4KMLB

Probing the n-terminal beta-sheet conversion in the crystal structure of the full-length human prion protein bound to a nanobody
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
b'AVQLQESGGGLVQPGGSLRLSCAASGRTFSSYNMGWFRQAPGKGREFVASITSSGDKSDYTDSVKGRFTISRDNAKNTMYLQMNNLKPEDTATYYCARGLGIYIIRARGGYDHWGQGTQVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major prion protein
publication title Probing the N-Terminal beta-Sheet Conversion in the Crystal Structure of the Human Prion Protein Bound to a Nanobody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/protein binding
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kmlB00
3UTZB 1H8NA 5E8OB 1KEGH 4PRPE 3QQ3A 4I2XE 4ZXBC 4C54A 4HS6A 3VFVA 5C0BD 4ZMAT 2LVCA 4C59B 2QR0B 4LCCA 4LLQA 2GY5A 1LD9B 5FYKU 3QUXC 4LLYB 1WIOA 5IR1B 3V5KA 1JYVA 3LRHA 3BZ4A 1I8IB 1OAXH 1T4KA 3D0VB 5FUZH 1OSPL 1UZ8B 3TO2B 2FH6A 4JDVB 5EG6C 5EU5A 3U79A 5JHLL 3SQOL 1DUYA 4JFPA 5KAQG 1IQWL 4U49A 3ZKMC 4KK8D 4KI5C 1U42A 4F80A 5JQHC 1KACB 1P9MC 5GHWL 2R2BB 4XMLH 5KOVC 3GMOB 4LVOC 2HKHH 2Z9TA 5EU4B 5CZKA 5C9JA 3ARYA 5CKAA 4L8CA 3MGOA 5C8JA 1OGAE 4PJEA 3TV3H 2M1KA 3AY4C 4R2GB 5KSUA 5C0EB 4H5SA 1U8IB 2A6JA 3BGAA 2XPGB 5FAAA 1ONQA 4OD2B 4WW2A 4GUPB 5E5MB 1NCBL 4OV5B 4OZFG 1TVHA 4P4KA 3MXWH 1KIUA 4Y0GA 2DTMH 4L4TE 1NJ9B 1H5BA 4QXUL 2ED9A 4HS8H 1ZA6B 5C92A 5D5MB 3NPZB 5DQJB 3ARGA 3MV7E 3WO4C 2X4UB 2I07B 1VCAA 1FGNH 4YWGL 1QFUL 1YECH 2ZNWA 5CJOL 4GOSA 2EDJA 3DVGA 4BSVA 3I2CL 5D1XB 2DQEL 4UIKL 1BWWA 1HQ4A 3ULUH 3HUJA 4QRUA 1DLHA 3UC0H 3BPNC 3SCMC 1ITBB 4OCXH 3SDCB 3HNTH 1TZHA 1XF4B 1HH6A 1CXIA 1MELA 1FNSL 2M26A 4LDLB 4WO4D 1U8OB 2Z91B 1R3IH 1D5MB 1WFUA 2IBZX 3WFZA 1BVKB 4Z77A 4M48L 2DBLH 5DVKA 1YMHB 3MLUL 1U8LA 4N0CD 1HYRC 4HF5L 3VXSD 5C70A 2VLRA 3D25B 3HZMA 1RJYA 1X6LA 2R56L 3BDXA 2CLZA 4ZPVA 1U8PB 1NUDA 4PJ9A 1KPRB 3R8QA 1IKFH 2APVA 3RDTD 1FYHB 5I1KH 3HC3H 1K8IA 3SKOB 1QLFB 5DI8B 3Q0HA 4MJ5A 5F7DB 1IQDA 3V9FA 4UTAL 5J12B 3MC0A 1BEYH 4HSQA 3AVEA 4EZMA 4E9LA 1YYLL 2QHRL 2C3GA 3NCJH 4MXQD 1MCIA 4NQEB 1DUZA 3E6HA 1N5YL 4RGNB 4CVWA 1EO8H 1MCPH 5FV1L 1CGYA 4YHIB 3QPXH 5E9DB 1CGXA 4LNRB 2YN5A 4UINH 1FLRH 1HKLH 5BVJB 3B5HA 3EJYD 3K81A 3CVIH 1SJEA 2F8OA 4QNPE 1MCSA 4Y4FD 5E2UL 3W5NA 2DM2A 3F7YB 3G9AB 3QXTA 3H3PH 2V9TA 1SEBB 3C60A 1HQRA 4DKFH 5DD0L 3F7VB 3WFEH 2O5ZH 3EUUA 3FQNB 4JFYA 1JN6A 3FO0H 1BFTA 4NZDA 5MEPA 3MJ6A 1MCWW 4HV8A 1LEIB 2AEPH 3ARED 3UXFA 2O61B 1MCFA 1BD2A 3FB6B 3FCTA 1SM3H 2FHBA 3WUWB 5IESL 2AXGB 3OAYH 4NKIH 4U6VH 3KPPB 4Q9QL 1T83C 4AT6B 3MUGB 2NQCA 3WKML 5LQBL 3H0TB 4GG8B 2XZQH 4RZCA 4JHBA 4OLYL 5ITBL 1U9KA 3SO5A 3MLZH 4DKAA 1BIIB 2Z35B 3BKYL 4KJPD 5TQ2L 4G8IA 1F3DJ 2XNAB 1ZXQA 3INUL 3DOSA 3IFOA 1YEFH 1I3VA 3GKWL 3C6SB 3M45A 3TCXA 3QUKA 3WIIL 3MLSL 4PJDF 4LHUA 2FATH 1CCZA 2AQ1A 1XF1A 1U8JB 5IBUB 4OD1H 4K9EL 5D6CA 4PTUB 1A0QH 5IVZB 3LKOB 2DQGL 4L1DA 4NHUA 1HOCA 4GXUN 3I84A 2EZ0D 3BP5A 3VXMA 4BFBD 5IEHB 5L2JB 4HLZG 2V6HA 3SE8L 1D5ZA 4DN3L 2QHLA 1I1YB 4QHLA 2H32H 2FBOJ 3MSPA 4BK5A 3B9KB 3F12B 1YMMB 4XCYA 1U93B 2BVOB 5B8CA 2JJWA 1CZ8H 1J8HD 2OL3L 2BSSB 1TETL 2D0HA 2LU3A 3OSKA 3MNWA 8CGTA 4F37K 4OZGE 3ZTJG 4POYA 4JKPH 1WF5A 3JWOL 1FYTB 5I71C 2X4OB 1FCCA 4E41B 2NY0C 1CXEA 1ZEAL 1BZ7A 1GZQA 4ALAL 3D0LB 3T0EE 2XQYK 1F11A 5AZ2H 3L1OH 2VKXA 4Z7NF 1DVFC 1PQZB 2NZ9C 5JXAH 4KMLB 2IPTL 3RZCD 2ADFH 2HJKA 3BN3B 2PW2B 2HFFB 3BH8B 3EKCA 2E27H 1HHIA 5DRWB 1P5VA 4L3EE 1J88A 4K07A 3VWJC 2AXJA 3V0WL 2H8PA 2NY4D 2VDKL 3O6LL 3MLRL 4K94H 4YIQB 1JZ8A 1IZJA 2SEBB 5J6GA 2VOTA 4NWUH 4OT1L 5IW1A 1N59B 4UB0L 4XZUB 3AU1B 4JHWL 5HHXL 2Q6WA 3UTOA 4GMTL 1MRCL 2VDQH 2GAZB 1G7IA 4XPAH 2F58L 2F5BH 5JIKA 2GSGB 1QRKA 3W0WA 4HUNB 1ZLWH 2Z8VC 1S7TB 2GJ6D 2YPVH 1V5JA 3RNKB 3IJYB 1FG2B 4MJ6B 1SY6L 1ZOXA 1KG0B 5IB3B 1U41A 4HJJH 4ZTOH 2GFBA 4RAUA 4U3CA 4KRPD 1BBDH 4HD9A 4ISVA 3QXUA 1JPSH 3QWRD 2V7NA 4X4YB 1PAMA 1TJGL 3PWJB 1DANU 3VG0L 4MD5B 3A6OA 1WBYA 3T2PA 3V0VB 3QG6B 5L2KD 3TBSA 4OFKA 5D7LD 4M6AA 5IMLB 2XA3A 2BDNL 2J6EA 2JKXA 1LNUB 2DBJA 4B5EA 2YPLA 2G60L 4JQVA 4X99A 4GBXB 1CICB 5IV2B 4Y4HA 2MSPA 2ITDB 1KEMH 4Z7WF 2BNQE 1I75A 4QTIL 1NGQH 4F7PA 5IB4B 4LF3B 2VMFA 2IGFH 3OKKA 2YRLA 3MLTB 5HJ3B 4FFWD 4IDLA 4NN6B 1MJ7L 1A4JA 1XIWA 2DYPB 2RFXB 2LU7A 5K93A 4NGHH 3LHPH 2QSCL 3LEXA 2W07A 4Y88A 1P7HL 3QSKB 2Q3AA 2QTEA 4X9GA 2GUOB 1Q72L 4PJIE 3MRDA 3VRJB 3BPCA 3QEQE 4M7KL 5CZXC 2P5EB 2VUYA 4XHJD 4ZXBB 2WBJD 4OJFH 5CCKH 1XR9B 4P4RA 1FC1A 4D0CB 2J8HA 1CDJA 1OCWL 3KR3H 1FZOB 1KN4H 3QUXB 3ARZA 1KC5L 2VL5A 2DQCH 1T1YA 1H3UA 1A7NH 1JV5A 3CMOL 1G0XA 4ZD3H 5AD0A 4WVRA 2ZSWA 2BNRD 1TVBB 3ULVL 1ZLSL 3O3AA 4AM0B 5DVNA 4O2CB 4PJ5A 5KSAC 1X5AA 4LRNH 3C8KA 3OKEA 4WY7L 4GRMA 3TWCL 1A9EB 2NXZD 3WBDA 5GRZA 3K4DA 3SHSA 1JF1B 1IAIH 1EFQA 4M03A 1BF8A 3T0DA 3FHAA 3UAJD 3LH2H 1UKTA 2A6DB 4ZS6C 5FDYA 1MOEA 3ISWA 1Y6MR 3D3VD 4WWKD 4YAQB 3IJSA 5I1GH 2LVEA 2EIBA 5CIPH 4D0DB 1QNZH 4GW5B 4LVOB 5DHVB 3OHXB 1GGIL 3QDGD 2ZWLT 1K9TA 2AEQL 2JJVA 1EUUA 4YHML 2NXYC 3VE0A 1G9NC 1I9IL 5EU7E 2IFFL 3K3QA 5CKGA 2CIIB 2DI8A 5E1HB 2DM3A 4LASH 2PN5A 3IFLH 3RL2B 1HSAA 3K4ZA 1IBGL 2HP4A 1TTUA 4MDJA 3QULB 2R1WA 1JHTA 1P4IL 4MA7L 1HHKA 3L6FA 4FQIH 5D71L 2ADJA 5FKAA 4PS4H 2OYPA 1V3KA 1T5XA 3CX5J 2HFTA 2R0ZH 1SYVA 2XRAH 3WO4B 4LLUA 3G5YB 5B38G 2YHGA 3L3IA 1CXFA 3V7AE 4FQHA 4R26L 2WANA 2AS5M 1KCUL 5IQ9A 3ZSSA 3S96A 3ME0A 3CFDA 3TBVA 1L6ZA 3UTTA 4D3CL 1Z0MA 3BPNB 1V05A 3SCMB 1N8ZA 4KZEH 1VA9A 1S9XA 3E8UL 1I7RA 4QOKE 4YHKH 2EXWC 5IFAH 4TVPH 4AENB 3MV9B 1QEWB 3RWJA 2Y5TA 5SWZD 3QCVH 3M8OH 4TQEH 4QTHB 3Q6GL 1JI2A 5AYQA 5M95B 1ZT7B 5CJ5A 2W9DL 2AXHA 2YK1H 3BPOC 4Y5YA 2HTKC 1I7UA 2AV1A 3IAPA 3WXWH 5D96C 2QJDA 3WHE1 3KPRB 1FVDA 3IU3A 4J8RB 4M7JH 5EBLA 4NM4L 1NUNB 2FD6L 2ADGA 1R5VB 4XP9L 3PGDB 1TQBC 4WIQA 2D0FA 5JDSB 3MLYH 3U2SB 5DWUL 1IGIL 3QNZB 3UO1L 5DTFB 1H15A 3HPLA 3SN6N 4QWWD 4Y4KC 5F7FA 1ADQL 4NQDE 5DD1L 1PYWA 2WWMD 1WV7T 4ZFGH 2ARJA 4M7LL 3ARUA 3LEYH 1CD8A 1QFOA 3ULVE 4KVNH 2NYYD 2NZIA 4MLSA 4OZIB 3OB8A 3TA3D 3AM8C 4XPBH 3MODH 5SX5H 4DGYH 2VDOH 4JQXA 4OM0L 1GPOL 1OT1A 4C56B 1T0MA 4HULB 4GKNA 1B90A 1KJ2L 1V7NH 3L3DA 5JO5B 4F7MA 1S5IH 1KFAH 3CDGB 3BHBB 4NZUL 5CHNB 1Z0NA 5FKPB 3MRGB 3B2VL 4U0RC 3GSNA 5FHAL 2VXVL 4K55A 1EVTC 3QA3B 5IB5A 2HFGL 1U3JA 3U7WH 5D2NE 2GTWA 3DYPA 4LLVA 1MWAA 3BKJH 3SE3C 3ZSTA 2XZAL 3MJ7B 5FGCB 2WK2A 4O2EA 3UYRH 1J1XL 4KUZH 4KHXH 5LWYH 2BVPB 4F7EA 1RIHH 3I3EA 3JZ7A 4NJAH 3ZE1F 3BWAB 4HXBL 1CFNB 4YFDB 5F9JA 3V6FA 1NDMB 1ITCA 2CJUH 5DMIL 1AD9A 3TJHC 3S9DB 4JFEA 4PJXB 5F6IC 4K3DL 3EO9H 3D85A 4LMQI 2CKBA 3MRMA 4FTVE 2KH2B 2YUWA 5D7JD 1Z2KA 3P77B 3FQWA 4OLUL 1CWVA 1GOHA 4TUKL 2QKIA 2FIKB 4OQ1A 4MQSB 4GG6E 5FA4A 3L5WA 3STLA 4AMKH 1J86A 4I5BB 4M9PA 2ZKHL 3EO0B 3BXNA 1MUJB 3RUGE 2ESVB 3IAQA 3BKMH 4NUGL 5F7YC 1RUQL 4TN9A 1IM9A 2IADB 5E6IC 1P7KB 1IGML 1K4DB 2HG5A 1XGRB 3VFRB 3EAKA 5A40E 1KJVA 3EO1A 3IDXH 2CQVA 2BHZA 5A2KH 4S1DD 5C0CD 4XPHH 4PY7A 2P5WB 3IF1B 3VU2A 4LBEB 2DQFA 4YHPA 3TYFB 4EQ2A 5K59E 3GMQB 3SE4C 2DICA 3O2DL 5IB2A 2VLRD 3V52L 1HKFA 5K9JL 5I71B 3LQAH 4OF6A 5D7KD 2R0KL 2NY0B 1EGJH 4K71C 4P23C 2WUBH 3HRZA 5HVWA 2Y06H 5KVDH 1N6UA 4ZAKC 1DVFB 5EN2A 1OQXA 1AGEB 4IMKA 5T3ZL 1H9VA 1SMAA 4XCFL 1O7VA 4ENED 3QCUH 4ODXA 5DXWA 1BZ9B 2HMIC 1YEHH 1KJMA 4LGPB 3HI1B 4RRPG 3VWJB 5JW3H 3MLVL 1BQUA 3D39D 1I9RH 4H25A 3KPSD 4JPKL 3GO1H 4Z0BH 2FJGA 2A0LC 3MMEA 5ALBL 1NEUA 3LB6D 4JR9L 1Q94B 3L3OA 3ARDA 1WEJH 2AJXH 4Y1AB 1CLOH 1I3RA 2R2CA 3GSRA 3L3HB 4L9LA 5HYSB 2G2RB 2QL1A 3OPZH 3BQUD 1ZTXH 2H2SC 3EOYG 5EZOH 3KYOA 2P43B 1A3LH 5DUMH 1JTOA 5C08D 1BQHA 3PWLA 3TPUA 4BZYA 2EXYC 5HDOA 5IHZB 2HT2C 5ESAA 4NUJA 5JW4M 2CH8A 2BFVL 3QDMD 1CD9B 4S0TD 5GJTH 1BD2D 5JW4R 2PETA 4QRTB 5MENE 4X4XA 1UA6L 2NY3C 3FB8A 5JUEH 1HILB 1JGEA 3MFFB 3RY4A 5FDWA 4YHNA 2KDGA 5BZDB 4GO6B 3LCYA 4ZG1A 4J4PD 4I77L 4G9FE 3LKPB 1OD9A 4K9EC 1PG7H 2YA1A 2F53D 2FX7L 1K5NA 3VXNB 1NC2B 5IKCB 1A3RH 2R0LH 4HMEA 2FX9H 1JPTH 2R69L 1G7MB 2MCPL 2BJML 4JN2B 4P2RB 2ADIA 3BUYA 2OS7A 3RFZC 3A6BH 1U6AH 4ONGH 1GGTA 3AC0A 4P2OA 3S4SB 5F3BA 4PRPB 5JA9A 4I2XB 4EIZC 1M71A 4XCNB 1ZWIB 4XP5H 5CJXC 3QEUA 5KOMC 3FO9A 3IDNB 1Q0XH 3QI9D 4PD4J 1GGCH 1CDBA 3CDYA 1RZKH 4RAVB 2FEDC 3BZFA 3HTLX 4LARH 3QIUC 4UIMA 3ZE2E 4H0IA 2WZPD 2NX5E 3E3QE 3SE9L 4TVPD 3Q1SH 2APXA 4ZUTA 1R5WA 1XAUA 4WW1B 3JUZA 5HBBA 1RQ5A 3G6JB 5KW9H 4KV5F 1X5KA 2D7QA 5ALCH 4XBEH 4YFLF 3T0BA 2XKNA 5ACZB 4MAYA 3VGBA 1F4HA 5I1IH 1U8KA 5KSAB 1AE6L 1PX4A 4R90L 1A02N 1JGLH 3PDGA 5DFVC 5KVEL 1FJ1B 1OT2A 3DTXA 4XI5D 4HIHA 3DETD 3JTTA 5DJZB 5GGQH 2YD8A 5FUOL 3OAZK 3S35L 3TO4C 1NANI 2J8UE 4XAWL 4DKEH 2BZDA 1RJCA 3G5ZB 4UQ3B 3U9UB 1NGYB 4P9HH 4NZTL 5HI5C 5EOCL 5KANI 1A1NB 1AXTH 1FIGH 2EKSA 3MBEC 1FZKA 1Q8MA 4O4YH 5J6HB 3QDHA 2HAZA 3OMZA 5EU7C 5GS1C 1Z9SA 5C0JA 1JJUA 4OF5A 2FX8L 1FH5H 3O6KH 4HUUA 4M62L 4NNXB 5IVXA 4MJ4A 2XWJB 3RWEA 4JPIB 5GSRA 2XWBB 1D5BA 4UAOC 1MFBH 3QNYA 4L4TB 5BVPL 4UT6H 3LKNA 5H2BA 2B4CC 4U6TA 1DSFL 1QBAA 4NQCD 5T5FL 1DN2A 4NRXB 2H3NA 2G5BB 5EIIA 3MV7B 4XNQB 4DOHE 1WQVT 4Y19E 5D1XD 5HYJA 4MAUH 1BMGA 3QIBC 2AK4D 5GZOC 5M7QA 2WNGA 3SDCD 4YQXL 5BV7C 4HWEL 1S5HB 2EDTA 3DWTA 2F54B 2I60L 4FXKA 2P8MA 1WTGT 4WFED 3WDIA 5F1SA 4QHNA 4IIQA 3SBWC 5CEYA 4HCRH 4FMFA 3X3GL 4OSUL 2GJJA 5H37H 1S7UB 4O5LH 1NSNH 2X2YA 2EH8H 3E2HC 4ZUSA 1N6QL 2CO6B 3FO2A 4UV4L 3MOBL 3W11D 1OP9A 3NA9L 4UZGA 3EYVB 3VXUE 1J5OH 3BPOB 4MGXA 3MJ9H 4BH8A 2ICWB 4QF1B 4LCWE 4NQVA 5D96B 1NCCL 4AH2A 2DOCA 4LKXA 1JNHA 5DHVH 4BFIB 1OTUC 1UEMA 3KPTA 1JNNL 1TQBB 3Q5TA 3V4PL 3X12B 2C1PA 3FFCA 3NIFF 5GGVH 1CG9A 2XI9A 2DM7A 4HS3B 25C8H 1F8TH 2AV7A 3WIHA 5DR5H 1CXHA 3MRPB 1UFUA 4JM2D 2VERN 2IJ0C 2R29L 4HGWA 3GMMA 4JM2F 4Y4KB 4YDKL 3WHE0 1O5DT 4NO0B 2ZCKH 4YDIH 5E9DD 4LHUG 1CN4A 2D9QB 5DMKA 3PHSA 1G7LA 4WV1A 4OGAC 4N9OB 3ULVC 5EIVA 1X7QA 5C0FA 3V79C 4PJHE 1MI5B 5CD5D 4CAGA 1Q0YL 1NMAL 1RU9L 3X14B 5I15L 3WFHB 5CINL 5E2WH 3NZ8A 2X4PA 4DGVH 3GSXA 2YXFA 3WS6A 5KTEH 3AGVA 4OCYL 5HHOA 4N0YH 3K74B 4D9QE 4DW2L 4JKLA 3SDAA 1QFWI 1Q9OA 3VXOA 2XY2A 4OF0A 4PJ5D 3ZDYE 4JO1L 2H9GA 2XKSA 4U0RB 4MNQA 5L88H 2X1OA 4YNYA 1X5IA 1C08B 4MQTB 4F7TB 4ZNEA 5D2NC 5E1AB 1CFVH 1G0DA 3L7FA 2CR3A 4DN4L 5JW5A 5DJDB 5CEZL 4HC1H 1L0QA 4JRYA 4RGOL 4UUJB 3RWCA 1BF2A 3H9SA 3DX7B 4JKMA 4QKXB 3IFNH 3S37X 4LSTH 1DE4B 1BQSA 3P30L 4YHZH 1Y0LB 4L3AA 4U2YA 4FFZL 3T2QA 4U6YA 5ICXA 2VDRH 4TUOB 2ZCLH 4BUHA 1FL3B 3RX5A 4CRPA 3RVVD 4RBPK 2QQLH 4R7DB 3VW3H 2R1XA 4U7SA 4HT1L 5F6IB 1T66D 3BD5A 4YDJB 5DHYA 3RRQA 4BJLA 1HI6A 3CPLB 2CR6A 3GBLA 3DX8A 4TNVF 4MNHB 5BRZE 3MX0A 1N64L 4UU9A 1EAPB 1LE9A 1LO5A 3PL6A 4KZDH 3T1WA 1CU4H 2BRQA 1FO0B 5CSGA 3TN0D 2MWCA 5BOPA 3IU4H 3UJIL 1B6UA 4M1GL 3EYQD 3PUCA 1WAAF 4TSCL 4Y16C 1EO7A 4LPYA 4R4FH 3P0YH 4HWZB 2PYEB 5E6IB 3DGCR 4NIKB 2VLMD 3GBMH 4FZEL 2XTJB 1A6WH 1YMMD 5E8DH 5TFSH 2RCSH 2X4SB 2JJUA 3L9RB 1ERNA 1IGYB 1OAZL 3SKMB 2XWTB 4EDXA 4F33B 1OTTD 3GK8L 4XBPA 4G8GE 4IRSA 4APQC 3DO3A 2B1AH 4OZGB 3IDJB 4DAGH 1SBBA 4PJBE 4G7YH 3LZFL 2NPLX 4HUMB 2ID5A 1MF2L 2Z92A 3GMLA 1WZKA 3DROB 4L29A 1YEJL 1QVOB 4KK9C 3DURB 4XNXL 4OFIA 5DJ2A 5ILTL 4P23B 4ELKA 1S7WB 1ZHKB 4PJFA 5SWSB 4N5UA 4ZAKB 4XWGL 3AB0C 3PXHA 2VXUL 3FONA 4PB0L 2WMPA 2BHYA 4LP4A 1AGFA 1DBJH 1W0YT 3NABH 3WFBL 2XN9E 4IMLA 5KSBE 1UJTA 1QACA 4AEFA 3DYOA 4M5ZH 4MCYA 4XMPH 1JPFA 3RX7A 5D1ZC 2AJZA 3OKDB 3O0RH 5TDPB 4LCUA 3MV8E 4LSDA 3HFMH 2VLKB 3U1SH 1JHLH 1FP5A 5DUBA 3OJMB 1AJ7L 4JDTH 5T1DL 3BP6A 4X8XA 1JNLL 2EICA 2VLJE 3UYPA 1P1ZA 2VH5L 4U1NB 4BQ6A 3TFKD 1IGCH 3UBXA 2RBLA 3TBYB 5E6YA 1AFVL 5CEZE 5I73C 5HHNA 2LFGA 1P69B 2VQ1A 1FL5B 4OFDA 4HUXB 5DQDL 1S8DA 2N7BA 3DRQA 1OSZA 3ARSA 2CIKB 3V95A 1F4WH 2IANB 3BH9B 3PQYA 2C3VB 3C5JA 2NY3B 3VH8B 1QSEB 2JIXA 4FP8L 1CL7I 4F58H 1QLEH 1T7VA 1FNHA 5JHDE 4OBSA 1BQLH 4RIRB 2VSCA 5E8NA 5TJWK 2YWYA 1HCVA 2NW3A 5BO1H 3HPJA 4JN1H 4QCIA 1U8MA 4LLAA 3RGVA 4MZ3A 3KXFA 4ODTL 1JPGA 4OB5H 3PWUA 2Y36L 4ZUUB 2DYPD 1PLGH 3CH1A 4QHKI 2FJHA 1YN6B 3RVUC 1QR1A 3UYOD 4PBXA 1IGTA 3UPRA 4PJIB 4G6FD 4Q9CA 5B38B 4X0KA 12E8L 4OCRH 4ZXBD 3U83A 5EO0A 5CJQL 2R1YA 1AY1L 3ZDZE 4NNYB 2ZUQC 3MNZB 5E2VL 2Y5EA 1QKZH 4QHMA 1A6UH 4YR6A 1JVKA 2F8VA 4KXZI 4H20H 2OL3B 3QIUB 4JFFE 3E3QC 1R6VA 2EDQA 3HNSH 4NOFA 5C2UB 3LSOB 4MXWH 1IM3A 4ODUB 5F88A 2D7PA 2D7OA 4GAJL 2E5EA 4G9DA 2V9RA 3VDBA 1FLTX 4ZO7A 1NCAL 2D9CA 3ZKMD 1AGBA 3QJFA 5F96H 1OTSC 2V7HB 4ZTPH 3DUUA 4CU8A 5HHQA 4X6CA 2DI9A 3B9VA 3ZYIA 3TO4B 5D8JL 3IKKA 3HMXL 4S2SA 4GW1A 4KDVA 3IVKA 3NIGF 1T03H 1OP5H 1SYSA 1QO3B 4RNRB 4K7FB 1TPXC 4CVXA 1C1EL 1NGXB 1RAMA 1J1OL 1MFDL 2FECI 2WIMA 1XR8B 1UG9A 1TCMA 1FAIH 5HGBB 1INEL 5GS1B 1XGTB 4Q97A 5IG7A 3DVIA 3O4OC 1L0YA 4LAQL 3LN4B 5IMOB 3QFJB 2GI7A 4LLMB 2J1KA 4OV6F 4HK3J 1EBPA 4LHJB 4YHOL 4UAOB 3WSQL 5CIPA 2A1WH 2JJSA 2RIKA 1P53A 1XGQA 4G5ZH 1JNJA 4DFIA 3R0MA 2GQHA 2HH0L 3TT3L 1MAJA 5C6TH 1I8MA 2QBWA 4XTRD 3U48A 5D72H 4B53A 4U1HB 4ZYKA 1JTTA 3QIBB 3THMH 1OW0C 3IETA 5IJKA 5E5UB 4PBWD 5D7IA 3RI5K 3RY6C 5BV7B 3PWPE 3MV9D 2AJSL 2GK2A 3HNVH 2HLAA 3KYMB 3KS0J 2R4SH 4PREA 1C5DA 3CXHJ 3FO1A 1QSFB 2XA8L 1JBJA 4PJ8D 2ORBH 3O9WA 1RURH 3QUMB 2J2ZA 5E8OA 3E2HB 2VN4A 2J4WH 3S98A 4MMZC 1G7QB 3G6DH 5DMJB 4A6YL 2QR0A 4V1DB 2E7CA 4KKNA 1LDPH 3O3DB 1VEMA 2ZUWA 3ZT6A 4GXVL 5EU6D 4CKVX 3GSOB 5GS0L 3QDJB 1I8IA 4MXVE 3D2UD 2X7LB 3JV0A 4AG4L 1TZGH 5DRXA 2EKJA 3WCYA 2BRRH 1UCTA 1G9NH 4Z7UE 2RR3A 3TO2A 1BFVL 2D4FA 1V3LA 5IMMA 2RAMA 2YXMA 3VRIA 3GKZA 4X5XB 3RHWF 4P2OD 1T3FB 1DQJB 2HJFB 5LXGH 4UT7H 2PR4L 1R3LB 4CU6A 3ZTNL 3UZQA 1RULL 4PGEB 3VFMB 3ZZ1A 1NQBA 2R2BA 1D6VL 1OF2B 3GZKA 4UDTB 4C56D 4TULL 4JG0L 5EU4A 1CLZL 1LK3L 1UCBL 2ZG3A 4X6EA 1B0WA 1Q1JL 1FGVH 1UKSA 2COQA 4I3GA 1QP1A 1P4LB 1B4JH 4MJIA 3C2SA 4GSDH 3DXAD 3OX8B 1UWGL 5LAXB 3WJJC 4JO2H 2MJWA 1CIDA 2YBRB 4N0UA 4OD2A 5I1JH 3O3EA 4GUPA 5DRNA 1P4BL 5E5MA 4OV5A 5D2NB 1MCKA 3QO0B 4LKCB 3C09C 1T7ZA 1NJ9A 1N6VA 3FT2B 2BY0A 1ZA6A 2X5PA 3MYJB 5D5MA 3KLHD 2CK0H 5DQJA 2OR8A 5B3NA 1HHHA 2I07A 1QFWM 3OZ9H 5TE7L 3VGAC 4KHTL 4PG9A 3KYNA 4WUKH 5LCVL 3SPVB 3VXRA 2BCKB 2DQUH 1X5XA 2LABA 2D4DA 3RKDC 4P46A 4PJGE 4XP6H 4OFVA 5IVXF 3GI8L 1XF4A 1YEGH 3QZWG 1KXVC 1ZLVH 5C09E 1U8OA 3FTGA 2NY6C 5JQ6H 1D5MA 2W65B 4J1UB 4GG6B 2PXYC 3WXVL 1JIBA 4I9WE 2DQTL 4FQLL 2CXKA 3RUGB 2V2XB 4PR5B 3D25A 2N1KA 4Y16B 1JRHI 4DK6A 3IRPX 1J05B 3K2UH 4OAWA 1KPRA 4BSWA 2AGJL 1T1WB 4J3XA 1OSPH 4NCC2 1LK2B 4NFCA 1MHHA 1OD7A 2VDML 5J1TC 5JHLH 3SQOH 1QLFA 5DI8A 1C8PA 1A8JH 2P5WD 5F7DA 1N3NB 3BUTA 4DCQA 1BQHG 4Y5XC 1Y18B 2DMKA 2WLYA 4PRDA 1ROWA 4NQEA 3D69B 1NFIB 2ARWA 4JG1H 4PRHB 4APQB 4YHIA 3T4AA 1MAKA 3QQ4A 3IGAB 4LNRA 1M4KA 5EOQH 4I18A 1U3HC 1SBSL 1T89C 4Z95H 1RVFH 5BVJA 4FHBD 1GC1L 2EH7L 3QIWD 1RFDH 3QEGH 1WTLA 1FNAA 1NDGB 2E6QA 4M8VA 2BY2A 1DVFD 3CIQA 2LAGB 4XAKD 3F7YA 4QRPE 3AB0B 1DBAH 2HT4C 2HT3C 1IKNC 4GFTB 2PCPB 3TIEB 1TFHA 4NWTL 5SX5K 3OXRB 1EXUA 4HK0B 5AWNL 1FORL 3AROA 4HDIA 3O4LD 3EGSB 3VWJD 3FQNA 5D7LE 4DWHA 4BQBA 1QBML 3BIKA 3LPWA 1LEIA 2X70B 1U92A 5D1ZB 2O61A 1QRND 5MEQB 3FB6A 3E6FA 1YYML 3ZKSD 3WUWA 4O58H 2AXGA 1KJ2B 4Z7WE 1NL0L 3KPPA 1EGJA 3L5IA 3TNNA 3I2CH 3MUGA 5D2LF 1K6QL 3WLWC 4GG8A 3SKJL 1FO0H 1GVIA 3RWGA 2HWZL 4CW1A 1BIIA 3RKPA 1CTOA 1YA5A 3BISA 3EFDL 3I50L 4HEME 4H26B 3O6FC 3CZFB 4EKXA 3FB7B 1CLYH 2H45A 5DGRA 5I73B 1T5WA 1TIUA 4HG4J 4PGCB 4XX1E 1MPAL 3MLUH 3CVHL 5DD3L 2A9ML 5DA4A 5JOFA 1CTNA 1T1XB 3OKOB 1SHMA 5C07E 3MRQB 3FOMB 1A1MA 2MTPA 1GOGA 4Z7VF 5FGBC 2XFXB 2XQBL 5DEFB 1U8JA 3ILQD 4BZ2L 5I9QB 4PJ7F 3TJEH 5IVZA 2HN7A 1MCCA 2GCYA 2PF6A 5I8OL 3FFDB 2NY7L 1XEDA 4GKOA 3S5LA 4DK3A 1ED3A 4RISH 4PJAA 5IM7B 5L2JA 1P84J 3MLWL 4G9FB 1YYLH 3A67L 3T3PF 4PGDB 5ISZE 4Y7MA 5KS9F 5T1KD 2QHRH 3TT1H 3B9KA 1AO7D 1NC2D 3F12A 5C0AE 4ZS7L 1ACYL 4KK8C 1N5YH 4PUBL 3QHFL 4Y2DC 4O51B 4Q6IC 5J1AA 1MFNA 4ODSH 3REVB 5DUPL 5TPWL 4P2RD 3D3VE 5DK0A 5CZXD 2BSSA 2D0GA 4M9OA 4PRPD 1UXSB 1GGUA 4FQJH 4X6DB 4XVTL 3TF7C 4OZHE 4K2UH 1NUGA 1FYTA 3PGCB 2WAHA 4ERSL 5EIQA 2X4OA 2VE6B 5LGHL 5DVMA 3V4UH 4E41A 3EFFB 4MCZA 2BSRA 5J8OA 2W0LA 4OF3A 3U82B 2NX5B 5TE6H 4LQFL 2JK5A 3CLFH 1FDLL 1PQZA 2FLRT 3NFSL 5CGYD 4KKCD 1PW3A 5T1LB 4N8VA 3OGCA 2WW8A 3SDYL 5DRWA 1NBYB 4P59H 3EOBA 5ITBH 4OLYH 4ZS6D 4YIQA 2YMXL 2YN3A 4XNMB 3BKYH 2J8UB 5TQ2H 3GB7B 5I1AB 1N59A 4FQ2L 4XZUA 3AU1A 4WU7B 3INUH 5KN5B 2GAZA 3VG9C 1T22B 3CK0L 5K9OB 4P5TB 1TPXB 4JREC 2NXYD 4U1LA 1OGAD 3MGTA 2ATKB 3RWIB 5GRWA 4Q0XL 1HNFA 3AS1A 3WIIH 4WO4C 1S7TA 3SDXB 3RNKA 1ZS8B 1FG2A 1KG0A 5JIIA 3PJSB 5SWQB 4EUPG 4K9EH 3MCKB 4FABL 1WCBB 1X4ZA 3PWJA 1OPGL 4MD5A 4HKBB 4LFHG 4TRPH 4L4TD 4HUVB 2E7BA 3QG6A 2X4TB 3MLXH 3RDTC 4ELME 2A9NL 5A2IH 1S7QB 4DN3H 4PRIE 3JV4A 3C8HA 4NBXB 1LNUA 3UTSA 3MV7D 4GRLB 2VLLB 4GBXA 4X6BB 1CICA 5IV2A 2Z93A 4DOHB 4WTXA 2BXYA 2G9HB 5I1DA 1FFOB 1CE6B 5IB4A 3QO1B 4YXKH 4LF3A 2IPUK 2OL3H 4MXQC 1A7PL 3MLTA 5IEKB 1UC6A 4R8WL 3LQMA 2RFXA 5DJAA 2GUOA 4OZ4B 3VRJA 3G5VB 3EJYC 4NT6A 1ZEAH 2R23B 4CJ0A 2P5EA 2J5LC 1JWUA 1KCVL 5J11C 3GSVB 4HBCL 2HTKD 3K8MA 4HWBA 3MCG1 2VAJA 1KF9B 4Y4FC 5INDA 1VSCA 2IPTH 5EWIL 3BRGC 3MOQA 3KXFD 3X13B 3QUXA 5JOEA 5D70L 5T3XL 1I1FA 4JAMA 4M7ZC 1TVBA 3V0WH 2EE3A 5I8KL 2YC1B 1KIQB 1WBXA 3L5HA 1NEZA 4AM0A 3O6LH 3FQRA 3DMMC 4ONOA 4U3HA 4F8TA 4FQQB 5ERWB 1OP3H 1A9EA 5JOPE 4QHUA 1AQKL 1E0OB 4JHWH 7FABL 5I19H 4GMTH 3KPLB 4BQ8A 2F58H 4ZO9A 3MJ9A 2A6DA 3GUTA 3DV6B 4KJPC 3ZE1E 2B1HL 4PJEE 1CD0A 3QUZD 1P9MA 3KWWB 4PJHB 4TNWF 1WBZB 4LSUL 1E4KC 3QCTH 4CNIA 2QQNH 2L0DA 3TZVD 2ZUSA 4GW5A 3OHXA 1NGWB 2B4CH 5C0NC 1DQQB 4QNPF 3JV6A 4LEOB 1F45A 1RHHA 1TJGH 2CIIA 2FHCA 4P2QA 3VG0H 3OQ3B 4UDUA 1KUMA 1VFBA 4OGXL 3RL2A 1XH3A 5BV7H 4U1SB 2WSKA 1KCSH 2BDNH 4G80A 3T2NL 2VXQL 2EZ0C 4OF8A 4OLVL 3QULA 1AQDA 3C09B 5K9KB 5GS2H 4JFDA 4HIXH 5EB9A 4MNGB 3QUMH 3K0WA 3VXTA 3OKLB 3MRHB 3HUJE 4OCNC 1UACH 4OGZA 1NC4B 1OARH 2OJZL 1NBZA 1MJ7H 3EHBC 2Y6SC 5CEXB 4S1SL 3L7EB 3VGAB 3TJHD 1YEIL 5FYKH 3OJVC 3MQIA 4HPYL 1CGSH 5H94B 2VUOA 3SCMA 4M7KH 4XC1L 4PY8I 2IH3A 5AUMB 1XGUB 2VLRE 4AENA 4S0SD 3IXTB 3CC5B 4HC1A 2NY6B 3AXLB 4QTHA 1I7TA 5C7XL 3QYCA 4OLWH 1OCWH 2PXYB 2ICWJ 4OIIL 5C86A 1KC5H 2K7QA 2I9LB 3HZKB 4G42B 5ANMB 2PO6B 1NLBL 3O45B 3GMNB 3ULVH 3RVWD 3KPRA 4J8RA 1X5ZA 2DLFL 4XC3L 2W91A 3QRGH 1YY9C 2VNCA 4KQ3L 4JDZA 4E42A 1R5VA 2EDYA 4O9HL 1D3CA 2ZOKB 3PGDA 4QY8A 3UBXG 1MCEA 1NCDL 3U2SA 1N4XL 1I8LA 3QNZA 3TVMA 3LY6A 1DFBH 5DTFA 4MA3A 4Y5XB 5FCSH 1MIML 3HR6A 2ZPKH 4IM8A 3N50A 4WEBH 4JRWA 5T3XE 4OZGF 4LOUC 1K3IA 4K7PH 5HHMD 2I9TA 3Q6FB 4U7MA 1RSFA 2NW2B 3L95A 4PJBB 2IF7A 1U3HB 4O2FB 5CSZB 4OZIA 4UTBH 2IFFH 2KL6A 5B39B 1MAML 4CL7A 3T0ED 5DZOA 4UILL 1DBBH 1CFSB 4C83A 1M05B 3HE7A 1J1PH 3VXQB 4QT5A 4U1IB 2W0FB 4ZAKD 5BZWB 2DQJH 2Q86A 1KPVB 4AIZA 3LV3B 1IBGH 1BD2E 1NH6A 3RGHA 4AQ1B 1VFMA 3CDGA 3BHBA 1IC5H 4O02L 4AL8L 4MA7H 5KSBB 5CHNA 5FKPA 2HMID 4L3ED 2FGWL 1VPOL 1RHFA 2AQ2A 3RTQD 1QSVA 3PHQB 1RZFL 4DVRL 2VISB 1CDYA 3MV8B 5LVEA 2EYSA 3V7MA 3SJVB 3OR6A 5ICYB 3H7BB 3C6LD 1F90L 5F70A 1ZSDB 3E8UH 2P24B 5IJVB 2H2SD 1AXSB 3O6FB 5EZJA 3LMJL 3GIVB 5CBAA 4GKZA 4HZLA 4AZ8A 1NDMA 4PYHA 4PJXA 5C0RL 1JF6A 1OAQH 2EXYD 2XZCL 4JQIH 1P2CA 4WNQA 2DIAA 2WBJC 2W9DH 3VXME 1AP2B 2BY3A 5C0BB 4ZUVB 4DZ8B 5I1EH 3G6AB 4M3JA 2FIKA 1OGTA 3V6OA 1E4WL 3PDDA 3EO0A 3RP1A 4NM4H 3HC4L 2FD6H 4J3UA 1DLFH 2ESVA 2QSQA 1A14L 4W70A 1YNTB 3VWKC 1ZA3B 3UZEA 3CXDL 4TTGA 1ORSB 5JNYB 2F9BT 5DWUH 1IGIH 1P7KA 2BNQD 5IQ7L 4W68A 1XGRA 4HKZB 1RUPH 2F19H 3O2WL 1SJVA 4S1QH 3QBTB 4Y2DB 4Q6IB 4M7LH 4LBEA 2A6KB 1BHGA 4WWKC 3QEQD 5HVHC 5FGRA 2B7DT 3W2DL 3GMQA 5DDHA 5GIRB 2X44D 4OM0H 5ETUB 4I3RL 4I3SL 4R3SB 4X98B 4PIRF 2FEDD 1Z9OA 4BQCA 3P4NA 4BZ1L 4NZUH 3FN0L 1JHKH 3BGFB 5GGRB 1J18A 2VXVH 4OUOA 3OL2A 1AGEA 4ONHB 4EIGB 4XB8A 1GC1C 2X41A 1MQKH 5TE4H 3ARRA 4P3CH 1DP0A 1BZ9A 5DFVD 4H8WC 2Z31C 1J1XH 3IS0X 3X3FL 4NQCE 1W0WB 4JY6A 2X4QA 5TQ0L 3A6CH 3TO4D 3W0WE 1MJUL 5HI5D 3NZHL 1Q94A 1NFDA 3MBED 1A64A 4Y1AA 5TF1L 1FPTH 4GAGL 5DVLA 1F13A 3L3HA 1IC1A 2R4RH 4JREB 5F7LB 4PP2B 2G2RA 3LEVL 3P0VL 4WO4B 2X40A 3OJDA 2VDPL 4TUKH 5DC0A 5FECA 4PFEA 1AHWA 43CAB 4R7NB 5IHZA 2YPLE 1T2JA 5HGHA 4RFOL 3LVEA 4M6NL 2AP2A 4NUGH 1A9BA 1Q9WA 1SEQH 4HH9B 3S37L 3RDTB 1IGMH 3K8KA 2OLDA 2ZCHL 2YA0A 1QLRB 4XNYL 5FB8B 1H3PH 1RI8A 1BOGA 3QIBD 5GZOD 1G9ML 2EC8A 3V5HA 4DUVA 2VZSA 1GHFH 3EW3B 3PDOB 3QJHA 1W72B 1QOKA 3T1FB 3PF2A 3PWPB 4QOKD 1PG7X 2NTFB 4YHLH 2W60A 5IKCA 1ZT4B 2EIEA 3BDBA 1F4XH 4RMSA 4OFYD 3V52H 2NYYC 3RAJL 4V2CB 3LKSB 4LCCC 4WEUD 4NO2B 1G7MA 3TA3C 4F3FA 1EHLL 2FJFA 1R24B 4MSWA 2J5LB 4XCNA 1U8NB 5GGTH 2W0KA 5J11B 2HVJB 2QSTA 4Y4FB 4HXAL 4X5LA 1JGVH 1Q38A 2OTUB 1BWMA 3PWNA 4LSQH 4RAVA 2C4FT 1DDHB 1RJZB 3ECBB 3HN3A 4L9DA 4PJ5E 1MLBB 2GEEA 1X5HA 5JPMB 4M7ZB 3HZYB 4WW1A 4DQOL 2Q1EA 1MNUL 3G6JA 5BW7C 2VC2L 3AREB 3ORJA 4Z7UB 5I1LB 1A7QH 3KLAB 4IOIB 1CR9H 5KSAA 4NQDD 5C2BL 1WFTA 3GSNL 1NCWL 3OKNB 1JZ6A 1FJ1A 1M7IB 4K7PY 4OGAD 1NGPL 1BLNB 2UY7A 3ULVD 3DBXB 5DJZA 5ECJE 5GXBB 3ULVF 2E9WA 3TH3T 3G5ZA 1MWAL 4UQ3A 5DJYB 5JLZB 2ITCB 4F15C 1A1NA 4XVUD 2ZUXA 1ZVHA 5IK3B 4TSBL 5J6HA 3BPLC 3REWB 4IRZL 5F9OL 3SEPA 4BH7A 4WFGE 1MH5B 3O8XD 5I6XC 1FZMB 4M1CC 1JMXA 4WW2C 1VDGA 2GJZB 4D8PA 3FAWA 3O3UN 2X09A 4PG2C 4PJDB 2BFVH 5JR1H 5C0IB 1NGZA 3QH3B 4OLZL 4C4KO 1OP5K 5F1NB 1IARB 1P7QB 5T1MA 4OI9A 1ZHNA 4M3KB 4NNXA 2CKBL 4JHZA 2XWJA 3ARGC 4WDIB 3U30C 3WE6B 4IS6A 5MEOB 4I77H 2ICES 4PB9H 1K4CB 3QUYA 3F6IA 3UTTE 4WTZG 3CFCL 1WVZA 4FQXA 4NRXA 5LGJB 5HYQB 4XNQA 1W0VB 3DX6A 4X80L 3HI5L 5DSCB 1RK0B 3KYKL 1J8HB 2XG4A 3I9GL 4FTVD 1S5HA 3ZL4H 2F54A 4PJGB 3L3GA 4NO5B 3MRIB 2UYLB 3GIZH 1R0AH 2MOVA 1CVSC 5DGQA 1YN7B 4GG6F 5J7CC 2IG2L 2UUDH 2X42A 1S7UA 1CBVH 2QQKL 4ODHH 1UM4L 3WUWG 2EEAA 3RUGF 1A2YB 3EYVA 1UGNA 3RA7H 3SE9H 1HIML 3MO1A 2FCBA 4NP4H 2KQMA 3VA2C 4QF1A 1HZHL 4P5KA 3RIAK 1I85A 5E2TH 5DYOB 1NBVH 4JCMA 4UOJA 4C58B 5CZVL 4BFIA 1T7WA 2H41A 5I18L 1NLDH 5KVEH 4HW6A 3CFJB 3W9DB 5I8CA 1L0XA 1PDKA 4A6YB 3UTPE 4P2CG 1B2WL 4LL9A 5K59F 1HEZA 4NZTH 4Y4KA 3VJ6B 3KDMB 4MJ2A 3FMGL 3OF6A 3P4OA 5IBUG 1VADB 5GISL 1HSBB 3RNQB 2R2HB 2R2EB 3O6ML 4DTGH 2Q8BH 1MI5A 1A7RH 3C60C 3MA7B 2AKRA 4KK9D 1HINL 1LO0H 1I9JL 3X14A 2V5TA 1GL4B 3WFHA 1A5FL 3D9AL 4RQQB 2FX8H 2OXHA 5F1IA 5F7EH 5FM4A 3AAZB 4KY1H 3VFOB 3NCCB 4XNUH 1ZANL 4QRPB 3QISA 1A6ZB 4HFUL 3MREB 3MXVL 2V5YA 4JKKA 5L2KB 2B2XL 1U8HB 3FT3B 4LSSH 5D7LB 5BVPH 1KIRB 3BSZL 3MR9A 5D1ZD 1DSFH 3K8LA 3NGBC 4F7TA 4U4BA 3P3YA 3VFWB 2NY5L 3CGTA 2IPUG 3R8BB 3AS3A 3FT4A 2J12B 4Z7WB 2B20A 1CXLA 3N1MC 3DX7A 4JFEE 3HR5B 5ID0B 4YQXH 4JHAH 2AJUL 3LIZH 2HA1A 4LDEB 1Y0LA 2FEEI 1HHGB 4CN6A 2V5RA 2X4NA 3M1BB 1FL3A 4EI5A 4KGJA 2VTFA 4R7DA 1UXWA 4KTEH 1UB5B 1Q9KA 4R96B 3ROOA 5B3JE 1N6QH 1S9VB 3CPLA 2WBJB 5MEND 4LGRB 4MNHA 4P49A 4U33A 5C07B 4GQ9L 1VKXA 3QI9C 1CFQB 4G7VL 5SX4H 2CDFA 5HDLA 1NCCH 1FO0A 5E99H 1B0GB 1ZLVK 3VWKB 1JNNH 1IC7L 2FBJL 2BNRB 5B8CC 4EUPB 1KYOJ 2PYEA 4G9FD 4MQ7B 1L7IL 4UNTA 3V8OA 1HH9B 3OR7B 4OTXL 5ISZB 3WHXB 1V7ML 1D6EB 5C0AB 4XI5C 3ZT5A 3DETC 3L9RA 1IGYA 5IBTH 1VGEL 3MTRA 2BSTB 2XWTA 4F33A 3O3BA 4RWYL 3NTCL 3TNMA 3D3VB 2DLEA 3GMPB 4NZJA 4WWKB 5HD8D 1XF2B 5HVHB 1Q0YH 1KEGL 3ZHKA 4LVNC 1YJDH 3IDJA 5T3ZE 4UQ2B 1TITA 1T0NB 4YBLC 3N06B 3HAEB 1ZGLB 5AZEH 1BREA 1QVOA 5JMOC 3ZE2F 1ZLUK 5FFLA 2ILLA 1A6TB 1EHAA 4P23A 1S7WA 4JO1H 2E7LC 5SWSA 3Q48A 3SGEH 1OAXL 5T1LD 1UB6A 5F6HJ 4X8JA 4DN4H 32C2B 4ZOAA 1YEDA 4PLKC 5CEZH 1N0LA 5EPMB 4LIQH 2Z31B 1PEZA 1U95B 3GI9H 3JTSB 4XH2A 1MCRA 2IH1B 4NM8H 3C87A 3QG7H 5TDPA 2CDGB 5T3ZD 2G75A 1LEKB 2VLKA 2OR7A 5DO2D 5BJTB 1C12A 4XMLL 5J9PB 3KHQA 2HKHL 4J3WA 2D7NA 3FRPG 4M6OH 5IGXL 1I8KB 4M00A 3CSYB 4HZAA 3MGAA 4HT1H 2BOCA 1Z6JT 2IAMD 2N56A 4OKVB 4F8QA 4L3CA 5EUOA 2JJTA 4NBYB 1PKQB 2H2PD 3RU8L 3ARPA 4HUXA 1NAKL 4JRXA 4JQVC 4L1HA 5E00B 1KT2B 4TSCH 4YJZL 2IANA 3WNNA 2HRLA 5BQ7B 2DTML 3BH9A 2C3VA 5FO7B 3VH8A 3ZYOA 4Q2ZB 1QSEA 1A7BA 1L9NA 3G08B 1WITA 1R5IB 1YPZA 1Z9MA 1LDSA 4FZEH 4RIRA 1FGNL 4XP1H 2PTTB 1XIWC 1YECL 2YUXA 3ARQA 4Y19D 1JGDB 3SGKA 2QQQA 3T2OA 3VFSB 2YD4A 1BJ8A 1HYSC 2WWKT 2CLVB 3ULUL 1KCKA 3RZWA 4JM2C 1DEEA 2APFA 3GK8H 4JFQB 5SV3A 3HNTL 4F9PC 2R0WH 2OJEA 3PV6A 1BIHA 3QQ3B 1WIPA 1YN6A 3VGFA 4FS0A 1F2QA 1MQ8A 4D9LH 3WIHL 4LCCB 4ZUWA 1KSRA 5SX4I 3TA3B 5B38A 2DLHA 1I1AD 1GAFH 4XNXH 3VXUD 3V5KB 2HVKA 3TESA 3BZ4B 4KPHH 5CJXA 4NNYA 4NNPH 2EO9A 1KN2H 3MNZA 4LCWD 1BFOA 4XWGH 1IKFL 3VRLE 4PB0H 3BD4A 3HC3L 3KNBA 2YRZA 3WFBH 3QIUA 1F3DH 1DUYB 3LSOA 4Z7OE 4JFPB 2BERA 4YDLC 1IVLA 2DIBA 4JPVH 1C5CL 3TGXA 1FQ9C 3CMGA 3NCJL 4QRSB 5HDQH 4X7CC 1MCPL 4NKMB 2VWEE 3QPXL 1BVLB 2V7HA 3EYUH 4JANB 4UINL 5C9JB 1X4YA 1HKLL 5JZ7D 5C8JB 5L8LB 4LNVA 4NN5C 4PJHF 3PXJA 1EPFA 3ZMRA 4F15B 5KSUB 2FR4A 3O11B 4H5SB 4QGYA 3M17B 3RVVC 1MY5A 5FHBL 4RNRA 4K7FA 3BPLB 1IGFH 2BVEA 3FAXA 5DQDH 5IVXE 5E56A 4ODVH 1ONQB 3H3PL 4D9QD 2PKDA 4Z0XB 3NFNB 1FVEA 1XGTA 5EO9B 5GS1A 5F7WC 3U4AA 3WFEL 2O5ZL 4HH8A 3ZDYF 4CBPA 1W72H 3FO0L 4M93C 3LN4A 2F74A 3RIFF 3O41B 5IMOA 1L7TL 3TN0C 4GLRH 2MHAA 3QFJA 3G5XB 1SM3L 1CGVA 4LLMA 3VFNA 3U30B 4NKIL 5C0GA 3DVGB 4BSVB 1NFDF 2GW5A 1U58A 4RA3A 3VFPB 2C7UA 3RPKA 1NC4D 2XZQL 4JY4B 3IFPB 4ODTH 4QRUB 2J8OA 3MLZL 3C9NB 5C0CB 1HH6B 5KAQF 4U1HA 1JF5A 1VHPA 1JZ7A 1OTTC 5EO1A 3RKDD 4JVPA 2NY2D 2QEJA 5CGMA 1H3XA 5CJQH 3KYMA 4Y5YC 4MWFB 2VLRB 1QSFA 5BRZD 2FATL 4Z9KB 3QUMA 4OD1L 1G9MC 5E2VH 3ULUE 1A0QL 3N0PB 1K8IB 1G7QA 1OB1A 4XAKE 3WS3A 1IQDB 3FFCE 4H1LB 1F02I 4V1DA 3O3DA 3KGRA 5T33L 1T6WA 5F1KC 5JMRA 1WZLA 3GSOA 3RY5A 2YD3A 1NCAH 3PHOA 3QDJA 1K8DB 2X7LA 3OAUH 4EOWH 1RD6A 3D39B 1MIEL 2ICCA 3KPSB 1CZ8L 3WYRA 1KB5B 4G8GD 3B3IB 3HMXH 4NPYB 3VI3F 3R4DA 1IZKA 4WGVB 4X5XA 1T3FA 1UWXH 4JKPL 5C3TA 1DQJA 4PJBF 1U3HD 2HJFA 5HHOE 1MFDH 1R3LA 3TFKC 3BQUB 1OP3K 3QXDA 4PGEA 3VFMA 5HDBE 3C60B 3CFEB 1HQRB 1AXIB 4UDTA 5GGSB 3QFDA 1KJ3H 5AZ2L 3L1OL 1E4XH 5SV4A 5B4MD 4MNQE 5MEPB 2JELL 5JXAL 3MJ8A 4XPGH 2HT3D 3I6GB 5EOCJ 3UJJL 4M61B 4U1MA 1BD2B 2XN9D 1VFOA 2E27L 4QXGH 1P4LA 1XCQB 4FQ1H 4JRYE 4YHOH 1UYWL 2FYYA 3H9SE 3GEWB 5LAXA 4RZCB 2YBRA 3C8DA 3DHJA 4WWID 3NGBB 4K94L 4I0PA 4LKCA 3VI4E 2HH0H 3MV8D 4POZD 1REIA 5F7UA 1XZ0B 4JGJA 3WIFB 2EYRB 3FT2A 3T3PE 3WLBA 4MMXC 4XPAL 4JJHA 3MYJA 2VLJD 4ONFL 4Z8FH 3LS5L 2XACC 4RMWA 3O6FD 1F42A 2AJSH 1AI1H 2FB4L 4JZNB 3QUKB 4RRPA 4NKOA 1BBJB 5CEZD 1EX0A 4BM7A 2XA8H 3SPVA 5HYEA 2W9EH 2OSLA 5L6YL 4ZTOL 2BCKA 2OX5A 4ETQB 3WDHA 3SDDD 5E03A 1BBDL 4IHOB 5ESVB 4HX1A 2VR9A 2P4AB 3BP5B 1KLUA 3VXMB 1ETZB 2W65A 1X5LA 4A6YH 3QI9B 3JUYA 3RWFA 2EIDA 15C8H 5GRJL 5HI3C 5JHDD 4QHLB 1M6OB 4Y16A 2YSSA 2O5YH 3PP4L 1J05A 4AG4H 5B8CB 1KEML 1CK0H 1X3DA 1T1WA 5HYSG 1YUHB 1LK2A 3GSQA 3P2TA 4I13B 2IGFL 1MSPA 3MNWB 5GGRY 4KVCL 4Y2DD 3BW9A 5ID1B 1N3NA 4NGHL 4JO3H 1DL7H 1Y18A 3V4VL 2DKMA 1BZ7B 1GZQB 3D69A 4UOW1 2UWEA 1NFIA 2EIZB 4PRHA 5DK2B 4APQA 4HWUA 4LVNB 4GMSH 4PJFE 5E6ZA 3ZDZF 1G1CA 1CLZH 4OJFL 5CCKL 1UCBH 3EIFA 4KI1A 1FFRA 4IMKC 4YBLB 3KR3L 2WWKO 1KN4L 1KELL 2DQCL 4ZQKA 1A7NL 1NDGA 3PNWB 4JFFD 1HHIB 3UJTL 4ZD3L 3CLEH 5DJ8A 5MHSE 4W4OA 3CX2A 3S3SA 2H8PB 5E95B 2IQ9L 1BFSA 3OXRA 2IWGA 3KLSA 3ARDC 2W38A 1MHEA 3EGSA 5F93C 2Q6WB 3C5ZA 1IAIL 3UMTA 4NQCB 2X70A 4NQSB 3LH2L 4XTRC 4KKAD 2DRUA 2X1QA 3S4SG 5GZNC 4HFWA 2AK4B 4X4MA 1E4XI 2VL4A 2GFBB 1IAKB 4LPTA 4RAUB 1SVCP 2P48B 3DV4B 2ZOLA 2VO5A 4JFOB 5IF0B 1UKQA 2V7NB 3K4AA 4H26A 2NY5C 4EUPH 4CMHC 2E9JA 3FB7A 4PJ8C 3PQYE 4G6KH 1TTGA 3N85H 3WXVH 2C3XA 5DMGD 1IEBB 5DJXB 4XVSH 2DQTH 1AH1A 2IMMA 2YPLB 3TCLB 4X99B 4FQLH 3P4LA 3OKOA 3HB3C 1YQVH 3FOMA 3MRQA 1RZIB 4KJWC 5TDOB 1DQDH 1DJSA 1FFNB 3U7YL 3H2WA 3KXFE 1ZT1B 4F7PB 4HGKC 2VXTH 4GAYA 1CQYA 5F8RC 3L5JA 2XRAL 1PBYA 3DJ9A 1XIWB 2VZUA 4X4ZA 1A22B 5DD5H 1EK3A 3HAEH 4FNLL 1DBKL 3MRBA 1KXTB 3WD5H 3HS0A 3GRWH 2HKFH 4PGDA 3PWPD 4JM2B 4KZEL 4YHKL 4P2OC 2ZJSL 3REVA 3M8OL 4L8DA 4TQEL 4OCWH 2F8XC 3GGWA 2EH7H 4QRRA 1KBGL 1RUAL 4NKDA 1UXSA 1AD0B 1T1YB 4X6DA 5AAWA 4H8WH 3RJDA 1JV5B 3L5XL 1E6OL 2YK1L 1FSKC 5AD0B 3PGCA 4YDVB 5I76A 2ZSWB 3UCRA 3WXWL 4WI6A 2V2TB 1EFXA 3N9GH 2UVEA 3UROR 2IC2A 2BVQB 4PJ5B 5AWNH 1FORH 4BSJA 4LEXL 5FUCE 4OLXH 4MXVF 3MLYL 4YDLB 5F89B 4E0RA 1LMKA 4Z7UF 4X6CE 3DMMD 4JPWH 3F58H 4NCDA 1RUKL 5GS3A 5IB1B 3ARTA 3U7AA 3HKFA 1QR4A 1NBYA 1K6QH 3FN9A 2VWEC 1OHQA 5GGTA 4ZFGL 3KLHC 3SKJH 5BS0A 4G8EB 4KJYB 1TJHL 1T1ZA 3GB7A 4XPBL 2FLBT 4DGYL 1LP9A 5KN5A 2OMBA 2OXGA 1T22A 5C0ND 5K9OA 4P5TA 2ATKA 2VR4A 3T77B 5DD3H 2A9MH 1CDGA 1AIFA 3ZDXE 1S5IL 4MDJB 1KFAL 4N68A 3SDXA 3IS1X 1P7QD 1HHKB 4K23L 3L6FB 3PJSA 5FKAB 5SWQA 4M93B 3LN9A 3MCKA 3OKMB 1LQSR 1U3ZA 3FZUD 3TN0B 5JW4Q 2ZSVA 3U7WL 5I8OH 1T5XB 2NY7H 5ICZA 4HMDA 5ADOL 4LLUB 4HKBA 3BKJL 4YUEH 2YKLH 3IDMB 3RL1A 3T65B 2X4TA 4P0DA 3UYRL 4FQHB 1S7QA 3MLWH 1PY9A 4KUZL 3HC0B 4KHXL 5D7IE 5LWYL 5IQ9B 3S96B 5I2IB 1RIHL 4GRLA 1N8ZB 3QHZH 4LMQE 4U6HA 3EHBD 4WU5A 1S9XB 2Y6SD 1I7RB 1PD6A 2VDNL 3HLAB 4NJAL 3QHFH 2Y5TB 4IIQC 3UP1A 1FFOA 5BOZG 5TPWH 5EUOF 3QO1A 3FHQA 3EO9L 3RY6A 4PJGF 5IEKA 4RDQG 3ESUF 3BAEL 5HHME 4JRXD 3WJLA 5DD6A 4YO0A 1CDIA 5C09D 3R1GL 2AV1B 4OUUA 3QIWC 2XXMB 4AMKL 4ERSH 3VD9A 4ZSOA 5FM8A 1MRFH 3G5VA 5LGHH 3IU3B 4I9WD 2R23A 4FMKA 3PGFH 2ADGB 2HFEA 1J0KA 1YPZF 3BKML 1D7FA 4LQFH 2KZWA 1FDLH 3NFSH 1TDQA 4NOBA 4UV7H 1YY9D 4LCYB 2EE6A 1MFEL 5MERB 3DYMA 3MV11 4XPHL 3ARFA 3SGDH 3BO8A 2ARJB 4WV1C 1EEUA 1KIQA 3VMOA 3GHBH 5D1QD 2DKSA 1NKRA 3HE6A 1D5IH 3MRKA 4LOUD 5GS0D 1VGKA 3KPLA 1A6VH 2BP3A 4KROC 4YBQD 4UNVA 1S9YA 4GKNB 1S7VA 5K33A 3LQAL 3ARBA 4Q0XH 3SDAC 3KWWA 4MD4A 3DLQR 5FEBA 4MJIE 4HKXB 2WUBL 3LKRB 2Y06L 5KVDL 3EYOA 4LEOA 1CQKA 4N0UE 4QRPD 3EYFA 3H9YA 4RWHA 1EJOL 2GTWB 4LLVB 4ODWB 3QCUL 3ILQC 4EN3D 2YD6A 1YEHL 3QEHA 1LE5B 4MD0A 1EEYB 1ZHLB 5JW3L 1OM3H 5HY9B 2VAAB 5D5ME 1I9RL 3GO1L 4Z0BL 1CS6A 2EO1A 1VFAB 3N1FC 4M8QB 5DEGA 3VD7A 4XVJH 2IQAB 4CDGC 3DVNB 4HIIA 1WEJL 2AJXL 4MNGA 4QRQA 5F9JB 5IHUH 3VXRE 1RZJH 4WJ5B 3V6FB 2AJYH 2YPKA 4EBQL 3D85B 1SJHB 3EJJX 3D18A 4MYWB 3LN5A 2MNUA 3NMEA 2OTWB 4WCYL 1WZ1H 5CEXA 1ZTXL 3OTTA 4H1LH 1FN4A 3L7EA 5EZOL 3T8XA 5DUML 4JJ5B 3LPFA 5FA4B 3PL6C 4G6FB 4I4WB 3UPAA 5A43C 3BXNB 4PJCA 2K7PA 4NC1E 4HBCH 5C07D 3VFTA 5LBSL 4JKWA 5JUEL 3TH4T 3U36B 4JFHE 4NBZB 3B8SA 3N1QC 1KB5H 2PXYA 3DNKA 1KJVB 4YXLH 3HZKA 4G42A 3VWKD 5ANMA 2PO6A 5H35B 1MEXH 3O45A 5CGYC 1E28B 4KKCC 5AYUH 2UUDK 3GMNA 5GPRA 2VITB 3B6SA 5I8KH 2BC4B 2DQFB 4YHPB 3BJLA 5ISZD 1PG7L 5E94B 3ETBF 2DQHH 4NQEE 2ZOKA 5C0AD 1AQKH 4LRIA 4K3GA 3KPQA 5F9AC 1LO4H 5FCUH 3QPQC 4Y5XA 2YZ8A 4HQQL 4RX4D 1C7SA 3A6BL 1U6AL 4LSUH 1U8QB 3D6GA 1MHCB 2DQDH 3VH8G 3HRZB 4OZHF 3Q6FA 2ATPB 4XP5L 1S3KL 5F71A 2PUQT 4K7PX 4PGJA 1S9WB 5EN2B 2AABL 5F7HA 3UBXI 1RZKL 5B39A 4LARL 4LVEA 4NZRL 1CFSA 1M05A 2VXSL 3VXQA 3Q1SL 1A4KA 1IRAY 2M2DA 4U1IA 5JA8B 1N0XL 5BZWA 2XG5A 5DJ6B 1KJMB 1D9KA 3VA6A 4FFVC 1F6AB 4NRZB 2Q7YA 3T2NH 5ALCL 4XBEL 2VXQH 1FL6A 4H25B 2HJLB 2CSPA 1QFWL 3MMEB 1FG9C 5F7KC 5I1IL 5JXEA 4DGIL 1JGLL 2EDEA 2Z31D 1G0YR 2OM5A 2PTUA 3GSRB 1Y6NR 5GGQL 3HI6H 1X5FA 4OM1H 2JB5H 4WEMB 2GT9B 4DKEL 4WI5A 2VISA 2GITB 3U4BL 1AXTL 1FIGL 3T0WA 2CMRL 3SJVA 4KC3B 4O4YL 3STZB 1YEIH 2OR9L 3H9HB 4HPYH 4KQ4H 1KTLB 3PWLB 1WGOA 1BJMA 2NLJB 1ZSDA 5TDNB 2P24A 4K94C 4OLEA 5IJVA 1AXSA 2Z8WC 3KJ6H 3GIVA 1OWWA 5I16B 1L4IA 4CMHB 4IRJA 4MB4A 3DSNA 4PJ8B 3ZO0A 4N0RA 2Y72A 3BESR 3B43A 2R39A 1QBLH 4PGBA 1WC7B 3U9PH 1AP2A 5C0BA 4ZUVA 1KB9J 1G6RB 3G6AA 4J12A 5TGBA 4PJAE 3EDDA 4L4VA 4ELMF 4UT6L 3RPIB 4PRID 4RMRA 1K2DB 2DLFH 1OQOA 1JZ2A 4XC3H 5EU6B 2XXCB 5EFIA 1XMWA 4HWBL 3EYSH 1AR1D 1ZA3A 3W39B 1NCDH 3D2UB 2XY1A 2ZNXA 1MCJA 5I8EA 5JNYA 1AKJD 1N4XH 4H0GA 4U6XA 4MAUL 1MIMH 1LVEA 5CMAA 1XCTB 3BUYB 1F6FB 1U91A 8FABA 5ELIA 1N7MH 4P2OB 2C4XA 1YNKL 2D2OA 1F4AA 4Q6IA 3LKQA 1FYTE 5I0DA 2AK1H 3QEUB 3FO9B 3QUZC 4E41E 1XGYH 4WI2A 2EH8L 3TZVC 1HXYA 1QQDB 2HLFD 4UILH 4UIMB 1IT9L 4X7FC 4L4JA 3CUPA 4XNZC 4P48A 3IDGB 1FSKB 1RZ7L 3MJ9L 3R06B 5DK3A 4R3SA 4X98A 4PP1C 4S1RH 2JB6B 4K8RD 3K7UA 2BK8A 4AL8H 1U8KB 3DXAB 1IAII 5GGRA 5FUCC 1EEZB 2P7TB 1VFUA 1VPOH 3P9WB 2CRIA 5IFJB 4ONHA 3UDWA 3ZKXC 5A16B 4XPTH 3KPOA 3FOLA 1F8TL 4JFXB 1RZFH 3MACH 5JOPD 3ALPA 2ZCKL 4YDIL 2KZ1B 1FZKB 1W0WA 4JY5H 4Y8DC 3LQZA 3JWDH 1E4JA 4YHYC 4PJEF 2UZYB 1AGCB 3I6LE 4RGMC 4Z18A 3S36H 5E2WL 3GSWB 4M1CD 4DGVL 2K1MA 3U0PB 5C0RH 4HUUB 3FB5A 4WW2F 5IVXB 5BMFL 4TTDD 4LPWA 3HHRB 5GSRB 4P4KD 4WO4A 1NAMB 4ZNCD 4WI8A 1MREH 2FWOB 1FE8L 4XGZB 1E4WH 4ZFOA 3VGDA 2JJSC 5H2BB 4R7NA 3ARGD 3UTSE 2AJVH 3VXSA 1QYGH 1A14H 5ESQA 2VZOA 4F2MA 3RVWC 2WINA 3DVFA 4D0BB 3RDTA 1CL7L 5FA3A 5IJKC 3HUJF 4A2MA 3IFNL 2YOCA 4M1DL 4LSTL 2H6PB 1CT8A 3TP4A 3S88L 3CFKA 5J3HD 2R8SH 1MCWM 4FXKB 2VDRL 1XGPB 4HPOH 3NCEB 1T7XA 4YFLI 2CGRH 1YDPB 3KPNA 2ZCLL 4IIQB 1WICA 4BFGA 3PDOA 1W72A 3VW3L 3ABZA 3T1FA 2X1PA 2Y1VA 2RQ8A 3DRTB 3QB7C 2P5EE 1KIPA 3W2DH 3FO2B 4RMQA 1S7XA 1P6FA 1TJIL 4PJ9D 4BH8B 3LKSA 4I3SH 5I66A 3QIWB 3RJQB 3NCBB 4NQVB 4AJ0A 3T0EC 1R24A 3WL9A 4ODBD 1OAYL 3IU4L 5I74C 1U8NA 5ACLA 2HVJA 2IEPA 4Y4FA 4R4FL 4LSRH 2C1PB 3FFCB 3P0YL 1U3YA 5E8PB 1LO3L 2AERT 5E8EA 3GBML 2AV7B 3QZWA 5GGSY 1B0RA 5EUKB 1MLBA 1A6WL 3O4LB 2A73A 5JPMA 3MRNB 5E8DL 4ZFFB 5J0BA 2RCSL 4KI5E 3RTQC 3AREA 2ZUTA 2JCCA 4WV1B 1QRNB 5D4QA 1II4E 1X7QB 4NKQB 2NNAB 1MJUH 5I1LA 1LEGB 1MLCB 4QRRD 3KLAA 4IOIA 4D2NA 5T3XD 3WFDL 5D2LB 3OKNA 2B1AL 5TF1H 3UZVB 4XCEB 4DAGL 4F37F 4KROB 3DARA 2L7JA 3NZ8B 4G7YL 4LQ1A 3GSXB 5D6DC 1ZGLM 3C6LC 4R0LA 3C60D 1NUFA 3LEVH 3P9MA 2ITCA 5JLZA 4P2QE 3SDAB 5E08H 1G84A 1ZHBB 5IK3A 4OD3H 2C9AA 5F9WC 2H26B 2VDPH 2H9GB 2X1WL 1FZMA 2Y9RT 2FECL 2GJZA 2MQ3A 1VACA 2LAAA 5DRZA 4PJDA 4RFOH 2DLGA 5C0IA 3QH3A 4Z7VB 5JW5B 4JFDE 4JM4H 4M5ZL 4PJ7B 4XMPL 4JRYB 4YX2H 1S7RB 3H9SB 3S37H 4U2ZA 2ZCHH 4I8DA 1JUFB 5BS0D 4WDIA 1EIBA 4JB9L 3U1SL 5BXFB 1X44A 5MEOA 2Z4QB 4JDTL 3STBA 1G9MH 1K4CA 1LP9F 4OQTA 1NPUA 4RA0C 1IC4L 5KS9B 2R1XB 5T1KB 1RMFH 4P46C 1AO7B 3M07A 5EBWA 5HYQA 1IGJA 4B7IA 1W0VA 4D9RE 2F5AL 3DX8B 1YEKL 4LHUD 2AXFB 4X6FA 3ES6B 5DZLA 1JFQH 1KTKE 1J87A 3VGEA 4F57L 3FQTB 1J8HA 1IL1A 4KK6C 3WNPA 1LE9B 3PL6B 1UWEH 1B88A 1H8OA 3FRUB 1EZVY 3VXMD 4NC1C 4NO5A 1RIVL 3MRIA 4R4NC 1F58L 2UYLA 4JLRA 3F7RA 1FAKT 2CUMA 1YN7A 1CFBA 4WHTA 3O81A 3KPRE 3CH8A 4F58L 3ALXA 2OP4H 1WWAX 1BQLL 3FQUA 1DQLH 3JWOC 3WFCL 2AEIT 4DKDC 5K9QG 1EVUA 2P46B 4DQOH 4JN1L 1FV1B 4B50A 2VC2H 5HHPB 3H42H 3RZCA 1WT5A 3MZTA 3TIDB 4OB5L 4L5FH 4EDXB 5FOBA 2CKNA 1CDHA 2ZUVA 3QQ9D 2ED8A 1CD1B 1PLGL 2CO7B 2EDDA 5C2BH 5KVGL 1NCWH 1HHJB 3CFJA 3W9DA 4I18C 4NHCH 1NGPH 4R4BB 4PTTA 3D48R 3IDIB 4OZIE 4MB5A 1KGCE 3GMLB 4OCRL 3KDMA 4ACPA 5DJ2B 5INCB 4PLJC 3SKNA 1VADA 5F9OH 1WSST 1HSBA 2NXYB 5E4EC 4A2LA 1OGAB 2R2EA 4WHYH 5C9KA 4K3EL 3WNMA 1QKZL 3FONB 2PW1B 2GJ6A 1A6UL 1AGFB 3MOAH 4OLZH 4IMLB 3SOBL 3V2AR 1UWXK 4RQQA 4XCCH 4TUJA 3DGGB 4MXWL 4MCYB 1S7SB 5JPNB 3AAZA 4ORGA 3QWRA 2AJZB 4LCUB 4PLKD 4WUUA 4XP4H 3KS0H 5L2KA 4C57C 3FT3A 5JIHA 5F96L 1A1OB 1TZIA 1KIRA 5D7LA 1MFAL 3BP6B 43C9A 4ZTPL 1O0VA 1OLLA 1GXEA 3W0WD 3MRLB 4U7KA 3VFWA 2IALA 1EHXA 3LRGA 2MPAH 2BVYA 3VCLB 1GGBL 2BNUA 1RJLB 4FZ8L 4PJXE 5ID0A 3KYKH 4K3JL 3I9GH 2C26A 1S8DB 1FAIL 4U1JB 3DRQB 3GFUA 1BM3H 3M1BA 3HZVA 3O2VH 2A83B 2DL2A 1NMBH 5KBNC 3V6OE 2RHEA 2P8PB 4KMTL 1UB5A 2YPLD 4OFPA 4R96A 2ESVE 1S9VA 1JE6A 4Y4HD 3F5WB 5DC9B 1ZVYA 5DC4B 2WBJA 5E8NB 4KAQL 3RWDB 3HPJB 5I30L 1HZHH 2APWA 4QCIB 1U8MB 1QHOA 2A1WL 3KXFB 5CILH 1JPGB 3BZEB 1B0GA 1IEHA 2WBWB 3B9KC 4G5ZL 1XIWD 5C6TL 3AFLA 3CH1B 2BNRA 5I18H 1JRHL 4EUPA 5D72L 1HYSD 2X4RA 4X7TB 1IGTB 1JWMA 4MQ7A 4WHDA 1HH9A 4DJMA 4X7SH 3T4YA 1G7HB 5KVFH 5CUSH 3WHXA 5EO0B 3HNVL 1D6EA 4LGSB 2Q87A 2R4SL 2R1YB 4LSPL 4EXKA 5DS8A 3GHEH 5GISH 1RURL 5A3ID 2KPNA 3O6MH 4HUKB 3GMPA 4WWKA 1XF2A 4QHMB 3QUZB 4XVUC 1NCTA 2I27N 1HINH 1I9JH 2J4WL 3TZVB 3D9AH 4NYLB 3QDGA 4P57B 3O8XC 4XNZB 5F88B 1J0YA 1ES0A 3DUSA 4QXWA 1T0NA 4G3YL 3ALWA 3HAEA 2WM0A 1ZGLA 3MBXH 5EZLA 3GRWA 5LKNA 3OAZH 3MUZ1 4Z76B 1A7OL 3NCMA 3MXVH 5DT1L 1IAMA 1VENA 2CRZA 5J06A 1AGBB 3BSZH 3DUUB 1TZGL 3ILPA 3T3ME 2O93L 1G9NL 3CX5K 3LS4H 4J6RL 3ZKXB 4P5MB 1E6JH 4W6XB 1J9CT 1FFPB 4X6CB 4M02A 3F7QA 1NFDE 1RZKC 32C2A 4AK1A 2DB8A 4S2SB 4Y1AE 3P4MA 3MA9H 4GW1B 1S78C 2DDQH 5I1HL 3IDYC 3MNVA 1RUMH 1SYSB 1U95A 3JTSA 4CVXB 4X9FA 2CDGA 5DF0A 1LEKA 4YHYB 1MFCL 1G6RH 4BYHA 5BJTA 5J9PA 1IAIM 4RGMB 2LE9A 1I8KA 3EOTH 5IG7B 4WFGD 4YEFA 1X5JA 5A2JH 2C1OB 3KG5A 4HJGA 2IBBA 4GKSB 3TBWA 5SWZA 3BX7C 1B4JL 1RZGB 1KB9K 4GQ9H 1PKQA 3EZJB 4G7VH 4MVBD 9CGTA 5DJCA 5F8QC 5I1JL 5J4MA 2FIRT 1CICC 5EA0L 2PTVA 1XGQB 3QQNA 5C0DA 1RY7B 2Q76B 1KT2A 1Q9LB 5E00A 4LLWA 2PYFB 2FBJH 3OBAA 2AVGA 3G08A 1DTUA 3UTTD 3IETB 1L7IH 4JFZL 5I17A 5D7IB 2CK0L 5FO9B 5FYLL 5IP4A 1C16B 1FRGL 3I02B 4NN6C 2ICEB 1JGDA 4M6MH 3VFSA 1F4YH 4PREB 3FO1B 4XHQA 4WUKL 2CLVA 2WUCH 1ORQB 1PSKH 2DWEB 1G7PB 2DQUL 3VI3E 1HXMA 3DSFH 1T21B 2EYTA 4KK5D 4XP6L 5T5NF 2CUHA 3TYGL 5HHMB 1YEGL 3MCLH 4OCSH 1NMCC 3NOIA 4FG6C 5JQ6L 3I75B 3V5DB 3EDJA 4L4VD 4YZFE 1JK8B 3TA3A 4K71B 4J3OC 2H32A 3T0EB 4NQTA 5GRUH 5C6WH 3K1DA 4PRBA 5I74B 2IPKB 1WJ3A 4W4NA 3G6JE 4DUWA 3K2UL 2LV4A 1M1SA 5DRXB 3QWOA 1GZPA 3GNML 5IMMB 4L3EB 2OMNA 3NAAH 3VRIB 1BVZA 1UM6H 2WIIA 3RTQB 3B9AA 5BW7A 2O5XL 4XPFH 3BP7B 3UTPD 4X9IA 3PWVB 2OZ4H 1NAMH 1H3VA 4NRYA 4QRSA 1TENA 4JG1L 1T2QH 4NKMA 3MRCA 1BVLA 1J0IA 5IGXH 5EOQL 5A2FA 4HWNA 4JANA 3QR2A 3OAYK 1RVFL 4Z95L 3C6LB 4X6EB 1IFHH 1RFDL 3QEGL 1N26A 3O11A 3M17A 4MJIB 5F9WB 1WWCA 2V5MA 5EC2B 3RU8H 3CCHB 1NAKH 2Q8AH 4N0UB 1DBAL 3O3EB 4HHAB 1KCRL 4G6AC 1HWHB 5DRNB 5D7JA 1HDMA 3NFNA 4Z0XA 4JZJA 4PG2A 5F7MC 3W82A 5EO9A 4KRNA 5D9SA 3BT2L 4K3HA 5DVOA 3O41A 4RBPH 2EDOA 5AG8A 1HHHB 3G5XA 1I4FB 4O58L 4H88H 5HXMA 3F62A 4YGVA 1CLCA 1XF5B 4PG9B 1EMTH 2BNQB 2Y07L 3KYNB 2VDLH 4JFED 3VFPA 4CU7A 3IRZA 4JY4A 3IFPA 3VXRB 1FO0L 1UJ3A 1ND0A 3D85D 5F72S 4IJ3C 1FZJA 3C9NA 1BAFH 4P46B 5B39G 2F54E 2GYSA 2XOTA 3J8F7 5C0CA 2Y23A 5HSFA 2DWDB 2CD0A 1CLYL 3FTGB 4Z5RB 1DBMH 5HD8C 5IWLA 3QEQB 3WIHH 4NC2B 4LCIL 1OAKL 3U6RA 5B3JF 5FYLE 4E5XB 1FNEA 4AEIL 4MWFA 1IM9D 2V2WA 2P42B 1UVQA 5L9DL 4OAWB 4BSWB 4JZOB 3TJEL 1BGXL 3TPKA 5HI3D 2A77L 1KULA 1MHHB 1RZ8B 4U3XA 4M43H 3UEZA 5GGVY 4ZFZB 6FABL 1I8LC 1YY8B 4H1LA 3TVMC 4RISL 1RK1B 1INQA 4DCQB 2EDWA 3NCYS 1FBIH 1C5CH 2C3WA 3BEVA 3HG1A 4PRDB 3TT1L 1MHPH 1F97A 2WQ8A 2GTZB 1F3RB 1K8DA 3WUZA 4JE4B 3T4AB 4GW4A 3QQ4B 5B21A 3D39A 3OG4B 4ODSL 4I18B 3KPSA 4HIJA 4Q9RH 1MI5E 4X5WB 5DO2C 1KB5A 1KXQE 3MBEB 3B3IA 4NPYA 4FQJL 3HE7C 5FHBH 1GCFA 4F9LA 4K2UL 5EZIH 5MP6L 1GIGL 4KKBC 2IAMC 5E4EB 4Z78B 3F8UB 5FM5M 3BQUA 1AC0A 2K9UA 1CYGA 3V4UL 5FF6A 3CFEA 5KSVA 5GGSA 3W9EB 1EXUB 1INDH 4L8SA 2H2PC 4HDIB 2D03L 5C08A 3ESVF 1I7ZA 5TE6L 3BE1L 3CLFL 4PBVC 3KYAA 1ZLWK 3BIKB 1L7TH 3QXVA 1KENL 3I6GA 1P6AB 4M61A 4IOFD 1U92B 3QDMA 2JCCF 2P8LA 3E6FB 5HGAB 5GJSL 3ARDD 1XCQA 1MJ8H 4AEHH 3VXPB 3RVXC 2NY1D 3TNNB 4GAFB 4P59L 2GHWB 1EO5A 3RWGB 4CW1B 4UT9H 2UZIH 2GSIB 2J88H 1YNLH 4CJ1A 2ZZUT 5GZND 3WN5A 2X9WA 4J4PA 1XZ0A 3WIFA 2EYRA 3QXAA 3H8NA 3DI2B 1T5WB 2Q3ZA 2F53A 4QOKB 2E6JA 4JO4L 4JZNA 2B8OT 5JOFB 1BBJA 2H1PL 1A1MB 2D7TH 4PD4K 4KH2A 3UTZA 3V6OC 4ETQA 1I1AC 4IHOA 5JORB 2HN7B 4LPXA 5ESVA 2GCYB 3HB3D 1B6DA 4KJWD 3F7PC 4P2YA 4XT1C 4TRPL 4Y5VC 2YD7A 1ETZA 1LD9A 3S5LB 2PYEE 4N8CH 3DO7B 3MLXL 4LLYA 3QI9A 1ED3B 4PJAB 4YC2C 5IFHH 5IR1A 2QADD 3K2MC 5T33H 3WNKA 4P9MH 2XTJE 1EUTA 3E0GA 2A38A 4U1GC 1M6OA 3X17A 3D0VA 1PFCA 5J1AB 3BIAX 2VKWA 1IE5A 1UZ8A 4MX7B 4JDVA 1MIEH 1JWSB 1YUHA 5DK0B 4YXKL 4M5YH 2R15A 4TOYH 4NQDB 1A6AB 3QNXB 5ID1A 3P11L 3BDYH 1R3JB 3R0NA 5JZ7C 4YPGB 1PJ9A 3GMOA 4N90E 2FSEB 5MI0C 2EIZA 1JI1A 4MCZB 2BSRB 5DK2A 1IAOB 5FYJL 3S34H 5SWSE 3O8XB 1PZUB 1DQML 1EEQA 2JK5B 2A74B 2JELH 2AW2A 3VRLF 1T6VN 5IT2H 3UJJH 4KRMB 4MAYD 5C0EA 1U8IA 4N8VB 3OGCB 3RWHB 3B8YA 5EBGA 3PNWA 3H9ZA 4Z7OF 2XPGA 1UYWH 3AMKA 2AEWA 1GSMA 5HPMB 2E7LA 2JTDA 3EOBB 1MVFA 4NQUA 5HYIA 3PABB 1DEDA 1H3GA 2A6IB 2VLKE 3DECA 1A6PA 2RJMA 5I19L 3IDYB 3Q3GB 4EVNB 3BD3A 5A2LH 4XBGB 2X4UA 4NQCA 4NQSA 4ONFH 3BMWA 2APTA 2L4OA 4U1LB 3LS5H 3MGTB 4EQ3A 1PVHA 2FB4H 4LP5A 5D1XA 4XMKH 3QCTL 2QQNL 5EUOE 5I1CL 3IKCB 2AK4A 3SGJC 2YZ1A 4FQCH 2B4CL 3SDCA 5L6YH 1IAKA 1AHWC 2EDHA 3DUHA 3DV4A 2NY2C 4FTVB 4JRXE 4JFOA 5IF0A 1FNLA 2Z91A 4NFDA 1BVKA 2IANE 4XXCC 2BOBB 4WUUD 1QSEE 1YMHA 4KUCD 4KDTC 4KUCF 5BV7L 1KCSL 1IEBA 3JV4B 5DJXA 3CDFA 5D93C 1UENA 1YPZE 5GRJH 3UTSB 3TCLA 4XWOC 5HYJD 1U8PA 1RZIA 2Z93B 5TDOA 1FFNA 3PP4H 1MCDA 4HIXL 5I1DB 3QUML 1ZT1A 4G6ML 3SKOA 3ZKND 1UACL 1WWWX 1IQWH 1DCLA 1OARL 5HGDB 3U4EB 4KVCH 4WFFE 2FHFA 5DJAB 4KGLA 5C3LD 3V4VH 1QFPA 2VN7A 5FYKL 5GHWH 1CGSL 4JM2A 1JCKA 4NT6B 5E9DA 4F9PA 1JWUB 4ZO8A 3S97C 4WTZA 1NMCB 5EH1A 3C2AL 5INDB 4W6YB 3ULUD 2XV6B 4OLWL 3ULUF 4IBLT 5D7SL 1AD0A 1KELH 1I1FB 3BGMB 3NIDE 4JAMB 3UJTH 4BELD 5B4MC 4NQXB 3FFCD 1HK6A 4YDVA 1SEBA 1NCBH 2IQ9H 3F7VA 1WBXB 2V2TA 1NEZB 1KLFA 3MYZA 4CADB 3QRGL 3FQRB 3I6KB 2BVQA 4QXUH 2L7UA 4LFHD 4HKJB 4QHUB 5FYJE 4CMMB 1TQCC 5F89A 1DFBL 3U0TB 2MQ0A 4YWGH 1QFUH 4POZC 5CJOH 3GUTB 2ZPKL 1AGDB 4AT6A 2FL5B 4WEBL 3H0TA 2DQEH 5IB1A 4UIKH 2BXZA 4CNIB 4KROD 4K7PL 4MQXC 5HHOD 2Z35A 3CNKA 1QFHA 3JV6B 4G8EA 4KJYA 2XNAA 3SDAD 4UTBL 1FNSH 5HYFA 5HDBF 1RHHB 4P2QB 1DBBL 3IXAB 4M48H 4MLIA 3MRJB 4UDUB 4XXDB 1J1PL 3PV7A 4CDHA 1VFBB 4MNQD 3SDDC 3C6SA 2DQJL 1XH3B 2CRYA 4G80B 3T77A 4HF5H 1KNOB 3QFJE 2R56H 5MENB 4LLDB 1AQDB 1HNGA 1IILE 1IC5L 2B39A 4JRYD 4PTUA 3H9SD 4JFDB