4KMAA

Crystal structure of drosophila suppressor of fused
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
460
structure length
440
Chain Sequence
AMDPEFMAEKPPPGLKAIIDHLGQVYPNQPNPLQVTTLLKYWLGGQDPLDYISMYNYPGDVDRNVPPHWHYISFGLSDLHGDERVHLREEGVTRSGMGFELTFRLAKTEIELKQQIENPEKPQRPPTWPANLLQAIGRYCFQTGNGLCFGDNIPWRKSLDGSTTSKLQNLLVAQDPQLGCIDTPTGTVDFCQIVGVFDDELEQASRWNGRGVLNFLRQDMQTGGDWLVTNMDRQMSVFELFPETLLNLQDDLEKQGSDLAGVNADFTFRELKPTKEVKEEVDFQALSEKCANDKREEPSFPQSMSMSSNSLHKSCPLDFQAQAPNCISLDGIEITLAPGVAKYLLLAIKDRIRHGRHFTFKAQHLALTLVAESVTGSAVTVNEPYGVLGYWIQVLIPDELVPRLMEDFCSAGLDEKCEPKERLELEWPDKNLKLIIDQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the mutual recognition and regulation between Suppressor of Fused and Gli/Ci.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
molecule keywords GM14141p
total genus 118
structure length 440
sequence length 460
ec nomenclature
pdb deposition date 2013-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05076 SUFU Suppressor of fused protein (SUFU)
A PF12470 SUFU_C Suppressor of Fused Gli/Ci N terminal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.230 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kmaA02
4KM8A 4KM9A 4KMHA 4KMDA 4KMAA 4BLAA 4BLBA
chains in the Genus database with same CATH superfamily
1Y1VA 4GTDA 1SFOK 4A3LK 1B4AA 1XXAA 1KQ4A 5C44K 3BP8C 3S1NC 1O2AA 5CHPA 1WCMA 3V4GA 3S2DK 1TWGA 4A3BC 1J98A 1Y1WC 1Y1WA 3L4JA 1I3QK 2GSNA 4KM9A 1O24A 1TWFK 4BBSC 3A8KA 2V6UA 4KARA 1JOEA 3DXJA 4C3IK 1R9TA 1WCMK 1ZVUA 3FOFA 3BP3A 3HXAA 3S0XA 4QIWL 3FKIA 3GEEA 4RMFA 4DDQA 2JA8K 1J6WA 2PPBA 4GTEA 3LPXA 4BLBA 1F7UA 1J6VA 3GIRA 4KMDA 3AQOA 4BXXK 3S14K 1DCOA 3T00A 1K83K 1VH2A 1EH1A 3CAGA 2RGRA 2JA5K 5M3MK 3GTQK 4GTBA 4P5BA 4XSXA 4XCHA 3RZOK 5FLMC 3GTQA 1HQMA 3S1QK 3AD7C 2CFAB 4A3KC 2A69A 4QJVB 3GTMC 1F9NA 3M4OK 4A3EK 4G0WA 3S1RK 1I50K 2WB1L 1YNJA 3H0GA 2GSOA 4AH6A 2NVXC 4G7ZA 3H0GK 4YFKA 2R7ZC 3BUEA 3GTKC 4QIWD 2KWAA 1DD5A 2JA6A 4P9SA 1RU0A 1L0WA 3PO2C 1IW7A 3GTGA 3N0CA 3LAJA 1EQRA 4G7OA 2PMZD 3TFIA 1IBAA 1J6XA 1XPPA 4YFNA 1TWGK 1WOOA 3HOZK 2V6TA 3ADAC 3S16C 3PO3K 3GTLC 2R7ZK 4LK0A 4JK1A 5HL8A 5C4XK 3H0GC 5M5YK 4A3FK 1WSVA 1ZQ1C 4MEYA 3CQZA 2GAGC 3RZDC 3HOWK 2NVTC 1TWGC 5TJ3A 4OIPA 2A6HA 3N3YA 3GTPK 2PA8D 2NVYK 4A3GC 2ZFZA 1I3QA 4YG2A 1VRQC 1BDFA 3SZYA 4WILA 4BXXC 5M5XK 3GTGK 4A3GK 1K83C 5EGEA 4LR2A 4AYBL 2O5IA 4NOIA 5E68A 4A3BK 5M5WK 4A3IC 4A3JC 5IP9C 4KDDA 2W7VA 2Y0SD 2E2IC 4C2MC 1TWCC 1TWCA 4A3JK 4A3FC 3S15C 5TMFA 1I6VA 3FKIC 2CW0A 4LQYA 4QJVA 3S1MC 3OREA 1PJ6A 3GTGC 1O26A 2E2JC 4Y7NC 3G4AA 2VUMA 4KC6A 1O27A 4MQ9A 3FOEA 4GTFA 4A3DC 3GTQC 4WJ4A 3S2HK 4ZH4A 1VJEA 1Y1WK 4KMHA 4PABA 3K7AK 3TFHA 3HOVC 2JA5C 1WOPA 3A8JA 3VA7A 4Y52K 2NVXA 2WB1D 2P5MA 3FHZA 4G0UA 3WODA 1UV7A 4FZBA 4M1XA 5IYBC 4MEXA 4C3JC 5IYCK 2JA8C 3L4KA 5C4XC 1R9TK 1YCLA 3GDZA 4PAAA 2XCRB 1TWHC 2R92C 3HOUK 1TWHK 4GTCA 1DCPA 2WAQD 5IOSA 5IP7K 2JA6K 4KB4A 2JA7C 5IYCC 3GTLA 2P8TA 1BS2A 3HKZL 1R9TC 3N0BA 2PHCB 4C3HC 2ZUEA 1USMA 3PO3C 2O5JA 1I50A 1SFOC 3S16K 5D4DA 4GZYA 2XCOA 2JA6C 2NVYC 1XZPA 4KATA 3RZDK 4Q5SA 2GAHC 3S2DC 2V6SA 2NVTK 2EBBA 1Y1VC 5IYDK 3TFJA 1O2FB 4C2MK 2E2IK 3FKIK 1HI9A 1F93A 4LOWA 3S15K 1WQFA 4OIQA 1XXBA 5FJ8K 3HKZD 2ZUFA 1IE0A 1XXCA 4XSZA 3AD8C 2A68A 3H3VD 1TWAA 4GT9A 3I4MK 4ILDA 1PJ7A 4Y7NK 3GTMA 3T02A 1WIHA 3LAPA 1YX2A 4Q4ZA 4BY1C 5IYBK 1IQ0A 1XZQA 3GEHA 3GTJC 3IPJA 4LLGA 4GTLA 3I4NK 2R93A 2R93C 3A8IA 4O2DA 5JVOA 4KM8A 5IP9K 2JA7A 1TWCK 2D6FC 1SFOA 4C45A 1WORA 1WQGA 5FLMK 1ISEA 2VUMC 3CQZC 5IOTA 4Y52C 4BLAA 1O2BA 4BY1K 1WOSA 1TWAK 4KAWX 2JH3A 3K7AC 1WSRA 3HOUC 4A3DK 3S2HC 3AD9C 3GTJA 3OPFA 3QX3A 4G0VA 1O28A 3GEIA 2E2HA 1Y1VK 2B63A 1EI6A 2NVQC 3M4OC 3GTLK 1X31C 4YFXA 5TMCA 4A3EC 1SMYA 3S1RC 1O29A 3HOZC 4A3IK 3T01A 1F7VA 2YU9C 1ZBSA 2YU9A 3PO2K 3GTPA 1WQHA 2JA5A 3HOWC 2R92A 5C44C 4J3NA 4FM9A 3NUHA 3JSTA 1JQWA 4A3LC 5C3EK 3Q3QA 5C4JK 1YNNA 2E2IA 2JA7K 4XLPA 4C3HK 1B4BA 3MMLB 2NVQK 5C3EC 5IYDC 2RH6A 4P5AA 2Y0SL 3OEPA 4KMUA 4OINA 1JVIA 1WCMC 4LJZA 1I3QC 2FQTA 2FQOA 1ZYRA 1TWFA 1TWFC 5L46A 2YU9K 1ZXOA 2A6EA 4BBSK 4A3MC 3AQPA 1USOA 3ERED 4KN4A 2NVYA 5IOQA 1INNA 4BKWA 4A3MK 1IS1A 5CJ9A 1K83A 3S1MK 3S14C 4GFQA 3TTGA 5JFEA 4KB2A 5C4JC 4G7HA 3S1NK 1GE9A 3CQZK 4BBRK 3EQLA 4KASA 3SZZA 2R93K 5M3FK 2NVXK 3GTKA 3GTJK 4KN7A 3AH5A 2XCQA 2BE5A 2WAQL 3RZOC 4A93K 2R92K 4C3IC 1I50C 3HOVK 4GTAA 4X6AK 3I4MC 5IORA 3S1QC 1G51A 4A93C 2PMZL 2PA8L 1TWAC 4LK1A 3GTOC 1VGXA 4A3KK 4X6AC 3HOXK 4WJ3M 1DCHA 2E2JK 1EK8A 5EGHA 2VUMK 1I6HC 1V5VA 3GTKK 4C3JK 2E2HK 1O25A 1XZQB 4BBRC 2B63K 2Y3PA 3M3YC 1EFWA 4KMAA 1IL2A 4OIOA 3S17C 2E2HC 2B63C 2GSUA 1BGWA 3HOYC 4A3CC 3I4NC 4XLNA 2R7ZA 3M3YK 3HOYK 1VLOA 2CFAA 3S17K 4A3CK 1XZPB 3HOXC 3GSIA 4OIRA 5IP7C 3H3VL 1I6HK 3GTMK 1TWHA 4AYBD 1PJ5A 3GTOK 4BY7K 1C0AA 1BJTA 3GTPC 1AB4A 3GTOA 3G4CA 4BY7C
chains in the Genus database with same CATH topology
1I50A 2XCOA 1ZBSA 2YU9A 3GTPA 3CQZA 1WQHA 2JA5A 1Y1VA 4GTDA 2R92A 4J3NA 1B4AA 4FM9A 3NUHA 4KATA 5TJ3A 1XXAA 1KQ4A 3N3YA 3Q3QA 2ZFZA 1O2AA 1I3QA 2E2IA 5CHPA 1WCMA 1B4BA 3MMLB 3V4GA 1TWGA 5EGEA 4LR2A 1Y1WA 2RH6A 4P5AA 3L4JA 3OEPA 2GSNA 4KM9A 1O24A 4KDDA 4KARA 1WQFA 4C2MC 1TWFA 1TWCA 1ZXOA 1XXBA 1R9TA 1ZVUA 3FOFA 3AQPA 4LQYA 3ERED 3S0XA 2NVYA 3FKIA 1XXCA 5IOQA 3OREA 4BKWA 1IS1A 5CJ9A 1O26A 1K83A 4DDQA 3G4AA 1TWAA 4GTEA 4GT9A 3LPXA 4ILDA 1O27A 4GFQA 4KC6A 4BLBA 4KB2A 5JFEA 3GTMA 1GE9A 3FOEA 1WIHA 4GTFA 4KMDA 3LAPA 3AQOA 4KASA 1EH1A 3CAGA 4KMHA 2RGRA 3GTKA 4GTLA 2R93A 4GTBA 4P5BA 3AH5A 2XCQA 5JVOA 4KM8A 2JA7A 3GTQA 3VA7A 1SFOA 4C3IC 2CFAB 4GTAA 2NVXA 5IORA 2P5MA 1F9NA 1WQGA 3FHZA 4G0UA 1ISEA 4G0WA 5IOTA 4FZBA 4M1XA 4BLAA 1O2BA 4C3JC 2VUMA 3H0GA 2GSOA 1EK8A 5EGHA 3L4KA 4KAWX 2JH3A 1O25A 2Y3PA 2XCRB 4KMAA 3BUEA 2GSUA 1BGWA 2KWAA 3GTJA 1DD5A 2JA6A 4GTCA 2R7ZA 5IOSA 3OPFA 2CFAA 3GTGA 3QX3A 3N0CA 3LAJA 4G0VA 4KB4A 3GTLA 1O28A 2E2HA 2B63A 1TWHA 1BJTA 3N0BA 1O29A 1AB4A 3GTOA 3G4CA 2PHCB 4C3HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KM8 A;  4KM9 A;  4KMH A;  4KMD A;  4KMA A;  4BLA A;  4BLB A; 
#chains in the Genus database with same CATH topology
 1Y1V A;  4GTD A;  1SFO K;  4A3L K;  1B4A A;  1XXA A;  1KQ4 A;  5C44 K;  3BP8 C;  3S1N C;  1O2A A;  5CHP A;  1WCM A;  3V4G A;  3S2D K;  1TWG A;  4A3B C;  1J98 A;  1Y1W C;  1Y1W A;  3L4J A;  1I3Q K;  2GSN A;  4KM9 A;  1O24 A;  1TWF K;  4BBS C;  3A8K A;  2V6U A;  4KAR A;  1JOE A;  3DXJ A;  4C3I K;  1R9T A;  1WCM K;  1ZVU A;  3FOF A;  3BP3 A;  3HXA A;  3S0X A;  4QIW L;  3FKI A;  3GEE A;  4RMF A;  4DDQ A;  2JA8 K;  1J6W A;  2PPB A;  4GTE A;  3LPX A;  4BLB A;  1F7U A;  1J6V A;  3GIR A;  4KMD A;  3AQO A;  4BXX K;  3S14 K;  1DCO A;  3T00 A;  1K83 K;  1VH2 A;  1EH1 A;  3CAG A;  2RGR A;  2JA5 K;  5M3M K;  3GTQ K;  4GTB A;  4P5B A;  4XSX A;  4XCH A;  3RZO K;  5FLM C;  3GTQ A;  1HQM A;  3S1Q K;  3AD7 C;  2CFA B;  4A3K C;  2A69 A;  4QJV B;  3GTM C;  1F9N A;  3M4O K;  4A3E K;  4G0W A;  3S1R K;  1I50 K;  2WB1 L;  1YNJ A;  3H0G A;  2GSO A;  4AH6 A;  2NVX C;  4G7Z A;  3H0G K;  4YFK A;  2R7Z C;  3BUE A;  3GTK C;  4QIW D;  2KWA A;  1DD5 A;  2JA6 A;  4P9S A;  1RU0 A;  1L0W A;  3PO2 C;  1IW7 A;  3GTG A;  3N0C A;  3LAJ A;  1EQR A;  4G7O A;  2PMZ D;  3TFI A;  1IBA A;  1J6X A;  1XPP A;  4YFN A;  1TWG K;  1WOO A;  3HOZ K;  2V6T A;  3ADA C;  3S16 C;  3PO3 K;  3GTL C;  2R7Z K;  4LK0 A;  4JK1 A;  5HL8 A;  5C4X K;  3H0G C;  5M5Y K;  4A3F K;  1WSV A;  1ZQ1 C;  4MEY A;  3CQZ A;  2GAG C;  3RZD C;  3HOW K;  2NVT C;  1TWG C;  5TJ3 A;  4OIP A;  2A6H A;  3N3Y A;  3GTP K;  2PA8 D;  2NVY K;  4A3G C;  2ZFZ A;  1I3Q A;  4YG2 A;  1VRQ C;  1BDF A;  3SZY A;  4WIL A;  4BXX C;  5M5X K;  3GTG K;  4A3G K;  1K83 C;  5EGE A;  4LR2 A;  4AYB L;  2O5I A;  4NOI A;  5E68 A;  4A3B K;  5M5W K;  4A3I C;  4A3J C;  5IP9 C;  4KDD A;  2W7V A;  2Y0S D;  2E2I C;  4C2M C;  1TWC C;  1TWC A;  4A3J K;  4A3F C;  3S15 C;  5TMF A;  1I6V A;  3FKI C;  2CW0 A;  4LQY A;  4QJV A;  3S1M C;  3ORE A;  1PJ6 A;  3GTG C;  1O26 A;  2E2J C;  4Y7N C;  3G4A A;  2VUM A;  4KC6 A;  1O27 A;  4MQ9 A;  3FOE A;  4GTF A;  4A3D C;  3GTQ C;  4WJ4 A;  3S2H K;  4ZH4 A;  1VJE A;  1Y1W K;  4KMH A;  4PAB A;  3K7A K;  3TFH A;  3HOV C;  2JA5 C;  1WOP A;  3A8J A;  3VA7 A;  4Y52 K;  2NVX A;  2WB1 D;  2P5M A;  3FHZ A;  4G0U A;  3WOD A;  1UV7 A;  4FZB A;  4M1X A;  5IYB C;  4MEX A;  4C3J C;  5IYC K;  2JA8 C;  3L4K A;  5C4X C;  1R9T K;  1YCL A;  3GDZ A;  4PAA A;  2XCR B;  1TWH C;  2R92 C;  3HOU K;  1TWH K;  4GTC A;  1DCP A;  2WAQ D;  5IOS A;  5IP7 K;  2JA6 K;  4KB4 A;  2JA7 C;  5IYC C;  3GTL A;  2P8T A;  1BS2 A;  3HKZ L;  1R9T C;  3N0B A;  2PHC B;  4C3H C;  2ZUE A;  1USM A;  3PO3 C;  2O5J A;  1I50 A;  1SFO C;  3S16 K;  5D4D A;  4GZY A;  2XCO A;  2JA6 C;  2NVY C;  1XZP A;  4KAT A;  3RZD K;  4Q5S A;  2GAH C;  3S2D C;  2V6S A;  2NVT K;  2EBB A;  1Y1V C;  5IYD K;  3TFJ A;  1O2F B;  4C2M K;  2E2I K;  3FKI K;  1HI9 A;  1F93 A;  4LOW A;  3S15 K;  1WQF A;  4OIQ A;  1XXB A;  5FJ8 K;  3HKZ D;  2ZUF A;  1IE0 A;  1XXC A;  4XSZ A;  3AD8 C;  2A68 A;  3H3V D;  1TWA A;  4GT9 A;  3I4M K;  4ILD A;  1PJ7 A;  4Y7N K;  3GTM A;  3T02 A;  1WIH A;  3LAP A;  1YX2 A;  4Q4Z A;  4BY1 C;  5IYB K;  1IQ0 A;  1XZQ A;  3GEH A;  3GTJ C;  3IPJ A;  4LLG A;  4GTL A;  3I4N K;  2R93 A;  2R93 C;  3A8I A;  4O2D A;  5JVO A;  4KM8 A;  5IP9 K;  2JA7 A;  1TWC K;  2D6F C;  1SFO A;  4C45 A;  1WOR A;  1WQG A;  5FLM K;  1ISE A;  2VUM C;  3CQZ C;  5IOT A;  4Y52 C;  4BLA A;  1O2B A;  4BY1 K;  1WOS A;  1TWA K;  4KAW X;  2JH3 A;  3K7A C;  1WSR A;  3HOU C;  4A3D K;  3S2H C;  3AD9 C;  3GTJ A;  3OPF A;  3QX3 A;  4G0V A;  1O28 A;  3GEI A;  2E2H A;  1Y1V K;  2B63 A;  1EI6 A;  2NVQ C;  3M4O C;  3GTL K;  1X31 C;  4YFX A;  5TMC A;  4A3E C;  1SMY A;  3S1R C;  1O29 A;  3HOZ C;  4A3I K;  3T01 A;  1F7V A;  2YU9 C;  1ZBS A;  2YU9 A;  3PO2 K;  3GTP A;  1WQH A;  2JA5 A;  3HOW C;  2R92 A;  5C44 C;  4J3N A;  4FM9 A;  3NUH A;  3JST A;  1JQW A;  4A3L C;  5C3E K;  3Q3Q A;  5C4J K;  1YNN A;  2E2I A;  2JA7 K;  4XLP A;  4C3H K;  1B4B A;  3MML B;  2NVQ K;  5C3E C;  5IYD C;  2RH6 A;  4P5A A;  2Y0S L;  3OEP A;  4KMU A;  4OIN A;  1JVI A;  1WCM C;  4LJZ A;  1I3Q C;  2FQT A;  2FQO A;  1ZYR A;  1TWF A;  1TWF C;  5L46 A;  2YU9 K;  1ZXO A;  2A6E A;  4BBS K;  4A3M C;  3AQP A;  1USO A;  3ERE D;  4KN4 A;  2NVY A;  5IOQ A;  1INN A;  4BKW A;  4A3M K;  1IS1 A;  5CJ9 A;  1K83 A;  3S1M K;  3S14 C;  4GFQ A;  3TTG A;  5JFE A;  4KB2 A;  5C4J C;  4G7H A;  3S1N K;  1GE9 A;  3CQZ K;  4BBR K;  3EQL A;  4KAS A;  3SZZ A;  2R93 K;  5M3F K;  2NVX K;  3GTK A;  3GTJ K;  4KN7 A;  3AH5 A;  2XCQ A;  2BE5 A;  2WAQ L;  3RZO C;  4A93 K;  2R92 K;  4C3I C;  1I50 C;  3HOV K;  4GTA A;  4X6A K;  3I4M C;  5IOR A;  3S1Q C;  1G51 A;  4A93 C;  2PMZ L;  2PA8 L;  1TWA C;  4LK1 A;  3GTO C;  1VGX A;  4A3K K;  4X6A C;  3HOX K;  4WJ3 M;  1DCH A;  2E2J K;  1EK8 A;  5EGH A;  2VUM K;  1I6H C;  1V5V A;  3GTK K;  4C3J K;  2E2H K;  1O25 A;  1XZQ B;  4BBR C;  2B63 K;  2Y3P A;  3M3Y C;  1EFW A;  4KMA A;  1IL2 A;  4OIO A;  3S17 C;  2E2H C;  2B63 C;  2GSU A;  1BGW A;  3HOY C;  4A3C C;  3I4N C;  4XLN A;  2R7Z A;  3M3Y K;  3HOY K;  1VLO A;  2CFA A;  3S17 K;  4A3C K;  1XZP B;  3HOX C;  3GSI A;  4OIR A;  5IP7 C;  3H3V L;  1I6H K;  3GTM K;  1TWH A;  4AYB D;  1PJ5 A;  3GTO K;  4BY7 K;  1C0A A;  1BJT A;  3GTP C;  1AB4 A;  3GTO A;  3G4C A;  4BY7 C; 
#chains in the Genus database with same CATH homology
 1I50 A;  2XCO A;  1ZBS A;  2YU9 A;  3GTP A;  3CQZ A;  1WQH A;  2JA5 A;  1Y1V A;  4GTD A;  2R92 A;  4J3N A;  1B4A A;  4FM9 A;  3NUH A;  4KAT A;  5TJ3 A;  1XXA A;  1KQ4 A;  3N3Y A;  3Q3Q A;  2ZFZ A;  1O2A A;  1I3Q A;  2E2I A;  5CHP A;  1WCM A;  1B4B A;  3MML B;  3V4G A;  1TWG A;  5EGE A;  4LR2 A;  1Y1W A;  2RH6 A;  4P5A A;  3L4J A;  3OEP A;  2GSN A;  4KM9 A;  1O24 A;  4KDD A;  4KAR A;  1WQF A;  4C2M C;  1TWF A;  1TWC A;  1ZXO A;  1XXB A;  1R9T A;  1ZVU A;  3FOF A;  3AQP A;  4LQY A;  3ERE D;  3S0X A;  2NVY A;  3FKI A;  1XXC A;  5IOQ A;  3ORE A;  4BKW A;  1IS1 A;  5CJ9 A;  1O26 A;  1K83 A;  4DDQ A;  3G4A A;  1TWA A;  4GTE A;  4GT9 A;  3LPX A;  4ILD A;  1O27 A;  4GFQ A;  4KC6 A;  4BLB A;  4KB2 A;  5JFE A;  3GTM A;  1GE9 A;  3FOE A;  1WIH A;  4GTF A;  4KMD A;  3LAP A;  3AQO A;  4KAS A;  1EH1 A;  3CAG A;  4KMH A;  2RGR A;  3GTK A;  4GTL A;  2R93 A;  4GTB A;  4P5B A;  3AH5 A;  2XCQ A;  5JVO A;  4KM8 A;  2JA7 A;  3GTQ A;  3VA7 A;  1SFO A;  4C3I C;  2CFA B;  4GTA A;  2NVX A;  5IOR A;  2P5M A;  1F9N A;  1WQG A;  3FHZ A;  4G0U A;  1ISE A;  4G0W A;  5IOT A;  4FZB A;  4M1X A;  4BLA A;  1O2B A;  4C3J C;  2VUM A;  3H0G A;  2GSO A;  1EK8 A;  5EGH A;  3L4K A;  4KAW X;  2JH3 A;  1O25 A;  2Y3P A;  2XCR B;  4KMA A;  3BUE A;  2GSU A;  1BGW A;  2KWA A;  3GTJ A;  1DD5 A;  2JA6 A;  4GTC A;  2R7Z A;  5IOS A;  3OPF A;  2CFA A;  3GTG A;  3QX3 A;  3N0C A;  3LAJ A;  4G0V A;  4KB4 A;  3GTL A;  1O28 A;  2E2H A;  2B63 A;  1TWH A;  1BJT A;  3N0B A;  1O29 A;  1AB4 A;  3GTO A;  3G4C A;  2PHC B;  4C3H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...