4KMAA

Crystal structure of drosophila suppressor of fused
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
460
structure length
440
Chain Sequence
AMDPEFMAEKPPPGLKAIIDHLGQVYPNQPNPLQVTTLLKYWLGGQDPLDYISMYNYPGDVDRNVPPHWHYISFGLSDLHGDERVHLREEGVTRSGMGFELTFRLAKTEIELKQQIENPEKPQRPPTWPANLLQAIGRYCFQTGNGLCFGDNIPWRKSLDGSTTSKLQNLLVAQDPQLGCIDTPTGTVDFCQIVGVFDDELEQASRWNGRGVLNFLRQDMQTGGDWLVTNMDRQMSVFELFPETLLNLQDDLEKQGSDLAGVNADFTFRELKPTKEVKEEVDFQALSEKCANDKREEPSFPQSMSMSSNSLHKSCPLDFQAQAPNCISLDGIEITLAPGVAKYLLLAIKDRIRHGRHFTFKAQHLALTLVAESVTGSAVTVNEPYGVLGYWIQVLIPDELVPRLMEDFCSAGLDEKCEPKERLELEWPDKNLKLIIDQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GM14141p
publication title Structural insight into the mutual recognition and regulation between Suppressor of Fused and Gli/Ci.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 118
structure length 440
sequence length 460
ec nomenclature
pdb deposition date 2013-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05076 SUFU Suppressor of fused protein (SUFU)
A PF12470 SUFU_C Suppressor of Fused Gli/Ci N terminal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.230 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kmaA02
4KM8A 4KM9A 4BLAA 4KMAA 4KMDA 4BLBA 4KMHA
chains in the Genus database with same CATH superfamily
3TFHA 1XXAA 4G7ZA 3HOUK 3AD9C 4G0UA 1PJ5A 4A93C 1C0AA 4QIWL 5M3FK 4PAAA 2R93A 2Y0SD 3FKIK 5IYDK 1PJ6A 1WCMC 3GTPK 3M4OK 2R7ZA 2KWAA 3FKIC 3GTLK 5IYDC 3A8IA 2D6FC 3RZDC 1VH2A 4LK1A 3CAGA 2YU9A 2A6EA 2PHCB 1JOEA 4XSXA 3HOZK 4A3BK 4MEYA 3GTPA 1YCLA 4XCHA 3HOZC 3T02A 4A3BC 1JQWA 3GTLA 2PA8D 3RZOK 2FQOA 3G4CA 2E2HA 1USOA 3A8KA 3RZOC 5C3EK 1B4BA 4OINA 1WIHA 2O5IA 3N0CA 3GTKK 4J3NA 3GDZA 4C3JK 3GTJK 3ERED 1YX2A 3WODA 5C4JK 3GTKC 4A3GK 4LQYA 2CW0A 3AQPA 1V5VA 1DD5A 3CQZA 4C3JC 4WJ3M 5IP7K 3H3VL 1L0WA 3NUHA 4BBSC 2XCRB 1IW7A 5IP7C 1WOSA 3G4AA 3FHZA 2NVYA 5IOTA 1BS2A 5D4DA 1VJEA 4GTLA 1WSRA 4KMDA 3GTJA 3S17C 2EBBA 1IQ0A 4A3CK 1EQRA 4YFNA 1WQHA 3S1RK 2B63K 1TWGK 4WILA 5IYCC 4NOIA 3S1RC 2B63C 4PABA 2PMZD 4KN4A 1I3QC 2JA7C 2VUMK 5FLMC 2PPBA 5C4XC 1ZYRA 3HOVK 3HOYC 1O2AA 2VUMC 4KMAA 3GTQK 5IP9K 4KB2A 3GTMA 1JVIA 3GEIA 1O29A 1TWGA 3GTQC 5IP9C 4BY1K 3JSTA 1VGXA 2GSNA 4A3MK 3AH5A 3HOWK 3HKZD 3N0BA 3VA7A 2R92K 5TMFA 4ILDA 5M5YK 2NVTK 2JA6A 4A3IK 4A3MC 3HOWC 3GEEA 2JH3A 4GTEA 2NVTC 3T00A 5TMCA 4Y7NK 1R9TA 3S1NK 1IS1A 1EH1A 5EGEA 2P5MA 4OIOA 2Y0SL 3S1NC 3L4JA 3I4NK 4KMUA 2R92A 4AH6A 3LPXA 4GT9A 1ZXOA 1AB4A 3I4NC 4A3DC 4RMFA 4KAWX 1SFOC 1TWCC 3S0XA 1WCMK 3AQOA 4KARA 4GFQA 1K83A 1WSVA 3RZDK 5IYBK 1GE9A 1DCHA 4G7OA 3AD7C 1O2BA 1YNNA 2GAHC 1XXCA 3BUEA 5IYBC 3OPFA 5M3MK 1O26A 4LR2A 1WCMA 3FKIA 4BLBA 4YFKA 1Y1WC 4OIQA 4GTCA 5C44K 2NVXK 3M3YK 5C44C 1DCOA 5M5WK 3S14C 2NVXC 4Y52K 3M3YC 3PO2C 1Y1VC 4GTBA 1O24A 4Y52C 1F7UA 1O28A 3HXAA 1TWAC 4P5BA 1EFWA 3GTOC 4BXXK 4BBSK 4QJVA 2A68A 2XCQA 4BXXC 4QJVB 2WAQD 1BGWA 1ZBSA 4GZYA 2PMZL 3S17K 3GTKA 1RU0A 5CHPA 1G51A 3TFJA 1SMYA 1WQFA 3A8JA 3S1QC 2E2IC 1I6HK 4GTFA 3H0GC 4GTDA 1I6HC 5IYCK 3SZYA 3FOEA 1I3QK 5CJ9A 1F93A 2JA7K 5FLMK 3HKZL 5C4XK 1O2FB 3HOYK 3S15C 2JA8K 2JA5C 1HQMA 5IORA 1O27A 5IOSA 4KDDA 4G0WA 2JA8C 1VRQC 4A3LC 2V6SA 3EQLA 2B63A 3DXJA 2WB1L 1IBAA 2GAGC 1I3QA 1I50K 2JA7A 3GTMC 1I50C 4KB4A 2VUMA 4LLGA 3K7AK 5E68A 3GIRA 4C3IC 5FJ8K 4XLNA 1IL2A 3GTQA 3K7AC 3GTGK 1DCPA 2ZUEA 1F7VA 4X6AK 1TWHK 2CFAA 2V6TA 3GTGC 2XCOA 1UV7A 2CFAB 4X6AC 4A3FC 1TWHC 4A3DK 1ZVUA 1XPPA 1EK8A 1SFOK 1TWCK 1BJTA 4BBRC 1YNJA 1TWFK 3HOXK 4LJZA 4MQ9A 2GSOA 2RGRA 2O5JA 4A3EC 3MMLB 1TWFC 1USMA 3HOXC 1XZPA 1B4AA 1XZPB 4BKWA 5HL8A 2R93K 1BDFA 3T01A 4A3KK 3I4MK 2PA8L 4LOWA 4AYBD 2R7ZK 2R93C 4C2MK 4A3KC 1SFOA 3I4MC 1TWCA 2P8TA 4BLAA 2R7ZC 4OIPA 3S16K 4C2MC 4KC6A 3V4GA 3TFIA 2YU9K 4KM8A 3S16C 1Y1WK 3BP3A 1PJ7A 4A3JK 2YU9C 4KASA 3HOUC 3GSIA 1J98A 4XLPA 2V6UA 4A3JC 5JFEA 3S14K 4G7HA 3PO2K 3OEPA 2WAQL 1XXBA 3GTPC 2W7VA 3M4OC 1Y1VK 3GEHA 2E2HK 3GTLC 3S2DK 5IOQA 1WOOA 3TTGA 1KQ4A 2E2HC 1Y1WA 1TWAK 1X31C 4O2DA 4C3HK 3S2DC 3LAPA 3GTOK 4QIWD 1I6VA 4KATA 5L46A 4C3HC 2NVXA 2NVQK 3CQZK 3AD8C 2E2JK 1Y1VA 2NVQC 3CQZC 4FM9A 4P5AA 4G0VA 4MEXA 2E2JC 1ZQ1C 3S1QK 2E2IK 1TWAA 1ISEA 3BP8C 2NVYK 3H0GK 5C3EC 3GTOA 1INNA 1XZQA 2NVYC 1XZQB 3GTJC 5C4JC 4A3GC 1F9NA 4KM9A 1WORA 4Q4ZA 4Q5SA 4ZH4A 3S15K 1WOPA 2JA5K 2E2IA 1J6VA 3H0GA 4FZBA 2A6HA 2BE5A 4KN7A 4A3LK 5EGHA 5TJ3A 5JVOA 2ZUFA 3GTMK 4A3CC 3H3VD 3SZZA 3S1MK 2JA5A 1O25A 4C3IK 1TWGC 4KMHA 3S1MC 4P9SA 3OREA 2JA6K 4M1XA 2RH6A 3LAJA 2JA6C 1HI9A 4BY7K 1R9TK 3HOVC 2A69A 1J6XA 3L4KA 4A3FK 1IE0A 1J6WA 1VLOA 4DDQA 4BY7C 1I50A 1R9TC 4YG2A 4XSZA 2GSUA 3Q3QA 4OIRA 4AYBL 4BBRK 3QX3A 3PO3K 4JK1A 4BY1C 2Y3PA 3N3YA 3PO3C 4A3EK 4LK0A 2R92C 4A3IC 3GTGA 2ZFZA 2FQTA 1TWHA 4Y7NC 4C45A 4YFXA 2WB1D 1K83K 3IPJA 1EI6A 1K83C 3S2HK 4WJ4A 3ADAC 1WQGA 4GTAA 3FOFA 1TWFA 5M5XK 3S2HC 4A93K
chains in the Genus database with same CATH topology
3N0BA 4KATA 3VA7A 1XXAA 4C3HC 4ILDA 2JA6A 4G0UA 5CJ9A 2NVXA 2JH3A 4GTEA 2R93A 1Y1VA 1R9TA 4FM9A 1IS1A 4P5AA 5IORA 1EH1A 4G0VA 5EGEA 1O27A 5IOSA 2P5MA 4KDDA 2KWAA 4G0WA 2R7ZA 1TWAA 1ISEA 3GTOA 3L4JA 2R92A 3CAGA 2YU9A 3LPXA 4GT9A 2B63A 1ZXOA 1AB4A 2PHCB 1I3QA 2JA7A 4KAWX 1F9NA 4KM9A 4KB4A 3S0XA 2VUMA 3GTPA 4C3IC 3GTLA 2E2IA 3AQOA 3G4CA 4KARA 4GFQA 3H0GA 1K83A 3GTQA 4FZBA 2E2HA 1B4BA 1GE9A 1WIHA 2CFAA 2XCOA 1O2BA 5EGHA 3N0CA 5TJ3A 1XXCA 3BUEA 2CFAB 4J3NA 3OPFA 5JVOA 3ERED 1ZVUA 1O26A 4LQYA 3AQPA 1EK8A 4LR2A 1BJTA 1DD5A 3CQZA 1WCMA 4C3JC 2JA5A 1O25A 3FKIA 2GSOA 4KMHA 4BLBA 3NUHA 2RGRA 3MMLB 4GTCA 3OREA 2XCRB 4M1XA 1B4AA 3G4AA 3FHZA 2RH6A 3LAJA 4BKWA 2NVYA 5IOTA 4GTLA 4KMDA 3L4KA 3GTJA 4DDQA 1SFOA 4GTBA 1I50A 1O24A 1TWCA 4BLAA 2GSUA 1WQHA 3Q3QA 1O28A 4C2MC 4KC6A 3QX3A 3V4GA 4P5BA 4KM8A 2Y3PA 3N3YA 4KASA 2XCQA 3GTGA 2ZFZA 1BGWA 1ZBSA 5JFEA 1TWHA 1O2AA 3GTKA 3OEPA 5CHPA 1XXBA 4KMAA 1WQFA 4KB2A 3GTMA 5IOQA 1O29A 4GTFA 1TWGA 1KQ4A 4GTAA 1WQGA 3FOFA 1Y1WA 4GTDA 1TWFA 2GSNA 3LAPA 3AH5A 3FOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KM8 A;  4KM9 A;  4BLA A;  4KMA A;  4KMD A;  4BLB A;  4KMH A; 
#chains in the Genus database with same CATH topology
 3TFH A;  1XXA A;  4G7Z A;  3HOU K;  3AD9 C;  4G0U A;  1PJ5 A;  4A93 C;  1C0A A;  4QIW L;  5M3F K;  4PAA A;  2R93 A;  2Y0S D;  3FKI K;  5IYD K;  1PJ6 A;  1WCM C;  3GTP K;  3M4O K;  2R7Z A;  2KWA A;  3FKI C;  3GTL K;  5IYD C;  3A8I A;  2D6F C;  3RZD C;  1VH2 A;  4LK1 A;  3CAG A;  2YU9 A;  2A6E A;  2PHC B;  1JOE A;  4XSX A;  3HOZ K;  4A3B K;  4MEY A;  3GTP A;  1YCL A;  4XCH A;  3HOZ C;  3T02 A;  4A3B C;  1JQW A;  3GTL A;  2PA8 D;  3RZO K;  2FQO A;  3G4C A;  2E2H A;  1USO A;  3A8K A;  3RZO C;  5C3E K;  1B4B A;  4OIN A;  1WIH A;  2O5I A;  3N0C A;  3GTK K;  4J3N A;  3GDZ A;  4C3J K;  3GTJ K;  3ERE D;  1YX2 A;  3WOD A;  5C4J K;  3GTK C;  4A3G K;  4LQY A;  2CW0 A;  3AQP A;  1V5V A;  1DD5 A;  3CQZ A;  4C3J C;  4WJ3 M;  5IP7 K;  3H3V L;  1L0W A;  3NUH A;  4BBS C;  2XCR B;  1IW7 A;  5IP7 C;  1WOS A;  3G4A A;  3FHZ A;  2NVY A;  5IOT A;  1BS2 A;  5D4D A;  1VJE A;  4GTL A;  1WSR A;  4KMD A;  3GTJ A;  3S17 C;  2EBB A;  1IQ0 A;  4A3C K;  1EQR A;  4YFN A;  1WQH A;  3S1R K;  2B63 K;  1TWG K;  4WIL A;  5IYC C;  4NOI A;  3S1R C;  2B63 C;  4PAB A;  2PMZ D;  4KN4 A;  1I3Q C;  2JA7 C;  2VUM K;  5FLM C;  2PPB A;  5C4X C;  1ZYR A;  3HOV K;  3HOY C;  1O2A A;  2VUM C;  4KMA A;  3GTQ K;  5IP9 K;  4KB2 A;  3GTM A;  1JVI A;  3GEI A;  1O29 A;  1TWG A;  3GTQ C;  5IP9 C;  4BY1 K;  3JST A;  1VGX A;  2GSN A;  4A3M K;  3AH5 A;  3HOW K;  3HKZ D;  3N0B A;  3VA7 A;  2R92 K;  5TMF A;  4ILD A;  5M5Y K;  2NVT K;  2JA6 A;  4A3I K;  4A3M C;  3HOW C;  3GEE A;  2JH3 A;  4GTE A;  2NVT C;  3T00 A;  5TMC A;  4Y7N K;  1R9T A;  3S1N K;  1IS1 A;  1EH1 A;  5EGE A;  2P5M A;  4OIO A;  2Y0S L;  3S1N C;  3L4J A;  3I4N K;  4KMU A;  2R92 A;  4AH6 A;  3LPX A;  4GT9 A;  1ZXO A;  1AB4 A;  3I4N C;  4A3D C;  4RMF A;  4KAW X;  1SFO C;  1TWC C;  3S0X A;  1WCM K;  3AQO A;  4KAR A;  4GFQ A;  1K83 A;  1WSV A;  3RZD K;  5IYB K;  1GE9 A;  1DCH A;  4G7O A;  3AD7 C;  1O2B A;  1YNN A;  2GAH C;  1XXC A;  3BUE A;  5IYB C;  3OPF A;  5M3M K;  1O26 A;  4LR2 A;  1WCM A;  3FKI A;  4BLB A;  4YFK A;  1Y1W C;  4OIQ A;  4GTC A;  5C44 K;  2NVX K;  3M3Y K;  5C44 C;  1DCO A;  5M5W K;  3S14 C;  2NVX C;  4Y52 K;  3M3Y C;  3PO2 C;  1Y1V C;  4GTB A;  1O24 A;  4Y52 C;  1F7U A;  1O28 A;  3HXA A;  1TWA C;  4P5B A;  1EFW A;  3GTO C;  4BXX K;  4BBS K;  4QJV A;  2A68 A;  2XCQ A;  4BXX C;  4QJV B;  2WAQ D;  1BGW A;  1ZBS A;  4GZY A;  2PMZ L;  3S17 K;  3GTK A;  1RU0 A;  5CHP A;  1G51 A;  3TFJ A;  1SMY A;  1WQF A;  3A8J A;  3S1Q C;  2E2I C;  1I6H K;  4GTF A;  3H0G C;  4GTD A;  1I6H C;  5IYC K;  3SZY A;  3FOE A;  1I3Q K;  5CJ9 A;  1F93 A;  2JA7 K;  5FLM K;  3HKZ L;  5C4X K;  1O2F B;  3HOY K;  3S15 C;  2JA8 K;  2JA5 C;  1HQM A;  5IOR A;  1O27 A;  5IOS A;  4KDD A;  4G0W A;  2JA8 C;  1VRQ C;  4A3L C;  2V6S A;  3EQL A;  2B63 A;  3DXJ A;  2WB1 L;  1IBA A;  2GAG C;  1I3Q A;  1I50 K;  2JA7 A;  3GTM C;  1I50 C;  4KB4 A;  2VUM A;  4LLG A;  3K7A K;  5E68 A;  3GIR A;  4C3I C;  5FJ8 K;  4XLN A;  1IL2 A;  3GTQ A;  3K7A C;  3GTG K;  1DCP A;  2ZUE A;  1F7V A;  4X6A K;  1TWH K;  2CFA A;  2V6T A;  3GTG C;  2XCO A;  1UV7 A;  2CFA B;  4X6A C;  4A3F C;  1TWH C;  4A3D K;  1ZVU A;  1XPP A;  1EK8 A;  1SFO K;  1TWC K;  1BJT A;  4BBR C;  1YNJ A;  1TWF K;  3HOX K;  4LJZ A;  4MQ9 A;  2GSO A;  2RGR A;  2O5J A;  4A3E C;  3MML B;  1TWF C;  1USM A;  3HOX C;  1XZP A;  1B4A A;  1XZP B;  4BKW A;  5HL8 A;  2R93 K;  1BDF A;  3T01 A;  4A3K K;  3I4M K;  2PA8 L;  4LOW A;  4AYB D;  2R7Z K;  2R93 C;  4C2M K;  4A3K C;  1SFO A;  3I4M C;  1TWC A;  2P8T A;  4BLA A;  2R7Z C;  4OIP A;  3S16 K;  4C2M C;  4KC6 A;  3V4G A;  3TFI A;  2YU9 K;  4KM8 A;  3S16 C;  1Y1W K;  3BP3 A;  1PJ7 A;  4A3J K;  2YU9 C;  4KAS A;  3HOU C;  3GSI A;  1J98 A;  4XLP A;  2V6U A;  4A3J C;  5JFE A;  3S14 K;  4G7H A;  3PO2 K;  3OEP A;  2WAQ L;  1XXB A;  3GTP C;  2W7V A;  3M4O C;  1Y1V K;  3GEH A;  2E2H K;  3GTL C;  3S2D K;  5IOQ A;  1WOO A;  3TTG A;  1KQ4 A;  2E2H C;  1Y1W A;  1TWA K;  1X31 C;  4O2D A;  4C3H K;  3S2D C;  3LAP A;  3GTO K;  4QIW D;  1I6V A;  4KAT A;  5L46 A;  4C3H C;  2NVX A;  2NVQ K;  3CQZ K;  3AD8 C;  2E2J K;  1Y1V A;  2NVQ C;  3CQZ C;  4FM9 A;  4P5A A;  4G0V A;  4MEX A;  2E2J C;  1ZQ1 C;  3S1Q K;  2E2I K;  1TWA A;  1ISE A;  3BP8 C;  2NVY K;  3H0G K;  5C3E C;  3GTO A;  1INN A;  1XZQ A;  2NVY C;  1XZQ B;  3GTJ C;  5C4J C;  4A3G C;  1F9N A;  4KM9 A;  1WOR A;  4Q4Z A;  4Q5S A;  4ZH4 A;  3S15 K;  1WOP A;  2JA5 K;  2E2I A;  1J6V A;  3H0G A;  4FZB A;  2A6H A;  2BE5 A;  4KN7 A;  4A3L K;  5EGH A;  5TJ3 A;  5JVO A;  2ZUF A;  3GTM K;  4A3C C;  3H3V D;  3SZZ A;  3S1M K;  2JA5 A;  1O25 A;  4C3I K;  1TWG C;  4KMH A;  3S1M C;  4P9S A;  3ORE A;  2JA6 K;  4M1X A;  2RH6 A;  3LAJ A;  2JA6 C;  1HI9 A;  4BY7 K;  1R9T K;  3HOV C;  2A69 A;  1J6X A;  3L4K A;  4A3F K;  1IE0 A;  1J6W A;  1VLO A;  4DDQ A;  4BY7 C;  1I50 A;  1R9T C;  4YG2 A;  4XSZ A;  2GSU A;  3Q3Q A;  4OIR A;  4AYB L;  4BBR K;  3QX3 A;  3PO3 K;  4JK1 A;  4BY1 C;  2Y3P A;  3N3Y A;  3PO3 C;  4A3E K;  4LK0 A;  2R92 C;  4A3I C;  3GTG A;  2ZFZ A;  2FQT A;  1TWH A;  4Y7N C;  4C45 A;  4YFX A;  2WB1 D;  1K83 K;  3IPJ A;  1EI6 A;  1K83 C;  3S2H K;  4WJ4 A;  3ADA C;  1WQG A;  4GTA A;  3FOF A;  1TWF A;  5M5X K;  3S2H C;  4A93 K; 
#chains in the Genus database with same CATH homology
 3N0B A;  4KAT A;  3VA7 A;  1XXA A;  4C3H C;  4ILD A;  2JA6 A;  4G0U A;  5CJ9 A;  2NVX A;  2JH3 A;  4GTE A;  2R93 A;  1Y1V A;  1R9T A;  4FM9 A;  1IS1 A;  4P5A A;  5IOR A;  1EH1 A;  4G0V A;  5EGE A;  1O27 A;  5IOS A;  2P5M A;  4KDD A;  2KWA A;  4G0W A;  2R7Z A;  1TWA A;  1ISE A;  3GTO A;  3L4J A;  2R92 A;  3CAG A;  2YU9 A;  3LPX A;  4GT9 A;  2B63 A;  1ZXO A;  1AB4 A;  2PHC B;  1I3Q A;  2JA7 A;  4KAW X;  1F9N A;  4KM9 A;  4KB4 A;  3S0X A;  2VUM A;  3GTP A;  4C3I C;  3GTL A;  2E2I A;  3AQO A;  3G4C A;  4KAR A;  4GFQ A;  3H0G A;  1K83 A;  3GTQ A;  4FZB A;  2E2H A;  1B4B A;  1GE9 A;  1WIH A;  2CFA A;  2XCO A;  1O2B A;  5EGH A;  3N0C A;  5TJ3 A;  1XXC A;  3BUE A;  2CFA B;  4J3N A;  3OPF A;  5JVO A;  3ERE D;  1ZVU A;  1O26 A;  4LQY A;  3AQP A;  1EK8 A;  4LR2 A;  1BJT A;  1DD5 A;  3CQZ A;  1WCM A;  4C3J C;  2JA5 A;  1O25 A;  3FKI A;  2GSO A;  4KMH A;  4BLB A;  3NUH A;  2RGR A;  3MML B;  4GTC A;  3ORE A;  2XCR B;  4M1X A;  1B4A A;  3G4A A;  3FHZ A;  2RH6 A;  3LAJ A;  4BKW A;  2NVY A;  5IOT A;  4GTL A;  4KMD A;  3L4K A;  3GTJ A;  4DDQ A;  1SFO A;  4GTB A;  1I50 A;  1O24 A;  1TWC A;  4BLA A;  2GSU A;  1WQH A;  3Q3Q A;  1O28 A;  4C2M C;  4KC6 A;  3QX3 A;  3V4G A;  4P5B A;  4KM8 A;  2Y3P A;  3N3Y A;  4KAS A;  2XCQ A;  3GTG A;  2ZFZ A;  1BGW A;  1ZBS A;  5JFE A;  1TWH A;  1O2A A;  3GTK A;  3OEP A;  5CHP A;  1XXB A;  4KMA A;  1WQF A;  4KB2 A;  3GTM A;  5IOQ A;  1O29 A;  4GTF A;  1TWG A;  1KQ4 A;  4GTA A;  1WQG A;  3FOF A;  1Y1W A;  4GTD A;  1TWF A;  2GSN A;  3LAP A;  3AH5 A;  3FOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...