA 2G5HB 1PK3A 5DLFA 4M9NA 3M6ZA 4LT6A 1QCKA 4O6AA 2ES6A 2IOHA 5HRHA 3HX0A 4NM1A 1URJA 3UQ2A 3M7DA 4KLLA 3TQ1A 4O67A 5AKKA 5TISU 9ICOA 2V4RA 3BQTA 4NKUA 3OSNA 1EXNA 4X4UA 4F4KA 4IL6U 3Q8RB 8ICBA 4KN7A 3SI8A 2K4PA 4FZMA 2P35A 2W9BB 1HUOA 4GLXA 2EH9A 1ZQ1C 4EEDA 1QQ7A 2HOQA 2G0AA 3PW2A 4O3NA 3EYZA 4EBDA 3RAQA 2BPCA 3KOOA 3JPNA 8ICKA 2DUYA 4ECSA 3PZPA 3UQ0A 3NWIA 5KFJA 5B5EU 1N5WA 2FDRA 2IOFA 2DF4B 4FHVA 3WKBA 4BWMA 1TVAA 5L1IA 3QNMA 9ICXA 2QKQA 3C18A 4O5KA 3H38A 1P7DA 4XRHA 1RYSA 4KLHA 2KK0A 4YQWA 4G3IA 9ICVA 1JRPA 4CNQA 3QEBZ 3J81j 5J0WA 2NYVA 3GV7B 2JMGA 5HR6A 5AK6A 3H4DA 3WKEA 3ISDA 1TKDA 3PVXA 4KLTA 2KE7A 1NJWA 4QZFA 4KLEA 4QZBA 2HHTA 2IHOA 3ERCC 4RQNA 4GXJA 3H39A 2ZH7A 1ZQMA 4JMUA 3OPXA 4C8NA 4QZIA 3K7DA 4X5VA 2BCUA 5IILA 1S97A 3MFIA 3HWTA 4EBKA 3H0LB 3WFQE 2KHVA 1X42A 1HIWA 2BBHA 2BCRA 1COKA 1RG6A 3GIJA 1Z1BA 5J0SA 5AKJA 4DCCA 2ZTCA 4G9BA 2JH7A 4YD1A 2IBKA 2K8CB 2WAQC 4UAWA 2KIVA 4IQVA 2KZ3A 5HRIA 1QTMA 2H5XA 4RWQA 4ELTA 2OEHA 1C7YA 4LJXA 3G6VA 1TV9A 2HOFA 1KEJA 4EELA 4PL1A 3ZDBA 9ICCA 1X9SA 4XJEA 2BPGA 4RQ5A 2YB4A 1TAMA 1ZRNA 3M9MB 4F4YA 3MGIA 2C2RA 1QLNA 2W8LA 5GTIU 5J2JA 1D8YA 9ICIA 4X4RA 5KG6A 1KFDA 1QQ5A 1X6JA 4C8OA 2DR8A 7ICMA 4J9MA 3GV5B 3GIKA 5EE0A 5DB6A 3TARA 4UB3A 4MFFA 4QWEA 1SKRA 4J9LA 3TFRA 4K97A 5HC9A 5F9LA 3MFHA 3OVBA 1NOMA 2NRWA 1XC9A 2KSOA 5ALOA 1V97A 2W3RA 3N97B 4QWDA 2DFLA 5KFNA 1JQRA 3ISBA 3K1ZA 2CXYA 3QZ8A 4Z6EA 2AU0A 5AM1A 2EWRA 2IOFK 4EBCA 3UMGA 1SIJA 1UT5A 2GWSA 3WFOA 3I1YA 3TADA 4YN4A 3KHGA 3ZD8A 5ALNA 4BJQA 1ZQYA 4OAHA 5KFTA 1PVRA 4CGZA 3NASA 1PVPA 4EENA 5J2KA 4NLKA 4GIBA 3AU2A 3AMZA 4UD5A 5KG0A 5KFUA 2XIDA 1MN8A 4PZOA 3H37A 3PSFA 2F44A 2W54A 3H0RB 4B9LA 2H3VA 1OUQA 5K4LA 5HHHA 2ODGA 4OD0A 4DSKA 4FHXA 2JZBB 2JGAA 3TADC 4DFJA 2WF7A 4ECTA 1FA0A 4F72A 4JK1A 1N2XA 3Q8PB 3IM1A 3HKZC 9ICSA 2W7PA 1N63A 3ETLA 4TUPA 2A19A 3KD3A 1B43A 4I2HA 2ZIUA 2BCSA 3NS1A 4E7XA 4PGXA 5AKIA 5J2GA 5ALRA 5KFKA 3WKCA 2YMQA 2VA8A 5AIAA 3M9NB 2E1FA 2XICA 1NKCA 2RHFA 3SV3A 3RR7A 5DBBA 2BQRA 3PX4A 1LB2B 3HT3A 3PSIA 2HVHA 1V38A 1KBUA 4UB6U 1B4FA 2A1JA 1L8LA 4UAVA 5AI9A 3ZDCA 2PBEA 3C29A 5CP2A 4S3NA 4US9A 4C0ZA 4DL6A 3HIYA 4AT7A 2EZXA 3IRUA 4RQ6A 3ZDAA 1KFSA 3PMLA 1L6NA 3V6KA 1KNYA 2LMRA 2YN4A 2WHEA 4M5DA 3HJ1A 3TFSA 2Z7JA 2MUTA 1SZPA 3RBDA 2C2EA 5F2VO 2VANA 5KG2A 1IM4A 4YP3A 8ICJA 2B21A 3RJIA 1ZQUA 4P4OA 5DB8A 4YR0A 2FI1A 4O9MA 2GLEA 4YXJA 3PY8A 3B9JA 4RT3A 8ICOA 3T5LA 4XA5A 5D61A 2HBMA 1OU5A 4RQ7A 2ZTDA 4M9GA 2ZIXB 2LYAA 3M1YA 2BHNA 2HHPA 3JYYA 5KFRA 1V85A 2H3FA 4FHWA 3AQKA 1MA7A 4X4OA 1IG6A 5CR0A 2ZIVB 4F5NA 2DRBA 1BNPA 4EX7A 2KV2A 1ED1A 2OHFA 2Y9TA 2XY5A 1ZQTA 2AHOB 3EPGA 4IR1A 2ALZA 2NV3A 4IQTA 3FYHA 3NVZA 2XY7A 4Y2QA 1L7PA 2YB1A 5ALMA 4PL2A 3K75D 2KVSA 5J0PA 2ZH8A 1XWLA 4AT8A 4DS5A 9ICKA 5DDMA 1L3SA 4N7RA 2ZXIA 3NGDA 4WCWA 3N4MB 4ZH4A 4CRXA 3N7SC 3LWLA 4FH5A 5KFYA 2ZH5A 2PFOA 3Q8KA 4KLGA 3ISCA 4OAGA 2OM6A 3LVWA 4C80A 3C66A 4NXWA 1Z1VA 1NJXA 7ICHA 1S5LU 4WC6A 2XI9A 2A3VA 1N62A 4NLNA 1Q8KA 4FZLA 2PFQA 1ZQSA 5ALQA 4IRDA 3C21A 1RDFA 1D8BA 5IIOA 5DQGA 1BPZA 2ASJA 1WUDA 3AU6A 2P6RA 4C8LA 1ZQIA 4IQUA 4O5CA 4UATA 4EGWA 2MA1A 2XGPA 3RJKA 1NK0A 3IG5A 4HX0A 3SEIA 5KT3A 2YY6A 8ICXA 5AKGA 1ZQRA 2WB1C 1GPJA 4F4XA 5AKYA 2R8HA 3C28A 5AM2A 4MF2A 1KSPA 2I5HA 4C4TA 3RJEA 1B22A 3D2QA 1RQLA 2EZYA 1VJ5A 2IHMA 1QQ6A 3NVWA 3UXPA 4KLMA 3WFPA 2G08A 3H0MB 4FHYA 4I2JA 2F2AB 4KMUA 4QZCA 2Y9UA 4LVSA 2DR5A 1ZQQA 3C1ZA 3T5HA 2FPKA 1XSLA 9ICNA 2K8AA 3O0FA 4ECZA 3VC8A 2YMLA 4DOCA 4YVZA 4NXTA 3L3FX 4MFCA 5CFTA 4DF8A 3PO4A 2EAPA 2W43A 9ICUA 1UA0A 4OJLA 4DQIA 4NLBA 1A77A 2D6FC 2P66A 2MSNA 3RH5A 1MQ2A 4UD4A 1NI3A 1WOTA 2I9GA 4DQSA 5KFCA 9ICWA 5DECA 3C2KA 1D8LA 3JZ0A 5GTHU 2Y0SC 5KT6A 5CFUA 4AYBF 2YMMA 7ICSA 4AT9A 2ASDA 2E1EA 3ICXA 2RDIA 5AKEA 4RQ2A 4DSEA 4BXOA 4QZAA 3TAPA 5JTGA 4Y2JA 3K1RB 1NJZA 5HRBA 3QXGA 2HBLA 4WC3A 3RTVA 4KN4A 5HP4A 1TK8A 2B51A 2LI6A 2NRTA 2W8KA 4OJ5A 2F77X 2PI4A 1QSSA 3AEVA 1ZD4A 4ECVA 4ED8A 2EDUA 3QZ7A 4MKPA 4LEVA 2KSOB 2WF6A 4JV2A 1QSYA 5KFIA 4M0AA 2H3ZA 2DKXA 3D2SA 3C1YA 2W7OA 1L7MA 4R66A 4F4ZA 1HJPA 1UA1A 2E8NA 5KFZA 4NM2A 3T3FA 1TFYA 5J2EA 1TE2A 3JPTA 5J2HA 2HW3A 8ICHA 1CRXA 3WK5A 2IMWP 1X2IA 1YT3A 4DSFA 4YCXA 1U48A 4YR3A 3FAHA 3BS5A 2M0NA 1U9LA 1SXEA 1S0VA 3Q8SB 2FMPA 5AIBA 5CB1A 1Z00A 1IV8A 5DB9A 3MR3A 1ZYQA 5IIMA 3IHQB 4K96A 4WC5A 2B4VA 4DOBA 4M6WA 2K4EA 4ATBA 4A8EA 2NO5A 3LWMA
chains in the Genus database with same CATH topology
3MR6A 3M9MB 1R8BA 4F4YA 5KFBA 3MGIA 4QWAA 2C2RA 1NO5A 1QLNA 1CEZA 1DGSA 5EWFA 3PMNA 4DL4A 3OSPA 2UVUA 5HRLA 2W8LA 4JV0A 5D46A 2NRVA 2MAXA 7ICGA 4ED1A 3AQNA 5J2JA 3Q8QB 4QZEA 1D8YA 9ICIA 4X4RA 5KG6A 2XCPA 7ICOA 3RR8A 1KFDA 1Z3EB 3C5FA 4C8OA 4WC4A 1T8EA 2DR8A 7ICMA 2ZH2A 5KT5A 1S10A 4J9MA 2Q66A 4EYHB 3GV5B 4B9VA 4PPXA 8ICRA 2FLNA 3GIKA 4ECWA 4O3RA 5DB6A 3TARA 2C22A 1ZJNA 4UB3A 4MFFA 2VA3A 1K1SA 2BKEA 4QWEA 1SKRA 3OVAA 4J9LA 3TFRA 1S76D 5HC9A 5F9LA 3MFHA 1KFTA 1NOMA 3OVBA 3V7LA 2NRWA 1XC9A 3KHLA 5JUMA 4ECUA 2UVRA 2R8IA 1F5AA 1YLQA 5IINA 1L3TA 1BPDA 1NZPA 1RXVA 8ICUA 3N97B 4O5EA 2FMQA 1UETA 3RB6A 4B9NA 4DFKA 4QWDA 2DFLA 5KFNA 1JQRA 4KLDA 3ISBA 2KTQA 1ZQZA 5KFFA 3LK9A 4QW8A 2Y1IA 4RPZA 5J2IA 3QZ8A 1ZETA 4B9SA 4Z6FA 3GILA 4Z6EA 2AU0A 7ICPA 4WC7A 4DEZA 4EBCA 4F93B 2XCAA 1A76A 1TK5A 4KLIA 4I2EA 4NXZA 5DKWA 3SYZA 4IQWA 4J9NA 5KFDA 3SZ2A 1UT5A 5KFLA 3H4BA 2GWSA 9ICHA 3WFOA 1RPLA 2A1JB 2FLPA 1ZQVA 4YN4A 3KHGA 4I2AA 3ZD8A 1LV5A 1KTQA 1UT8A 1R8CA 4ED6A 4E8FA 4J9RA 4PH5A 4KITB 1ZQWA 5HMLA 1BPXA 1Q79A 5KTQA 1NK6A 1UEVA 3OJSA 1ZQYA 2ISPA 1V4AA 5KFTA 3OUYA 3ZDEA 4BGDA 5J2KA 4P4MA 5KFWA 3K4GA 4RQ8A 3M8RA 5KT7A 4B9TA 4NLKA 5J0TA 5J0XA 5DG7A 1XS9D 4I2IA 5TZVA 2WTFA 2J6TA 3AU2A 1NKEA 8ICLA 4UD5A 2BGWA 5KG0A 1ZQAA 4KLSA 5KFUA 5L1LA 2BCQA 9ICBA 5KG5A 2V9WA 7ICRA 4I2GA 4I29A 5DQIA 2PXIA 4ECXA 3H37A 5DGBA 3C2LA 2KZMA 3RAXA 4PHEA 1R89A 4F50A 4B9LA 3E2EA 5HRGA 4RWNA 1T3NA 2W9CA 2MUTB 5J29A 2HHUA 1L3VA 5HHHA 5HR9A 1ZQCA 4DSKA 2M2VA 4FHXA 3PW7A 2JZBB 2BQ3A 4DFJA 3T5KA 5BPCA 4ECTA 1FA0A 4JK1A 3Q8PB 3IM1A 5L1KA 3FDSA 3PR4A 3TAQA 4I28A 4JV1A 4F5RA 5CA7A 4YXMA 3RH4A 9ICSA 1KLNA 2HHXA 2ZHAA 2RFFA 2DR7A 4B9UA 4DSJA 7ICFA 4O0IA 4WBZA 2DPJA 4E0DA 1PX5A 3UPQA 4UBCA 3ETLA 4TUPA 3TI0A 2DPIA 8ICGA 1B43A 9ICJA 4I2HA 3RH6A 1NJYA 1N48A 2BCSA 8ICSA 4E7XA 4PGXA 5J2GA 4DFPA 5EWGA 5KFKA 3JPQA 1U47A 2HHWA 2VA8A 3NTUA 5HNKA 5J0UA 2RDJA 3BJYA 3RB3A 3M9NB 1TK0A 4ECQA 7ICNA 1R8AA 3WFSC 4RUAA 1JXEA 4J9QA 4IG8A 4Q44A 4BDPA 5HRDA 5J2DA 3RRHA 1NKCA 2FLLA 3SV3A 8ICWA 3LDAA 3RR7A 1ZQDA 3WFRE 5DBBA 3SV4A 4C8KA 4ED0A 2JEIA 5KFXA 5KT2A 3UPSA 4IR9A 2I1QA 3MR2A 1S0MA 2ZH1A 2FPMA 1XSPA 4QZDA 2AGOA 4EZ9A 3GIMA 2BQRA 3HW8A 2HHQA 3PX4A 1XSNA 4NY8A 1LB2B 3HT3A 2HVHA 3BQ0A 4F2RA 5C5JA 3RRGA 4GXIA 7ICVA 4YD2A 2A1JA 2V4QA 3MABA 3H8JA 4DSLA 4X4TA 1D9FA 3ZDCA 2W9CB 2PBEA 5D4BA 5J0RA 3JPRA 5CP2A 4F5QA 4S3NA 4Q45A 1TFRA 4PGYA 2Q0ZX 3G6YA 4IRCA 1MSWD 4O3PA 7ICTA 4DL6A 4AT8B 4ED2A 4RUCA 2AQ0A 4P4PA 4TQSA 4FO6A 2BPGA 1MC8A 2KP7A 3HIYA 4X4OA 4RPYA 1T4GA 2W9MA 9ICTA 4AT7A 2AGQA 1ZQOA 4RQ6A 3ZDAA 7ICIA 1KFSA 3PMLA 4PHAA 4QWBA 3C2MA 4TQRA 3V6KA 1KNYA 2NRZA 5J0YA 3PO5A 1ZQKA 3G6XA 2BE3A 1S9FA 4M5DA 1BPYA 3HJ1A 4ED3A 4UB4A 1JX4A 3TFSA 2C2EA 2MUTA 1SZPA 4RZRA 5DB7A 3B0YA 1DOQA 5KFPA 3RBDA 4K4HA 4M9JA 4KLJA 5F2VO 2VANA 5L9XA 1IM4A 2JZBA 5KG2A 2B21A 5KFEA 4YP3A 3EWAA 4DF4A 3RJIA 5HREA 4RWOA 1ZQUA 4P4OA 5DB8A 4YR0A 1BPEA 4UAZA 3QEAZ 4X4SA 4O9MA 4I2DA 5DLGA 4O3QA 4DO9A 4FH3A 4F5OA 4YXJA 3PY8A 4P2HA 3HP6A 4F8RA 4QZ9A 5BOLA 4RT3A 8ICTA 8ICOA 5KFSA 3KHRA 2M2UA 5HRBA 3T5LA 4XA5A 4PGQA 2HHSA 4KLOA 5HMMA 9ICRA 4UQGA 5DG9A 4RU9A 3JPPA 4RQ7A 1T7PA 8ICMA 1OU5A 1VFGA 2ZTDA 3JPOA 3EPIA 2JEFA 4DLGA 3QE9Y 1SL1A 4M9GA 3OHAA 5DQHA 4M04A 2BHNA 4DLEA 2DVIA 2HHPA 3JYYA 2ZJAA 5KFRA 3PR5B 2XGQA 5J2AA 1XU4A 1U4BA 4CCHA 3PW4A 4GC6A 4KLFA 4FHWA 1NK8A 4E80A 3AQKA 1KRPA 5DGAA 1KDHA 1ZQNA 5DEDA 3B0XA 4J9KA 2F1HA 5CR0A 1SL0A 2PFPA 2IA6A 1NK7A 1MIWA 1PZNA 3GIIA 8ICIA 4F5PA 2M2TA 4RQ0A 4F5NA 2DRBA 1BNPA 2BQUA 7ICUA 4TURA 3V6JA 2DRAA 2ZTEA 3GDXA 2XY5A 1ZQTA 4EP7A 2BCVA 1U45A 3EPGA 1TAQA 4IR1A 9ICQA 2M2WA 2ALZA 4IQTA 4FS1A 1JN3A 3FYHA 2ZUBA 4QWCA 2W9AA 3KHHA 2XY7A 8ICCA 1RYRA 3UXNA 4DQQA 2C2DA 3Q8LA 3ZD9A 2P6UA 1COOA 2J6UA 4O3OA 4J9OA 1NKBA 8ICNA 1ZQGA 1CUKA 1RXWA 1ZJMA 3K75D 4RQ3A 3BQ2A 4I2CA 5J0PA 4EYIB 4UB2A 2FPLA 3V72A 3TANA 3MR5A 2ZH8A 1XWLA 4YMMA 1BPBA 4RNOA 2R8KA 3L9DA 3NYBA 4AT8A 4DL7A 5F9NA 4C8MA 3PNCA 4DQRA 1ZQFA 2ATLA 4K4IA 4KLQA 3M8SA 5HRKA 1S0NA 2ZJ5A 4DS5A 4JWNA 4M2YA 9ICKA 4EBJA 5J0OA 1NK4A 5IIJA 4I27A 9ICLA 3M9OB 5DDMA 1L3SA 5D49A 1V9PA 3H8WA 2XY6A 4M9HA 3NGDA 2HVIA 1U49A 4WCWA 8ICFA 4ECYA 3RB0A 3H3AA 3N4MB 4ZH4A 3H40A 1TFWA 1D9DA 5HHIA 4EZ6A 4Q8EA 3LWLA 4QZ8A 4FH5A 4MF8A 5KFYA 2ZH5A 5EOZA 2PFOA 3Q8KA 2KFNA 2OWOA 1BNOA 4KLGA 4PHDA 4J9SA 3ISCA 3RB4A 1JXLA 3C66A 5KG1A 4ELVA 5CWRA 8ICZA 1NJXA 4X0AA 4I2FA 7ICHA 3HJ4A 2AQ4A 4WC6A 1MQ3A 5IIKA 4Q43A 3KTQA 3OJUA 9ICAA 4NKTA 9ICGA 4X4QA 5KG3A 2AGPA 4NLNA 2ZH4A 9ICPA 5DBAA 4FS2A 4F92B 2PFQA 3RJFA 3HPOA 4X4VA 2JEJA 1ZQSA 1ZQHA 4YMOA 4NLZA 1L3UA 4IRDA 3BQ1A 3C21A 2PI5A 5KFOA 4R65A 4XQ7A 1DK2A 9ICEA 8ICAA 3PX6A 2UVWA 5IIOA 4MFAA 4FBUA 5DQGA 1SKSA 1BPZA 7ICQA 2ASJA 3RBEA 4FBTA 9ICFA 4RQ1A 4LZDA 4UB5A 2KN7A 4GC7A 4UB1A 3AU6A 2P6RA 4FHPA 4C8LA 4M9LA 4AT9B 2PFNA 5J2BA 8ICVA 4UBBA 1ZQIA 3PW5A 4IQUA 4O5CA 4BXOB 4I2BA 3AUOA 2XGPA 1S0OA 4DSIA 3RJKA 1NK0A 5DLFA 4IRKA 5KT3A 4M9NA 8ICXA 2ZUCA 2BR0A 3JPSA 2ZH6A 4LT6A 1AROP 1ZQRA 4F4XA 5HRHA 3HX0A 2R8HA 4NM1A 4DQPA 7ICEA 4MF2A 2HHVA 4XUSA 2F1IA 3UQ2A 4KLLA 3OV7A 4JUZA 3V6HA 3TQ1A 1KSPA 2XC9A 2R8JA 4M47A 1UEUA 4X4UA 1JIHA 3RJEA 4KLUA 9ICOA 2KFZA 5IIIA 5KFMA 1XO1A 4EEYA 9ICMA 1B22A 4X0BA 1L5UA 5CJ7A 2V4RA 4WC0A 3BQTA 2IHMA 4NKUA 3OSNA 3UXPA 4KLMA 1EXNA 3OHBA 3MDAA 2BPFA 4F4KA 3Q8RB 1H38A 3ZDDA 3RJHA 4RT2A 2XO7A 2JEGA 4KN7A 4QZHA 3THVA 3SI8A 2IHNA 8ICBA 3WFPA 4R8UB 2W9BB 1HUOA 4GLXA 1DK3A 4FHYA 4I2JA 4KMUA 4J9PA 3AQMA 1Q78A 4QZCA 1HUZA 4RPXA 1ZQEA 4ECRA 4MEXA 3OVSA 4LVSA 2DR5A 3PW2A 4O3NA 3EYZA 3C1ZA 4EBDA 3RAQA 1WCNA 1ZQQA 2BPCA 4Z6DA 3V7JA 3T5HA 4DFMA 3JPNA 2FPKA 1XSLA 5J0QA 5DBCA 8ICKA 4NLGA 4PHPA 1SKWA 9ICNA 4ECZA 1ZQPA 5KFQA 1RZTA 1Y88A 4R63A 4ECSA 3UQ0A 4DS4A 5KG7A 4DOCA 4MEYA 4K4GA 4YVZA 2M9NA 3V7KA 4F4WA 8ICEA 4MFCA 5KFJA 4DF8A 4XQ8A 4YR2A 3PO4A 1JAJA 2AJQA 7ICKA 1X9MA 9ICUA 4AT7B 3H7IA 5DDYA 4TUSA 1UA0A 4DQIA 4GXKA 8ICQA 3C5GA 1A77A 1MIYA 4FHVA 4Z6CA 4BWMA 1WCLA 2F1JA 1TVAA 5L1IA 3RH5A 2P66A 9ICXA 4RNNA 3EW9A 1SL2A 1Z00B 4TUQA 1MQ2A 3RJGA 3C18A 4UD4A 1WOTA 4O5KA 4DL3A 2I9GA 1S77D 1MIVA 3H38A 3AQLA 4XRHA 4DQSA 4DL5A 1X9WA 5KFCA 1RYSA 3BDPA 4KLHA 4YQWA 3H8SA 2J6SA 9ICWA 5DECA 3C2KA 4M6WB 4RQ4A 2Y1JA 4G3IA 1D8LA 3JZ0A 5KT6A 3Q8MA 4ATBB 9ICVA 7ICSA 4AT9A 5L1JA 3QEBZ 5J0WA 4ED7A 2ASDA 3GV7B 5KT4A 3OGUA 1VJ7A 2RDIA 5KFVA 4EBEA 5DG8A 4RQ2A 3MDCA 3H4DA 4DSEA 4BXOA 4QZAA 3PW0A 3EZ5A 3TAPA 4O3SA 4QZGA 1ZQJA 3ISDA 4YMNA 1NK5A 3PVXA 1TKDA 4KLTA 1N56A 1NJZA 5J2FA 3T5JA 1NJWA 2R8GA 4QZFA 4DWIA 4KLEA 4QZBA 2HHTA 4WBYA 2ZH9A 4WC3A 4X4PA 3RTVA 2ZHBA 3PX0A 4KN4A 7ICJA 5HP4A 1TK8A 2ISOA 4RNMA 2VA2A 4WC1A 3PV8A 1ZQXA 2NRTA 2W8KA 4GXJA 3H39A 2ZH7A 2PI4A 3GV8B 1QSSA 2ID1A 1ZQMA 1K1QA 4BWJA 8ICJA 4ECVA 2ZJ8A 4YG2A 4ED8A 2ZH3A 3QZ7A 2ZUDA 4LZGA 4F91B 2O1PA 7ICLA 1JMSA 4C8NA 3MBYA 4QZIA 4X5VA 2BCUA 4JV2A 3GQCA 3C23A 4R8UA 1QSYA 5KFIA 5KG4A 2W9BA 5IILA 4M0AA 1BGXT 4QW9A 3MFIA 1BVSA 3HWTA 1S97A 4EBKA 3LQCB 3WFQE 3RJJA 3C1YA 3UXOA 4R66A 2NRKA 1NK9A 3MGHA 4F4ZA 4Q8FA 2BCRA 2KZZA 1HJPA 1UA1A 4KTQA 4X4NA 2DR9A 1ZQBA 4WC2A 5KFZA 2ASLA 4NM2A 3T3FA 2UVVA 1TFYA 3ORYA 5BOMA 3GIJA 5J2EA 2FMSA 2HW3A 3JPTA 5J0SA 5J2HA 4ELUA 8ICHA 4R64A 2ZTCA 4YD1A 2IBKA 2IMWP 1X2IA 4JWMA 4DOAA 5KFHA 4DSFA 4UAWA 4YCXA 1U48A 4UAYA 5KFAA 2O5AA 4YR3A 4IQVA 2KZ3A 5HRIA 4RWPA 1QTMA 1U9LA 5HRFA 3OUYB 5J2CA 1S0VA 3Q8SB 2H5XA 5CHGA 2FMPA 5CB1A 4RWQA 4ELTA 1IXRA 1Z00A 5DB9A 3MR3A 2C28A 2BDPA 1C7YA 1ZYQA 1QSLA 3GFKB 5IIMA 2NRXA 3IHQB 3G6VA 1TV9A 1TAUA 8ICPA 4WC5A 4DOBA 4B9MA 2LYHA 4M6WA 1KEJA 4F2SA 8ICYA 4ATBA 5KFGA 1ZQLA 3ZDBA 4HYKA 4YFKA 1X9SA 3LWMA 4F3OA 9ICCA 4DL2A 5EWEA 4RQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MR6 A;  3M9M B;  1R8B A;  4F4Y A;  5KFB A;  3MGI A;  4QWA A;  2C2R A;  1NO5 A;  1QLN A;  1CEZ A;  1DGS A;  5EWF A;  3PMN A;  4DL4 A;  3OSP A;  2UVU A;  5HRL A;  2W8L A;  4JV0 A;  5D46 A;  2NRV A;  2MAX A;  7ICG A;  4ED1 A;  3AQN A;  5J2J A;  3Q8Q B;  4QZE A;  1D8Y A;  9ICI A;  4X4R A;  5KG6 A;  2XCP A;  7ICO A;  3RR8 A;  1KFD A;  1Z3E B;  3C5F A;  4C8O A;  4WC4 A;  1T8E A;  2DR8 A;  7ICM A;  2ZH2 A;  5KT5 A;  1S10 A;  4J9M A;  2Q66 A;  4EYH B;  3GV5 B;  4B9V A;  4PPX A;  8ICR A;  2FLN A;  3GIK A;  4ECW A;  4O3R A;  5DB6 A;  3TAR A;  2C22 A;  1ZJN A;  4UB3 A;  4MFF A;  2VA3 A;  1K1S A;  2BKE A;  4QWE A;  1SKR A;  3OVA A;  4J9L A;  3TFR A;  1S76 D;  5HC9 A;  5F9L A;  3MFH A;  1KFT A;  1NOM A;  3OVB A;  3V7L A;  2NRW A;  1XC9 A;  3KHL A;  5JUM A;  4ECU A;  2UVR A;  2R8I A;  1F5A A;  1YLQ A;  5IIN A;  1L3T A;  1BPD A;  1NZP A;  1RXV A;  8ICU A;  3N97 B;  4O5E A;  2FMQ A;  1UET A;  3RB6 A;  4B9N A;  4DFK A;  4QWD A;  2DFL A;  5KFN A;  1JQR A;  4KLD A;  3ISB A;  2KTQ A;  1ZQZ A;  5KFF A;  3LK9 A;  4QW8 A;  2Y1I A;  4RPZ A;  5J2I A;  3QZ8 A;  1ZET A;  4B9S A;  4Z6F A;  3GIL A;  4Z6E A;  2AU0 A;  7ICP A;  4WC7 A;  4DEZ A;  4EBC A;  4F93 B;  2XCA A;  1A76 A;  1TK5 A;  4KLI A;  4I2E A;  4NXZ A;  5DKW A;  3SYZ A;  4IQW A;  4J9N A;  5KFD A;  3SZ2 A;  1UT5 A;  5KFL A;  3H4B A;  2GWS A;  9ICH A;  3WFO A;  1RPL A;  2A1J B;  2FLP A;  1ZQV A;  4YN4 A;  3KHG A;  4I2A A;  3ZD8 A;  1LV5 A;  1KTQ A;  1UT8 A;  1R8C A;  4ED6 A;  4E8F A;  4J9R A;  4PH5 A;  4KIT B;  1ZQW A;  5HML A;  1BPX A;  1Q79 A;  5KTQ A;  1NK6 A;  1UEV A;  3OJS A;  1ZQY A;  2ISP A;  1V4A A;  5KFT A;  3OUY A;  3ZDE A;  4BGD A;  5J2K A;  4P4M A;  5KFW A;  3K4G A;  4RQ8 A;  3M8R A;  5KT7 A;  4B9T A;  4NLK A;  5J0T A;  5J0X A;  5DG7 A;  1XS9 D;  4I2I A;  5TZV A;  2WTF A;  2J6T A;  3AU2 A;  1NKE A;  8ICL A;  4UD5 A;  2BGW A;  5KG0 A;  1ZQA A;  4KLS A;  5KFU A;  5L1L A;  2BCQ A;  9ICB A;  5KG5 A;  2V9W A;  7ICR A;  4I2G A;  4I29 A;  5DQI A;  2PXI A;  4ECX A;  3H37 A;  5DGB A;  3C2L A;  2KZM A;  3RAX A;  4PHE A;  1R89 A;  4F50 A;  4B9L A;  3E2E A;  5HRG A;  4RWN A;  1T3N A;  2W9C A;  2MUT B;  5J29 A;  2HHU A;  1L3V A;  5HHH A;  5HR9 A;  1ZQC A;  4DSK A;  2M2V A;  4FHX A;  3PW7 A;  2JZB B;  2BQ3 A;  4DFJ A;  3T5K A;  5BPC A;  4ECT A;  1FA0 A;  4JK1 A;  3Q8P B;  3IM1 A;  5L1K A;  3FDS A;  3PR4 A;  3TAQ A;  4I28 A;  4JV1 A;  4F5R A;  5CA7 A;  4YXM A;  3RH4 A;  9ICS A;  1KLN A;  2HHX A;  2ZHA A;  2RFF A;  2DR7 A;  4B9U A;  4DSJ A;  7ICF A;  4O0I A;  4WBZ A;  2DPJ A;  4E0D A;  1PX5 A;  3UPQ A;  4UBC A;  3ETL A;  4TUP A;  3TI0 A;  2DPI A;  8ICG A;  1B43 A;  9ICJ A;  4I2H A;  3RH6 A;  1NJY A;  1N48 A;  2BCS A;  8ICS A;  4E7X A;  4PGX A;  5J2G A;  4DFP A;  5EWG A;  5KFK A;  3JPQ A;  1U47 A;  2HHW A;  2VA8 A;  3NTU A;  5HNK A;  5J0U A;  2RDJ A;  3BJY A;  3RB3 A;  3M9N B;  1TK0 A;  4ECQ A;  7ICN A;  1R8A A;  3WFS C;  4RUA A;  1JXE A;  4J9Q A;  4IG8 A;  4Q44 A;  4BDP A;  5HRD A;  5J2D A;  3RRH A;  1NKC A;  2FLL A;  3SV3 A;  8ICW A;  3LDA A;  3RR7 A;  1ZQD A;  3WFR E;  5DBB A;  3SV4 A;  4C8K A;  4ED0 A;  2JEI A;  5KFX A;  5KT2 A;  3UPS A;  4IR9 A;  2I1Q A;  3MR2 A;  1S0M A;  2ZH1 A;  2FPM A;  1XSP A;  4QZD A;  2AGO A;  4EZ9 A;  3GIM A;  2BQR A;  3HW8 A;  2HHQ A;  3PX4 A;  1XSN A;  4NY8 A;  1LB2 B;  3HT3 A;  2HVH A;  3BQ0 A;  4F2R A;  5C5J A;  3RRG A;  4GXI A;  7ICV A;  4YD2 A;  2A1J A;  2V4Q A;  3MAB A;  3H8J A;  4DSL A;  4X4T A;  1D9F A;  3ZDC A;  2W9C B;  2PBE A;  5D4B A;  5J0R A;  3JPR A;  5CP2 A;  4F5Q A;  4S3N A;  4Q45 A;  1TFR A;  4PGY A;  2Q0Z X;  3G6Y A;  4IRC A;  1MSW D;  4O3P A;  7ICT A;  4DL6 A;  4AT8 B;  4ED2 A;  4RUC A;  2AQ0 A;  4P4P A;  4TQS A;  4FO6 A;  2BPG A;  1MC8 A;  2KP7 A;  3HIY A;  4X4O A;  4RPY A;  1T4G A;  2W9M A;  9ICT A;  4AT7 A;  2AGQ A;  1ZQO A;  4RQ6 A;  3ZDA A;  7ICI A;  1KFS A;  3PML A;  4PHA A;  4QWB A;  3C2M A;  4TQR A;  3V6K A;  1KNY A;  2NRZ A;  5J0Y A;  3PO5 A;  1ZQK A;  3G6X A;  2BE3 A;  1S9F A;  4M5D A;  1BPY A;  3HJ1 A;  4ED3 A;  4UB4 A;  1JX4 A;  3TFS A;  2C2E A;  2MUT A;  1SZP A;  4RZR A;  5DB7 A;  3B0Y A;  1DOQ A;  5KFP A;  3RBD A;  4K4H A;  4M9J A;  4KLJ A;  5F2V O;  2VAN A;  5L9X A;  1IM4 A;  2JZB A;  5KG2 A;  2B21 A;  5KFE A;  4YP3 A;  3EWA A;  4DF4 A;  3RJI A;  5HRE A;  4RWO A;  1ZQU A;  4P4O A;  5DB8 A;  4YR0 A;  1BPE A;  4UAZ A;  3QEA Z;  4X4S A;  4O9M A;  4I2D A;  5DLG A;  4O3Q A;  4DO9 A;  4FH3 A;  4F5O A;  4YXJ A;  3PY8 A;  4P2H A;  3HP6 A;  4F8R A;  4QZ9 A;  5BOL A;  4RT3 A;  8ICT A;  8ICO A;  5KFS A;  3KHR A;  2M2U A;  5HRB A;  3T5L A;  4XA5 A;  4PGQ A;  2HHS A;  4KLO A;  5HMM A;  9ICR A;  4UQG A;  5DG9 A;  4RU9 A;  3JPP A;  4RQ7 A;  1T7P A;  8ICM A;  1OU5 A;  1VFG A;  2ZTD A;  3JPO A;  3EPI A;  2JEF A;  4DLG A;  3QE9 Y;  1SL1 A;  4M9G A;  3OHA A;  5DQH A;  4M04 A;  2BHN A;  4DLE A;  2DVI A;  2HHP A;  3JYY A;  2ZJA A;  5KFR A;  3PR5 B;  2XGQ A;  5J2A A;  1XU4 A;  1U4B A;  4CCH A;  3PW4 A;  4GC6 A;  4KLF A;  4FHW A;  1NK8 A;  4E80 A;  3AQK A;  1KRP A;  5DGA A;  1KDH A;  1ZQN A;  5DED A;  3B0X A;  4J9K A;  2F1H A;  5CR0 A;  1SL0 A;  2PFP A;  2IA6 A;  1NK7 A;  1MIW A;  1PZN A;  3GII A;  8ICI A;  4F5P A;  2M2T A;  4RQ0 A;  4F5N A;  2DRB A;  1BNP A;  2BQU A;  7ICU A;  4TUR A;  3V6J A;  2DRA A;  2ZTE A;  3GDX A;  2XY5 A;  1ZQT A;  4EP7 A;  2BCV A;  1U45 A;  3EPG A;  1TAQ A;  4IR1 A;  9ICQ A;  2M2W A;  2ALZ A;  4IQT A;  4FS1 A;  1JN3 A;  3FYH A;  2ZUB A;  4QWC A;  2W9A A;  3KHH A;  2XY7 A;  8ICC A;  1RYR A;  3UXN A;  4DQQ A;  2C2D A;  3Q8L A;  3ZD9 A;  2P6U A;  1COO A;  2J6U A;  4O3O A;  4J9O A;  1NKB A;  8ICN A;  1ZQG A;  1CUK A;  1RXW A;  1ZJM A;  3K75 D;  4RQ3 A;  3BQ2 A;  4I2C A;  5J0P A;  4EYI B;  4UB2 A;  2FPL A;  3V72 A;  3TAN A;  3MR5 A;  2ZH8 A;  1XWL A;  4YMM A;  1BPB A;  4RNO A;  2R8K A;  3L9D A;  3NYB A;  4AT8 A;  4DL7 A;  5F9N A;  4C8M A;  3PNC A;  4DQR A;  1ZQF A;  2ATL A;  4K4I A;  4KLQ A;  3M8S A;  5HRK A;  1S0N A;  2ZJ5 A;  4DS5 A;  4JWN A;  4M2Y A;  9ICK A;  4EBJ A;  5J0O A;  1NK4 A;  5IIJ A;  4I27 A;  9ICL A;  3M9O B;  5DDM A;  1L3S A;  5D49 A;  1V9P A;  3H8W A;  2XY6 A;  4M9H A;  3NGD A;  2HVI A;  1U49 A;  4WCW A;  8ICF A;  4ECY A;  3RB0 A;  3H3A A;  3N4M B;  4ZH4 A;  3H40 A;  1TFW A;  1D9D A;  5HHI A;  4EZ6 A;  4Q8E A;  3LWL A;  4QZ8 A;  4FH5 A;  4MF8 A;  5KFY A;  2ZH5 A;  5EOZ A;  2PFO A;  3Q8K A;  2KFN A;  2OWO A;  1BNO A;  4KLG A;  4PHD A;  4J9S A;  3ISC A;  3RB4 A;  1JXL A;  3C66 A;  5KG1 A;  4ELV A;  5CWR A;  8ICZ A;  1NJX A;  4X0A A;  4I2F A;  7ICH A;  3HJ4 A;  2AQ4 A;  4WC6 A;  1MQ3 A;  5IIK A;  4Q43 A;  3KTQ A;  3OJU A;  9ICA A;  4NKT A;  9ICG A;  4X4Q A;  5KG3 A;  2AGP A;  4NLN A;  2ZH4 A;  9ICP A;  5DBA A;  4FS2 A;  4F92 B;  2PFQ A;  3RJF A;  3HPO A;  4X4V A;  2JEJ A;  1ZQS A;  1ZQH A;  4YMO A;  4NLZ A;  1L3U A;  4IRD A;  3BQ1 A;  3C21 A;  2PI5 A;  5KFO A;  4R65 A;  4XQ7 A;  1DK2 A;  9ICE A;  8ICA A;  3PX6 A;  2UVW A;  5IIO A;  4MFA A;  4FBU A;  5DQG A;  1SKS A;  1BPZ A;  7ICQ A;  2ASJ A;  3RBE A;  4FBT A;  9ICF A;  4RQ1 A;  4LZD A;  4UB5 A;  2KN7 A;  4GC7 A;  4UB1 A;  3AU6 A;  2P6R A;  4FHP A;  4C8L A;  4M9L A;  4AT9 B;  2PFN A;  5J2B A;  8ICV A;  4UBB A;  1ZQI A;  3PW5 A;  4IQU A;  4O5C A;  4BXO B;  4I2B A;  3AUO A;  2XGP A;  1S0O A;  4DSI A;  3RJK A;  1NK0 A;  5DLF A;  4IRK A;  5KT3 A;  4M9N A;  8ICX A;  2ZUC A;  2BR0 A;  3JPS A;  2ZH6 A;  4LT6 A;  1ARO P;  1ZQR A;  4F4X A;  5HRH A;  3HX0 A;  2R8H A;  4NM1 A;  4DQP A;  7ICE A;  4MF2 A;  2HHV A;  4XUS A;  2F1I A;  3UQ2 A;  4KLL A;  3OV7 A;  4JUZ A;  3V6H A;  3TQ1 A;  1KSP A;  2XC9 A;  2R8J A;  4M47 A;  1UEU A;  4X4U A;  1JIH A;  3RJE A;  4KLU A;  9ICO A;  2KFZ A;  5III A;  5KFM A;  1XO1 A;  4EEY A;  9ICM A;  1B22 A;  4X0B A;  1L5U A;  5CJ7 A;  2V4R A;  4WC0 A;  3BQT A;  2IHM A;  4NKU A;  3OSN A;  3UXP A;  4KLM A;  1EXN A;  3OHB A;  3MDA A;  2BPF A;  4F4K A;  3Q8R B;  1H38 A;  3ZDD A;  3RJH A;  4RT2 A;  2XO7 A;  2JEG A;  4KN7 A;  4QZH A;  3THV A;  3SI8 A;  2IHN A;  8ICB A;  3WFP A;  4R8U B;  2W9B B;  1HUO A;  4GLX A;  1DK3 A;  4FHY A;  4I2J A;  4KMU A;  4J9P A;  3AQM A;  1Q78 A;  4QZC A;  1HUZ A;  4RPX A;  1ZQE A;  4ECR A;  4MEX A;  3OVS A;  4LVS A;  2DR5 A;  3PW2 A;  4O3N A;  3EYZ A;  3C1Z A;  4EBD A;  3RAQ A;  1WCN A;  1ZQQ A;  2BPC A;  4Z6D A;  3V7J A;  3T5H A;  4DFM A;  3JPN A;  2FPK A;  1XSL A;  5J0Q A;  5DBC A;  8ICK A;  4NLG A;  4PHP A;  1SKW A;  9ICN A;  4ECZ A;  1ZQP A;  5KFQ A;  1RZT A;  1Y88 A;  4R63 A;  4ECS A;  3UQ0 A;  4DS4 A;  5KG7 A;  4DOC A;  4MEY A;  4K4G A;  4YVZ A;  2M9N A;  3V7K A;  4F4W A;  8ICE A;  4MFC A;  5KFJ A;  4DF8 A;  4XQ8 A;  4YR2 A;  3PO4 A;  1JAJ A;  2AJQ A;  7ICK A;  1X9M A;  9ICU A;  4AT7 B;  3H7I A;  5DDY A;  4TUS A;  1UA0 A;  4DQI A;  4GXK A;  8ICQ A;  3C5G A;  1A77 A;  1MIY A;  4FHV A;  4Z6C A;  4BWM A;  1WCL A;  2F1J A;  1TVA A;  5L1I A;  3RH5 A;  2P66 A;  9ICX A;  4RNN A;  3EW9 A;  1SL2 A;  1Z00 B;  4TUQ A;  1MQ2 A;  3RJG A;  3C18 A;  4UD4 A;  1WOT A;  4O5K A;  4DL3 A;  2I9G A;  1S77 D;  1MIV A;  3H38 A;  3AQL A;  4XRH A;  4DQS A;  4DL5 A;  1X9W A;  5KFC A;  1RYS A;  3BDP A;  4KLH A;  4YQW A;  3H8S A;  2J6S A;  9ICW A;  5DEC A;  3C2K A;  4M6W B;  4RQ4 A;  2Y1J A;  4G3I A;  1D8L A;  3JZ0 A;  5KT6 A;  3Q8M A;  4ATB B;  9ICV A;  7ICS A;  4AT9 A;  5L1J A;  3QEB Z;  5J0W A;  4ED7 A;  2ASD A;  3GV7 B;  5KT4 A;  3OGU A;  1VJ7 A;  2RDI A;  5KFV A;  4EBE A;  5DG8 A;  4RQ2 A;  3MDC A;  3H4D A;  4DSE A;  4BXO A;  4QZA A;  3PW0 A;  3EZ5 A;  3TAP A;  4O3S A;  4QZG A;  1ZQJ A;  3ISD A;  4YMN A;  1NK5 A;  3PVX A;  1TKD A;  4KLT A;  1N56 A;  1NJZ A;  5J2F A;  3T5J A;  1NJW A;  2R8G A;  4QZF A;  4DWI A;  4KLE A;  4QZB A;  2HHT A;  4WBY A;  2ZH9 A;  4WC3 A;  4X4P A;  3RTV A;  2ZHB A;  3PX0 A;  4KN4 A;  7ICJ A;  5HP4 A;  1TK8 A;  2ISO A;  4RNM A;  2VA2 A;  4WC1 A;  3PV8 A;  1ZQX A;  2NRT A;  2W8K A;  4GXJ A;  3H39 A;  2ZH7 A;  2PI4 A;  3GV8 B;  1QSS A;  2ID1 A;  1ZQM A;  1K1Q A;  4BWJ A;  8ICJ A;  4ECV A;  2ZJ8 A;  4YG2 A;  4ED8 A;  2ZH3 A;  3QZ7 A;  2ZUD A;  4LZG A;  4F91 B;  2O1P A;  7ICL A;  1JMS A;  4C8N A;  3MBY A;  4QZI A;  4X5V A;  2BCU A;  4JV2 A;  3GQC A;  3C23 A;  4R8U A;  1QSY A;  5KFI A;  5KG4 A;  2W9B A;  5IIL A;  4M0A A;  1BGX T;  4QW9 A;  3MFI A;  1BVS A;  3HWT A;  1S97 A;  4EBK A;  3LQC B;  3WFQ E;  3RJJ A;  3C1Y A;  3UXO A;  4R66 A;  2NRK A;  1NK9 A;  3MGH A;  4F4Z A;  4Q8F A;  2BCR A;  2KZZ A;  1HJP A;  1UA1 A;  4KTQ A;  4X4N A;  2DR9 A;  1ZQB A;  4WC2 A;  5KFZ A;  2ASL A;  4NM2 A;  3T3F A;  2UVV A;  1TFY A;  3ORY A;  5BOM A;  3GIJ A;  5J2E A;  2FMS A;  2HW3 A;  3JPT A;  5J0S A;  5J2H A;  4ELU A;  8ICH A;  4R64 A;  2ZTC A;  4YD1 A;  2IBK A;  2IMW P;  1X2I A;  4JWM A;  4DOA A;  5KFH A;  4DSF A;  4UAW A;  4YCX A;  1U48 A;  4UAY A;  5KFA A;  2O5A A;  4YR3 A;  4IQV A;  2KZ3 A;  5HRI A;  4RWP A;  1QTM A;  1U9L A;  5HRF A;  3OUY B;  5J2C A;  1S0V A;  3Q8S B;  2H5X A;  5CHG A;  2FMP A;  5CB1 A;  4RWQ A;  4ELT A;  1IXR A;  1Z00 A;  5DB9 A;  3MR3 A;  2C28 A;  2BDP A;  1C7Y A;  1ZYQ A;  1QSL A;  3GFK B;  5IIM A;  2NRX A;  3IHQ B;  3G6V A;  1TV9 A;  1TAU A;  8ICP A;  4WC5 A;  4DOB A;  4B9M A;  2LYH A;  4M6W A;  1KEJ A;  4F2S A;  8ICY A;  4ATB A;  5KFG A;  1ZQL A;  3ZDB A;  4HYK A;  4YFK A;  1X9S A;  3LWM A;  4F3O A;  9ICC A;  4DL2 A;  5EWE A;  4RQ5 A; 
#chains in the Genus database with same CATH topology
 1NO5 A;  1ZD2 P;  1CEZ A;  5EWF A;  4JV0 A;  5D46 A;  1IIP A;  7ICG A;  3AQN A;  3PHZ A;  3C5F A;  3DDH A;  4EEK A;  2Q66 A;  4EYH B;  8ICR A;  3WKA A;  2FLN A;  4O3R A;  1K1S A;  3LVV A;  2KKP A;  3CYM A;  2RRD A;  2ZIU B;  4P0Q A;  3QU2 A;  4ECU A;  4NWI A;  5AI6 A;  2R8I A;  1F5A A;  1L3T A;  1RXV A;  1Z4N A;  5L1M A;  5AKZ A;  4O5E A;  2FMQ A;  1UET A;  4B9N A;  2BDU A;  4DFK A;  1GO3 F;  3MGV A;  4QW8 A;  4RPZ A;  3GIL A;  7ICP A;  2EZZ A;  4DEZ A;  1TK5 A;  2XCA A;  2ZH1 A;  1A76 A;  2DQN B;  2FE9 A;  3SYZ A;  3E58 A;  4IQW A;  4J9N A;  3WK8 A;  5JTI A;  3SZ2 A;  3CK6 A;  3H4B A;  1RPL A;  2KIC A;  5A0L A;  1NZB A;  2ZXH A;  2A1J B;  2I6X A;  1ZQV A;  1UT8 A;  2A1A A;  1SB3 C;  3SEN A;  3CP8 A;  3TKA A;  4EV6 A;  1V4A A;  3OJS A;  1FFU A;  1O03 A;  3M8R A;  4P4M A;  4RQ8 A;  3UMB A;  4WQK A;  5J0T A;  1XS9 D;  4AT7 B;  5TZV A;  2WTF A;  1NKE A;  3ZI4 A;  1ZQA A;  5L1L A;  4I2G A;  5DQI A;  2PXI A;  3PST A;  5DGB A;  2KZM A;  4F50 A;  3E2E A;  4RWN A;  1T3N A;  4CE6 A;  2MUT B;  5J29 A;  2HHU A;  2BQ3 A;  3KZI U;  3T5K A;  5CFS A;  2L5Y A;  3PR4 A;  2WF8 A;  1KLN A;  2DGZ A;  2RFF A;  7ICF A;  4O0I A;  5EE3 A;  2DPJ A;  1PX5 A;  3UPQ A;  3TI0 A;  3VCB A;  2KHQ A;  4HAI A;  4DFP A;  4OAF A;  3BZK A;  2HHW A;  1U47 A;  2LM4 A;  4NLC A;  5J0U A;  3RB3 A;  1F44 A;  4J9Q A;  4IG8 A;  4Q44 A;  1KL9 A;  2RQ5 A;  5J2D A;  2WF9 A;  2FLL A;  2E5S A;  3WFR E;  2RP5 A;  3LDA A;  1ZQD A;  4C8K A;  2VKQ A;  3SV4 A;  4ED0 A;  2E3T A;  1S0M A;  1X66 A;  2NO4 A;  4QZD A;  4EZ9 A;  3AQE A;  3HW8 A;  2HHQ A;  5AKL A;  4F2R A;  2W11 A;  2AH5 A;  4GXI A;  2DWQ A;  2F3N A;  3F2D A;  4OCZ A;  2W9C B;  4GFJ A;  3WK7 A;  5D4B A;  4F5Q A;  1MSW D;  4AT8 B;  2Q4T A;  2QAR A;  4RUC A;  2AQ0 A;  2KP7 A;  4TQS A;  4P4P A;  5CHE A;  1T4G A;  9ICT A;  4WOY A;  4WH5 A;  4PHA A;  1ECW A;  4QWB A;  1CI4 A;  2CN1 A;  5J0Y A;  3PO5 A;  2LKY A;  1S9F A;  4ED3 A;  4UB4 A;  1TAU A;  4RZR A;  5DB7 A;  5KFP A;  1DOQ A;  4K4H A;  4KLJ A;  2JR5 A;  5L9X A;  5KFE A;  5HRE A;  3NRZ A;  3MCR A;  4RWO A;  4X4S A;  4UAZ A;  4ACO A;  5DLG A;  4O3Q A;  4FH3 A;  4FFD A;  3HP6 A;  8ICT A;  3KHR A;  2HHS A;  1J2N A;  4RU9 A;  1VFG A;  1JUD A;  3JPO A;  3QE9 Y;  1SL1 A;  1KQQ A;  4US8 A;  3F2C A;  4CCH A;  3PW4 A;  4KLF A;  1KRP A;  5AI5 A;  5DGA A;  3B0X A;  1SL0 A;  4O69 A;  1MIW A;  2IA6 A;  1PK1 A;  3V6J A;  2DRA A;  2ZTE A;  1U45 A;  4RQM A;  2G09 A;  1SV0 C;  2KKV A;  3KHH A;  8ICC A;  1RYR A;  3UXN A;  2C2D A;  2P6U A;  2HBK A;  4O3O A;  1NKB A;  3QU9 A;  1Z4O A;  2B6G A;  4RQ3 A;  7ICE A;  2DL0 A;  4EYI B;  3TAN A;  4YMM A;  4RNO A;  1BPB A;  2F8K A;  4DL7 A;  2ATL A;  3M8S A;  2WF5 A;  3D2N A;  1S0N A;  4M2Y A;  4EBJ A;  1L7N A;  1NK4 A;  5D49 A;  3H8W A;  5J8Y A;  1FFV A;  4M9H A;  8ICF A;  3RB0 A;  3H3A A;  3H40 A;  5ALY A;  3WK6 A;  3QYP A;  4Q8E A;  4Y2T A;  4MF8 A;  5EOZ A;  2KFN A;  3RB4 A;  2FCL A;  5ALL A;  2GOL A;  1VLB A;  1SZH A;  3HJ4 A;  4NXU A;  1MQ3 A;  5IIK A;  4Q43 A;  4IS7 A;  4NKT A;  3IDW A;  1L3U A;  5KFO A;  4XQ7 A;  5J8Y C;  1DK2 A;  9ICE A;  8ICA A;  2UVW A;  1SKS A;  4FBT A;  4UB5 A;  2KN7 A;  1Q3U A;  4AT9 B;  4QJF B;  3NVV A;  8ICV A;  2LPE A;  1XNS A;  4BXO B;  1KN5 A;  1N5X A;  4O3M A;  3JPS A;  1ARO P;  1S8O A;  4DQP A;  4XUS A;  3V6H A;  1UEU A;  2XVT A;  4KLU A;  2KFZ A;  5KFM A;  4X0B A;  1L5U A;  4WC0 A;  1ZRM A;  3OHB A;  3MDA A;  2BPF A;  3ZDD A;  3RJH A;  2XO7 A;  2JEG A;  1F0M A;  4KB6 A;  2KJ5 A;  2IHN A;  4Y2U A;  1HUZ A;  4RPX A;  4MEX A;  1MIV A;  2LHT A;  1Q3V A;  2V9W A;  1WCN A;  4Z6D A;  3V7J A;  5H2F U;  5DBC A;  4NLG A;  5ALT A;  1ZQP A;  5KFQ A;  1RZT A;  1Y88 A;  4DS4 A;  5ALP A;  5KG7 A;  4K4G A;  3V7K A;  4F4W A;  3SAH A;  5D62 A;  3ED5 A;  4YR2 A;  1JAJ A;  2AJQ A;  3QU4 A;  1X9M A;  5DDY A;  4TUS A;  5ALS A;  3C5G A;  3L4P A;  4Z6C A;  5AM5 A;  1WYG A;  3EW9 A;  4RNN A;  1Z00 B;  2YX8 A;  3RJG A;  4DL3 A;  3A0H U;  4UAR A;  4ZOH C;  1X9W A;  4DL5 A;  3BDP A;  3H8S A;  2Y1J A;  4M6W B;  4RQ4 A;  3Q8M A;  2KEY A;  4ATB B;  5KT4 A;  3OGU A;  5KFV A;  4EBE A;  5DG8 A;  5AKX A;  3ER8 C;  2OYY A;  3EZ5 A;  4O3S A;  4YMN A;  1NK5 A;  1N56 A;  4DWI A;  2ZH9 A;  1Z19 A;  4X4P A;  2ZHB A;  7ICJ A;  2ISO A;  4WC1 A;  2KG5 A;  1ZQX A;  2G06 A;  3GV8 B;  2ID1 A;  3KBB A;  1K1Q A;  2K4I A;  3WK9 A;  2ZH3 A;  2ZUD A;  4LZG A;  4P0Q B;  7ICL A;  2EAO A;  3PSP A;  3C23 A;  1ZXI A;  4R8U A;  9ICQ A;  1SXD A;  2NRK A;  1NK9 A;  4Q8F A;  4X4N A;  4WC2 A;  1LKY A;  2ASL A;  2UVV A;  5C0Y A;  5ALE A;  4R64 A;  4JWM A;  5KFH A;  4UAY A;  5J2C A;  3QU7 A;  3N28 A;  1IXR A;  2PMZ F;  2NRX A;  5D63 A;  1N60 A;  8ICP A;  1PUZ A;  2LYH A;  4C4S A;  2YTU A;  4USA A;  8ICY A;  1FO4 A;  3AUO A;  4DL2 A;  5EWE A;  3LQC B;  5DG7 A;  3MR6 A;  2JXJ A;  2D3D A;  3PMN A;  4DL4 A;  3L5K A;  2UVU A;  1OXJ A;  4ED1 A;  2VJ4 A;  5AI0 A;  3Q8Q B;  2B56 A;  4WC4 A;  1UQV A;  1T8E A;  2QLT A;  5KL1 B;  1S10 A;  1FIQ A;  4B9V A;  4PPX A;  1ZJN A;  5AI8 A;  1Q46 A;  1S76 D;  3FC4 A;  1KFT A;  4K8V A;  1YZ7 A;  3KHL A;  2W04 A;  3CNH A;  5AIC A;  1YLQ A;  5IIN A;  1BPD A;  2AXT U;  1NZP A;  3BQ7 A;  3RB6 A;  4KLD A;  2GH1 A;  1JRO A;  1ZQZ A;  2N1R A;  2Y1I A;  4Y2R A;  4WC7 A;  5T14 A;  4I2E A;  4KLI A;  1K5O A;  3OTQ A;  5DKW A;  2MRL A;  5KFD A;  5KFL A;  1ZD5 A;  9ICH A;  2FLP A;  4J03 A;  4I2A A;  4JLX A;  2B0C A;  4J9R A;  1Q79 A;  1ZOL A;  1ZQW A;  4KIT B;  3QUC A;  1NK6 A;  1UEV A;  1WWU A;  3OUY A;  4BGD A;  3K4G A;  4B9T A;  5J0X A;  8ICL A;  2J6T A;  3SAF A;  2BGW A;  3N7P D;  1DGJ A;  1QH9 A;  9ICB A;  7ICR A;  2VJ5 A;  4ECX A;  3T79 A;  4CF3 A;  4PHE A;  5HRG A;  3H8M A;  2OH2 A;  3I28 A;  4PJ0 U;  1T94 A;  2M2V A;  2KIW A;  4FZN A;  4KX3 A;  5BPC A;  5ALF A;  2E8O A;  4I28 A;  4JV1 A;  4F5R A;  5CA7 A;  1J2M A;  2HHX A;  2ZHA A;  2IUB A;  4B9U A;  4F71 A;  4WJ3 B;  2DPI A;  8ICG A;  2HSZ A;  2ZIW A;  4PZN A;  3AQF A;  8ICS A;  3EF2 A;  3JPQ A;  3CW2 C;  3NTU A;  2LBO A;  5ALJ A;  5HNK A;  2RDJ A;  1TK0 A;  1R8A A;  3WFS C;  2HBJ A;  7ICN A;  5EE1 A;  4RUA A;  1PK1 B;  5ALW A;  8ICW A;  4NL9 C;  2JEI A;  5KFX A;  5KT2 A;  4IR9 A;  2FPM A;  4I0U A;  4Y2Y A;  4MHV A;  2WFA A;  1XSN A;  3BQ0 A;  1F5S A;  5KAF U;  2V4Q A;  1D9F A;  3JPR A;  2KJ8 A;  2Q0Z X;  4O3P A;  3SR6 A;  2JV3 A;  1VDV A;  1MC8 A;  3CRX A;  4RPY A;  3GZF A;  2WAQ F;  2AGQ A;  5KAI U;  5EE9 A;  4OJ6 A;  4TQR A;  4NJ8 A;  3G6X A;  2BE3 A;  1L8O A;  5AK4 A;  1BPY A;  5FP0 A;  3AL0 B;  1JX4 A;  2E8P A;  3B0Y A;  5KNI A;  4M9J A;  4KMO B;  5B3P A;  2ESE A;  4UAS A;  4AP9 A;  4DO9 A;  4QZ9 A;  5BOL A;  3OWG A;  5KFS A;  4PGQ A;  4KLO A;  9ICR A;  4AYB C;  1T7P A;  3EPI A;  2JEF A;  3OHA A;  4M04 A;  2JRZ A;  1A0P A;  4ICA A;  3PR5 B;  2XGQ A;  5B3Q A;  4CF4 A;  1XU4 A;  5CEH A;  2KMD A;  4JLZ A;  1KDH A;  5DED A;  4J9K A;  4E8F A;  3I76 A;  5ALG A;  1PZN A;  3GII A;  8ICI A;  4TUR A;  1UHU A;  3QU5 A;  5ALU A;  5CRX A;  2G07 A;  2M2W A;  4FS1 A;  2HMX A;  2ZUB A;  4BX9 C;  4DQQ A;  3ZD9 A;  4B6J A;  2J6U A;  1KW4 A;  4J9O A;  4NXX A;  3KKA A;  8ICN A;  1RXW A;  4I2C A;  4UB2 A;  3MR5 A;  3NYB A;  2R8K A;  3L9D A;  5F9N A;  3PNC A;  4DQR A;  3F53 A;  4KLQ A;  2ZJ5 A;  3M9O B;  1T3Q A;  2H3Q A;  1V9P A;  2HVI A;  5AI4 A;  2YQE A;  4ECY A;  1TFW A;  1D9D A;  4K9B A;  4QIW C;  2OWO A;  4PHD A;  3D6J A;  1JXL A;  5KG1 A;  4ELV A;  3KKA C;  8ICZ A;  3N7R C;  3ER9 B;  4I2F A;  1XO0 A;  3E0F A;  3KTQ A;  4UAU A;  3OJU A;  2AGP A;  4C7Z A;  9ICP A;  5DBA A;  2VIX A;  5ALH A;  3HKZ F;  2JEJ A;  3BQ1 A;  2PI5 A;  5HR7 A;  4R65 A;  2RLT A;  3UMC A;  4MFA A;  7ICQ A;  4OAI Z;  4LZD A;  4FHP A;  4UB1 A;  1SGG A;  4M9L A;  4I2B A;  2QB1 A;  1S0O A;  4IRK A;  2PKE A;  4DSI A;  4OO1 J;  3M6K A;  2ZUC A;  2BR0 A;  2ZH6 A;  1RM6 C;  1OW5 A;  1SV4 A;  2HHV A;  2F1I A;  3WU2 U;  4JUZ A;  4M47 A;  2XC9 A;  2R8J A;  1JIH A;  2EAN A;  5III A;  1XO1 A;  4EEY A;  9ICM A;  5CJ7 A;  4UW9 A;  1H38 A;  1L7O A;  4RT2 A;  3THV A;  4QZH A;  4Y2P A;  4R8U B;  1DK3 A;  3AM9 A;  4J9P A;  3AQM A;  1Q78 A;  1ZQE A;  1SV0 A;  4ECR A;  2HCF A;  3OVS A;  1LKY B;  4DFM A;  5J0Q A;  4PHP A;  1SKW A;  1N61 A;  1FEZ A;  4R63 A;  4U7C A;  1SWW A;  4MEY A;  2M9N A;  8ICE A;  2QB0 A;  2E8M A;  4XQ8 A;  3H7I A;  4GXK A;  8ICQ A;  1MIY A;  1WCL A;  2F1J A;  1SL2 A;  4TUQ A;  4UB8 U;  1S77 D;  4P0P A;  3AQL A;  2J6S A;  2W3S A;  4FE3 A;  4EEB A;  1ZD3 A;  5L1J A;  4ED7 A;  3FM9 A;  1VJ7 A;  2GAF D;  3MDC A;  1YZ6 A;  3PW0 A;  4QZG A;  1ZQJ A;  5J2F A;  3T5J A;  2R8G A;  4WBY A;  2JH1 A;  4Y2X A;  3F5E A;  4NXV A;  3PX0 A;  4KX5 A;  4LEW A;  4K98 A;  3NUQ A;  4RNM A;  2VA2 A;  3PV8 A;  4QNL A;  2FJ6 A;  1B0X A;  2KOB A;  4BWJ A;  1UCV A;  2ZJ8 A;  4YG2 A;  4F91 B;  2O1P A;  1JMS A;  2KNJ A;  3MBY A;  4JB3 A;  1JI7 A;  3GQC A;  5KG4 A;  2W9B A;  1BGX T;  4QW9 A;  1BVS A;  3SQI A;  3RJJ A;  3UXO A;  2KVC A;  3MGH A;  4C4R A;  2KZZ A;  3ETR A;  4KTQ A;  3BZC A;  2DR9 A;  1ZQB A;  1J97 A;  5AK5 A;  3ORY A;  5BOM A;  2FMS A;  1RYU A;  4ELU A;  3TAC B;  4DOA A;  3MC1 A;  3QX7 A;  4LEY A;  4CDG A;  2O5A A;  5KFA A;  4KM5 A;  3F2B A;  4Y2S A;  3JCF A;  4RWP A;  5HRF A;  3OUY B;  5AKH A;  5JU5 A;  5CHG A;  1LVH A;  2C28 A;  2BDP A;  5E79 U;  1QSL A;  3GFK B;  3DV9 A;  4B9M A;  4F2S A;  5KFG A;  2EAM A;  1ZQL A;  4HYK A;  4YFK A;  3KZX A;  4F3O A;  1R89 A;  1R8B A;  5KFB A;  4QWA A;  1DGS A;  3OSP A;  2K89 A;  5HRL A;  3IP4 B;  2NRV A;  2MAX A;  1WG8 A;  5KL8 B;  4QZE A;  2XCP A;  7ICO A;  3RR8 A;  1Z3E B;  3SD7 A;  2ZH2 A;  5KT5 A;  2R18 A;  3DEE A;  1RQN A;  2HN2 A;  3F5A A;  4DFD A;  2GO7 A;  4ECW A;  2C22 A;  3HRD D;  2WB1 F;  2BKE A;  2VA3 A;  3V7L A;  2ZIW B;  5JUM A;  2HN1 A;  3RF9 A;  2UVR A;  2HDO A;  2D8C A;  8ICU A;  2OXO A;  3BS5 B;  4LEZ A;  1A6S A;  2KTQ A;  5KFF A;  3LK9 A;  1ZET A;  5J2I A;  4B9S A;  4IC9 A;  4Z6F A;  4Y2V A;  3RFA A;  4F93 B;  4NXZ A;  1DXS A;  2HOI A;  1C20 A;  5AM4 A;  1LV5 A;  1KTQ A;  3AN1 A;  1R8C A;  4ED6 A;  2W55 A;  4PH5 A;  5HML A;  1BPX A;  5AHX A;  5KTQ A;  2ISP A;  3ZDE A;  2YMP A;  5KFW A;  1UPH A;  5ALZ A;  5KT7 A;  4I2I A;  2MU2 A;  5JRT A;  4OJO A;  4KLS A;  2BCQ A;  5KG5 A;  4I29 A;  3C2L A;  3RAX A;  3ONN A;  2W9C A;  1L3V A;  5HR9 A;  1ZQC A;  3PW7 A;  2Y0S F;  3QUB A;  5L1K A;  3FDS A;  4YXM A;  3RH4 A;  2DR7 A;  4DSJ A;  2BBJ A;  4WBZ A;  4E0D A;  4OJP A;  4UBC A;  3NKU A;  9ICJ A;  3RH6 A;  1NJY A;  1N48 A;  3S6J A;  2F76 X;  5EWG A;  2CPR A;  3BJY A;  3UM9 A;  4WQL A;  4ECQ A;  1JXE A;  4BDP A;  5HRD A;  2H3I A;  3RRH A;  3GU3 A;  4O68 A;  3UPS A;  2I1Q A;  3MR2 A;  4BUG A;  1XSP A;  5ALX A;  1X6I A;  2AGO A;  3GIM A;  3QUT A;  4NY8 A;  5G5G A;  5C5J A;  3RRG A;  7ICV A;  4YD2 A;  3MAB A;  3H8J A;  4DSL A;  4X4T A;  1PVQ A;  2K60 A;  4C7Y A;  5J0R A;  4Q45 A;  1TFR A;  4PGY A;  3IN5 A;  3G6Y A;  4IRC A;  7ICT A;  4ED2 A;  4FO6 A;  2W9M A;  4EX6 A;  4CF5 A;  1ZQO A;  7ICI A;  3NRW A;  1NNL A;  3C2M A;  2NRZ A;  3IG8 A;  3NVY A;  1ZQK A;  3U26 A;  7ICK A;  5B66 U;  3TAQ A;  2JZB A;  5ALK A;  4DF4 A;  3EWA A;  2EQY A;  1BPE A;  3QEA Z;  2K4H A;  4I2D A;  4F5O A;  4K99 A;  4P2H A;  1X40 A;  4F8R A;  2M2U A;  3NVO A;  2BZF A;  5HMM A;  4UQG A;  5DG9 A;  3JPP A;  8ICM A;  4DLG A;  5DQH A;  4NV0 A;  4DLE A;  2DVI A;  3BS7 A;  2ZJA A;  5J2A A;  1U4B A;  4GC6 A;  1NK8 A;  4E80 A;  2ZG6 A;  5AM0 A;  1ZQN A;  3OV7 A;  3OVA A;  2F1H A;  2PFP A;  1NK7 A;  4F5P A;  2M2T A;  5ALV A;  4RQ0 A;  2BQU A;  7ICU A;  2K8B B;  2QAR B;  3HIL A;  3GDX A;  4EP7 A;  3QUQ A;  2BCV A;  1TAQ A;  1JN3 A;  2W03 A;  4QWC A;  2W9A A;  5ALI A;  5AK3 A;  1JAL A;  3Q8L A;  5F3X B;  1COO A;  2LYB A;  2HI0 A;  1ZQG A;  1CUK A;  1ZJM A;  3BQ2 A;  2FPL A;  3V72 A;  4NL9 A;  4C8M A;  1ZQF A;  1WWV A;  4K4I A;  5HRK A;  1HEK A;  4JWN A;  5J0O A;  5IIJ A;  4I27 A;  9ICL A;  3KFU F;  3R9K A;  1KKX A;  2XY6 A;  2KJ9 A;  5AM3 A;  1U49 A;  3WKD A;  3EUB 2;  5HHI A;  4U6P A;  2DKZ A;  4EZ6 A;  4QZ8 A;  1BNO A;  4J9S A;  3SAG A;  5CWR A;  1X9X A;  2QB0 B;  2GA9 D;  4X0A A;  2PMZ C;  2AQ4 A;  1M6Y A;  3LYS A;  9ICA A;  9ICG A;  4X4Q A;  5KG3 A;  3WK4 A;  2ZH4 A;  2OCE A;  2CRX A;  4FS2 A;  4F92 B;  3HJE A;  3ALR A;  3RJF A;  3HPO A;  3SMV A;  5ALD A;  1SWV A;  4NLZ A;  2KD1 A;  2F8L A;  4YMO A;  2O6K A;  1ZQH A;  4FO1 A;  4X4V A;  2ZIX A;  2G5I B;  4P0P B;  1AQ6 A;  3PX6 A;  4FBU A;  3RBE A;  9ICF A;  5G5H A;  4RQ1 A;  4K9A A;  4GC7 A;  1O08 A;  2PFN A;  3IV6 A;  2DBY A;  5J2B A;  4UBB A;  2LM1 A;  3PW5 A;  3A0B U;  4QIW F;  2JHD A;  1DRG A;  2ZIV A;  2G5H B;  1PK3 A;  5DLF A;  4M9N A;  3M6Z A;  4LT6 A;  1QCK A;  4O6A A;  2ES6 A;  2IOH A;  5HRH A;  3HX0 A;  4NM1 A;  1URJ A;  3UQ2 A;  3M7D A;  4KLL A;  3TQ1 A;  4O67 A;  5AKK A;  5TIS U;  9ICO A;  2V4R A;  3BQT A;  4NKU A;  3OSN A;  1EXN A;  4X4U A;  4F4K A;  4IL6 U;  3Q8R B;  8ICB A;  4KN7 A;  3SI8 A;  2K4P A;  4FZM A;  2P35 A;  2W9B B;  1HUO A;  4GLX A;  2EH9 A;  1ZQ1 C;  4EED A;  1QQ7 A;  2HOQ A;  2G0A A;  3PW2 A;  4O3N A;  3EYZ A;  4EBD A;  3RAQ A;  2BPC A;  3KOO A;  3JPN A;  8ICK A;  2DUY A;  4ECS A;  3PZP A;  3UQ0 A;  3NWI A;  5KFJ A;  5B5E U;  1N5W A;  2FDR A;  2IOF A;  2DF4 B;  4FHV A;  3WKB A;  4BWM A;  1TVA A;  5L1I A;  3QNM A;  9ICX A;  2QKQ A;  3C18 A;  4O5K A;  3H38 A;  1P7D A;  4XRH A;  1RYS A;  4KLH A;  2KK0 A;  4YQW A;  4G3I A;  9ICV A;  1JRP A;  4CNQ A;  3QEB Z;  3J81 j;  5J0W A;  2NYV A;  3GV7 B;  2JMG A;  5HR6 A;  5AK6 A;  3H4D A;  3WKE A;  3ISD A;  1TKD A;  3PVX A;  4KLT A;  2KE7 A;  1NJW A;  4QZF A;  4KLE A;  4QZB A;  2HHT A;  2IHO A;  3ERC C;  4RQN A;  4GXJ A;  3H39 A;  2ZH7 A;  1ZQM A;  4JMU A;  3OPX A;  4C8N A;  4QZI A;  3K7D A;  4X5V A;  2BCU A;  5IIL A;  1S97 A;  3MFI A;  3HWT A;  4EBK A;  3H0L B;  3WFQ E;  2KHV A;  1X42 A;  1HIW A;  2BBH A;  2BCR A;  1COK A;  1RG6 A;  3GIJ A;  1Z1B A;  5J0S A;  5AKJ A;  4DCC A;  2ZTC A;  4G9B A;  2JH7 A;  4YD1 A;  2IBK A;  2K8C B;  2WAQ C;  4UAW A;  2KIV A;  4IQV A;  2KZ3 A;  5HRI A;  1QTM A;  2H5X A;  4RWQ A;  4ELT A;  2OEH A;  1C7Y A;  4LJX A;  3G6V A;  1TV9 A;  2HOF A;  1KEJ A;  4EEL A;  4PL1 A;  3ZDB A;  9ICC A;  1X9S A;  4XJE A;  2BPG A;  4RQ5 A;  2YB4 A;  1TAM A;  1ZRN A;  3M9M B;  4F4Y A;  3MGI A;  2C2R A;  1QLN A;  2W8L A;  5GTI U;  5J2J A;  1D8Y A;  9ICI A;  4X4R A;  5KG6 A;  1KFD A;  1QQ5 A;  1X6J A;  4C8O A;  2DR8 A;  7ICM A;  4J9M A;  3GV5 B;  3GIK A;  5EE0 A;  5DB6 A;  3TAR A;  4UB3 A;  4MFF A;  4QWE A;  1SKR A;  4J9L A;  3TFR A;  4K97 A;  5HC9 A;  5F9L A;  3MFH A;  3OVB A;  1NOM A;  2NRW A;  1XC9 A;  2KSO A;  5ALO A;  1V97 A;  2W3R A;  3N97 B;  4QWD A;  2DFL A;  5KFN A;  1JQR A;  3ISB A;  3K1Z A;  2CXY A;  3QZ8 A;  4Z6E A;  2AU0 A;  5AM1 A;  2EWR A;  2IOF K;  4EBC A;  3UMG A;  1SIJ A;  1UT5 A;  2GWS A;  3WFO A;  3I1Y A;  3TAD A;  4YN4 A;  3KHG A;  3ZD8 A;  5ALN A;  4BJQ A;  1ZQY A;  4OAH A;  5KFT A;  1PVR A;  4CGZ A;  3NAS A;  1PVP A;  4EEN A;  5J2K A;  4NLK A;  4GIB A;  3AU2 A;  3AMZ A;  4UD5 A;  5KG0 A;  5KFU A;  2XID A;  1MN8 A;  4PZO A;  3H37 A;  3PSF A;  2F44 A;  2W54 A;  3H0R B;  4B9L A;  2H3V A;  1OUQ A;  5K4L A;  5HHH A;  2ODG A;  4OD0 A;  4DSK A;  4FHX A;  2JZB B;  2JGA A;  3TAD C;  4DFJ A;  2WF7 A;  4ECT A;  1FA0 A;  4F72 A;  4JK1 A;  1N2X A;  3Q8P B;  3IM1 A;  3HKZ C;  9ICS A;  2W7P A;  1N63 A;  3ETL A;  4TUP A;  2A19 A;  3KD3 A;  1B43 A;  4I2H A;  2ZIU A;  2BCS A;  3NS1 A;  4E7X A;  4PGX A;  5AKI A;  5J2G A;  5ALR A;  5KFK A;  3WKC A;  2YMQ A;  2VA8 A;  5AIA A;  3M9N B;  2E1F A;  2XIC A;  1NKC A;  2RHF A;  3SV3 A;  3RR7 A;  5DBB A;  2BQR A;  3PX4 A;  1LB2 B;  3HT3 A;  3PSI A;  2HVH A;  1V38 A;  1KBU A;  4UB6 U;  1B4F A;  2A1J A;  1L8L A;  4UAV A;  5AI9 A;  3ZDC A;  2PBE A;  3C29 A;  5CP2 A;  4S3N A;  4US9 A;  4C0Z A;  4DL6 A;  3HIY A;  4AT7 A;  2EZX A;  3IRU A;  4RQ6 A;  3ZDA A;  1KFS A;  3PML A;  1L6N A;  3V6K A;  1KNY A;  2LMR A;  2YN4 A;  2WHE A;  4M5D A;  3HJ1 A;  3TFS A;  2Z7J A;  2MUT A;  1SZP A;  3RBD A;  2C2E A;  5F2V O;  2VAN A;  5KG2 A;  1IM4 A;  4YP3 A;  8ICJ A;  2B21 A;  3RJI A;  1ZQU A;  4P4O A;  5DB8 A;  4YR0 A;  2FI1 A;  4O9M A;  2GLE A;  4YXJ A;  3PY8 A;  3B9J A;  4RT3 A;  8ICO A;  3T5L A;  4XA5 A;  5D61 A;  2HBM A;  1OU5 A;  4RQ7 A;  2ZTD A;  4M9G A;  2ZIX B;  2LYA A;  3M1Y A;  2BHN A;  2HHP A;  3JYY A;  5KFR A;  1V85 A;  2H3F A;  4FHW A;  3AQK A;  1MA7 A;  4X4O A;  1IG6 A;  5CR0 A;  2ZIV B;  4F5N A;  2DRB A;  1BNP A;  4EX7 A;  2KV2 A;  1ED1 A;  2OHF A;  2Y9T A;  2XY5 A;  1ZQT A;  2AHO B;  3EPG A;  4IR1 A;  2ALZ A;  2NV3 A;  4IQT A;  3FYH A;  3NVZ A;  2XY7 A;  4Y2Q A;  1L7P A;  2YB1 A;  5ALM A;  4PL2 A;  3K75 D;  2KVS A;  5J0P A;  2ZH8 A;  1XWL A;  4AT8 A;  4DS5 A;  9ICK A;  5DDM A;  1L3S A;  4N7R A;  2ZXI A;  3NGD A;  4WCW A;  3N4M B;  4ZH4 A;  4CRX A;  3N7S C;  3LWL A;  4FH5 A;  5KFY A;  2ZH5 A;  2PFO A;  3Q8K A;  4KLG A;  3ISC A;  4OAG A;  2OM6 A;  3LVW A;  4C80 A;  3C66 A;  4NXW A;  1Z1V A;  1NJX A;  7ICH A;  1S5L U;  4WC6 A;  2XI9 A;  2A3V A;  1N62 A;  4NLN A;  1Q8K A;  4FZL A;  2PFQ A;  1ZQS A;  5ALQ A;  4IRD A;  3C21 A;  1RDF A;  1D8B A;  5IIO A;  5DQG A;  1BPZ A;  2ASJ A;  1WUD A;  3AU6 A;  2P6R A;  4C8L A;  1ZQI A;  4IQU A;  4O5C A;  4UAT A;  4EGW A;  2MA1 A;  2XGP A;  3RJK A;  1NK0 A;  3IG5 A;  4HX0 A;  3SEI A;  5KT3 A;  2YY6 A;  8ICX A;  5AKG A;  1ZQR A;  2WB1 C;  1GPJ A;  4F4X A;  5AKY A;  2R8H A;  3C28 A;  5AM2 A;  4MF2 A;  1KSP A;  2I5H A;  4C4T A;  3RJE A;  1B22 A;  3D2Q A;  1RQL A;  2EZY A;  1VJ5 A;  2IHM A;  1QQ6 A;  3NVW A;  3UXP A;  4KLM A;  3WFP A;  2G08 A;  3H0M B;  4FHY A;  4I2J A;  2F2A B;  4KMU A;  4QZC A;  2Y9U A;  4LVS A;  2DR5 A;  1ZQQ A;  3C1Z A;  3T5H A;  2FPK A;  1XSL A;  9ICN A;  2K8A A;  3O0F A;  4ECZ A;  3VC8 A;  2YML A;  4DOC A;  4YVZ A;  4NXT A;  3L3F X;  4MFC A;  5CFT A;  4DF8 A;  3PO4 A;  2EAP A;  2W43 A;  9ICU A;  1UA0 A;  4OJL A;  4DQI A;  4NLB A;  1A77 A;  2D6F C;  2P66 A;  2MSN A;  3RH5 A;  1MQ2 A;  4UD4 A;  1NI3 A;  1WOT A;  2I9G A;  4DQS A;  5KFC A;  9ICW A;  5DEC A;  3C2K A;  1D8L A;  3JZ0 A;  5GTH U;  2Y0S C;  5KT6 A;  5CFU A;  4AYB F;  2YMM A;  7ICS A;  4AT9 A;  2ASD A;  2E1E A;  3ICX A;  2RDI A;  5AKE A;  4RQ2 A;  4DSE A;  4BXO A;  4QZA A;  3TAP A;  5JTG A;  4Y2J A;  3K1R B;  1NJZ A;  5HRB A;  3QXG A;  2HBL A;  4WC3 A;  3RTV A;  4KN4 A;  5HP4 A;  1TK8 A;  2B51 A;  2LI6 A;  2NRT A;  2W8K A;  4OJ5 A;  2F77 X;  2PI4 A;  1QSS A;  3AEV A;  1ZD4 A;  4ECV A;  4ED8 A;  2EDU A;  3QZ7 A;  4MKP A;  4LEV A;  2KSO B;  2WF6 A;  4JV2 A;  1QSY A;  5KFI A;  4M0A A;  2H3Z A;  2DKX A;  3D2S A;  3C1Y A;  2W7O A;  1L7M A;  4R66 A;  4F4Z A;  1HJP A;  1UA1 A;  2E8N A;  5KFZ A;  4NM2 A;  3T3F A;  1TFY A;  5J2E A;  1TE2 A;  3JPT A;  5J2H A;  2HW3 A;  8ICH A;  1CRX A;  3WK5 A;  2IMW P;  1X2I A;  1YT3 A;  4DSF A;  4YCX A;  1U48 A;  4YR3 A;  3FAH A;  3BS5 A;  2M0N A;  1U9L A;  1SXE A;  1S0V A;  3Q8S B;  2FMP A;  5AIB A;  5CB1 A;  1Z00 A;  1IV8 A;  5DB9 A;  3MR3 A;  1ZYQ A;  5IIM A;  3IHQ B;  4K96 A;  4WC5 A;  2B4V A;  4DOB A;  4M6W A;  2K4E A;  4ATB A;  4A8E A;  2NO5 A;  3LWM A; 
#chains in the Genus database with same CATH homology
 3MR6 A;  3M9M B;  1R8B A;  4F4Y A;  5KFB A;  3MGI A;  4QWA A;  2C2R A;  1NO5 A;  1QLN A;  1CEZ A;  1DGS A;  5EWF A;  3PMN A;  4DL4 A;  3OSP A;  2UVU A;  5HRL A;  2W8L A;  4JV0 A;  5D46 A;  2NRV A;  2MAX A;  7ICG A;  4ED1 A;  3AQN A;  5J2J A;  3Q8Q B;  4QZE A;  1D8Y A;  9ICI A;  4X4R A;  5KG6 A;  2XCP A;  7ICO A;  3RR8 A;  1KFD A;  1Z3E B;  3C5F A;  4C8O A;  4WC4 A;  1T8E A;  2DR8 A;  7ICM A;  2ZH2 A;  5KT5 A;  1S10 A;  4J9M A;  2Q66 A;  4EYH B;  3GV5 B;  4B9V A;  4PPX A;  8ICR A;  2FLN A;  3GIK A;  4ECW A;  4O3R A;  5DB6 A;  3TAR A;  2C22 A;  1ZJN A;  4UB3 A;  4MFF A;  2VA3 A;  1K1S A;  2BKE A;  4QWE A;  1SKR A;  3OVA A;  4J9L A;  3TFR A;  1S76 D;  5HC9 A;  5F9L A;  3MFH A;  1KFT A;  1NOM A;  3OVB A;  3V7L A;  2NRW A;  1XC9 A;  3KHL A;  5JUM A;  4ECU A;  2UVR A;  2R8I A;  1F5A A;  1YLQ A;  5IIN A;  1L3T A;  1BPD A;  1NZP A;  1RXV A;  8ICU A;  3N97 B;  4O5E A;  2FMQ A;  1UET A;  3RB6 A;  4B9N A;  4DFK A;  4QWD A;  2DFL A;  5KFN A;  1JQR A;  4KLD A;  3ISB A;  2KTQ A;  1ZQZ A;  5KFF A;  3LK9 A;  4QW8 A;  2Y1I A;  4RPZ A;  5J2I A;  3QZ8 A;  1ZET A;  4B9S A;  4Z6F A;  3GIL A;  4Z6E A;  2AU0 A;  7ICP A;  4WC7 A;  4DEZ A;  4EBC A;  4F93 B;  2XCA A;  1A76 A;  1TK5 A;  4KLI A;  4I2E A;  4NXZ A;  5DKW A;  3SYZ A;  4IQW A;  4J9N A;  5KFD A;  3SZ2 A;  1UT5 A;  5KFL A;  3H4B A;  2GWS A;  9ICH A;  3WFO A;  1RPL A;  2A1J B;  2FLP A;  1ZQV A;  4YN4 A;  3KHG A;  4I2A A;  3ZD8 A;  1LV5 A;  1KTQ A;  1UT8 A;  1R8C A;  4ED6 A;  4E8F A;  4J9R A;  4PH5 A;  4KIT B;  1ZQW A;  5HML A;  1BPX A;  1Q79 A;  5KTQ A;  1NK6 A;  1UEV A;  3OJS A;  1ZQY A;  2ISP A;  1V4A A;  5KFT A;  3OUY A;  3ZDE A;  4BGD A;  5J2K A;  4P4M A;  5KFW A;  3K4G A;  4RQ8 A;  3M8R A;  5KT7 A;  4B9T A;  4NLK A;  5J0T A;  5J0X A;  5DG7 A;  1XS9 D;  4I2I A;  5TZV A;  2WTF A;  2J6T A;  3AU2 A;  1NKE A;  8ICL A;  4UD5 A;  2BGW A;  5KG0 A;  1ZQA A;  4KLS A;  5KFU A;  5L1L A;  2BCQ A;  9ICB A;  5KG5 A;  2V9W A;  7ICR A;  4I2G A;  4I29 A;  5DQI A;  2PXI A;  4ECX A;  3H37 A;  5DGB A;  3C2L A;  2KZM A;  3RAX A;  4PHE A;  1R89 A;  4F50 A;  4B9L A;  3E2E A;  5HRG A;  4RWN A;  1T3N A;  2W9C A;  2MUT B;  5J29 A;  2HHU A;  1L3V A;  5HHH A;  5HR9 A;  1ZQC A;  4DSK A;  2M2V A;  4FHX A;  3PW7 A;  2JZB B;  2BQ3 A;  4DFJ A;  3T5K A;  5BPC A;  4ECT A;  1FA0 A;  4JK1 A;  3Q8P B;  3IM1 A;  5L1K A;  3FDS A;  3PR4 A;  3TAQ A;  4I28 A;  4JV1 A;  4F5R A;  5CA7 A;  4YXM A;  3RH4 A;  9ICS A;  1KLN A;  2HHX A;  2ZHA A;  2RFF A;  2DR7 A;  4B9U A;  4DSJ A;  7ICF A;  4O0I A;  4WBZ A;  2DPJ A;  4E0D A;  1PX5 A;  3UPQ A;  4UBC A;  3ETL A;  4TUP A;  3TI0 A;  2DPI A;  8ICG A;  1B43 A;  9ICJ A;  4I2H A;  3RH6 A;  1NJY A;  1N48 A;  2BCS A;  8ICS A;  4E7X A;  4PGX A;  5J2G A;  4DFP A;  5EWG A;  5KFK A;  3JPQ A;  1U47 A;  2HHW A;  2VA8 A;  3NTU A;  5HNK A;  5J0U A;  2RDJ A;  3BJY A;  3RB3 A;  3M9N B;  1TK0 A;  4ECQ A;  7ICN A;  1R8A A;  3WFS C;  4RUA A;  1JXE A;  4J9Q A;  4IG8 A;  4Q44 A;  4BDP A;  5HRD A;  5J2D A;  3RRH A;  1NKC A;  2FLL A;  3SV3 A;  8ICW A;  3LDA A;  3RR7 A;  1ZQD A;  3WFR E;  5DBB A;  3SV4 A;  4C8K A;  4ED0 A;  2JEI A;  5KFX A;  5KT2 A;  3UPS A;  4IR9 A;  2I1Q A;  3MR2 A;  1S0M A;  2ZH1 A;  2FPM A;  1XSP A;  4QZD A;  2AGO A;  4EZ9 A;  3GIM A;  2BQR A;  3HW8 A;  2HHQ A;  3PX4 A;  1XSN A;  4NY8 A;  1LB2 B;  3HT3 A;  2HVH A;  3BQ0 A;  4F2R A;  5C5J A;  3RRG A;  4GXI A;  7ICV A;  4YD2 A;  2A1J A;  2V4Q A;  3MAB A;  3H8J A;  4DSL A;  4X4T A;  1D9F A;  3ZDC A;  2W9C B;  2PBE A;  5D4B A;  5J0R A;  3JPR A;  5CP2 A;  4F5Q A;  4S3N A;  4Q45 A;  1TFR A;  4PGY A;  2Q0Z X;  3G6Y A;  4IRC A;  1MSW D;  4O3P A;  7ICT A;  4DL6 A;  4AT8 B;  4ED2 A;  4RUC A;  2AQ0 A;  4P4P A;  4TQS A;  4FO6 A;  2BPG A;  1MC8 A;  2KP7 A;  3HIY A;  4X4O A;  4RPY A;  1T4G A;  2W9M A;  9ICT A;  4AT7 A;  2AGQ A;  1ZQO A;  4RQ6 A;  3ZDA A;  7ICI A;  1KFS A;  3PML A;  4PHA A;  4QWB A;  3C2M A;  4TQR A;  3V6K A;  1KNY A;  2NRZ A;  5J0Y A;  3PO5 A;  1ZQK A;  3G6X A;  2BE3 A;  1S9F A;  4M5D A;  1BPY A;  3HJ1 A;  4ED3 A;  4UB4 A;  1JX4 A;  3TFS A;  2C2E A;  2MUT A;  1SZP A;  4RZR A;  5DB7 A;  3B0Y A;  1DOQ A;  5KFP A;  3RBD A;  4K4H A;  4M9J A;  4KLJ A;  5F2V O;  2VAN A;  5L9X A;  1IM4 A;  2JZB A;  5KG2 A;  2B21 A;  5KFE A;  4YP3 A;  3EWA A;  4DF4 A;  3RJI A;  5HRE A;  4RWO A;  1ZQU A;  4P4O A;  5DB8 A;  4YR0 A;  1BPE A;  4UAZ A;  3QEA Z;  4X4S A;  4O9M A;  4I2D A;  5DLG A;  4O3Q A;  4DO9 A;  4FH3 A;  4F5O A;  4YXJ A;  3PY8 A;  4P2H A;  3HP6 A;  4F8R A;  4QZ9 A;  5BOL A;  4RT3 A;  8ICT A;  8ICO A;  5KFS A;  3KHR A;  2M2U A;  5HRB A;  3T5L A;  4XA5 A;  4PGQ A;  2HHS A;  4KLO A;  5HMM A;  9ICR A;  4UQG A;  5DG9 A;  4RU9 A;  3JPP A;  4RQ7 A;  1T7P A;  8ICM A;  1OU5 A;  1VFG A;  2ZTD A;  3JPO A;  3EPI A;  2JEF A;  4DLG A;  3QE9 Y;  1SL1 A;  4M9G A;  3OHA A;  5DQH A;  4M04 A;  2BHN A;  4DLE A;  2DVI A;  2HHP A;  3JYY A;  2ZJA A;  5KFR A;  3PR5 B;  2XGQ A;  5J2A A;  1XU4 A;  1U4B A;  4CCH A;  3PW4 A;  4GC6 A;  4KLF A;  4FHW A;  1NK8 A;  4E80 A;  3AQK A;  1KRP A;  5DGA A;  1KDH A;  1ZQN A;  5DED A;  3B0X A;  4J9K A;  2F1H A;  5CR0 A;  1SL0 A;  2PFP A;  2IA6 A;  1NK7 A;  1MIW A;  1PZN A;  3GII A;  8ICI A;  4F5P A;  2M2T A;  4RQ0 A;  4F5N A;  2DRB A;  1BNP A;  2BQU A;  7ICU A;  4TUR A;  3V6J A;  2DRA A;  2ZTE A;  3GDX A;  2XY5 A;  1ZQT A;  4EP7 A;  2BCV A;  1U45 A;  3EPG A;  1TAQ A;  4IR1 A;  9ICQ A;  2M2W A;  2ALZ A;  4IQT A;  4FS1 A;  1JN3 A;  3FYH A;  2ZUB A;  4QWC A;  2W9A A;  3KHH A;  2XY7 A;  8ICC A;  1RYR A;  3UXN A;  4DQQ A;  2C2D A;  3Q8L A;  3ZD9 A;  2P6U A;  1COO A;  2J6U A;  4O3O A;  4J9O A;  1NKB A;  8ICN A;  1ZQG A;  1CUK A;  1RXW A;  1ZJM A;  3K75 D;  4RQ3 A;  3BQ2 A;  4I2C A;  5J0P A;  4EYI B;  4UB2 A;  2FPL A;  3V72 A;  3TAN A;  3MR5 A;  2ZH8 A;  1XWL A;  4YMM A;  1BPB A;  4RNO A;  2R8K A;  3L9D A;  3NYB A;  4AT8 A;  4DL7 A;  5F9N A;  4C8M A;  3PNC A;  4DQR A;  1ZQF A;  2ATL A;  4K4I A;  4KLQ A;  3M8S A;  5HRK A;  1S0N A;  2ZJ5 A;  4DS5 A;  4JWN A;  4M2Y A;  9ICK A;  4EBJ A;  5J0O A;  1NK4 A;  5IIJ A;  4I27 A;  9ICL A;  3M9O B;  5DDM A;  1L3S A;  5D49 A;  1V9P A;  3H8W A;  2XY6 A;  4M9H A;  3NGD A;  2HVI A;  1U49 A;  4WCW A;  8ICF A;  4ECY A;  3RB0 A;  3H3A A;  3N4M B;  4ZH4 A;  3H40 A;  1TFW A;  1D9D A;  5HHI A;  4EZ6 A;  4Q8E A;  3LWL A;  4QZ8 A;  4FH5 A;  4MF8 A;  5KFY A;  2ZH5 A;  5EOZ A;  2PFO A;  3Q8K A;  2KFN A;  2OWO A;  1BNO A;  4KLG A;  4PHD A;  4J9S A;  3ISC A;  3RB4 A;  1JXL A;  3C66 A;  5KG1 A;  4ELV A;  5CWR A;  8ICZ A;  1NJX A;  4X0A A;  4I2F A;  7ICH A;  3HJ4 A;  2AQ4 A;  4WC6 A;  1MQ3 A;  5IIK A;  4Q43 A;  3KTQ A;  3OJU A;  9ICA A;  4NKT A;  9ICG A;  4X4Q A;  5KG3 A;  2AGP A;  4NLN A;  2ZH4 A;  9ICP A;  5DBA A;  4FS2 A;  4F92 B;  2PFQ A;  3RJF A;  3HPO A;  4X4V A;  2JEJ A;  1ZQS A;  1ZQH A;  4YMO A;  4NLZ A;  1L3U A;  4IRD A;  3BQ1 A;  3C21 A;  2PI5 A;  5KFO A;  4R65 A;  4XQ7 A;  1DK2 A;  9ICE A;  8ICA A;  3PX6 A;  2UVW A;  5IIO A;  4MFA A;  4FBU A;  5DQG A;  1SKS A;  1BPZ A;  7ICQ A;  2ASJ A;  3RBE A;  4FBT A;  9ICF A;  4RQ1 A;  4LZD A;  4UB5 A;  2KN7 A;  4GC7 A;  4UB1 A;  3AU6 A;  2P6R A;  4FHP A;  4C8L A;  4M9L A;  4AT9 B;  2PFN A;  5J2B A;  8ICV A;  4UBB A;  1ZQI A;  3PW5 A;  4IQU A;  4O5C A;  4BXO B;  4I2B A;  3AUO A;  2XGP A;  1S0O A;  4DSI A;  3RJK A;  1NK0 A;  5DLF A;  4IRK A;  5KT3 A;  4M9N A;  8ICX A;  2ZUC A;  2BR0 A;  3JPS A;  2ZH6 A;  4LT6 A;  1ARO P;  1ZQR A;  4F4X A;  5HRH A;  3HX0 A;  2R8H A;  4NM1 A;  4DQP A;  7ICE A;  4MF2 A;  2HHV A;  4XUS A;  2F1I A;  3UQ2 A;  4KLL A;  3OV7 A;  4JUZ A;  3V6H A;  3TQ1 A;  1KSP A;  2XC9 A;  2R8J A;  4M47 A;  1UEU A;  4X4U A;  1JIH A;  3RJE A;  4KLU A;  9ICO A;  2KFZ A;  5III A;  5KFM A;  1XO1 A;  4EEY A;  9ICM A;  1B22 A;  4X0B A;  1L5U A;  5CJ7 A;  2V4R A;  4WC0 A;  3BQT A;  2IHM A;  4NKU A;  3OSN A;  3UXP A;  4KLM A;  1EXN A;  3OHB A;  3MDA A;  2BPF A;  4F4K A;  3Q8R B;  1H38 A;  3ZDD A;  3RJH A;  4RT2 A;  2XO7 A;  2JEG A;  4KN7 A;  4QZH A;  3THV A;  3SI8 A;  2IHN A;  8ICB A;  3WFP A;  4R8U B;  2W9B B;  1HUO A;  4GLX A;  1DK3 A;  4FHY A;  4I2J A;  4KMU A;  4J9P A;  3AQM A;  1Q78 A;  4QZC A;  1HUZ A;  4RPX A;  1ZQE A;  4ECR A;  4MEX A;  3OVS A;  4LVS A;  2DR5 A;  3PW2 A;  4O3N A;  3EYZ A;  3C1Z A;  4EBD A;  3RAQ A;  1WCN A;  1ZQQ A;  2BPC A;  4Z6D A;  3V7J A;  3T5H A;  4DFM A;  3JPN A;  2FPK A;  1XSL A;  5J0Q A;  5DBC A;  8ICK A;  4NLG A;  4PHP A;  1SKW A;  9ICN A;  4ECZ A;  1ZQP A;  5KFQ A;  1RZT A;  1Y88 A;  4R63 A;  4ECS A;  3UQ0 A;  4DS4 A;  5KG7 A;  4DOC A;  4MEY A;  4K4G A;  4YVZ A;  2M9N A;  3V7K A;  4F4W A;  8ICE A;  4MFC A;  5KFJ A;  4DF8 A;  4XQ8 A;  4YR2 A;  3PO4 A;  1JAJ A;  2AJQ A;  7ICK A;  1X9M A;  9ICU A;  4AT7 B;  3H7I A;  5DDY A;  4TUS A;  1UA0 A;  4DQI A;  4GXK A;  8ICQ A;  3C5G A;  1A77 A;  1MIY A;  4FHV A;  4Z6C A;  4BWM A;  1WCL A;  2F1J A;  1TVA A;  5L1I A;  3RH5 A;  2P66 A;  9ICX A;  4RNN A;  3EW9 A;  1SL2 A;  1Z00 B;  4TUQ A;  1MQ2 A;  3RJG A;  3C18 A;  4UD4 A;  1WOT A;  4O5K A;  4DL3 A;  2I9G A;  1S77 D;  1MIV A;  3H38 A;  3AQL A;  4XRH A;  4DQS A;  4DL5 A;  1X9W A;  5KFC A;  1RYS A;  3BDP A;  4KLH A;  4YQW A;  3H8S A;  2J6S A;  9ICW A;  5DEC A;  3C2K A;  4M6W B;  4RQ4 A;  2Y1J A;  4G3I A;  1D8L A;  3JZ0 A;  5KT6 A;  3Q8M A;  4ATB B;  9ICV A;  7ICS A;  4AT9 A;  5L1J A;  3QEB Z;  5J0W A;  4ED7 A;  2ASD A;  3GV7 B;  5KT4 A;  3OGU A;  1VJ7 A;  2RDI A;  5KFV A;  4EBE A;  5DG8 A;  4RQ2 A;  3MDC A;  3H4D A;  4DSE A;  4BXO A;  4QZA A;  3PW0 A;  3EZ5 A;  3TAP A;  4O3S A;  4QZG A;  1ZQJ A;  3ISD A;  4YMN A;  1NK5 A;  3PVX A;  1TKD A;  4KLT A;  1N56 A;  1NJZ A;  5J2F A;  3T5J A;  1NJW A;  2R8G A;  4QZF A;  4DWI A;  4KLE A;  4QZB A;  2HHT A;  4WBY A;  2ZH9 A;  4WC3 A;  4X4P A;  3RTV A;  2ZHB A;  3PX0 A;  4KN4 A;  7ICJ A;  5HP4 A;  1TK8 A;  2ISO A;  4RNM A;  2VA2 A;  4WC1 A;  3PV8 A;  1ZQX A;  2NRT A;  2W8K A;  4GXJ A;  3H39 A;  2ZH7 A;  2PI4 A;  3GV8 B;  1QSS A;  2ID1 A;  1ZQM A;  1K1Q A;  4BWJ A;  8ICJ A;  4ECV A;  2ZJ8 A;  4YG2 A;  4ED8 A;  2ZH3 A;  3QZ7 A;  2ZUD A;  4LZG A;  4F91 B;  2O1P A;  7ICL A;  1JMS A;  4C8N A;  3MBY A;  4QZI A;  4X5V A;  2BCU A;  4JV2 A;  3GQC A;  3C23 A;  4R8U A;  1QSY A;  5KFI A;  5KG4 A;  2W9B A;  5IIL A;  4M0A A;  1BGX T;  4QW9 A;  3MFI A;  1BVS A;  3HWT A;  1S97 A;  4EBK A;  3LQC B;  3WFQ E;  3RJJ A;  3C1Y A;  3UXO A;  4R66 A;  2NRK A;  1NK9 A;  3MGH A;  4F4Z A;  4Q8F A;  2BCR A;  2KZZ A;  1HJP A;  1UA1 A;  4KTQ A;  4X4N A;  2DR9 A;  1ZQB A;  4WC2 A;  5KFZ A;  2ASL A;  4NM2 A;  3T3F A;  2UVV A;  1TFY A;  3ORY A;  5BOM A;  3GIJ A;  5J2E A;  2FMS A;  2HW3 A;  3JPT A;  5J0S A;  5J2H A;  4ELU A;  8ICH A;  4R64 A;  2ZTC A;  4YD1 A;  2IBK A;  2IMW P;  1X2I A;  4JWM A;  4DOA A;  5KFH A;  4DSF A;  4UAW A;  4YCX A;  1U48 A;  4UAY A;  5KFA A;  2O5A A;  4YR3 A;  4IQV A;  2KZ3 A;  5HRI A;  4RWP A;  1QTM A;  1U9L A;  5HRF A;  3OUY B;  5J2C A;  1S0V A;  3Q8S B;  2H5X A;  5CHG A;  2FMP A;  5CB1 A;  4RWQ A;  4ELT A;  1IXR A;  1Z00 A;  5DB9 A;  3MR3 A;  2C28 A;  2BDP A;  1C7Y A;  1ZYQ A;  1QSL A;  3GFK B;  5IIM A;  2NRX A;  3IHQ B;  3G6V A;  1TV9 A;  1TAU A;  8ICP A;  4WC5 A;  4DOB A;  4B9M A;  2LYH A;  4M6W A;  1KEJ A;  4F2S A;  8ICY A;  4ATB A;  5KFG A;  1ZQL A;  3ZDB A;  4HYK A;  4YFK A;  1X9S A;  3LWM A;  4F3O A;  9ICC A;  4DL2 A;  5EWE A;  4RQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...