4KLUA

Dna polymerase beta mismatched product complex with mn2+, 15 h
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
325
structure length
322
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Observing a DNA polymerase choose right from wrong.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 106
structure length 322
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4kluA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4kluA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4kluA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4kluA03
4RQ6A 3HWTA 4FO6A 1S9FA 1ZQOA 3UXNA 2JEGA 9ICIA 5BPCA 5HRHA 3N97B 5TZVA 3BQ1A 3LDAA 3RBDA 4DSLA 3BQ2A 2HHUA 4WC1A 3V6JA 3PNCA 2KTQA 1MIVA 3OVBA 8ICSA 1R8AA 9ICFA 4TURA 2HVIA 4FH5A 1S0OA 4RZRA 2LYHA 5KT7A 4ED2A 2ZH2A 4ELTA 5J0RA 5CB1A 3V72A 3SV4A 3UQ0A 2KZMA 1ZQSA 1NJWA 4TUSA 4FBTA 4QWBA 9ICNA 2ZHAA 1ZQDA 1F5AA 4M9HA 4RWNA 3RB3A 3V6HA 3HPOA 4IQTA 4KLQA 1B43A 1S76D 4ATBB 3C21A 9ICBA 3MR6A 1ZQVA 3RR7A 2WTFA 3TANA 1V9PA 1XC9A 2I9GA 5J29A 7ICMA 4TQSA 4GC7A 4J9KA 2FMPA 4PGXA 8ICRA 7ICTA 9ICUA 4X4QA 3TFSA 4J9PA 2BHNA 5KFDA 3UPQA 4QZ8A 4F92B 5J2KA 2MUTB 3AQNA 4DEZA 3RTVA 4DLEA 4P4PA 3V7KA 2NRXA 1Z3EB 5KFPA 1NKCA 5DLGA 7ICIA 4YMNA 9ICCA 8ICJA 3PMNA 3EWAA 5DBAA 5J2JA 5F9NA 4R8UB 3LWMA 1U47A 1KRPA 1AROP 5KFAA 3RH4A 4K4HA 5CP2A 3GDXA 5KFBA 4FS1A 1L3VA 3OV7A 4RPZA 2C2EA 3H40A 1UETA 3ZDEA 3NGDA 1T3NA 1DOQA 2JEIA 4FBUA 1SL2A 1SKSA 3OUYA 4RWOA 3RJEA 4DS5A 4F4XA 2UVVA 1NK7A 4MF8A 5IIKA 2XO7A 3MBYA 2JEJA 2AGOA 2BR0A 5KFJA 4QWAA 4RPYA 4ED3A 1TFYA 3V6KA 4X4RA 3RH6A 4DQIA 5DG7A 3MABA 5KFRA 1ZQJA 3N4MB 8ICVA 2DR5A 2F1HA 1NK5A 4KITB 1Q78A 5DGAA 1QSYA 4ATBA 5KT5A 3GILA 5J2EA 3OJSA 3THVA 2IHMA 4DQPA 3GV8B 4O9MA 2J6UA 9ICAA 3EW9A 7ICPA 3RJIA 4X4OA 3AU6A 4TQRA 2HHXA 3C66A 4JUZA 1ZQEA 2MUTA 4BXOB 4RUAA 8ICLA 4AT9B 1BPEA 3JZ0A 8ICXA 4KLMA 3RB0A 2R8JA 1FA0A 5KFSA 4UB5A 1X9SA 2UVUA 4Q45A 1ZQGA 4S3NA 1T7PA 4YXMA 4F4ZA 1L3SA 2XC9A 3BQTA 4YXJA 3UXPA 4UBCA 4KLTA 4M9GA 3OHAA 1VJ7A 3MDCA 1ZJMA 4BWMA 4R65A 2IHNA 1K1SA 9ICVA 5HC9A 3TQ1A 4YG2A 4Z6FA 3Q8QB 4ECTA 2JZBB 5KFLA 1JXEA 4CCHA 5KFNA 5DG8A 4M9JA 1ZQLA 1JMSA 2ZUBA 3UXOA 1SL1A 2BCUA 2Q0ZX 4QZEA 4B9SA 9ICEA 5EWEA 4LT6A 3AQKA 1BVSA 4QZ9A 3RJHA 1BPXA 1KFTA 1BNPA 4RWPA 2OWOA 3PO5A 5DDYA 1K1QA 3E2EA 1Y88A 1BPYA 2DR7A 5CWRA 4YQWA 4EP7A 4JK1A 2H5XA 2ZUCA 2ZH4A 2M2VA 3UQ2A 4YD1A 4KLOA 3QE9Y 3RBEA 1UA1A 4RQ5A 2FLPA 4RPXA 4EZ9A 2M2TA 4AT7A 4NKUA 4XQ7A 4WCWA 5KT4A 3PR5B 3QEBZ 1JN3A 2V9WA 4JV2A 9ICLA 5HRBA 1IXRA 3JPQA 2W9BB 3ZDDA 3WFOA 4IQVA 5KFOA 5KFEA 1NOMA 4DS4A 3Q8PB 3OHBA 3PW0A 1TK0A 4P4OA 2KZ3A 1ZQWA 2W8KA 7ICEA 4I2EA 4IG8A 4EZ6A 2ZH6A 5L1LA 1XO1A 1CUKA 3HX0A 2XGQA 3RJKA 2M2UA 4YMOA 2FMSA 3C5FA 2V4RA 7ICKA 2ZH3A 1BPZA 2XY7A 3LWLA 5J0UA 4DL3A 5DB8A 4QZCA 2W9CA 4DQQA 2W9AA 4JWMA 3JYYA 8ICUA 2UVRA 1TVAA 4PHDA 2A1JA 2AGPA 1UT8A 4DSFA 1SKWA 5J0YA 4MEXA 3TARA 4EBJA 2NRKA 4F3OA 4X0AA 4DF8A 8ICCA 3WFQE 7ICUA 1D9DA 1T8EA 1PX5A 3RAQA 5EWGA 3MGIA 1ZQMA 1ZYQA 8ICEA 3EYZA 3OVSA 3Q8LA 1KFSA 3PVXA 2R8HA 4YR0A 4F5RA 4EBKA 4E7XA 2BPGA 2DRAA 2ZH7A 4XA5A 2F1JA 9ICRA 5DGBA 4UAYA 1JIHA 3H8JA 1NJYA 2VA2A 4F5PA 4Z6CA 4RQ3A 4MFCA 3H39A 7ICQA 4DFJA 4M2YA 4YD2A 4KLUA 1Z00B 5L1JA 2W9BA 3GIKA 8ICFA 4F5NA 5KFIA 5KG2A 4E0DA 5DB6A 3ETLA 3PMLA 4J9OA 4DL5A 3RJJA 3MGHA 3M9OB 2DPIA 7ICFA 4GXIA 2PI5A 5D4BA 4I29A 3JPRA 4O3RA 3NTUA 2C2RA 3RRHA 1NK9A 3OSPA 2BDPA 4RUCA 5HRLA 4F5QA 5DKWA 2PFOA 4UD4A 4O3PA 8ICOA 4QZFA 5CR0A 4DFMA 4F8RA 2DR8A 3PW2A 4X5VA 4J9NA 1NK0A 4M9LA 4DL4A 5DQGA 4WC5A 1L5UA 5CJ7A 2B21A 4J9MA 4UB4A 1X9MA 3C1YA 1DK2A 5KFYA 4NLKA 1KTQA 2R8IA 4EBEA 4I2BA 1JQRA 2P66A 3ZD8A 3T3FA 1NKEA 4WC7A 1ZQHA 3PW4A 4WC2A 3RJFA 8ICKA 3C23A 4O5KA 3AU2A 5KFVA 3Q8KA 1BNOA 2BQ3A 1DK3A 2ZH1A 4B9UA 1A76A 4QWCA 4C8KA 4IRKA 3LK9A 3M9MB 3HW8A 1CEZA 3Q8RB 9ICJA 2FPLA 5KFXA 4UAZA 4WC0A 4ZH4A 1ZQNA 2MAXA 4WBZA 7ICLA 3RB6A 8ICTA 5HRGA 1T4GA 1U49A 3ZDBA 4ECYA 4WC6A 3GFKB 4F4KA 5L9XA 4KTQA 3HJ1A 3PW5A 5J2DA 3TFRA 5KFTA 1ZQFA 4NY8A 2BKEA 1S10A 5J0PA 4ECQA 2IA6A 4J9QA 4DO9A 1ZJNA 1NJZA 1N48A 3V7LA 9ICHA 3JPOA 1U9LA 4NM1A 2HHVA 9ICWA 5DECA 2NRWA 4IQWA 3TAQA 5JUMA 2ZTDA 4RQ0A 2XGPA 1TK5A 3FYHA 1S0NA 3GIMA 1QSSA 2GWSA 1R8CA 1R8BA 5EOZA 4KLGA 8ICZA 2HHTA 7ICVA 3ZD9A 3G6YA 4X4VA 1COOA 2AU0A 9ICQA 3WFRE 3H8SA 1JXLA 4X4TA 1S77D 4RQ8A 2AGQA 3OGUA 2AQ0A 1L3TA 1ZQKA 3BDPA 8ICWA 9ICOA 4DF4A 2IBKA 1SKRA 4R8UA 4DSEA 4DL7A 1UEUA 2ZJ5A 3Q8MA 7ICSA 3QEAZ 2BGWA 4I2CA 1X2IA 4O3QA 3C18A 4E80A 5KTQA 4RU9A 2HVHA 3K4GA 5IILA 5IIIA 3PV8A 1L3UA 4B9LA 2VANA 4Z6DA 2PI4A 2HHQA 5DQHA 4B9MA 4I28A 4QZDA 5L1IA 2ISPA 4IRCA 4QZHA 8ICYA 5DBBA 4QW9A 4UB3A 5KG4A 5J2AA 5J2CA 1KFDA 2C22A 3SYZA 1U48A 4RT3A 1ZQIA 8ICQA 2ZH5A 2BPFA 4DL2A 2NRZA 4BWJA 2O5AA 1D8YA 5J0WA 5F9LA 5DQIA 4I2GA 5KFCA 5DDMA 4QZBA 4FHWA 4XUSA 3BJYA 4DSIA 1TK8A 4DSKA 4F2RA 2W9MA 2KP7A 4NLGA 4X4UA 3H8WA 1A77A 5J0XA 3T5JA 4NLNA 1TAUA 1KSPA 1MIYA 5D49A 3ISDA 4WC3A 1XSPA 3MR2A 5HRDA 4M6WB 5KFQA 4ECZA 5HMLA 5BOLA 3PO4A 4BXOA 3RR8A 4AT9A 5KFUA 3GIJA 1D9FA 3G6VA 5IIOA 4ELUA 1MC8A 1QLNA 3HJ4A 2I1QA 4Q8EA 3T5LA 5HR9A 2M9NA 1XWLA 3ORYA 3BQ0A 2ID1A 4ED6A 3RJGA 5DBCA 2KFZA 3H7IA 4EYHB 1OU5A 4YR2A 5HHHA 3AQMA 4PH5A 3PY8A 1D8LA 4QZIA 4DOAA 3MFIA 4X4SA 2PBEA 4NXZA 1KLNA 2DR9A 4UD5A 2NRVA 4GC6A 2XY6A 2ASLA 5D46A 2JZBA 4FS2A 1NK4A 3C2KA 1NO5A 5F2VO 4Q43A 3JPSA 4KLHA 4DSJA 3MR3A 4MFAA 2DVIA 3JPPA 3KTQA 1ZQZA 4YR3A 4R63A 2HHWA 4BGDA 1MIWA 4JWNA 5KG6A 5KG3A 3WFSC 4X0BA 1KEJA 2BE3A 9ICMA 2VA8A 5KT3A 5BOMA 2ATLA 4E8FA 5J0QA 1ZQAA 5C5JA 4KLJA 2RDIA 4NKTA 5KFMA 4RNOA 1JX4A 4RT2A 1TKDA 5KFHA 4FHVA 3IHQB 1XSNA 1RYSA 2PFQA 2R8KA 4MFFA 2KZZA 4LVSA 1MSWD 4MEYA 2FPKA 4PHAA 2BCQA 4EEYA 2VA3A 4RNNA 3ZDAA 4QW8A 4I2HA 5CHGA 5KT6A 4UQGA 2ZUDA 4R64A 4C8LA 4NLZA 4XRHA 2BCSA 1HUZA 4X4NA 4EBDA 4TUQA 4DFKA 4DL6A 5KFWA 4J9SA 3HP6A 4UBBA 1QTMA 1JAJA 3GIIA 2ISOA 4FHPA 5HMMA 2M2WA 3TI0A 2BCVA 4P4MA 4ED0A 4KN4A 2W8LA 1RPLA 7ICNA 2FMQA 1H38A 7ICRA 4GXKA 5EWFA 3HT3A 1S97A 3M8SA 3ISCA 3B0XA 1ZQCA 2JEFA 3QZ8A 3OUYB 1VFGA 4F4YA 4PPXA 3K75D 5CA7A 1S0MA 4ELVA 2HHPA 5IIMA 4DFPA 4IR1A 3C2LA 3TAPA 1BGXT 4YVZA 3ISBA 3V7JA 2ALZA 4B9VA 1TFWA 2Q66A 4X4PA 4YCXA 1SL0A 5J0SA 5J2HA 1V4AA 4M5DA 3OVAA 4JV0A 4RNMA 3KHHA 4K4IA 7ICOA 1RXWA 4IQUA 5HHIA 1BPBA 4PGQA 1ZQRA 4ED7A 4B9NA 1ZETA 4GXJA 8ICIA 4DOBA 1ZQXA 2FPMA 3IM1A 4C8NA 7ICJA 4J9LA 1ZQYA 5J2GA 3SI8A 5HNKA 2J6SA 1Q79A 4O3OA 4DLGA 4M04A 5HRKA 2ZJ8A 5KFKA 1Z00A 1R89A 4I2AA 2O1PA 4UB1A 1C7YA 1XS9D 3T5HA 3T5KA 5HRFA 5IINA 4LZDA 3KHRA 3PX4A 9ICKA 1S0VA 2XCPA 3OSNA 4GLXA 4YFKA 5DEDA 8ICHA 3M9NB 2AQ4A 5DB9A 4RQ1A 3H3AA 4DQRA 4Z6EA 2ZH8A 4ECVA 2P6RA 1IM4A 3M8RA 1U4BA 3KHLA 5J0OA 3ZDCA 3QZ7A 4O5EA 4RQ4A 2KFNA 3HIYA 5KFZA 4DOCA 4I2DA 4F4WA 3AUOA 3FDSA 3RAXA 4RQ2A 1PZNA 1TAQA 1EXNA 4PHEA 3MR5A 3GV5B 1XSLA 4UAWA 1LV5A 4ECXA 2ZJAA 5KG0A 4KLLA 4G3IA 3GV7B 9ICPA 5KG5A 2ZHBA 4ECRA 2XY5A 1N56A 5J2IA 4FH3A 9ICSA 2F1IA 2R8GA 4C8MA 3SV3A 4UB2A 5J2BA 4ECSA 2C28A 4KLDA 2PFPA 2P6UA 3PX0A 4KLFA 1HJPA 8ICPA 4AT8B 3LQCB 3KHGA 3H38A 2ZTCA 8ICNA 5DG9A 4Q8FA 4QWEA 2BQRA 5HRIA 1UT5A 1X9WA 4AT7B 1UEVA 2DRBA 2RDJA 3H4DA 4M9NA 1MQ3A 4MF2A 4DWIA 4QWDA 3PR4A 2DPJA 1KNYA 4P2HA 4F93B 2KN7A 3UPSA 4R66A 5HP4A 1NK8A 1ZQPA 1YLQA 1HUOA 2HW3A 2J6TA 5J2FA 1NK6A 2C2DA 1BPDA 3OJUA 4EBCA 4KLSA 8ICAA 5L1KA 4M0AA 3PW7A 3EPGA 1TV9A 1QSLA 4RQ7A 3WFPA 3AQLA 4F2SA 5DB7A 4IR9A 1SZPA 4KLEA 1WCLA 4ECWA 3C5GA 2ZTEA 4KN7A 2FLNA 1WOTA 3JPTA 9ICGA 4NM2A 4YMMA 5KT2A 4YP3A 1NKBA 5KG1A 2W9CB 1RYRA 1ZQBA 4J9RA 4XQ8A 3H4BA 3RRGA 2DFLA 9ICXA 2A1JB 4PHPA 4ED1A 4DQSA 4O5CA 4O3SA 4TUPA 2ASDA 4YN4A 5KFFA 8ICBA 3Q8SB 1NZPA 1ZQQA 4RWQA 4FHYA 1U45A 3JPNA 3MFHA 4LZGA 3L9DA 4F91B 7ICGA 8ICGA 1RXVA 4HYKA 1KDHA 4KMUA 1DGSA 4ECUA 4WC4A 4AT8A 8ICMA 4QZGA 4C8OA 2XCAA 4I2IA 2PXIA 4F5OA 4K4GA 4I27A 4M47A 1B22A 3PX6A 3G6XA 4F50A 4PGYA 3EZ5A 2Y1IA 4QZAA 1XU4A 4WBYA 2ZH9A 5J0TA 2BCRA 4O3NA 4JV1A 1MQ2A 1ZQUA 3C2MA 3GQCA 1NJXA 4B9TA 4KLIA 2Y1JA 7ICHA 2RFFA 2HHSA 5KFGA 5IIJA 3NYBA 2NRTA 3MDAA 3B0YA 3C1ZA 4IRDA 3EPIA 4M6WA 2IMWP 2AJQA 2ASJA 3SZ2A 2PFNA 4FHXA 4EYIB 4I2FA 3RH5A 5HREA 1ZQTA 2FLLA 1LB2B 2BQUA 2UVWA 4BDPA 9ICTA 4ED8A 1RZTA 1WCNA 3RB4A 4I2JA 1TFRA 5KG7A 4O0IA 4Q44A 5DLFA 2V4QA 1UA0A 3H37A 2BPCA
chains in the Genus database with same CATH superfamily
1ZQOA 4NJ8A 3UXNA 3N97B 3LDAA 3BQ2A 1LKYA 3PNCA 2KTQA 1MIVA 8ICSA 9ICFA 4TURA 3WK6A 4ED2A 2EH9A 5J0RA 2KZMA 1ZQSA 2ZHAA 1ZQDA 3HPOA 3ED5A 3NUQA 2G5HB 2QLTA 2HOQA 2K4PA 4J9PA 5KFDA 4QZ8A 5ALIA 1J97A 1Z3EB 9ICCA 4FZLA 5J2JA 3K1RB 4LEYA 2C2EA 3H40A 1T3NA 1DOQA 2JEIA 1SKSA 3OUYA 2JR5A 2UVVA 3MBYA 1TFYA 2ZIVA 3V6KA 4X4RA 3MABA 4MHVA 5KFRA 3M7DA 2F1HA 2D3DA 1Q78A 5JRTA 3LYSA 5J2EA 4DQPA 1Z1BA 3RJIA 3AU6A 3C66A 3BS5B 5AKIA 4BXOB 8ICLA 2HN1A 2R8JA 4UB5A 1ZQGA 2JHDA 3I28A 4G9BA 3UXPA 4KLTA 5ALXA 5ALZA 3F53A 2I6XA 9ICVA 2Y0SF 4YG2A 4Z6FA 1ZRNA 2JZBB 3E58A 1JXEA 4CCHA 1K5OA 2OCEA 1SL1A 2Q0ZX 5EWEA 2IUBA 1Y88A 1BPYA 1SGGA 4YQWA 4LEVA 2M2VA 4I0UA 4RQ5A 5HR7A 3AMZA 1JUDA 4OJOA 3PR5B 2ZIWA 3QEBZ 4JV2A 5ALQA 3ZDDA 5KFEA 3OHBA 5KL1B 2KZ3A 1ZQWA 4I2EA 2NO5A 5L1LA 1IIPA 2XGQA 4YMOA 2FMSA 7ICKA 2DWQA 2ZH3A 1WWUA 4K97A 3LWLA 5J0UA 4DL3A 5DB8A 2W9CA 3ZI4A 3BS7A 2UVRA 1TVAA 3TARA 1SV0A 2YQEA 8ICCA 1OW5A 4NL9C 1D9DA 3RAQA 1ZQMA 2GOLA 2R8HA 4F5RA 5AM1A 4UAYA 4F5PA 4RQ3A 3KFUF 7ICQA 4DFJA 4M2YA 4YD2A 4KLUA 1MN8A 3QXGA 5L1JA 3GIKA 5KFIA 4E0DA 5DB6A 3ETLA 2DPIA 1N5WA 5ALYA 2E5SA 5D4BA 4I29A 4O3RA 5DKWA 2PFOA 4P0PB 3PW2A 4USAA 4J9MA 1KTQA 2AHOB 1SXDA 2R8IA 5CRXA 4I2BA 3ZD8A 3T3FA 5L1MA 4WC7A 4WC2A 3RJFA 3C23A 1ZXIA 4O5KA 3IP4B 5AK5A 2BQ3A 1A76A 4O3MA 4K8VA 3HW8A 4PZOA 4WC0A 4ZH4A 1ZQNA 5ALJA 1AQ6A 8ICTA 5HRGA 3QNMA 1U49A 3JCFA 4ECYA 3MCRA 5L9XA 2O6KA 1S10A 1QQ5A 9ICWA 9ICHA 3JPOA 2HHVA 4IQWA 5JUMA 2ZTDA 1R8CA 5G5HA 1COOA 9ICQA 1JXLA 4X4TA 1PUZA 4RQ8A 3PZPA 4O67A 2AQ0A 5ALHA 2IBKA 4DSEA 4O69A 2KICA 2BGWA 3C18A 3K4GA 2VJ4A 4Y2PA 5IILA 3PV8A 2VANA 4Z6DA 2DF4B 2RQ5A 3NASA 5L1IA 4I28A 8ICYA 4CGZA 2C22A 1KFDA 1U48A 4Y2VA 8ICQA 1JI7A 2Z7JA 2EWRA 2NRZA 2CPRA 1D8YA 1GPJA 2HN2A 4XUSA 1WYGA 4DSIA 4DSKA 2W9MA 5CFTA 3HKZC 2Q4TA 4UARA 4X4UA 2LM1A 1RQNA 1KSPA 3ISDA 2P35A 2HBLA 3HJ4A 1SB3C 3WK8A 4Q8EA 2M9NA 1XWLA 3BQ0A 3AQMA 1KLNA 2DR9A 3KKAA 3E0FA 4MFAA 3JPPA 4YR3A 4R63A 4BGDA 4GFJA 3K1ZA 5KT3A 1GO3F 3C28A 4E8FA 2F77X 1NNLA 4KLJA 1JX4A 4RT2A 1XSNA 3IRUA 3QX7A 4FE3A 2HBKA 5CHGA 4KMOB 4OJLA 4R64A 1JALA 1HUZA 3NVYA 1QQ6A 3HP6A 3GIIA 4IS7A 4HX0A 7ICRA 1H38A 3HT3A 1S97A 3ISCA 1B4FA 5HR6A 4F4YA 2NO4A 3IDWA 5AK4A 1SL0A 4X4PA 2OHFA 5J2HA 2ODGA 4RNMA 4K4IA 2QB1A 4PGQA 3GZFA 1ZQRA 1KKXA 1ZQXA 2WF7A 5HNKA 5HRKA 4M04A 2HBJA 1Z00A 2D8CA 1XS9D 3T5KA 3PX4A 1S0VA 2XCPA 2WAQF 2NV3A 4YFKA 3M9NB 5DB9A 4RQ1A 2ZH8A 1T94A 3M8RA 5J0OA 4C7YA 3H0RB 4F4WA 3RAXA 4RQ2A 1PZNA 1BPZA 2ZH1A 4G3IA 3GV7B 2KJ8A 1WG8A 2OEHA 9ICSA 2ZIXA 4UB2A 4AT8B 2K4HA 3PX0A 8ICPA 1HJPA 3BZKA 3LQCB 3KHGA 8ICNA 4Q8FA 4QWEA 1X9WA 1UEVA 3IN5A 2DPJA 3DV9A 4R66A 3WKBA 2RLTA 8ICAA 1NK6A 1BPDA 3WU2U 2MSNA 4M0AA 5DB7A 4IR9A 1SZPA 3C5GA 2ZTEA 3JPTA 4C80A 4NM2A 1NKBA 2GAFD 4J9RA 9ICXA 4PHPA 4O5CA 4TUPA 5KFFA 3KD3A 5AKXA 1U45A 4WQLA 3SAFA 2F3NA 4AT8A 4QZGA 4C8OA 2D6FC 2B6GA 3U26A 2PXIA 4I27A 1Z19A 2Y1IA 3I76A 4WBYA 5J0TA 4O3NA 1QCKA 5AKGA 1ZQUA 3N7PD 5KFGA 2LPEA 5B3QA 1Q3UA 3FC4A 3C1ZA 4C4TA 2YB1A 4FFDA 5A0LA 2AJQA 3RH5A 5HREA 4KM5A 1ZQTA 2KG5A 3H8MA 9ICTA 4ED8A 2ZG6A 4XJEA 2F8KA 3NRZA 3H37A 3HWTA 4FO6A 4P0QA 9ICIA 5ALVA 3SQIA 5D63A 5TZVA 3BQ1A 3RBDA 2MRLA 2HHUA 3OVBA 2HVIA 4FH5A 5KT7A 5AI9A 2H3IA 4ELTA 1FFVA 4QIWF 3V72A 4TUSA 4QWBA 1TAMA 9ICNA 1F5AA 4IQTA 3KBBA 2AH5A 9ICBA 2QB0B 5AK6A 3HRDD 3TANA 3R9KA 1IV8A 2I9GA 3PHZA 7ICMA 4GC7A 2FMPA 7ICTA 3PSPA 3UPQA 1C20A 3RTVA 1NKCA 4DLEA 5KFPA 5DLGA 4B6JA 4YMNA 3PMNA 4M9NA 4K4HA 1AROP 3GDXA 4RPZA 4MKPA 5ALNA 1FIQA 2LM4A 3WKEA 3RJEA 4F4XA 5KNIA 2AGOA 5ALRA 2BR0A 2Y9UA 1SV4A 5ALGA 1NK5A 2LYBA 3NS1A 1VLBA 1NI3A 3GV8B 3EW9A 7ICPA 1QQ7A 2JGAA 5KAIU 2HHXA 2I5HA 1ZQEA 4LEWA 4RUAA 5CFUA 2KHVA 1FA0A 5AICA 3IG8A 2UVUA 2OH2A 2HI0A 1K1SA 5ALEA 2XICA 4OAIZ 5DG8A 4Y2SA 4QZEA 2B51A 3AQKA 3RJHA 4N7RA 2OWOA 3PO5A 5DDYA 1UQVA 3UQ2A 2E1FA 5B66U 1UA1A 4EZ9A 2FLPA 2W55A 3M1YA 4RPXA 4NKUA 1TE2A 4XQ7A 2E1EA 1JN3A 2ESEA 5HRBA 1IXRA 5ALLA 3JPQA 3WFOA 5KFOA 2W8KA 4IG8A 2LBOA 1CUKA 3RJKA 2M2UA 2F8LA 2HOFA 4JWMA 8ICUA 2BBJA 5J8YC 1UHUA 1UT8A 4EBJA 5J0YA 2NRKA 4F3OA 4DF8A 7ICUA 1T8EA 1ZYQA 3EYZA 3OVSA 3QYPA 2BDUA 4EEKA 2WF6A 3PVXA 4EBKA 2R18A 2ZH7A 1HIWA 2F1JA 9ICRA 2W04A 5DGBA 1NJYA 4MFCA 1A6SA 1OUQA 3MGHA 2EAPA 4Y2TA 3AL0B 3NTUA 2BDPA 4LJXA 5HRLA 4F5QA 1FFUA 2F44A 2FDRA 2IOFK 4X5VA 5DQGA 2B21A 4NLKA 2K8CB 1NKEA 2VKQA 5JU5A 3AM9A 3Q8KA 5AKYA 1RYUA 1Q3VA 2DKXA 1Z4NA 1CEZA 9ICJA 5KFXA 4WBZA 2B4VA 3RB6A 1T4GA 4UB6U 4F4KA 2IOHA 4KTQA 3HJ1A 2WB1F 4HAIA 5J2DA 2G09A 1ZQFA 4NY8A 5J0PA 4ECQA 2IA6A 4J9QA 1ZJNA 5DECA 4RQ0A 4X4VA 4KLGA 2HHTA 3G6YA 2FI1A 2H3VA 1S77D 2OYYA 2AGQA 9ICOA 8ICWA 4DF4A 2ZIUB 4DL7A 4C7ZA 3Q8MA 4PL2A 3RF9A 3QEAZ 4I2CA 5KTQA 2HVHA 2YB4A 2DBYA 3RFAA 5IIIA 1L3UA 4X0BA 2PI4A 5DQHA 4PZNA 4IRCA 2FE9A 4QZHA 4QW9A 1N61A 4UAVA 5DBBA 4UB3A 1ZQIA 3PSIA 4QNLA 2O5AA 5D61A 4I2GA 1TK8A 2EZXA 3OWGA 1ZD4A 4NLGA 5J0XA 1MIYA 2ZXHA 3BS5A 4M6WB 2DGZA 4BXOA 3GU3A 3ER8C 3GIJA 2QKQA 3G6VA 5IIOA 2ZIUA 3T5LA 4FZNA 4IC9A 2DQNB 4ED6A 1OU5A 5HHHA 2XI9A 3OPXA 2PBEA 2XY6A 2JZBA 4FS2A 4LEZA 3C2KA 1PVQA 4Q43A 3JPSA 2DVIA 2CN1A 2GO7A 1MIWA 1JRPA 2HHWA 2W43A 2BE3A 5KAFU 2ATLA 5J0QA 1ZQAA 3QU5A 2QARB 3F2BA 3CK6A 3IHQB 2R8KA 2FPKA 2F76X 4EEYA 1RM6C 1HEKA 4UQGA 1SV0C 4X4NA 4EBDA 4TUQA 4WOYA 5KFWA 4J9SA 4UBBA 2ISOA 4FHPA 3TI0A 2DKZA 2BCVA 4KN4A 2W8LA 5ALKA 5EWFA 3L5KA 1ZQCA 3B0XA 4PPXA 4CE6A 1RDFA 1S0MA 2BZFA 4DFPA 4IR1A 4EX6A 4OAGA 3ISBA 1TFWA 4B9VA 3NVOA 5AKJA 1V4AA 3OVAA 1L7NA 1RXWA 4IQUA 2QARA 3SMVA 1X6IA 1Q8KA 2ES6A 4UW9A 4DOBA 1MA7A 3SENA 7ICJA 4J9LA 3SD7A 2J6SA 2ZJ8A 5KFKA 3N7SC 4I2AA 2O1PA 4BJQA 1C7YA 3T5HA 5IINA 9ICKA 5EE0A 4NWIA 3OSNA 2AQ4A 2JV3A 3CW2C 4DQRA 2P6RA 3PSFA 1IM4A 3KHLA 3D2NA 1XNSA 4P0PA 4RQ4A 2KFNA 2PMZC 4DOCA 4I2DA 1SZHA 4PHEA 3T79A 3GV5B 1LV5A 5KG0A 2JMGA 4KLLA 5KG5A 2ZHBA 5J2IA 4FH3A 2C28A 3SV3A 2PFPA 2P6UA 4US8A 5DG9A 2BQRA 5AKEA 4AT7B 1DGJA 4QJFB 2RDJA 3H4DA 2IOFA 4F93B 1M6YA 3F5EA 5HP4A 1NK8A 1ZQPA 1YLQA 2HW3A 3WK4A 4EBCA 3PW7A 3EPGA 3HKZF 3AQLA 3H0MB 4KLEA 1WCLA 2FLNA 5AIAA 5KG1A 4JLXA 4EV6A 3RRGA 2DFLA 2A1JB 4ED1A 1N63A 2ASDA 8ICBA 5ALWA 4LZGA 3MFHA 7ICGA 1PK1B 1RXVA 1KDHA 4EX7A 3NRWA 1FEZA 1VDVA 4WQKA 1X66A 4F5OA 4K4GA 4M47A 3TACB 4BUGA 1B22A 3C29A 1SXEA 1L7OA 1XU4A 5AI4A 4C4RA 4B9TA 4KLIA 7ICHA 3UMBA 3NYBA 2KKVA 3KKAC 3B0YA 3TADA 3EPIA 3WFPA 2ASJA 2PFNA 4EYIB 4I2FA 1LB2B 2UVWA 4BDPA 5ALOA 1RZTA 2WF9A 3OTQA 1PK3A 3RB4A 1LVHA 5KG7A 4O0IA 1UA0A 4EENA 4C0ZA 4RQ6A 2JEGA 2YMQA 1PK1A 5BPCA 5HRHA 1KL9A 3V6JA 1URJA 1S0OA 1SIJA 4RZRA 2ZH2A 5CB1A 1KW4A 2KSOB 3UQ0A 1NJWA 3RB3A 1PVPA 4KLQA 1B43A 4ATBB 3MR6A 1ZQVA 2Y9TA 2WTFA 1V9PA 1XC9A 5J29A 4TQSA 4J9KA 8ICRA 4X4QA 2EDUA 2BHNA 5KL8B 4F92B 3AQNA 2MUTB 3D2QA 4DEZA 3V7KA 2NRXA 3O0FA 8ICJA 3EWAA 4NLBA 3LWMA 3KZIU 4R8UB 1U47A 5KFAA 1L3VA 3OV7A 3AQFA 1UETA 3ZDEA 4FBUA 1SL2A 4RWOA 4DS5A 1NK7A 2XO7A 5IIKA 5KFJA 5ALFA 2KSOA 4OJ5A 4C4SA 5DG7A 3RH6A 1RG6A 4KITB 4ATBA 5FP0A 5KT5A 3THVA 4O9MA 2J6UA 5K4LA 2E8MA 1B0XA 4TQRA 4JUZA 5B5EU 2MUTA 4AT9B 8ICXA 4KLMA 3RB0A 1Q46A 2KHQA 5KFSA 4NXVA 4S3NA 1T7PA 4F4ZA 4YXJA 1D8BA 4UBCA 1WWVA 3PSTA 2KOBA 4M9GA 2W11A 1Z4OA 3IG5A 4BWMA 1VJ7A 4R65A 2IHNA 5HC9A 2KK0A 2RP5A 2LHTA 4M9JA 2ZUBA 4CF5A 4LT6A 4QZ9A 1BPXA 1BNPA 4UASA 1K1QA 3E2EA 2DR7A 2JH7A 5CWRA 4JK1A 2H5XA 4OO1J 2VJ5A 1V85A 4YD1A 4UATA 2KIWA 1COKA 1XO0A 4WCWA 5KT4A 3EF2A 9ICLA 4WH5A 4IQVA 4K9BA 1NOMA 4DS4A 3Q8PB 1TK0A 7ICEA 1X6JA 4EZ6A 2ZH6A 2HBMA 5AKKA 3HX0A 3C5FA 2V4RA 1UCVA 3NVZA 2XY7A 4QZCA 4MEXA 4PHDA 1SKWA 4DSFA 4X0AA 3WFQE 1ZD2P 2H3QA 4OJPA 1PX5A 5EWGA 3Q8LA 1KFSA 4YR0A 4Y2YA 3H8JA 4Z6CA 4Y2XA 1ZRMA 3QU2A 3NVVA 8ICFA 5KG2A 3RJJA 2B0CA 5AM5A 5AKLA 2PI5A 3NKUA 2C2RA 3RRHA 3OSPA 4RUCA 4U7CA 4UD4A 8ICOA 4QZFA 5CR0A 4DFMA 4K98A 4J9NA 4GIBA 1KBUA 4DL4A 4QIWC 4WC5A 2W03A 1L5UA 3D6JA 1X9MA 4UB4A 5KFYA 1JQRA 4CDGA 2P66A 2GA9D 2KE7A 1ZQHA 3F2CA 8ICKA 5KFVA 1DK3A 4B9UA 2KV2A 4IRKA 2LMRA 3LK9A 2WHEA 5AI6A 2MAXA 4JLZA 3QUQA 7ICLA 3ZDBA 4WC6A 3H0LB 3MC1A 3PW5A 5CHEA 5KFTA 2BKEA 2DRBA 4DO9A 1NJZA 1J2MA 2QB0A 2CXYA 3V7LA 2G07A 1U9LA 5AM4A 5EE9A 4NM1A 2NRWA 4F71A 1S0NA 1A0PA 1X9XA 4OJ6A 3GIMA 1QSSA 5EOZA 2EAMA 2GWSA 8ICZA 2AU0A 3WFRE 4OD0A 1ZQKA 3OGUA 2KIVA 1ED1A 1UEUA 1F0MA 2ZJ5A 2PKEA 3WKAA 4J03A 4B9LA 4KX5A 4B9MA 2ISPA 3AEVA 4AYBC 5AIBA 5KG4A 5J2AA 5J2CA 4BWJA 5J0WA 2K8BB 5DDMA 4QZBA 4FHWA 3QU7A 2RHFA 4NLNA 3MR2A 5KFQA 4ECZA 5HMLA 3PO4A 1D9FA 4ELUA 2I1QA 5HR9A 2YX8A 2ID1A 4ACOA 5DBCA 3H7IA 2G5IB 4YR2A 5ALMA 4PH5A 1D8LA 3MFIA 4NXZA 2KJ5A 2NRVA 4IL6U 4GC6A 5TISU 1LKYB 5D46A 1V38A 4DSJA 3MR3A 3WFSC 1KEJA 5F3XB 2WF8A 3A0HU 5KFMA 4RNOA 1TKDA 1MSWD 1RYSA 2PFQA 2EZYA 4LVSA 4MEYA 2BCQA 2VA3A 3A0BU 4NLZA 5KT6A 2F2AB 4C8LA 2BCSA 1WUDA 1JAJA 1QTMA 1N60A 4P4MA 4ED0A 2RRDA 1RPLA 3D2SA 2FMQA 4NXTA 2JEFA 2K4EA 3OUYB 3SAGA 5CA7A 2OM6A 5IIMA 2ZIVB 3VC8A 3C2LA 1BGXT 3TAPA 2ALZA 2HOIA 2Q66A 4YCXA 3ONNA 4M5DA 3QUTA 4JV0A 3KHHA 3FM9A 4ED7A 1ZETA 1S5LU 1ZQ1C 3J81j 3IM1A 1ZQYA 3SI8A 1Q79A 4O3OA 4AP9A 2XVTA 4Y2RA 5HRFA 3KHRA 4CF4A 4GLXA 2YMPA 4DFDA 3ICXA 4ECVA 1U4BA 3ZDCA 3QZ7A 4O5EA 2FCLA 5E79U 3HIYA 5KFZA 3AUOA 1EXNA 1XSLA 4UAWA 4ECXA 2WB1C 9ICPA 5JTIA 1N56A 2G08A 3ERCC 2R8GA 4KLDA 5ALUA 4KLFA 1UT5A 1KN5A 3WKDA 2KNJA 1ZD5A 5AK3A 1MQ3A 2ZIWB 4CNQA 5T14A 4P2HA 3S6JA 2KN7A 3UPSA 1UPHA 4BX9C 5J2FA 2C2DA 4KLSA 5L1KA 2H3ZA 2LKYA 2Y0SC 1QSLA 1SWWA 5ALSA 4ECWA 4PL1A 1WOTA 3QU9A 5AI5A 5KT2A 4YP3A 2YMLA 2W9CB 3CYMA 4XQ8A 1NZPA 4O3SA 4UD5A 3Q8SB 4NXWA 4RWQA 2W7OA 4F91B 1DGSA 3TKAA 4ECUA 4WC4A 8ICMA 4OAHA 3EZ5A 4QZAA 2BCRA 4JV1A 3GQCA 4NL9A 2Y1JA 4F72A 2HHSA 2NRTA 3MDAA 2IMWP 4M6WA 3SZ2A 2LI6A 2FLLA 2BQUA 1P7DA 4I2JA 1TFRA 3ER9B 3BZCA 4Q44A 1VJ5A 1OXJA 3M6KA 1S9FA 2JXJA 4KX3A 4OAFA 2E3TA 4DSLA 4WC1A 1R8AA 2XIDA 2LYHA 3K7DA 1CRXA 3SV4A 3B9JA 4FBTA 2JH1A 5AM2A 4M9HA 4RWNA 3V6HA 1KQQA 1S76D 3C21A 3RR7A 1L7PA 2DL0A 9ICUA 2A3VA 4PGXA 1FO4A 3TFSA 5AM3A 5J2KA 3F5AA 1X42A 3HILA 4P4PA 7ICIA 4OCZA 1O08A 5DBAA 5F9NA 1KRPA 4K96A 3LVWA 3RH4A 5CP2A 5KFBA 4FS1A 2E8NA 3CNHA 2EZZA 3NGDA 1S8OA 4MF8A 2AXTU 2JEJA 2PMZF 4QWAA 3L4PA 4RPYA 4ED3A 2A19A 4DQIA 2W7PA 1ZQJA 3N4MB 8ICVA 2DR5A 3I1YA 5AKHA 4A8EA 5DGAA 1QSYA 3GILA 3OJSA 4O6AA 2IHMA 9ICAA 3M6ZA 4X4OA 4CF3A 1BPEA 2YY6A 3JZ0A 3F2DA 1X9SA 2BBHA 4Q45A 1RQLA 4YXMA 1L3SA 2XC9A 3BQTA 3OHAA 3MDCA 1ZJMA 2WF5A 3TQ1A 3Q8QB 4ECTA 5KFLA 5KFNA 5C0YA 1ZQLA 1JMSA 3UXOA 1L6NA 2BCUA 4B9SA 1DRGA 9ICEA 3AQEA 1BVSA 1KFTA 4RWPA 1V97A 4EP7A 2ZUCA 2NYVA 2IHOA 4O68A 4KLOA 3QE9Y 3RBEA 4AT7A 2M2TA 4K9AA 4EEBA 2EANA 1PVRA 2V9WA 1ZD3A 2GH1A 2W9BB 5ALTA 3KZXA 3PW0A 4P4OA 3QUBA 1N2XA 1XO1A 3WK5A 1ECWA 3JYYA 4DQQA 4JMUA 2W9AA 2M0NA 2A1JA 2AGPA 1N62A 1NZBA 2W3SA 2HMXA 3UMGA 3MGIA 8ICEA 3TADC 4E7XA 2BPGA 2DRAA 4XA5A 1JIHA 2VA2A 3H39A 4NXXA 1Z00B 2GLEA 2W9BA 4F5NA 2W3RA 5AM0A 4PJ0U 3PMLA 4J9OA 4DL5A 3M9OB 7ICFA 2E8OA 4GXIA 3JPRA 5AI8A 2HDOA 1NK9A 3SAHA 4CRXA 4O3PA 2WFAA 4F8RA 2DR8A 1NK0A 4M9LA 3WK9A 1L8LA 2HSZA 5CJ7A 1DK2A 3C1YA 2K60A 2KMDA 4EBEA 5GTIU 3PW4A 3SEIA 3DEEA 1ZOLA 2ZIXB 1BNOA 3AU2A 3KOOA 4QWCA 4C8KA 4NLCA 3M9MB 3Q8RB 2FPLA 4UAZA 3GFKB 2DUYA 3MGVA 2WAQC 3TFRA 2OXOA 1N48A 3TAQA 5EE3A 2A1AA 2XGPA 1TK5A 3FYHA 1YT3A 1R8BA 7ICVA 1F44A 3ZD9A 3H8SA 1L3TA 3BDPA 3UM9A 2YMMA 4R8UA 1SKRA 7ICSA 1X2IA 4O3QA 5D62A 4E80A 4RU9A 2HHQA 4K99A 4QZDA 5H2FU 2G0AA 3FAHA 3QUCA 4ICAA 3SYZA 5ALPA 4RT3A 5G5GA 2ZH5A 2BPFA 1J2NA 4DL2A 5F9LA 5DQIA 5KFCA 5B3PA 3AN1A 3NWIA 3BJYA 4ZOHC 2ZXIA 3HJEA 2KP7A 4F2RA 3H8WA 1A77A 1O03A 3T5JA 1TAUA 4WC3A 5D49A 3NVWA 1XSPA 5HRDA 3RR8A 3N7RC 1DXSA 5BOLA 4AT9A 5KFUA 1MC8A 4UB8U 1QLNA 3ORYA 4RQMA 3L3FX 3N28A 3RJGA 1IG6A 2KFZA 4EYHB 3UMCA 3PY8A 4P0QB 4QZIA 4DOAA 5ALDA 4EGWA 4X4SA 1JROA 2CRXA 2ASLA 1NK4A 1NO5A 1F5SA 3IV6A 5F2VO 4KLHA 3KTQA 1ZQZA 4JWNA 5KG6A 5AHXA 2G06A 5KG3A 4UAUA 9ICMA 2VA8A 5BOMA 2K89A 1L7MA 1QH9A 2EAOA 5C5JA 2RDIA 2HCFA 4NKTA 1SWVA 3VCBA 2VIXA 5KFHA 4FHVA 5JTGA 4MFFA 3BQ7A 2KZZA 4PHAA 3QU4A 4JB3A 4NXUA 4RNNA 3ZDAA 4QW8A 3CP8A 4I2HA 2ZUDA 4XRHA 1YZ7A 3SR6A 4DFKA 4DL6A 2B56A 5HMMA 4EELA 2M2WA 3WK7A 7ICNA 4GXKA 2EQYA 3M8SA 1YZ6A 3QZ8A 1VFGA 3K75D 2HHPA 4ELVA 2N1RA 4YVZA 3V7JA 1L8OA 2KKPA 4EEDA 2FJ6A 5J0SA 2KJ9A 7ICOA 5HHIA 1BPBA 4B9NA 8ICIA 4GXJA 2MA1A 2FPMA 4C8NA 3CRXA 5J2GA 1T3QA 2E8PA 5AI0A 4DLGA 2KVSA 1R89A 2MU2A 4UB1A 4LZDA 2KVCA 2LYAA 5AKZA 4KB6A 5DEDA 8ICHA 1Z1VA 3H3AA 4Z6EA 3ALRA 4FO1A 3FDSA 1TAQA 3MR5A 2ZJAA 4ECRA 2XY5A 2YTUA 1X40A 2F1IA 2H3FA 4C8MA 4ECSA 5J2BA 9ICGA 4FZMA 2JRZA 3H38A 2ZTCA 5HRIA 4AYBF 2KD1A 4DCCA 4MF2A 2L5YA 4RQNA 2K4IA 4U6PA 4QWDA 4Y2JA 3PR4A 4DWIA 1KNYA 1HUOA 3DDHA 2J6TA 3OJUA 1TV9A 4RQ7A 5CFSA 4F2SA 3WKCA 4KN7A 5GTHU 4YMMA 1RYRA 1N5XA 1ZQBA 3H4BA 4Y2UA 4DQSA 4YN4A 1ZQQA 1CI4A 4FHYA 3JPNA 3L9DA 5EE1A 8ICGA 4HYKA 2W54A 4KMUA 4WJ3B 2XCAA 4I2IA 2K8AA 3PX6A 3G6XA 4F50A 3ETRA 4PGYA 5J8YA 2ZH9A 3LVVA 1MQ2A 3C2MA 1NJXA 3EUB2 2KEYA 2RFFA 5IIJA 4Y2QA 2YN4A 4US9A 4IRDA 2ZH4A 4FHXA 5CEHA 1WCNA 5DLFA 2V4QA 4NV0A 2BPCA
chains in the Genus database with same CATH topology
4RQ6A 3HWTA 4FO6A 1S9FA 1ZQOA 3UXNA 2JEGA 9ICIA 5BPCA 5HRHA 3N97B 5TZVA 3BQ1A 3LDAA 3RBDA 4DSLA 3BQ2A 2HHUA 4WC1A 3V6JA 3PNCA 2KTQA 1MIVA 3OVBA 8ICSA 1R8AA 9ICFA 4TURA 2HVIA 4FH5A 1S0OA 4RZRA 2LYHA 5KT7A 4ED2A 2ZH2A 4ELTA 5J0RA 5CB1A 3V72A 3SV4A 3UQ0A 2KZMA 1ZQSA 1NJWA 4TUSA 4FBTA 4QWBA 9ICNA 2ZHAA 1ZQDA 1F5AA 4M9HA 4RWNA 3RB3A 3V6HA 3HPOA 4IQTA 4KLQA 1B43A 1S76D 4ATBB 3C21A 9ICBA 3MR6A 1ZQVA 3RR7A 2WTFA 3TANA 1V9PA 1XC9A 2I9GA 5J29A 7ICMA 4TQSA 4GC7A 4J9KA 2FMPA 4PGXA 8ICRA 7ICTA 9ICUA 4X4QA 3TFSA 4J9PA 2BHNA 5KFDA 3UPQA 4QZ8A 4F92B 5J2KA 2MUTB 3AQNA 4DEZA 3RTVA 4DLEA 4P4PA 3V7KA 2NRXA 1Z3EB 5KFPA 1NKCA 5DLGA 7ICIA 4YMNA 9ICCA 8ICJA 3PMNA 3EWAA 5DBAA 5J2JA 5F9NA 4R8UB 3LWMA 1U47A 1KRPA 1AROP 5KFAA 3RH4A 4K4HA 5CP2A 3GDXA 5KFBA 4FS1A 1L3VA 3OV7A 4RPZA 2C2EA 3H40A 1UETA 3ZDEA 3NGDA 1T3NA 1DOQA 2JEIA 4FBUA 1SL2A 1SKSA 3OUYA 4RWOA 3RJEA 4DS5A 4F4XA 2UVVA 1NK7A 4MF8A 5IIKA 2XO7A 3MBYA 2JEJA 2AGOA 2BR0A 5KFJA 4QWAA 4RPYA 4ED3A 1TFYA 3V6KA 4X4RA 3RH6A 4DQIA 5DG7A 3MABA 5KFRA 1ZQJA 3N4MB 8ICVA 2DR5A 2F1HA 1NK5A 4KITB 1Q78A 5DGAA 1QSYA 4ATBA 5KT5A 3GILA 5J2EA 3OJSA 3THVA 2IHMA 4DQPA 3GV8B 4O9MA 2J6UA 9ICAA 3EW9A 7ICPA 3RJIA 4X4OA 3AU6A 4TQRA 2HHXA 3C66A 4JUZA 1ZQEA 2MUTA 4BXOB 4RUAA 8ICLA 4AT9B 1BPEA 3JZ0A 8ICXA 4KLMA 3RB0A 2R8JA 1FA0A 5KFSA 4UB5A 1X9SA 2UVUA 4Q45A 1ZQGA 4S3NA 1T7PA 4YXMA 4F4ZA 1L3SA 2XC9A 3BQTA 4YXJA 3UXPA 4UBCA 4KLTA 4M9GA 3OHAA 1VJ7A 3MDCA 1ZJMA 4BWMA 4R65A 2IHNA 1K1SA 9ICVA 5HC9A 3TQ1A 4YG2A 4Z6FA 3Q8QB 4ECTA 2JZBB 5KFLA 1JXEA 4CCHA 5KFNA 5DG8A 4M9JA 1ZQLA 1JMSA 2ZUBA 3UXOA 1SL1A 2BCUA 2Q0ZX 4QZEA 4B9SA 9ICEA 5EWEA 4LT6A 3AQKA 1BVSA 4QZ9A 3RJHA 1BPXA 1KFTA 1BNPA 4RWPA 2OWOA 3PO5A 5DDYA 1K1QA 3E2EA 1Y88A 1BPYA 2DR7A 5CWRA 4YQWA 4EP7A 4JK1A 2H5XA 2ZUCA 2ZH4A 2M2VA 3UQ2A 4YD1A 4KLOA 3QE9Y 3RBEA 1UA1A 4RQ5A 2FLPA 4RPXA 4EZ9A 2M2TA 4AT7A 4NKUA 4XQ7A 4WCWA 5KT4A 3PR5B 3QEBZ 1JN3A 2V9WA 4JV2A 9ICLA 5HRBA 1IXRA 3JPQA 2W9BB 3ZDDA 3WFOA 4IQVA 5KFOA 5KFEA 1NOMA 4DS4A 3Q8PB 3OHBA 3PW0A 1TK0A 4P4OA 2KZ3A 1ZQWA 2W8KA 7ICEA 4I2EA 4IG8A 4EZ6A 2ZH6A 5L1LA 1XO1A 1CUKA 3HX0A 2XGQA 3RJKA 2M2UA 4YMOA 2FMSA 3C5FA 2V4RA 7ICKA 2ZH3A 1BPZA 2XY7A 3LWLA 5J0UA 4DL3A 5DB8A 4QZCA 2W9CA 4DQQA 2W9AA 4JWMA 3JYYA 8ICUA 2UVRA 1TVAA 4PHDA 2A1JA 2AGPA 1UT8A 4DSFA 1SKWA 5J0YA 4MEXA 3TARA 4EBJA 2NRKA 4F3OA 4X0AA 4DF8A 8ICCA 3WFQE 7ICUA 1D9DA 1T8EA 1PX5A 3RAQA 5EWGA 3MGIA 1ZQMA 1ZYQA 8ICEA 3EYZA 3OVSA 3Q8LA 1KFSA 3PVXA 2R8HA 4YR0A 4F5RA 4EBKA 4E7XA 2BPGA 2DRAA 2ZH7A 4XA5A 2F1JA 9ICRA 5DGBA 4UAYA 1JIHA 3H8JA 1NJYA 2VA2A 4F5PA 4Z6CA 4RQ3A 4MFCA 3H39A 7ICQA 4DFJA 4M2YA 4YD2A 4KLUA 1Z00B 5L1JA 2W9BA 3GIKA 8ICFA 4F5NA 5KFIA 5KG2A 4E0DA 5DB6A 3ETLA 3PMLA 4J9OA 4DL5A 3RJJA 3MGHA 3M9OB 2DPIA 7ICFA 4GXIA 2PI5A 5D4BA 4I29A 3JPRA 4O3RA 3NTUA 2C2RA 3RRHA 1NK9A 3OSPA 2BDPA 4RUCA 5HRLA 4F5QA 5DKWA 2PFOA 4UD4A 4O3PA 8ICOA 4QZFA 5CR0A 4DFMA 4F8RA 2DR8A 3PW2A 4X5VA 4J9NA 1NK0A 4M9LA 4DL4A 5DQGA 4WC5A 1L5UA 5CJ7A 2B21A 4J9MA 4UB4A 1X9MA 3C1YA 1DK2A 5KFYA 4NLKA 1KTQA 2R8IA 4EBEA 4I2BA 1JQRA 2P66A 3ZD8A 3T3FA 1NKEA 4WC7A 1ZQHA 3PW4A 4WC2A 3RJFA 8ICKA 3C23A 4O5KA 3AU2A 5KFVA 3Q8KA 1BNOA 2BQ3A 1DK3A 2ZH1A 4B9UA 1A76A 4QWCA 4C8KA 4IRKA 3LK9A 3M9MB 3HW8A 1CEZA 3Q8RB 9ICJA 2FPLA 5KFXA 4UAZA 4WC0A 4ZH4A 1ZQNA 2MAXA 4WBZA 7ICLA 3RB6A 8ICTA 5HRGA 1T4GA 1U49A 3ZDBA 4ECYA 4WC6A 3GFKB 4F4KA 5L9XA 4KTQA 3HJ1A 3PW5A 5J2DA 3TFRA 5KFTA 1ZQFA 4NY8A 2BKEA 1S10A 5J0PA 4ECQA 2IA6A 4J9QA 4DO9A 1ZJNA 1NJZA 1N48A 3V7LA 9ICHA 3JPOA 1U9LA 4NM1A 2HHVA 9ICWA 5DECA 2NRWA 4IQWA 3TAQA 5JUMA 2ZTDA 4RQ0A 2XGPA 1TK5A 3FYHA 1S0NA 3GIMA 1QSSA 2GWSA 1R8CA 1R8BA 5EOZA 4KLGA 8ICZA 2HHTA 7ICVA 3ZD9A 3G6YA 4X4VA 1COOA 2AU0A 9ICQA 3WFRE 3H8SA 1JXLA 4X4TA 1S77D 4RQ8A 2AGQA 3OGUA 2AQ0A 1L3TA 1ZQKA 3BDPA 8ICWA 9ICOA 4DF4A 2IBKA 1SKRA 4R8UA 4DSEA 4DL7A 1UEUA 2ZJ5A 3Q8MA 7ICSA 3QEAZ 2BGWA 4I2CA 1X2IA 4O3QA 3C18A 4E80A 5KTQA 4RU9A 2HVHA 3K4GA 5IILA 5IIIA 3PV8A 1L3UA 4B9LA 2VANA 4Z6DA 2PI4A 2HHQA 5DQHA 4B9MA 4I28A 4QZDA 5L1IA 2ISPA 4IRCA 4QZHA 8ICYA 5DBBA 4QW9A 4UB3A 5KG4A 5J2AA 5J2CA 1KFDA 2C22A 3SYZA 1U48A 4RT3A 1ZQIA 8ICQA 2ZH5A 2BPFA 4DL2A 2NRZA 4BWJA 2O5AA 1D8YA 5J0WA 5F9LA 5DQIA 4I2GA 5KFCA 5DDMA 4QZBA 4FHWA 4XUSA 3BJYA 4DSIA 1TK8A 4DSKA 4F2RA 2W9MA 2KP7A 4NLGA 4X4UA 3H8WA 1A77A 5J0XA 3T5JA 4NLNA 1TAUA 1KSPA 1MIYA 5D49A 3ISDA 4WC3A 1XSPA 3MR2A 5HRDA 4M6WB 5KFQA 4ECZA 5HMLA 5BOLA 3PO4A 4BXOA 3RR8A 4AT9A 5KFUA 3GIJA 1D9FA 3G6VA 5IIOA 4ELUA 1MC8A 1QLNA 3HJ4A 2I1QA 4Q8EA 3T5LA 5HR9A 2M9NA 1XWLA 3ORYA 3BQ0A 2ID1A 4ED6A 3RJGA 5DBCA 2KFZA 3H7IA 4EYHB 1OU5A 4YR2A 5HHHA 3AQMA 4PH5A 3PY8A 1D8LA 4QZIA 4DOAA 3MFIA 4X4SA 2PBEA 4NXZA 1KLNA 2DR9A 4UD5A 2NRVA 4GC6A 2XY6A 2ASLA 5D46A 2JZBA 4FS2A 1NK4A 3C2KA 1NO5A 5F2VO 4Q43A 3JPSA 4KLHA 4DSJA 3MR3A 4MFAA 2DVIA 3JPPA 3KTQA 1ZQZA 4YR3A 4R63A 2HHWA 4BGDA 1MIWA 4JWNA 5KG6A 5KG3A 3WFSC 4X0BA 1KEJA 2BE3A 9ICMA 2VA8A 5KT3A 5BOMA 2ATLA 4E8FA 5J0QA 1ZQAA 5C5JA 4KLJA 2RDIA 4NKTA 5KFMA 4RNOA 1JX4A 4RT2A 1TKDA 5KFHA 4FHVA 3IHQB 1XSNA 1RYSA 2PFQA 2R8KA 4MFFA 2KZZA 4LVSA 1MSWD 4MEYA 2FPKA 4PHAA 2BCQA 4EEYA 2VA3A 4RNNA 3ZDAA 4QW8A 4I2HA 5CHGA 5KT6A 4UQGA 2ZUDA 4R64A 4C8LA 4NLZA 4XRHA 2BCSA 1HUZA 4X4NA 4EBDA 4TUQA 4DFKA 4DL6A 5KFWA 4J9SA 3HP6A 4UBBA 1QTMA 1JAJA 3GIIA 2ISOA 4FHPA 5HMMA 2M2WA 3TI0A 2BCVA 4P4MA 4ED0A 4KN4A 2W8LA 1RPLA 7ICNA 2FMQA 1H38A 7ICRA 4GXKA 5EWFA 3HT3A 1S97A 3M8SA 3ISCA 3B0XA 1ZQCA 2JEFA 3QZ8A 3OUYB 1VFGA 4F4YA 4PPXA 3K75D 5CA7A 1S0MA 4ELVA 2HHPA 5IIMA 4DFPA 4IR1A 3C2LA 3TAPA 1BGXT 4YVZA 3ISBA 3V7JA 2ALZA 4B9VA 1TFWA 2Q66A 4X4PA 4YCXA 1SL0A 5J0SA 5J2HA 1V4AA 4M5DA 3OVAA 4JV0A 4RNMA 3KHHA 4K4IA 7ICOA 1RXWA 4IQUA 5HHIA 1BPBA 4PGQA 1ZQRA 4ED7A 4B9NA 1ZETA 4GXJA 8ICIA 4DOBA 1ZQXA 2FPMA 3IM1A 4C8NA 7ICJA 4J9LA 1ZQYA 5J2GA 3SI8A 5HNKA 2J6SA 1Q79A 4O3OA 4DLGA 4M04A 5HRKA 2ZJ8A 5KFKA 1Z00A 1R89A 4I2AA 2O1PA 4UB1A 1C7YA 1XS9D 3T5HA 3T5KA 5HRFA 5IINA 4LZDA 3KHRA 3PX4A 9ICKA 1S0VA 2XCPA 3OSNA 4GLXA 4YFKA 5DEDA 8ICHA 3M9NB 2AQ4A 5DB9A 4RQ1A 3H3AA 4DQRA 4Z6EA 2ZH8A 4ECVA 2P6RA 1IM4A 3M8RA 1U4BA 3KHLA 5J0OA 3ZDCA 3QZ7A 4O5EA 4RQ4A 2KFNA 3HIYA 5KFZA 4DOCA 4I2DA 4F4WA 3AUOA 3FDSA 3RAXA 4RQ2A 1PZNA 1TAQA 1EXNA 4PHEA 3MR5A 3GV5B 1XSLA 4UAWA 1LV5A 4ECXA 2ZJAA 5KG0A 4KLLA 4G3IA 3GV7B 9ICPA 5KG5A 2ZHBA 4ECRA 2XY5A 1N56A 5J2IA 4FH3A 9ICSA 2F1IA 2R8GA 4C8MA 3SV3A 4UB2A 5J2BA 4ECSA 2C28A 4KLDA 2PFPA 2P6UA 3PX0A 4KLFA 1HJPA 8ICPA 4AT8B 3LQCB 3KHGA 3H38A 2ZTCA 8ICNA 5DG9A 4Q8FA 4QWEA 2BQRA 5HRIA 1UT5A 1X9WA 4AT7B 1UEVA 2DRBA 2RDJA 3H4DA 4M9NA 1MQ3A 4MF2A 4DWIA 4QWDA 3PR4A 2DPJA 1KNYA 4P2HA 4F93B 2KN7A 3UPSA 4R66A 5HP4A 1NK8A 1ZQPA 1YLQA 1HUOA 2HW3A 2J6TA 5J2FA 1NK6A 2C2DA 1BPDA 3OJUA 4EBCA 4KLSA 8ICAA 5L1KA 4M0AA 3PW7A 3EPGA 1TV9A 1QSLA 4RQ7A 3WFPA 3AQLA 4F2SA 5DB7A 4IR9A 1SZPA 4KLEA 1WCLA 4ECWA 3C5GA 2ZTEA 4KN7A 2FLNA 1WOTA 3JPTA 9ICGA 4NM2A 4YMMA 5KT2A 4YP3A 1NKBA 5KG1A 2W9CB 1RYRA 1ZQBA 4J9RA 4XQ8A 3H4BA 3RRGA 2DFLA 9ICXA 2A1JB 4PHPA 4ED1A 4DQSA 4O5CA 4O3SA 4TUPA 2ASDA 4YN4A 5KFFA 8ICBA 3Q8SB 1NZPA 1ZQQA 4RWQA 4FHYA 1U45A 3JPNA 3MFHA 4LZGA 3L9DA 4F91B 7ICGA 8ICGA 1RXVA 4HYKA 1KDHA 4KMUA 1DGSA 4ECUA 4WC4A 4AT8A 8ICMA 4QZGA 4C8OA 2XCAA 4I2IA 2PXIA 4F5OA 4K4GA 4I27A 4M47A 1B22A 3PX6A 3G6XA 4F50A 4PGYA 3EZ5A 2Y1IA 4QZAA 1XU4A 4WBYA 2ZH9A 5J0TA 2BCRA 4O3NA 4JV1A 1MQ2A 1ZQUA 3C2MA 3GQCA 1NJXA 4B9TA 4KLIA 2Y1JA 7ICHA 2RFFA 2HHSA 5KFGA 5IIJA 3NYBA 2NRTA 3MDAA 3B0YA 3C1ZA 4IRDA 3EPIA 4M6WA 2IMWP 2AJQA 2ASJA 3SZ2A 2PFNA 4FHXA 4EYIB 4I2FA 3RH5A 5HREA 1ZQTA 2FLLA 1LB2B 2BQUA 2UVWA 4BDPA 9ICTA 4ED8A 1RZTA 1WCNA 3RB4A 4I2JA 1TFRA 5KG7A 4O0IA 4Q44A 5DLFA 2V4QA 1UA0A 3H37A 2BPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ6 A;  3HWT A;  4FO6 A;  1S9F A;  1ZQO A;  3UXN A;  2JEG A;  9ICI A;  5BPC A;  5HRH A;  3N97 B;  5TZV A;  3BQ1 A;  3LDA A;  3RBD A;  4DSL A;  3BQ2 A;  2HHU A;  4WC1 A;  3V6J A;  3PNC A;  2KTQ A;  1MIV A;  3OVB A;  8ICS A;  1R8A A;  9ICF A;  4TUR A;  2HVI A;  4FH5 A;  1S0O A;  4RZR A;  2LYH A;  5KT7 A;  4ED2 A;  2ZH2 A;  4ELT A;  5J0R A;  5CB1 A;  3V72 A;  3SV4 A;  3UQ0 A;  2KZM A;  1ZQS A;  1NJW A;  4TUS A;  4FBT A;  4QWB A;  9ICN A;  2ZHA A;  1ZQD A;  1F5A A;  4M9H A;  4RWN A;  3RB3 A;  3V6H A;  3HPO A;  4IQT A;  4KLQ A;  1B43 A;  1S76 D;  4ATB B;  3C21 A;  9ICB A;  3MR6 A;  1ZQV A;  3RR7 A;  2WTF A;  3TAN A;  1V9P A;  1XC9 A;  2I9G A;  5J29 A;  7ICM A;  4TQS A;  4GC7 A;  4J9K A;  2FMP A;  4PGX A;  8ICR A;  7ICT A;  9ICU A;  4X4Q A;  3TFS A;  4J9P A;  2BHN A;  5KFD A;  3UPQ A;  4QZ8 A;  4F92 B;  5J2K A;  2MUT B;  3AQN A;  4DEZ A;  3RTV A;  4DLE A;  4P4P A;  3V7K A;  2NRX A;  1Z3E B;  5KFP A;  1NKC A;  5DLG A;  7ICI A;  4YMN A;  9ICC A;  8ICJ A;  3PMN A;  3EWA A;  5DBA A;  5J2J A;  5F9N A;  4R8U B;  3LWM A;  1U47 A;  1KRP A;  1ARO P;  5KFA A;  3RH4 A;  4K4H A;  5CP2 A;  3GDX A;  5KFB A;  4FS1 A;  1L3V A;  3OV7 A;  4RPZ A;  2C2E A;  3H40 A;  1UET A;  3ZDE A;  3NGD A;  1T3N A;  1DOQ A;  2JEI A;  4FBU A;  1SL2 A;  1SKS A;  3OUY A;  4RWO A;  3RJE A;  4DS5 A;  4F4X A;  2UVV A;  1NK7 A;  4MF8 A;  5IIK A;  2XO7 A;  3MBY A;  2JEJ A;  2AGO A;  2BR0 A;  5KFJ A;  4QWA A;  4RPY A;  4ED3 A;  1TFY A;  3V6K A;  4X4R A;  3RH6 A;  4DQI A;  5DG7 A;  3MAB A;  5KFR A;  1ZQJ A;  3N4M B;  8ICV A;  2DR5 A;  2F1H A;  1NK5 A;  4KIT B;  1Q78 A;  5DGA A;  1QSY A;  4ATB A;  5KT5 A;  3GIL A;  5J2E A;  3OJS A;  3THV A;  2IHM A;  4DQP A;  3GV8 B;  4O9M A;  2J6U A;  9ICA A;  3EW9 A;  7ICP A;  3RJI A;  4X4O A;  3AU6 A;  4TQR A;  2HHX A;  3C66 A;  4JUZ A;  1ZQE A;  2MUT A;  4BXO B;  4RUA A;  8ICL A;  4AT9 B;  1BPE A;  3JZ0 A;  8ICX A;  4KLM A;  3RB0 A;  2R8J A;  1FA0 A;  5KFS A;  4UB5 A;  1X9S A;  2UVU A;  4Q45 A;  1ZQG A;  4S3N A;  1T7P A;  4YXM A;  4F4Z A;  1L3S A;  2XC9 A;  3BQT A;  4YXJ A;  3UXP A;  4UBC A;  4KLT A;  4M9G A;  3OHA A;  1VJ7 A;  3MDC A;  1ZJM A;  4BWM A;  4R65 A;  2IHN A;  1K1S A;  9ICV A;  5HC9 A;  3TQ1 A;  4YG2 A;  4Z6F A;  3Q8Q B;  4ECT A;  2JZB B;  5KFL A;  1JXE A;  4CCH A;  5KFN A;  5DG8 A;  4M9J A;  1ZQL A;  1JMS A;  2ZUB A;  3UXO A;  1SL1 A;  2BCU A;  2Q0Z X;  4QZE A;  4B9S A;  9ICE A;  5EWE A;  4LT6 A;  3AQK A;  1BVS A;  4QZ9 A;  3RJH A;  1BPX A;  1KFT A;  1BNP A;  4RWP A;  2OWO A;  3PO5 A;  5DDY A;  1K1Q A;  3E2E A;  1Y88 A;  1BPY A;  2DR7 A;  5CWR A;  4YQW A;  4EP7 A;  4JK1 A;  2H5X A;  2ZUC A;  2ZH4 A;  2M2V A;  3UQ2 A;  4YD1 A;  4KLO A;  3QE9 Y;  3RBE A;  1UA1 A;  4RQ5 A;  2FLP A;  4RPX A;  4EZ9 A;  2M2T A;  4AT7 A;  4NKU A;  4XQ7 A;  4WCW A;  5KT4 A;  3PR5 B;  3QEB Z;  1JN3 A;  2V9W A;  4JV2 A;  9ICL A;  5HRB A;  1IXR A;  3JPQ A;  2W9B B;  3ZDD A;  3WFO A;  4IQV A;  5KFO A;  5KFE A;  1NOM A;  4DS4 A;  3Q8P B;  3OHB A;  3PW0 A;  1TK0 A;  4P4O A;  2KZ3 A;  1ZQW A;  2W8K A;  7ICE A;  4I2E A;  4IG8 A;  4EZ6 A;  2ZH6 A;  5L1L A;  1XO1 A;  1CUK A;  3HX0 A;  2XGQ A;  3RJK A;  2M2U A;  4YMO A;  2FMS A;  3C5F A;  2V4R A;  7ICK A;  2ZH3 A;  1BPZ A;  2XY7 A;  3LWL A;  5J0U A;  4DL3 A;  5DB8 A;  4QZC A;  2W9C A;  4DQQ A;  2W9A A;  4JWM A;  3JYY A;  8ICU A;  2UVR A;  1TVA A;  4PHD A;  2A1J A;  2AGP A;  1UT8 A;  4DSF A;  1SKW A;  5J0Y A;  4MEX A;  3TAR A;  4EBJ A;  2NRK A;  4F3O A;  4X0A A;  4DF8 A;  8ICC A;  3WFQ E;  7ICU A;  1D9D A;  1T8E A;  1PX5 A;  3RAQ A;  5EWG A;  3MGI A;  1ZQM A;  1ZYQ A;  8ICE A;  3EYZ A;  3OVS A;  3Q8L A;  1KFS A;  3PVX A;  2R8H A;  4YR0 A;  4F5R A;  4EBK A;  4E7X A;  2BPG A;  2DRA A;  2ZH7 A;  4XA5 A;  2F1J A;  9ICR A;  5DGB A;  4UAY A;  1JIH A;  3H8J A;  1NJY A;  2VA2 A;  4F5P A;  4Z6C A;  4RQ3 A;  4MFC A;  3H39 A;  7ICQ A;  4DFJ A;  4M2Y A;  4YD2 A;  4KLU A;  1Z00 B;  5L1J A;  2W9B A;  3GIK A;  8ICF A;  4F5N A;  5KFI A;  5KG2 A;  4E0D A;  5DB6 A;  3ETL A;  3PML A;  4J9O A;  4DL5 A;  3RJJ A;  3MGH A;  3M9O B;  2DPI A;  7ICF A;  4GXI A;  2PI5 A;  5D4B A;  4I29 A;  3JPR A;  4O3R A;  3NTU A;  2C2R A;  3RRH A;  1NK9 A;  3OSP A;  2BDP A;  4RUC A;  5HRL A;  4F5Q A;  5DKW A;  2PFO A;  4UD4 A;  4O3P A;  8ICO A;  4QZF A;  5CR0 A;  4DFM A;  4F8R A;  2DR8 A;  3PW2 A;  4X5V A;  4J9N A;  1NK0 A;  4M9L A;  4DL4 A;  5DQG A;  4WC5 A;  1L5U A;  5CJ7 A;  2B21 A;  4J9M A;  4UB4 A;  1X9M A;  3C1Y A;  1DK2 A;  5KFY A;  4NLK A;  1KTQ A;  2R8I A;  4EBE A;  4I2B A;  1JQR A;  2P66 A;  3ZD8 A;  3T3F A;  1NKE A;  4WC7 A;  1ZQH A;  3PW4 A;  4WC2 A;  3RJF A;  8ICK A;  3C23 A;  4O5K A;  3AU2 A;  5KFV A;  3Q8K A;  1BNO A;  2BQ3 A;  1DK3 A;  2ZH1 A;  4B9U A;  1A76 A;  4QWC A;  4C8K A;  4IRK A;  3LK9 A;  3M9M B;  3HW8 A;  1CEZ A;  3Q8R B;  9ICJ A;  2FPL A;  5KFX A;  4UAZ A;  4WC0 A;  4ZH4 A;  1ZQN A;  2MAX A;  4WBZ A;  7ICL A;  3RB6 A;  8ICT A;  5HRG A;  1T4G A;  1U49 A;  3ZDB A;  4ECY A;  4WC6 A;  3GFK B;  4F4K A;  5L9X A;  4KTQ A;  3HJ1 A;  3PW5 A;  5J2D A;  3TFR A;  5KFT A;  1ZQF A;  4NY8 A;  2BKE A;  1S10 A;  5J0P A;  4ECQ A;  2IA6 A;  4J9Q A;  4DO9 A;  1ZJN A;  1NJZ A;  1N48 A;  3V7L A;  9ICH A;  3JPO A;  1U9L A;  4NM1 A;  2HHV A;  9ICW A;  5DEC A;  2NRW A;  4IQW A;  3TAQ A;  5JUM A;  2ZTD A;  4RQ0 A;  2XGP A;  1TK5 A;  3FYH A;  1S0N A;  3GIM A;  1QSS A;  2GWS A;  1R8C A;  1R8B A;  5EOZ A;  4KLG A;  8ICZ A;  2HHT A;  7ICV A;  3ZD9 A;  3G6Y A;  4X4V A;  1COO A;  2AU0 A;  9ICQ A;  3WFR E;  3H8S A;  1JXL A;  4X4T A;  1S77 D;  4RQ8 A;  2AGQ A;  3OGU A;  2AQ0 A;  1L3T A;  1ZQK A;  3BDP A;  8ICW A;  9ICO A;  4DF4 A;  2IBK A;  1SKR A;  4R8U A;  4DSE A;  4DL7 A;  1UEU A;  2ZJ5 A;  3Q8M A;  7ICS A;  3QEA Z;  2BGW A;  4I2C A;  1X2I A;  4O3Q A;  3C18 A;  4E80 A;  5KTQ A;  4RU9 A;  2HVH A;  3K4G A;  5IIL A;  5III A;  3PV8 A;  1L3U A;  4B9L A;  2VAN A;  4Z6D A;  2PI4 A;  2HHQ A;  5DQH A;  4B9M A;  4I28 A;  4QZD A;  5L1I A;  2ISP A;  4IRC A;  4QZH A;  8ICY A;  5DBB A;  4QW9 A;  4UB3 A;  5KG4 A;  5J2A A;  5J2C A;  1KFD A;  2C22 A;  3SYZ A;  1U48 A;  4RT3 A;  1ZQI A;  8ICQ A;  2ZH5 A;  2BPF A;  4DL2 A;  2NRZ A;  4BWJ A;  2O5A A;  1D8Y A;  5J0W A;  5F9L A;  5DQI A;  4I2G A;  5KFC A;  5DDM A;  4QZB A;  4FHW A;  4XUS A;  3BJY A;  4DSI A;  1TK8 A;  4DSK A;  4F2R A;  2W9M A;  2KP7 A;  4NLG A;  4X4U A;  3H8W A;  1A77 A;  5J0X A;  3T5J A;  4NLN A;  1TAU A;  1KSP A;  1MIY A;  5D49 A;  3ISD A;  4WC3 A;  1XSP A;  3MR2 A;  5HRD A;  4M6W B;  5KFQ A;  4ECZ A;  5HML A;  5BOL A;  3PO4 A;  4BXO A;  3RR8 A;  4AT9 A;  5KFU A;  3GIJ A;  1D9F A;  3G6V A;  5IIO A;  4ELU A;  1MC8 A;  1QLN A;  3HJ4 A;  2I1Q A;  4Q8E A;  3T5L A;  5HR9 A;  2M9N A;  1XWL A;  3ORY A;  3BQ0 A;  2ID1 A;  4ED6 A;  3RJG A;  5DBC A;  2KFZ A;  3H7I A;  4EYH B;  1OU5 A;  4YR2 A;  5HHH A;  3AQM A;  4PH5 A;  3PY8 A;  1D8L A;  4QZI A;  4DOA A;  3MFI A;  4X4S A;  2PBE A;  4NXZ A;  1KLN A;  2DR9 A;  4UD5 A;  2NRV A;  4GC6 A;  2XY6 A;  2ASL A;  5D46 A;  2JZB A;  4FS2 A;  1NK4 A;  3C2K A;  1NO5 A;  5F2V O;  4Q43 A;  3JPS A;  4KLH A;  4DSJ A;  3MR3 A;  4MFA A;  2DVI A;  3JPP A;  3KTQ A;  1ZQZ A;  4YR3 A;  4R63 A;  2HHW A;  4BGD A;  1MIW A;  4JWN A;  5KG6 A;  5KG3 A;  3WFS C;  4X0B A;  1KEJ A;  2BE3 A;  9ICM A;  2VA8 A;  5KT3 A;  5BOM A;  2ATL A;  4E8F A;  5J0Q A;  1ZQA A;  5C5J A;  4KLJ A;  2RDI A;  4NKT A;  5KFM A;  4RNO A;  1JX4 A;  4RT2 A;  1TKD A;  5KFH A;  4FHV A;  3IHQ B;  1XSN A;  1RYS A;  2PFQ A;  2R8K A;  4MFF A;  2KZZ A;  4LVS A;  1MSW D;  4MEY A;  2FPK A;  4PHA A;  2BCQ A;  4EEY A;  2VA3 A;  4RNN A;  3ZDA A;  4QW8 A;  4I2H A;  5CHG A;  5KT6 A;  4UQG A;  2ZUD A;  4R64 A;  4C8L A;  4NLZ A;  4XRH A;  2BCS A;  1HUZ A;  4X4N A;  4EBD A;  4TUQ A;  4DFK A;  4DL6 A;  5KFW A;  4J9S A;  3HP6 A;  4UBB A;  1QTM A;  1JAJ A;  3GII A;  2ISO A;  4FHP A;  5HMM A;  2M2W A;  3TI0 A;  2BCV A;  4P4M A;  4ED0 A;  4KN4 A;  2W8L A;  1RPL A;  7ICN A;  2FMQ A;  1H38 A;  7ICR A;  4GXK A;  5EWF A;  3HT3 A;  1S97 A;  3M8S A;  3ISC A;  3B0X A;  1ZQC A;  2JEF A;  3QZ8 A;  3OUY B;  1VFG A;  4F4Y A;  4PPX A;  3K75 D;  5CA7 A;  1S0M A;  4ELV A;  2HHP A;  5IIM A;  4DFP A;  4IR1 A;  3C2L A;  3TAP A;  1BGX T;  4YVZ A;  3ISB A;  3V7J A;  2ALZ A;  4B9V A;  1TFW A;  2Q66 A;  4X4P A;  4YCX A;  1SL0 A;  5J0S A;  5J2H A;  1V4A A;  4M5D A;  3OVA A;  4JV0 A;  4RNM A;  3KHH A;  4K4I A;  7ICO A;  1RXW A;  4IQU A;  5HHI A;  1BPB A;  4PGQ A;  1ZQR A;  4ED7 A;  4B9N A;  1ZET A;  4GXJ A;  8ICI A;  4DOB A;  1ZQX A;  2FPM A;  3IM1 A;  4C8N A;  7ICJ A;  4J9L A;  1ZQY A;  5J2G A;  3SI8 A;  5HNK A;  2J6S A;  1Q79 A;  4O3O A;  4DLG A;  4M04 A;  5HRK A;  2ZJ8 A;  5KFK A;  1Z00 A;  1R89 A;  4I2A A;  2O1P A;  4UB1 A;  1C7Y A;  1XS9 D;  3T5H A;  3T5K A;  5HRF A;  5IIN A;  4LZD A;  3KHR A;  3PX4 A;  9ICK A;  1S0V A;  2XCP A;  3OSN A;  4GLX A;  4YFK A;  5DED A;  8ICH A;  3M9N B;  2AQ4 A;  5DB9 A;  4RQ1 A;  3H3A A;  4DQR A;  4Z6E A;  2ZH8 A;  4ECV A;  2P6R A;  1IM4 A;  3M8R A;  1U4B A;  3KHL A;  5J0O A;  3ZDC A;  3QZ7 A;  4O5E A;  4RQ4 A;  2KFN A;  3HIY A;  5KFZ A;  4DOC A;  4I2D A;  4F4W A;  3AUO A;  3FDS A;  3RAX A;  4RQ2 A;  1PZN A;  1TAQ A;  1EXN A;  4PHE A;  3MR5 A;  3GV5 B;  1XSL A;  4UAW A;  1LV5 A;  4ECX A;  2ZJA A;  5KG0 A;  4KLL A;  4G3I A;  3GV7 B;  9ICP A;  5KG5 A;  2ZHB A;  4ECR A;  2XY5 A;  1N56 A;  5J2I A;  4FH3 A;  9ICS A;  2F1I A;  2R8G A;  4C8M A;  3SV3 A;  4UB2 A;  5J2B A;  4ECS A;  2C28 A;  4KLD A;  2PFP A;  2P6U A;  3PX0 A;  4KLF A;  1HJP A;  8ICP A;  4AT8 B;  3LQC B;  3KHG A;  3H38 A;  2ZTC A;  8ICN A;  5DG9 A;  4Q8F A;  4QWE A;  2BQR A;  5HRI A;  1UT5 A;  1X9W A;  4AT7 B;  1UEV A;  2DRB A;  2RDJ A;  3H4D A;  4M9N A;  1MQ3 A;  4MF2 A;  4DWI A;  4QWD A;  3PR4 A;  2DPJ A;  1KNY A;  4P2H A;  4F93 B;  2KN7 A;  3UPS A;  4R66 A;  5HP4 A;  1NK8 A;  1ZQP A;  1YLQ A;  1HUO A;  2HW3 A;  2J6T A;  5J2F A;  1NK6 A;  2C2D A;  1BPD A;  3OJU A;  4EBC A;  4KLS A;  8ICA A;  5L1K A;  4M0A A;  3PW7 A;  3EPG A;  1TV9 A;  1QSL A;  4RQ7 A;  3WFP A;  3AQL A;  4F2S A;  5DB7 A;  4IR9 A;  1SZP A;  4KLE A;  1WCL A;  4ECW A;  3C5G A;  2ZTE A;  4KN7 A;  2FLN A;  1WOT A;  3JPT A;  9ICG A;  4NM2 A;  4YMM A;  5KT2 A;  4YP3 A;  1NKB A;  5KG1 A;  2W9C B;  1RYR A;  1ZQB A;  4J9R A;  4XQ8 A;  3H4B A;  3RRG A;  2DFL A;  9ICX A;  2A1J B;  4PHP A;  4ED1 A;  4DQS A;  4O5C A;  4O3S A;  4TUP A;  2ASD A;  4YN4 A;  5KFF A;  8ICB A;  3Q8S B;  1NZP A;  1ZQQ A;  4RWQ A;  4FHY A;  1U45 A;  3JPN A;  3MFH A;  4LZG A;  3L9D A;  4F91 B;  7ICG A;  8ICG A;  1RXV A;  4HYK A;  1KDH A;  4KMU A;  1DGS A;  4ECU A;  4WC4 A;  4AT8 A;  8ICM A;  4QZG A;  4C8O A;  2XCA A;  4I2I A;  2PXI A;  4F5O A;  4K4G A;  4I27 A;  4M47 A;  1B22 A;  3PX6 A;  3G6X A;  4F50 A;  4PGY A;  3EZ5 A;  2Y1I A;  4QZA A;  1XU4 A;  4WBY A;  2ZH9 A;  5J0T A;  2BCR A;  4O3N A;  4JV1 A;  1MQ2 A;  1ZQU A;  3C2M A;  3GQC A;  1NJX A;  4B9T A;  4KLI A;  2Y1J A;  7ICH A;  2RFF A;  2HHS A;  5KFG A;  5IIJ A;  3NYB A;  2NRT A;  3MDA A;  3B0Y A;  3C1Z A;  4IRD A;  3EPI A;  4M6W A;  2IMW P;  2AJQ A;  2ASJ A;  3SZ2 A;  2PFN A;  4FHX A;  4EYI B;  4I2F A;  3RH5 A;  5HRE A;  1ZQT A;  2FLL A;  1LB2 B;  2BQU A;  2UVW A;  4BDP A;  9ICT A;  4ED8 A;  1RZT A;  1WCN A;  3RB4 A;  4I2J A;  1TFR A;  5KG7 A;  4O0I A;  4Q44 A;  5DLF A;  2V4Q A;  1UA0 A;  3H37 A;  2BPC A; 
#chains in the Genus database with same CATH topology
 1ZQO A;  4NJ8 A;  3UXN A;  3N97 B;  3LDA A;  3BQ2 A;  1LKY A;  3PNC A;  2KTQ A;  1MIV A;  8ICS A;  9ICF A;  4TUR A;  3WK6 A;  4ED2 A;  2EH9 A;  5J0R A;  2KZM A;  1ZQS A;  2ZHA A;  1ZQD A;  3HPO A;  3ED5 A;  3NUQ A;  2G5H B;  2QLT A;  2HOQ A;  2K4P A;  4J9P A;  5KFD A;  4QZ8 A;  5ALI A;  1J97 A;  1Z3E B;  9ICC A;  4FZL A;  5J2J A;  3K1R B;  4LEY A;  2C2E A;  3H40 A;  1T3N A;  1DOQ A;  2JEI A;  1SKS A;  3OUY A;  2JR5 A;  2UVV A;  3MBY A;  1TFY A;  2ZIV A;  3V6K A;  4X4R A;  3MAB A;  4MHV A;  5KFR A;  3M7D A;  2F1H A;  2D3D A;  1Q78 A;  5JRT A;  3LYS A;  5J2E A;  4DQP A;  1Z1B A;  3RJI A;  3AU6 A;  3C66 A;  3BS5 B;  5AKI A;  4BXO B;  8ICL A;  2HN1 A;  2R8J A;  4UB5 A;  1ZQG A;  2JHD A;  3I28 A;  4G9B A;  3UXP A;  4KLT A;  5ALX A;  5ALZ A;  3F53 A;  2I6X A;  9ICV A;  2Y0S F;  4YG2 A;  4Z6F A;  1ZRN A;  2JZB B;  3E58 A;  1JXE A;  4CCH A;  1K5O A;  2OCE A;  1SL1 A;  2Q0Z X;  5EWE A;  2IUB A;  1Y88 A;  1BPY A;  1SGG A;  4YQW A;  4LEV A;  2M2V A;  4I0U A;  4RQ5 A;  5HR7 A;  3AMZ A;  1JUD A;  4OJO A;  3PR5 B;  2ZIW A;  3QEB Z;  4JV2 A;  5ALQ A;  3ZDD A;  5KFE A;  3OHB A;  5KL1 B;  2KZ3 A;  1ZQW A;  4I2E A;  2NO5 A;  5L1L A;  1IIP A;  2XGQ A;  4YMO A;  2FMS A;  7ICK A;  2DWQ A;  2ZH3 A;  1WWU A;  4K97 A;  3LWL A;  5J0U A;  4DL3 A;  5DB8 A;  2W9C A;  3ZI4 A;  3BS7 A;  2UVR A;  1TVA A;  3TAR A;  1SV0 A;  2YQE A;  8ICC A;  1OW5 A;  4NL9 C;  1D9D A;  3RAQ A;  1ZQM A;  2GOL A;  2R8H A;  4F5R A;  5AM1 A;  4UAY A;  4F5P A;  4RQ3 A;  3KFU F;  7ICQ A;  4DFJ A;  4M2Y A;  4YD2 A;  4KLU A;  1MN8 A;  3QXG A;  5L1J A;  3GIK A;  5KFI A;  4E0D A;  5DB6 A;  3ETL A;  2DPI A;  1N5W A;  5ALY A;  2E5S A;  5D4B A;  4I29 A;  4O3R A;  5DKW A;  2PFO A;  4P0P B;  3PW2 A;  4USA A;  4J9M A;  1KTQ A;  2AHO B;  1SXD A;  2R8I A;  5CRX A;  4I2B A;  3ZD8 A;  3T3F A;  5L1M A;  4WC7 A;  4WC2 A;  3RJF A;  3C23 A;  1ZXI A;  4O5K A;  3IP4 B;  5AK5 A;  2BQ3 A;  1A76 A;  4O3M A;  4K8V A;  3HW8 A;  4PZO A;  4WC0 A;  4ZH4 A;  1ZQN A;  5ALJ A;  1AQ6 A;  8ICT A;  5HRG A;  3QNM A;  1U49 A;  3JCF A;  4ECY A;  3MCR A;  5L9X A;  2O6K A;  1S10 A;  1QQ5 A;  9ICW A;  9ICH A;  3JPO A;  2HHV A;  4IQW A;  5JUM A;  2ZTD A;  1R8C A;  5G5H A;  1COO A;  9ICQ A;  1JXL A;  4X4T A;  1PUZ A;  4RQ8 A;  3PZP A;  4O67 A;  2AQ0 A;  5ALH A;  2IBK A;  4DSE A;  4O69 A;  2KIC A;  2BGW A;  3C18 A;  3K4G A;  2VJ4 A;  4Y2P A;  5IIL A;  3PV8 A;  2VAN A;  4Z6D A;  2DF4 B;  2RQ5 A;  3NAS A;  5L1I A;  4I28 A;  8ICY A;  4CGZ A;  2C22 A;  1KFD A;  1U48 A;  4Y2V A;  8ICQ A;  1JI7 A;  2Z7J A;  2EWR A;  2NRZ A;  2CPR A;  1D8Y A;  1GPJ A;  2HN2 A;  4XUS A;  1WYG A;  4DSI A;  4DSK A;  2W9M A;  5CFT A;  3HKZ C;  2Q4T A;  4UAR A;  4X4U A;  2LM1 A;  1RQN A;  1KSP A;  3ISD A;  2P35 A;  2HBL A;  3HJ4 A;  1SB3 C;  3WK8 A;  4Q8E A;  2M9N A;  1XWL A;  3BQ0 A;  3AQM A;  1KLN A;  2DR9 A;  3KKA A;  3E0F A;  4MFA A;  3JPP A;  4YR3 A;  4R63 A;  4BGD A;  4GFJ A;  3K1Z A;  5KT3 A;  1GO3 F;  3C28 A;  4E8F A;  2F77 X;  1NNL A;  4KLJ A;  1JX4 A;  4RT2 A;  1XSN A;  3IRU A;  3QX7 A;  4FE3 A;  2HBK A;  5CHG A;  4KMO B;  4OJL A;  4R64 A;  1JAL A;  1HUZ A;  3NVY A;  1QQ6 A;  3HP6 A;  3GII A;  4IS7 A;  4HX0 A;  7ICR A;  1H38 A;  3HT3 A;  1S97 A;  3ISC A;  1B4F A;  5HR6 A;  4F4Y A;  2NO4 A;  3IDW A;  5AK4 A;  1SL0 A;  4X4P A;  2OHF A;  5J2H A;  2ODG A;  4RNM A;  4K4I A;  2QB1 A;  4PGQ A;  3GZF A;  1ZQR A;  1KKX A;  1ZQX A;  2WF7 A;  5HNK A;  5HRK A;  4M04 A;  2HBJ A;  1Z00 A;  2D8C A;  1XS9 D;  3T5K A;  3PX4 A;  1S0V A;  2XCP A;  2WAQ F;  2NV3 A;  4YFK A;  3M9N B;  5DB9 A;  4RQ1 A;  2ZH8 A;  1T94 A;  3M8R A;  5J0O A;  4C7Y A;  3H0R B;  4F4W A;  3RAX A;  4RQ2 A;  1PZN A;  1BPZ A;  2ZH1 A;  4G3I A;  3GV7 B;  2KJ8 A;  1WG8 A;  2OEH A;  9ICS A;  2ZIX A;  4UB2 A;  4AT8 B;  2K4H A;  3PX0 A;  8ICP A;  1HJP A;  3BZK A;  3LQC B;  3KHG A;  8ICN A;  4Q8F A;  4QWE A;  1X9W A;  1UEV A;  3IN5 A;  2DPJ A;  3DV9 A;  4R66 A;  3WKB A;  2RLT A;  8ICA A;  1NK6 A;  1BPD A;  3WU2 U;  2MSN A;  4M0A A;  5DB7 A;  4IR9 A;  1SZP A;  3C5G A;  2ZTE A;  3JPT A;  4C80 A;  4NM2 A;  1NKB A;  2GAF D;  4J9R A;  9ICX A;  4PHP A;  4O5C A;  4TUP A;  5KFF A;  3KD3 A;  5AKX A;  1U45 A;  4WQL A;  3SAF A;  2F3N A;  4AT8 A;  4QZG A;  4C8O A;  2D6F C;  2B6G A;  3U26 A;  2PXI A;  4I27 A;  1Z19 A;  2Y1I A;  3I76 A;  4WBY A;  5J0T A;  4O3N A;  1QCK A;  5AKG A;  1ZQU A;  3N7P D;  5KFG A;  2LPE A;  5B3Q A;  1Q3U A;  3FC4 A;  3C1Z A;  4C4T A;  2YB1 A;  4FFD A;  5A0L A;  2AJQ A;  3RH5 A;  5HRE A;  4KM5 A;  1ZQT A;  2KG5 A;  3H8M A;  9ICT A;  4ED8 A;  2ZG6 A;  4XJE A;  2F8K A;  3NRZ A;  3H37 A;  3HWT A;  4FO6 A;  4P0Q A;  9ICI A;  5ALV A;  3SQI A;  5D63 A;  5TZV A;  3BQ1 A;  3RBD A;  2MRL A;  2HHU A;  3OVB A;  2HVI A;  4FH5 A;  5KT7 A;  5AI9 A;  2H3I A;  4ELT A;  1FFV A;  4QIW F;  3V72 A;  4TUS A;  4QWB A;  1TAM A;  9ICN A;  1F5A A;  4IQT A;  3KBB A;  2AH5 A;  9ICB A;  2QB0 B;  5AK6 A;  3HRD D;  3TAN A;  3R9K A;  1IV8 A;  2I9G A;  3PHZ A;  7ICM A;  4GC7 A;  2FMP A;  7ICT A;  3PSP A;  3UPQ A;  1C20 A;  3RTV A;  1NKC A;  4DLE A;  5KFP A;  5DLG A;  4B6J A;  4YMN A;  3PMN A;  4M9N A;  4K4H A;  1ARO P;  3GDX A;  4RPZ A;  4MKP A;  5ALN A;  1FIQ A;  2LM4 A;  3WKE A;  3RJE A;  4F4X A;  5KNI A;  2AGO A;  5ALR A;  2BR0 A;  2Y9U A;  1SV4 A;  5ALG A;  1NK5 A;  2LYB A;  3NS1 A;  1VLB A;  1NI3 A;  3GV8 B;  3EW9 A;  7ICP A;  1QQ7 A;  2JGA A;  5KAI U;  2HHX A;  2I5H A;  1ZQE A;  4LEW A;  4RUA A;  5CFU A;  2KHV A;  1FA0 A;  5AIC A;  3IG8 A;  2UVU A;  2OH2 A;  2HI0 A;  1K1S A;  5ALE A;  2XIC A;  4OAI Z;  5DG8 A;  4Y2S A;  4QZE A;  2B51 A;  3AQK A;  3RJH A;  4N7R A;  2OWO A;  3PO5 A;  5DDY A;  1UQV A;  3UQ2 A;  2E1F A;  5B66 U;  1UA1 A;  4EZ9 A;  2FLP A;  2W55 A;  3M1Y A;  4RPX A;  4NKU A;  1TE2 A;  4XQ7 A;  2E1E A;  1JN3 A;  2ESE A;  5HRB A;  1IXR A;  5ALL A;  3JPQ A;  3WFO A;  5KFO A;  2W8K A;  4IG8 A;  2LBO A;  1CUK A;  3RJK A;  2M2U A;  2F8L A;  2HOF A;  4JWM A;  8ICU A;  2BBJ A;  5J8Y C;  1UHU A;  1UT8 A;  4EBJ A;  5J0Y A;  2NRK A;  4F3O A;  4DF8 A;  7ICU A;  1T8E A;  1ZYQ A;  3EYZ A;  3OVS A;  3QYP A;  2BDU A;  4EEK A;  2WF6 A;  3PVX A;  4EBK A;  2R18 A;  2ZH7 A;  1HIW A;  2F1J A;  9ICR A;  2W04 A;  5DGB A;  1NJY A;  4MFC A;  1A6S A;  1OUQ A;  3MGH A;  2EAP A;  4Y2T A;  3AL0 B;  3NTU A;  2BDP A;  4LJX A;  5HRL A;  4F5Q A;  1FFU A;  2F44 A;  2FDR A;  2IOF K;  4X5V A;  5DQG A;  2B21 A;  4NLK A;  2K8C B;  1NKE A;  2VKQ A;  5JU5 A;  3AM9 A;  3Q8K A;  5AKY A;  1RYU A;  1Q3V A;  2DKX A;  1Z4N A;  1CEZ A;  9ICJ A;  5KFX A;  4WBZ A;  2B4V A;  3RB6 A;  1T4G A;  4UB6 U;  4F4K A;  2IOH A;  4KTQ A;  3HJ1 A;  2WB1 F;  4HAI A;  5J2D A;  2G09 A;  1ZQF A;  4NY8 A;  5J0P A;  4ECQ A;  2IA6 A;  4J9Q A;  1ZJN A;  5DEC A;  4RQ0 A;  4X4V A;  4KLG A;  2HHT A;  3G6Y A;  2FI1 A;  2H3V A;  1S77 D;  2OYY A;  2AGQ A;  9ICO A;  8ICW A;  4DF4 A;  2ZIU B;  4DL7 A;  4C7Z A;  3Q8M A;  4PL2 A;  3RF9 A;  3QEA Z;  4I2C A;  5KTQ A;  2HVH A;  2YB4 A;  2DBY A;  3RFA A;  5III A;  1L3U A;  4X0B A;  2PI4 A;  5DQH A;  4PZN A;  4IRC A;  2FE9 A;  4QZH A;  4QW9 A;  1N61 A;  4UAV A;  5DBB A;  4UB3 A;  1ZQI A;  3PSI A;  4QNL A;  2O5A A;  5D61 A;  4I2G A;  1TK8 A;  2EZX A;  3OWG A;  1ZD4 A;  4NLG A;  5J0X A;  1MIY A;  2ZXH A;  3BS5 A;  4M6W B;  2DGZ A;  4BXO A;  3GU3 A;  3ER8 C;  3GIJ A;  2QKQ A;  3G6V A;  5IIO A;  2ZIU A;  3T5L A;  4FZN A;  4IC9 A;  2DQN B;  4ED6 A;  1OU5 A;  5HHH A;  2XI9 A;  3OPX A;  2PBE A;  2XY6 A;  2JZB A;  4FS2 A;  4LEZ A;  3C2K A;  1PVQ A;  4Q43 A;  3JPS A;  2DVI A;  2CN1 A;  2GO7 A;  1MIW A;  1JRP A;  2HHW A;  2W43 A;  2BE3 A;  5KAF U;  2ATL A;  5J0Q A;  1ZQA A;  3QU5 A;  2QAR B;  3F2B A;  3CK6 A;  3IHQ B;  2R8K A;  2FPK A;  2F76 X;  4EEY A;  1RM6 C;  1HEK A;  4UQG A;  1SV0 C;  4X4N A;  4EBD A;  4TUQ A;  4WOY A;  5KFW A;  4J9S A;  4UBB A;  2ISO A;  4FHP A;  3TI0 A;  2DKZ A;  2BCV A;  4KN4 A;  2W8L A;  5ALK A;  5EWF A;  3L5K A;  1ZQC A;  3B0X A;  4PPX A;  4CE6 A;  1RDF A;  1S0M A;  2BZF A;  4DFP A;  4IR1 A;  4EX6 A;  4OAG A;  3ISB A;  1TFW A;  4B9V A;  3NVO A;  5AKJ A;  1V4A A;  3OVA A;  1L7N A;  1RXW A;  4IQU A;  2QAR A;  3SMV A;  1X6I A;  1Q8K A;  2ES6 A;  4UW9 A;  4DOB A;  1MA7 A;  3SEN A;  7ICJ A;  4J9L A;  3SD7 A;  2J6S A;  2ZJ8 A;  5KFK A;  3N7S C;  4I2A A;  2O1P A;  4BJQ A;  1C7Y A;  3T5H A;  5IIN A;  9ICK A;  5EE0 A;  4NWI A;  3OSN A;  2AQ4 A;  2JV3 A;  3CW2 C;  4DQR A;  2P6R A;  3PSF A;  1IM4 A;  3KHL A;  3D2N A;  1XNS A;  4P0P A;  4RQ4 A;  2KFN A;  2PMZ C;  4DOC A;  4I2D A;  1SZH A;  4PHE A;  3T79 A;  3GV5 B;  1LV5 A;  5KG0 A;  2JMG A;  4KLL A;  5KG5 A;  2ZHB A;  5J2I A;  4FH3 A;  2C28 A;  3SV3 A;  2PFP A;  2P6U A;  4US8 A;  5DG9 A;  2BQR A;  5AKE A;  4AT7 B;  1DGJ A;  4QJF B;  2RDJ A;  3H4D A;  2IOF A;  4F93 B;  1M6Y A;  3F5E A;  5HP4 A;  1NK8 A;  1ZQP A;  1YLQ A;  2HW3 A;  3WK4 A;  4EBC A;  3PW7 A;  3EPG A;  3HKZ F;  3AQL A;  3H0M B;  4KLE A;  1WCL A;  2FLN A;  5AIA A;  5KG1 A;  4JLX A;  4EV6 A;  3RRG A;  2DFL A;  2A1J B;  4ED1 A;  1N63 A;  2ASD A;  8ICB A;  5ALW A;  4LZG A;  3MFH A;  7ICG A;  1PK1 B;  1RXV A;  1KDH A;  4EX7 A;  3NRW A;  1FEZ A;  1VDV A;  4WQK A;  1X66 A;  4F5O A;  4K4G A;  4M47 A;  3TAC B;  4BUG A;  1B22 A;  3C29 A;  1SXE A;  1L7O A;  1XU4 A;  5AI4 A;  4C4R A;  4B9T A;  4KLI A;  7ICH A;  3UMB A;  3NYB A;  2KKV A;  3KKA C;  3B0Y A;  3TAD A;  3EPI A;  3WFP A;  2ASJ A;  2PFN A;  4EYI B;  4I2F A;  1LB2 B;  2UVW A;  4BDP A;  5ALO A;  1RZT A;  2WF9 A;  3OTQ A;  1PK3 A;  3RB4 A;  1LVH A;  5KG7 A;  4O0I A;  1UA0 A;  4EEN A;  4C0Z A;  4RQ6 A;  2JEG A;  2YMQ A;  1PK1 A;  5BPC A;  5HRH A;  1KL9 A;  3V6J A;  1URJ A;  1S0O A;  1SIJ A;  4RZR A;  2ZH2 A;  5CB1 A;  1KW4 A;  2KSO B;  3UQ0 A;  1NJW A;  3RB3 A;  1PVP A;  4KLQ A;  1B43 A;  4ATB B;  3MR6 A;  1ZQV A;  2Y9T A;  2WTF A;  1V9P A;  1XC9 A;  5J29 A;  4TQS A;  4J9K A;  8ICR A;  4X4Q A;  2EDU A;  2BHN A;  5KL8 B;  4F92 B;  3AQN A;  2MUT B;  3D2Q A;  4DEZ A;  3V7K A;  2NRX A;  3O0F A;  8ICJ A;  3EWA A;  4NLB A;  3LWM A;  3KZI U;  4R8U B;  1U47 A;  5KFA A;  1L3V A;  3OV7 A;  3AQF A;  1UET A;  3ZDE A;  4FBU A;  1SL2 A;  4RWO A;  4DS5 A;  1NK7 A;  2XO7 A;  5IIK A;  5KFJ A;  5ALF A;  2KSO A;  4OJ5 A;  4C4S A;  5DG7 A;  3RH6 A;  1RG6 A;  4KIT B;  4ATB A;  5FP0 A;  5KT5 A;  3THV A;  4O9M A;  2J6U A;  5K4L A;  2E8M A;  1B0X A;  4TQR A;  4JUZ A;  5B5E U;  2MUT A;  4AT9 B;  8ICX A;  4KLM A;  3RB0 A;  1Q46 A;  2KHQ A;  5KFS A;  4NXV A;  4S3N A;  1T7P A;  4F4Z A;  4YXJ A;  1D8B A;  4UBC A;  1WWV A;  3PST A;  2KOB A;  4M9G A;  2W11 A;  1Z4O A;  3IG5 A;  4BWM A;  1VJ7 A;  4R65 A;  2IHN A;  5HC9 A;  2KK0 A;  2RP5 A;  2LHT A;  4M9J A;  2ZUB A;  4CF5 A;  4LT6 A;  4QZ9 A;  1BPX A;  1BNP A;  4UAS A;  1K1Q A;  3E2E A;  2DR7 A;  2JH7 A;  5CWR A;  4JK1 A;  2H5X A;  4OO1 J;  2VJ5 A;  1V85 A;  4YD1 A;  4UAT A;  2KIW A;  1COK A;  1XO0 A;  4WCW A;  5KT4 A;  3EF2 A;  9ICL A;  4WH5 A;  4IQV A;  4K9B A;  1NOM A;  4DS4 A;  3Q8P B;  1TK0 A;  7ICE A;  1X6J A;  4EZ6 A;  2ZH6 A;  2HBM A;  5AKK A;  3HX0 A;  3C5F A;  2V4R A;  1UCV A;  3NVZ A;  2XY7 A;  4QZC A;  4MEX A;  4PHD A;  1SKW A;  4DSF A;  4X0A A;  3WFQ E;  1ZD2 P;  2H3Q A;  4OJP A;  1PX5 A;  5EWG A;  3Q8L A;  1KFS A;  4YR0 A;  4Y2Y A;  3H8J A;  4Z6C A;  4Y2X A;  1ZRM A;  3QU2 A;  3NVV A;  8ICF A;  5KG2 A;  3RJJ A;  2B0C A;  5AM5 A;  5AKL A;  2PI5 A;  3NKU A;  2C2R A;  3RRH A;  3OSP A;  4RUC A;  4U7C A;  4UD4 A;  8ICO A;  4QZF A;  5CR0 A;  4DFM A;  4K98 A;  4J9N A;  4GIB A;  1KBU A;  4DL4 A;  4QIW C;  4WC5 A;  2W03 A;  1L5U A;  3D6J A;  1X9M A;  4UB4 A;  5KFY A;  1JQR A;  4CDG A;  2P66 A;  2GA9 D;  2KE7 A;  1ZQH A;  3F2C A;  8ICK A;  5KFV A;  1DK3 A;  4B9U A;  2KV2 A;  4IRK A;  2LMR A;  3LK9 A;  2WHE A;  5AI6 A;  2MAX A;  4JLZ A;  3QUQ A;  7ICL A;  3ZDB A;  4WC6 A;  3H0L B;  3MC1 A;  3PW5 A;  5CHE A;  5KFT A;  2BKE A;  2DRB A;  4DO9 A;  1NJZ A;  1J2M A;  2QB0 A;  2CXY A;  3V7L A;  2G07 A;  1U9L A;  5AM4 A;  5EE9 A;  4NM1 A;  2NRW A;  4F71 A;  1S0N A;  1A0P A;  1X9X A;  4OJ6 A;  3GIM A;  1QSS A;  5EOZ A;  2EAM A;  2GWS A;  8ICZ A;  2AU0 A;  3WFR E;  4OD0 A;  1ZQK A;  3OGU A;  2KIV A;  1ED1 A;  1UEU A;  1F0M A;  2ZJ5 A;  2PKE A;  3WKA A;  4J03 A;  4B9L A;  4KX5 A;  4B9M A;  2ISP A;  3AEV A;  4AYB C;  5AIB A;  5KG4 A;  5J2A A;  5J2C A;  4BWJ A;  5J0W A;  2K8B B;  5DDM A;  4QZB A;  4FHW A;  3QU7 A;  2RHF A;  4NLN A;  3MR2 A;  5KFQ A;  4ECZ A;  5HML A;  3PO4 A;  1D9F A;  4ELU A;  2I1Q A;  5HR9 A;  2YX8 A;  2ID1 A;  4ACO A;  5DBC A;  3H7I A;  2G5I B;  4YR2 A;  5ALM A;  4PH5 A;  1D8L A;  3MFI A;  4NXZ A;  2KJ5 A;  2NRV A;  4IL6 U;  4GC6 A;  5TIS U;  1LKY B;  5D46 A;  1V38 A;  4DSJ A;  3MR3 A;  3WFS C;  1KEJ A;  5F3X B;  2WF8 A;  3A0H U;  5KFM A;  4RNO A;  1TKD A;  1MSW D;  1RYS A;  2PFQ A;  2EZY A;  4LVS A;  4MEY A;  2BCQ A;  2VA3 A;  3A0B U;  4NLZ A;  5KT6 A;  2F2A B;  4C8L A;  2BCS A;  1WUD A;  1JAJ A;  1QTM A;  1N60 A;  4P4M A;  4ED0 A;  2RRD A;  1RPL A;  3D2S A;  2FMQ A;  4NXT A;  2JEF A;  2K4E A;  3OUY B;  3SAG A;  5CA7 A;  2OM6 A;  5IIM A;  2ZIV B;  3VC8 A;  3C2L A;  1BGX T;  3TAP A;  2ALZ A;  2HOI A;  2Q66 A;  4YCX A;  3ONN A;  4M5D A;  3QUT A;  4JV0 A;  3KHH A;  3FM9 A;  4ED7 A;  1ZET A;  1S5L U;  1ZQ1 C;  3J81 j;  3IM1 A;  1ZQY A;  3SI8 A;  1Q79 A;  4O3O A;  4AP9 A;  2XVT A;  4Y2R A;  5HRF A;  3KHR A;  4CF4 A;  4GLX A;  2YMP A;  4DFD A;  3ICX A;  4ECV A;  1U4B A;  3ZDC A;  3QZ7 A;  4O5E A;  2FCL A;  5E79 U;  3HIY A;  5KFZ A;  3AUO A;  1EXN A;  1XSL A;  4UAW A;  4ECX A;  2WB1 C;  9ICP A;  5JTI A;  1N56 A;  2G08 A;  3ERC C;  2R8G A;  4KLD A;  5ALU A;  4KLF A;  1UT5 A;  1KN5 A;  3WKD A;  2KNJ A;  1ZD5 A;  5AK3 A;  1MQ3 A;  2ZIW B;  4CNQ A;  5T14 A;  4P2H A;  3S6J A;  2KN7 A;  3UPS A;  1UPH A;  4BX9 C;  5J2F A;  2C2D A;  4KLS A;  5L1K A;  2H3Z A;  2LKY A;  2Y0S C;  1QSL A;  1SWW A;  5ALS A;  4ECW A;  4PL1 A;  1WOT A;  3QU9 A;  5AI5 A;  5KT2 A;  4YP3 A;  2YML A;  2W9C B;  3CYM A;  4XQ8 A;  1NZP A;  4O3S A;  4UD5 A;  3Q8S B;  4NXW A;  4RWQ A;  2W7O A;  4F91 B;  1DGS A;  3TKA A;  4ECU A;  4WC4 A;  8ICM A;  4OAH A;  3EZ5 A;  4QZA A;  2BCR A;  4JV1 A;  3GQC A;  4NL9 A;  2Y1J A;  4F72 A;  2HHS A;  2NRT A;  3MDA A;  2IMW P;  4M6W A;  3SZ2 A;  2LI6 A;  2FLL A;  2BQU A;  1P7D A;  4I2J A;  1TFR A;  3ER9 B;  3BZC A;  4Q44 A;  1VJ5 A;  1OXJ A;  3M6K A;  1S9F A;  2JXJ A;  4KX3 A;  4OAF A;  2E3T A;  4DSL A;  4WC1 A;  1R8A A;  2XID A;  2LYH A;  3K7D A;  1CRX A;  3SV4 A;  3B9J A;  4FBT A;  2JH1 A;  5AM2 A;  4M9H A;  4RWN A;  3V6H A;  1KQQ A;  1S76 D;  3C21 A;  3RR7 A;  1L7P A;  2DL0 A;  9ICU A;  2A3V A;  4PGX A;  1FO4 A;  3TFS A;  5AM3 A;  5J2K A;  3F5A A;  1X42 A;  3HIL A;  4P4P A;  7ICI A;  4OCZ A;  1O08 A;  5DBA A;  5F9N A;  1KRP A;  4K96 A;  3LVW A;  3RH4 A;  5CP2 A;  5KFB A;  4FS1 A;  2E8N A;  3CNH A;  2EZZ A;  3NGD A;  1S8O A;  4MF8 A;  2AXT U;  2JEJ A;  2PMZ F;  4QWA A;  3L4P A;  4RPY A;  4ED3 A;  2A19 A;  4DQI A;  2W7P A;  1ZQJ A;  3N4M B;  8ICV A;  2DR5 A;  3I1Y A;  5AKH A;  4A8E A;  5DGA A;  1QSY A;  3GIL A;  3OJS A;  4O6A A;  2IHM A;  9ICA A;  3M6Z A;  4X4O A;  4CF3 A;  1BPE A;  2YY6 A;  3JZ0 A;  3F2D A;  1X9S A;  2BBH A;  4Q45 A;  1RQL A;  4YXM A;  1L3S A;  2XC9 A;  3BQT A;  3OHA A;  3MDC A;  1ZJM A;  2WF5 A;  3TQ1 A;  3Q8Q B;  4ECT A;  5KFL A;  5KFN A;  5C0Y A;  1ZQL A;  1JMS A;  3UXO A;  1L6N A;  2BCU A;  4B9S A;  1DRG A;  9ICE A;  3AQE A;  1BVS A;  1KFT A;  4RWP A;  1V97 A;  4EP7 A;  2ZUC A;  2NYV A;  2IHO A;  4O68 A;  4KLO A;  3QE9 Y;  3RBE A;  4AT7 A;  2M2T A;  4K9A A;  4EEB A;  2EAN A;  1PVR A;  2V9W A;  1ZD3 A;  2GH1 A;  2W9B B;  5ALT A;  3KZX A;  3PW0 A;  4P4O A;  3QUB A;  1N2X A;  1XO1 A;  3WK5 A;  1ECW A;  3JYY A;  4DQQ A;  4JMU A;  2W9A A;  2M0N A;  2A1J A;  2AGP A;  1N62 A;  1NZB A;  2W3S A;  2HMX A;  3UMG A;  3MGI A;  8ICE A;  3TAD C;  4E7X A;  2BPG A;  2DRA A;  4XA5 A;  1JIH A;  2VA2 A;  3H39 A;  4NXX A;  1Z00 B;  2GLE A;  2W9B A;  4F5N A;  2W3R A;  5AM0 A;  4PJ0 U;  3PML A;  4J9O A;  4DL5 A;  3M9O B;  7ICF A;  2E8O A;  4GXI A;  3JPR A;  5AI8 A;  2HDO A;  1NK9 A;  3SAH A;  4CRX A;  4O3P A;  2WFA A;  4F8R A;  2DR8 A;  1NK0 A;  4M9L A;  3WK9 A;  1L8L A;  2HSZ A;  5CJ7 A;  1DK2 A;  3C1Y A;  2K60 A;  2KMD A;  4EBE A;  5GTI U;  3PW4 A;  3SEI A;  3DEE A;  1ZOL A;  2ZIX B;  1BNO A;  3AU2 A;  3KOO A;  4QWC A;  4C8K A;  4NLC A;  3M9M B;  3Q8R B;  2FPL A;  4UAZ A;  3GFK B;  2DUY A;  3MGV A;  2WAQ C;  3TFR A;  2OXO A;  1N48 A;  3TAQ A;  5EE3 A;  2A1A A;  2XGP A;  1TK5 A;  3FYH A;  1YT3 A;  1R8B A;  7ICV A;  1F44 A;  3ZD9 A;  3H8S A;  1L3T A;  3BDP A;  3UM9 A;  2YMM A;  4R8U A;  1SKR A;  7ICS A;  1X2I A;  4O3Q A;  5D62 A;  4E80 A;  4RU9 A;  2HHQ A;  4K99 A;  4QZD A;  5H2F U;  2G0A A;  3FAH A;  3QUC A;  4ICA A;  3SYZ A;  5ALP A;  4RT3 A;  5G5G A;  2ZH5 A;  2BPF A;  1J2N A;  4DL2 A;  5F9L A;  5DQI A;  5KFC A;  5B3P A;  3AN1 A;  3NWI A;  3BJY A;  4ZOH C;  2ZXI A;  3HJE A;  2KP7 A;  4F2R A;  3H8W A;  1A77 A;  1O03 A;  3T5J A;  1TAU A;  4WC3 A;  5D49 A;  3NVW A;  1XSP A;  5HRD A;  3RR8 A;  3N7R C;  1DXS A;  5BOL A;  4AT9 A;  5KFU A;  1MC8 A;  4UB8 U;  1QLN A;  3ORY A;  4RQM A;  3L3F X;  3N28 A;  3RJG A;  1IG6 A;  2KFZ A;  4EYH B;  3UMC A;  3PY8 A;  4P0Q B;  4QZI A;  4DOA A;  5ALD A;  4EGW A;  4X4S A;  1JRO A;  2CRX A;  2ASL A;  1NK4 A;  1NO5 A;  1F5S A;  3IV6 A;  5F2V O;  4KLH A;  3KTQ A;  1ZQZ A;  4JWN A;  5KG6 A;  5AHX A;  2G06 A;  5KG3 A;  4UAU A;  9ICM A;  2VA8 A;  5BOM A;  2K89 A;  1L7M A;  1QH9 A;  2EAO A;  5C5J A;  2RDI A;  2HCF A;  4NKT A;  1SWV A;  3VCB A;  2VIX A;  5KFH A;  4FHV A;  5JTG A;  4MFF A;  3BQ7 A;  2KZZ A;  4PHA A;  3QU4 A;  4JB3 A;  4NXU A;  4RNN A;  3ZDA A;  4QW8 A;  3CP8 A;  4I2H A;  2ZUD A;  4XRH A;  1YZ7 A;  3SR6 A;  4DFK A;  4DL6 A;  2B56 A;  5HMM A;  4EEL A;  2M2W A;  3WK7 A;  7ICN A;  4GXK A;  2EQY A;  3M8S A;  1YZ6 A;  3QZ8 A;  1VFG A;  3K75 D;  2HHP A;  4ELV A;  2N1R A;  4YVZ A;  3V7J A;  1L8O A;  2KKP A;  4EED A;  2FJ6 A;  5J0S A;  2KJ9 A;  7ICO A;  5HHI A;  1BPB A;  4B9N A;  8ICI A;  4GXJ A;  2MA1 A;  2FPM A;  4C8N A;  3CRX A;  5J2G A;  1T3Q A;  2E8P A;  5AI0 A;  4DLG A;  2KVS A;  1R89 A;  2MU2 A;  4UB1 A;  4LZD A;  2KVC A;  2LYA A;  5AKZ A;  4KB6 A;  5DED A;  8ICH A;  1Z1V A;  3H3A A;  4Z6E A;  3ALR A;  4FO1 A;  3FDS A;  1TAQ A;  3MR5 A;  2ZJA A;  4ECR A;  2XY5 A;  2YTU A;  1X40 A;  2F1I A;  2H3F A;  4C8M A;  4ECS A;  5J2B A;  9ICG A;  4FZM A;  2JRZ A;  3H38 A;  2ZTC A;  5HRI A;  4AYB F;  2KD1 A;  4DCC A;  4MF2 A;  2L5Y A;  4RQN A;  2K4I A;  4U6P A;  4QWD A;  4Y2J A;  3PR4 A;  4DWI A;  1KNY A;  1HUO A;  3DDH A;  2J6T A;  3OJU A;  1TV9 A;  4RQ7 A;  5CFS A;  4F2S A;  3WKC A;  4KN7 A;  5GTH U;  4YMM A;  1RYR A;  1N5X A;  1ZQB A;  3H4B A;  4Y2U A;  4DQS A;  4YN4 A;  1ZQQ A;  1CI4 A;  4FHY A;  3JPN A;  3L9D A;  5EE1 A;  8ICG A;  4HYK A;  2W54 A;  4KMU A;  4WJ3 B;  2XCA A;  4I2I A;  2K8A A;  3PX6 A;  3G6X A;  4F50 A;  3ETR A;  4PGY A;  5J8Y A;  2ZH9 A;  3LVV A;  1MQ2 A;  3C2M A;  1NJX A;  3EUB 2;  2KEY A;  2RFF A;  5IIJ A;  4Y2Q A;  2YN4 A;  4US9 A;  4IRD A;  2ZH4 A;  4FHX A;  5CEH A;  1WCN A;  5DLF A;  2V4Q A;  4NV0 A;  2BPC A; 
#chains in the Genus database with same CATH homology
 4RQ6 A;  3HWT A;  4FO6 A;  1S9F A;  1ZQO A;  3UXN A;  2JEG A;  9ICI A;  5BPC A;  5HRH A;  3N97 B;  5TZV A;  3BQ1 A;  3LDA A;  3RBD A;  4DSL A;  3BQ2 A;  2HHU A;  4WC1 A;  3V6J A;  3PNC A;  2KTQ A;  1MIV A;  3OVB A;  8ICS A;  1R8A A;  9ICF A;  4TUR A;  2HVI A;  4FH5 A;  1S0O A;  4RZR A;  2LYH A;  5KT7 A;  4ED2 A;  2ZH2 A;  4ELT A;  5J0R A;  5CB1 A;  3V72 A;  3SV4 A;  3UQ0 A;  2KZM A;  1ZQS A;  1NJW A;  4TUS A;  4FBT A;  4QWB A;  9ICN A;  2ZHA A;  1ZQD A;  1F5A A;  4M9H A;  4RWN A;  3RB3 A;  3V6H A;  3HPO A;  4IQT A;  4KLQ A;  1B43 A;  1S76 D;  4ATB B;  3C21 A;  9ICB A;  3MR6 A;  1ZQV A;  3RR7 A;  2WTF A;  3TAN A;  1V9P A;  1XC9 A;  2I9G A;  5J29 A;  7ICM A;  4TQS A;  4GC7 A;  4J9K A;  2FMP A;  4PGX A;  8ICR A;  7ICT A;  9ICU A;  4X4Q A;  3TFS A;  4J9P A;  2BHN A;  5KFD A;  3UPQ A;  4QZ8 A;  4F92 B;  5J2K A;  2MUT B;  3AQN A;  4DEZ A;  3RTV A;  4DLE A;  4P4P A;  3V7K A;  2NRX A;  1Z3E B;  5KFP A;  1NKC A;  5DLG A;  7ICI A;  4YMN A;  9ICC A;  8ICJ A;  3PMN A;  3EWA A;  5DBA A;  5J2J A;  5F9N A;  4R8U B;  3LWM A;  1U47 A;  1KRP A;  1ARO P;  5KFA A;  3RH4 A;  4K4H A;  5CP2 A;  3GDX A;  5KFB A;  4FS1 A;  1L3V A;  3OV7 A;  4RPZ A;  2C2E A;  3H40 A;  1UET A;  3ZDE A;  3NGD A;  1T3N A;  1DOQ A;  2JEI A;  4FBU A;  1SL2 A;  1SKS A;  3OUY A;  4RWO A;  3RJE A;  4DS5 A;  4F4X A;  2UVV A;  1NK7 A;  4MF8 A;  5IIK A;  2XO7 A;  3MBY A;  2JEJ A;  2AGO A;  2BR0 A;  5KFJ A;  4QWA A;  4RPY A;  4ED3 A;  1TFY A;  3V6K A;  4X4R A;  3RH6 A;  4DQI A;  5DG7 A;  3MAB A;  5KFR A;  1ZQJ A;  3N4M B;  8ICV A;  2DR5 A;  2F1H A;  1NK5 A;  4KIT B;  1Q78 A;  5DGA A;  1QSY A;  4ATB A;  5KT5 A;  3GIL A;  5J2E A;  3OJS A;  3THV A;  2IHM A;  4DQP A;  3GV8 B;  4O9M A;  2J6U A;  9ICA A;  3EW9 A;  7ICP A;  3RJI A;  4X4O A;  3AU6 A;  4TQR A;  2HHX A;  3C66 A;  4JUZ A;  1ZQE A;  2MUT A;  4BXO B;  4RUA A;  8ICL A;  4AT9 B;  1BPE A;  3JZ0 A;  8ICX A;  4KLM A;  3RB0 A;  2R8J A;  1FA0 A;  5KFS A;  4UB5 A;  1X9S A;  2UVU A;  4Q45 A;  1ZQG A;  4S3N A;  1T7P A;  4YXM A;  4F4Z A;  1L3S A;  2XC9 A;  3BQT A;  4YXJ A;  3UXP A;  4UBC A;  4KLT A;  4M9G A;  3OHA A;  1VJ7 A;  3MDC A;  1ZJM A;  4BWM A;  4R65 A;  2IHN A;  1K1S A;  9ICV A;  5HC9 A;  3TQ1 A;  4YG2 A;  4Z6F A;  3Q8Q B;  4ECT A;  2JZB B;  5KFL A;  1JXE A;  4CCH A;  5KFN A;  5DG8 A;  4M9J A;  1ZQL A;  1JMS A;  2ZUB A;  3UXO A;  1SL1 A;  2BCU A;  2Q0Z X;  4QZE A;  4B9S A;  9ICE A;  5EWE A;  4LT6 A;  3AQK A;  1BVS A;  4QZ9 A;  3RJH A;  1BPX A;  1KFT A;  1BNP A;  4RWP A;  2OWO A;  3PO5 A;  5DDY A;  1K1Q A;  3E2E A;  1Y88 A;  1BPY A;  2DR7 A;  5CWR A;  4YQW A;  4EP7 A;  4JK1 A;  2H5X A;  2ZUC A;  2ZH4 A;  2M2V A;  3UQ2 A;  4YD1 A;  4KLO A;  3QE9 Y;  3RBE A;  1UA1 A;  4RQ5 A;  2FLP A;  4RPX A;  4EZ9 A;  2M2T A;  4AT7 A;  4NKU A;  4XQ7 A;  4WCW A;  5KT4 A;  3PR5 B;  3QEB Z;  1JN3 A;  2V9W A;  4JV2 A;  9ICL A;  5HRB A;  1IXR A;  3JPQ A;  2W9B B;  3ZDD A;  3WFO A;  4IQV A;  5KFO A;  5KFE A;  1NOM A;  4DS4 A;  3Q8P B;  3OHB A;  3PW0 A;  1TK0 A;  4P4O A;  2KZ3 A;  1ZQW A;  2W8K A;  7ICE A;  4I2E A;  4IG8 A;  4EZ6 A;  2ZH6 A;  5L1L A;  1XO1 A;  1CUK A;  3HX0 A;  2XGQ A;  3RJK A;  2M2U A;  4YMO A;  2FMS A;  3C5F A;  2V4R A;  7ICK A;  2ZH3 A;  1BPZ A;  2XY7 A;  3LWL A;  5J0U A;  4DL3 A;  5DB8 A;  4QZC A;  2W9C A;  4DQQ A;  2W9A A;  4JWM A;  3JYY A;  8ICU A;  2UVR A;  1TVA A;  4PHD A;  2A1J A;  2AGP A;  1UT8 A;  4DSF A;  1SKW A;  5J0Y A;  4MEX A;  3TAR A;  4EBJ A;  2NRK A;  4F3O A;  4X0A A;  4DF8 A;  8ICC A;  3WFQ E;  7ICU A;  1D9D A;  1T8E A;  1PX5 A;  3RAQ A;  5EWG A;  3MGI A;  1ZQM A;  1ZYQ A;  8ICE A;  3EYZ A;  3OVS A;  3Q8L A;  1KFS A;  3PVX A;  2R8H A;  4YR0 A;  4F5R A;  4EBK A;  4E7X A;  2BPG A;  2DRA A;  2ZH7 A;  4XA5 A;  2F1J A;  9ICR A;  5DGB A;  4UAY A;  1JIH A;  3H8J A;  1NJY A;  2VA2 A;  4F5P A;  4Z6C A;  4RQ3 A;  4MFC A;  3H39 A;  7ICQ A;  4DFJ A;  4M2Y A;  4YD2 A;  4KLU A;  1Z00 B;  5L1J A;  2W9B A;  3GIK A;  8ICF A;  4F5N A;  5KFI A;  5KG2 A;  4E0D A;  5DB6 A;  3ETL A;  3PML A;  4J9O A;  4DL5 A;  3RJJ A;  3MGH A;  3M9O B;  2DPI A;  7ICF A;  4GXI A;  2PI5 A;  5D4B A;  4I29 A;  3JPR A;  4O3R A;  3NTU A;  2C2R A;  3RRH A;  1NK9 A;  3OSP A;  2BDP A;  4RUC A;  5HRL A;  4F5Q A;  5DKW A;  2PFO A;  4UD4 A;  4O3P A;  8ICO A;  4QZF A;  5CR0 A;  4DFM A;  4F8R A;  2DR8 A;  3PW2 A;  4X5V A;  4J9N A;  1NK0 A;  4M9L A;  4DL4 A;  5DQG A;  4WC5 A;  1L5U A;  5CJ7 A;  2B21 A;  4J9M A;  4UB4 A;  1X9M A;  3C1Y A;  1DK2 A;  5KFY A;  4NLK A;  1KTQ A;  2R8I A;  4EBE A;  4I2B A;  1JQR A;  2P66 A;  3ZD8 A;  3T3F A;  1NKE A;  4WC7 A;  1ZQH A;  3PW4 A;  4WC2 A;  3RJF A;  8ICK A;  3C23 A;  4O5K A;  3AU2 A;  5KFV A;  3Q8K A;  1BNO A;  2BQ3 A;  1DK3 A;  2ZH1 A;  4B9U A;  1A76 A;  4QWC A;  4C8K A;  4IRK A;  3LK9 A;  3M9M B;  3HW8 A;  1CEZ A;  3Q8R B;  9ICJ A;  2FPL A;  5KFX A;  4UAZ A;  4WC0 A;  4ZH4 A;  1ZQN A;  2MAX A;  4WBZ A;  7ICL A;  3RB6 A;  8ICT A;  5HRG A;  1T4G A;  1U49 A;  3ZDB A;  4ECY A;  4WC6 A;  3GFK B;  4F4K A;  5L9X A;  4KTQ A;  3HJ1 A;  3PW5 A;  5J2D A;  3TFR A;  5KFT A;  1ZQF A;  4NY8 A;  2BKE A;  1S10 A;  5J0P A;  4ECQ A;  2IA6 A;  4J9Q A;  4DO9 A;  1ZJN A;  1NJZ A;  1N48 A;  3V7L A;  9ICH A;  3JPO A;  1U9L A;  4NM1 A;  2HHV A;  9ICW A;  5DEC A;  2NRW A;  4IQW A;  3TAQ A;  5JUM A;  2ZTD A;  4RQ0 A;  2XGP A;  1TK5 A;  3FYH A;  1S0N A;  3GIM A;  1QSS A;  2GWS A;  1R8C A;  1R8B A;  5EOZ A;  4KLG A;  8ICZ A;  2HHT A;  7ICV A;  3ZD9 A;  3G6Y A;  4X4V A;  1COO A;  2AU0 A;  9ICQ A;  3WFR E;  3H8S A;  1JXL A;  4X4T A;  1S77 D;  4RQ8 A;  2AGQ A;  3OGU A;  2AQ0 A;  1L3T A;  1ZQK A;  3BDP A;  8ICW A;  9ICO A;  4DF4 A;  2IBK A;  1SKR A;  4R8U A;  4DSE A;  4DL7 A;  1UEU A;  2ZJ5 A;  3Q8M A;  7ICS A;  3QEA Z;  2BGW A;  4I2C A;  1X2I A;  4O3Q A;  3C18 A;  4E80 A;  5KTQ A;  4RU9 A;  2HVH A;  3K4G A;  5IIL A;  5III A;  3PV8 A;  1L3U A;  4B9L A;  2VAN A;  4Z6D A;  2PI4 A;  2HHQ A;  5DQH A;  4B9M A;  4I28 A;  4QZD A;  5L1I A;  2ISP A;  4IRC A;  4QZH A;  8ICY A;  5DBB A;  4QW9 A;  4UB3 A;  5KG4 A;  5J2A A;  5J2C A;  1KFD A;  2C22 A;  3SYZ A;  1U48 A;  4RT3 A;  1ZQI A;  8ICQ A;  2ZH5 A;  2BPF A;  4DL2 A;  2NRZ A;  4BWJ A;  2O5A A;  1D8Y A;  5J0W A;  5F9L A;  5DQI A;  4I2G A;  5KFC A;  5DDM A;  4QZB A;  4FHW A;  4XUS A;  3BJY A;  4DSI A;  1TK8 A;  4DSK A;  4F2R A;  2W9M A;  2KP7 A;  4NLG A;  4X4U A;  3H8W A;  1A77 A;  5J0X A;  3T5J A;  4NLN A;  1TAU A;  1KSP A;  1MIY A;  5D49 A;  3ISD A;  4WC3 A;  1XSP A;  3MR2 A;  5HRD A;  4M6W B;  5KFQ A;  4ECZ A;  5HML A;  5BOL A;  3PO4 A;  4BXO A;  3RR8 A;  4AT9 A;  5KFU A;  3GIJ A;  1D9F A;  3G6V A;  5IIO A;  4ELU A;  1MC8 A;  1QLN A;  3HJ4 A;  2I1Q A;  4Q8E A;  3T5L A;  5HR9 A;  2M9N A;  1XWL A;  3ORY A;  3BQ0 A;  2ID1 A;  4ED6 A;  3RJG A;  5DBC A;  2KFZ A;  3H7I A;  4EYH B;  1OU5 A;  4YR2 A;  5HHH A;  3AQM A;  4PH5 A;  3PY8 A;  1D8L A;  4QZI A;  4DOA A;  3MFI A;  4X4S A;  2PBE A;  4NXZ A;  1KLN A;  2DR9 A;  4UD5 A;  2NRV A;  4GC6 A;  2XY6 A;  2ASL A;  5D46 A;  2JZB A;  4FS2 A;  1NK4 A;  3C2K A;  1NO5 A;  5F2V O;  4Q43 A;  3JPS A;  4KLH A;  4DSJ A;  3MR3 A;  4MFA A;  2DVI A;  3JPP A;  3KTQ A;  1ZQZ A;  4YR3 A;  4R63 A;  2HHW A;  4BGD A;  1MIW A;  4JWN A;  5KG6 A;  5KG3 A;  3WFS C;  4X0B A;  1KEJ A;  2BE3 A;  9ICM A;  2VA8 A;  5KT3 A;  5BOM A;  2ATL A;  4E8F A;  5J0Q A;  1ZQA A;  5C5J A;  4KLJ A;  2RDI A;  4NKT A;  5KFM A;  4RNO A;  1JX4 A;  4RT2 A;  1TKD A;  5KFH A;  4FHV A;  3IHQ B;  1XSN A;  1RYS A;  2PFQ A;  2R8K A;  4MFF A;  2KZZ A;  4LVS A;  1MSW D;  4MEY A;  2FPK A;  4PHA A;  2BCQ A;  4EEY A;  2VA3 A;  4RNN A;  3ZDA A;  4QW8 A;  4I2H A;  5CHG A;  5KT6 A;  4UQG A;  2ZUD A;  4R64 A;  4C8L A;  4NLZ A;  4XRH A;  2BCS A;  1HUZ A;  4X4N A;  4EBD A;  4TUQ A;  4DFK A;  4DL6 A;  5KFW A;  4J9S A;  3HP6 A;  4UBB A;  1QTM A;  1JAJ A;  3GII A;  2ISO A;  4FHP A;  5HMM A;  2M2W A;  3TI0 A;  2BCV A;  4P4M A;  4ED0 A;  4KN4 A;  2W8L A;  1RPL A;  7ICN A;  2FMQ A;  1H38 A;  7ICR A;  4GXK A;  5EWF A;  3HT3 A;  1S97 A;  3M8S A;  3ISC A;  3B0X A;  1ZQC A;  2JEF A;  3QZ8 A;  3OUY B;  1VFG A;  4F4Y A;  4PPX A;  3K75 D;  5CA7 A;  1S0M A;  4ELV A;  2HHP A;  5IIM A;  4DFP A;  4IR1 A;  3C2L A;  3TAP A;  1BGX T;  4YVZ A;  3ISB A;  3V7J A;  2ALZ A;  4B9V A;  1TFW A;  2Q66 A;  4X4P A;  4YCX A;  1SL0 A;  5J0S A;  5J2H A;  1V4A A;  4M5D A;  3OVA A;  4JV0 A;  4RNM A;  3KHH A;  4K4I A;  7ICO A;  1RXW A;  4IQU A;  5HHI A;  1BPB A;  4PGQ A;  1ZQR A;  4ED7 A;  4B9N A;  1ZET A;  4GXJ A;  8ICI A;  4DOB A;  1ZQX A;  2FPM A;  3IM1 A;  4C8N A;  7ICJ A;  4J9L A;  1ZQY A;  5J2G A;  3SI8 A;  5HNK A;  2J6S A;  1Q79 A;  4O3O A;  4DLG A;  4M04 A;  5HRK A;  2ZJ8 A;  5KFK A;  1Z00 A;  1R89 A;  4I2A A;  2O1P A;  4UB1 A;  1C7Y A;  1XS9 D;  3T5H A;  3T5K A;  5HRF A;  5IIN A;  4LZD A;  3KHR A;  3PX4 A;  9ICK A;  1S0V A;  2XCP A;  3OSN A;  4GLX A;  4YFK A;  5DED A;  8ICH A;  3M9N B;  2AQ4 A;  5DB9 A;  4RQ1 A;  3H3A A;  4DQR A;  4Z6E A;  2ZH8 A;  4ECV A;  2P6R A;  1IM4 A;  3M8R A;  1U4B A;  3KHL A;  5J0O A;  3ZDC A;  3QZ7 A;  4O5E A;  4RQ4 A;  2KFN A;  3HIY A;  5KFZ A;  4DOC A;  4I2D A;  4F4W A;  3AUO A;  3FDS A;  3RAX A;  4RQ2 A;  1PZN A;  1TAQ A;  1EXN A;  4PHE A;  3MR5 A;  3GV5 B;  1XSL A;  4UAW A;  1LV5 A;  4ECX A;  2ZJA A;  5KG0 A;  4KLL A;  4G3I A;  3GV7 B;  9ICP A;  5KG5 A;  2ZHB A;  4ECR A;  2XY5 A;  1N56 A;  5J2I A;  4FH3 A;  9ICS A;  2F1I A;  2R8G A;  4C8M A;  3SV3 A;  4UB2 A;  5J2B A;  4ECS A;  2C28 A;  4KLD A;  2PFP A;  2P6U A;  3PX0 A;  4KLF A;  1HJP A;  8ICP A;  4AT8 B;  3LQC B;  3KHG A;  3H38 A;  2ZTC A;  8ICN A;  5DG9 A;  4Q8F A;  4QWE A;  2BQR A;  5HRI A;  1UT5 A;  1X9W A;  4AT7 B;  1UEV A;  2DRB A;  2RDJ A;  3H4D A;  4M9N A;  1MQ3 A;  4MF2 A;  4DWI A;  4QWD A;  3PR4 A;  2DPJ A;  1KNY A;  4P2H A;  4F93 B;  2KN7 A;  3UPS A;  4R66 A;  5HP4 A;  1NK8 A;  1ZQP A;  1YLQ A;  1HUO A;  2HW3 A;  2J6T A;  5J2F A;  1NK6 A;  2C2D A;  1BPD A;  3OJU A;  4EBC A;  4KLS A;  8ICA A;  5L1K A;  4M0A A;  3PW7 A;  3EPG A;  1TV9 A;  1QSL A;  4RQ7 A;  3WFP A;  3AQL A;  4F2S A;  5DB7 A;  4IR9 A;  1SZP A;  4KLE A;  1WCL A;  4ECW A;  3C5G A;  2ZTE A;  4KN7 A;  2FLN A;  1WOT A;  3JPT A;  9ICG A;  4NM2 A;  4YMM A;  5KT2 A;  4YP3 A;  1NKB A;  5KG1 A;  2W9C B;  1RYR A;  1ZQB A;  4J9R A;  4XQ8 A;  3H4B A;  3RRG A;  2DFL A;  9ICX A;  2A1J B;  4PHP A;  4ED1 A;  4DQS A;  4O5C A;  4O3S A;  4TUP A;  2ASD A;  4YN4 A;  5KFF A;  8ICB A;  3Q8S B;  1NZP A;  1ZQQ A;  4RWQ A;  4FHY A;  1U45 A;  3JPN A;  3MFH A;  4LZG A;  3L9D A;  4F91 B;  7ICG A;  8ICG A;  1RXV A;  4HYK A;  1KDH A;  4KMU A;  1DGS A;  4ECU A;  4WC4 A;  4AT8 A;  8ICM A;  4QZG A;  4C8O A;  2XCA A;  4I2I A;  2PXI A;  4F5O A;  4K4G A;  4I27 A;  4M47 A;  1B22 A;  3PX6 A;  3G6X A;  4F50 A;  4PGY A;  3EZ5 A;  2Y1I A;  4QZA A;  1XU4 A;  4WBY A;  2ZH9 A;  5J0T A;  2BCR A;  4O3N A;  4JV1 A;  1MQ2 A;  1ZQU A;  3C2M A;  3GQC A;  1NJX A;  4B9T A;  4KLI A;  2Y1J A;  7ICH A;  2RFF A;  2HHS A;  5KFG A;  5IIJ A;  3NYB A;  2NRT A;  3MDA A;  3B0Y A;  3C1Z A;  4IRD A;  3EPI A;  4M6W A;  2IMW P;  2AJQ A;  2ASJ A;  3SZ2 A;  2PFN A;  4FHX A;  4EYI B;  4I2F A;  3RH5 A;  5HRE A;  1ZQT A;  2FLL A;  1LB2 B;  2BQU A;  2UVW A;  4BDP A;  9ICT A;  4ED8 A;  1RZT A;  1WCN A;  3RB4 A;  4I2J A;  1TFR A;  5KG7 A;  4O0I A;  4Q44 A;  5DLF A;  2V4Q A;  1UA0 A;  3H37 A;  2BPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...