4KMAA

Crystal structure of drosophila suppressor of fused
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
460
structure length
440
Chain Sequence
b'AMDPEFMAEKPPPGLKAIIDHLGQVYPNQPNPLQVTTLLKYWLGGQDPLDYISMYNYPGDVDRNVPPHWHYISFGLSDLHGDERVHLREEGVTRSGMGFELTFRLAKTEIELKQQIENPEKPQRPPTWPANLLQAIGRYCFQTGNGLCFGDNIPWRKSLDGSTTSKLQNLLVAQDPQLGCIDTPTGTVDFCQIVGVFDDELEQASRWNGRGVLNFLRQDMQTGGDWLVTNMDRQMSVFELFPETLLNLQDDLEKQGSDLAGVNADFTFRELKPTKEVKEEVDFQALSEKCANDKREEPSFPQSMSMSSNSLHKSCPLDFQAQAPNCISLDGIEITLAPGVAKYLLLAIKDRIRHGRHFTFKAQHLALTLVAESVTGSAVTVNEPYGVLGYWIQVLIPDELVPRLMEDFCSAGLDEKCEPKERLELEWPDKNLKLIIDQPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GM14141p
publication title Structural insight into the mutual recognition and regulation between Suppressor of Fused and Gli/Ci.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein binding
total genus 118
structure length 440
sequence length 460
ec nomenclature
pdb deposition date 2013-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05076 SUFU Suppressor of fused protein (SUFU)
A PF12470 SUFU_C Suppressor of Fused Gli/Ci N terminal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.230 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4kmaA02
4BLBA 4KM9A 4KMAA 4KM8A 4KMHA 4KMDA 4BLAA
chains in the Genus database with same CATH superfamily
3GTJA 3S2DC 1TWGC 4A3KC 4X6AK 4GTBA 3T00A 2VUMC 4G0UA 1J98A 1BGWA 2O5JA 3S1QC 4KN4A 5TJ3A 1JQWA 1K83K 4GTLA 1Y1VC 3CQZK 3S2HK 3S1NC 3GTLK 4QIWL 4Y7NC 1BDFA 2V6SA 1TWFC 3GTJK 3MMLB 3TFHA 2E2HA 1VGXA 4WJ4A 4BY1C 2NVXC 2WB1L 5IYDK 1INNA 4KN7A 3PO3C 5IYCC 3S1MC 3A8IA 3H3VD 1TWHC 1O2BA 4LK1A 3S17C 2NVYC 1I50C 1WIHA 2JA7K 4GTEA 4KARA 4KB4A 3HOXK 3GTKK 4C3JK 4A3LC 1C0AA 4PAAA 1L0WA 3GEIA 3HOVC 1I6HC 1WQFA 1O25A 3FKIC 5C4XK 1Y1VA 4AYBD 2E2HK 4A93K 4O2DA 2V6UA 2O5IA 2R92C 3CAGA 1SFOA 1ZVUA 4GT9A 2V6TA 3M4OC 3N0BA 4LQYA 4XSZA 1O27A 4X6AC 3PO2K 4KATA 2NVXA 1ZYRA 4GFQA 1XXBA 1KQ4A 4XSXA 3T02A 4G7OA 3GSIA 3I4MC 3ERED 4FZBA 1B4AA 3BP3A 4WJ3M 3GTOA 5M3FK 3CQZC 1XZPB 4YFNA 3K7AK 4A3FK 3S2HC 3GTLC 1TWAK 2XCQA 1O2FB 4BLBA 1SFOK 3S1RK 2B63A 3NUHA 4KM9A 4A3GK 3GTJC 1IQ0A 1VJEA 5IYDC 3HOUK 3H3VL 2NVQK 4OIOA 3V4GA 2WB1D 3RZOK 4MEYA 4KMUA 5IORA 1WCMK 1BS2A 1YX2A 1PJ7A 1O26A 4BBRK 4A3EK 3GTOK 2A6EA 1F7UA 2FQOA 4C3HK 3HOXC 4C3JC 1O28A 2GAGC 1WQGA 4QJVB 1B4BA 1K83A 3LPXA 1DD5A 2A69A 2ZUEA 2E2HC 1XZPA 4A93C 1O24A 4XCHA 3ADAC 1JOEA 4KMHA 2R7ZA 1WOPA 2YU9A 1J6VA 2BE5A 4KMAA 3PO2C 1J6WA 3H0GA 3AD9C 5FJ8K 4MEXA 4A3JK 1Y1WA 2W7VA 4A3BK 2JA7A 3K7AC 4A3FC 3GTKA 3RZDK 1SFOC 3BUEA 2RGRA 3BP8C 4KAWX 3S1RC 3I4NK 1WOSA 2R7ZK 1PJ5A 2YU9K 3M3YK 1F9NA 4A3GC 3GTMA 3FOFA 4ZH4A 1WSVA 3H0GK 3HOUC 1I6VA 1BJTA 4KC6A 3LAJA 1O29A 2NVQC 3T01A 2E2JK 1Y1WK 5IYBK 4BY7K 1G51A 3A8KA 4GTFA 4G7HA 3RZOC 1WCMC 3HKZD 4BBRC 4YG2A 4A3EC 1EQRA 2E2IK 3GTOC 4XLNA 1YNJA 3TTGA 3N3YA 3TFJA 1EK8A 4FM9A 1EFWA 2WAQD 2B63C 1ZBSA 1HQMA 3GTMK 1PJ6A 1WSRA 2A6HA 4Y52K 1TWAA 1IW7A 1R9TA 5JVOA 3HOZC 5FLMK 4GTCA 3AH5A 4A3CK 2JH3A 4DDQA 1XZQB 4LLGA 3GTQA 1JVIA 2PA8D 1V5VA 4LJZA 4A3JC 4A3IK 2JA5K 3IPJA 2NVTK 5M3MK 4A3BC 5E68A 1WCMA 1K83C 1VLOA 3VA7A 3G4AA 3L4KA 1I3QK 4G0WA 4G7ZA 3RZDC 1TWGK 4A3KK 3AQOA 1R9TK 5C3EK 2R7ZC 5CJ9A 3L4JA 5C44K 2YU9C 1EH1A 3M3YC 4P5BA 4C45A 2PMZL 4A3DK 3GEEA 3H0GC 3GTQK 3GDZA 1HI9A 3HKZL 2E2JC 1Y1WC 5IYBC 2PHCB 1XZQA 3FHZA 3GTPA 1DCHA 3LAPA 4OIPA 2WAQL 2Y0SD 2XCRB 2JA7C 1GE9A 2GSOA 4C3IK 3GTKC 2R93A 3Q3QA 4BY1K 2D6FC 4BBSK 5IP9K 5C4XC 3GTMC 1J6XA 1F93A 2XCOA 4Y52C 1WORA 3S14K 4ILDA 5FLMC 4Q5SA 2PA8L 3HOWK 3GEHA 1I50K 1DCOA 2GSNA 4OINA 1VH2A 2A68A 3GTPK 5D4DA 4LR2A 4P5AA 1RU0A 4NOIA 4YFKA 4A3IC 2JA8K 4GTAA 2JA5C 3FKIK 2KWAA 2NVTC 3S16K 2R93K 4XLPA 1IL2A 5CHPA 5IP7K 4OIQA 4BLAA 3S0XA 2R92K 3HXAA 2E2IA 3EQLA 1IE0A 1WOOA 1I3QC 4WILA 1XXAA 4KMDA 1WQHA 1TWAC 1R9TC 5C3EC 4QJVA 5C44C 5TMCA 4G0VA 2CW0A 4MQ9A 2FQTA 4A3DC 3I4MK 2JA6K 3GTQC 3OPFA 2PMZD 4P9SA 1TWCK 4C2MK 2Y0SL 3AQPA 1IBAA 1YNNA 3JSTA 1AB4A 2JA5A 3SZZA 4C3IC 4BKWA 4YFXA 4C3HC 2EBBA 4GZYA 1USMA 3GTGA 4BBSC 5IP9C 4PABA 3AD7C 3OEPA 2ZFZA 4LK0A 5JFEA 5L46A 5TMFA 1I3QA 4M1XA 1TWGA 3WODA 3S14C 5EGHA 5EGEA 5M5WK 2VUMA 3HOWC 4BXXK 1UV7A 5IOTA 3GTPC 4KB2A 1XPPA 3S15K 5C4JK 2P5MA 2JA8C 2GAHC 3S16C 2R93C 5IP7C 1O2AA 3GTGK 4A3MK 1ISEA 3HOYK 3DXJA 4KM8A 1TWFA 2CFAB 3S2DK 3I4NC 1SMYA 4LOWA 2VUMK 4KASA 5HL8A 4AH6A 3SZYA 5IOQA 1ZQ1C 2JA6C 1YCLA 4JK1A 3S1QK 1TWHA 1TWCC 2NVYA 3N0CA 1I50A 4BY7C 3G4CA 4C2MC 1Y1VK 3FOEA 1VRQC 3S1NK 4J3NA 4Q4ZA 4Y7NK 4OIRA 2E2IC 3FKIA 1TWFK 4QIWD 1X31C 3QX3A 2R92A 2NVXK 5M5XK 1DCPA 2GSUA 3OREA 3PO3K 2CFAA 5IYCK 2ZUFA 1XXCA 3S1MK 1TWHK 3A8JA 3S17K 2RH6A 2NVYK 4A3CC 5M5YK 4BXXC 4RMFA 1IS1A 3GIRA 3S15C 2JA6A 3AD8C 4A3LK 2Y3PA 4AYBL 5C4JC 2P8TA 1F7VA 1TWCA 3HOVK 2B63K 1I6HK 1USOA 3TFIA 3CQZA 4KDDA 3GTGC 4GTDA 5IOSA 4A3MC 1ZXOA 2PPBA 3GTLA 3HOYC 3M4OK 3HOZK 1EI6A
chains in the Genus database with same CATH topology
4C3HC 3GTJA 3V4GA 3GTGA 4GTBA 1WCMA 5IORA 5JFEA 3OEPA 2ZFZA 4G0UA 1O26A 1BGWA 3VA7A 3G4AA 1I3QA 4M1XA 3L4KA 4G0WA 4C3JC 1TWGA 1O28A 3AQOA 5EGHA 5TJ3A 5CJ9A 1WQGA 5EGEA 3L4JA 1EH1A 2VUMA 1B4BA 1K83A 3LPXA 4P5BA 1DD5A 4GTLA 5IOTA 4KB2A 1O24A 4KMHA 2P5MA 2R7ZA 2YU9A 4KMAA 2PHCB 3MMLB 2E2HA 1O2AA 3FHZA 3GTPA 1ISEA 3H0GA 3LAPA 4KM8A 2XCRB 1GE9A 2GSOA 1Y1WA 2R93A 3Q3QA 1TWFA 2CFAB 1O2BA 4KASA 5IOQA 1WIHA 2JA7A 4GTEA 4KARA 3GTKA 4KB4A 2XCOA 3BUEA 2RGRA 4ILDA 4KAWX 1TWHA 1WQFA 2NVYA 1O25A 1F9NA 3N0CA 3GTMA 1I50A 1Y1VA 3G4CA 4C2MC 3FOFA 2GSNA 3FOEA 4J3NA 3CAGA 1SFOA 4LR2A 1BJTA 1ZVUA 4GT9A 4P5AA 4KC6A 3LAJA 1O29A 4GTAA 3FKIA 2KWAA 3N0BA 4LQYA 1O27A 4GTFA 5CHPA 4KATA 3QX3A 2NVXA 2R92A 4BLAA 4GFQA 3S0XA 1XXBA 1KQ4A 2E2IA 2GSUA 1XXAA 4KMDA 3OREA 3N3YA 1WQHA 2CFAA 1EK8A 3ERED 4FM9A 1XXCA 4FZBA 1ZBSA 1B4AA 2RH6A 3GTOA 4G0VA 1IS1A 2JA6A 1TWAA 2Y3PA 2XCQA 4BLBA 1R9TA 3OPFA 5JVOA 2B63A 1TWCA 3NUHA 4GTCA 3AH5A 4KM9A 2JH3A 4DDQA 3CQZA 3AQPA 4KDDA 4GTDA 5IOSA 1ZXOA 3GTQA 3GTLA 1AB4A 2JA5A 4C3IC 4BKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BLB A;  4KM9 A;  4KMA A;  4KM8 A;  4KMH A;  4KMD A;  4BLA A; 
#chains in the Genus database with same CATH topology
 3GTJ A;  3S2D C;  1TWG C;  4A3K C;  4X6A K;  4GTB A;  3T00 A;  2VUM C;  4G0U A;  1J98 A;  1BGW A;  2O5J A;  3S1Q C;  4KN4 A;  5TJ3 A;  1JQW A;  1K83 K;  4GTL A;  1Y1V C;  3CQZ K;  3S2H K;  3S1N C;  3GTL K;  4QIW L;  4Y7N C;  1BDF A;  2V6S A;  1TWF C;  3GTJ K;  3MML B;  3TFH A;  2E2H A;  1VGX A;  4WJ4 A;  4BY1 C;  2NVX C;  2WB1 L;  5IYD K;  1INN A;  4KN7 A;  3PO3 C;  5IYC C;  3S1M C;  3A8I A;  3H3V D;  1TWH C;  1O2B A;  4LK1 A;  3S17 C;  2NVY C;  1I50 C;  1WIH A;  2JA7 K;  4GTE A;  4KAR A;  4KB4 A;  3HOX K;  3GTK K;  4C3J K;  4A3L C;  1C0A A;  4PAA A;  1L0W A;  3GEI A;  3HOV C;  1I6H C;  1WQF A;  1O25 A;  3FKI C;  5C4X K;  1Y1V A;  4AYB D;  2E2H K;  4A93 K;  4O2D A;  2V6U A;  2O5I A;  2R92 C;  3CAG A;  1SFO A;  1ZVU A;  4GT9 A;  2V6T A;  3M4O C;  3N0B A;  4LQY A;  4XSZ A;  1O27 A;  4X6A C;  3PO2 K;  4KAT A;  2NVX A;  1ZYR A;  4GFQ A;  1XXB A;  1KQ4 A;  4XSX A;  3T02 A;  4G7O A;  3GSI A;  3I4M C;  3ERE D;  4FZB A;  1B4A A;  3BP3 A;  4WJ3 M;  3GTO A;  5M3F K;  3CQZ C;  1XZP B;  4YFN A;  3K7A K;  4A3F K;  3S2H C;  3GTL C;  1TWA K;  2XCQ A;  1O2F B;  4BLB A;  1SFO K;  3S1R K;  2B63 A;  3NUH A;  4KM9 A;  4A3G K;  3GTJ C;  1IQ0 A;  1VJE A;  5IYD C;  3HOU K;  3H3V L;  2NVQ K;  4OIO A;  3V4G A;  2WB1 D;  3RZO K;  4MEY A;  4KMU A;  5IOR A;  1WCM K;  1BS2 A;  1YX2 A;  1PJ7 A;  1O26 A;  4BBR K;  4A3E K;  3GTO K;  2A6E A;  1F7U A;  2FQO A;  4C3H K;  3HOX C;  4C3J C;  1O28 A;  2GAG C;  1WQG A;  4QJV B;  1B4B A;  1K83 A;  3LPX A;  1DD5 A;  2A69 A;  2ZUE A;  2E2H C;  1XZP A;  4A93 C;  1O24 A;  4XCH A;  3ADA C;  1JOE A;  4KMH A;  2R7Z A;  1WOP A;  2YU9 A;  1J6V A;  2BE5 A;  4KMA A;  3PO2 C;  1J6W A;  3H0G A;  3AD9 C;  5FJ8 K;  4MEX A;  4A3J K;  1Y1W A;  2W7V A;  4A3B K;  2JA7 A;  3K7A C;  4A3F C;  3GTK A;  3RZD K;  1SFO C;  3BUE A;  2RGR A;  3BP8 C;  4KAW X;  3S1R C;  3I4N K;  1WOS A;  2R7Z K;  1PJ5 A;  2YU9 K;  3M3Y K;  1F9N A;  4A3G C;  3GTM A;  3FOF A;  4ZH4 A;  1WSV A;  3H0G K;  3HOU C;  1I6V A;  1BJT A;  4KC6 A;  3LAJ A;  1O29 A;  2NVQ C;  3T01 A;  2E2J K;  1Y1W K;  5IYB K;  4BY7 K;  1G51 A;  3A8K A;  4GTF A;  4G7H A;  3RZO C;  1WCM C;  3HKZ D;  4BBR C;  4YG2 A;  4A3E C;  1EQR A;  2E2I K;  3GTO C;  4XLN A;  1YNJ A;  3TTG A;  3N3Y A;  3TFJ A;  1EK8 A;  4FM9 A;  1EFW A;  2WAQ D;  2B63 C;  1ZBS A;  1HQM A;  3GTM K;  1PJ6 A;  1WSR A;  2A6H A;  4Y52 K;  1TWA A;  1IW7 A;  1R9T A;  5JVO A;  3HOZ C;  5FLM K;  4GTC A;  3AH5 A;  4A3C K;  2JH3 A;  4DDQ A;  1XZQ B;  4LLG A;  3GTQ A;  1JVI A;  2PA8 D;  1V5V A;  4LJZ A;  4A3J C;  4A3I K;  2JA5 K;  3IPJ A;  2NVT K;  5M3M K;  4A3B C;  5E68 A;  1WCM A;  1K83 C;  1VLO A;  3VA7 A;  3G4A A;  3L4K A;  1I3Q K;  4G0W A;  4G7Z A;  3RZD C;  1TWG K;  4A3K K;  3AQO A;  1R9T K;  5C3E K;  2R7Z C;  5CJ9 A;  3L4J A;  5C44 K;  2YU9 C;  1EH1 A;  3M3Y C;  4P5B A;  4C45 A;  2PMZ L;  4A3D K;  3GEE A;  3H0G C;  3GTQ K;  3GDZ A;  1HI9 A;  3HKZ L;  2E2J C;  1Y1W C;  5IYB C;  2PHC B;  1XZQ A;  3FHZ A;  3GTP A;  1DCH A;  3LAP A;  4OIP A;  2WAQ L;  2Y0S D;  2XCR B;  2JA7 C;  1GE9 A;  2GSO A;  4C3I K;  3GTK C;  2R93 A;  3Q3Q A;  4BY1 K;  2D6F C;  4BBS K;  5IP9 K;  5C4X C;  3GTM C;  1J6X A;  1F93 A;  2XCO A;  4Y52 C;  1WOR A;  3S14 K;  4ILD A;  5FLM C;  4Q5S A;  2PA8 L;  3HOW K;  3GEH A;  1I50 K;  1DCO A;  2GSN A;  4OIN A;  1VH2 A;  2A68 A;  3GTP K;  5D4D A;  4LR2 A;  4P5A A;  1RU0 A;  4NOI A;  4YFK A;  4A3I C;  2JA8 K;  4GTA A;  2JA5 C;  3FKI K;  2KWA A;  2NVT C;  3S16 K;  2R93 K;  4XLP A;  1IL2 A;  5CHP A;  5IP7 K;  4OIQ A;  4BLA A;  3S0X A;  2R92 K;  3HXA A;  2E2I A;  3EQL A;  1IE0 A;  1WOO A;  1I3Q C;  4WIL A;  1XXA A;  4KMD A;  1WQH A;  1TWA C;  1R9T C;  5C3E C;  4QJV A;  5C44 C;  5TMC A;  4G0V A;  2CW0 A;  4MQ9 A;  2FQT A;  4A3D C;  3I4M K;  2JA6 K;  3GTQ C;  3OPF A;  2PMZ D;  4P9S A;  1TWC K;  4C2M K;  2Y0S L;  3AQP A;  1IBA A;  1YNN A;  3JST A;  1AB4 A;  2JA5 A;  3SZZ A;  4C3I C;  4BKW A;  4YFX A;  4C3H C;  2EBB A;  4GZY A;  1USM A;  3GTG A;  4BBS C;  5IP9 C;  4PAB A;  3AD7 C;  3OEP A;  2ZFZ A;  4LK0 A;  5JFE A;  5L46 A;  5TMF A;  1I3Q A;  4M1X A;  1TWG A;  3WOD A;  3S14 C;  5EGH A;  5EGE A;  5M5W K;  2VUM A;  3HOW C;  4BXX K;  1UV7 A;  5IOT A;  3GTP C;  4KB2 A;  1XPP A;  3S15 K;  5C4J K;  2P5M A;  2JA8 C;  2GAH C;  3S16 C;  2R93 C;  5IP7 C;  1O2A A;  3GTG K;  4A3M K;  1ISE A;  3HOY K;  3DXJ A;  4KM8 A;  1TWF A;  2CFA B;  3S2D K;  3I4N C;  1SMY A;  4LOW A;  2VUM K;  4KAS A;  5HL8 A;  4AH6 A;  3SZY A;  5IOQ A;  1ZQ1 C;  2JA6 C;  1YCL A;  4JK1 A;  3S1Q K;  1TWH A;  1TWC C;  2NVY A;  3N0C A;  1I50 A;  4BY7 C;  3G4C A;  4C2M C;  1Y1V K;  3FOE A;  1VRQ C;  3S1N K;  4J3N A;  4Q4Z A;  4Y7N K;  4OIR A;  2E2I C;  3FKI A;  1TWF K;  4QIW D;  1X31 C;  3QX3 A;  2R92 A;  2NVX K;  5M5X K;  1DCP A;  2GSU A;  3ORE A;  3PO3 K;  2CFA A;  5IYC K;  2ZUF A;  1XXC A;  3S1M K;  1TWH K;  3A8J A;  3S17 K;  2RH6 A;  2NVY K;  4A3C C;  5M5Y K;  4BXX C;  4RMF A;  1IS1 A;  3GIR A;  3S15 C;  2JA6 A;  3AD8 C;  4A3L K;  2Y3P A;  4AYB L;  5C4J C;  2P8T A;  1F7V A;  1TWC A;  3HOV K;  2B63 K;  1I6H K;  1USO A;  3TFI A;  3CQZ A;  4KDD A;  3GTG C;  4GTD A;  5IOS A;  4A3M C;  1ZXO A;  2PPB A;  3GTL A;  3HOY C;  3M4O K;  3HOZ K;  1EI6 A; 
#chains in the Genus database with same CATH homology
 4C3H C;  3GTJ A;  3V4G A;  3GTG A;  4GTB A;  1WCM A;  5IOR A;  5JFE A;  3OEP A;  2ZFZ A;  4G0U A;  1O26 A;  1BGW A;  3VA7 A;  3G4A A;  1I3Q A;  4M1X A;  3L4K A;  4G0W A;  4C3J C;  1TWG A;  1O28 A;  3AQO A;  5EGH A;  5TJ3 A;  5CJ9 A;  1WQG A;  5EGE A;  3L4J A;  1EH1 A;  2VUM A;  1B4B A;  1K83 A;  3LPX A;  4P5B A;  1DD5 A;  4GTL A;  5IOT A;  4KB2 A;  1O24 A;  4KMH A;  2P5M A;  2R7Z A;  2YU9 A;  4KMA A;  2PHC B;  3MML B;  2E2H A;  1O2A A;  3FHZ A;  3GTP A;  1ISE A;  3H0G A;  3LAP A;  4KM8 A;  2XCR B;  1GE9 A;  2GSO A;  1Y1W A;  2R93 A;  3Q3Q A;  1TWF A;  2CFA B;  1O2B A;  4KAS A;  5IOQ A;  1WIH A;  2JA7 A;  4GTE A;  4KAR A;  3GTK A;  4KB4 A;  2XCO A;  3BUE A;  2RGR A;  4ILD A;  4KAW X;  1TWH A;  1WQF A;  2NVY A;  1O25 A;  1F9N A;  3N0C A;  3GTM A;  1I50 A;  1Y1V A;  3G4C A;  4C2M C;  3FOF A;  2GSN A;  3FOE A;  4J3N A;  3CAG A;  1SFO A;  4LR2 A;  1BJT A;  1ZVU A;  4GT9 A;  4P5A A;  4KC6 A;  3LAJ A;  1O29 A;  4GTA A;  3FKI A;  2KWA A;  3N0B A;  4LQY A;  1O27 A;  4GTF A;  5CHP A;  4KAT A;  3QX3 A;  2NVX A;  2R92 A;  4BLA A;  4GFQ A;  3S0X A;  1XXB A;  1KQ4 A;  2E2I A;  2GSU A;  1XXA A;  4KMD A;  3ORE A;  3N3Y A;  1WQH A;  2CFA A;  1EK8 A;  3ERE D;  4FM9 A;  1XXC A;  4FZB A;  1ZBS A;  1B4A A;  2RH6 A;  3GTO A;  4G0V A;  1IS1 A;  2JA6 A;  1TWA A;  2Y3P A;  2XCQ A;  4BLB A;  1R9T A;  3OPF A;  5JVO A;  2B63 A;  1TWC A;  3NUH A;  4GTC A;  3AH5 A;  4KM9 A;  2JH3 A;  4DDQ A;  3CQZ A;  3AQP A;  4KDD A;  4GTD A;  5IOS A;  1ZXO A;  3GTQ A;  3GTL A;  1AB4 A;  2JA5 A;  4C3I C;  4BKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...