4KLUA

Dna polymerase beta mismatched product complex with mn2+, 15 h
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
325
structure length
322
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Observing a DNA polymerase choose right from wrong.
pubmed doi rcsb
molecule keywords DNA polymerase beta
molecule tags Transferase, lyase/dna
source organism Homo sapiens
total genus 106
structure length 322
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4kluA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4kluA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4kluA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4kluA03
5DECA 5CWRA 5KT6A 4QWBA 2FLPA 1ZYQA 3H39A 4RQ1A 5HRIA 2PI5A 4DSFA 4J9OA 2DR9A 3IHQB 2DVIA 1XC9A 3RRHA 5L1IA 8ICLA 2NRKA 3RBDA 5DGAA 4BXOB 1KLNA 4E7XA 5KFNA 4IR9A 7ICGA 2FLNA 3PY8A 3GDXA 1BVSA 4J9KA 7ICMA 3H4BA 5HP4A 1JX4A 1DGSA 1ZQPA 1Z00B 3AUOA 3MGHA 4BDPA 4I2FA 4RT3A 2HHWA 1UEUA 4ATBA 2ZUCA 8ICHA 2W9BA 2IA6A 2Y1JA 3H4DA 1VJ7A 3WFRE 2VANA 5DLGA 4ED1A 4I2AA 4C8NA 3JPSA 4J9MA 4ECSA 4JWMA 3C1YA 4FHXA 5J2KA 4MFFA 5KG3A 4YG2A 1QLNA 4YR0A 2XGQA 1ZQDA 4RZRA 4EBKA 1ZQFA 3QZ7A 5DQHA 1S76D 4EYHB 1T4GA 4LZGA 1R8AA 4FBUA 3PR4A 1Q78A 2XGPA 1S97A 5J0SA 2ZHBA 3ORYA 3ISBA 9ICRA 4DSIA 4F92B 5KFQA 2ZJ5A 1R8BA 3C2MA 4UD4A 1ZQEA 3EZ5A 1ZQBA 9ICXA 1ZQTA 1B43A 4RWQA 5KFMA 4IQTA 4UB2A 3JPNA 5KFEA 5EOZA 4QZ8A 4EZ6A 4I2EA 4P2HA 5KG7A 4RPYA 1TVAA 3V7KA 4GC7A 4RPZA 3RB0A 3RJJA 2P6UA 1Q79A 5KG0A 3ZDDA 4JV2A 5DG8A 5EWGA 4EBCA 4FO6A 3SZ2A 2AJQA 4F4KA 2O1PA 4Q45A 5HC9A 3M9MB 4KLEA 5KFJA 5EWEA 2KFNA 4RNNA 3BQTA 9ICAA 1NOMA 9ICJA 4BGDA 3C2KA 2BCVA 4EBDA 3EPGA 2HHTA 4IQVA 4Q44A 1TK0A 4M2YA 5DGBA 2Q0ZX 2RFFA 3NTUA 4XQ7A 4DF8A 4ECYA 9ICNA 5IINA 3HJ1A 4MF8A 1T3NA 1ZQNA 4QWCA 2C22A 7ICTA 5HHIA 4KLMA 1MIYA 1UA0A 5BOMA 1UEVA 1SKWA 2HHSA 1X9WA 2JEFA 2PBEA 3OVBA 1S0NA 5KFIA 4ELVA 4QZAA 4FS1A 7ICUA 4F3OA 4O5KA 1S0VA 4ED7A 1TFYA 4QWEA 4DOCA 4P4MA 1X2IA 1S10A 3OV7A 3PV8A 3GQCA 4O3PA 8ICYA 2M2VA 4E80A 7ICPA 4F5NA 5J29A 4XUSA 5KT3A 4PGQA 4PHDA 1XSNA 4O5EA 4NLKA 4YP3A 4FHWA 3B0XA 5DKWA 2KZMA 1JXEA 4ECUA 4I27A 1JQRA 4KITB 7ICIA 2MAXA 4IRCA 2AGQA 1NJWA 4YD1A 3G6XA 2PI4A 3PW2A 5J0XA 1MQ3A 5J2EA 3PW7A 4I2GA 1KFTA 9ICUA 3JZ0A 1MQ2A 1ZQCA 5CA7A 1L3SA 4GXKA 5KG4A 3RB4A 1S9FA 4KLUA 2XC9A 3RAXA 4KLGA 4PPXA 3AQLA 2ZH9A 3OUYA 7ICQA 5DBCA 3MABA 4O5CA 4KLDA 9ICOA 4JK1A 4P4OA 3C23A 5KTQA 1JIHA 4UB5A 1NK7A 5HMMA 5D49A 3GIMA 3FDSA 4ECXA 4NM1A 2BE3A 2ZJAA 4FHVA 2JZBB 2WTFA 5KG1A 4TUQA 2W8KA 2ZH1A 5L9XA 4R65A 2AQ0A 5DB8A 4DWIA 5BPCA 1SL1A 3RTVA 4RNOA 4S3NA 2OWOA 3QEBZ 1XWLA 2ZTEA 5KFWA 4RQ5A 8ICIA 1NO5A 4WC1A 9ICIA 4UAYA 5F9LA 9ICEA 4BWJA 3ETLA 8ICZA 2JEGA 3UXOA 4ECRA 4M9NA 4DQRA 2ZUDA 5KG6A 5L1KA 3UQ0A 5HMLA 1BPDA 5CHGA 1U45A 1OU5A 5KFTA 4RQ7A 3PMLA 1R89A 2ZTCA 1A77A 4DQQA 5CJ7A 3PW4A 3SV3A 3G6YA 9ICLA 5KFYA 5KFVA 4RUCA 4F4YA 3ZD8A 2C2EA 3ZD9A 4RNMA 2MUTA 4EYIB 3GIJA 3PX6A 2PFNA 1DK3A 5IIKA 5J2CA 1JMSA 4J9QA 4QZCA 4M9LA 5DBAA 2BDPA 5J2AA 4Q8FA 1B22A 5DDYA 2HHPA 3C18A 4QZBA 3MGIA 3RAQA 3T3FA 4GLXA 4YVZA 4YQWA 2W9CA 5HR9A 9ICWA 3RB6A 2ASJA 2F1IA 1NJZA 4HYKA 2AGOA 4UB3A 3OHBA 4MEXA 5HRKA 1KFDA 1XSPA 5J0RA 2IHNA 1YLQA 1ZQRA 4E8FA 3TI0A 4DOAA 2W9MA 4CCHA 7ICFA 2KN7A 5KFKA 4KLOA 4DFPA 2VA3A 4YR2A 2R8KA 4QW8A 1ZQWA 2I9GA 4NLZA 5KFPA 9ICVA 4ECZA 3Q8MA 3C5GA 8ICJA 4F5OA 1T7PA 8ICFA 2ZJ8A 4FBTA 7ICVA 8ICQA 4O0IA 2HHVA 4YCXA 4DL5A 3H37A 4AT7B 2FPMA 2ZH8A 4J9SA 3JPTA 3M8SA 1ZQLA 3Q8SB 5HRLA 4PGXA 2RDIA 4QW9A 4Q43A 4J9LA 3MR2A 9ICMA 3PVXA 3OVAA 5KFOA 1A76A 3H7IA 4IQUA 4RQ8A 2UVVA 7ICOA 2W8LA 3HT3A 5J2DA 2J6UA 4RT2A 4DL7A 2W9AA 1QSYA 2KZ3A 3C1ZA 5KFRA 2HVHA 3M8RA 4DQPA 3GFKB 5KT5A 3M9NB 5C5JA 1NK0A 5L1LA 3UXPA 2BCRA 4JV1A 4M0AA 2HW3A 2ZH4A 1KEJA 4DS4A 8ICEA 5KFAA 9ICBA 5KFFA 4KMUA 1U49A 8ICXA 4AT8B 2R8HA 1K1QA 2ZH5A 1VFGA 3WFOA 5HHHA 3H40A 1T8EA 1BPBA 5CR0A 3SV4A 4DQSA 3AU2A 5J0PA 3RH5A 1XSLA 1U4BA 3H8JA 4RPXA 4GC6A 2KTQA 2Q66A 4EZ9A 3NYBA 4WC2A 4R8UB 4QZEA 2ZTDA 3C2LA 5J0QA 1ZQVA 4Z6CA 5J2JA 4KLTA 4YR3A 4DLGA 4B9MA 1PZNA 3C66A 2DPIA 3BJYA 4UAWA 4DSEA 4NKTA 3HWTA 3ZDAA 2V9WA 3OJSA 4F5RA 2NRWA 3N4MB 4C8LA 4F8RA 2F1JA 4X4PA 1S0MA 8ICUA 4RQ2A 4IG8A 4UQGA 3ISDA 3QZ8A 1QSSA 4M9GA 4KLJA 1BPEA 1DK2A 3PX0A 4BXOA 3C5FA 4UBBA 3RJFA 2DR5A 1NK4A 5EWFA 3HPOA 4GXIA 1RYSA 2DRBA 2P6RA 4F5QA 4ED6A 4AT7A 1Z00A 4F93B 4JUZA 1IXRA 3GV5B 4UD5A 4X4VA 3LDAA 4J9PA 1JXLA 3V7JA 2J6TA 3PO4A 2M2TA 4X0BA 3PW0A 1BNOA 4QZ9A 4KLHA 4RUAA 2C2RA 1NK9A 1QSLA 4WBZA 4F4WA 3RH4A 4IQWA 4X4OA 3JPOA 9ICKA 1NZPA 4DOBA 3HIYA 4RWOA 1ZQYA 2FPLA 2M9NA 1ZQOA 5J0UA 4AT8A 1RZTA 4EP7A 3RJEA 4UBCA 4WCWA 4F4XA 4EEYA 2M2UA 3TFSA 1MSWD 8ICWA 4I2IA 4F50A 1AROP 2BCUA 3TFRA 1V4AA 3HJ4A 2ASLA 1TK5A 3ZDCA 1K1SA 4M6WB 3KHLA 4IRKA 2ID1A 4K4GA 2H5XA 4QZIA 4DQIA 4YN4A 3PX4A 3EWAA 1SKRA 7ICSA 1L3UA 1XS9D 4X4TA 4KLFA 5J0WA 3B0YA 4ZH4A 3ISCA 1H38A 2PFOA 4DSKA 3LK9A 7ICKA 1ZQIA 9ICGA 3H3AA 1X9SA 1HUZA 4MFAA 3RJHA 4M04A 4ECVA 2XCPA 4R64A 3GV8B 1NJXA 3E2EA 8ICOA 2B21A 1KFSA 7ICRA 1ZQXA 3OHAA 2IMWP 4B9UA 1F5AA 3WFSC 2NRZA 3C21A 4M5DA 1NK5A 4IR1A 4X4UA 1KNYA 2BPGA 2HHUA 2P66A 3QEAZ 4K4HA 4X0AA 5HNKA 1XO1A 1WOTA 3JPQA 1ZQHA 3V6HA 9ICFA 4DL4A 4EBJA 1ZQGA 4NKUA 1NKBA 3UPSA 4I2JA 2BHNA 4ECQA 9ICHA 4RWPA 3PMNA 5F2VO 1UETA 3BQ0A 2KFZA 8ICKA 4PH5A 4LT6A 4FHYA 4DFMA 4NLNA 4EBEA 2BGWA 2JEIA 1N48A 4X4QA 4ED0A 4I2BA 4DLEA 3T5KA 4DFKA 5KFCA 3AQKA 1ZJNA 2AGPA 3JPRA 1R8CA 4JV0A 1N56A 4AT9B 1V9PA 1ZQAA 3UXNA 2C2DA 3RJGA 4JWNA 4O9MA 7ICJA 4ECWA 9ICTA 3LWMA 4DL6A 3WFQE 3V6KA 1XU4A 4FHPA 3K4GA 2XY6A 2XO7A 4M9JA 2LYHA 2W9BB 3OJUA 1SL0A 4B9TA 4C8KA 3TAQA 9ICCA 5HRGA 2BKEA 4LZDA 4RQ3A 5CP2A 5DG9A 3HW8A 3RBEA 5KFXA 2ASDA 1UA1A 3OGUA 1S0OA 8ICRA 4WC4A 2GWSA 4WC0A 2JZBA 4TQRA 4GXJA 4YMNA 4Z6EA 2NRVA 1RPLA 4XA5A 3KHGA 3V6JA 1D8YA 2DRAA 4C8OA 4DSJA 4QZDA 1PX5A 1CEZA 1NJYA 1RXWA 4X4RA 1Z3EB 5TZVA 4TUPA 5HRHA 4TUSA 1ZQJA 2Y1IA 2RDJA 2IHMA 8ICGA 4WC3A 5KFSA 4DL2A 1NK6A 4MFCA 2I1QA 4YMOA 3ZDBA 4E0DA 3TAPA 2DR8A 3GILA 2F1HA 1BNPA 4YXJA 2BPCA 4FH3A 3OVSA 4Z6DA 3RR7A 5HREA 1TFWA 4QWAA 4DF4A 2FLLA 3PNCA 2IBKA 2FPKA 3QE9Y 4B9SA 4YFKA 1MC8A 1UT5A 2KP7A 2PFQA 3T5JA 1LV5A 3HP6A 5IILA 3SYZA 1X9MA 1FA0A 1L3TA 3PR5B 5DDMA 4WC5A 1SKSA 4AT9A 1ZQUA 3LQCB 5DQIA 1UT8A 1CUKA 3FYHA 2AU0A 4J9NA 4DEZA 2V4RA 3NGDA 5D4BA 4M9HA 1S77D 7ICEA 4FH5A 2C28A 5KT2A 1ZQKA 5HRDA 4DL3A 8ICMA 3MFIA 3H8WA 4UB1A 2ZH3A 3MR3A 2V4QA 1U9LA 8ICBA 2HHQA 2KZZA 4Q8EA 3BQ1A 4NM2A 3AU6A 3OSPA 2BQRA 4PGYA 1HJPA 1JAJA 2A1JB 4Z6FA 5JUMA 4G3IA 2ZH7A 2FMQA 2ISPA 3RH6A 2NRXA 1QTMA 5D46A 2XY5A 1ZJMA 3JYYA 3L9DA 5KFDA 2ATLA 2FMSA 3Q8PB 3WFPA 2BQUA 3T5LA 4O3SA 5HRFA 2DFLA 3MR6A 4KN7A 3K75D 4K4IA 3EW9A 5J0TA 1RXVA 5DBBA 1IM4A 4NLGA 8ICVA 5DQGA 1SL2A 3H38A 2BPFA 3OUYB 4BWMA 1BPYA 1MIWA 3SI8A 4ELTA 9ICQA 4RWNA 4P4PA 3AQNA 5DEDA 5KT7A 1D9DA 4XRHA 3G6VA 2BR0A 1LB2B 2UVWA 4XQ8A 4F2RA 4RQ0A 4UAZA 4ECTA 4J9RA 1KRPA 1JN3A 5IIMA 1COOA 4QZHA 8ICSA 4X5VA 2ZH2A 5J2HA 1C7YA 2BQ3A 4O3RA 4RQ4A 3UPQA 8ICNA 3IM1A 3T5HA 7ICLA 1ZQZA 4R8UA 1WCLA 1NKCA 1KDHA 4ELUA 4PHAA 3BQ2A 1U48A 5F9NA 4MF2A 3TARA 4RQ6A 1ZQQA 3MBYA 3AQMA 2BCQA 3V72A 4ED8A 3RJKA 4QWDA 2ALZA 2ZHAA 3M9OB 4I2HA 2A1JA 4FS2A 4ED3A 3BDPA 3JPPA 4F2SA 2VA2A 4WBYA 1EXNA 3MDAA 5IIOA 4I28A 1TAUA 8ICTA 1D8LA 5IIJA 3GV7B 4O3QA 3GIIA 2JEJA 8ICCA 7ICNA 2MUTB 5J2GA 4TQSA 4M47A 3Q8KA 8ICPA 2HHXA 3KTQA 4WC6A 4RU9A 1TAQA 3MR5A 5DLFA 3TQ1A 1BPZA 2ISOA 3RJIA 3PO5A 2HVIA 4WC7A 1ZQSA 4KTQA 5BOLA 2ZH6A 1SZPA 5CB1A 2W9CB 2R8GA 3N97B 1TFRA 4YD2A 1WCNA 3OSNA 4F91B 2M2WA 3RRGA 5KFUA 4DSLA 4KLSA 4O3OA 4DS5A 4KLQA 1DOQA 1BGXT 3KHRA 4KLLA 5KG2A 5KFHA 2R8JA 2DPJA 3LWLA 2XCAA 1KSPA 5DG7A 4C8MA 4UB4A 1L5UA 5KFZA 4MEYA 2UVUA 4DFJA 3GIKA 2O5AA 3Q8QB 4B9VA 5KT4A 1RYRA 4B9LA 5J0YA 3V7LA 5J2IA 5IIIA 5HRBA 8ICAA 4I29A 4PHEA 2FMPA 1KTQA 2DR7A 5KFBA 1TK8A 4LVSA 3PW5A 1Y88A 5KG5A 4R63A 4X4SA 3TANA 4NXZA 5KFGA 2UVRA 4DO9A 4M6WA 2PXIA 4O3NA 1NKEA 4ATBB 3Q8RB 3UQ2A 1U47A 2NRTA 4F4ZA 3ZDEA 1HUOA 4QZGA 5DB7A 4KN4A 1BPXA 4KLIA 5J2BA 4ED2A 3KHHA 2ZUBA 2VA8A 9ICPA 2R8IA 5DB6A 3HX0A 2AQ4A 4B9NA 3EYZA 4R66A 1D9FA 3MFHA 3RB3A 2PFPA 5L1JA 4I2CA 1MIVA 4X4NA 3MDCA 5J2FA 4I2DA 3H8SA 4TURA 4F5PA 5J0OA 3THVA 2XY7A 2BCSA 4IRDA 3Q8LA 4YXMA 1ZQMA 4PHPA 4YMMA 9ICSA 5DB9A 3EPIA 1ZETA 1NK8A 1L3VA 4NY8A 3RR8A 7ICHA 2J6SA 5KFLA 1TV9A 1TKDA 4QZFA
chains in the Genus database with same CATH superfamily
5CWRA 5KT6A 3H39A 4RQ1A 5HRIA 4J9OA 1XC9A 2XVTA 5L1IA 3O0FA 5KFNA 3PY8A 2NO5A 1DGSA 4I2FA 3AUOA 3CW2C 1SB3C 8ICHA 1V85A 3H4DA 2EQYA 4FHXA 1ZOLA 1JUDA 1T4GA 1S97A 3RF9A 3OPXA 3CYMA 3C29A 2HN1A 4JMUA 2BBHA 2QB0A 2ZJ5A 2JR5A 3C2MA 1ZQEA 2AHOB 2JRZA 2KIVA 5B3QA 5EOZA 4OJPA 2RHFA 2YN4A 1TVAA 3V7KA 2ES6A 2P6UA 4OO1J 3ZDDA 1ZD5A 5HC9A 2KFNA 2FJ6A 2BCVA 2HHTA 3EPGA 1TK0A 2LPEA 4DF8A 1XO0A 1T3NA 1ZQNA 2GO7A 4QWCA 2C22A 1UEVA 4KLMA 2WAQF 5BOMA 1UA0A 1S0NA 5KFIA 3MGVA 4FS1A 4F3OA 1ZD3A 3GQCA 8ICYA 3WKBA 2M2VA 7ICPA 4PHDA 4YP3A 1JQRA 4PL2A 3D2NA 5AKJA 5J0XA 1L7MA 9ICUA 1CI4A 4KLUA 4GXKA 5ALLA 4JB3A 3AQLA 3RAXA 2ZH9A 2NO4A 3MABA 4O5CA 4UB5A 2LM1A 5KG1A 2B56A 3VC8A 5BPCA 1SL1A 3RTVA 1X40A 4EX7A 2OWOA 3NVVA 9ICIA 4UAYA 3QUQA 9ICEA 4NXTA 2ZTCA 2DQNB 1A77A 4DQQA 5CJ7A 3PW4A 2HBLA 3G6YA 2EDUA 3EUB2 1N63A 3I1YA 4O69A 2HHPA 3C18A 3T3FA 4YQWA 2W9CA 3D2QA 1Q3UA 1VDVA 2AGOA 4UB3A 2A1AA 2H3IA 1XSPA 1ZQRA 3BZKA 2W9MA 2E3TA 3ZI4A 4KLOA 4DFPA 5AI0A 4YR2A 4NLZA 4ECZA 2DKZA 4F5OA 4F72A 8ICQA 4O0IA 5AHXA 3VCBA 4DCCA 2FPMA 5D62A 4J9SA 3M7DA 1L6NA 3Q8SB 4PGXA 3QYPA 3PVXA 2W7OA 1A76A 5B66U 4RQ8A 7ICOA 3HT3A 2J6UA 4DL7A 2ZXHA 1QSYA 4QIWC 2KSOA 5KFRA 2HVHA 4DQPA 3M9NB 2BCRA 4JV1A 2ZH4A 5L1LA 2CRXA 4AT8B 2K8BB 5KFAA 1U49A 3NKUA 3H8MA 5ALHA 5HHHA 3TADA 1BPBA 5CR0A 1BPYA 3AU2A 5J0PA 3BZCA 3H8JA 1YT3A 4NJ8A 3M1YA 3TADC 4QZEA 4KLTA 4NXUA 3BJYA 3ZDAA 2V9WA 4F8RA 2NRWA 4IG8A 3GZFA 3T79A 1QSSA 4M9GA 4EENA 2DR5A 3WKAA 5AM5A 4ED6A 4F93B 4X4VA 5ALSA 3LDAA 1JXLA 4G9BA 2Y9TA 3PW0A 2K89A 2C2RA 1QSLA 4F4WA 4IQWA 4X4OA 3JPOA 9ICKA 1NZPA 2WB1F 2FPLA 2M9NA 4EP7A 2HI0A 4UBCA 4I2IA 4F50A 5F3XB 2ASLA 1K1SA 3KHLA 5AM3A 1RQLA 2H5XA 4DQIA 4YN4A 1L3UA 4X4TA 4ZH4A 3ISCA 4DSKA 3H3AA 1ZQIA 3WK7A 1S5LU 4M04A 1OW5A 2K60A 2K4IA 1A0PA 8ICOA 2B21A 1KFSA 2IMWP 1Q3VA 5KAIU 3IG8A 3C21A 2P66A 4K4HA 5HNKA 1XO1A 1ZXIA 4DL4A 2ODGA 3UPSA 3NRZA 9ICHA 3BQ0A 2KFZA 8ICKA 4LT6A 3FM9A 4FHYA 4NLNA 4X4QA 1T3QA 3C28A 2W55A 3DEEA 5KFCA 3AQKA 1YZ7A 4AT9B 1ZQAA 2G08A 2KV2A 2PKEA 3NUQA 1F44A 4FHPA 4M9JA 2W9BB 3OJUA 1SL0A 4B9TA 3H0RB 4LZDA 2KICA 2E1FA 4FZNA 8ICRA 2HOFA 4NXVA 2NRVA 2DRAA 4OAFA 3KHGA 3ERCC 4Y2RA 1PX5A 2LI6A 1NJYA 1RXWA 4TUSA 8ICGA 5KFSA 3QX7A 4DL2A 3QXGA 2EAMA 2YTUA 3GILA 2F1HA 3IV6A 2ZIUB 3BS5B 2BPCA 3U26A 5CHEA 3OVSA 3RR7A 5HREA 1QQ7A 5J8YA 3PNCA 4ICAA 4O3MA 1QH9A 5ALWA 4B9SA 5ALKA 5J8YC 1LV5A 2KJ9A 1CRXA 5AKZA 4KMOB 1CUKA 2E1EA 3NGDA 1IIPA 3OWGA 2MRLA 7ICEA 1ZQKA 5G5HA 4DL3A 3H8WA 4UB1A 2ZH3A 2BZFA 1U9LA 8ICBA 5H2FU 2K4HA 4Y2QA 1HJPA 2WF8A 2WF6A 5JUMA 2FMQA 3S6JA 3AN1A 2XY5A 1ZJMA 3L9DA 3K1ZA 1SV0A 3T5LA 4OD0A 4KN7A 1SV0C 1K5OA 4K4IA 3WKDA 1PUZA 1RXVA 1IM4A 1SL2A 2BPFA 1MIWA 9ICQA 4K99A 2VJ5A 2BR0A 3G6VA 1LB2B 4XQ8A 4QNLA 1J97A 1N62A 4ECTA 1JN3A 4ZOHC 2H3FA 3PSFA 5AI6A 4QZHA 3N7RC 2I5HA 1M6YA 5J2HA 3IM1A 2G07A 1KNYA 1RQNA 4PHAA 3BQ2A 1U48A 3KD3A 4MF2A 1ZQQA 4RQ6A 4QWDA 2DKXA 2YMLA 4UARA 3QU5A 4NXWA 2VA2A 5IIOA 8ICTA 2OM6A 1D8LA 5IIJA 4O3QA 2JEJA 2MUTB 4TQSA 4M47A 3QU4A 3Q8KA 1X6IA 4J03A 5DLFA 2PMZF 4IL6U 5ALIA 5BOLA 1WCNA 3OSNA 2M2WA 1JRPA 4KLLA 2KKVA 2DPJA 3LWLA 2BDUA 4MEYA 4GFJA 4EGWA 3V7LA 4PHEA 3EF2A 5D61A 2FMPA 1Y88A 2GAFD 4HX0A 4LEZA 2KHVA 5ALVA 4KN4A 2VA8A 2PFPA 2RP5A 4I2CA 2M0NA 1MIVA 4C4RA 3AEVA 5J0OA 3THVA 3N28A 4PL1A 4PHPA 9ICSA 5DB9A 4OJ6A 4ACOA 1ZETA 3UM9A 2J6SA 5KFLA 1TKDA 2ZIWB 2FCLA 1Z4OA 4C0ZA 3GU3A 4WQLA 2FDRA 3BS7A 4DSFA 2DR9A 4CNQA 1JALA 3RRHA 4OJOA 5TISU 3RBDA 1COKA 4P0PB 1T94A 3FC4A 4IR9A 1P7DA 4CF4A 2FLNA 7ICMA 2EH9A 3H4BA 2HHWA 1UEUA 1Z00B 2W9BA 2IA6A 1DXSA 2JH7A 4ED1A 3IN5A 4JWMA 3JPSA 4Y2VA 3TKAA 1QLNA 2XGQA 4O67A 4Y2JA 1ZQFA 5DQHA 1S76D 2E8MA 3E58A 4FBUA 1Q78A 3K1RB 2XGPA 3ORYA 4DSIA 4RQMA 3EZ5A 1ZQBA 5EE9A 1FEZA 2ZIUA 3BS5A 4C80A 2W11A 4F71A 4UB2A 4EZ6A 3NWIA 4GC7A 4RPZA 2EAPA 4JV2A 4FO6A 3SZ2A 3IDWA 2O1PA 3KZXA 4Q45A 4RNNA 3BQTA 1NOMA 9ICJA 4EBDA 5ALJA 2RFFA 4O68A 9ICNA 5IINA 2MU2A 3N7SC 1MIYA 3AQEA 2HHSA 2PBEA 2JEFA 4ELVA 3OV7A 1F0MA 4E80A 4IS7A 4PGQA 4XUSA 5KT3A 4XJEA 1KBUA 4X0AA 4ECUA 5AM1A 2AGQA 1NJWA 3G6XA 3PW2A 3JZ0A 1KFTA 5KG4A 3RB4A 1S9FA 3I76A 1UPHA 5HR6A 4KLDA 4JK1A 3HIYA 1NK7A 2Y0SC 2OXOA 3GIMA 3FDSA 4NM1A 2BE3A 4FHVA 2WTFA 5L9XA 4R65A 3K7DA 3AMZA 4RNOA 8ICIA 5F9LA 3ETLA 2JEGA 5HMLA 1U45A 1GO3F 2KSOB 4Y2TA 4RUCA 2C2EA 2MUTA 1DK3A 5AI4A 5J2CA 4M9LA 5J2AA 5DDYA 4NXXA 1B0XA 3ED5A 4YVZA 5HR9A 2KNJA 9ICWA 3RB6A 1NJZA 2F1IA 3OHBA 4MEXA 2G06A 1KFDA 5J0RA 5AICA 2IHNA 2VA3A 5D63A 1JROA 2R8KA 4QW8A 2I9GA 2L5YA 5EE0A 1T7PA 4FBTA 7ICVA 4NL9A 3HKZF 4YCXA 4DL5A 3JPTA 3M8SA 4NL9C 2HSZA 3MR2A 9ICMA 3H7IA 2UVVA 5ALXA 2WB1C 3M8RA 1OXJA 8ICJA 1NK0A 1KKXA 3UXPA 2CPRA 1KEJA 4KMUA 2ZH5A 1VFGA 4UATA 1K1QA 4FE3A 3SV4A 4I2GA 1XSLA 3WK9A 1N5WA 4RPXA 2KEYA 2KTQA 2Q66A 4WC2A 1Q46A 2ZIWA 5CRXA 4UAWA 4NKTA 4C8LA 2F1JA 4X4PA 1S0MA 4EEBA 1DK2A 3PX0A 4UBBA 1TAMA 4P0PA 1NK4A 3UMCA 1RYSA 4NWIA 1N60A 3MCRA 1Z00A 4UD5A 4JUZA 1IXRA 3KBBA 3V7JA 2HDOA 2M2TA 5AM0A 1X66A 4KLHA 5JRTA 2DUYA 4C4TA 5AK6A 1RZTA 2QARA 4F4XA 3TFSA 1V4AA 3HJ4A 3ZDCA 4M6WB 4IRKA 2ID1A 4K4GA 5J0WA 3B0YA 1X9SA 4Y2UA 4C7ZA 4IC9A 3WK5A 3H0LB 3OHAA 2NRZA 2HHUA 1WOTA 3JPQA 4I2JA 3PMNA 1UHUA 1UETA 2F8KA 4KB6A 4DFMA 4ED0A 3WK4A 1ZJNA 4FFDA 2K8AA 2C2DA 3RJGA 2VIXA 3WFQE 3V6KA 1SGGA 5CFUA 2LYHA 1ZRNA 2OHFA 9ICCA 5HRGA 5ALYA 1S0OA 4WC4A 1F5SA 4TQRA 4YMNA 3V6JA 1RPLA 1CEZA 2JV3A 1ZQJA 1GPJA 2IHMA 3ZDBA 3KOOA 3NRWA 2OYYA 3HJEA 1TFWA 2F3NA 2FLLA 2FPKA 1UT5A 2KP7A 3T5JA 5AI5A 1L3TA 3PR5B 4WC5A 2IOFA 3SAHA 3FYHA 2ZG6A 3WK8A 4DEZA 4J9NA 1S77D 5KT2A 5AIAA 5B3PA 3OSPA 2KK0A 4CGZA 4N7RA 4WJ3B 4G3IA 2YQEA 3F2BA 1S8OA 4I0UA 5D46A 3JYYA 1PVRA 5KFDA 3Q8PB 4B6JA 2OEHA 2BQUA 5HRFA 1FFUA 3EW9A 5DBBA 2BBJA 8ICVA 3OUYB 4OCZA 1ED1A 2D8CA 4JLZA 3SAGA 4F2RA 4A8EA 1N5XA 1KRPA 4UAVA 8ICSA 2ZH2A 3D6JA 4NLCA 4O3RA 1Q8KA 3UPQA 3T5HA 7ICLA 4ELUA 5F9NA 3TARA 3UMGA 3MBYA 2O6KA 3V72A 2BCQA 2ALZA 4I2HA 1FO4A 5GTHU 3MDAA 4I28A 1TAUA 8ICCA 7ICNA 2OH2A 3KTQA 1QQ6A 3MR5A 2ISOA 3RJIA 3PO5A 2HVIA 1KL9A 4KTQA 4WC7A 2XIDA 5CB1A 1TFRA 4YD2A 4F91B 1VJ5A 4KLSA 4KLQA 1DOQA 3M6ZA 2YMQA 2R8JA 5AI9A 2XCAA 1KSPA 5DG7A 2UVUA 1R8CA 4WBZA 5KFZA 4OJ5A 3Q8QB 5IIIA 2P35A 4I29A 5KFBA 2AXTU 1LVHA 2IUBA 1LKYA 4M6WA 1WUDA 2NRTA 3ZDEA 5J2BA 9ICPA 2ZUBA 2LBOA 3HX0A 2YY6A 5JTGA 2Q4TA 2HN2A 2XY7A 2BCSA 4IRDA 1ZQMA 4YMMA 3EPIA 4NY8A 5L1MA 1WYGA 5DECA 4Y2XA 1PK3A 1WWVA 3AM9A 2FLPA 2W54A 5KL8B 2PI5A 3IHQB 8ICLA 3SAFA 2G5HB 2WF5A 4BXOB 4E7XA 7ICGA 4J9KA 2KHQA 3UMBA 1JX4A 1ZQPA 4OAIZ 3MGHA 5AM4A 4RT3A 3B9JA 2ZUCA 3WFRE 2VANA 4I2AA 2B0CA 5J2KA 3A0BU 2KE7A 5T14A 4EBKA 4RQNA 3QZ7A 4EYHB 1R8AA 3PR4A 5J0SA 1NI3A 9ICRA 1SV4A 5KNIA 4NV0A 1R8BA 4UD4A 5AKLA 1L8LA 1ZQTA 5ALNA 4RWQA 2D3DA 5KFMA 5KFEA 4QZ8A 4I2EA 5KG7A 3RB0A 3QNMA 1Q79A 5KG0A 5DG8A 5EWGA 3DV9A 2EAOA 2YB1A 2AJQA 3M9MB 4KLEA 5KFJA 3C2KA 4IQVA 4Q44A 5DGBA 2Q0ZX 5AK4A 2KMDA 5ALOA 3HJ1A 4MF8A 2DL0A 7ICTA 5HHIA 4UAUA 1X9WA 4QZAA 2KJ5A 4O5KA 1TFYA 1HIWA 4QWEA 4P4MA 1X2IA 5ALDA 4DOCA 4K9AA 4QIWF 2HBKA 5J29A 4O5EA 4NLKA 5DKWA 4I27A 2CN1A 4IRCA 1HEKA 3NVYA 3NVZA 4YD1A 5ALMA 5CFTA 1ZD2P 1MQ3A 2ZIVB 4JLXA 1L3SA 4PPXA 2XC9A 4KLGA 3OUYA 7ICQA 9ICOA 4LEWA 5KTQA 3C23A 1JI7A 3WKCA 3CRXA 2ZJAA 4Y2YA 2JZBB 4TUQA 2W8KA 2AQ0A 3PHZA 4S3NA 2B4VA 3QEBZ 5KFWA 2ZTEA 4RQ5A 1NO5A 2W04A 3NVOA 1VLBA 2K4EA 2HOIA 4US9A 2IOHA 3F5EA 3HRDD 5CHGA 1OU5A 5KFTA 4RQ7A 3PMLA 1R89A 3SV3A 9ICLA 4OJLA 3LVWA 5KFYA 5KFVA 4F4YA 3ZD9A 4EYIB 5IIKA 1B22A 1JMSA 3KZIU 4QZCA 4J9QA 4Q8FA 1V97A 4QZBA 3MGIA 3RAQA 2YX8A 4GLXA 2ASJA 5AM2A 4HYKA 2EZYA 4DFDA 5HRKA 1YLQA 4E8FA 2W3SA 4DOAA 7ICFA 2F8LA 1ZQWA 9ICVA 3C5GA 8ICFA 2ZJ8A 1KN5A 4PZOA 2Y9UA 2JHDA 2WAQC 5HRLA 4J9LA 1PVQA 3SR6A 4C7YA 4K97A 2W8LA 2RLTA 1X42A 2W9AA 2KZ3A 2DGZA 4F4KA 3GFKB 2HW3A 8ICEA 5KFFA 8ICXA 2R8HA 2QARB 1T8EA 4AYBF 5AKIA 4CF3A 4GC6A 4EZ9A 3NYBA 1SZHA 2ZTDA 3AL0B 3C2LA 5J0QA 4Z6CA 2LHTA 4MHVA 5J2JA 4DLGA 2DPIA 2AH5A 4PZNA 4DSEA 4FZLA 1ZRMA 3HWTA 3OJSA 3N4MB 8ICUA 4RQ2A 4UQGA 3R9KA 1BPEA 2QKQA 3FAHA 4BXOA 1FIQA 4CF5A 3HPOA 2DRBA 4AT7A 1IV8A 3GV5B 2LMRA 4FO1A 1BNOA 2NV3A 4RUAA 5AIBA 4US8A 2QB1A 5EE3A 4RWOA 3RFAA 2DWQA 3F2DA 5J0UA 3RJEA 4EEYA 8ICWA 1AROP 3PSTA 3TFRA 1TK5A 3L4PA 3IRUA 5ALFA 7ICSA 2E8NA 1SKRA 2NYVA 1XS9D 4KLFA 2PFOA 9ICGA 1HUZA 3RJHA 4HAIA 4ECVA 4R64A 3GV8B 1NJXA 7ICRA 5ALGA 4B9UA 4NKUA 9ICFA 3V6HA 2VJ4A 3QU2A 1NKBA 3L3FX 1N61A 4PH5A 3CK6A 2GA9D 4EBEA 2BGWA 1N48A 4I2BA 4DLEA 3T5KA 2AGPA 3JPRA 4JV0A 1N56A 1V9PA 4LJXA 3UXNA 1RYUA 4JWNA 4O9MA 9ICTA 4DL6A 2ZIVA 4OAGA 3K4GA 2G09A 3ICXA 2BKEA 3HW8A 4RQ3A 5KFXA 2ASDA 3OGUA 2GWSA 4WQKA 2JZBA 4GXJA 4Z6EA 4XA5A 1D8YA 4C8OA 4DSJA 4QZDA 5FP0A 4P0QB 1Z3EB 5TZVA 4TUPA 4X4RA 1SWWA 4WC3A 4PJ0U 4C4SA 4MFCA 2HCFA 4YMOA 1URJA 4FH3A 3KKAA 4QWAA 3KKAC 1N2XA 2F44A 3OTQA 4YFKA 2PFQA 1FA0A 3SYZA 2B51A 5DDMA 3HILA 3SD7A 3QUCA 4KX5A 1OUQA 3LQCB 5DQIA 5D4BA 4M9HA 4FH5A 5HRDA 2V4QA 2KZZA 4Y2SA 3NS1A 4NM2A 1JAJA 4Z6FA 2ZH7A 2YMMA 2KVCA 2KIWA 2GLEA 2FMSA 2ATLA 1DRGA 3BQ7A 4O3SA 2DFLA 3MR6A 3SQIA 2N1RA 1KQQA 2GOLA 5A0LA 3H38A 4U7CA 3SI8A 3AQNA 5DEDA 1J2NA 4UB6U 1D9DA 2UVWA 3NASA 4UAZA 4J9RA 2E8PA 3J81j 1C20A 1COOA 4X5VA 2BQ3A 2G5IB 2F2AB 8ICNA 1LKYB 1ZQZA 2JXJA 1WCLA 1NKCA 4O6AA 2A3VA 2FE9A 3AQMA 4ED8A 1PK1B 2A1JA 4FS2A 4ED3A 3BDPA 3DDHA 4F2SA 1EXNA 2JGAA 3GV7B 3GIIA 2LKYA 2KG5A 5J2GA 1NZBA 8ICPA 5CFSA 2HHXA 1TAQA 1AQ6A 1ZQSA 1SZPA 2XICA 2A19A 1Z19A 4UW9A 4EX6A 4DSLA 1BGXT 5KG2A 4LEVA 3TACB 1L5UA 4XQ7A 3WFPA 2O5AA 3GIKA 5KT4A 5JTIA 5J2IA 5HRBA 3I28A 3QU9A 2LYBA 2DR7A 4LVSA 1TK8A 4X4SA 3PW5A 5KG5A 4R63A 3TANA 5KFGA 2UVRA 4DO9A 2PXIA 4KM5A 3UQ2A 4K96A 2H3VA 4QZGA 5DB7A 1BPXA 3KHHA 2R8IA 5DB6A 4B9NA 3ER9B 5L1JA 4MKPA 4I2DA 4F5PA 3Q8LA 4YXMA 4K98A 5ALEA 1NK8A 7ICHA 2GH1A 5HR7A 4QZFA 5E79U 1WG8A 2LYAA 4QWBA 5AK5A 1ZYQA 2Y0SF 2DVIA 2ZXIA 2NRKA 5DGAA 1KLNA 1ZD4A 3GDXA 1BVSA 5HP4A 4BDPA 1O08A 4ATBA 2CXYA 1L7NA 2ZIXA 2Y1JA 5GTIU 1VJ7A 5DLGA 4C8NA 4J9MA 4ECSA 2F76X 3C1YA 4MFFA 5KG3A 3F53A 4YG2A 4YR0A 1ZQDA 4RZRA 4FZMA 4LZGA 4P0QA 2ZHBA 3ISBA 1L8OA 4F92B 2PMZC 4CE6A 5KFQA 5AKXA 3D2SA 9ICXA 1B43A 1TE2A 4IQTA 3JPNA 1NNLA 4P2HA 4RPYA 3RJJA 2YB4A 4EBCA 4KX3A 5EWEA 9ICAA 4BGDA 5ALZA 4M2YA 2YMPA 3NTUA 2K8CB 2JH1A 4ECYA 2E5SA 2R18A 3OVBA 2D6FC 1SKWA 2W3RA 5KL1B 7ICUA 1S0VA 4ED7A 1S10A 3PV8A 4O3PA 2H3QA 4F5NA 1XSNA 4BJQA 4FHWA 3B0XA 2KZMA 1JXEA 4KITB 7ICIA 2MAXA 5C0YA 1UCVA 4UB8U 2KOBA 2PI4A 5J2EA 3PW7A 1MQ2A 1ZQCA 5CA7A 3ER8C 4LEYA 5DBCA 3KFUF 3JCFA 1WWUA 4P4OA 1JIHA 5D49A 5HMMA 4ECXA 2W43A 5G5GA 2ZH1A 3ONNA 5DB8A 4DWIA 2EZXA 1MN8A 1XWLA 4WC1A 1ZQ1C 1DGJA 3PSIA 4BWJA 8ICZA 3UXOA 4ECRA 4M9NA 4DQRA 2ZUDA 5KG6A 5L1KA 3UQ0A 1BPDA 1PK1A 2DBYA 3ETRA 3N7PD 2Z7JA 5AI8A 3QUBA 3ZD8A 2EANA 3LVVA 4RNMA 2JMGA 2PFNA 3GIJA 3PX6A 1Z1VA 4AYBC 5DBAA 2BDPA 5AKEA 3SENA 4NLBA 3MC1A 5AKHA 5CEHA 1D8BA 4QJFB 3TI0A 4CCHA 2KN7A 5KFKA 2KVSA 2DF4B 5KFPA 1SXEA 3Q8MA 5AKGA 2HHVA 3H37A 4AT7B 2ZH8A 2EZZA 5B5EU 1ZQLA 5EE1A 2DR8A 2RDIA 2MA1A 4Q43A 2WF7A 4QW9A 3OVAA 5KFOA 4IQUA 5J2DA 4RT2A 3C1ZA 5KT5A 5C5JA 4M0AA 4WH5A 4DS4A 9ICBA 3WFOA 1IG6A 3H40A 4K8VA 4DQSA 3RH5A 1U4BA 4K9BA 2IHOA 2XI9A 5ALUA 4R8UB 1ZQVA 1KW4A 4YR3A 4B9MA 3C66A 1PZNA 4F5RA 4BX9C 3ISDA 3QZ8A 4KLJA 3C5FA 3RJFA 5EWFA 3CP8A 4GXIA 2P6RA 4F5QA 4J9PA 4EELA 2J6TA 5JU5A 3PO4A 4X0BA 4QZ9A 2HBMA 4OAHA 1NK9A 3RH4A 4DOBA 1ZQYA 1ZQOA 4AT8A 4CDGA 4WCWA 2M2UA 1MSWD 2H3ZA 2BCUA 2F77X 3F2CA 4AP9A 4GIBA 4QZIA 3PX4A 3EWAA 1X9XA 2G0AA 1H38A 7ICKA 3LK9A 3QU7A 4MFAA 2XCPA 3E2EA 3HKZC 1ZQXA 3WFSC 1F5AA 5AK3A 4M5DA 1NK5A 4IR1A 4X4UA 2BPGA 3QEAZ 1ZQHA 4EBJA 1ZQGA 2BHNA 4ECQA 2E8OA 4RWPA 5F2VO 2JEIA 3IG5A 3PSPA 3SEIA 4DFKA 4EV6A 1J2MA 2KKPA 1RM6C 1PVPA 7ICJA 4ECWA 3LWMA 1XU4A 2XY6A 5AKKA 2XO7A 2FI1A 1UQVA 4C8KA 3TAQA 5DG9A 1QCKA 5CP2A 4BUGA 3RBEA 1UA1A 4WC0A 3E0FA 5ALPA 3M6KA 2RRDA 5HRHA 1QQ5A 3A0HU 2Y1IA 2HBJA 2RDJA 2QB0B 1NK6A 1MA7A 2I1QA 4E0DA 3TAPA 5ALQA 3F5AA 1BNPA 4YXJA 2EWRA 4Z6DA 3L5KA 4DF4A 2IBKA 3QE9Y 4U6PA 1MC8A 3HP6A 5IILA 1X9MA 1FFVA 1SKSA 4AT9A 1ZQUA 2W7PA 1UT8A 3ALRA 2AU0A 2V4RA 2C28A 8ICMA 3MFIA 1X6JA 3MR3A 4WOYA 2HHQA 4Q8EA 3BQ1A 3AU6A 2BQRA 4PGYA 2A1JB 3AQFA 1ECWA 2ISPA 3RH6A 2NRXA 1QTMA 2LM4A 3IP4B 3K75D 5J0TA 3SMVA 4NLGA 1O03A 5DQGA 2B6GA 4BWMA 4ELTA 4EEDA 4EEKA 4RWNA 4P4PA 5KAFU 5KT7A 2MSNA 3WU2U 4XRHA 1A6SA 4RQ0A 3LYSA 5ALRA 5IIMA 1RG6A 1C7YA 4RQ4A 2KJ8A 4R8UA 1KDHA 1Z4NA 1L7PA 3RJKA 3WKEA 2ZHAA 2HMXA 3M9OB 1B4FA 3JPPA 2WF9A 4WBYA 2HOQA 2I6XA 2WFAA 1SIJA 1V38A 2K4PA 5AKYA 2W03A 4WC6A 4RU9A 3TQ1A 3CNHA 1Z1BA 1BPZA 2ZH6A 2W9CB 2R8GA 3N97B 3RRGA 3QUTA 2WHEA 5KFUA 4O3OA 4DS5A 1YZ6A 3KHRA 1SWVA 5KFHA 4C8MA 4UB4A 1L7OA 4DFJA 4B9VA 2IOFK 2QLTA 1RYRA 4B9LA 5J0YA 2OCEA 8ICAA 1RDFA 1KTQA 4NXZA 4O3NA 1NKEA 4ATBB 2RQ5A 3Q8RB 1U47A 2ZIXB 4F4ZA 3PZPA 1XNSA 1HUOA 4KLIA 4ED2A 2AQ4A 4UASA 2KD1A 3EYZA 3H0MB 4R66A 1D9FA 5K4LA 1SXDA 3MFHA 3RB3A 4CRXA 4X4NA 3MDCA 2VKQA 5J2FA 4TURA 3H8SA 2ESEA 4Y2PA 3WK6A 4USAA 3NVWA 1L3VA 3RR8A 1TV9A 5ALTA
chains in the Genus database with same CATH topology
5DECA 5CWRA 5KT6A 4QWBA 2FLPA 1ZYQA 3H39A 4RQ1A 5HRIA 2PI5A 4DSFA 4J9OA 2DR9A 3IHQB 2DVIA 1XC9A 3RRHA 5L1IA 8ICLA 2NRKA 3RBDA 5DGAA 4BXOB 1KLNA 4E7XA 5KFNA 4IR9A 7ICGA 2FLNA 3PY8A 3GDXA 1BVSA 4J9KA 7ICMA 3H4BA 5HP4A 1JX4A 1DGSA 1ZQPA 1Z00B 3AUOA 3MGHA 4BDPA 4I2FA 4RT3A 2HHWA 1UEUA 4ATBA 2ZUCA 8ICHA 2W9BA 2IA6A 2Y1JA 3H4DA 1VJ7A 3WFRE 2VANA 5DLGA 4ED1A 4I2AA 4C8NA 3JPSA 4J9MA 4ECSA 4JWMA 3C1YA 4FHXA 5J2KA 4MFFA 5KG3A 4YG2A 1QLNA 4YR0A 2XGQA 1ZQDA 4RZRA 4EBKA 1ZQFA 3QZ7A 5DQHA 1S76D 4EYHB 1T4GA 4LZGA 1R8AA 4FBUA 3PR4A 1Q78A 2XGPA 1S97A 5J0SA 2ZHBA 3ORYA 3ISBA 9ICRA 4DSIA 4F92B 5KFQA 2ZJ5A 1R8BA 3C2MA 4UD4A 1ZQEA 3EZ5A 1ZQBA 9ICXA 1ZQTA 1B43A 4RWQA 5KFMA 4IQTA 4UB2A 3JPNA 5KFEA 5EOZA 4QZ8A 4EZ6A 4I2EA 4P2HA 5KG7A 4RPYA 1TVAA 3V7KA 4GC7A 4RPZA 3RB0A 3RJJA 2P6UA 1Q79A 5KG0A 3ZDDA 4JV2A 5DG8A 5EWGA 4EBCA 4FO6A 3SZ2A 2AJQA 4F4KA 2O1PA 4Q45A 5HC9A 3M9MB 4KLEA 5KFJA 5EWEA 2KFNA 4RNNA 3BQTA 9ICAA 1NOMA 9ICJA 4BGDA 3C2KA 2BCVA 4EBDA 3EPGA 2HHTA 4IQVA 4Q44A 1TK0A 4M2YA 5DGBA 2Q0ZX 2RFFA 3NTUA 4XQ7A 4DF8A 4ECYA 9ICNA 5IINA 3HJ1A 4MF8A 1T3NA 1ZQNA 4QWCA 2C22A 7ICTA 5HHIA 4KLMA 1MIYA 1UA0A 5BOMA 1UEVA 1SKWA 2HHSA 1X9WA 2JEFA 2PBEA 3OVBA 1S0NA 5KFIA 4ELVA 4QZAA 4FS1A 7ICUA 4F3OA 4O5KA 1S0VA 4ED7A 1TFYA 4QWEA 4DOCA 4P4MA 1X2IA 1S10A 3OV7A 3PV8A 3GQCA 4O3PA 8ICYA 2M2VA 4E80A 7ICPA 4F5NA 5J29A 4XUSA 5KT3A 4PGQA 4PHDA 1XSNA 4O5EA 4NLKA 4YP3A 4FHWA 3B0XA 5DKWA 2KZMA 1JXEA 4ECUA 4I27A 1JQRA 4KITB 7ICIA 2MAXA 4IRCA 2AGQA 1NJWA 4YD1A 3G6XA 2PI4A 3PW2A 5J0XA 1MQ3A 5J2EA 3PW7A 4I2GA 1KFTA 9ICUA 3JZ0A 1MQ2A 1ZQCA 5CA7A 1L3SA 4GXKA 5KG4A 3RB4A 1S9FA 4KLUA 2XC9A 3RAXA 4KLGA 4PPXA 3AQLA 2ZH9A 3OUYA 7ICQA 5DBCA 3MABA 4O5CA 4KLDA 9ICOA 4JK1A 4P4OA 3C23A 5KTQA 1JIHA 4UB5A 1NK7A 5HMMA 5D49A 3GIMA 3FDSA 4ECXA 4NM1A 2BE3A 2ZJAA 4FHVA 2JZBB 2WTFA 5KG1A 4TUQA 2W8KA 2ZH1A 5L9XA 4R65A 2AQ0A 5DB8A 4DWIA 5BPCA 1SL1A 3RTVA 4RNOA 4S3NA 2OWOA 3QEBZ 1XWLA 2ZTEA 5KFWA 4RQ5A 8ICIA 1NO5A 4WC1A 9ICIA 4UAYA 5F9LA 9ICEA 4BWJA 3ETLA 8ICZA 2JEGA 3UXOA 4ECRA 4M9NA 4DQRA 2ZUDA 5KG6A 5L1KA 3UQ0A 5HMLA 1BPDA 5CHGA 1U45A 1OU5A 5KFTA 4RQ7A 3PMLA 1R89A 2ZTCA 1A77A 4DQQA 5CJ7A 3PW4A 3SV3A 3G6YA 9ICLA 5KFYA 5KFVA 4RUCA 4F4YA 3ZD8A 2C2EA 3ZD9A 4RNMA 2MUTA 4EYIB 3GIJA 3PX6A 2PFNA 1DK3A 5IIKA 5J2CA 1JMSA 4J9QA 4QZCA 4M9LA 5DBAA 2BDPA 5J2AA 4Q8FA 1B22A 5DDYA 2HHPA 3C18A 4QZBA 3MGIA 3RAQA 3T3FA 4GLXA 4YVZA 4YQWA 2W9CA 5HR9A 9ICWA 3RB6A 2ASJA 2F1IA 1NJZA 4HYKA 2AGOA 4UB3A 3OHBA 4MEXA 5HRKA 1KFDA 1XSPA 5J0RA 2IHNA 1YLQA 1ZQRA 4E8FA 3TI0A 4DOAA 2W9MA 4CCHA 7ICFA 2KN7A 5KFKA 4KLOA 4DFPA 2VA3A 4YR2A 2R8KA 4QW8A 1ZQWA 2I9GA 4NLZA 5KFPA 9ICVA 4ECZA 3Q8MA 3C5GA 8ICJA 4F5OA 1T7PA 8ICFA 2ZJ8A 4FBTA 7ICVA 8ICQA 4O0IA 2HHVA 4YCXA 4DL5A 3H37A 4AT7B 2FPMA 2ZH8A 4J9SA 3JPTA 3M8SA 1ZQLA 3Q8SB 5HRLA 4PGXA 2RDIA 4QW9A 4Q43A 4J9LA 3MR2A 9ICMA 3PVXA 3OVAA 5KFOA 1A76A 3H7IA 4IQUA 4RQ8A 2UVVA 7ICOA 2W8LA 3HT3A 5J2DA 2J6UA 4RT2A 4DL7A 2W9AA 1QSYA 2KZ3A 3C1ZA 5KFRA 2HVHA 3M8RA 4DQPA 3GFKB 5KT5A 3M9NB 5C5JA 1NK0A 5L1LA 3UXPA 2BCRA 4JV1A 4M0AA 2HW3A 2ZH4A 1KEJA 4DS4A 8ICEA 5KFAA 9ICBA 5KFFA 4KMUA 1U49A 8ICXA 4AT8B 2R8HA 1K1QA 2ZH5A 1VFGA 3WFOA 5HHHA 3H40A 1T8EA 1BPBA 5CR0A 3SV4A 4DQSA 3AU2A 5J0PA 3RH5A 1XSLA 1U4BA 3H8JA 4RPXA 4GC6A 2KTQA 2Q66A 4EZ9A 3NYBA 4WC2A 4R8UB 4QZEA 2ZTDA 3C2LA 5J0QA 1ZQVA 4Z6CA 5J2JA 4KLTA 4YR3A 4DLGA 4B9MA 1PZNA 3C66A 2DPIA 3BJYA 4UAWA 4DSEA 4NKTA 3HWTA 3ZDAA 2V9WA 3OJSA 4F5RA 2NRWA 3N4MB 4C8LA 4F8RA 2F1JA 4X4PA 1S0MA 8ICUA 4RQ2A 4IG8A 4UQGA 3ISDA 3QZ8A 1QSSA 4M9GA 4KLJA 1BPEA 1DK2A 3PX0A 4BXOA 3C5FA 4UBBA 3RJFA 2DR5A 1NK4A 5EWFA 3HPOA 4GXIA 1RYSA 2DRBA 2P6RA 4F5QA 4ED6A 4AT7A 1Z00A 4F93B 4JUZA 1IXRA 3GV5B 4UD5A 4X4VA 3LDAA 4J9PA 1JXLA 3V7JA 2J6TA 3PO4A 2M2TA 4X0BA 3PW0A 1BNOA 4QZ9A 4KLHA 4RUAA 2C2RA 1NK9A 1QSLA 4WBZA 4F4WA 3RH4A 4IQWA 4X4OA 3JPOA 9ICKA 1NZPA 4DOBA 3HIYA 4RWOA 1ZQYA 2FPLA 2M9NA 1ZQOA 5J0UA 4AT8A 1RZTA 4EP7A 3RJEA 4UBCA 4WCWA 4F4XA 4EEYA 2M2UA 3TFSA 1MSWD 8ICWA 4I2IA 4F50A 1AROP 2BCUA 3TFRA 1V4AA 3HJ4A 2ASLA 1TK5A 3ZDCA 1K1SA 4M6WB 3KHLA 4IRKA 2ID1A 4K4GA 2H5XA 4QZIA 4DQIA 4YN4A 3PX4A 3EWAA 1SKRA 7ICSA 1L3UA 1XS9D 4X4TA 4KLFA 5J0WA 3B0YA 4ZH4A 3ISCA 1H38A 2PFOA 4DSKA 3LK9A 7ICKA 1ZQIA 9ICGA 3H3AA 1X9SA 1HUZA 4MFAA 3RJHA 4M04A 4ECVA 2XCPA 4R64A 3GV8B 1NJXA 3E2EA 8ICOA 2B21A 1KFSA 7ICRA 1ZQXA 3OHAA 2IMWP 4B9UA 1F5AA 3WFSC 2NRZA 3C21A 4M5DA 1NK5A 4IR1A 4X4UA 1KNYA 2BPGA 2HHUA 2P66A 3QEAZ 4K4HA 4X0AA 5HNKA 1XO1A 1WOTA 3JPQA 1ZQHA 3V6HA 9ICFA 4DL4A 4EBJA 1ZQGA 4NKUA 1NKBA 3UPSA 4I2JA 2BHNA 4ECQA 9ICHA 4RWPA 3PMNA 5F2VO 1UETA 3BQ0A 2KFZA 8ICKA 4PH5A 4LT6A 4FHYA 4DFMA 4NLNA 4EBEA 2BGWA 2JEIA 1N48A 4X4QA 4ED0A 4I2BA 4DLEA 3T5KA 4DFKA 5KFCA 3AQKA 1ZJNA 2AGPA 3JPRA 1R8CA 4JV0A 1N56A 4AT9B 1V9PA 1ZQAA 3UXNA 2C2DA 3RJGA 4JWNA 4O9MA 7ICJA 4ECWA 9ICTA 3LWMA 4DL6A 3WFQE 3V6KA 1XU4A 4FHPA 3K4GA 2XY6A 2XO7A 4M9JA 2LYHA 2W9BB 3OJUA 1SL0A 4B9TA 4C8KA 3TAQA 9ICCA 5HRGA 2BKEA 4LZDA 4RQ3A 5CP2A 5DG9A 3HW8A 3RBEA 5KFXA 2ASDA 1UA1A 3OGUA 1S0OA 8ICRA 4WC4A 2GWSA 4WC0A 2JZBA 4TQRA 4GXJA 4YMNA 4Z6EA 2NRVA 1RPLA 4XA5A 3KHGA 3V6JA 1D8YA 2DRAA 4C8OA 4DSJA 4QZDA 1PX5A 1CEZA 1NJYA 1RXWA 4X4RA 1Z3EB 5TZVA 4TUPA 5HRHA 4TUSA 1ZQJA 2Y1IA 2RDJA 2IHMA 8ICGA 4WC3A 5KFSA 4DL2A 1NK6A 4MFCA 2I1QA 4YMOA 3ZDBA 4E0DA 3TAPA 2DR8A 3GILA 2F1HA 1BNPA 4YXJA 2BPCA 4FH3A 3OVSA 4Z6DA 3RR7A 5HREA 1TFWA 4QWAA 4DF4A 2FLLA 3PNCA 2IBKA 2FPKA 3QE9Y 4B9SA 4YFKA 1MC8A 1UT5A 2KP7A 2PFQA 3T5JA 1LV5A 3HP6A 5IILA 3SYZA 1X9MA 1FA0A 1L3TA 3PR5B 5DDMA 4WC5A 1SKSA 4AT9A 1ZQUA 3LQCB 5DQIA 1UT8A 1CUKA 3FYHA 2AU0A 4J9NA 4DEZA 2V4RA 3NGDA 5D4BA 4M9HA 1S77D 7ICEA 4FH5A 2C28A 5KT2A 1ZQKA 5HRDA 4DL3A 8ICMA 3MFIA 3H8WA 4UB1A 2ZH3A 3MR3A 2V4QA 1U9LA 8ICBA 2HHQA 2KZZA 4Q8EA 3BQ1A 4NM2A 3AU6A 3OSPA 2BQRA 4PGYA 1HJPA 1JAJA 2A1JB 4Z6FA 5JUMA 4G3IA 2ZH7A 2FMQA 2ISPA 3RH6A 2NRXA 1QTMA 5D46A 2XY5A 1ZJMA 3JYYA 3L9DA 5KFDA 2ATLA 2FMSA 3Q8PB 3WFPA 2BQUA 3T5LA 4O3SA 5HRFA 2DFLA 3MR6A 4KN7A 3K75D 4K4IA 3EW9A 5J0TA 1RXVA 5DBBA 1IM4A 4NLGA 8ICVA 5DQGA 1SL2A 3H38A 2BPFA 3OUYB 4BWMA 1BPYA 1MIWA 3SI8A 4ELTA 9ICQA 4RWNA 4P4PA 3AQNA 5DEDA 5KT7A 1D9DA 4XRHA 3G6VA 2BR0A 1LB2B 2UVWA 4XQ8A 4F2RA 4RQ0A 4UAZA 4ECTA 4J9RA 1KRPA 1JN3A 5IIMA 1COOA 4QZHA 8ICSA 4X5VA 2ZH2A 5J2HA 1C7YA 2BQ3A 4O3RA 4RQ4A 3UPQA 8ICNA 3IM1A 3T5HA 7ICLA 1ZQZA 4R8UA 1WCLA 1NKCA 1KDHA 4ELUA 4PHAA 3BQ2A 1U48A 5F9NA 4MF2A 3TARA 4RQ6A 1ZQQA 3MBYA 3AQMA 2BCQA 3V72A 4ED8A 3RJKA 4QWDA 2ALZA 2ZHAA 3M9OB 4I2HA 2A1JA 4FS2A 4ED3A 3BDPA 3JPPA 4F2SA 2VA2A 4WBYA 1EXNA 3MDAA 5IIOA 4I28A 1TAUA 8ICTA 1D8LA 5IIJA 3GV7B 4O3QA 3GIIA 2JEJA 8ICCA 7ICNA 2MUTB 5J2GA 4TQSA 4M47A 3Q8KA 8ICPA 2HHXA 3KTQA 4WC6A 4RU9A 1TAQA 3MR5A 5DLFA 3TQ1A 1BPZA 2ISOA 3RJIA 3PO5A 2HVIA 4WC7A 1ZQSA 4KTQA 5BOLA 2ZH6A 1SZPA 5CB1A 2W9CB 2R8GA 3N97B 1TFRA 4YD2A 1WCNA 3OSNA 4F91B 2M2WA 3RRGA 5KFUA 4DSLA 4KLSA 4O3OA 4DS5A 4KLQA 1DOQA 1BGXT 3KHRA 4KLLA 5KG2A 5KFHA 2R8JA 2DPJA 3LWLA 2XCAA 1KSPA 5DG7A 4C8MA 4UB4A 1L5UA 5KFZA 4MEYA 2UVUA 4DFJA 3GIKA 2O5AA 3Q8QB 4B9VA 5KT4A 1RYRA 4B9LA 5J0YA 3V7LA 5J2IA 5IIIA 5HRBA 8ICAA 4I29A 4PHEA 2FMPA 1KTQA 2DR7A 5KFBA 1TK8A 4LVSA 3PW5A 1Y88A 5KG5A 4R63A 4X4SA 3TANA 4NXZA 5KFGA 2UVRA 4DO9A 4M6WA 2PXIA 4O3NA 1NKEA 4ATBB 3Q8RB 3UQ2A 1U47A 2NRTA 4F4ZA 3ZDEA 1HUOA 4QZGA 5DB7A 4KN4A 1BPXA 4KLIA 5J2BA 4ED2A 3KHHA 2ZUBA 2VA8A 9ICPA 2R8IA 5DB6A 3HX0A 2AQ4A 4B9NA 3EYZA 4R66A 1D9FA 3MFHA 3RB3A 2PFPA 5L1JA 4I2CA 1MIVA 4X4NA 3MDCA 5J2FA 4I2DA 3H8SA 4TURA 4F5PA 5J0OA 3THVA 2XY7A 2BCSA 4IRDA 3Q8LA 4YXMA 1ZQMA 4PHPA 4YMMA 9ICSA 5DB9A 3EPIA 1ZETA 1NK8A 1L3VA 4NY8A 3RR8A 7ICHA 2J6SA 5KFLA 1TV9A 1TKDA 4QZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DEC A;  5CWR A;  5KT6 A;  4QWB A;  2FLP A;  1ZYQ A;  3H39 A;  4RQ1 A;  5HRI A;  2PI5 A;  4DSF A;  4J9O A;  2DR9 A;  3IHQ B;  2DVI A;  1XC9 A;  3RRH A;  5L1I A;  8ICL A;  2NRK A;  3RBD A;  5DGA A;  4BXO B;  1KLN A;  4E7X A;  5KFN A;  4IR9 A;  7ICG A;  2FLN A;  3PY8 A;  3GDX A;  1BVS A;  4J9K A;  7ICM A;  3H4B A;  5HP4 A;  1JX4 A;  1DGS A;  1ZQP A;  1Z00 B;  3AUO A;  3MGH A;  4BDP A;  4I2F A;  4RT3 A;  2HHW A;  1UEU A;  4ATB A;  2ZUC A;  8ICH A;  2W9B A;  2IA6 A;  2Y1J A;  3H4D A;  1VJ7 A;  3WFR E;  2VAN A;  5DLG A;  4ED1 A;  4I2A A;  4C8N A;  3JPS A;  4J9M A;  4ECS A;  4JWM A;  3C1Y A;  4FHX A;  5J2K A;  4MFF A;  5KG3 A;  4YG2 A;  1QLN A;  4YR0 A;  2XGQ A;  1ZQD A;  4RZR A;  4EBK A;  1ZQF A;  3QZ7 A;  5DQH A;  1S76 D;  4EYH B;  1T4G A;  4LZG A;  1R8A A;  4FBU A;  3PR4 A;  1Q78 A;  2XGP A;  1S97 A;  5J0S A;  2ZHB A;  3ORY A;  3ISB A;  9ICR A;  4DSI A;  4F92 B;  5KFQ A;  2ZJ5 A;  1R8B A;  3C2M A;  4UD4 A;  1ZQE A;  3EZ5 A;  1ZQB A;  9ICX A;  1ZQT A;  1B43 A;  4RWQ A;  5KFM A;  4IQT A;  4UB2 A;  3JPN A;  5KFE A;  5EOZ A;  4QZ8 A;  4EZ6 A;  4I2E A;  4P2H A;  5KG7 A;  4RPY A;  1TVA A;  3V7K A;  4GC7 A;  4RPZ A;  3RB0 A;  3RJJ A;  2P6U A;  1Q79 A;  5KG0 A;  3ZDD A;  4JV2 A;  5DG8 A;  5EWG A;  4EBC A;  4FO6 A;  3SZ2 A;  2AJQ A;  4F4K A;  2O1P A;  4Q45 A;  5HC9 A;  3M9M B;  4KLE A;  5KFJ A;  5EWE A;  2KFN A;  4RNN A;  3BQT A;  9ICA A;  1NOM A;  9ICJ A;  4BGD A;  3C2K A;  2BCV A;  4EBD A;  3EPG A;  2HHT A;  4IQV A;  4Q44 A;  1TK0 A;  4M2Y A;  5DGB A;  2Q0Z X;  2RFF A;  3NTU A;  4XQ7 A;  4DF8 A;  4ECY A;  9ICN A;  5IIN A;  3HJ1 A;  4MF8 A;  1T3N A;  1ZQN A;  4QWC A;  2C22 A;  7ICT A;  5HHI A;  4KLM A;  1MIY A;  1UA0 A;  5BOM A;  1UEV A;  1SKW A;  2HHS A;  1X9W A;  2JEF A;  2PBE A;  3OVB A;  1S0N A;  5KFI A;  4ELV A;  4QZA A;  4FS1 A;  7ICU A;  4F3O A;  4O5K A;  1S0V A;  4ED7 A;  1TFY A;  4QWE A;  4DOC A;  4P4M A;  1X2I A;  1S10 A;  3OV7 A;  3PV8 A;  3GQC A;  4O3P A;  8ICY A;  2M2V A;  4E80 A;  7ICP A;  4F5N A;  5J29 A;  4XUS A;  5KT3 A;  4PGQ A;  4PHD A;  1XSN A;  4O5E A;  4NLK A;  4YP3 A;  4FHW A;  3B0X A;  5DKW A;  2KZM A;  1JXE A;  4ECU A;  4I27 A;  1JQR A;  4KIT B;  7ICI A;  2MAX A;  4IRC A;  2AGQ A;  1NJW A;  4YD1 A;  3G6X A;  2PI4 A;  3PW2 A;  5J0X A;  1MQ3 A;  5J2E A;  3PW7 A;  4I2G A;  1KFT A;  9ICU A;  3JZ0 A;  1MQ2 A;  1ZQC A;  5CA7 A;  1L3S A;  4GXK A;  5KG4 A;  3RB4 A;  1S9F A;  4KLU A;  2XC9 A;  3RAX A;  4KLG A;  4PPX A;  3AQL A;  2ZH9 A;  3OUY A;  7ICQ A;  5DBC A;  3MAB A;  4O5C A;  4KLD A;  9ICO A;  4JK1 A;  4P4O A;  3C23 A;  5KTQ A;  1JIH A;  4UB5 A;  1NK7 A;  5HMM A;  5D49 A;  3GIM A;  3FDS A;  4ECX A;  4NM1 A;  2BE3 A;  2ZJA A;  4FHV A;  2JZB B;  2WTF A;  5KG1 A;  4TUQ A;  2W8K A;  2ZH1 A;  5L9X A;  4R65 A;  2AQ0 A;  5DB8 A;  4DWI A;  5BPC A;  1SL1 A;  3RTV A;  4RNO A;  4S3N A;  2OWO A;  3QEB Z;  1XWL A;  2ZTE A;  5KFW A;  4RQ5 A;  8ICI A;  1NO5 A;  4WC1 A;  9ICI A;  4UAY A;  5F9L A;  9ICE A;  4BWJ A;  3ETL A;  8ICZ A;  2JEG A;  3UXO A;  4ECR A;  4M9N A;  4DQR A;  2ZUD A;  5KG6 A;  5L1K A;  3UQ0 A;  5HML A;  1BPD A;  5CHG A;  1U45 A;  1OU5 A;  5KFT A;  4RQ7 A;  3PML A;  1R89 A;  2ZTC A;  1A77 A;  4DQQ A;  5CJ7 A;  3PW4 A;  3SV3 A;  3G6Y A;  9ICL A;  5KFY A;  5KFV A;  4RUC A;  4F4Y A;  3ZD8 A;  2C2E A;  3ZD9 A;  4RNM A;  2MUT A;  4EYI B;  3GIJ A;  3PX6 A;  2PFN A;  1DK3 A;  5IIK A;  5J2C A;  1JMS A;  4J9Q A;  4QZC A;  4M9L A;  5DBA A;  2BDP A;  5J2A A;  4Q8F A;  1B22 A;  5DDY A;  2HHP A;  3C18 A;  4QZB A;  3MGI A;  3RAQ A;  3T3F A;  4GLX A;  4YVZ A;  4YQW A;  2W9C A;  5HR9 A;  9ICW A;  3RB6 A;  2ASJ A;  2F1I A;  1NJZ A;  4HYK A;  2AGO A;  4UB3 A;  3OHB A;  4MEX A;  5HRK A;  1KFD A;  1XSP A;  5J0R A;  2IHN A;  1YLQ A;  1ZQR A;  4E8F A;  3TI0 A;  4DOA A;  2W9M A;  4CCH A;  7ICF A;  2KN7 A;  5KFK A;  4KLO A;  4DFP A;  2VA3 A;  4YR2 A;  2R8K A;  4QW8 A;  1ZQW A;  2I9G A;  4NLZ A;  5KFP A;  9ICV A;  4ECZ A;  3Q8M A;  3C5G A;  8ICJ A;  4F5O A;  1T7P A;  8ICF A;  2ZJ8 A;  4FBT A;  7ICV A;  8ICQ A;  4O0I A;  2HHV A;  4YCX A;  4DL5 A;  3H37 A;  4AT7 B;  2FPM A;  2ZH8 A;  4J9S A;  3JPT A;  3M8S A;  1ZQL A;  3Q8S B;  5HRL A;  4PGX A;  2RDI A;  4QW9 A;  4Q43 A;  4J9L A;  3MR2 A;  9ICM A;  3PVX A;  3OVA A;  5KFO A;  1A76 A;  3H7I A;  4IQU A;  4RQ8 A;  2UVV A;  7ICO A;  2W8L A;  3HT3 A;  5J2D A;  2J6U A;  4RT2 A;  4DL7 A;  2W9A A;  1QSY A;  2KZ3 A;  3C1Z A;  5KFR A;  2HVH A;  3M8R A;  4DQP A;  3GFK B;  5KT5 A;  3M9N B;  5C5J A;  1NK0 A;  5L1L A;  3UXP A;  2BCR A;  4JV1 A;  4M0A A;  2HW3 A;  2ZH4 A;  1KEJ A;  4DS4 A;  8ICE A;  5KFA A;  9ICB A;  5KFF A;  4KMU A;  1U49 A;  8ICX A;  4AT8 B;  2R8H A;  1K1Q A;  2ZH5 A;  1VFG A;  3WFO A;  5HHH A;  3H40 A;  1T8E A;  1BPB A;  5CR0 A;  3SV4 A;  4DQS A;  3AU2 A;  5J0P A;  3RH5 A;  1XSL A;  1U4B A;  3H8J A;  4RPX A;  4GC6 A;  2KTQ A;  2Q66 A;  4EZ9 A;  3NYB A;  4WC2 A;  4R8U B;  4QZE A;  2ZTD A;  3C2L A;  5J0Q A;  1ZQV A;  4Z6C A;  5J2J A;  4KLT A;  4YR3 A;  4DLG A;  4B9M A;  1PZN A;  3C66 A;  2DPI A;  3BJY A;  4UAW A;  4DSE A;  4NKT A;  3HWT A;  3ZDA A;  2V9W A;  3OJS A;  4F5R A;  2NRW A;  3N4M B;  4C8L A;  4F8R A;  2F1J A;  4X4P A;  1S0M A;  8ICU A;  4RQ2 A;  4IG8 A;  4UQG A;  3ISD A;  3QZ8 A;  1QSS A;  4M9G A;  4KLJ A;  1BPE A;  1DK2 A;  3PX0 A;  4BXO A;  3C5F A;  4UBB A;  3RJF A;  2DR5 A;  1NK4 A;  5EWF A;  3HPO A;  4GXI A;  1RYS A;  2DRB A;  2P6R A;  4F5Q A;  4ED6 A;  4AT7 A;  1Z00 A;  4F93 B;  4JUZ A;  1IXR A;  3GV5 B;  4UD5 A;  4X4V A;  3LDA A;  4J9P A;  1JXL A;  3V7J A;  2J6T A;  3PO4 A;  2M2T A;  4X0B A;  3PW0 A;  1BNO A;  4QZ9 A;  4KLH A;  4RUA A;  2C2R A;  1NK9 A;  1QSL A;  4WBZ A;  4F4W A;  3RH4 A;  4IQW A;  4X4O A;  3JPO A;  9ICK A;  1NZP A;  4DOB A;  3HIY A;  4RWO A;  1ZQY A;  2FPL A;  2M9N A;  1ZQO A;  5J0U A;  4AT8 A;  1RZT A;  4EP7 A;  3RJE A;  4UBC A;  4WCW A;  4F4X A;  4EEY A;  2M2U A;  3TFS A;  1MSW D;  8ICW A;  4I2I A;  4F50 A;  1ARO P;  2BCU A;  3TFR A;  1V4A A;  3HJ4 A;  2ASL A;  1TK5 A;  3ZDC A;  1K1S A;  4M6W B;  3KHL A;  4IRK A;  2ID1 A;  4K4G A;  2H5X A;  4QZI A;  4DQI A;  4YN4 A;  3PX4 A;  3EWA A;  1SKR A;  7ICS A;  1L3U A;  1XS9 D;  4X4T A;  4KLF A;  5J0W A;  3B0Y A;  4ZH4 A;  3ISC A;  1H38 A;  2PFO A;  4DSK A;  3LK9 A;  7ICK A;  1ZQI A;  9ICG A;  3H3A A;  1X9S A;  1HUZ A;  4MFA A;  3RJH A;  4M04 A;  4ECV A;  2XCP A;  4R64 A;  3GV8 B;  1NJX A;  3E2E A;  8ICO A;  2B21 A;  1KFS A;  7ICR A;  1ZQX A;  3OHA A;  2IMW P;  4B9U A;  1F5A A;  3WFS C;  2NRZ A;  3C21 A;  4M5D A;  1NK5 A;  4IR1 A;  4X4U A;  1KNY A;  2BPG A;  2HHU A;  2P66 A;  3QEA Z;  4K4H A;  4X0A A;  5HNK A;  1XO1 A;  1WOT A;  3JPQ A;  1ZQH A;  3V6H A;  9ICF A;  4DL4 A;  4EBJ A;  1ZQG A;  4NKU A;  1NKB A;  3UPS A;  4I2J A;  2BHN A;  4ECQ A;  9ICH A;  4RWP A;  3PMN A;  5F2V O;  1UET A;  3BQ0 A;  2KFZ A;  8ICK A;  4PH5 A;  4LT6 A;  4FHY A;  4DFM A;  4NLN A;  4EBE A;  2BGW A;  2JEI A;  1N48 A;  4X4Q A;  4ED0 A;  4I2B A;  4DLE A;  3T5K A;  4DFK A;  5KFC A;  3AQK A;  1ZJN A;  2AGP A;  3JPR A;  1R8C A;  4JV0 A;  1N56 A;  4AT9 B;  1V9P A;  1ZQA A;  3UXN A;  2C2D A;  3RJG A;  4JWN A;  4O9M A;  7ICJ A;  4ECW A;  9ICT A;  3LWM A;  4DL6 A;  3WFQ E;  3V6K A;  1XU4 A;  4FHP A;  3K4G A;  2XY6 A;  2XO7 A;  4M9J A;  2LYH A;  2W9B B;  3OJU A;  1SL0 A;  4B9T A;  4C8K A;  3TAQ A;  9ICC A;  5HRG A;  2BKE A;  4LZD A;  4RQ3 A;  5CP2 A;  5DG9 A;  3HW8 A;  3RBE A;  5KFX A;  2ASD A;  1UA1 A;  3OGU A;  1S0O A;  8ICR A;  4WC4 A;  2GWS A;  4WC0 A;  2JZB A;  4TQR A;  4GXJ A;  4YMN A;  4Z6E A;  2NRV A;  1RPL A;  4XA5 A;  3KHG A;  3V6J A;  1D8Y A;  2DRA A;  4C8O A;  4DSJ A;  4QZD A;  1PX5 A;  1CEZ A;  1NJY A;  1RXW A;  4X4R A;  1Z3E B;  5TZV A;  4TUP A;  5HRH A;  4TUS A;  1ZQJ A;  2Y1I A;  2RDJ A;  2IHM A;  8ICG A;  4WC3 A;  5KFS A;  4DL2 A;  1NK6 A;  4MFC A;  2I1Q A;  4YMO A;  3ZDB A;  4E0D A;  3TAP A;  2DR8 A;  3GIL A;  2F1H A;  1BNP A;  4YXJ A;  2BPC A;  4FH3 A;  3OVS A;  4Z6D A;  3RR7 A;  5HRE A;  1TFW A;  4QWA A;  4DF4 A;  2FLL A;  3PNC A;  2IBK A;  2FPK A;  3QE9 Y;  4B9S A;  4YFK A;  1MC8 A;  1UT5 A;  2KP7 A;  2PFQ A;  3T5J A;  1LV5 A;  3HP6 A;  5IIL A;  3SYZ A;  1X9M A;  1FA0 A;  1L3T A;  3PR5 B;  5DDM A;  4WC5 A;  1SKS A;  4AT9 A;  1ZQU A;  3LQC B;  5DQI A;  1UT8 A;  1CUK A;  3FYH A;  2AU0 A;  4J9N A;  4DEZ A;  2V4R A;  3NGD A;  5D4B A;  4M9H A;  1S77 D;  7ICE A;  4FH5 A;  2C28 A;  5KT2 A;  1ZQK A;  5HRD A;  4DL3 A;  8ICM A;  3MFI A;  3H8W A;  4UB1 A;  2ZH3 A;  3MR3 A;  2V4Q A;  1U9L A;  8ICB A;  2HHQ A;  2KZZ A;  4Q8E A;  3BQ1 A;  4NM2 A;  3AU6 A;  3OSP A;  2BQR A;  4PGY A;  1HJP A;  1JAJ A;  2A1J B;  4Z6F A;  5JUM A;  4G3I A;  2ZH7 A;  2FMQ A;  2ISP A;  3RH6 A;  2NRX A;  1QTM A;  5D46 A;  2XY5 A;  1ZJM A;  3JYY A;  3L9D A;  5KFD A;  2ATL A;  2FMS A;  3Q8P B;  3WFP A;  2BQU A;  3T5L A;  4O3S A;  5HRF A;  2DFL A;  3MR6 A;  4KN7 A;  3K75 D;  4K4I A;  3EW9 A;  5J0T A;  1RXV A;  5DBB A;  1IM4 A;  4NLG A;  8ICV A;  5DQG A;  1SL2 A;  3H38 A;  2BPF A;  3OUY B;  4BWM A;  1BPY A;  1MIW A;  3SI8 A;  4ELT A;  9ICQ A;  4RWN A;  4P4P A;  3AQN A;  5DED A;  5KT7 A;  1D9D A;  4XRH A;  3G6V A;  2BR0 A;  1LB2 B;  2UVW A;  4XQ8 A;  4F2R A;  4RQ0 A;  4UAZ A;  4ECT A;  4J9R A;  1KRP A;  1JN3 A;  5IIM A;  1COO A;  4QZH A;  8ICS A;  4X5V A;  2ZH2 A;  5J2H A;  1C7Y A;  2BQ3 A;  4O3R A;  4RQ4 A;  3UPQ A;  8ICN A;  3IM1 A;  3T5H A;  7ICL A;  1ZQZ A;  4R8U A;  1WCL A;  1NKC A;  1KDH A;  4ELU A;  4PHA A;  3BQ2 A;  1U48 A;  5F9N A;  4MF2 A;  3TAR A;  4RQ6 A;  1ZQQ A;  3MBY A;  3AQM A;  2BCQ A;  3V72 A;  4ED8 A;  3RJK A;  4QWD A;  2ALZ A;  2ZHA A;  3M9O B;  4I2H A;  2A1J A;  4FS2 A;  4ED3 A;  3BDP A;  3JPP A;  4F2S A;  2VA2 A;  4WBY A;  1EXN A;  3MDA A;  5IIO A;  4I28 A;  1TAU A;  8ICT A;  1D8L A;  5IIJ A;  3GV7 B;  4O3Q A;  3GII A;  2JEJ A;  8ICC A;  7ICN A;  2MUT B;  5J2G A;  4TQS A;  4M47 A;  3Q8K A;  8ICP A;  2HHX A;  3KTQ A;  4WC6 A;  4RU9 A;  1TAQ A;  3MR5 A;  5DLF A;  3TQ1 A;  1BPZ A;  2ISO A;  3RJI A;  3PO5 A;  2HVI A;  4WC7 A;  1ZQS A;  4KTQ A;  5BOL A;  2ZH6 A;  1SZP A;  5CB1 A;  2W9C B;  2R8G A;  3N97 B;  1TFR A;  4YD2 A;  1WCN A;  3OSN A;  4F91 B;  2M2W A;  3RRG A;  5KFU A;  4DSL A;  4KLS A;  4O3O A;  4DS5 A;  4KLQ A;  1DOQ A;  1BGX T;  3KHR A;  4KLL A;  5KG2 A;  5KFH A;  2R8J A;  2DPJ A;  3LWL A;  2XCA A;  1KSP A;  5DG7 A;  4C8M A;  4UB4 A;  1L5U A;  5KFZ A;  4MEY A;  2UVU A;  4DFJ A;  3GIK A;  2O5A A;  3Q8Q B;  4B9V A;  5KT4 A;  1RYR A;  4B9L A;  5J0Y A;  3V7L A;  5J2I A;  5III A;  5HRB A;  8ICA A;  4I29 A;  4PHE A;  2FMP A;  1KTQ A;  2DR7 A;  5KFB A;  1TK8 A;  4LVS A;  3PW5 A;  1Y88 A;  5KG5 A;  4R63 A;  4X4S A;  3TAN A;  4NXZ A;  5KFG A;  2UVR A;  4DO9 A;  4M6W A;  2PXI A;  4O3N A;  1NKE A;  4ATB B;  3Q8R B;  3UQ2 A;  1U47 A;  2NRT A;  4F4Z A;  3ZDE A;  1HUO A;  4QZG A;  5DB7 A;  4KN4 A;  1BPX A;  4KLI A;  5J2B A;  4ED2 A;  3KHH A;  2ZUB A;  2VA8 A;  9ICP A;  2R8I A;  5DB6 A;  3HX0 A;  2AQ4 A;  4B9N A;  3EYZ A;  4R66 A;  1D9F A;  3MFH A;  3RB3 A;  2PFP A;  5L1J A;  4I2C A;  1MIV A;  4X4N A;  3MDC A;  5J2F A;  4I2D A;  3H8S A;  4TUR A;  4F5P A;  5J0O A;  3THV A;  2XY7 A;  2BCS A;  4IRD A;  3Q8L A;  4YXM A;  1ZQM A;  4PHP A;  4YMM A;  9ICS A;  5DB9 A;  3EPI A;  1ZET A;  1NK8 A;  1L3V A;  4NY8 A;  3RR8 A;  7ICH A;  2J6S A;  5KFL A;  1TV9 A;  1TKD A;  4QZF A; 
#chains in the Genus database with same CATH topology
 5CWR A;  5KT6 A;  3H39 A;  4RQ1 A;  5HRI A;  4J9O A;  1XC9 A;  2XVT A;  5L1I A;  3O0F A;  5KFN A;  3PY8 A;  2NO5 A;  1DGS A;  4I2F A;  3AUO A;  3CW2 C;  1SB3 C;  8ICH A;  1V85 A;  3H4D A;  2EQY A;  4FHX A;  1ZOL A;  1JUD A;  1T4G A;  1S97 A;  3RF9 A;  3OPX A;  3CYM A;  3C29 A;  2HN1 A;  4JMU A;  2BBH A;  2QB0 A;  2ZJ5 A;  2JR5 A;  3C2M A;  1ZQE A;  2AHO B;  2JRZ A;  2KIV A;  5B3Q A;  5EOZ A;  4OJP A;  2RHF A;  2YN4 A;  1TVA A;  3V7K A;  2ES6 A;  2P6U A;  4OO1 J;  3ZDD A;  1ZD5 A;  5HC9 A;  2KFN A;  2FJ6 A;  2BCV A;  2HHT A;  3EPG A;  1TK0 A;  2LPE A;  4DF8 A;  1XO0 A;  1T3N A;  1ZQN A;  2GO7 A;  4QWC A;  2C22 A;  1UEV A;  4KLM A;  2WAQ F;  5BOM A;  1UA0 A;  1S0N A;  5KFI A;  3MGV A;  4FS1 A;  4F3O A;  1ZD3 A;  3GQC A;  8ICY A;  3WKB A;  2M2V A;  7ICP A;  4PHD A;  4YP3 A;  1JQR A;  4PL2 A;  3D2N A;  5AKJ A;  5J0X A;  1L7M A;  9ICU A;  1CI4 A;  4KLU A;  4GXK A;  5ALL A;  4JB3 A;  3AQL A;  3RAX A;  2ZH9 A;  2NO4 A;  3MAB A;  4O5C A;  4UB5 A;  2LM1 A;  5KG1 A;  2B56 A;  3VC8 A;  5BPC A;  1SL1 A;  3RTV A;  1X40 A;  4EX7 A;  2OWO A;  3NVV A;  9ICI A;  4UAY A;  3QUQ A;  9ICE A;  4NXT A;  2ZTC A;  2DQN B;  1A77 A;  4DQQ A;  5CJ7 A;  3PW4 A;  2HBL A;  3G6Y A;  2EDU A;  3EUB 2;  1N63 A;  3I1Y A;  4O69 A;  2HHP A;  3C18 A;  3T3F A;  4YQW A;  2W9C A;  3D2Q A;  1Q3U A;  1VDV A;  2AGO A;  4UB3 A;  2A1A A;  2H3I A;  1XSP A;  1ZQR A;  3BZK A;  2W9M A;  2E3T A;  3ZI4 A;  4KLO A;  4DFP A;  5AI0 A;  4YR2 A;  4NLZ A;  4ECZ A;  2DKZ A;  4F5O A;  4F72 A;  8ICQ A;  4O0I A;  5AHX A;  3VCB A;  4DCC A;  2FPM A;  5D62 A;  4J9S A;  3M7D A;  1L6N A;  3Q8S B;  4PGX A;  3QYP A;  3PVX A;  2W7O A;  1A76 A;  5B66 U;  4RQ8 A;  7ICO A;  3HT3 A;  2J6U A;  4DL7 A;  2ZXH A;  1QSY A;  4QIW C;  2KSO A;  5KFR A;  2HVH A;  4DQP A;  3M9N B;  2BCR A;  4JV1 A;  2ZH4 A;  5L1L A;  2CRX A;  4AT8 B;  2K8B B;  5KFA A;  1U49 A;  3NKU A;  3H8M A;  5ALH A;  5HHH A;  3TAD A;  1BPB A;  5CR0 A;  1BPY A;  3AU2 A;  5J0P A;  3BZC A;  3H8J A;  1YT3 A;  4NJ8 A;  3M1Y A;  3TAD C;  4QZE A;  4KLT A;  4NXU A;  3BJY A;  3ZDA A;  2V9W A;  4F8R A;  2NRW A;  4IG8 A;  3GZF A;  3T79 A;  1QSS A;  4M9G A;  4EEN A;  2DR5 A;  3WKA A;  5AM5 A;  4ED6 A;  4F93 B;  4X4V A;  5ALS A;  3LDA A;  1JXL A;  4G9B A;  2Y9T A;  3PW0 A;  2K89 A;  2C2R A;  1QSL A;  4F4W A;  4IQW A;  4X4O A;  3JPO A;  9ICK A;  1NZP A;  2WB1 F;  2FPL A;  2M9N A;  4EP7 A;  2HI0 A;  4UBC A;  4I2I A;  4F50 A;  5F3X B;  2ASL A;  1K1S A;  3KHL A;  5AM3 A;  1RQL A;  2H5X A;  4DQI A;  4YN4 A;  1L3U A;  4X4T A;  4ZH4 A;  3ISC A;  4DSK A;  3H3A A;  1ZQI A;  3WK7 A;  1S5L U;  4M04 A;  1OW5 A;  2K60 A;  2K4I A;  1A0P A;  8ICO A;  2B21 A;  1KFS A;  2IMW P;  1Q3V A;  5KAI U;  3IG8 A;  3C21 A;  2P66 A;  4K4H A;  5HNK A;  1XO1 A;  1ZXI A;  4DL4 A;  2ODG A;  3UPS A;  3NRZ A;  9ICH A;  3BQ0 A;  2KFZ A;  8ICK A;  4LT6 A;  3FM9 A;  4FHY A;  4NLN A;  4X4Q A;  1T3Q A;  3C28 A;  2W55 A;  3DEE A;  5KFC A;  3AQK A;  1YZ7 A;  4AT9 B;  1ZQA A;  2G08 A;  2KV2 A;  2PKE A;  3NUQ A;  1F44 A;  4FHP A;  4M9J A;  2W9B B;  3OJU A;  1SL0 A;  4B9T A;  3H0R B;  4LZD A;  2KIC A;  2E1F A;  4FZN A;  8ICR A;  2HOF A;  4NXV A;  2NRV A;  2DRA A;  4OAF A;  3KHG A;  3ERC C;  4Y2R A;  1PX5 A;  2LI6 A;  1NJY A;  1RXW A;  4TUS A;  8ICG A;  5KFS A;  3QX7 A;  4DL2 A;  3QXG A;  2EAM A;  2YTU A;  3GIL A;  2F1H A;  3IV6 A;  2ZIU B;  3BS5 B;  2BPC A;  3U26 A;  5CHE A;  3OVS A;  3RR7 A;  5HRE A;  1QQ7 A;  5J8Y A;  3PNC A;  4ICA A;  4O3M A;  1QH9 A;  5ALW A;  4B9S A;  5ALK A;  5J8Y C;  1LV5 A;  2KJ9 A;  1CRX A;  5AKZ A;  4KMO B;  1CUK A;  2E1E A;  3NGD A;  1IIP A;  3OWG A;  2MRL A;  7ICE A;  1ZQK A;  5G5H A;  4DL3 A;  3H8W A;  4UB1 A;  2ZH3 A;  2BZF A;  1U9L A;  8ICB A;  5H2F U;  2K4H A;  4Y2Q A;  1HJP A;  2WF8 A;  2WF6 A;  5JUM A;  2FMQ A;  3S6J A;  3AN1 A;  2XY5 A;  1ZJM A;  3L9D A;  3K1Z A;  1SV0 A;  3T5L A;  4OD0 A;  4KN7 A;  1SV0 C;  1K5O A;  4K4I A;  3WKD A;  1PUZ A;  1RXV A;  1IM4 A;  1SL2 A;  2BPF A;  1MIW A;  9ICQ A;  4K99 A;  2VJ5 A;  2BR0 A;  3G6V A;  1LB2 B;  4XQ8 A;  4QNL A;  1J97 A;  1N62 A;  4ECT A;  1JN3 A;  4ZOH C;  2H3F A;  3PSF A;  5AI6 A;  4QZH A;  3N7R C;  2I5H A;  1M6Y A;  5J2H A;  3IM1 A;  2G07 A;  1KNY A;  1RQN A;  4PHA A;  3BQ2 A;  1U48 A;  3KD3 A;  4MF2 A;  1ZQQ A;  4RQ6 A;  4QWD A;  2DKX A;  2YML A;  4UAR A;  3QU5 A;  4NXW A;  2VA2 A;  5IIO A;  8ICT A;  2OM6 A;  1D8L A;  5IIJ A;  4O3Q A;  2JEJ A;  2MUT B;  4TQS A;  4M47 A;  3QU4 A;  3Q8K A;  1X6I A;  4J03 A;  5DLF A;  2PMZ F;  4IL6 U;  5ALI A;  5BOL A;  1WCN A;  3OSN A;  2M2W A;  1JRP A;  4KLL A;  2KKV A;  2DPJ A;  3LWL A;  2BDU A;  4MEY A;  4GFJ A;  4EGW A;  3V7L A;  4PHE A;  3EF2 A;  5D61 A;  2FMP A;  1Y88 A;  2GAF D;  4HX0 A;  4LEZ A;  2KHV A;  5ALV A;  4KN4 A;  2VA8 A;  2PFP A;  2RP5 A;  4I2C A;  2M0N A;  1MIV A;  4C4R A;  3AEV A;  5J0O A;  3THV A;  3N28 A;  4PL1 A;  4PHP A;  9ICS A;  5DB9 A;  4OJ6 A;  4ACO A;  1ZET A;  3UM9 A;  2J6S A;  5KFL A;  1TKD A;  2ZIW B;  2FCL A;  1Z4O A;  4C0Z A;  3GU3 A;  4WQL A;  2FDR A;  3BS7 A;  4DSF A;  2DR9 A;  4CNQ A;  1JAL A;  3RRH A;  4OJO A;  5TIS U;  3RBD A;  1COK A;  4P0P B;  1T94 A;  3FC4 A;  4IR9 A;  1P7D A;  4CF4 A;  2FLN A;  7ICM A;  2EH9 A;  3H4B A;  2HHW A;  1UEU A;  1Z00 B;  2W9B A;  2IA6 A;  1DXS A;  2JH7 A;  4ED1 A;  3IN5 A;  4JWM A;  3JPS A;  4Y2V A;  3TKA A;  1QLN A;  2XGQ A;  4O67 A;  4Y2J A;  1ZQF A;  5DQH A;  1S76 D;  2E8M A;  3E58 A;  4FBU A;  1Q78 A;  3K1R B;  2XGP A;  3ORY A;  4DSI A;  4RQM A;  3EZ5 A;  1ZQB A;  5EE9 A;  1FEZ A;  2ZIU A;  3BS5 A;  4C80 A;  2W11 A;  4F71 A;  4UB2 A;  4EZ6 A;  3NWI A;  4GC7 A;  4RPZ A;  2EAP A;  4JV2 A;  4FO6 A;  3SZ2 A;  3IDW A;  2O1P A;  3KZX A;  4Q45 A;  4RNN A;  3BQT A;  1NOM A;  9ICJ A;  4EBD A;  5ALJ A;  2RFF A;  4O68 A;  9ICN A;  5IIN A;  2MU2 A;  3N7S C;  1MIY A;  3AQE A;  2HHS A;  2PBE A;  2JEF A;  4ELV A;  3OV7 A;  1F0M A;  4E80 A;  4IS7 A;  4PGQ A;  4XUS A;  5KT3 A;  4XJE A;  1KBU A;  4X0A A;  4ECU A;  5AM1 A;  2AGQ A;  1NJW A;  3G6X A;  3PW2 A;  3JZ0 A;  1KFT A;  5KG4 A;  3RB4 A;  1S9F A;  3I76 A;  1UPH A;  5HR6 A;  4KLD A;  4JK1 A;  3HIY A;  1NK7 A;  2Y0S C;  2OXO A;  3GIM A;  3FDS A;  4NM1 A;  2BE3 A;  4FHV A;  2WTF A;  5L9X A;  4R65 A;  3K7D A;  3AMZ A;  4RNO A;  8ICI A;  5F9L A;  3ETL A;  2JEG A;  5HML A;  1U45 A;  1GO3 F;  2KSO B;  4Y2T A;  4RUC A;  2C2E A;  2MUT A;  1DK3 A;  5AI4 A;  5J2C A;  4M9L A;  5J2A A;  5DDY A;  4NXX A;  1B0X A;  3ED5 A;  4YVZ A;  5HR9 A;  2KNJ A;  9ICW A;  3RB6 A;  1NJZ A;  2F1I A;  3OHB A;  4MEX A;  2G06 A;  1KFD A;  5J0R A;  5AIC A;  2IHN A;  2VA3 A;  5D63 A;  1JRO A;  2R8K A;  4QW8 A;  2I9G A;  2L5Y A;  5EE0 A;  1T7P A;  4FBT A;  7ICV A;  4NL9 A;  3HKZ F;  4YCX A;  4DL5 A;  3JPT A;  3M8S A;  4NL9 C;  2HSZ A;  3MR2 A;  9ICM A;  3H7I A;  2UVV A;  5ALX A;  2WB1 C;  3M8R A;  1OXJ A;  8ICJ A;  1NK0 A;  1KKX A;  3UXP A;  2CPR A;  1KEJ A;  4KMU A;  2ZH5 A;  1VFG A;  4UAT A;  1K1Q A;  4FE3 A;  3SV4 A;  4I2G A;  1XSL A;  3WK9 A;  1N5W A;  4RPX A;  2KEY A;  2KTQ A;  2Q66 A;  4WC2 A;  1Q46 A;  2ZIW A;  5CRX A;  4UAW A;  4NKT A;  4C8L A;  2F1J A;  4X4P A;  1S0M A;  4EEB A;  1DK2 A;  3PX0 A;  4UBB A;  1TAM A;  4P0P A;  1NK4 A;  3UMC A;  1RYS A;  4NWI A;  1N60 A;  3MCR A;  1Z00 A;  4UD5 A;  4JUZ A;  1IXR A;  3KBB A;  3V7J A;  2HDO A;  2M2T A;  5AM0 A;  1X66 A;  4KLH A;  5JRT A;  2DUY A;  4C4T A;  5AK6 A;  1RZT A;  2QAR A;  4F4X A;  3TFS A;  1V4A A;  3HJ4 A;  3ZDC A;  4M6W B;  4IRK A;  2ID1 A;  4K4G A;  5J0W A;  3B0Y A;  1X9S A;  4Y2U A;  4C7Z A;  4IC9 A;  3WK5 A;  3H0L B;  3OHA A;  2NRZ A;  2HHU A;  1WOT A;  3JPQ A;  4I2J A;  3PMN A;  1UHU A;  1UET A;  2F8K A;  4KB6 A;  4DFM A;  4ED0 A;  3WK4 A;  1ZJN A;  4FFD A;  2K8A A;  2C2D A;  3RJG A;  2VIX A;  3WFQ E;  3V6K A;  1SGG A;  5CFU A;  2LYH A;  1ZRN A;  2OHF A;  9ICC A;  5HRG A;  5ALY A;  1S0O A;  4WC4 A;  1F5S A;  4TQR A;  4YMN A;  3V6J A;  1RPL A;  1CEZ A;  2JV3 A;  1ZQJ A;  1GPJ A;  2IHM A;  3ZDB A;  3KOO A;  3NRW A;  2OYY A;  3HJE A;  1TFW A;  2F3N A;  2FLL A;  2FPK A;  1UT5 A;  2KP7 A;  3T5J A;  5AI5 A;  1L3T A;  3PR5 B;  4WC5 A;  2IOF A;  3SAH A;  3FYH A;  2ZG6 A;  3WK8 A;  4DEZ A;  4J9N A;  1S77 D;  5KT2 A;  5AIA A;  5B3P A;  3OSP A;  2KK0 A;  4CGZ A;  4N7R A;  4WJ3 B;  4G3I A;  2YQE A;  3F2B A;  1S8O A;  4I0U A;  5D46 A;  3JYY A;  1PVR A;  5KFD A;  3Q8P B;  4B6J A;  2OEH A;  2BQU A;  5HRF A;  1FFU A;  3EW9 A;  5DBB A;  2BBJ A;  8ICV A;  3OUY B;  4OCZ A;  1ED1 A;  2D8C A;  4JLZ A;  3SAG A;  4F2R A;  4A8E A;  1N5X A;  1KRP A;  4UAV A;  8ICS A;  2ZH2 A;  3D6J A;  4NLC A;  4O3R A;  1Q8K A;  3UPQ A;  3T5H A;  7ICL A;  4ELU A;  5F9N A;  3TAR A;  3UMG A;  3MBY A;  2O6K A;  3V72 A;  2BCQ A;  2ALZ A;  4I2H A;  1FO4 A;  5GTH U;  3MDA A;  4I28 A;  1TAU A;  8ICC A;  7ICN A;  2OH2 A;  3KTQ A;  1QQ6 A;  3MR5 A;  2ISO A;  3RJI A;  3PO5 A;  2HVI A;  1KL9 A;  4KTQ A;  4WC7 A;  2XID A;  5CB1 A;  1TFR A;  4YD2 A;  4F91 B;  1VJ5 A;  4KLS A;  4KLQ A;  1DOQ A;  3M6Z A;  2YMQ A;  2R8J A;  5AI9 A;  2XCA A;  1KSP A;  5DG7 A;  2UVU A;  1R8C A;  4WBZ A;  5KFZ A;  4OJ5 A;  3Q8Q B;  5III A;  2P35 A;  4I29 A;  5KFB A;  2AXT U;  1LVH A;  2IUB A;  1LKY A;  4M6W A;  1WUD A;  2NRT A;  3ZDE A;  5J2B A;  9ICP A;  2ZUB A;  2LBO A;  3HX0 A;  2YY6 A;  5JTG A;  2Q4T A;  2HN2 A;  2XY7 A;  2BCS A;  4IRD A;  1ZQM A;  4YMM A;  3EPI A;  4NY8 A;  5L1M A;  1WYG A;  5DEC A;  4Y2X A;  1PK3 A;  1WWV A;  3AM9 A;  2FLP A;  2W54 A;  5KL8 B;  2PI5 A;  3IHQ B;  8ICL A;  3SAF A;  2G5H B;  2WF5 A;  4BXO B;  4E7X A;  7ICG A;  4J9K A;  2KHQ A;  3UMB A;  1JX4 A;  1ZQP A;  4OAI Z;  3MGH A;  5AM4 A;  4RT3 A;  3B9J A;  2ZUC A;  3WFR E;  2VAN A;  4I2A A;  2B0C A;  5J2K A;  3A0B U;  2KE7 A;  5T14 A;  4EBK A;  4RQN A;  3QZ7 A;  4EYH B;  1R8A A;  3PR4 A;  5J0S A;  1NI3 A;  9ICR A;  1SV4 A;  5KNI A;  4NV0 A;  1R8B A;  4UD4 A;  5AKL A;  1L8L A;  1ZQT A;  5ALN A;  4RWQ A;  2D3D A;  5KFM A;  5KFE A;  4QZ8 A;  4I2E A;  5KG7 A;  3RB0 A;  3QNM A;  1Q79 A;  5KG0 A;  5DG8 A;  5EWG A;  3DV9 A;  2EAO A;  2YB1 A;  2AJQ A;  3M9M B;  4KLE A;  5KFJ A;  3C2K A;  4IQV A;  4Q44 A;  5DGB A;  2Q0Z X;  5AK4 A;  2KMD A;  5ALO A;  3HJ1 A;  4MF8 A;  2DL0 A;  7ICT A;  5HHI A;  4UAU A;  1X9W A;  4QZA A;  2KJ5 A;  4O5K A;  1TFY A;  1HIW A;  4QWE A;  4P4M A;  1X2I A;  5ALD A;  4DOC A;  4K9A A;  4QIW F;  2HBK A;  5J29 A;  4O5E A;  4NLK A;  5DKW A;  4I27 A;  2CN1 A;  4IRC A;  1HEK A;  3NVY A;  3NVZ A;  4YD1 A;  5ALM A;  5CFT A;  1ZD2 P;  1MQ3 A;  2ZIV B;  4JLX A;  1L3S A;  4PPX A;  2XC9 A;  4KLG A;  3OUY A;  7ICQ A;  9ICO A;  4LEW A;  5KTQ A;  3C23 A;  1JI7 A;  3WKC A;  3CRX A;  2ZJA A;  4Y2Y A;  2JZB B;  4TUQ A;  2W8K A;  2AQ0 A;  3PHZ A;  4S3N A;  2B4V A;  3QEB Z;  5KFW A;  2ZTE A;  4RQ5 A;  1NO5 A;  2W04 A;  3NVO A;  1VLB A;  2K4E A;  2HOI A;  4US9 A;  2IOH A;  3F5E A;  3HRD D;  5CHG A;  1OU5 A;  5KFT A;  4RQ7 A;  3PML A;  1R89 A;  3SV3 A;  9ICL A;  4OJL A;  3LVW A;  5KFY A;  5KFV A;  4F4Y A;  3ZD9 A;  4EYI B;  5IIK A;  1B22 A;  1JMS A;  3KZI U;  4QZC A;  4J9Q A;  4Q8F A;  1V97 A;  4QZB A;  3MGI A;  3RAQ A;  2YX8 A;  4GLX A;  2ASJ A;  5AM2 A;  4HYK A;  2EZY A;  4DFD A;  5HRK A;  1YLQ A;  4E8F A;  2W3S A;  4DOA A;  7ICF A;  2F8L A;  1ZQW A;  9ICV A;  3C5G A;  8ICF A;  2ZJ8 A;  1KN5 A;  4PZO A;  2Y9U A;  2JHD A;  2WAQ C;  5HRL A;  4J9L A;  1PVQ A;  3SR6 A;  4C7Y A;  4K97 A;  2W8L A;  2RLT A;  1X42 A;  2W9A A;  2KZ3 A;  2DGZ A;  4F4K A;  3GFK B;  2HW3 A;  8ICE A;  5KFF A;  8ICX A;  2R8H A;  2QAR B;  1T8E A;  4AYB F;  5AKI A;  4CF3 A;  4GC6 A;  4EZ9 A;  3NYB A;  1SZH A;  2ZTD A;  3AL0 B;  3C2L A;  5J0Q A;  4Z6C A;  2LHT A;  4MHV A;  5J2J A;  4DLG A;  2DPI A;  2AH5 A;  4PZN A;  4DSE A;  4FZL A;  1ZRM A;  3HWT A;  3OJS A;  3N4M B;  8ICU A;  4RQ2 A;  4UQG A;  3R9K A;  1BPE A;  2QKQ A;  3FAH A;  4BXO A;  1FIQ A;  4CF5 A;  3HPO A;  2DRB A;  4AT7 A;  1IV8 A;  3GV5 B;  2LMR A;  4FO1 A;  1BNO A;  2NV3 A;  4RUA A;  5AIB A;  4US8 A;  2QB1 A;  5EE3 A;  4RWO A;  3RFA A;  2DWQ A;  3F2D A;  5J0U A;  3RJE A;  4EEY A;  8ICW A;  1ARO P;  3PST A;  3TFR A;  1TK5 A;  3L4P A;  3IRU A;  5ALF A;  7ICS A;  2E8N A;  1SKR A;  2NYV A;  1XS9 D;  4KLF A;  2PFO A;  9ICG A;  1HUZ A;  3RJH A;  4HAI A;  4ECV A;  4R64 A;  3GV8 B;  1NJX A;  7ICR A;  5ALG A;  4B9U A;  4NKU A;  9ICF A;  3V6H A;  2VJ4 A;  3QU2 A;  1NKB A;  3L3F X;  1N61 A;  4PH5 A;  3CK6 A;  2GA9 D;  4EBE A;  2BGW A;  1N48 A;  4I2B A;  4DLE A;  3T5K A;  2AGP A;  3JPR A;  4JV0 A;  1N56 A;  1V9P A;  4LJX A;  3UXN A;  1RYU A;  4JWN A;  4O9M A;  9ICT A;  4DL6 A;  2ZIV A;  4OAG A;  3K4G A;  2G09 A;  3ICX A;  2BKE A;  3HW8 A;  4RQ3 A;  5KFX A;  2ASD A;  3OGU A;  2GWS A;  4WQK A;  2JZB A;  4GXJ A;  4Z6E A;  4XA5 A;  1D8Y A;  4C8O A;  4DSJ A;  4QZD A;  5FP0 A;  4P0Q B;  1Z3E B;  5TZV A;  4TUP A;  4X4R A;  1SWW A;  4WC3 A;  4PJ0 U;  4C4S A;  4MFC A;  2HCF A;  4YMO A;  1URJ A;  4FH3 A;  3KKA A;  4QWA A;  3KKA C;  1N2X A;  2F44 A;  3OTQ A;  4YFK A;  2PFQ A;  1FA0 A;  3SYZ A;  2B51 A;  5DDM A;  3HIL A;  3SD7 A;  3QUC A;  4KX5 A;  1OUQ A;  3LQC B;  5DQI A;  5D4B A;  4M9H A;  4FH5 A;  5HRD A;  2V4Q A;  2KZZ A;  4Y2S A;  3NS1 A;  4NM2 A;  1JAJ A;  4Z6F A;  2ZH7 A;  2YMM A;  2KVC A;  2KIW A;  2GLE A;  2FMS A;  2ATL A;  1DRG A;  3BQ7 A;  4O3S A;  2DFL A;  3MR6 A;  3SQI A;  2N1R A;  1KQQ A;  2GOL A;  5A0L A;  3H38 A;  4U7C A;  3SI8 A;  3AQN A;  5DED A;  1J2N A;  4UB6 U;  1D9D A;  2UVW A;  3NAS A;  4UAZ A;  4J9R A;  2E8P A;  3J81 j;  1C20 A;  1COO A;  4X5V A;  2BQ3 A;  2G5I B;  2F2A B;  8ICN A;  1LKY B;  1ZQZ A;  2JXJ A;  1WCL A;  1NKC A;  4O6A A;  2A3V A;  2FE9 A;  3AQM A;  4ED8 A;  1PK1 B;  2A1J A;  4FS2 A;  4ED3 A;  3BDP A;  3DDH A;  4F2S A;  1EXN A;  2JGA A;  3GV7 B;  3GII A;  2LKY A;  2KG5 A;  5J2G A;  1NZB A;  8ICP A;  5CFS A;  2HHX A;  1TAQ A;  1AQ6 A;  1ZQS A;  1SZP A;  2XIC A;  2A19 A;  1Z19 A;  4UW9 A;  4EX6 A;  4DSL A;  1BGX T;  5KG2 A;  4LEV A;  3TAC B;  1L5U A;  4XQ7 A;  3WFP A;  2O5A A;  3GIK A;  5KT4 A;  5JTI A;  5J2I A;  5HRB A;  3I28 A;  3QU9 A;  2LYB A;  2DR7 A;  4LVS A;  1TK8 A;  4X4S A;  3PW5 A;  5KG5 A;  4R63 A;  3TAN A;  5KFG A;  2UVR A;  4DO9 A;  2PXI A;  4KM5 A;  3UQ2 A;  4K96 A;  2H3V A;  4QZG A;  5DB7 A;  1BPX A;  3KHH A;  2R8I A;  5DB6 A;  4B9N A;  3ER9 B;  5L1J A;  4MKP A;  4I2D A;  4F5P A;  3Q8L A;  4YXM A;  4K98 A;  5ALE A;  1NK8 A;  7ICH A;  2GH1 A;  5HR7 A;  4QZF A;  5E79 U;  1WG8 A;  2LYA A;  4QWB A;  5AK5 A;  1ZYQ A;  2Y0S F;  2DVI A;  2ZXI A;  2NRK A;  5DGA A;  1KLN A;  1ZD4 A;  3GDX A;  1BVS A;  5HP4 A;  4BDP A;  1O08 A;  4ATB A;  2CXY A;  1L7N A;  2ZIX A;  2Y1J A;  5GTI U;  1VJ7 A;  5DLG A;  4C8N A;  4J9M A;  4ECS A;  2F76 X;  3C1Y A;  4MFF A;  5KG3 A;  3F53 A;  4YG2 A;  4YR0 A;  1ZQD A;  4RZR A;  4FZM A;  4LZG A;  4P0Q A;  2ZHB A;  3ISB A;  1L8O A;  4F92 B;  2PMZ C;  4CE6 A;  5KFQ A;  5AKX A;  3D2S A;  9ICX A;  1B43 A;  1TE2 A;  4IQT A;  3JPN A;  1NNL A;  4P2H A;  4RPY A;  3RJJ A;  2YB4 A;  4EBC A;  4KX3 A;  5EWE A;  9ICA A;  4BGD A;  5ALZ A;  4M2Y A;  2YMP A;  3NTU A;  2K8C B;  2JH1 A;  4ECY A;  2E5S A;  2R18 A;  3OVB A;  2D6F C;  1SKW A;  2W3R A;  5KL1 B;  7ICU A;  1S0V A;  4ED7 A;  1S10 A;  3PV8 A;  4O3P A;  2H3Q A;  4F5N A;  1XSN A;  4BJQ A;  4FHW A;  3B0X A;  2KZM A;  1JXE A;  4KIT B;  7ICI A;  2MAX A;  5C0Y A;  1UCV A;  4UB8 U;  2KOB A;  2PI4 A;  5J2E A;  3PW7 A;  1MQ2 A;  1ZQC A;  5CA7 A;  3ER8 C;  4LEY A;  5DBC A;  3KFU F;  3JCF A;  1WWU A;  4P4O A;  1JIH A;  5D49 A;  5HMM A;  4ECX A;  2W43 A;  5G5G A;  2ZH1 A;  3ONN A;  5DB8 A;  4DWI A;  2EZX A;  1MN8 A;  1XWL A;  4WC1 A;  1ZQ1 C;  1DGJ A;  3PSI A;  4BWJ A;  8ICZ A;  3UXO A;  4ECR A;  4M9N A;  4DQR A;  2ZUD A;  5KG6 A;  5L1K A;  3UQ0 A;  1BPD A;  1PK1 A;  2DBY A;  3ETR A;  3N7P D;  2Z7J A;  5AI8 A;  3QUB A;  3ZD8 A;  2EAN A;  3LVV A;  4RNM A;  2JMG A;  2PFN A;  3GIJ A;  3PX6 A;  1Z1V A;  4AYB C;  5DBA A;  2BDP A;  5AKE A;  3SEN A;  4NLB A;  3MC1 A;  5AKH A;  5CEH A;  1D8B A;  4QJF B;  3TI0 A;  4CCH A;  2KN7 A;  5KFK A;  2KVS A;  2DF4 B;  5KFP A;  1SXE A;  3Q8M A;  5AKG A;  2HHV A;  3H37 A;  4AT7 B;  2ZH8 A;  2EZZ A;  5B5E U;  1ZQL A;  5EE1 A;  2DR8 A;  2RDI A;  2MA1 A;  4Q43 A;  2WF7 A;  4QW9 A;  3OVA A;  5KFO A;  4IQU A;  5J2D A;  4RT2 A;  3C1Z A;  5KT5 A;  5C5J A;  4M0A A;  4WH5 A;  4DS4 A;  9ICB A;  3WFO A;  1IG6 A;  3H40 A;  4K8V A;  4DQS A;  3RH5 A;  1U4B A;  4K9B A;  2IHO A;  2XI9 A;  5ALU A;  4R8U B;  1ZQV A;  1KW4 A;  4YR3 A;  4B9M A;  3C66 A;  1PZN A;  4F5R A;  4BX9 C;  3ISD A;  3QZ8 A;  4KLJ A;  3C5F A;  3RJF A;  5EWF A;  3CP8 A;  4GXI A;  2P6R A;  4F5Q A;  4J9P A;  4EEL A;  2J6T A;  5JU5 A;  3PO4 A;  4X0B A;  4QZ9 A;  2HBM A;  4OAH A;  1NK9 A;  3RH4 A;  4DOB A;  1ZQY A;  1ZQO A;  4AT8 A;  4CDG A;  4WCW A;  2M2U A;  1MSW D;  2H3Z A;  2BCU A;  2F77 X;  3F2C A;  4AP9 A;  4GIB A;  4QZI A;  3PX4 A;  3EWA A;  1X9X A;  2G0A A;  1H38 A;  7ICK A;  3LK9 A;  3QU7 A;  4MFA A;  2XCP A;  3E2E A;  3HKZ C;  1ZQX A;  3WFS C;  1F5A A;  5AK3 A;  4M5D A;  1NK5 A;  4IR1 A;  4X4U A;  2BPG A;  3QEA Z;  1ZQH A;  4EBJ A;  1ZQG A;  2BHN A;  4ECQ A;  2E8O A;  4RWP A;  5F2V O;  2JEI A;  3IG5 A;  3PSP A;  3SEI A;  4DFK A;  4EV6 A;  1J2M A;  2KKP A;  1RM6 C;  1PVP A;  7ICJ A;  4ECW A;  3LWM A;  1XU4 A;  2XY6 A;  5AKK A;  2XO7 A;  2FI1 A;  1UQV A;  4C8K A;  3TAQ A;  5DG9 A;  1QCK A;  5CP2 A;  4BUG A;  3RBE A;  1UA1 A;  4WC0 A;  3E0F A;  5ALP A;  3M6K A;  2RRD A;  5HRH A;  1QQ5 A;  3A0H U;  2Y1I A;  2HBJ A;  2RDJ A;  2QB0 B;  1NK6 A;  1MA7 A;  2I1Q A;  4E0D A;  3TAP A;  5ALQ A;  3F5A A;  1BNP A;  4YXJ A;  2EWR A;  4Z6D A;  3L5K A;  4DF4 A;  2IBK A;  3QE9 Y;  4U6P A;  1MC8 A;  3HP6 A;  5IIL A;  1X9M A;  1FFV A;  1SKS A;  4AT9 A;  1ZQU A;  2W7P A;  1UT8 A;  3ALR A;  2AU0 A;  2V4R A;  2C28 A;  8ICM A;  3MFI A;  1X6J A;  3MR3 A;  4WOY A;  2HHQ A;  4Q8E A;  3BQ1 A;  3AU6 A;  2BQR A;  4PGY A;  2A1J B;  3AQF A;  1ECW A;  2ISP A;  3RH6 A;  2NRX A;  1QTM A;  2LM4 A;  3IP4 B;  3K75 D;  5J0T A;  3SMV A;  4NLG A;  1O03 A;  5DQG A;  2B6G A;  4BWM A;  4ELT A;  4EED A;  4EEK A;  4RWN A;  4P4P A;  5KAF U;  5KT7 A;  2MSN A;  3WU2 U;  4XRH A;  1A6S A;  4RQ0 A;  3LYS A;  5ALR A;  5IIM A;  1RG6 A;  1C7Y A;  4RQ4 A;  2KJ8 A;  4R8U A;  1KDH A;  1Z4N A;  1L7P A;  3RJK A;  3WKE A;  2ZHA A;  2HMX A;  3M9O B;  1B4F A;  3JPP A;  2WF9 A;  4WBY A;  2HOQ A;  2I6X A;  2WFA A;  1SIJ A;  1V38 A;  2K4P A;  5AKY A;  2W03 A;  4WC6 A;  4RU9 A;  3TQ1 A;  3CNH A;  1Z1B A;  1BPZ A;  2ZH6 A;  2W9C B;  2R8G A;  3N97 B;  3RRG A;  3QUT A;  2WHE A;  5KFU A;  4O3O A;  4DS5 A;  1YZ6 A;  3KHR A;  1SWV A;  5KFH A;  4C8M A;  4UB4 A;  1L7O A;  4DFJ A;  4B9V A;  2IOF K;  2QLT A;  1RYR A;  4B9L A;  5J0Y A;  2OCE A;  8ICA A;  1RDF A;  1KTQ A;  4NXZ A;  4O3N A;  1NKE A;  4ATB B;  2RQ5 A;  3Q8R B;  1U47 A;  2ZIX B;  4F4Z A;  3PZP A;  1XNS A;  1HUO A;  4KLI A;  4ED2 A;  2AQ4 A;  4UAS A;  2KD1 A;  3EYZ A;  3H0M B;  4R66 A;  1D9F A;  5K4L A;  1SXD A;  3MFH A;  3RB3 A;  4CRX A;  4X4N A;  3MDC A;  2VKQ A;  5J2F A;  4TUR A;  3H8S A;  2ESE A;  4Y2P A;  3WK6 A;  4USA A;  3NVW A;  1L3V A;  3RR8 A;  1TV9 A;  5ALT A; 
#chains in the Genus database with same CATH homology
 5DEC A;  5CWR A;  5KT6 A;  4QWB A;  2FLP A;  1ZYQ A;  3H39 A;  4RQ1 A;  5HRI A;  2PI5 A;  4DSF A;  4J9O A;  2DR9 A;  3IHQ B;  2DVI A;  1XC9 A;  3RRH A;  5L1I A;  8ICL A;  2NRK A;  3RBD A;  5DGA A;  4BXO B;  1KLN A;  4E7X A;  5KFN A;  4IR9 A;  7ICG A;  2FLN A;  3PY8 A;  3GDX A;  1BVS A;  4J9K A;  7ICM A;  3H4B A;  5HP4 A;  1JX4 A;  1DGS A;  1ZQP A;  1Z00 B;  3AUO A;  3MGH A;  4BDP A;  4I2F A;  4RT3 A;  2HHW A;  1UEU A;  4ATB A;  2ZUC A;  8ICH A;  2W9B A;  2IA6 A;  2Y1J A;  3H4D A;  1VJ7 A;  3WFR E;  2VAN A;  5DLG A;  4ED1 A;  4I2A A;  4C8N A;  3JPS A;  4J9M A;  4ECS A;  4JWM A;  3C1Y A;  4FHX A;  5J2K A;  4MFF A;  5KG3 A;  4YG2 A;  1QLN A;  4YR0 A;  2XGQ A;  1ZQD A;  4RZR A;  4EBK A;  1ZQF A;  3QZ7 A;  5DQH A;  1S76 D;  4EYH B;  1T4G A;  4LZG A;  1R8A A;  4FBU A;  3PR4 A;  1Q78 A;  2XGP A;  1S97 A;  5J0S A;  2ZHB A;  3ORY A;  3ISB A;  9ICR A;  4DSI A;  4F92 B;  5KFQ A;  2ZJ5 A;  1R8B A;  3C2M A;  4UD4 A;  1ZQE A;  3EZ5 A;  1ZQB A;  9ICX A;  1ZQT A;  1B43 A;  4RWQ A;  5KFM A;  4IQT A;  4UB2 A;  3JPN A;  5KFE A;  5EOZ A;  4QZ8 A;  4EZ6 A;  4I2E A;  4P2H A;  5KG7 A;  4RPY A;  1TVA A;  3V7K A;  4GC7 A;  4RPZ A;  3RB0 A;  3RJJ A;  2P6U A;  1Q79 A;  5KG0 A;  3ZDD A;  4JV2 A;  5DG8 A;  5EWG A;  4EBC A;  4FO6 A;  3SZ2 A;  2AJQ A;  4F4K A;  2O1P A;  4Q45 A;  5HC9 A;  3M9M B;  4KLE A;  5KFJ A;  5EWE A;  2KFN A;  4RNN A;  3BQT A;  9ICA A;  1NOM A;  9ICJ A;  4BGD A;  3C2K A;  2BCV A;  4EBD A;  3EPG A;  2HHT A;  4IQV A;  4Q44 A;  1TK0 A;  4M2Y A;  5DGB A;  2Q0Z X;  2RFF A;  3NTU A;  4XQ7 A;  4DF8 A;  4ECY A;  9ICN A;  5IIN A;  3HJ1 A;  4MF8 A;  1T3N A;  1ZQN A;  4QWC A;  2C22 A;  7ICT A;  5HHI A;  4KLM A;  1MIY A;  1UA0 A;  5BOM A;  1UEV A;  1SKW A;  2HHS A;  1X9W A;  2JEF A;  2PBE A;  3OVB A;  1S0N A;  5KFI A;  4ELV A;  4QZA A;  4FS1 A;  7ICU A;  4F3O A;  4O5K A;  1S0V A;  4ED7 A;  1TFY A;  4QWE A;  4DOC A;  4P4M A;  1X2I A;  1S10 A;  3OV7 A;  3PV8 A;  3GQC A;  4O3P A;  8ICY A;  2M2V A;  4E80 A;  7ICP A;  4F5N A;  5J29 A;  4XUS A;  5KT3 A;  4PGQ A;  4PHD A;  1XSN A;  4O5E A;  4NLK A;  4YP3 A;  4FHW A;  3B0X A;  5DKW A;  2KZM A;  1JXE A;  4ECU A;  4I27 A;  1JQR A;  4KIT B;  7ICI A;  2MAX A;  4IRC A;  2AGQ A;  1NJW A;  4YD1 A;  3G6X A;  2PI4 A;  3PW2 A;  5J0X A;  1MQ3 A;  5J2E A;  3PW7 A;  4I2G A;  1KFT A;  9ICU A;  3JZ0 A;  1MQ2 A;  1ZQC A;  5CA7 A;  1L3S A;  4GXK A;  5KG4 A;  3RB4 A;  1S9F A;  4KLU A;  2XC9 A;  3RAX A;  4KLG A;  4PPX A;  3AQL A;  2ZH9 A;  3OUY A;  7ICQ A;  5DBC A;  3MAB A;  4O5C A;  4KLD A;  9ICO A;  4JK1 A;  4P4O A;  3C23 A;  5KTQ A;  1JIH A;  4UB5 A;  1NK7 A;  5HMM A;  5D49 A;  3GIM A;  3FDS A;  4ECX A;  4NM1 A;  2BE3 A;  2ZJA A;  4FHV A;  2JZB B;  2WTF A;  5KG1 A;  4TUQ A;  2W8K A;  2ZH1 A;  5L9X A;  4R65 A;  2AQ0 A;  5DB8 A;  4DWI A;  5BPC A;  1SL1 A;  3RTV A;  4RNO A;  4S3N A;  2OWO A;  3QEB Z;  1XWL A;  2ZTE A;  5KFW A;  4RQ5 A;  8ICI A;  1NO5 A;  4WC1 A;  9ICI A;  4UAY A;  5F9L A;  9ICE A;  4BWJ A;  3ETL A;  8ICZ A;  2JEG A;  3UXO A;  4ECR A;  4M9N A;  4DQR A;  2ZUD A;  5KG6 A;  5L1K A;  3UQ0 A;  5HML A;  1BPD A;  5CHG A;  1U45 A;  1OU5 A;  5KFT A;  4RQ7 A;  3PML A;  1R89 A;  2ZTC A;  1A77 A;  4DQQ A;  5CJ7 A;  3PW4 A;  3SV3 A;  3G6Y A;  9ICL A;  5KFY A;  5KFV A;  4RUC A;  4F4Y A;  3ZD8 A;  2C2E A;  3ZD9 A;  4RNM A;  2MUT A;  4EYI B;  3GIJ A;  3PX6 A;  2PFN A;  1DK3 A;  5IIK A;  5J2C A;  1JMS A;  4J9Q A;  4QZC A;  4M9L A;  5DBA A;  2BDP A;  5J2A A;  4Q8F A;  1B22 A;  5DDY A;  2HHP A;  3C18 A;  4QZB A;  3MGI A;  3RAQ A;  3T3F A;  4GLX A;  4YVZ A;  4YQW A;  2W9C A;  5HR9 A;  9ICW A;  3RB6 A;  2ASJ A;  2F1I A;  1NJZ A;  4HYK A;  2AGO A;  4UB3 A;  3OHB A;  4MEX A;  5HRK A;  1KFD A;  1XSP A;  5J0R A;  2IHN A;  1YLQ A;  1ZQR A;  4E8F A;  3TI0 A;  4DOA A;  2W9M A;  4CCH A;  7ICF A;  2KN7 A;  5KFK A;  4KLO A;  4DFP A;  2VA3 A;  4YR2 A;  2R8K A;  4QW8 A;  1ZQW A;  2I9G A;  4NLZ A;  5KFP A;  9ICV A;  4ECZ A;  3Q8M A;  3C5G A;  8ICJ A;  4F5O A;  1T7P A;  8ICF A;  2ZJ8 A;  4FBT A;  7ICV A;  8ICQ A;  4O0I A;  2HHV A;  4YCX A;  4DL5 A;  3H37 A;  4AT7 B;  2FPM A;  2ZH8 A;  4J9S A;  3JPT A;  3M8S A;  1ZQL A;  3Q8S B;  5HRL A;  4PGX A;  2RDI A;  4QW9 A;  4Q43 A;  4J9L A;  3MR2 A;  9ICM A;  3PVX A;  3OVA A;  5KFO A;  1A76 A;  3H7I A;  4IQU A;  4RQ8 A;  2UVV A;  7ICO A;  2W8L A;  3HT3 A;  5J2D A;  2J6U A;  4RT2 A;  4DL7 A;  2W9A A;  1QSY A;  2KZ3 A;  3C1Z A;  5KFR A;  2HVH A;  3M8R A;  4DQP A;  3GFK B;  5KT5 A;  3M9N B;  5C5J A;  1NK0 A;  5L1L A;  3UXP A;  2BCR A;  4JV1 A;  4M0A A;  2HW3 A;  2ZH4 A;  1KEJ A;  4DS4 A;  8ICE A;  5KFA A;  9ICB A;  5KFF A;  4KMU A;  1U49 A;  8ICX A;  4AT8 B;  2R8H A;  1K1Q A;  2ZH5 A;  1VFG A;  3WFO A;  5HHH A;  3H40 A;  1T8E A;  1BPB A;  5CR0 A;  3SV4 A;  4DQS A;  3AU2 A;  5J0P A;  3RH5 A;  1XSL A;  1U4B A;  3H8J A;  4RPX A;  4GC6 A;  2KTQ A;  2Q66 A;  4EZ9 A;  3NYB A;  4WC2 A;  4R8U B;  4QZE A;  2ZTD A;  3C2L A;  5J0Q A;  1ZQV A;  4Z6C A;  5J2J A;  4KLT A;  4YR3 A;  4DLG A;  4B9M A;  1PZN A;  3C66 A;  2DPI A;  3BJY A;  4UAW A;  4DSE A;  4NKT A;  3HWT A;  3ZDA A;  2V9W A;  3OJS A;  4F5R A;  2NRW A;  3N4M B;  4C8L A;  4F8R A;  2F1J A;  4X4P A;  1S0M A;  8ICU A;  4RQ2 A;  4IG8 A;  4UQG A;  3ISD A;  3QZ8 A;  1QSS A;  4M9G A;  4KLJ A;  1BPE A;  1DK2 A;  3PX0 A;  4BXO A;  3C5F A;  4UBB A;  3RJF A;  2DR5 A;  1NK4 A;  5EWF A;  3HPO A;  4GXI A;  1RYS A;  2DRB A;  2P6R A;  4F5Q A;  4ED6 A;  4AT7 A;  1Z00 A;  4F93 B;  4JUZ A;  1IXR A;  3GV5 B;  4UD5 A;  4X4V A;  3LDA A;  4J9P A;  1JXL A;  3V7J A;  2J6T A;  3PO4 A;  2M2T A;  4X0B A;  3PW0 A;  1BNO A;  4QZ9 A;  4KLH A;  4RUA A;  2C2R A;  1NK9 A;  1QSL A;  4WBZ A;  4F4W A;  3RH4 A;  4IQW A;  4X4O A;  3JPO A;  9ICK A;  1NZP A;  4DOB A;  3HIY A;  4RWO A;  1ZQY A;  2FPL A;  2M9N A;  1ZQO A;  5J0U A;  4AT8 A;  1RZT A;  4EP7 A;  3RJE A;  4UBC A;  4WCW A;  4F4X A;  4EEY A;  2M2U A;  3TFS A;  1MSW D;  8ICW A;  4I2I A;  4F50 A;  1ARO P;  2BCU A;  3TFR A;  1V4A A;  3HJ4 A;  2ASL A;  1TK5 A;  3ZDC A;  1K1S A;  4M6W B;  3KHL A;  4IRK A;  2ID1 A;  4K4G A;  2H5X A;  4QZI A;  4DQI A;  4YN4 A;  3PX4 A;  3EWA A;  1SKR A;  7ICS A;  1L3U A;  1XS9 D;  4X4T A;  4KLF A;  5J0W A;  3B0Y A;  4ZH4 A;  3ISC A;  1H38 A;  2PFO A;  4DSK A;  3LK9 A;  7ICK A;  1ZQI A;  9ICG A;  3H3A A;  1X9S A;  1HUZ A;  4MFA A;  3RJH A;  4M04 A;  4ECV A;  2XCP A;  4R64 A;  3GV8 B;  1NJX A;  3E2E A;  8ICO A;  2B21 A;  1KFS A;  7ICR A;  1ZQX A;  3OHA A;  2IMW P;  4B9U A;  1F5A A;  3WFS C;  2NRZ A;  3C21 A;  4M5D A;  1NK5 A;  4IR1 A;  4X4U A;  1KNY A;  2BPG A;  2HHU A;  2P66 A;  3QEA Z;  4K4H A;  4X0A A;  5HNK A;  1XO1 A;  1WOT A;  3JPQ A;  1ZQH A;  3V6H A;  9ICF A;  4DL4 A;  4EBJ A;  1ZQG A;  4NKU A;  1NKB A;  3UPS A;  4I2J A;  2BHN A;  4ECQ A;  9ICH A;  4RWP A;  3PMN A;  5F2V O;  1UET A;  3BQ0 A;  2KFZ A;  8ICK A;  4PH5 A;  4LT6 A;  4FHY A;  4DFM A;  4NLN A;  4EBE A;  2BGW A;  2JEI A;  1N48 A;  4X4Q A;  4ED0 A;  4I2B A;  4DLE A;  3T5K A;  4DFK A;  5KFC A;  3AQK A;  1ZJN A;  2AGP A;  3JPR A;  1R8C A;  4JV0 A;  1N56 A;  4AT9 B;  1V9P A;  1ZQA A;  3UXN A;  2C2D A;  3RJG A;  4JWN A;  4O9M A;  7ICJ A;  4ECW A;  9ICT A;  3LWM A;  4DL6 A;  3WFQ E;  3V6K A;  1XU4 A;  4FHP A;  3K4G A;  2XY6 A;  2XO7 A;  4M9J A;  2LYH A;  2W9B B;  3OJU A;  1SL0 A;  4B9T A;  4C8K A;  3TAQ A;  9ICC A;  5HRG A;  2BKE A;  4LZD A;  4RQ3 A;  5CP2 A;  5DG9 A;  3HW8 A;  3RBE A;  5KFX A;  2ASD A;  1UA1 A;  3OGU A;  1S0O A;  8ICR A;  4WC4 A;  2GWS A;  4WC0 A;  2JZB A;  4TQR A;  4GXJ A;  4YMN A;  4Z6E A;  2NRV A;  1RPL A;  4XA5 A;  3KHG A;  3V6J A;  1D8Y A;  2DRA A;  4C8O A;  4DSJ A;  4QZD A;  1PX5 A;  1CEZ A;  1NJY A;  1RXW A;  4X4R A;  1Z3E B;  5TZV A;  4TUP A;  5HRH A;  4TUS A;  1ZQJ A;  2Y1I A;  2RDJ A;  2IHM A;  8ICG A;  4WC3 A;  5KFS A;  4DL2 A;  1NK6 A;  4MFC A;  2I1Q A;  4YMO A;  3ZDB A;  4E0D A;  3TAP A;  2DR8 A;  3GIL A;  2F1H A;  1BNP A;  4YXJ A;  2BPC A;  4FH3 A;  3OVS A;  4Z6D A;  3RR7 A;  5HRE A;  1TFW A;  4QWA A;  4DF4 A;  2FLL A;  3PNC A;  2IBK A;  2FPK A;  3QE9 Y;  4B9S A;  4YFK A;  1MC8 A;  1UT5 A;  2KP7 A;  2PFQ A;  3T5J A;  1LV5 A;  3HP6 A;  5IIL A;  3SYZ A;  1X9M A;  1FA0 A;  1L3T A;  3PR5 B;  5DDM A;  4WC5 A;  1SKS A;  4AT9 A;  1ZQU A;  3LQC B;  5DQI A;  1UT8 A;  1CUK A;  3FYH A;  2AU0 A;  4J9N A;  4DEZ A;  2V4R A;  3NGD A;  5D4B A;  4M9H A;  1S77 D;  7ICE A;  4FH5 A;  2C28 A;  5KT2 A;  1ZQK A;  5HRD A;  4DL3 A;  8ICM A;  3MFI A;  3H8W A;  4UB1 A;  2ZH3 A;  3MR3 A;  2V4Q A;  1U9L A;  8ICB A;  2HHQ A;  2KZZ A;  4Q8E A;  3BQ1 A;  4NM2 A;  3AU6 A;  3OSP A;  2BQR A;  4PGY A;  1HJP A;  1JAJ A;  2A1J B;  4Z6F A;  5JUM A;  4G3I A;  2ZH7 A;  2FMQ A;  2ISP A;  3RH6 A;  2NRX A;  1QTM A;  5D46 A;  2XY5 A;  1ZJM A;  3JYY A;  3L9D A;  5KFD A;  2ATL A;  2FMS A;  3Q8P B;  3WFP A;  2BQU A;  3T5L A;  4O3S A;  5HRF A;  2DFL A;  3MR6 A;  4KN7 A;  3K75 D;  4K4I A;  3EW9 A;  5J0T A;  1RXV A;  5DBB A;  1IM4 A;  4NLG A;  8ICV A;  5DQG A;  1SL2 A;  3H38 A;  2BPF A;  3OUY B;  4BWM A;  1BPY A;  1MIW A;  3SI8 A;  4ELT A;  9ICQ A;  4RWN A;  4P4P A;  3AQN A;  5DED A;  5KT7 A;  1D9D A;  4XRH A;  3G6V A;  2BR0 A;  1LB2 B;  2UVW A;  4XQ8 A;  4F2R A;  4RQ0 A;  4UAZ A;  4ECT A;  4J9R A;  1KRP A;  1JN3 A;  5IIM A;  1COO A;  4QZH A;  8ICS A;  4X5V A;  2ZH2 A;  5J2H A;  1C7Y A;  2BQ3 A;  4O3R A;  4RQ4 A;  3UPQ A;  8ICN A;  3IM1 A;  3T5H A;  7ICL A;  1ZQZ A;  4R8U A;  1WCL A;  1NKC A;  1KDH A;  4ELU A;  4PHA A;  3BQ2 A;  1U48 A;  5F9N A;  4MF2 A;  3TAR A;  4RQ6 A;  1ZQQ A;  3MBY A;  3AQM A;  2BCQ A;  3V72 A;  4ED8 A;  3RJK A;  4QWD A;  2ALZ A;  2ZHA A;  3M9O B;  4I2H A;  2A1J A;  4FS2 A;  4ED3 A;  3BDP A;  3JPP A;  4F2S A;  2VA2 A;  4WBY A;  1EXN A;  3MDA A;  5IIO A;  4I28 A;  1TAU A;  8ICT A;  1D8L A;  5IIJ A;  3GV7 B;  4O3Q A;  3GII A;  2JEJ A;  8ICC A;  7ICN A;  2MUT B;  5J2G A;  4TQS A;  4M47 A;  3Q8K A;  8ICP A;  2HHX A;  3KTQ A;  4WC6 A;  4RU9 A;  1TAQ A;  3MR5 A;  5DLF A;  3TQ1 A;  1BPZ A;  2ISO A;  3RJI A;  3PO5 A;  2HVI A;  4WC7 A;  1ZQS A;  4KTQ A;  5BOL A;  2ZH6 A;  1SZP A;  5CB1 A;  2W9C B;  2R8G A;  3N97 B;  1TFR A;  4YD2 A;  1WCN A;  3OSN A;  4F91 B;  2M2W A;  3RRG A;  5KFU A;  4DSL A;  4KLS A;  4O3O A;  4DS5 A;  4KLQ A;  1DOQ A;  1BGX T;  3KHR A;  4KLL A;  5KG2 A;  5KFH A;  2R8J A;  2DPJ A;  3LWL A;  2XCA A;  1KSP A;  5DG7 A;  4C8M A;  4UB4 A;  1L5U A;  5KFZ A;  4MEY A;  2UVU A;  4DFJ A;  3GIK A;  2O5A A;  3Q8Q B;  4B9V A;  5KT4 A;  1RYR A;  4B9L A;  5J0Y A;  3V7L A;  5J2I A;  5III A;  5HRB A;  8ICA A;  4I29 A;  4PHE A;  2FMP A;  1KTQ A;  2DR7 A;  5KFB A;  1TK8 A;  4LVS A;  3PW5 A;  1Y88 A;  5KG5 A;  4R63 A;  4X4S A;  3TAN A;  4NXZ A;  5KFG A;  2UVR A;  4DO9 A;  4M6W A;  2PXI A;  4O3N A;  1NKE A;  4ATB B;  3Q8R B;  3UQ2 A;  1U47 A;  2NRT A;  4F4Z A;  3ZDE A;  1HUO A;  4QZG A;  5DB7 A;  4KN4 A;  1BPX A;  4KLI A;  5J2B A;  4ED2 A;  3KHH A;  2ZUB A;  2VA8 A;  9ICP A;  2R8I A;  5DB6 A;  3HX0 A;  2AQ4 A;  4B9N A;  3EYZ A;  4R66 A;  1D9F A;  3MFH A;  3RB3 A;  2PFP A;  5L1J A;  4I2C A;  1MIV A;  4X4N A;  3MDC A;  5J2F A;  4I2D A;  3H8S A;  4TUR A;  4F5P A;  5J0O A;  3THV A;  2XY7 A;  2BCS A;  4IRD A;  3Q8L A;  4YXM A;  1ZQM A;  4PHP A;  4YMM A;  9ICS A;  5DB9 A;  3EPI A;  1ZET A;  1NK8 A;  1L3V A;  4NY8 A;  3RR8 A;  7ICH A;  2J6S A;  5KFL A;  1TV9 A;  1TKD A;  4QZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...