4KLTA

Dna polymerase beta mismatched product complex with mn2+, 30 min
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
326
structure length
314
Chain Sequence
b'TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTTKQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Observing a DNA polymerase choose right from wrong.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 104
structure length 314
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4kltA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4kltA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4kltA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4kltA03
3QEAZ 3ZD9A 4XA5A 1ZQMA 4KLQA 2DPJA 1Q78A 2BDPA 2JEIA 1BPBA 5J0PA 1XS9D 5KG1A 4ECWA 4DOCA 1BGXT 5HRLA 2DRBA 2BCRA 4K4IA 3JPRA 3C2MA 1SL2A 3HPOA 4Q8FA 8ICUA 5KFPA 5KT2A 5J0OA 1NK8A 3HJ4A 2HHXA 5KFHA 4GXIA 4RQ1A 2BCQA 4EBDA 1UEUA 3NGDA 8ICFA 2ZH4A 4ELVA 3ZD8A 2FLPA 2W9CB 3PW0A 3PX6A 4X0BA 5BPCA 4FBUA 2V4QA 2VA3A 4DQIA 4GXJA 2AGPA 2DR9A 5KTQA 4RQ0A 5KFVA 3RBDA 4IR1A 2H5XA 1ZQGA 8ICXA 3RH6A 3EPIA 2M2VA 2UVRA 1NK5A 1ZQJA 1ZQHA 3GIKA 4RPZA 1SL1A 2ATLA 4QZAA 2HHSA 8ICPA 3V6KA 3RJGA 3H8SA 5KFKA 4KLGA 4LZDA 5KFNA 1DK3A 4KLUA 1WOTA 4ED2A 3AUOA 1NJZA 4JK1A 4MEXA 2FMQA 4IRCA 3GV7B 3QEBZ 3TQ1A 1K1SA 4B9SA 4YFKA 1RPLA 4IQWA 9ICBA 3MFIA 3PW4A 7ICLA 2MAXA 4O3QA 4RQ4A 4KN7A 4M6WB 3OV7A 2DR8A 4O3NA 3BQ2A 2ZH9A 5IIOA 1BPZA 2HVIA 4KLEA 1JXEA 4JUZA 1HUZA 1N56A 8ICMA 4MFCA 4KLLA 2Y1IA 3C21A 1B22A 1TFWA 1ZQVA 5J2KA 4O0IA 3MGIA 1ZQIA 2ZJAA 1ZQPA 4FHXA 1KFDA 1V4AA 2W9AA 2R8GA 3RJHA 3JPNA 4UB3A 4ECVA 5HRDA 4DFMA 1MQ3A 2ZH1A 4QZEA 3L9DA 3TFRA 3Q8QB 2FPLA 2XGPA 3GIMA 1BNPA 5KFDA 5J2AA 4KLIA 8ICKA 3C1YA 4FO6A 1V9PA 2KZZA 4DOBA 2Y1JA 1ZQFA 4EEYA 4WBYA 9ICRA 3N97B 4KLJA 3KHGA 1R8BA 3H4DA 1NJXA 2AU0A 1CEZA 3WFSC 1ZQKA 4PHEA 3M8RA 1DOQA 3UQ2A 4I27A 2DR7A 3Q8PB 2V9WA 2XCAA 4UD5A 4B9LA 4ECRA 3N4MB 3JPTA 5KFYA 5J2JA 2ZJ5A 4RPYA 5KFBA 4MF8A 3OGUA 3GIJA 4FBTA 2ID1A 4BWJA 2PXIA 5HRFA 4J9RA 1YLQA 5IIMA 4IG8A 5F9NA 3ZDAA 4O3PA 5DGBA 3RJKA 2AGQA 2PFNA 5HR9A 3V72A 3RB6A 2PFOA 4JV1A 3Q8RB 5HMLA 5EWEA 4DQQA 7ICFA 5HRIA 4PHDA 4UD4A 1S77D 3QZ8A 4RNMA 1R89A 3BJYA 4F4WA 1D8LA 9ICTA 1DGSA 4YVZA 1S0VA 2FLNA 4BWMA 4GC6A 2NRXA 4DO9A 4ECSA 4DFKA 1CUKA 2IA6A 4UB2A 1S0OA 4I2EA 4X5VA 4F91B 1NK4A 4AT8B 3M9OB 2ASDA 3C2LA 3ZDEA 4QW8A 5J2EA 4EYIB 4ECTA 2M2UA 4WBZA 4I2HA 1ZQYA 2BCVA 4WC4A 1COOA 1TK5A 3KHHA 2ZH6A 2AGOA 4DQSA 8ICQA 8ICAA 1PX5A 2F1JA 2IHNA 1JN3A 3B0YA 1ZQBA 1KSPA 7ICTA 4O3SA 4C8OA 1XWLA 9ICAA 2FMPA 5DQGA 1UA1A 4C8LA 4ED8A 5D4BA 4E7XA 4YN4A 8ICBA 4DEZA 4ED0A 5DBAA 5HNKA 5BOLA 2UVWA 5KG0A 4X4QA 4M9HA 4QW9A 1XSPA 1X9SA 5J0TA 4M47A 2BCSA 1D9DA 3JPPA 1UEVA 1MIWA 1IXRA 2FPKA 5KG3A 4QZ9A 4B9NA 2A1JB 4UBBA 1RZTA 4DQPA 5HRGA 1S0MA 1U9LA 2M9NA 5J0UA 5KT5A 1ZQUA 5KFXA 2P6UA 4ED6A 4B9VA 7ICJA 2ZHBA 4BXOB 5J2GA 4K4GA 1QSSA 2KZ3A 2GWSA 2C2EA 1Q79A 5KT3A 4JV2A 1NK0A 4AT7B 4WC5A 2ZJ8A 3ISBA 1NKEA 1TAUA 1SKWA 4FHWA 2KTQA 4J9MA 2DVIA 3HWTA 1NKCA 2ZH8A 4RWNA 2BGWA 1HUOA 2WTFA 1ZQXA 4I2DA 4QWAA 3M8SA 4O3OA 4NM1A 5D49A 1SKSA 4XQ7A 4RQ7A 4ECYA 4X4UA 1RYSA 5DECA 4RQ5A 1TFYA 1L3UA 4B9MA 5KT4A 1NJWA 1TFRA 2P6RA 3PMNA 2C2RA 2M2WA 3V7JA 1TAQA 4QWBA 4QZHA 5KFOA 3H7IA 4KN4A 1BPYA 1KDHA 4YCXA 9ICVA 1T7PA 2XY6A 2P66A 3LWLA 2IHMA 4UAZA 2IMWP 1H38A 3FYHA 4IQUA 4MEYA 3T5JA 2J6UA 4KTQA 5J0XA 4KLDA 4RQ3A 2W9CA 4YQWA 4YR0A 4C8MA 2BHNA 4TURA 4DL2A 5HHIA 2ALZA 4IRDA 5L1IA 8ICJA 9ICIA 2PI4A 5DG9A 3GDXA 3AQNA 5CHGA 3PV8A 2BQUA 5KFUA 4M9GA 4WC0A 2NRVA 4KLTA 1PZNA 5TZVA 8ICHA 5CR0A 4G3IA 2ZUCA 4M5DA 3HIYA 1D9FA 3PO5A 4DSKA 3NYBA 3SV3A 3TI0A 3G6XA 2BPGA 4CCHA 9ICJA 3IM1A 4UAYA 8ICCA 1D8YA 3RBEA 3TAQA 3H37A 4X4PA 4TUQA 4F92B 4MFFA 5C5JA 4Q43A 9ICOA 1C7YA 3GFKB 4M6WA 8ICSA 4EBCA 5DKWA 5F2VO 4J9SA 1XSLA 3KHLA 4Q44A 3MR3A 1ZJNA 5KFLA 4E8FA 1ZJMA 4EP7A 4M9LA 3UQ0A 1RXVA 3C1ZA 4R65A 2ISPA 4RWOA 4GXKA 8ICIA 4RUCA 4DFJA 1QTMA 4FHPA 1KEJA 1MIVA 2ZH2A 5DG8A 1BVSA 9ICHA 4RNOA 4FS2A 2VA8A 3UXNA 4X4OA 1NO5A 2KFZA 1S76D 3TAPA 4M04A 4WC6A 4R8UA 1KLNA 4R8UB 1U4BA 4DS4A 3IHQB 5CJ7A 4F3OA 1S97A 5HREA 3OHAA 4QZBA 4WC3A 4KITB 3OJSA 4F50A 5HP4A 3ETLA 9ICFA 4YD1A 4DSEA 3K4GA 4LZGA 4PGQA 1ZQWA 1S10A 4JV0A 4TQSA 2V4RA 1LV5A 3RJEA 9ICSA 5CWRA 5DG7A 4WCWA 4RQ8A 1L5UA 4BGDA 1WCNA 3KTQA 7ICHA 2MUTB 5J2FA 1EXNA 4QWDA 4I2GA 1RYRA 3MBYA 3G6YA 3LDAA 4Q45A 2XO7A 5BOMA 3Q8SB 3PW2A 4UB4A 2C2DA 3ZDBA 1Z00B 2HHQA 3HJ1A 8ICLA 5KFSA 4ATBB 4JWMA 4R63A 5D46A 1L3TA 4NKUA 8ICTA 3OUYA 1TK0A 3OUYB 1T4GA 5F9LA 3H3AA 7ICSA 4QZCA 1ZQCA 4EBJA 4LT6A 3TARA 9ICWA 4C8KA 2PI5A 1AROP 4F5QA 4YXMA 3EPGA 7ICMA 4ED7A 1UA0A 7ICGA 1SZPA 4IR9A 2ZH5A 4YMOA 3QZ7A 1DK2A 3AQMA 2F1HA 5KT7A 5HMMA 3RRGA 1JMSA 4M2YA 1X9MA 3MFHA 2FPMA 5KG6A 1Z3EB 3M9NB 3RAQA 4O5CA 4DSLA 9ICGA 5J0RA 4AT8A 2JZBA 2KZMA 2JZBB 4KLSA 2NRZA 3ZDCA 2HHPA 1A77A 4YD2A 3RB0A 1ZQTA 3H8JA 9ICLA 2ASLA 4EZ6A 5KFWA 1JAJA 3UXPA 2ASJA 2HHTA 3PW5A 2HHVA 1KFSA 8ICOA 4LVSA 5DBCA 1R8AA 3WFOA 5KFIA 3GV8B 4Z6FA 4X0AA 5J0YA 4UB1A 4DSIA 1MQ2A 3RTVA 1MIYA 3V6JA 4XQ8A 4NLKA 4AT9B 4F8RA 1QSYA 4O5KA 2R8JA 3GILA 4TQRA 2BR0A 1UT8A 4B9TA 5CB1A 4UB5A 4I2AA 4F4KA 4FHVA 2A1JA 4TUPA 4DWIA 1JQRA 2J6SA 2JEFA 4I29A 4I2CA 1KNYA 9ICEA 3NTUA 4MFAA 4BXOA 5EWFA 1A76A 3ISCA 4F4ZA 2JEGA 3RH5A 4I2BA 8ICNA 2RDIA 3PVXA 4AT7A 3EW9A 4YR3A 2RFFA 3BDPA 3RB3A 1QSLA 4M9JA 5IIKA 3RB4A 1NJYA 1X9WA 1KTQA 2B21A 5KG2A 3MR2A 1MC8A 2BQ3A 2W9BB 3WFPA 5IIIA 3RAXA 1K1QA 3PY8A 4I28A 5J2DA 1R8CA 4DL7A 9ICXA 2XC9A 1ZQLA 3MR6A 4MF2A 2M2TA 3GQCA 2R8HA 4DF4A 5KFEA 3V7LA 5IILA 4KLFA 1MSWD 2OWOA 5HC9A 5KFJA 5KFZA 4EBKA 1UT5A 5J0WA 3OSNA 4DFPA 4R66A 3WFQE 4DL6A 4M9NA 1RXWA 4KLHA 4PPXA 3E2EA 4I2IA 4IQVA 5HHHA 2BE3A 4DLGA 5DGAA 3MR5A 2F1IA 2W9MA 4QZIA 1WCLA 4DSJA 3RH4A 2AJQA 5EOZA 1ZQEA 4QZ8A 5KG4A 1L3SA 3PNCA 3C2KA 2AQ0A 2DFLA 2UVUA 4JWNA 1U48A 5KFGA 2C28A 1ZETA 1QLNA 3ORYA 5J2IA 4XUSA 1N48A 2HHUA 8ICGA 1VFGA 2BQRA 3K75D 9ICMA 4J9PA 7ICEA 7ICUA 5IIJA 4QWCA 3C18A 7ICRA 1NK9A 1ZYQA 1F5AA 1ZQZA 3UXOA 4E0DA 4K4HA 4YMNA 2PBEA 4E80A 3JPOA 3AU2A 4YG2A 4RUAA 4DQRA 5KFAA 4RU9A 2W8KA 3V7KA 4I2FA 7ICOA 3TANA 4QZFA 4ZH4A 4ECUA 2HHWA 1TK8A 2PFPA 5DB9A 9ICUA 4FHYA 4RWPA 4EZ9A 3JZ0A 1X2IA 3JPSA 3THVA 4J9NA 3Q8LA 2XGQA 3H39A 3MGHA 2ZTCA 4ECZA 4WC1A 1ZQDA 5L1JA 4DL3A 3QE9Y 5KFCA 3GIIA 5DB6A 4ED1A 2R8KA 4F4XA 5KT6A 4QWEA 3V6HA 2ZTDA 3LWMA 1ZQSA 1OU5A 3T5HA 5KG5A 5J0QA 4RZRA 3HX0A 4O9MA 4YMMA 3AU6A 2VA2A 2NRKA 4RQ6A 4KLOA 3LK9A 1U47A 4NLGA 4J9LA 2UVVA 2KP7A 1NOMA 4S3NA 3PX4A 1S9FA 4RT3A 4RPXA 3H38A 4X4VA 5DQIA 5J2CA 1NKBA 3HW8A 4O3RA 8ICYA 8ICZA 4X4RA 4UAWA 4WC2A 3PO4A 3EWAA 4Z6DA 3ZDDA 7ICNA 4F4YA 4DLEA 3SYZA 5IINA 4ELTA 4F93B 3OJUA 4J9OA 4IQTA 4ECQA 5DB7A 1NK7A 4NKTA 5DLFA 3OVBA 1TVAA 3GV5B 4PGXA 4Z6CA 5DDMA 2I1QA 1ZQOA 5KG7A 3C5GA 4P2HA 1TKDA 4Q8EA 3AQLA 3FDSA 3PMLA 4YR2A 8ICRA 4P4MA 4F5NA 3T5LA 1XO1A 1HJPA 2MUTA 5J29A 4QZDA 2HVHA 7ICKA 4F5RA 3SI8A 2DR5A 1NK6A 8ICEA 3Q8KA 4B9UA 3EZ5A 1ZQNA 4NM2A 1Z00A 4PGYA 4X4NA 4KMUA 4RQ2A 3RRHA 4QZGA 4HYKA 4NY8A 4ATBA 4TUSA 4WC7A 1BNOA 4RNNA 3UPQA 2I9GA 3KHRA 1S0NA 2ZTEA 7ICQA 1SKRA 4PH5A 3JYYA 1IM4A 4F5OA 5DB8A 1T3NA 3TFSA 4FH5A 3RJFA 3JPQA 2FLLA 2NRTA 3MDCA 3H4BA 4O5EA 4DF8A 4GLXA 3OSPA 1TV9A 4IRKA 3LQCB 1XU4A 3RJIA 3OVSA 4BDPA 4KLMA 5DDYA 3SZ2A 5KFFA 4YP3A 3SV4A 3BQ0A 3MDAA 1KFTA 4PHPA 4FS1A 1JIHA 2XY7A 4P4PA 2Q0ZX 4NLZA 7ICIA 1XC9A 9ICQA 2FMSA 5J2BA 4GC7A 3RR7A 3C23A 4UBCA 1XSNA 9ICCA 5L1LA 5DEDA 4F5PA 1U49A 1UETA 1B43A 5DQHA 4I2JA 1T8EA 2KFNA 1KRPA 3G6VA 2ISOA 2BPFA 2J6TA 3PR4A 1BPDA 1JX4A 3ISDA 2JEJA 4AT9A 3H8WA 2PFQA 8ICVA 7ICPA 4UQGA 4PHAA 5J0SA 4Z6EA 2BCUA 1BPEA 3OVAA 3BQ1A 4ED3A 3HT3A 3BQTA 4ECXA 7ICVA 4EBEA 4EYHB 3RJJA 5DBBA 3Q8MA 9ICKA 4RWQA 2ZH7A 3MABA 4P4OA 5KFMA 8ICWA 3PR5B 2R8IA 2XY5A 3AQKA 4NLNA 5L1KA 1ZQRA 1LB2B 4F2RA 1NZPA 3T3FA 2LYHA 5KFRA 3B0XA 5CP2A 2ZH3A 4M0AA 1L3VA 2ZHAA 4FH3A 4C8NA 3C5FA 5CA7A 3PW7A 2W9BA 2XCPA 1Y88A 4J9QA 4DSFA 4DL5A 2NRWA 2O5AA 3HP6A 3T5KA 1ZQAA 1FA0A 2KN7A 3EYZA 1SL0A 5J2HA 4RT2A 2AQ4A 2BKEA 5KFTA 4YXJA 5JUMA 5HRBA 5HRHA 3UPSA 2C22A 4XRHA 4DS5A 4ELUA 2W8LA 2IBKA 3C66A 1ZQQA 4DL4A 2RDJA 3PX0A 2DPIA 5DLGA 1U45A 3RR8A 3M9MB 4R64A 5HRKA 2DRAA 2Q66A 9ICNA 3OHBA 4NXZA 1BPXA 5KFQA 4X4TA 2ZUDA 2O1PA 5EWGA 4DOAA 1JXLA 9ICPA 2HW3A 1VJ7A 3WFRE 4X4SA 2ZUBA 4F2SA 3H40A 2BPCA 4J9KA 5L9XA 2VANA
chains in the Genus database with same CATH superfamily
5AICA 5ALQA 1Q78A 3CK6A 1XS9D 1KQQA 1KBUA 1BGXT 3C2MA 3HPOA 5AI6A 5AIBA 2HHXA 2BCQA 8ICFA 2ZH4A 2W9CB 3PX6A 2WHEA 5BPCA 2V4QA 1JI7A 2VA3A 2DR9A 4QIWC 5KTQA 2H5XA 3RH6A 3EPIA 1NK5A 2D6FC 4RPZA 1SL1A 2ATLA 2HHSA 5AM5A 8ICPA 3V6KA 3H0MB 5KFKA 2KKVA 2ODGA 1UEUA 4IQWA 1ZOLA 2YY6A 3OWGA 4KN7A 3WK6A 3OV7A 4HX0A 3BQ2A 3J81j 1JXEA 5EE1A 8ICMA 4NL9C 1TFWA 1ZQVA 5E79U 2W9AA 3RJHA 1OW5A 1JALA 2FE9A 5J2AA 4KLIA 4FO6A 2K4PA 4DOBA 2Y1JA 3DV9A 1ZQFA 4EEYA 5AHXA 2QB1A 3N97B 3H4DA 1NJXA 2AU0A 4PHEA 1DOQA 1RQLA 2V9WA 1ZQ1C 4NXVA 2LPEA 2DKZA 4JMUA 4MF8A 5HRFA 1Q46A 5F9NA 5DGBA 5HR9A 3RB6A 2A1AA 4DQQA 5HRIA 3I28A 4RNMA 3DDHA 9ICTA 2ZG6A 2ZIWB 4YVZA 1S0VA 4FZMA 2D8CA 4BWMA 4UB2A 4F91B 1NK4A 3M9OB 4UASA 4I2HA 1ZQYA 2BCVA 1WYGA 3B0YA 1KSPA 4O3SA 2FMPA 5D62A 2PKEA 1DXSA 5BOLA 4M9HA 3L3FX 1UEVA 1MIWA 4B9NA 2A1JB 1RZTA 1S0MA 2M9NA 4WQLA 5KFXA 2ZHBA 4BXOB 2I5HA 5AM2A 2GWSA 4JV2A 2HDOA 2DVIA 5J8YA 1ZQXA 4NM1A 3A0BU 1SKSA 2FI1A 4WJ3B 1L3UA 2P6RA 3PMNA 1TAQA 4QWBA 3H7IA 9ICVA 4P0QA 3NRZA 2IMWP 3NASA 4QNLA 4MEYA 3T5JA 1H38A 2J6UA 4K8VA 4YR0A 2BHNA 2LHTA 4DL2A 2KSOA 4Y2QA 3ALRA 5DG9A 3GDXA 3PV8A 1JROA 4ACOA 5TZVA 1V97A 2PMZF 5F3XB 5CR0A 2HBLA 3KBBA 4QIWF 3G6XA 2YB1A 4UAYA 8ICCA 2H3QA 9ICOA 4Q43A 4RQNA 2GA9D 4J9SA 2LM1A 2KNJA 2KOBA 4Y2RA 3KHLA 1ZJMA 3UQ0A 2P35A 1QQ5A 5AM1A 4R65A 1RXVA 2OM6A 8ICIA 2HBMA 1SXEA 5AKHA 5DG8A 2QLTA 3RFAA 2VA8A 1NO5A 1RM6C 4R8UA 4R8UB 2LM4A 5AKEA 1S97A 3OHAA 4WC3A 3OJSA 5ALLA 4DSEA 3FC4A 4PGQA 2W03A 1X6IA 3RJEA 9ICSA 5ALJA 7ICHA 3R9KA 3KTQA 2MUTB 5J2FA 1EXNA 4QWDA 2QB0B 1RYRA 5AIAA 5AK3A 3G6YA 3BQ7A 3LDAA 4Q45A 3PW2A 2C2DA 3ZDBA 8ICLA 5AM0A 1L3TA 3OUYA 1TK0A 3OUYB 1ZQCA 2K4IA 3SEIA 4F5QA 1UA0A 4IR9A 2KVCA 2ZH5A 5ALUA 1X9MA 2MSNA 3VCBA 1SWWA 4KMOB 3RF9A 3QUCA 3WK5A 4KLSA 3ZDCA 2HHPA 3SENA 4NJ8A 5ALDA 4NXXA 9ICLA 5KFWA 4OJLA 3UXPA 4Z6FA 2F77X 4X0AA 5B66U 5J0YA 3H0RB 4DSIA 1MIYA 4NLKA 5AKGA 2EWRA 1QQ7A 4F8RA 2DKXA 2JEFA 3UMBA 5JTIA 1KNYA 9ICEA 3NTUA 4OD0A 2E3TA 2XI9A 3ISCA 2JEGA 2RDIA 2JR5A 1QSLA 1NJYA 3MR2A 3WFPA 5ALOA 5IIIA 3PY8A 4I28A 2YMMA 4NL9A 2XC9A 4MF2A 2M2TA 2R8HA 1SWVA 5KFEA 4KLFA 4UB8U 3QU7A 2EZZA 4BX9C 1IV8A 5HC9A 5KFJA 4DFPA 3A0HU 3IN5A 3OTQA 3E2EA 5DGAA 4QZIA 3SAHA 4KX5A 3PNCA 2AQ0A 1R8AA 1N48A 8ICGA 2W43A 1RG6A 3K75D 7ICEA 1NK9A 4E0DA 2FCLA 3JPOA 3AU2A 4YG2A 2OXOA 2W8KA 1HIWA 2Q66A 4QZFA 4ECUA 2G5HB 3JZ0A 1X2IA 3Q8LA 2XGQA 1Z19A 3H39A 4ECZA 4WC1A 1ZQDA 4F4XA 4JB3A 2ZTDA 5KG5A 3HX0A 3IRUA 5C0YA 3LK9A 1U47A 2UVVA 2RRDA 3PX4A 1S9FA 4RPXA 3H38A 4X4VA 8ICYA 4UAWA 4F4YA 4DLEA 1O03A 4J9OA 4IQTA 1NK7A 1COKA 1L6NA 4Q8EA 5KG7A 8ICRA 7ICKA 2FDRA 2N1RA 4KB6A 3Q8KA 1AQ6A 1ZQNA 1Z00A 4QZGA 1URJA 4O67A 1L7NA 3UPQA 3KKAC 4G9BA 2I9GA 1S0NA 2ZTEA 2LI6A 7ICQA 4USAA 3JYYA 1IM4A 3TFSA 3RJFA 2WB1C 1T94A 4US9A 3H4BA 4O5EA 1TV9A 3OVSA 2DL0A 4YP3A 5EE3A 1V38A 1JIHA 4B6JA 3ICXA 4P4PA 2XY7A 1XC9A 2FMSA 2IOFK 5ALTA 5J2BA 3RR7A 4UBCA 9ICCA 5AKIA 2KFNA 4I2JA 2BPFA 1BPDA 2JEJA 4AT9A 8ICVA 4P0PA 7ICPA 5J0SA 3WKAA 3OVAA 3BQTA 4P4OA 3WKDA 4C4TA 5L1KA 1XO0A 4O3MA 2LYHA 4M0AA 4FH3A 2XCPA 2KG5A 2KMDA 3AM9A 2F8LA 3GZFA 4RT2A 2AQ4A 3PSIA 4U6PA 3UPSA 4ELUA 2CN1A 2W8LA 3QU2A 1ZQQA 2K8BB 1U45A 3M9MB 4OCZA 2DRAA 9ICNA 2KJ5A 5EWGA 4DOAA 3BZKA 1PUZA 3H40A 4J9KA 5L9XA 1L7MA 4KLQA 3IV6A 5K4LA 1LVHA 2MU2A 2B51A 2DRBA 4K4IA 5KL8B 8ICUA 3HJ4A 5KFHA 3HILA 4WH5A 2AHOB 3LYSA 4GIBA 4RQ1A 1FO4A 3NGDA 4EBDA 3ZD8A 2FLPA 2VKQA 4X0BA 4DQIA 4GXJA 4RQ0A 1ZQGA 3O0FA 1ZQJA 2DF4B 5ALMA 3RJGA 4LZDA 5KFNA 4ED2A 4MEXA 2FMQA 4IRCA 5CEHA 3QEBZ 1K1SA 2OEHA 4RQ4A 2E5SA 2K89A 5FP0A 4M6WB 5J8YC 2ZIVB 4CGZA 5AKZA 3C21A 3QU9A 3AQEA 2R8GA 4DFMA 3L9DA 2FPLA 5KFDA 5AKJA 1WWVA 1JUDA 1R8BA 4QJFB 2JH7A 3WFSC 1ZQKA 5KNIA 3SQIA 3Q8PB 2XCAA 2YX8A 4K99A 3N4MB 3JPTA 3NVOA 4RPYA 3OGUA 5KFBA 5CFSA 1FEZA 2WB1F 1YLQA 2GLEA 3V72A 2PFOA 5H2FU 3Q8RB 5HMLA 4UD4A 2F3NA 1Z1BA 2XICA 1DGSA 4GC6A 4DO9A 4ECSA 4DFKA 4CF3A 1CUKA 1S0OA 3C2LA 3ZDEA 2CXYA 2M2UA 2W7OA 4OAIZ 2DBYA 2KK0A 1VDVA 4C8LA 8ICBA 5KG0A 4QW9A 2G07A 1X9SA 5ALHA 1D9DA 3JPPA 1SZHA 1PK1B 2FPKA 5HRGA 1U9LA 7ICJA 5J2GA 1Q79A 4AT7B 1NK0A 2JRZA 1D8BA 1TAUA 3ISBA 1PVQA 1O08A 3HRDD 3HWTA 4NV0A 5ALSA 1ZD2P 2BGWA 2WTFA 4I2DA 4FH5A 4RWNA 5ALVA 2KIWA 4RQ7A 4NLCA 4B9MA 5KT4A 1NJWA 2M2WA 3SR6A 1BPYA 1T7PA 4F72A 3KKAA 4OAHA 4IQUA 4KTQA 5J0XA 2PMZC 2W9CA 4YQWA 3ER8C 5L1IA 9ICIA 2PI4A 2BQUA 5KFUA 4M9GA 4WC0A 4KLTA 5AK5A 2CPRA 8ICHA 2ZUCA 4DCCA 3TACB 3PO5A 2BBJA 2HBKA 1FFUA 2BPGA 3GU3A 3H37A 4X4PA 4F92B 4MFFA 5C5JA 3UMCA 2I6XA 1NI3A 4EBCA 5F2VO 5AI5A 1XSLA 4Q44A 3L4PA 3MR3A 1F44A 3C1ZA 4CF4A 3ED5A 4DFJA 1QTMA 2YN4A 4FHPA 1MIVA 1A6SA 1S76D 4EEDA 5EE0A 4WC6A 1KLNA 1U4BA 1Q8KA 5CJ7A 4DS4A 2K8CB 5HREA 4QZBA 5A0LA 2OH2A 3QU4A 2V4RA 5DG7A 4WCWA 1L5UA 1WCNA 4I2GA 3CRXA 2KD1A 3Q8SB 4UB4A 4ATBB 5D46A 1J2NA 4NKUA 7ICSA 4LT6A 3TARA 4C8KA 2PI5A 7ICMA 7ICGA 2ZIWA 3AQMA 2E8PA 4UARA 4M2YA 2FPMA 4DSLA 3AQFA 1A77A 1ZQTA 4EZ6A 2MA1A 2HHTA 2RHFA 4LVSA 2EANA 5ALGA 4UB1A 1KW4A 4NXTA 3SAFA 3V6JA 4XQ8A 1QSYA 2R8JA 4TQRA 4B9TA 4I2AA 4FHVA 2A1JA 4DWIA 1JQRA 2J6SA 3BZCA 2E1FA 3NVVA 4OJPA 4BXOA 5EWFA 1A76A 3RH5A 8ICNA 3PVXA 4YR3A 2RFFA 3RB3A 3NS1A 4FO1A 1X9WA 4NXUA 2B21A 5KG2A 2W9BB 2E8NA 3NUQA 1K5OA 1K1QA 3RAXA 5ALKA 5J2DA 3BS5A 3BS5B 2HOIA 3V7LA 4C4SA 3H0LB 5KFZA 5J0WA 2ZIUA 2ZIUB 4I2IA 2LBOA 5HHHA 2BE3A 2KJ8A 3NVYA 4EEKA 2W9MA 4DSJA 3RH4A 3ERCC 2KV2A 1ZQEA 5CHEA 2UVUA 4JWNA 4O68A 2F76X 4US8A 5KFGA 5HRKA 2W3RA 3WK7A 1VFGA 5AI9A 2BQRA 3QUQA 7ICUA 5IIJA 4QWCA 2GAFD 1ZYQA 1F5AA 1ZQZA 2PBEA 4YMNA 4E80A 5G5HA 5KFAA 4RU9A 1YZ7A 3IG5A 3L5KA 3TANA 4ZH4A 3CNHA 4FHYA 5DB9A 5T14A 2Y9UA 2E1EA 5AKLA 3TKAA 2JMGA 4DL3A 5KFCA 3NRWA 4ED1A 5KT6A 4QWEA 3V6HA 1ZQSA 5J0QA 4RZRA 1UCVA 4O9MA 4YMMA 3SMVA 2NRKA 4Y2TA 4NLGA 4J9LA 1NKBA 3ETRA 5AI4A 3EWAA 3E58A 3F2BA 5IINA 3OJUA 3OVBA 1X40A 2KHQA 5KL1B 4PGXA 3IP4B 4Z6CA 5DDMA 1TKDA 4F5NA 2DR5A 1HJPA 2MUTA 2QB0A 4F5RA 1NK6A 8ICEA 4B9UA 2HI0A 4NY8A 3RRHA 4HYKA 4WC7A 1IIPA 3E0FA 4EX6A 2LYBA 3JPQA 3MDCA 4DF8A 4GLXA 4IRKA 3RJIA 4BDPA 4KLMA 4PZOA 1F0MA 2Q0ZX 1XSNA 4JLXA 3EUB2 1U49A 3M7DA 1UETA 5D61A 3SAGA 2EAMA 2J6TA 4JLZA 3ISDA 3H8WA 2PFQA 4UQGA 2BCUA 3PZPA 4ECXA 2R18A 4EBEA 4EYHB 1L8OA 3MABA 4F2RA 4PJ0U 3D2NA 2YMLA 3T3FA 5ALEA 3B0XA 1DGJA 5CP2A 4FZNA 2YMQA 1L3VA 2ZHAA 5CA7A 3PW7A 1Y88A 4EEBA 2NRWA 3HP6A 3T5KA 3EYZA 3F2CA 5J2HA 5KFTA 4YXJA 5HRBA 2JV3A 5DLGA 4Y2YA 3OHBA 4Y2SA 3ONNA 3WFRE 2ZUBA 1IG6A 4IG8A 4XA5A 2BDPA 2JEIA 5J0PA 5KG1A 4DOCA 3UMGA 2F44A 3JPRA 1SL2A 3WKEA 1NK8A 1L8LA 1B0XA 4GXIA 3PW0A 2H3FA 5HR6A 4KX3A 2AGPA 2OYYA 4IR1A 1KL9A 5KFVA 3RBDA 2DQNB 2M2VA 4ICAA 4A8EA 1ZQHA 4I0UA 3GIKA 4NWIA 3H8SA 3AUOA 1ECWA 3TQ1A 3NVZA 2EAPA 2ZH9A 5IIOA 1BPZA 3QUBA 1HUZA 3N7RC 2YQEA 4KLLA 2JXJA 1B22A 1ZQPA 1KFDA 1V4AA 4ECVA 2ZH1A 4QZEA 3TFRA 3Q8QB 2XGPA 2G06A 1BNPA 3EF2A 2RQ5A 1V9PA 1LKYB 2G0AA 2QARB 4WBYA 9ICRA 4KLJA 3QX7A 1YZ6A 1N5WA 1ZXIA 2NO5A 3M8RA 3UQ2A 5CRXA 4J03A 1L7PA 4B9LA 5J2JA 2ZJ5A 4MHVA 1Z4NA 3F2DA 5JU5A 4BWJA 2PXIA 4O3PA 3BS7A 4JV1A 1S77D 1R89A 3BJYA 1SIJA 1RQNA 2IOFA 2KKPA 2FLNA 1V85A 3AEVA 4Y2VA 2IA6A 2W54A 4I2EA 4AT8B 4IC9A 3M6KA 4EYIB 4ECTA 3N7SC 1M6YA 2ZH6A 2AGOA 5JRTA 2Z7JA 4CE6A 8ICQA 4EENA 1JN3A 1ZQBA 4FE3A 3C29A 4C8OA 1XWLA 9ICAA 5D4BA 4E7XA 1NZBA 3ZI4A 4DEZA 5DBAA 2UVWA 4X4QA 3VC8A 4M47A 4EX7A 4QZ9A 4UBBA 4DQPA 5J0UA 4ED6A 2P6UA 5B3PA 2KE7A 3U26A 1ZRMA 1QSSA 1CRXA 2C2EA 4WC5A 5KT3A 3MCRA 2ZJ8A 1NKEA 5L1MA 2KTQA 1NKCA 1N63A 4QWAA 4UB6U 1N61A 4O3OA 4XQ7A 1N60A 4ECYA 4X4UA 5DECA 1TFRA 2Y0SC 3V7JA 1FIQA 4QZHA 4O69A 1KDHA 2A19A 2P66A 3FYHA 4TURA 4OAGA 2ALZA 8ICJA 3IDWA 3AQNA 2NRVA 4AYBC 1RYUA 3HIYA 1D9FA 4DSKA 4CCHA 9ICJA 4WOYA 1D8YA 5AKXA 3TAQA 2WF5A 4TUQA 1WWUA 4Y2XA 4M6WA 8ICSA 4K9AA 3M6ZA 4EP7A 4M9LA 2ZIVA 2NYVA 4GXKA 1UPHA 1X42A 2E8OA 2ZH2A 3QUTA 2WFAA 4RNOA 2VJ5A 4FS2A 3UXNA 4X4OA 3TAPA 2W3SA 4CNQA 1PVRA 4KITB 3NKUA 4F50A 2LYAA 3K4GA 4LZGA 1ZQWA 1J2MA 1S10A 4JV0A 4TQSA 4C0ZA 5ALRA 4LEVA 3K7DA 1CI4A 5AI0A 1JRPA 2XO7A 1S5LU 3HJ1A 5KFSA 4JWMA 4R63A 2OHFA 2DGZA 1T4GA 5F9LA 1S8OA 4QZCA 1Z1VA 1AROP 3EPGA 3FM9A 2F1HA 5KT7A 5HR7A 1X6JA 3RAQA 5J0RA 2KZMA 3KD3A 2NRZA 2H3VA 3I76A 5ALFA 2YTUA 2ASLA 1KKXA 2ASJA 3PW5A 1KFSA 8ICOA 3M1YA 3WFOA 5KFIA 1N5XA 2BDUA 4LEYA 1MQ2A 4OO1J 4O5KA 1UHUA 2BR0A 1UT8A 4WQKA 5CB1A 1PK1A 4F4KA 4I29A 4I2CA 4PL2A 4I2BA 2H3IA 4AT7A 3EW9A 3BDPA 4M9JA 3KZXA 1MC8A 2BQ3A 3I1YA 4DL7A 1OU5A 3CYMA 5ALPA 1X9XA 3MR6A 4DF4A 2BBHA 1MSWD 1HEKA 2RP5A 3AN1A 3D2SA 4EBKA 1SV0C 4DL6A 4PZNA 2Y0SF 1RXWA 4KLHA 4IQVA 1J97A 2F1IA 2WF7A 5EOZA 2CRXA 1L3SA 2C28A 1ZETA 3ORYA 5J2IA 4LEZA 5B5EU 4J9PA 2HN1A 4DFDA 2G09A 3KFUF 2IUBA 4AYBF 2GO7A 7ICOA 2EAOA 9ICUA 1TK8A 4EZ9A 1SGGA 4J9NA 2ZTCA 4UAUA 2HN2A 2JHDA 2VA2A 3AU6A 1A0PA 1RDFA 1NOMA 4S3NA 4RT3A 5DQIA 5J2CA 4O3RA 4X4RA 1ZD5A 4WC2A 3PO4A 7ICNA 4C4RA 4ELTA 2HBJA 4NKTA 5DB7A 1T3QA 3GV5B 4Y2JA 2LMRA 3C5GA 4P2HA 2KEYA 3N28A 3AQLA 3PMLA 4YR2A 4P4MA 3T5LA 1XO1A 5J29A 4U7CA 3SI8A 3HKZC 1KN5A 3EZ5A 4NM2A 4PGYA 4KMUA 4RQ2A 4ATBA 4TUSA 1BNOA 3CW2C 2K4HA 3KHRA 1XNSA 4PH5A 5DB8A 1T3NA 2D3DA 3PHZA 2OCEA 2ESEA 1VLBA 3AMZA 2BZFA 3SZ2A 5KFFA 3SV4A 1ZD4A 1TE2A 3MDAA 4PHPA 4FS1A 1TFYA 5ALIA 7ICIA 4IL6U 3C23A 5L1LA 3HJEA 2WAQC 2ISOA 2W11A 3PR4A 1JX4A 4PHAA 4C80A 1GO3F 3BQ1A 4ED3A 2KIVA 9ICKA 3RJJA 5DBBA 3Q8MA 1QQ6A 2FJ6A 5KFMA 2O6KA 8ICWA 2R8IA 3QU5A 3AQKA 4NLNA 5KFRA 3UM9A 2ZH3A 4C8NA 3C5FA 2W9BA 4DSFA 1ZQAA 1TAMA 2KHVA 2KN7A 2GH1A 2ZXIA 2EQYA 4EV6A 2JGAA 2IBKA 3C66A 2ZXHA 4C7YA 4DL4A 4FFDA 2RDJA 3RR8A 4NXZA 5KFQA 2ZUDA 2O1PA 5G5GA 2VJ4A 1JXLA 4N7RA 2HW3A 1VJ7A 4X4SA 4F2SA 4EELA 3C28A 2BPCA 2WF6A 2VANA 3QEAZ 3ZD9A 1ZQMA 2DPJA 1BPBA 4ECWA 3WK4A 5HRLA 5ALZA 2BCRA 3PSFA 4Q8FA 2WF8A 5KAFU 5KFPA 5KT2A 5J0OA 3LVVA 2EH9A 4P0QB 4ELVA 1VJ5A 4FBUA 2KSOB 2QKQA 3ER9B 8ICXA 2UVRA 3LVWA 4XJEA 2EZYA 4QZAA 4KLGA 1WOTA 2EZXA 1DK3A 4KLUA 1NJZA 2LKYA 4JK1A 2HOQA 9ICBA 3GV7B 4B9SA 7ICLA 4YFKA 1RPLA 3MFIA 3PW4A 2MAXA 4O3QA 2DR8A 4O3NA 2HVIA 4KLEA 4JUZA 1N56A 4MFCA 2Y1IA 3JCFA 5J2KA 4O0IA 3MGIA 1Q3VA 2ZJAA 1ZQIA 4FHXA 3JPNA 5HRDA 1MQ3A 4K96A 4NXWA 3GIMA 5GTIU 2A3VA 8ICKA 1Q3UA 3C1YA 3HKZF 2KZZA 3KHGA 4K97A 3D2QA 1CEZA 4OAFA 2DR7A 4I27A 3QNMA 4UD5A 4ECRA 5KFYA 4FBTA 3GIJA 2HMXA 1P7DA 2ID1A 2Q4TA 1SV0A 4J9RA 5IIMA 2K8AA 3ZDAA 3RJKA 2AGQA 2PFNA 3CP8A 4GFJA 5EWEA 4IS7A 7ICFA 4PHDA 3QZ8A 4F4WA 1D8LA 1NNLA 2NRXA 4ZOHC 5TISU 4X5VA 2WAQF 2ASDA 4RQMA 4QW8A 5J2EA 2XIDA 4WBZA 4WC4A 1COOA 1TK5A 3KHHA 4DQSA 8ICAA 1PX5A 2F1JA 2IHNA 7ICTA 5B3QA 5DQGA 1UA1A 4ED8A 1MA7A 3WU2U 4YN4A 2Y9TA 4ED0A 5HNKA 1XSPA 5J0TA 2W04A 2BCSA 1IXRA 5KG3A 1ZQUA 2KJ9A 1SV4A 2XVTA 5KAIU 5KT5A 4B9VA 4K4GA 2KZ3A 2YB4A 4CF5A 4FHWA 1SKWA 4J9MA 1YT3A 2ZH8A 1HUOA 2HSZA 3M8SA 5CFTA 5D49A 3WK9A 1RYSA 4RQ5A 2RLTA 2C2RA 3FAHA 5KFOA 4KN4A 1B4FA 3OPXA 4YCXA 2XY6A 3K1RB 3LWLA 2IHMA 4UAZA 1L7OA 1FFVA 3TADC 2JH1A 4RQ3A 4KLDA 4LEWA 4C8MA 5HHIA 4IRDA 4BUGA 5CHGA 2K60A 1PZNA 1DRGA 4OJ6A 5AKYA 4UATA 3WKCA 4G3IA 4M5DA 3NYBA 3SV3A 3TI0A 3WK8A 5AM3A 3IM1A 3RBEA 2H3ZA 2IHOA 1C7YA 3GFKB 3F5AA 4Y2PA 2ES6A 2YMPA 5DKWA 4E8FA 1ZJNA 5KFLA 2ISPA 4RWOA 4RUCA 1KEJA 5EE9A 1PK3A 1BVSA 9ICHA 4OJOA 2KFZA 1WUDA 4M04A 2HOFA 2B56A 3IHQB 4F3OA 1LKYA 2W55A 2QARA 5HP4A 3ETLA 9ICFA 4YD1A 1OUQA 2NO4A 4UAVA 1LV5A 5CWRA 4RQ8A 2AXTU 2WF9A 4BGDA 5ALYA 3MBYA 5AK6A 5BOMA 1Z00B 2HHQA 3H8MA 1F5SA 8ICTA 3NWIA 2HCFA 3H3AA 5GTHU 4EBJA 9ICWA 5CFUA 3K1ZA 3DEEA 4YXMA 4ED7A 1SXDA 1SZPA 2L5YA 4YMOA 3QZ7A 1DK2A 5HMMA 3RRGA 1JMSA 3N7PD 4PL1A 3MFHA 5KG6A 1Z3EB 3M9NB 4O5CA 9ICGA 4CDGA 4AT8A 2JZBA 2JZBB 5JTGA 4YD2A 3RB0A 3H8JA 1JAJA 2HHVA 5DBCA 3GV8B 2B6GA 3RTVA 3T79A 4AT9B 2W7PA 4P0PB 3GILA 4UB5A 3SD7A 5AKKA 4TUPA 1X66A 4MFAA 4F4ZA 1ZD3A 5IIKA 3RB4A 1KTQA 2AH5A 2G5IB 1R8CA 5AM4A 9ICXA 1ZQLA 3GQCA 3QYPA 3MGVA 5IILA 2OWOA 1UT5A 3OSNA 4R66A 4Y2UA 2B0CA 3WFQE 4M9NA 4PPXA 2ZIXA 3MC1A 2ZIXB 4DLGA 3MR5A 2IOHA 1WCLA 2AJQA 3QXGA 3F5EA 4AP9A 4QZ8A 5KG4A 3C2KA 2DFLA 1QLNA 1U48A 4HAIA 2EDUA 4XUSA 2F2AB 4BJQA 2HHUA 9ICMA 3C18A 7ICRA 3UXOA 4K4HA 4RUAA 4NLBA 3S6JA 4DQRA 3V7KA 4I2FA 2HHWA 4RWPA 2PFPA 2B4VA 3KZIU 1PVPA 3JPSA 3THVA 2KVSA 5ALWA 3MGHA 5L1JA 3QE9Y 3GIIA 5DB6A 2R8KA 3LWMA 2DWQA 3T5HA 5AK4A 3KOOA 4RQ6A 4KLOA 4K9BA 1GPJA 2VIXA 2KP7A 3HW8A 8ICZA 2E8MA 4OJ5A 3NVWA 4Z6DA 3ZDDA 1N2XA 4O6AA 3SYZA 2G08A 3AL0B 4F93B 4ECQA 2DUYA 1N62A 5DLFA 1TVAA 1MN8A 5ALNA 2I1QA 1ZQOA 4LJXA 3FDSA 4QZDA 2HVHA 4UW9A 2K4EA 4X4NA 4RNNA 2NV3A 1SKRA 4F5OA 2M0NA 3B9JA 1ED1A 2FLLA 2NRTA 4C7ZA 3OSPA 3LQCB 1XU4A 4F71A 5DDYA 1OXJA 3BQ0A 2F8KA 1KFTA 4NLZA 9ICQA 3TADA 4MKPA 1QH9A 4GC7A 3D6JA 5DEDA 4F5PA 1UQVA 1B43A 5DQHA 5AI8A 1T8EA 1KRPA 4CRXA 3G6VA 5D63A 1ZRNA 4Z6EA 1BPEA 3HT3A 7ICVA 1C20A 4RWQA 1QCKA 4K98A 2ZH7A 5ALXA 3PR5B 2XY5A 1ZQRA 1LB2B 2MRLA 3PSTA 1NZPA 1WG8A 2O5AA 4J9QA 4DL5A 1FA0A 1Z4OA 1SL0A 2GOLA 2BKEA 1SB3C 3WKBA 5JUMA 5HRHA 2C22A 4XRHA 4DS5A 2DPIA 3IG8A 3PX0A 4R64A 3PSPA 1BPXA 2KICA 4X4TA 3F53A 4FZLA 9ICPA 4EGWA 4KM5A 4UB3A
chains in the Genus database with same CATH topology
3QEAZ 3ZD9A 4XA5A 1ZQMA 4KLQA 2DPJA 1Q78A 2BDPA 2JEIA 1BPBA 5J0PA 1XS9D 5KG1A 4ECWA 4DOCA 1BGXT 5HRLA 2DRBA 2BCRA 4K4IA 3JPRA 3C2MA 1SL2A 3HPOA 4Q8FA 8ICUA 5KFPA 5KT2A 5J0OA 1NK8A 3HJ4A 2HHXA 5KFHA 4GXIA 4RQ1A 2BCQA 4EBDA 1UEUA 3NGDA 8ICFA 2ZH4A 4ELVA 3ZD8A 2FLPA 2W9CB 3PW0A 3PX6A 4X0BA 5BPCA 4FBUA 2V4QA 2VA3A 4DQIA 4GXJA 2AGPA 2DR9A 5KTQA 4RQ0A 5KFVA 3RBDA 4IR1A 2H5XA 1ZQGA 8ICXA 3RH6A 3EPIA 2M2VA 2UVRA 1NK5A 1ZQJA 1ZQHA 3GIKA 4RPZA 1SL1A 2ATLA 4QZAA 2HHSA 8ICPA 3V6KA 3RJGA 3H8SA 5KFKA 4KLGA 4LZDA 5KFNA 1DK3A 4KLUA 1WOTA 4ED2A 3AUOA 1NJZA 4JK1A 4MEXA 2FMQA 4IRCA 3GV7B 3QEBZ 3TQ1A 1K1SA 4B9SA 4YFKA 1RPLA 4IQWA 9ICBA 3MFIA 3PW4A 7ICLA 2MAXA 4O3QA 4RQ4A 4KN7A 4M6WB 3OV7A 2DR8A 4O3NA 3BQ2A 2ZH9A 5IIOA 1BPZA 2HVIA 4KLEA 1JXEA 4JUZA 1HUZA 1N56A 8ICMA 4MFCA 4KLLA 2Y1IA 3C21A 1B22A 1TFWA 1ZQVA 5J2KA 4O0IA 3MGIA 1ZQIA 2ZJAA 1ZQPA 4FHXA 1KFDA 1V4AA 2W9AA 2R8GA 3RJHA 3JPNA 4UB3A 4ECVA 5HRDA 4DFMA 1MQ3A 2ZH1A 4QZEA 3L9DA 3TFRA 3Q8QB 2FPLA 2XGPA 3GIMA 1BNPA 5KFDA 5J2AA 4KLIA 8ICKA 3C1YA 4FO6A 1V9PA 2KZZA 4DOBA 2Y1JA 1ZQFA 4EEYA 4WBYA 9ICRA 3N97B 4KLJA 3KHGA 1R8BA 3H4DA 1NJXA 2AU0A 1CEZA 3WFSC 1ZQKA 4PHEA 3M8RA 1DOQA 3UQ2A 4I27A 2DR7A 3Q8PB 2V9WA 2XCAA 4UD5A 4B9LA 4ECRA 3N4MB 3JPTA 5KFYA 5J2JA 2ZJ5A 4RPYA 5KFBA 4MF8A 3OGUA 3GIJA 4FBTA 2ID1A 4BWJA 2PXIA 5HRFA 4J9RA 1YLQA 5IIMA 4IG8A 5F9NA 3ZDAA 4O3PA 5DGBA 3RJKA 2AGQA 2PFNA 5HR9A 3V72A 3RB6A 2PFOA 4JV1A 3Q8RB 5HMLA 5EWEA 4DQQA 7ICFA 5HRIA 4PHDA 4UD4A 1S77D 3QZ8A 4RNMA 1R89A 3BJYA 4F4WA 1D8LA 9ICTA 1DGSA 4YVZA 1S0VA 2FLNA 4BWMA 4GC6A 2NRXA 4DO9A 4ECSA 4DFKA 1CUKA 2IA6A 4UB2A 1S0OA 4I2EA 4X5VA 4F91B 1NK4A 4AT8B 3M9OB 2ASDA 3C2LA 3ZDEA 4QW8A 5J2EA 4EYIB 4ECTA 2M2UA 4WBZA 4I2HA 1ZQYA 2BCVA 4WC4A 1COOA 1TK5A 3KHHA 2ZH6A 2AGOA 4DQSA 8ICQA 8ICAA 1PX5A 2F1JA 2IHNA 1JN3A 3B0YA 1ZQBA 1KSPA 7ICTA 4O3SA 4C8OA 1XWLA 9ICAA 2FMPA 5DQGA 1UA1A 4C8LA 4ED8A 5D4BA 4E7XA 4YN4A 8ICBA 4DEZA 4ED0A 5DBAA 5HNKA 5BOLA 2UVWA 5KG0A 4X4QA 4M9HA 4QW9A 1XSPA 1X9SA 5J0TA 4M47A 2BCSA 1D9DA 3JPPA 1UEVA 1MIWA 1IXRA 2FPKA 5KG3A 4QZ9A 4B9NA 2A1JB 4UBBA 1RZTA 4DQPA 5HRGA 1S0MA 1U9LA 2M9NA 5J0UA 5KT5A 1ZQUA 5KFXA 2P6UA 4ED6A 4B9VA 7ICJA 2ZHBA 4BXOB 5J2GA 4K4GA 1QSSA 2KZ3A 2GWSA 2C2EA 1Q79A 5KT3A 4JV2A 1NK0A 4AT7B 4WC5A 2ZJ8A 3ISBA 1NKEA 1TAUA 1SKWA 4FHWA 2KTQA 4J9MA 2DVIA 3HWTA 1NKCA 2ZH8A 4RWNA 2BGWA 1HUOA 2WTFA 1ZQXA 4I2DA 4QWAA 3M8SA 4O3OA 4NM1A 5D49A 1SKSA 4XQ7A 4RQ7A 4ECYA 4X4UA 1RYSA 5DECA 4RQ5A 1TFYA 1L3UA 4B9MA 5KT4A 1NJWA 1TFRA 2P6RA 3PMNA 2C2RA 2M2WA 3V7JA 1TAQA 4QWBA 4QZHA 5KFOA 3H7IA 4KN4A 1BPYA 1KDHA 4YCXA 9ICVA 1T7PA 2XY6A 2P66A 3LWLA 2IHMA 4UAZA 2IMWP 1H38A 3FYHA 4IQUA 4MEYA 3T5JA 2J6UA 4KTQA 5J0XA 4KLDA 4RQ3A 2W9CA 4YQWA 4YR0A 4C8MA 2BHNA 4TURA 4DL2A 5HHIA 2ALZA 4IRDA 5L1IA 8ICJA 9ICIA 2PI4A 5DG9A 3GDXA 3AQNA 5CHGA 3PV8A 2BQUA 5KFUA 4M9GA 4WC0A 2NRVA 4KLTA 1PZNA 5TZVA 8ICHA 5CR0A 4G3IA 2ZUCA 4M5DA 3HIYA 1D9FA 3PO5A 4DSKA 3NYBA 3SV3A 3TI0A 3G6XA 2BPGA 4CCHA 9ICJA 3IM1A 4UAYA 8ICCA 1D8YA 3RBEA 3TAQA 3H37A 4X4PA 4TUQA 4F92B 4MFFA 5C5JA 4Q43A 9ICOA 1C7YA 3GFKB 4M6WA 8ICSA 4EBCA 5DKWA 5F2VO 4J9SA 1XSLA 3KHLA 4Q44A 3MR3A 1ZJNA 5KFLA 4E8FA 1ZJMA 4EP7A 4M9LA 3UQ0A 1RXVA 3C1ZA 4R65A 2ISPA 4RWOA 4GXKA 8ICIA 4RUCA 4DFJA 1QTMA 4FHPA 1KEJA 1MIVA 2ZH2A 5DG8A 1BVSA 9ICHA 4RNOA 4FS2A 2VA8A 3UXNA 4X4OA 1NO5A 2KFZA 1S76D 3TAPA 4M04A 4WC6A 4R8UA 1KLNA 4R8UB 1U4BA 4DS4A 3IHQB 5CJ7A 4F3OA 1S97A 5HREA 3OHAA 4QZBA 4WC3A 4KITB 3OJSA 4F50A 5HP4A 3ETLA 9ICFA 4YD1A 4DSEA 3K4GA 4LZGA 4PGQA 1ZQWA 1S10A 4JV0A 4TQSA 2V4RA 1LV5A 3RJEA 9ICSA 5CWRA 5DG7A 4WCWA 4RQ8A 1L5UA 4BGDA 1WCNA 3KTQA 7ICHA 2MUTB 5J2FA 1EXNA 4QWDA 4I2GA 1RYRA 3MBYA 3G6YA 3LDAA 4Q45A 2XO7A 5BOMA 3Q8SB 3PW2A 4UB4A 2C2DA 3ZDBA 1Z00B 2HHQA 3HJ1A 8ICLA 5KFSA 4ATBB 4JWMA 4R63A 5D46A 1L3TA 4NKUA 8ICTA 3OUYA 1TK0A 3OUYB 1T4GA 5F9LA 3H3AA 7ICSA 4QZCA 1ZQCA 4EBJA 4LT6A 3TARA 9ICWA 4C8KA 2PI5A 1AROP 4F5QA 4YXMA 3EPGA 7ICMA 4ED7A 1UA0A 7ICGA 1SZPA 4IR9A 2ZH5A 4YMOA 3QZ7A 1DK2A 3AQMA 2F1HA 5KT7A 5HMMA 3RRGA 1JMSA 4M2YA 1X9MA 3MFHA 2FPMA 5KG6A 1Z3EB 3M9NB 3RAQA 4O5CA 4DSLA 9ICGA 5J0RA 4AT8A 2JZBA 2KZMA 2JZBB 4KLSA 2NRZA 3ZDCA 2HHPA 1A77A 4YD2A 3RB0A 1ZQTA 3H8JA 9ICLA 2ASLA 4EZ6A 5KFWA 1JAJA 3UXPA 2ASJA 2HHTA 3PW5A 2HHVA 1KFSA 8ICOA 4LVSA 5DBCA 1R8AA 3WFOA 5KFIA 3GV8B 4Z6FA 4X0AA 5J0YA 4UB1A 4DSIA 1MQ2A 3RTVA 1MIYA 3V6JA 4XQ8A 4NLKA 4AT9B 4F8RA 1QSYA 4O5KA 2R8JA 3GILA 4TQRA 2BR0A 1UT8A 4B9TA 5CB1A 4UB5A 4I2AA 4F4KA 4FHVA 2A1JA 4TUPA 4DWIA 1JQRA 2J6SA 2JEFA 4I29A 4I2CA 1KNYA 9ICEA 3NTUA 4MFAA 4BXOA 5EWFA 1A76A 3ISCA 4F4ZA 2JEGA 3RH5A 4I2BA 8ICNA 2RDIA 3PVXA 4AT7A 3EW9A 4YR3A 2RFFA 3BDPA 3RB3A 1QSLA 4M9JA 5IIKA 3RB4A 1NJYA 1X9WA 1KTQA 2B21A 5KG2A 3MR2A 1MC8A 2BQ3A 2W9BB 3WFPA 5IIIA 3RAXA 1K1QA 3PY8A 4I28A 5J2DA 1R8CA 4DL7A 9ICXA 2XC9A 1ZQLA 3MR6A 4MF2A 2M2TA 3GQCA 2R8HA 4DF4A 5KFEA 3V7LA 5IILA 4KLFA 1MSWD 2OWOA 5HC9A 5KFJA 5KFZA 4EBKA 1UT5A 5J0WA 3OSNA 4DFPA 4R66A 3WFQE 4DL6A 4M9NA 1RXWA 4KLHA 4PPXA 3E2EA 4I2IA 4IQVA 5HHHA 2BE3A 4DLGA 5DGAA 3MR5A 2F1IA 2W9MA 4QZIA 1WCLA 4DSJA 3RH4A 2AJQA 5EOZA 1ZQEA 4QZ8A 5KG4A 1L3SA 3PNCA 3C2KA 2AQ0A 2DFLA 2UVUA 4JWNA 1U48A 5KFGA 2C28A 1ZETA 1QLNA 3ORYA 5J2IA 4XUSA 1N48A 2HHUA 8ICGA 1VFGA 2BQRA 3K75D 9ICMA 4J9PA 7ICEA 7ICUA 5IIJA 4QWCA 3C18A 7ICRA 1NK9A 1ZYQA 1F5AA 1ZQZA 3UXOA 4E0DA 4K4HA 4YMNA 2PBEA 4E80A 3JPOA 3AU2A 4YG2A 4RUAA 4DQRA 5KFAA 4RU9A 2W8KA 3V7KA 4I2FA 7ICOA 3TANA 4QZFA 4ZH4A 4ECUA 2HHWA 1TK8A 2PFPA 5DB9A 9ICUA 4FHYA 4RWPA 4EZ9A 3JZ0A 1X2IA 3JPSA 3THVA 4J9NA 3Q8LA 2XGQA 3H39A 3MGHA 2ZTCA 4ECZA 4WC1A 1ZQDA 5L1JA 4DL3A 3QE9Y 5KFCA 3GIIA 5DB6A 4ED1A 2R8KA 4F4XA 5KT6A 4QWEA 3V6HA 2ZTDA 3LWMA 1ZQSA 1OU5A 3T5HA 5KG5A 5J0QA 4RZRA 3HX0A 4O9MA 4YMMA 3AU6A 2VA2A 2NRKA 4RQ6A 4KLOA 3LK9A 1U47A 4NLGA 4J9LA 2UVVA 2KP7A 1NOMA 4S3NA 3PX4A 1S9FA 4RT3A 4RPXA 3H38A 4X4VA 5DQIA 5J2CA 1NKBA 3HW8A 4O3RA 8ICYA 8ICZA 4X4RA 4UAWA 4WC2A 3PO4A 3EWAA 4Z6DA 3ZDDA 7ICNA 4F4YA 4DLEA 3SYZA 5IINA 4ELTA 4F93B 3OJUA 4J9OA 4IQTA 4ECQA 5DB7A 1NK7A 4NKTA 5DLFA 3OVBA 1TVAA 3GV5B 4PGXA 4Z6CA 5DDMA 2I1QA 1ZQOA 5KG7A 3C5GA 4P2HA 1TKDA 4Q8EA 3AQLA 3FDSA 3PMLA 4YR2A 8ICRA 4P4MA 4F5NA 3T5LA 1XO1A 1HJPA 2MUTA 5J29A 4QZDA 2HVHA 7ICKA 4F5RA 3SI8A 2DR5A 1NK6A 8ICEA 3Q8KA 4B9UA 3EZ5A 1ZQNA 4NM2A 1Z00A 4PGYA 4X4NA 4KMUA 4RQ2A 3RRHA 4QZGA 4HYKA 4NY8A 4ATBA 4TUSA 4WC7A 1BNOA 4RNNA 3UPQA 2I9GA 3KHRA 1S0NA 2ZTEA 7ICQA 1SKRA 4PH5A 3JYYA 1IM4A 4F5OA 5DB8A 1T3NA 3TFSA 4FH5A 3RJFA 3JPQA 2FLLA 2NRTA 3MDCA 3H4BA 4O5EA 4DF8A 4GLXA 3OSPA 1TV9A 4IRKA 3LQCB 1XU4A 3RJIA 3OVSA 4BDPA 4KLMA 5DDYA 3SZ2A 5KFFA 4YP3A 3SV4A 3BQ0A 3MDAA 1KFTA 4PHPA 4FS1A 1JIHA 2XY7A 4P4PA 2Q0ZX 4NLZA 7ICIA 1XC9A 9ICQA 2FMSA 5J2BA 4GC7A 3RR7A 3C23A 4UBCA 1XSNA 9ICCA 5L1LA 5DEDA 4F5PA 1U49A 1UETA 1B43A 5DQHA 4I2JA 1T8EA 2KFNA 1KRPA 3G6VA 2ISOA 2BPFA 2J6TA 3PR4A 1BPDA 1JX4A 3ISDA 2JEJA 4AT9A 3H8WA 2PFQA 8ICVA 7ICPA 4UQGA 4PHAA 5J0SA 4Z6EA 2BCUA 1BPEA 3OVAA 3BQ1A 4ED3A 3HT3A 3BQTA 4ECXA 7ICVA 4EBEA 4EYHB 3RJJA 5DBBA 3Q8MA 9ICKA 4RWQA 2ZH7A 3MABA 4P4OA 5KFMA 8ICWA 3PR5B 2R8IA 2XY5A 3AQKA 4NLNA 5L1KA 1ZQRA 1LB2B 4F2RA 1NZPA 3T3FA 2LYHA 5KFRA 3B0XA 5CP2A 2ZH3A 4M0AA 1L3VA 2ZHAA 4FH3A 4C8NA 3C5FA 5CA7A 3PW7A 2W9BA 2XCPA 1Y88A 4J9QA 4DSFA 4DL5A 2NRWA 2O5AA 3HP6A 3T5KA 1ZQAA 1FA0A 2KN7A 3EYZA 1SL0A 5J2HA 4RT2A 2AQ4A 2BKEA 5KFTA 4YXJA 5JUMA 5HRBA 5HRHA 3UPSA 2C22A 4XRHA 4DS5A 4ELUA 2W8LA 2IBKA 3C66A 1ZQQA 4DL4A 2RDJA 3PX0A 2DPIA 5DLGA 1U45A 3RR8A 3M9MB 4R64A 5HRKA 2DRAA 2Q66A 9ICNA 3OHBA 4NXZA 1BPXA 5KFQA 4X4TA 2ZUDA 2O1PA 5EWGA 4DOAA 1JXLA 9ICPA 2HW3A 1VJ7A 3WFRE 4X4SA 2ZUBA 4F2SA 3H40A 2BPCA 4J9KA 5L9XA 2VANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QEA Z;  3ZD9 A;  4XA5 A;  1ZQM A;  4KLQ A;  2DPJ A;  1Q78 A;  2BDP A;  2JEI A;  1BPB A;  5J0P A;  1XS9 D;  5KG1 A;  4ECW A;  4DOC A;  1BGX T;  5HRL A;  2DRB A;  2BCR A;  4K4I A;  3JPR A;  3C2M A;  1SL2 A;  3HPO A;  4Q8F A;  8ICU A;  5KFP A;  5KT2 A;  5J0O A;  1NK8 A;  3HJ4 A;  2HHX A;  5KFH A;  4GXI A;  4RQ1 A;  2BCQ A;  4EBD A;  1UEU A;  3NGD A;  8ICF A;  2ZH4 A;  4ELV A;  3ZD8 A;  2FLP A;  2W9C B;  3PW0 A;  3PX6 A;  4X0B A;  5BPC A;  4FBU A;  2V4Q A;  2VA3 A;  4DQI A;  4GXJ A;  2AGP A;  2DR9 A;  5KTQ A;  4RQ0 A;  5KFV A;  3RBD A;  4IR1 A;  2H5X A;  1ZQG A;  8ICX A;  3RH6 A;  3EPI A;  2M2V A;  2UVR A;  1NK5 A;  1ZQJ A;  1ZQH A;  3GIK A;  4RPZ A;  1SL1 A;  2ATL A;  4QZA A;  2HHS A;  8ICP A;  3V6K A;  3RJG A;  3H8S A;  5KFK A;  4KLG A;  4LZD A;  5KFN A;  1DK3 A;  4KLU A;  1WOT A;  4ED2 A;  3AUO A;  1NJZ A;  4JK1 A;  4MEX A;  2FMQ A;  4IRC A;  3GV7 B;  3QEB Z;  3TQ1 A;  1K1S A;  4B9S A;  4YFK A;  1RPL A;  4IQW A;  9ICB A;  3MFI A;  3PW4 A;  7ICL A;  2MAX A;  4O3Q A;  4RQ4 A;  4KN7 A;  4M6W B;  3OV7 A;  2DR8 A;  4O3N A;  3BQ2 A;  2ZH9 A;  5IIO A;  1BPZ A;  2HVI A;  4KLE A;  1JXE A;  4JUZ A;  1HUZ A;  1N56 A;  8ICM A;  4MFC A;  4KLL A;  2Y1I A;  3C21 A;  1B22 A;  1TFW A;  1ZQV A;  5J2K A;  4O0I A;  3MGI A;  1ZQI A;  2ZJA A;  1ZQP A;  4FHX A;  1KFD A;  1V4A A;  2W9A A;  2R8G A;  3RJH A;  3JPN A;  4UB3 A;  4ECV A;  5HRD A;  4DFM A;  1MQ3 A;  2ZH1 A;  4QZE A;  3L9D A;  3TFR A;  3Q8Q B;  2FPL A;  2XGP A;  3GIM A;  1BNP A;  5KFD A;  5J2A A;  4KLI A;  8ICK A;  3C1Y A;  4FO6 A;  1V9P A;  2KZZ A;  4DOB A;  2Y1J A;  1ZQF A;  4EEY A;  4WBY A;  9ICR A;  3N97 B;  4KLJ A;  3KHG A;  1R8B A;  3H4D A;  1NJX A;  2AU0 A;  1CEZ A;  3WFS C;  1ZQK A;  4PHE A;  3M8R A;  1DOQ A;  3UQ2 A;  4I27 A;  2DR7 A;  3Q8P B;  2V9W A;  2XCA A;  4UD5 A;  4B9L A;  4ECR A;  3N4M B;  3JPT A;  5KFY A;  5J2J A;  2ZJ5 A;  4RPY A;  5KFB A;  4MF8 A;  3OGU A;  3GIJ A;  4FBT A;  2ID1 A;  4BWJ A;  2PXI A;  5HRF A;  4J9R A;  1YLQ A;  5IIM A;  4IG8 A;  5F9N A;  3ZDA A;  4O3P A;  5DGB A;  3RJK A;  2AGQ A;  2PFN A;  5HR9 A;  3V72 A;  3RB6 A;  2PFO A;  4JV1 A;  3Q8R B;  5HML A;  5EWE A;  4DQQ A;  7ICF A;  5HRI A;  4PHD A;  4UD4 A;  1S77 D;  3QZ8 A;  4RNM A;  1R89 A;  3BJY A;  4F4W A;  1D8L A;  9ICT A;  1DGS A;  4YVZ A;  1S0V A;  2FLN A;  4BWM A;  4GC6 A;  2NRX A;  4DO9 A;  4ECS A;  4DFK A;  1CUK A;  2IA6 A;  4UB2 A;  1S0O A;  4I2E A;  4X5V A;  4F91 B;  1NK4 A;  4AT8 B;  3M9O B;  2ASD A;  3C2L A;  3ZDE A;  4QW8 A;  5J2E A;  4EYI B;  4ECT A;  2M2U A;  4WBZ A;  4I2H A;  1ZQY A;  2BCV A;  4WC4 A;  1COO A;  1TK5 A;  3KHH A;  2ZH6 A;  2AGO A;  4DQS A;  8ICQ A;  8ICA A;  1PX5 A;  2F1J A;  2IHN A;  1JN3 A;  3B0Y A;  1ZQB A;  1KSP A;  7ICT A;  4O3S A;  4C8O A;  1XWL A;  9ICA A;  2FMP A;  5DQG A;  1UA1 A;  4C8L A;  4ED8 A;  5D4B A;  4E7X A;  4YN4 A;  8ICB A;  4DEZ A;  4ED0 A;  5DBA A;  5HNK A;  5BOL A;  2UVW A;  5KG0 A;  4X4Q A;  4M9H A;  4QW9 A;  1XSP A;  1X9S A;  5J0T A;  4M47 A;  2BCS A;  1D9D A;  3JPP A;  1UEV A;  1MIW A;  1IXR A;  2FPK A;  5KG3 A;  4QZ9 A;  4B9N A;  2A1J B;  4UBB A;  1RZT A;  4DQP A;  5HRG A;  1S0M A;  1U9L A;  2M9N A;  5J0U A;  5KT5 A;  1ZQU A;  5KFX A;  2P6U A;  4ED6 A;  4B9V A;  7ICJ A;  2ZHB A;  4BXO B;  5J2G A;  4K4G A;  1QSS A;  2KZ3 A;  2GWS A;  2C2E A;  1Q79 A;  5KT3 A;  4JV2 A;  1NK0 A;  4AT7 B;  4WC5 A;  2ZJ8 A;  3ISB A;  1NKE A;  1TAU A;  1SKW A;  4FHW A;  2KTQ A;  4J9M A;  2DVI A;  3HWT A;  1NKC A;  2ZH8 A;  4RWN A;  2BGW A;  1HUO A;  2WTF A;  1ZQX A;  4I2D A;  4QWA A;  3M8S A;  4O3O A;  4NM1 A;  5D49 A;  1SKS A;  4XQ7 A;  4RQ7 A;  4ECY A;  4X4U A;  1RYS A;  5DEC A;  4RQ5 A;  1TFY A;  1L3U A;  4B9M A;  5KT4 A;  1NJW A;  1TFR A;  2P6R A;  3PMN A;  2C2R A;  2M2W A;  3V7J A;  1TAQ A;  4QWB A;  4QZH A;  5KFO A;  3H7I A;  4KN4 A;  1BPY A;  1KDH A;  4YCX A;  9ICV A;  1T7P A;  2XY6 A;  2P66 A;  3LWL A;  2IHM A;  4UAZ A;  2IMW P;  1H38 A;  3FYH A;  4IQU A;  4MEY A;  3T5J A;  2J6U A;  4KTQ A;  5J0X A;  4KLD A;  4RQ3 A;  2W9C A;  4YQW A;  4YR0 A;  4C8M A;  2BHN A;  4TUR A;  4DL2 A;  5HHI A;  2ALZ A;  4IRD A;  5L1I A;  8ICJ A;  9ICI A;  2PI4 A;  5DG9 A;  3GDX A;  3AQN A;  5CHG A;  3PV8 A;  2BQU A;  5KFU A;  4M9G A;  4WC0 A;  2NRV A;  4KLT A;  1PZN A;  5TZV A;  8ICH A;  5CR0 A;  4G3I A;  2ZUC A;  4M5D A;  3HIY A;  1D9F A;  3PO5 A;  4DSK A;  3NYB A;  3SV3 A;  3TI0 A;  3G6X A;  2BPG A;  4CCH A;  9ICJ A;  3IM1 A;  4UAY A;  8ICC A;  1D8Y A;  3RBE A;  3TAQ A;  3H37 A;  4X4P A;  4TUQ A;  4F92 B;  4MFF A;  5C5J A;  4Q43 A;  9ICO A;  1C7Y A;  3GFK B;  4M6W A;  8ICS A;  4EBC A;  5DKW A;  5F2V O;  4J9S A;  1XSL A;  3KHL A;  4Q44 A;  3MR3 A;  1ZJN A;  5KFL A;  4E8F A;  1ZJM A;  4EP7 A;  4M9L A;  3UQ0 A;  1RXV A;  3C1Z A;  4R65 A;  2ISP A;  4RWO A;  4GXK A;  8ICI A;  4RUC A;  4DFJ A;  1QTM A;  4FHP A;  1KEJ A;  1MIV A;  2ZH2 A;  5DG8 A;  1BVS A;  9ICH A;  4RNO A;  4FS2 A;  2VA8 A;  3UXN A;  4X4O A;  1NO5 A;  2KFZ A;  1S76 D;  3TAP A;  4M04 A;  4WC6 A;  4R8U A;  1KLN A;  4R8U B;  1U4B A;  4DS4 A;  3IHQ B;  5CJ7 A;  4F3O A;  1S97 A;  5HRE A;  3OHA A;  4QZB A;  4WC3 A;  4KIT B;  3OJS A;  4F50 A;  5HP4 A;  3ETL A;  9ICF A;  4YD1 A;  4DSE A;  3K4G A;  4LZG A;  4PGQ A;  1ZQW A;  1S10 A;  4JV0 A;  4TQS A;  2V4R A;  1LV5 A;  3RJE A;  9ICS A;  5CWR A;  5DG7 A;  4WCW A;  4RQ8 A;  1L5U A;  4BGD A;  1WCN A;  3KTQ A;  7ICH A;  2MUT B;  5J2F A;  1EXN A;  4QWD A;  4I2G A;  1RYR A;  3MBY A;  3G6Y A;  3LDA A;  4Q45 A;  2XO7 A;  5BOM A;  3Q8S B;  3PW2 A;  4UB4 A;  2C2D A;  3ZDB A;  1Z00 B;  2HHQ A;  3HJ1 A;  8ICL A;  5KFS A;  4ATB B;  4JWM A;  4R63 A;  5D46 A;  1L3T A;  4NKU A;  8ICT A;  3OUY A;  1TK0 A;  3OUY B;  1T4G A;  5F9L A;  3H3A A;  7ICS A;  4QZC A;  1ZQC A;  4EBJ A;  4LT6 A;  3TAR A;  9ICW A;  4C8K A;  2PI5 A;  1ARO P;  4F5Q A;  4YXM A;  3EPG A;  7ICM A;  4ED7 A;  1UA0 A;  7ICG A;  1SZP A;  4IR9 A;  2ZH5 A;  4YMO A;  3QZ7 A;  1DK2 A;  3AQM A;  2F1H A;  5KT7 A;  5HMM A;  3RRG A;  1JMS A;  4M2Y A;  1X9M A;  3MFH A;  2FPM A;  5KG6 A;  1Z3E B;  3M9N B;  3RAQ A;  4O5C A;  4DSL A;  9ICG A;  5J0R A;  4AT8 A;  2JZB A;  2KZM A;  2JZB B;  4KLS A;  2NRZ A;  3ZDC A;  2HHP A;  1A77 A;  4YD2 A;  3RB0 A;  1ZQT A;  3H8J A;  9ICL A;  2ASL A;  4EZ6 A;  5KFW A;  1JAJ A;  3UXP A;  2ASJ A;  2HHT A;  3PW5 A;  2HHV A;  1KFS A;  8ICO A;  4LVS A;  5DBC A;  1R8A A;  3WFO A;  5KFI A;  3GV8 B;  4Z6F A;  4X0A A;  5J0Y A;  4UB1 A;  4DSI A;  1MQ2 A;  3RTV A;  1MIY A;  3V6J A;  4XQ8 A;  4NLK A;  4AT9 B;  4F8R A;  1QSY A;  4O5K A;  2R8J A;  3GIL A;  4TQR A;  2BR0 A;  1UT8 A;  4B9T A;  5CB1 A;  4UB5 A;  4I2A A;  4F4K A;  4FHV A;  2A1J A;  4TUP A;  4DWI A;  1JQR A;  2J6S A;  2JEF A;  4I29 A;  4I2C A;  1KNY A;  9ICE A;  3NTU A;  4MFA A;  4BXO A;  5EWF A;  1A76 A;  3ISC A;  4F4Z A;  2JEG A;  3RH5 A;  4I2B A;  8ICN A;  2RDI A;  3PVX A;  4AT7 A;  3EW9 A;  4YR3 A;  2RFF A;  3BDP A;  3RB3 A;  1QSL A;  4M9J A;  5IIK A;  3RB4 A;  1NJY A;  1X9W A;  1KTQ A;  2B21 A;  5KG2 A;  3MR2 A;  1MC8 A;  2BQ3 A;  2W9B B;  3WFP A;  5III A;  3RAX A;  1K1Q A;  3PY8 A;  4I28 A;  5J2D A;  1R8C A;  4DL7 A;  9ICX A;  2XC9 A;  1ZQL A;  3MR6 A;  4MF2 A;  2M2T A;  3GQC A;  2R8H A;  4DF4 A;  5KFE A;  3V7L A;  5IIL A;  4KLF A;  1MSW D;  2OWO A;  5HC9 A;  5KFJ A;  5KFZ A;  4EBK A;  1UT5 A;  5J0W A;  3OSN A;  4DFP A;  4R66 A;  3WFQ E;  4DL6 A;  4M9N A;  1RXW A;  4KLH A;  4PPX A;  3E2E A;  4I2I A;  4IQV A;  5HHH A;  2BE3 A;  4DLG A;  5DGA A;  3MR5 A;  2F1I A;  2W9M A;  4QZI A;  1WCL A;  4DSJ A;  3RH4 A;  2AJQ A;  5EOZ A;  1ZQE A;  4QZ8 A;  5KG4 A;  1L3S A;  3PNC A;  3C2K A;  2AQ0 A;  2DFL A;  2UVU A;  4JWN A;  1U48 A;  5KFG A;  2C28 A;  1ZET A;  1QLN A;  3ORY A;  5J2I A;  4XUS A;  1N48 A;  2HHU A;  8ICG A;  1VFG A;  2BQR A;  3K75 D;  9ICM A;  4J9P A;  7ICE A;  7ICU A;  5IIJ A;  4QWC A;  3C18 A;  7ICR A;  1NK9 A;  1ZYQ A;  1F5A A;  1ZQZ A;  3UXO A;  4E0D A;  4K4H A;  4YMN A;  2PBE A;  4E80 A;  3JPO A;  3AU2 A;  4YG2 A;  4RUA A;  4DQR A;  5KFA A;  4RU9 A;  2W8K A;  3V7K A;  4I2F A;  7ICO A;  3TAN A;  4QZF A;  4ZH4 A;  4ECU A;  2HHW A;  1TK8 A;  2PFP A;  5DB9 A;  9ICU A;  4FHY A;  4RWP A;  4EZ9 A;  3JZ0 A;  1X2I A;  3JPS A;  3THV A;  4J9N A;  3Q8L A;  2XGQ A;  3H39 A;  3MGH A;  2ZTC A;  4ECZ A;  4WC1 A;  1ZQD A;  5L1J A;  4DL3 A;  3QE9 Y;  5KFC A;  3GII A;  5DB6 A;  4ED1 A;  2R8K A;  4F4X A;  5KT6 A;  4QWE A;  3V6H A;  2ZTD A;  3LWM A;  1ZQS A;  1OU5 A;  3T5H A;  5KG5 A;  5J0Q A;  4RZR A;  3HX0 A;  4O9M A;  4YMM A;  3AU6 A;  2VA2 A;  2NRK A;  4RQ6 A;  4KLO A;  3LK9 A;  1U47 A;  4NLG A;  4J9L A;  2UVV A;  2KP7 A;  1NOM A;  4S3N A;  3PX4 A;  1S9F A;  4RT3 A;  4RPX A;  3H38 A;  4X4V A;  5DQI A;  5J2C A;  1NKB A;  3HW8 A;  4O3R A;  8ICY A;  8ICZ A;  4X4R A;  4UAW A;  4WC2 A;  3PO4 A;  3EWA A;  4Z6D A;  3ZDD A;  7ICN A;  4F4Y A;  4DLE A;  3SYZ A;  5IIN A;  4ELT A;  4F93 B;  3OJU A;  4J9O A;  4IQT A;  4ECQ A;  5DB7 A;  1NK7 A;  4NKT A;  5DLF A;  3OVB A;  1TVA A;  3GV5 B;  4PGX A;  4Z6C A;  5DDM A;  2I1Q A;  1ZQO A;  5KG7 A;  3C5G A;  4P2H A;  1TKD A;  4Q8E A;  3AQL A;  3FDS A;  3PML A;  4YR2 A;  8ICR A;  4P4M A;  4F5N A;  3T5L A;  1XO1 A;  1HJP A;  2MUT A;  5J29 A;  4QZD A;  2HVH A;  7ICK A;  4F5R A;  3SI8 A;  2DR5 A;  1NK6 A;  8ICE A;  3Q8K A;  4B9U A;  3EZ5 A;  1ZQN A;  4NM2 A;  1Z00 A;  4PGY A;  4X4N A;  4KMU A;  4RQ2 A;  3RRH A;  4QZG A;  4HYK A;  4NY8 A;  4ATB A;  4TUS A;  4WC7 A;  1BNO A;  4RNN A;  3UPQ A;  2I9G A;  3KHR A;  1S0N A;  2ZTE A;  7ICQ A;  1SKR A;  4PH5 A;  3JYY A;  1IM4 A;  4F5O A;  5DB8 A;  1T3N A;  3TFS A;  4FH5 A;  3RJF A;  3JPQ A;  2FLL A;  2NRT A;  3MDC A;  3H4B A;  4O5E A;  4DF8 A;  4GLX A;  3OSP A;  1TV9 A;  4IRK A;  3LQC B;  1XU4 A;  3RJI A;  3OVS A;  4BDP A;  4KLM A;  5DDY A;  3SZ2 A;  5KFF A;  4YP3 A;  3SV4 A;  3BQ0 A;  3MDA A;  1KFT A;  4PHP A;  4FS1 A;  1JIH A;  2XY7 A;  4P4P A;  2Q0Z X;  4NLZ A;  7ICI A;  1XC9 A;  9ICQ A;  2FMS A;  5J2B A;  4GC7 A;  3RR7 A;  3C23 A;  4UBC A;  1XSN A;  9ICC A;  5L1L A;  5DED A;  4F5P A;  1U49 A;  1UET A;  1B43 A;  5DQH A;  4I2J A;  1T8E A;  2KFN A;  1KRP A;  3G6V A;  2ISO A;  2BPF A;  2J6T A;  3PR4 A;  1BPD A;  1JX4 A;  3ISD A;  2JEJ A;  4AT9 A;  3H8W A;  2PFQ A;  8ICV A;  7ICP A;  4UQG A;  4PHA A;  5J0S A;  4Z6E A;  2BCU A;  1BPE A;  3OVA A;  3BQ1 A;  4ED3 A;  3HT3 A;  3BQT A;  4ECX A;  7ICV A;  4EBE A;  4EYH B;  3RJJ A;  5DBB A;  3Q8M A;  9ICK A;  4RWQ A;  2ZH7 A;  3MAB A;  4P4O A;  5KFM A;  8ICW A;  3PR5 B;  2R8I A;  2XY5 A;  3AQK A;  4NLN A;  5L1K A;  1ZQR A;  1LB2 B;  4F2R A;  1NZP A;  3T3F A;  2LYH A;  5KFR A;  3B0X A;  5CP2 A;  2ZH3 A;  4M0A A;  1L3V A;  2ZHA A;  4FH3 A;  4C8N A;  3C5F A;  5CA7 A;  3PW7 A;  2W9B A;  2XCP A;  1Y88 A;  4J9Q A;  4DSF A;  4DL5 A;  2NRW A;  2O5A A;  3HP6 A;  3T5K A;  1ZQA A;  1FA0 A;  2KN7 A;  3EYZ A;  1SL0 A;  5J2H A;  4RT2 A;  2AQ4 A;  2BKE A;  5KFT A;  4YXJ A;  5JUM A;  5HRB A;  5HRH A;  3UPS A;  2C22 A;  4XRH A;  4DS5 A;  4ELU A;  2W8L A;  2IBK A;  3C66 A;  1ZQQ A;  4DL4 A;  2RDJ A;  3PX0 A;  2DPI A;  5DLG A;  1U45 A;  3RR8 A;  3M9M B;  4R64 A;  5HRK A;  2DRA A;  2Q66 A;  9ICN A;  3OHB A;  4NXZ A;  1BPX A;  5KFQ A;  4X4T A;  2ZUD A;  2O1P A;  5EWG A;  4DOA A;  1JXL A;  9ICP A;  2HW3 A;  1VJ7 A;  3WFR E;  4X4S A;  2ZUB A;  4F2S A;  3H40 A;  2BPC A;  4J9K A;  5L9X A;  2VAN A; 
#chains in the Genus database with same CATH topology
 5AIC A;  5ALQ A;  1Q78 A;  3CK6 A;  1XS9 D;  1KQQ A;  1KBU A;  1BGX T;  3C2M A;  3HPO A;  5AI6 A;  5AIB A;  2HHX A;  2BCQ A;  8ICF A;  2ZH4 A;  2W9C B;  3PX6 A;  2WHE A;  5BPC A;  2V4Q A;  1JI7 A;  2VA3 A;  2DR9 A;  4QIW C;  5KTQ A;  2H5X A;  3RH6 A;  3EPI A;  1NK5 A;  2D6F C;  4RPZ A;  1SL1 A;  2ATL A;  2HHS A;  5AM5 A;  8ICP A;  3V6K A;  3H0M B;  5KFK A;  2KKV A;  2ODG A;  1UEU A;  4IQW A;  1ZOL A;  2YY6 A;  3OWG A;  4KN7 A;  3WK6 A;  3OV7 A;  4HX0 A;  3BQ2 A;  3J81 j;  1JXE A;  5EE1 A;  8ICM A;  4NL9 C;  1TFW A;  1ZQV A;  5E79 U;  2W9A A;  3RJH A;  1OW5 A;  1JAL A;  2FE9 A;  5J2A A;  4KLI A;  4FO6 A;  2K4P A;  4DOB A;  2Y1J A;  3DV9 A;  1ZQF A;  4EEY A;  5AHX A;  2QB1 A;  3N97 B;  3H4D A;  1NJX A;  2AU0 A;  4PHE A;  1DOQ A;  1RQL A;  2V9W A;  1ZQ1 C;  4NXV A;  2LPE A;  2DKZ A;  4JMU A;  4MF8 A;  5HRF A;  1Q46 A;  5F9N A;  5DGB A;  5HR9 A;  3RB6 A;  2A1A A;  4DQQ A;  5HRI A;  3I28 A;  4RNM A;  3DDH A;  9ICT A;  2ZG6 A;  2ZIW B;  4YVZ A;  1S0V A;  4FZM A;  2D8C A;  4BWM A;  4UB2 A;  4F91 B;  1NK4 A;  3M9O B;  4UAS A;  4I2H A;  1ZQY A;  2BCV A;  1WYG A;  3B0Y A;  1KSP A;  4O3S A;  2FMP A;  5D62 A;  2PKE A;  1DXS A;  5BOL A;  4M9H A;  3L3F X;  1UEV A;  1MIW A;  4B9N A;  2A1J B;  1RZT A;  1S0M A;  2M9N A;  4WQL A;  5KFX A;  2ZHB A;  4BXO B;  2I5H A;  5AM2 A;  2GWS A;  4JV2 A;  2HDO A;  2DVI A;  5J8Y A;  1ZQX A;  4NM1 A;  3A0B U;  1SKS A;  2FI1 A;  4WJ3 B;  1L3U A;  2P6R A;  3PMN A;  1TAQ A;  4QWB A;  3H7I A;  9ICV A;  4P0Q A;  3NRZ A;  2IMW P;  3NAS A;  4QNL A;  4MEY A;  3T5J A;  1H38 A;  2J6U A;  4K8V A;  4YR0 A;  2BHN A;  2LHT A;  4DL2 A;  2KSO A;  4Y2Q A;  3ALR A;  5DG9 A;  3GDX A;  3PV8 A;  1JRO A;  4ACO A;  5TZV A;  1V97 A;  2PMZ F;  5F3X B;  5CR0 A;  2HBL A;  3KBB A;  4QIW F;  3G6X A;  2YB1 A;  4UAY A;  8ICC A;  2H3Q A;  9ICO A;  4Q43 A;  4RQN A;  2GA9 D;  4J9S A;  2LM1 A;  2KNJ A;  2KOB A;  4Y2R A;  3KHL A;  1ZJM A;  3UQ0 A;  2P35 A;  1QQ5 A;  5AM1 A;  4R65 A;  1RXV A;  2OM6 A;  8ICI A;  2HBM A;  1SXE A;  5AKH A;  5DG8 A;  2QLT A;  3RFA A;  2VA8 A;  1NO5 A;  1RM6 C;  4R8U A;  4R8U B;  2LM4 A;  5AKE A;  1S97 A;  3OHA A;  4WC3 A;  3OJS A;  5ALL A;  4DSE A;  3FC4 A;  4PGQ A;  2W03 A;  1X6I A;  3RJE A;  9ICS A;  5ALJ A;  7ICH A;  3R9K A;  3KTQ A;  2MUT B;  5J2F A;  1EXN A;  4QWD A;  2QB0 B;  1RYR A;  5AIA A;  5AK3 A;  3G6Y A;  3BQ7 A;  3LDA A;  4Q45 A;  3PW2 A;  2C2D A;  3ZDB A;  8ICL A;  5AM0 A;  1L3T A;  3OUY A;  1TK0 A;  3OUY B;  1ZQC A;  2K4I A;  3SEI A;  4F5Q A;  1UA0 A;  4IR9 A;  2KVC A;  2ZH5 A;  5ALU A;  1X9M A;  2MSN A;  3VCB A;  1SWW A;  4KMO B;  3RF9 A;  3QUC A;  3WK5 A;  4KLS A;  3ZDC A;  2HHP A;  3SEN A;  4NJ8 A;  5ALD A;  4NXX A;  9ICL A;  5KFW A;  4OJL A;  3UXP A;  4Z6F A;  2F77 X;  4X0A A;  5B66 U;  5J0Y A;  3H0R B;  4DSI A;  1MIY A;  4NLK A;  5AKG A;  2EWR A;  1QQ7 A;  4F8R A;  2DKX A;  2JEF A;  3UMB A;  5JTI A;  1KNY A;  9ICE A;  3NTU A;  4OD0 A;  2E3T A;  2XI9 A;  3ISC A;  2JEG A;  2RDI A;  2JR5 A;  1QSL A;  1NJY A;  3MR2 A;  3WFP A;  5ALO A;  5III A;  3PY8 A;  4I28 A;  2YMM A;  4NL9 A;  2XC9 A;  4MF2 A;  2M2T A;  2R8H A;  1SWV A;  5KFE A;  4KLF A;  4UB8 U;  3QU7 A;  2EZZ A;  4BX9 C;  1IV8 A;  5HC9 A;  5KFJ A;  4DFP A;  3A0H U;  3IN5 A;  3OTQ A;  3E2E A;  5DGA A;  4QZI A;  3SAH A;  4KX5 A;  3PNC A;  2AQ0 A;  1R8A A;  1N48 A;  8ICG A;  2W43 A;  1RG6 A;  3K75 D;  7ICE A;  1NK9 A;  4E0D A;  2FCL A;  3JPO A;  3AU2 A;  4YG2 A;  2OXO A;  2W8K A;  1HIW A;  2Q66 A;  4QZF A;  4ECU A;  2G5H B;  3JZ0 A;  1X2I A;  3Q8L A;  2XGQ A;  1Z19 A;  3H39 A;  4ECZ A;  4WC1 A;  1ZQD A;  4F4X A;  4JB3 A;  2ZTD A;  5KG5 A;  3HX0 A;  3IRU A;  5C0Y A;  3LK9 A;  1U47 A;  2UVV A;  2RRD A;  3PX4 A;  1S9F A;  4RPX A;  3H38 A;  4X4V A;  8ICY A;  4UAW A;  4F4Y A;  4DLE A;  1O03 A;  4J9O A;  4IQT A;  1NK7 A;  1COK A;  1L6N A;  4Q8E A;  5KG7 A;  8ICR A;  7ICK A;  2FDR A;  2N1R A;  4KB6 A;  3Q8K A;  1AQ6 A;  1ZQN A;  1Z00 A;  4QZG A;  1URJ A;  4O67 A;  1L7N A;  3UPQ A;  3KKA C;  4G9B A;  2I9G A;  1S0N A;  2ZTE A;  2LI6 A;  7ICQ A;  4USA A;  3JYY A;  1IM4 A;  3TFS A;  3RJF A;  2WB1 C;  1T94 A;  4US9 A;  3H4B A;  4O5E A;  1TV9 A;  3OVS A;  2DL0 A;  4YP3 A;  5EE3 A;  1V38 A;  1JIH A;  4B6J A;  3ICX A;  4P4P A;  2XY7 A;  1XC9 A;  2FMS A;  2IOF K;  5ALT A;  5J2B A;  3RR7 A;  4UBC A;  9ICC A;  5AKI A;  2KFN A;  4I2J A;  2BPF A;  1BPD A;  2JEJ A;  4AT9 A;  8ICV A;  4P0P A;  7ICP A;  5J0S A;  3WKA A;  3OVA A;  3BQT A;  4P4O A;  3WKD A;  4C4T A;  5L1K A;  1XO0 A;  4O3M A;  2LYH A;  4M0A A;  4FH3 A;  2XCP A;  2KG5 A;  2KMD A;  3AM9 A;  2F8L A;  3GZF A;  4RT2 A;  2AQ4 A;  3PSI A;  4U6P A;  3UPS A;  4ELU A;  2CN1 A;  2W8L A;  3QU2 A;  1ZQQ A;  2K8B B;  1U45 A;  3M9M B;  4OCZ A;  2DRA A;  9ICN A;  2KJ5 A;  5EWG A;  4DOA A;  3BZK A;  1PUZ A;  3H40 A;  4J9K A;  5L9X A;  1L7M A;  4KLQ A;  3IV6 A;  5K4L A;  1LVH A;  2MU2 A;  2B51 A;  2DRB A;  4K4I A;  5KL8 B;  8ICU A;  3HJ4 A;  5KFH A;  3HIL A;  4WH5 A;  2AHO B;  3LYS A;  4GIB A;  4RQ1 A;  1FO4 A;  3NGD A;  4EBD A;  3ZD8 A;  2FLP A;  2VKQ A;  4X0B A;  4DQI A;  4GXJ A;  4RQ0 A;  1ZQG A;  3O0F A;  1ZQJ A;  2DF4 B;  5ALM A;  3RJG A;  4LZD A;  5KFN A;  4ED2 A;  4MEX A;  2FMQ A;  4IRC A;  5CEH A;  3QEB Z;  1K1S A;  2OEH A;  4RQ4 A;  2E5S A;  2K89 A;  5FP0 A;  4M6W B;  5J8Y C;  2ZIV B;  4CGZ A;  5AKZ A;  3C21 A;  3QU9 A;  3AQE A;  2R8G A;  4DFM A;  3L9D A;  2FPL A;  5KFD A;  5AKJ A;  1WWV A;  1JUD A;  1R8B A;  4QJF B;  2JH7 A;  3WFS C;  1ZQK A;  5KNI A;  3SQI A;  3Q8P B;  2XCA A;  2YX8 A;  4K99 A;  3N4M B;  3JPT A;  3NVO A;  4RPY A;  3OGU A;  5KFB A;  5CFS A;  1FEZ A;  2WB1 F;  1YLQ A;  2GLE A;  3V72 A;  2PFO A;  5H2F U;  3Q8R B;  5HML A;  4UD4 A;  2F3N A;  1Z1B A;  2XIC A;  1DGS A;  4GC6 A;  4DO9 A;  4ECS A;  4DFK A;  4CF3 A;  1CUK A;  1S0O A;  3C2L A;  3ZDE A;  2CXY A;  2M2U A;  2W7O A;  4OAI Z;  2DBY A;  2KK0 A;  1VDV A;  4C8L A;  8ICB A;  5KG0 A;  4QW9 A;  2G07 A;  1X9S A;  5ALH A;  1D9D A;  3JPP A;  1SZH A;  1PK1 B;  2FPK A;  5HRG A;  1U9L A;  7ICJ A;  5J2G A;  1Q79 A;  4AT7 B;  1NK0 A;  2JRZ A;  1D8B A;  1TAU A;  3ISB A;  1PVQ A;  1O08 A;  3HRD D;  3HWT A;  4NV0 A;  5ALS A;  1ZD2 P;  2BGW A;  2WTF A;  4I2D A;  4FH5 A;  4RWN A;  5ALV A;  2KIW A;  4RQ7 A;  4NLC A;  4B9M A;  5KT4 A;  1NJW A;  2M2W A;  3SR6 A;  1BPY A;  1T7P A;  4F72 A;  3KKA A;  4OAH A;  4IQU A;  4KTQ A;  5J0X A;  2PMZ C;  2W9C A;  4YQW A;  3ER8 C;  5L1I A;  9ICI A;  2PI4 A;  2BQU A;  5KFU A;  4M9G A;  4WC0 A;  4KLT A;  5AK5 A;  2CPR A;  8ICH A;  2ZUC A;  4DCC A;  3TAC B;  3PO5 A;  2BBJ A;  2HBK A;  1FFU A;  2BPG A;  3GU3 A;  3H37 A;  4X4P A;  4F92 B;  4MFF A;  5C5J A;  3UMC A;  2I6X A;  1NI3 A;  4EBC A;  5F2V O;  5AI5 A;  1XSL A;  4Q44 A;  3L4P A;  3MR3 A;  1F44 A;  3C1Z A;  4CF4 A;  3ED5 A;  4DFJ A;  1QTM A;  2YN4 A;  4FHP A;  1MIV A;  1A6S A;  1S76 D;  4EED A;  5EE0 A;  4WC6 A;  1KLN A;  1U4B A;  1Q8K A;  5CJ7 A;  4DS4 A;  2K8C B;  5HRE A;  4QZB A;  5A0L A;  2OH2 A;  3QU4 A;  2V4R A;  5DG7 A;  4WCW A;  1L5U A;  1WCN A;  4I2G A;  3CRX A;  2KD1 A;  3Q8S B;  4UB4 A;  4ATB B;  5D46 A;  1J2N A;  4NKU A;  7ICS A;  4LT6 A;  3TAR A;  4C8K A;  2PI5 A;  7ICM A;  7ICG A;  2ZIW A;  3AQM A;  2E8P A;  4UAR A;  4M2Y A;  2FPM A;  4DSL A;  3AQF A;  1A77 A;  1ZQT A;  4EZ6 A;  2MA1 A;  2HHT A;  2RHF A;  4LVS A;  2EAN A;  5ALG A;  4UB1 A;  1KW4 A;  4NXT A;  3SAF A;  3V6J A;  4XQ8 A;  1QSY A;  2R8J A;  4TQR A;  4B9T A;  4I2A A;  4FHV A;  2A1J A;  4DWI A;  1JQR A;  2J6S A;  3BZC A;  2E1F A;  3NVV A;  4OJP A;  4BXO A;  5EWF A;  1A76 A;  3RH5 A;  8ICN A;  3PVX A;  4YR3 A;  2RFF A;  3RB3 A;  3NS1 A;  4FO1 A;  1X9W A;  4NXU A;  2B21 A;  5KG2 A;  2W9B B;  2E8N A;  3NUQ A;  1K5O A;  1K1Q A;  3RAX A;  5ALK A;  5J2D A;  3BS5 A;  3BS5 B;  2HOI A;  3V7L A;  4C4S A;  3H0L B;  5KFZ A;  5J0W A;  2ZIU A;  2ZIU B;  4I2I A;  2LBO A;  5HHH A;  2BE3 A;  2KJ8 A;  3NVY A;  4EEK A;  2W9M A;  4DSJ A;  3RH4 A;  3ERC C;  2KV2 A;  1ZQE A;  5CHE A;  2UVU A;  4JWN A;  4O68 A;  2F76 X;  4US8 A;  5KFG A;  5HRK A;  2W3R A;  3WK7 A;  1VFG A;  5AI9 A;  2BQR A;  3QUQ A;  7ICU A;  5IIJ A;  4QWC A;  2GAF D;  1ZYQ A;  1F5A A;  1ZQZ A;  2PBE A;  4YMN A;  4E80 A;  5G5H A;  5KFA A;  4RU9 A;  1YZ7 A;  3IG5 A;  3L5K A;  3TAN A;  4ZH4 A;  3CNH A;  4FHY A;  5DB9 A;  5T14 A;  2Y9U A;  2E1E A;  5AKL A;  3TKA A;  2JMG A;  4DL3 A;  5KFC A;  3NRW A;  4ED1 A;  5KT6 A;  4QWE A;  3V6H A;  1ZQS A;  5J0Q A;  4RZR A;  1UCV A;  4O9M A;  4YMM A;  3SMV A;  2NRK A;  4Y2T A;  4NLG A;  4J9L A;  1NKB A;  3ETR A;  5AI4 A;  3EWA A;  3E58 A;  3F2B A;  5IIN A;  3OJU A;  3OVB A;  1X40 A;  2KHQ A;  5KL1 B;  4PGX A;  3IP4 B;  4Z6C A;  5DDM A;  1TKD A;  4F5N A;  2DR5 A;  1HJP A;  2MUT A;  2QB0 A;  4F5R A;  1NK6 A;  8ICE A;  4B9U A;  2HI0 A;  4NY8 A;  3RRH A;  4HYK A;  4WC7 A;  1IIP A;  3E0F A;  4EX6 A;  2LYB A;  3JPQ A;  3MDC A;  4DF8 A;  4GLX A;  4IRK A;  3RJI A;  4BDP A;  4KLM A;  4PZO A;  1F0M A;  2Q0Z X;  1XSN A;  4JLX A;  3EUB 2;  1U49 A;  3M7D A;  1UET A;  5D61 A;  3SAG A;  2EAM A;  2J6T A;  4JLZ A;  3ISD A;  3H8W A;  2PFQ A;  4UQG A;  2BCU A;  3PZP A;  4ECX A;  2R18 A;  4EBE A;  4EYH B;  1L8O A;  3MAB A;  4F2R A;  4PJ0 U;  3D2N A;  2YML A;  3T3F A;  5ALE A;  3B0X A;  1DGJ A;  5CP2 A;  4FZN A;  2YMQ A;  1L3V A;  2ZHA A;  5CA7 A;  3PW7 A;  1Y88 A;  4EEB A;  2NRW A;  3HP6 A;  3T5K A;  3EYZ A;  3F2C A;  5J2H A;  5KFT A;  4YXJ A;  5HRB A;  2JV3 A;  5DLG A;  4Y2Y A;  3OHB A;  4Y2S A;  3ONN A;  3WFR E;  2ZUB A;  1IG6 A;  4IG8 A;  4XA5 A;  2BDP A;  2JEI A;  5J0P A;  5KG1 A;  4DOC A;  3UMG A;  2F44 A;  3JPR A;  1SL2 A;  3WKE A;  1NK8 A;  1L8L A;  1B0X A;  4GXI A;  3PW0 A;  2H3F A;  5HR6 A;  4KX3 A;  2AGP A;  2OYY A;  4IR1 A;  1KL9 A;  5KFV A;  3RBD A;  2DQN B;  2M2V A;  4ICA A;  4A8E A;  1ZQH A;  4I0U A;  3GIK A;  4NWI A;  3H8S A;  3AUO A;  1ECW A;  3TQ1 A;  3NVZ A;  2EAP A;  2ZH9 A;  5IIO A;  1BPZ A;  3QUB A;  1HUZ A;  3N7R C;  2YQE A;  4KLL A;  2JXJ A;  1B22 A;  1ZQP A;  1KFD A;  1V4A A;  4ECV A;  2ZH1 A;  4QZE A;  3TFR A;  3Q8Q B;  2XGP A;  2G06 A;  1BNP A;  3EF2 A;  2RQ5 A;  1V9P A;  1LKY B;  2G0A A;  2QAR B;  4WBY A;  9ICR A;  4KLJ A;  3QX7 A;  1YZ6 A;  1N5W A;  1ZXI A;  2NO5 A;  3M8R A;  3UQ2 A;  5CRX A;  4J03 A;  1L7P A;  4B9L A;  5J2J A;  2ZJ5 A;  4MHV A;  1Z4N A;  3F2D A;  5JU5 A;  4BWJ A;  2PXI A;  4O3P A;  3BS7 A;  4JV1 A;  1S77 D;  1R89 A;  3BJY A;  1SIJ A;  1RQN A;  2IOF A;  2KKP A;  2FLN A;  1V85 A;  3AEV A;  4Y2V A;  2IA6 A;  2W54 A;  4I2E A;  4AT8 B;  4IC9 A;  3M6K A;  4EYI B;  4ECT A;  3N7S C;  1M6Y A;  2ZH6 A;  2AGO A;  5JRT A;  2Z7J A;  4CE6 A;  8ICQ A;  4EEN A;  1JN3 A;  1ZQB A;  4FE3 A;  3C29 A;  4C8O A;  1XWL A;  9ICA A;  5D4B A;  4E7X A;  1NZB A;  3ZI4 A;  4DEZ A;  5DBA A;  2UVW A;  4X4Q A;  3VC8 A;  4M47 A;  4EX7 A;  4QZ9 A;  4UBB A;  4DQP A;  5J0U A;  4ED6 A;  2P6U A;  5B3P A;  2KE7 A;  3U26 A;  1ZRM A;  1QSS A;  1CRX A;  2C2E A;  4WC5 A;  5KT3 A;  3MCR A;  2ZJ8 A;  1NKE A;  5L1M A;  2KTQ A;  1NKC A;  1N63 A;  4QWA A;  4UB6 U;  1N61 A;  4O3O A;  4XQ7 A;  1N60 A;  4ECY A;  4X4U A;  5DEC A;  1TFR A;  2Y0S C;  3V7J A;  1FIQ A;  4QZH A;  4O69 A;  1KDH A;  2A19 A;  2P66 A;  3FYH A;  4TUR A;  4OAG A;  2ALZ A;  8ICJ A;  3IDW A;  3AQN A;  2NRV A;  4AYB C;  1RYU A;  3HIY A;  1D9F A;  4DSK A;  4CCH A;  9ICJ A;  4WOY A;  1D8Y A;  5AKX A;  3TAQ A;  2WF5 A;  4TUQ A;  1WWU A;  4Y2X A;  4M6W A;  8ICS A;  4K9A A;  3M6Z A;  4EP7 A;  4M9L A;  2ZIV A;  2NYV A;  4GXK A;  1UPH A;  1X42 A;  2E8O A;  2ZH2 A;  3QUT A;  2WFA A;  4RNO A;  2VJ5 A;  4FS2 A;  3UXN A;  4X4O A;  3TAP A;  2W3S A;  4CNQ A;  1PVR A;  4KIT B;  3NKU A;  4F50 A;  2LYA A;  3K4G A;  4LZG A;  1ZQW A;  1J2M A;  1S10 A;  4JV0 A;  4TQS A;  4C0Z A;  5ALR A;  4LEV A;  3K7D A;  1CI4 A;  5AI0 A;  1JRP A;  2XO7 A;  1S5L U;  3HJ1 A;  5KFS A;  4JWM A;  4R63 A;  2OHF A;  2DGZ A;  1T4G A;  5F9L A;  1S8O A;  4QZC A;  1Z1V A;  1ARO P;  3EPG A;  3FM9 A;  2F1H A;  5KT7 A;  5HR7 A;  1X6J A;  3RAQ A;  5J0R A;  2KZM A;  3KD3 A;  2NRZ A;  2H3V A;  3I76 A;  5ALF A;  2YTU A;  2ASL A;  1KKX A;  2ASJ A;  3PW5 A;  1KFS A;  8ICO A;  3M1Y A;  3WFO A;  5KFI A;  1N5X A;  2BDU A;  4LEY A;  1MQ2 A;  4OO1 J;  4O5K A;  1UHU A;  2BR0 A;  1UT8 A;  4WQK A;  5CB1 A;  1PK1 A;  4F4K A;  4I29 A;  4I2C A;  4PL2 A;  4I2B A;  2H3I A;  4AT7 A;  3EW9 A;  3BDP A;  4M9J A;  3KZX A;  1MC8 A;  2BQ3 A;  3I1Y A;  4DL7 A;  1OU5 A;  3CYM A;  5ALP A;  1X9X A;  3MR6 A;  4DF4 A;  2BBH A;  1MSW D;  1HEK A;  2RP5 A;  3AN1 A;  3D2S A;  4EBK A;  1SV0 C;  4DL6 A;  4PZN A;  2Y0S F;  1RXW A;  4KLH A;  4IQV A;  1J97 A;  2F1I A;  2WF7 A;  5EOZ A;  2CRX A;  1L3S A;  2C28 A;  1ZET A;  3ORY A;  5J2I A;  4LEZ A;  5B5E U;  4J9P A;  2HN1 A;  4DFD A;  2G09 A;  3KFU F;  2IUB A;  4AYB F;  2GO7 A;  7ICO A;  2EAO A;  9ICU A;  1TK8 A;  4EZ9 A;  1SGG A;  4J9N A;  2ZTC A;  4UAU A;  2HN2 A;  2JHD A;  2VA2 A;  3AU6 A;  1A0P A;  1RDF A;  1NOM A;  4S3N A;  4RT3 A;  5DQI A;  5J2C A;  4O3R A;  4X4R A;  1ZD5 A;  4WC2 A;  3PO4 A;  7ICN A;  4C4R A;  4ELT A;  2HBJ A;  4NKT A;  5DB7 A;  1T3Q A;  3GV5 B;  4Y2J A;  2LMR A;  3C5G A;  4P2H A;  2KEY A;  3N28 A;  3AQL A;  3PML A;  4YR2 A;  4P4M A;  3T5L A;  1XO1 A;  5J29 A;  4U7C A;  3SI8 A;  3HKZ C;  1KN5 A;  3EZ5 A;  4NM2 A;  4PGY A;  4KMU A;  4RQ2 A;  4ATB A;  4TUS A;  1BNO A;  3CW2 C;  2K4H A;  3KHR A;  1XNS A;  4PH5 A;  5DB8 A;  1T3N A;  2D3D A;  3PHZ A;  2OCE A;  2ESE A;  1VLB A;  3AMZ A;  2BZF A;  3SZ2 A;  5KFF A;  3SV4 A;  1ZD4 A;  1TE2 A;  3MDA A;  4PHP A;  4FS1 A;  1TFY A;  5ALI A;  7ICI A;  4IL6 U;  3C23 A;  5L1L A;  3HJE A;  2WAQ C;  2ISO A;  2W11 A;  3PR4 A;  1JX4 A;  4PHA A;  4C80 A;  1GO3 F;  3BQ1 A;  4ED3 A;  2KIV A;  9ICK A;  3RJJ A;  5DBB A;  3Q8M A;  1QQ6 A;  2FJ6 A;  5KFM A;  2O6K A;  8ICW A;  2R8I A;  3QU5 A;  3AQK A;  4NLN A;  5KFR A;  3UM9 A;  2ZH3 A;  4C8N A;  3C5F A;  2W9B A;  4DSF A;  1ZQA A;  1TAM A;  2KHV A;  2KN7 A;  2GH1 A;  2ZXI A;  2EQY A;  4EV6 A;  2JGA A;  2IBK A;  3C66 A;  2ZXH A;  4C7Y A;  4DL4 A;  4FFD A;  2RDJ A;  3RR8 A;  4NXZ A;  5KFQ A;  2ZUD A;  2O1P A;  5G5G A;  2VJ4 A;  1JXL A;  4N7R A;  2HW3 A;  1VJ7 A;  4X4S A;  4F2S A;  4EEL A;  3C28 A;  2BPC A;  2WF6 A;  2VAN A;  3QEA Z;  3ZD9 A;  1ZQM A;  2DPJ A;  1BPB A;  4ECW A;  3WK4 A;  5HRL A;  5ALZ A;  2BCR A;  3PSF A;  4Q8F A;  2WF8 A;  5KAF U;  5KFP A;  5KT2 A;  5J0O A;  3LVV A;  2EH9 A;  4P0Q B;  4ELV A;  1VJ5 A;  4FBU A;  2KSO B;  2QKQ A;  3ER9 B;  8ICX A;  2UVR A;  3LVW A;  4XJE A;  2EZY A;  4QZA A;  4KLG A;  1WOT A;  2EZX A;  1DK3 A;  4KLU A;  1NJZ A;  2LKY A;  4JK1 A;  2HOQ A;  9ICB A;  3GV7 B;  4B9S A;  7ICL A;  4YFK A;  1RPL A;  3MFI A;  3PW4 A;  2MAX A;  4O3Q A;  2DR8 A;  4O3N A;  2HVI A;  4KLE A;  4JUZ A;  1N56 A;  4MFC A;  2Y1I A;  3JCF A;  5J2K A;  4O0I A;  3MGI A;  1Q3V A;  2ZJA A;  1ZQI A;  4FHX A;  3JPN A;  5HRD A;  1MQ3 A;  4K96 A;  4NXW A;  3GIM A;  5GTI U;  2A3V A;  8ICK A;  1Q3U A;  3C1Y A;  3HKZ F;  2KZZ A;  3KHG A;  4K97 A;  3D2Q A;  1CEZ A;  4OAF A;  2DR7 A;  4I27 A;  3QNM A;  4UD5 A;  4ECR A;  5KFY A;  4FBT A;  3GIJ A;  2HMX A;  1P7D A;  2ID1 A;  2Q4T A;  1SV0 A;  4J9R A;  5IIM A;  2K8A A;  3ZDA A;  3RJK A;  2AGQ A;  2PFN A;  3CP8 A;  4GFJ A;  5EWE A;  4IS7 A;  7ICF A;  4PHD A;  3QZ8 A;  4F4W A;  1D8L A;  1NNL A;  2NRX A;  4ZOH C;  5TIS U;  4X5V A;  2WAQ F;  2ASD A;  4RQM A;  4QW8 A;  5J2E A;  2XID A;  4WBZ A;  4WC4 A;  1COO A;  1TK5 A;  3KHH A;  4DQS A;  8ICA A;  1PX5 A;  2F1J A;  2IHN A;  7ICT A;  5B3Q A;  5DQG A;  1UA1 A;  4ED8 A;  1MA7 A;  3WU2 U;  4YN4 A;  2Y9T A;  4ED0 A;  5HNK A;  1XSP A;  5J0T A;  2W04 A;  2BCS A;  1IXR A;  5KG3 A;  1ZQU A;  2KJ9 A;  1SV4 A;  2XVT A;  5KAI U;  5KT5 A;  4B9V A;  4K4G A;  2KZ3 A;  2YB4 A;  4CF5 A;  4FHW A;  1SKW A;  4J9M A;  1YT3 A;  2ZH8 A;  1HUO A;  2HSZ A;  3M8S A;  5CFT A;  5D49 A;  3WK9 A;  1RYS A;  4RQ5 A;  2RLT A;  2C2R A;  3FAH A;  5KFO A;  4KN4 A;  1B4F A;  3OPX A;  4YCX A;  2XY6 A;  3K1R B;  3LWL A;  2IHM A;  4UAZ A;  1L7O A;  1FFV A;  3TAD C;  2JH1 A;  4RQ3 A;  4KLD A;  4LEW A;  4C8M A;  5HHI A;  4IRD A;  4BUG A;  5CHG A;  2K60 A;  1PZN A;  1DRG A;  4OJ6 A;  5AKY A;  4UAT A;  3WKC A;  4G3I A;  4M5D A;  3NYB A;  3SV3 A;  3TI0 A;  3WK8 A;  5AM3 A;  3IM1 A;  3RBE A;  2H3Z A;  2IHO A;  1C7Y A;  3GFK B;  3F5A A;  4Y2P A;  2ES6 A;  2YMP A;  5DKW A;  4E8F A;  1ZJN A;  5KFL A;  2ISP A;  4RWO A;  4RUC A;  1KEJ A;  5EE9 A;  1PK3 A;  1BVS A;  9ICH A;  4OJO A;  2KFZ A;  1WUD A;  4M04 A;  2HOF A;  2B56 A;  3IHQ B;  4F3O A;  1LKY A;  2W55 A;  2QAR A;  5HP4 A;  3ETL A;  9ICF A;  4YD1 A;  1OUQ A;  2NO4 A;  4UAV A;  1LV5 A;  5CWR A;  4RQ8 A;  2AXT U;  2WF9 A;  4BGD A;  5ALY A;  3MBY A;  5AK6 A;  5BOM A;  1Z00 B;  2HHQ A;  3H8M A;  1F5S A;  8ICT A;  3NWI A;  2HCF A;  3H3A A;  5GTH U;  4EBJ A;  9ICW A;  5CFU A;  3K1Z A;  3DEE A;  4YXM A;  4ED7 A;  1SXD A;  1SZP A;  2L5Y A;  4YMO A;  3QZ7 A;  1DK2 A;  5HMM A;  3RRG A;  1JMS A;  3N7P D;  4PL1 A;  3MFH A;  5KG6 A;  1Z3E B;  3M9N B;  4O5C A;  9ICG A;  4CDG A;  4AT8 A;  2JZB A;  2JZB B;  5JTG A;  4YD2 A;  3RB0 A;  3H8J A;  1JAJ A;  2HHV A;  5DBC A;  3GV8 B;  2B6G A;  3RTV A;  3T79 A;  4AT9 B;  2W7P A;  4P0P B;  3GIL A;  4UB5 A;  3SD7 A;  5AKK A;  4TUP A;  1X66 A;  4MFA A;  4F4Z A;  1ZD3 A;  5IIK A;  3RB4 A;  1KTQ A;  2AH5 A;  2G5I B;  1R8C A;  5AM4 A;  9ICX A;  1ZQL A;  3GQC A;  3QYP A;  3MGV A;  5IIL A;  2OWO A;  1UT5 A;  3OSN A;  4R66 A;  4Y2U A;  2B0C A;  3WFQ E;  4M9N A;  4PPX A;  2ZIX A;  3MC1 A;  2ZIX B;  4DLG A;  3MR5 A;  2IOH A;  1WCL A;  2AJQ A;  3QXG A;  3F5E A;  4AP9 A;  4QZ8 A;  5KG4 A;  3C2K A;  2DFL A;  1QLN A;  1U48 A;  4HAI A;  2EDU A;  4XUS A;  2F2A B;  4BJQ A;  2HHU A;  9ICM A;  3C18 A;  7ICR A;  3UXO A;  4K4H A;  4RUA A;  4NLB A;  3S6J A;  4DQR A;  3V7K A;  4I2F A;  2HHW A;  4RWP A;  2PFP A;  2B4V A;  3KZI U;  1PVP A;  3JPS A;  3THV A;  2KVS A;  5ALW A;  3MGH A;  5L1J A;  3QE9 Y;  3GII A;  5DB6 A;  2R8K A;  3LWM A;  2DWQ A;  3T5H A;  5AK4 A;  3KOO A;  4RQ6 A;  4KLO A;  4K9B A;  1GPJ A;  2VIX A;  2KP7 A;  3HW8 A;  8ICZ A;  2E8M A;  4OJ5 A;  3NVW A;  4Z6D A;  3ZDD A;  1N2X A;  4O6A A;  3SYZ A;  2G08 A;  3AL0 B;  4F93 B;  4ECQ A;  2DUY A;  1N62 A;  5DLF A;  1TVA A;  1MN8 A;  5ALN A;  2I1Q A;  1ZQO A;  4LJX A;  3FDS A;  4QZD A;  2HVH A;  4UW9 A;  2K4E A;  4X4N A;  4RNN A;  2NV3 A;  1SKR A;  4F5O A;  2M0N A;  3B9J A;  1ED1 A;  2FLL A;  2NRT A;  4C7Z A;  3OSP A;  3LQC B;  1XU4 A;  4F71 A;  5DDY A;  1OXJ A;  3BQ0 A;  2F8K A;  1KFT A;  4NLZ A;  9ICQ A;  3TAD A;  4MKP A;  1QH9 A;  4GC7 A;  3D6J A;  5DED A;  4F5P A;  1UQV A;  1B43 A;  5DQH A;  5AI8 A;  1T8E A;  1KRP A;  4CRX A;  3G6V A;  5D63 A;  1ZRN A;  4Z6E A;  1BPE A;  3HT3 A;  7ICV A;  1C20 A;  4RWQ A;  1QCK A;  4K98 A;  2ZH7 A;  5ALX A;  3PR5 B;  2XY5 A;  1ZQR A;  1LB2 B;  2MRL A;  3PST A;  1NZP A;  1WG8 A;  2O5A A;  4J9Q A;  4DL5 A;  1FA0 A;  1Z4O A;  1SL0 A;  2GOL A;  2BKE A;  1SB3 C;  3WKB A;  5JUM A;  5HRH A;  2C22 A;  4XRH A;  4DS5 A;  2DPI A;  3IG8 A;  3PX0 A;  4R64 A;  3PSP A;  1BPX A;  2KIC A;  4X4T A;  3F53 A;  4FZL A;  9ICP A;  4EGW A;  4KM5 A;  4UB3 A; 
#chains in the Genus database with same CATH homology
 3QEA Z;  3ZD9 A;  4XA5 A;  1ZQM A;  4KLQ A;  2DPJ A;  1Q78 A;  2BDP A;  2JEI A;  1BPB A;  5J0P A;  1XS9 D;  5KG1 A;  4ECW A;  4DOC A;  1BGX T;  5HRL A;  2DRB A;  2BCR A;  4K4I A;  3JPR A;  3C2M A;  1SL2 A;  3HPO A;  4Q8F A;  8ICU A;  5KFP A;  5KT2 A;  5J0O A;  1NK8 A;  3HJ4 A;  2HHX A;  5KFH A;  4GXI A;  4RQ1 A;  2BCQ A;  4EBD A;  1UEU A;  3NGD A;  8ICF A;  2ZH4 A;  4ELV A;  3ZD8 A;  2FLP A;  2W9C B;  3PW0 A;  3PX6 A;  4X0B A;  5BPC A;  4FBU A;  2V4Q A;  2VA3 A;  4DQI A;  4GXJ A;  2AGP A;  2DR9 A;  5KTQ A;  4RQ0 A;  5KFV A;  3RBD A;  4IR1 A;  2H5X A;  1ZQG A;  8ICX A;  3RH6 A;  3EPI A;  2M2V A;  2UVR A;  1NK5 A;  1ZQJ A;  1ZQH A;  3GIK A;  4RPZ A;  1SL1 A;  2ATL A;  4QZA A;  2HHS A;  8ICP A;  3V6K A;  3RJG A;  3H8S A;  5KFK A;  4KLG A;  4LZD A;  5KFN A;  1DK3 A;  4KLU A;  1WOT A;  4ED2 A;  3AUO A;  1NJZ A;  4JK1 A;  4MEX A;  2FMQ A;  4IRC A;  3GV7 B;  3QEB Z;  3TQ1 A;  1K1S A;  4B9S A;  4YFK A;  1RPL A;  4IQW A;  9ICB A;  3MFI A;  3PW4 A;  7ICL A;  2MAX A;  4O3Q A;  4RQ4 A;  4KN7 A;  4M6W B;  3OV7 A;  2DR8 A;  4O3N A;  3BQ2 A;  2ZH9 A;  5IIO A;  1BPZ A;  2HVI A;  4KLE A;  1JXE A;  4JUZ A;  1HUZ A;  1N56 A;  8ICM A;  4MFC A;  4KLL A;  2Y1I A;  3C21 A;  1B22 A;  1TFW A;  1ZQV A;  5J2K A;  4O0I A;  3MGI A;  1ZQI A;  2ZJA A;  1ZQP A;  4FHX A;  1KFD A;  1V4A A;  2W9A A;  2R8G A;  3RJH A;  3JPN A;  4UB3 A;  4ECV A;  5HRD A;  4DFM A;  1MQ3 A;  2ZH1 A;  4QZE A;  3L9D A;  3TFR A;  3Q8Q B;  2FPL A;  2XGP A;  3GIM A;  1BNP A;  5KFD A;  5J2A A;  4KLI A;  8ICK A;  3C1Y A;  4FO6 A;  1V9P A;  2KZZ A;  4DOB A;  2Y1J A;  1ZQF A;  4EEY A;  4WBY A;  9ICR A;  3N97 B;  4KLJ A;  3KHG A;  1R8B A;  3H4D A;  1NJX A;  2AU0 A;  1CEZ A;  3WFS C;  1ZQK A;  4PHE A;  3M8R A;  1DOQ A;  3UQ2 A;  4I27 A;  2DR7 A;  3Q8P B;  2V9W A;  2XCA A;  4UD5 A;  4B9L A;  4ECR A;  3N4M B;  3JPT A;  5KFY A;  5J2J A;  2ZJ5 A;  4RPY A;  5KFB A;  4MF8 A;  3OGU A;  3GIJ A;  4FBT A;  2ID1 A;  4BWJ A;  2PXI A;  5HRF A;  4J9R A;  1YLQ A;  5IIM A;  4IG8 A;  5F9N A;  3ZDA A;  4O3P A;  5DGB A;  3RJK A;  2AGQ A;  2PFN A;  5HR9 A;  3V72 A;  3RB6 A;  2PFO A;  4JV1 A;  3Q8R B;  5HML A;  5EWE A;  4DQQ A;  7ICF A;  5HRI A;  4PHD A;  4UD4 A;  1S77 D;  3QZ8 A;  4RNM A;  1R89 A;  3BJY A;  4F4W A;  1D8L A;  9ICT A;  1DGS A;  4YVZ A;  1S0V A;  2FLN A;  4BWM A;  4GC6 A;  2NRX A;  4DO9 A;  4ECS A;  4DFK A;  1CUK A;  2IA6 A;  4UB2 A;  1S0O A;  4I2E A;  4X5V A;  4F91 B;  1NK4 A;  4AT8 B;  3M9O B;  2ASD A;  3C2L A;  3ZDE A;  4QW8 A;  5J2E A;  4EYI B;  4ECT A;  2M2U A;  4WBZ A;  4I2H A;  1ZQY A;  2BCV A;  4WC4 A;  1COO A;  1TK5 A;  3KHH A;  2ZH6 A;  2AGO A;  4DQS A;  8ICQ A;  8ICA A;  1PX5 A;  2F1J A;  2IHN A;  1JN3 A;  3B0Y A;  1ZQB A;  1KSP A;  7ICT A;  4O3S A;  4C8O A;  1XWL A;  9ICA A;  2FMP A;  5DQG A;  1UA1 A;  4C8L A;  4ED8 A;  5D4B A;  4E7X A;  4YN4 A;  8ICB A;  4DEZ A;  4ED0 A;  5DBA A;  5HNK A;  5BOL A;  2UVW A;  5KG0 A;  4X4Q A;  4M9H A;  4QW9 A;  1XSP A;  1X9S A;  5J0T A;  4M47 A;  2BCS A;  1D9D A;  3JPP A;  1UEV A;  1MIW A;  1IXR A;  2FPK A;  5KG3 A;  4QZ9 A;  4B9N A;  2A1J B;  4UBB A;  1RZT A;  4DQP A;  5HRG A;  1S0M A;  1U9L A;  2M9N A;  5J0U A;  5KT5 A;  1ZQU A;  5KFX A;  2P6U A;  4ED6 A;  4B9V A;  7ICJ A;  2ZHB A;  4BXO B;  5J2G A;  4K4G A;  1QSS A;  2KZ3 A;  2GWS A;  2C2E A;  1Q79 A;  5KT3 A;  4JV2 A;  1NK0 A;  4AT7 B;  4WC5 A;  2ZJ8 A;  3ISB A;  1NKE A;  1TAU A;  1SKW A;  4FHW A;  2KTQ A;  4J9M A;  2DVI A;  3HWT A;  1NKC A;  2ZH8 A;  4RWN A;  2BGW A;  1HUO A;  2WTF A;  1ZQX A;  4I2D A;  4QWA A;  3M8S A;  4O3O A;  4NM1 A;  5D49 A;  1SKS A;  4XQ7 A;  4RQ7 A;  4ECY A;  4X4U A;  1RYS A;  5DEC A;  4RQ5 A;  1TFY A;  1L3U A;  4B9M A;  5KT4 A;  1NJW A;  1TFR A;  2P6R A;  3PMN A;  2C2R A;  2M2W A;  3V7J A;  1TAQ A;  4QWB A;  4QZH A;  5KFO A;  3H7I A;  4KN4 A;  1BPY A;  1KDH A;  4YCX A;  9ICV A;  1T7P A;  2XY6 A;  2P66 A;  3LWL A;  2IHM A;  4UAZ A;  2IMW P;  1H38 A;  3FYH A;  4IQU A;  4MEY A;  3T5J A;  2J6U A;  4KTQ A;  5J0X A;  4KLD A;  4RQ3 A;  2W9C A;  4YQW A;  4YR0 A;  4C8M A;  2BHN A;  4TUR A;  4DL2 A;  5HHI A;  2ALZ A;  4IRD A;  5L1I A;  8ICJ A;  9ICI A;  2PI4 A;  5DG9 A;  3GDX A;  3AQN A;  5CHG A;  3PV8 A;  2BQU A;  5KFU A;  4M9G A;  4WC0 A;  2NRV A;  4KLT A;  1PZN A;  5TZV A;  8ICH A;  5CR0 A;  4G3I A;  2ZUC A;  4M5D A;  3HIY A;  1D9F A;  3PO5 A;  4DSK A;  3NYB A;  3SV3 A;  3TI0 A;  3G6X A;  2BPG A;  4CCH A;  9ICJ A;  3IM1 A;  4UAY A;  8ICC A;  1D8Y A;  3RBE A;  3TAQ A;  3H37 A;  4X4P A;  4TUQ A;  4F92 B;  4MFF A;  5C5J A;  4Q43 A;  9ICO A;  1C7Y A;  3GFK B;  4M6W A;  8ICS A;  4EBC A;  5DKW A;  5F2V O;  4J9S A;  1XSL A;  3KHL A;  4Q44 A;  3MR3 A;  1ZJN A;  5KFL A;  4E8F A;  1ZJM A;  4EP7 A;  4M9L A;  3UQ0 A;  1RXV A;  3C1Z A;  4R65 A;  2ISP A;  4RWO A;  4GXK A;  8ICI A;  4RUC A;  4DFJ A;  1QTM A;  4FHP A;  1KEJ A;  1MIV A;  2ZH2 A;  5DG8 A;  1BVS A;  9ICH A;  4RNO A;  4FS2 A;  2VA8 A;  3UXN A;  4X4O A;  1NO5 A;  2KFZ A;  1S76 D;  3TAP A;  4M04 A;  4WC6 A;  4R8U A;  1KLN A;  4R8U B;  1U4B A;  4DS4 A;  3IHQ B;  5CJ7 A;  4F3O A;  1S97 A;  5HRE A;  3OHA A;  4QZB A;  4WC3 A;  4KIT B;  3OJS A;  4F50 A;  5HP4 A;  3ETL A;  9ICF A;  4YD1 A;  4DSE A;  3K4G A;  4LZG A;  4PGQ A;  1ZQW A;  1S10 A;  4JV0 A;  4TQS A;  2V4R A;  1LV5 A;  3RJE A;  9ICS A;  5CWR A;  5DG7 A;  4WCW A;  4RQ8 A;  1L5U A;  4BGD A;  1WCN A;  3KTQ A;  7ICH A;  2MUT B;  5J2F A;  1EXN A;  4QWD A;  4I2G A;  1RYR A;  3MBY A;  3G6Y A;  3LDA A;  4Q45 A;  2XO7 A;  5BOM A;  3Q8S B;  3PW2 A;  4UB4 A;  2C2D A;  3ZDB A;  1Z00 B;  2HHQ A;  3HJ1 A;  8ICL A;  5KFS A;  4ATB B;  4JWM A;  4R63 A;  5D46 A;  1L3T A;  4NKU A;  8ICT A;  3OUY A;  1TK0 A;  3OUY B;  1T4G A;  5F9L A;  3H3A A;  7ICS A;  4QZC A;  1ZQC A;  4EBJ A;  4LT6 A;  3TAR A;  9ICW A;  4C8K A;  2PI5 A;  1ARO P;  4F5Q A;  4YXM A;  3EPG A;  7ICM A;  4ED7 A;  1UA0 A;  7ICG A;  1SZP A;  4IR9 A;  2ZH5 A;  4YMO A;  3QZ7 A;  1DK2 A;  3AQM A;  2F1H A;  5KT7 A;  5HMM A;  3RRG A;  1JMS A;  4M2Y A;  1X9M A;  3MFH A;  2FPM A;  5KG6 A;  1Z3E B;  3M9N B;  3RAQ A;  4O5C A;  4DSL A;  9ICG A;  5J0R A;  4AT8 A;  2JZB A;  2KZM A;  2JZB B;  4KLS A;  2NRZ A;  3ZDC A;  2HHP A;  1A77 A;  4YD2 A;  3RB0 A;  1ZQT A;  3H8J A;  9ICL A;  2ASL A;  4EZ6 A;  5KFW A;  1JAJ A;  3UXP A;  2ASJ A;  2HHT A;  3PW5 A;  2HHV A;  1KFS A;  8ICO A;  4LVS A;  5DBC A;  1R8A A;  3WFO A;  5KFI A;  3GV8 B;  4Z6F A;  4X0A A;  5J0Y A;  4UB1 A;  4DSI A;  1MQ2 A;  3RTV A;  1MIY A;  3V6J A;  4XQ8 A;  4NLK A;  4AT9 B;  4F8R A;  1QSY A;  4O5K A;  2R8J A;  3GIL A;  4TQR A;  2BR0 A;  1UT8 A;  4B9T A;  5CB1 A;  4UB5 A;  4I2A A;  4F4K A;  4FHV A;  2A1J A;  4TUP A;  4DWI A;  1JQR A;  2J6S A;  2JEF A;  4I29 A;  4I2C A;  1KNY A;  9ICE A;  3NTU A;  4MFA A;  4BXO A;  5EWF A;  1A76 A;  3ISC A;  4F4Z A;  2JEG A;  3RH5 A;  4I2B A;  8ICN A;  2RDI A;  3PVX A;  4AT7 A;  3EW9 A;  4YR3 A;  2RFF A;  3BDP A;  3RB3 A;  1QSL A;  4M9J A;  5IIK A;  3RB4 A;  1NJY A;  1X9W A;  1KTQ A;  2B21 A;  5KG2 A;  3MR2 A;  1MC8 A;  2BQ3 A;  2W9B B;  3WFP A;  5III A;  3RAX A;  1K1Q A;  3PY8 A;  4I28 A;  5J2D A;  1R8C A;  4DL7 A;  9ICX A;  2XC9 A;  1ZQL A;  3MR6 A;  4MF2 A;  2M2T A;  3GQC A;  2R8H A;  4DF4 A;  5KFE A;  3V7L A;  5IIL A;  4KLF A;  1MSW D;  2OWO A;  5HC9 A;  5KFJ A;  5KFZ A;  4EBK A;  1UT5 A;  5J0W A;  3OSN A;  4DFP A;  4R66 A;  3WFQ E;  4DL6 A;  4M9N A;  1RXW A;  4KLH A;  4PPX A;  3E2E A;  4I2I A;  4IQV A;  5HHH A;  2BE3 A;  4DLG A;  5DGA A;  3MR5 A;  2F1I A;  2W9M A;  4QZI A;  1WCL A;  4DSJ A;  3RH4 A;  2AJQ A;  5EOZ A;  1ZQE A;  4QZ8 A;  5KG4 A;  1L3S A;  3PNC A;  3C2K A;  2AQ0 A;  2DFL A;  2UVU A;  4JWN A;  1U48 A;  5KFG A;  2C28 A;  1ZET A;  1QLN A;  3ORY A;  5J2I A;  4XUS A;  1N48 A;  2HHU A;  8ICG A;  1VFG A;  2BQR A;  3K75 D;  9ICM A;  4J9P A;  7ICE A;  7ICU A;  5IIJ A;  4QWC A;  3C18 A;  7ICR A;  1NK9 A;  1ZYQ A;  1F5A A;  1ZQZ A;  3UXO A;  4E0D A;  4K4H A;  4YMN A;  2PBE A;  4E80 A;  3JPO A;  3AU2 A;  4YG2 A;  4RUA A;  4DQR A;  5KFA A;  4RU9 A;  2W8K A;  3V7K A;  4I2F A;  7ICO A;  3TAN A;  4QZF A;  4ZH4 A;  4ECU A;  2HHW A;  1TK8 A;  2PFP A;  5DB9 A;  9ICU A;  4FHY A;  4RWP A;  4EZ9 A;  3JZ0 A;  1X2I A;  3JPS A;  3THV A;  4J9N A;  3Q8L A;  2XGQ A;  3H39 A;  3MGH A;  2ZTC A;  4ECZ A;  4WC1 A;  1ZQD A;  5L1J A;  4DL3 A;  3QE9 Y;  5KFC A;  3GII A;  5DB6 A;  4ED1 A;  2R8K A;  4F4X A;  5KT6 A;  4QWE A;  3V6H A;  2ZTD A;  3LWM A;  1ZQS A;  1OU5 A;  3T5H A;  5KG5 A;  5J0Q A;  4RZR A;  3HX0 A;  4O9M A;  4YMM A;  3AU6 A;  2VA2 A;  2NRK A;  4RQ6 A;  4KLO A;  3LK9 A;  1U47 A;  4NLG A;  4J9L A;  2UVV A;  2KP7 A;  1NOM A;  4S3N A;  3PX4 A;  1S9F A;  4RT3 A;  4RPX A;  3H38 A;  4X4V A;  5DQI A;  5J2C A;  1NKB A;  3HW8 A;  4O3R A;  8ICY A;  8ICZ A;  4X4R A;  4UAW A;  4WC2 A;  3PO4 A;  3EWA A;  4Z6D A;  3ZDD A;  7ICN A;  4F4Y A;  4DLE A;  3SYZ A;  5IIN A;  4ELT A;  4F93 B;  3OJU A;  4J9O A;  4IQT A;  4ECQ A;  5DB7 A;  1NK7 A;  4NKT A;  5DLF A;  3OVB A;  1TVA A;  3GV5 B;  4PGX A;  4Z6C A;  5DDM A;  2I1Q A;  1ZQO A;  5KG7 A;  3C5G A;  4P2H A;  1TKD A;  4Q8E A;  3AQL A;  3FDS A;  3PML A;  4YR2 A;  8ICR A;  4P4M A;  4F5N A;  3T5L A;  1XO1 A;  1HJP A;  2MUT A;  5J29 A;  4QZD A;  2HVH A;  7ICK A;  4F5R A;  3SI8 A;  2DR5 A;  1NK6 A;  8ICE A;  3Q8K A;  4B9U A;  3EZ5 A;  1ZQN A;  4NM2 A;  1Z00 A;  4PGY A;  4X4N A;  4KMU A;  4RQ2 A;  3RRH A;  4QZG A;  4HYK A;  4NY8 A;  4ATB A;  4TUS A;  4WC7 A;  1BNO A;  4RNN A;  3UPQ A;  2I9G A;  3KHR A;  1S0N A;  2ZTE A;  7ICQ A;  1SKR A;  4PH5 A;  3JYY A;  1IM4 A;  4F5O A;  5DB8 A;  1T3N A;  3TFS A;  4FH5 A;  3RJF A;  3JPQ A;  2FLL A;  2NRT A;  3MDC A;  3H4B A;  4O5E A;  4DF8 A;  4GLX A;  3OSP A;  1TV9 A;  4IRK A;  3LQC B;  1XU4 A;  3RJI A;  3OVS A;  4BDP A;  4KLM A;  5DDY A;  3SZ2 A;  5KFF A;  4YP3 A;  3SV4 A;  3BQ0 A;  3MDA A;  1KFT A;  4PHP A;  4FS1 A;  1JIH A;  2XY7 A;  4P4P A;  2Q0Z X;  4NLZ A;  7ICI A;  1XC9 A;  9ICQ A;  2FMS A;  5J2B A;  4GC7 A;  3RR7 A;  3C23 A;  4UBC A;  1XSN A;  9ICC A;  5L1L A;  5DED A;  4F5P A;  1U49 A;  1UET A;  1B43 A;  5DQH A;  4I2J A;  1T8E A;  2KFN A;  1KRP A;  3G6V A;  2ISO A;  2BPF A;  2J6T A;  3PR4 A;  1BPD A;  1JX4 A;  3ISD A;  2JEJ A;  4AT9 A;  3H8W A;  2PFQ A;  8ICV A;  7ICP A;  4UQG A;  4PHA A;  5J0S A;  4Z6E A;  2BCU A;  1BPE A;  3OVA A;  3BQ1 A;  4ED3 A;  3HT3 A;  3BQT A;  4ECX A;  7ICV A;  4EBE A;  4EYH B;  3RJJ A;  5DBB A;  3Q8M A;  9ICK A;  4RWQ A;  2ZH7 A;  3MAB A;  4P4O A;  5KFM A;  8ICW A;  3PR5 B;  2R8I A;  2XY5 A;  3AQK A;  4NLN A;  5L1K A;  1ZQR A;  1LB2 B;  4F2R A;  1NZP A;  3T3F A;  2LYH A;  5KFR A;  3B0X A;  5CP2 A;  2ZH3 A;  4M0A A;  1L3V A;  2ZHA A;  4FH3 A;  4C8N A;  3C5F A;  5CA7 A;  3PW7 A;  2W9B A;  2XCP A;  1Y88 A;  4J9Q A;  4DSF A;  4DL5 A;  2NRW A;  2O5A A;  3HP6 A;  3T5K A;  1ZQA A;  1FA0 A;  2KN7 A;  3EYZ A;  1SL0 A;  5J2H A;  4RT2 A;  2AQ4 A;  2BKE A;  5KFT A;  4YXJ A;  5JUM A;  5HRB A;  5HRH A;  3UPS A;  2C22 A;  4XRH A;  4DS5 A;  4ELU A;  2W8L A;  2IBK A;  3C66 A;  1ZQQ A;  4DL4 A;  2RDJ A;  3PX0 A;  2DPI A;  5DLG A;  1U45 A;  3RR8 A;  3M9M B;  4R64 A;  5HRK A;  2DRA A;  2Q66 A;  9ICN A;  3OHB A;  4NXZ A;  1BPX A;  5KFQ A;  4X4T A;  2ZUD A;  2O1P A;  5EWG A;  4DOA A;  1JXL A;  9ICP A;  2HW3 A;  1VJ7 A;  3WFR E;  4X4S A;  2ZUB A;  4F2S A;  3H40 A;  2BPC A;  4J9K A;  5L9X A;  2VAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...