4KMLB

Probing the n-terminal beta-sheet conversion in the crystal structure of the full-length human prion protein bound to a nanobody
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
AVQLQESGGGLVQPGGSLRLSCAASGRTFSSYNMGWFRQAPGKGREFVASITSSGDKSDYTDSVKGRFTISRDNAKNTMYLQMNNLKPEDTATYYCARGLGIYIIRARGGYDHWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the N-Terminal beta-Sheet Conversion in the Crystal Structure of the Human Prion Protein Bound to a Nanobody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/protein binding
molecule keywords Major prion protein
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kmlB00
4OFDA 2QLVB 3EO0A 1OLZA 4PRAA 3NCBB 3WFEH 1SJVA 3QWOB 4JRWA 4PP1C 3WNKA 3GBLA 3LKRB 4JN2A 1XT5A 4R90H 2P42B 5I15L 1Y18B 2XY2A 4MDJA 5HVHC 3QXWA 2L4OA 3MLSH 4I4WB 1HH9B 3SDCD 2C3HA 3I75A 1J0JA 4OZGA 1T22B 1HILA 2CR3A 5D71L 4GKNB 3C09B 3RRQA 3F7VB 5EOCL 4XPHL 2EIBA 3GBMH 3N0PB 1P7KA 4X5LA 5T5FL 4RGNB 3NABH 4FP8H 4P5MA 4YHNB 4IIQB 4X83A 5BO1L 4AL8H 3UJTH 1T3FA 3QJFB 3K80A 3OKDB 3RWGA 1Q9LA 3DSFH 4HPOL 3QXTA 5FM5M 4HUXA 2NY7L 4MXVE 5IB3B 4MAYC 2CJUL 2LU3A 1GZPB 3VFUA 4HIHA 1OB1B 3NGBB 3DETC 5D5ME 5E6IB 3CFBA 3TP4A 5ID1B 4JM2A 4MQ7A 1NGQL 4GRMB 1Q94B 4NZJA 4HXBH 4JFHE 1LE9A 2F74A 1NMCC 4FQXA 1KOAA 1OD7A 4WTXA 3G5ZA 1AGCB 3I2CL 4NJ9H 1LO5B 2EIEA 4LSDA 4NNYA 1WTLA 3O3DB 4PB0H 4MJ6A 2YPLE 1J1XL 1YPZE 3VD3A 4KV5F 3RI5F 4RAHA 5LGKA 1RZFL 4D0CA 1YNTA 4OZHA 2VR4A 3VFTB 4LAQL 2ARWA 3ALPA 3QXDA 4JAMB 1U8PA 5DWUH 2CO7B 4L9LA 4PP1D 5DQJB 1K2DB 3SDAC 5IG7A 5EOCJ 1N6VA 2CLVB 1N2RA 1Z2KA 2HFEA 4Q2ZB 1WC7A 1NDMA 5E2TH 1HSBB 5ALCL 3WDJA 1NCCL 1T21B 1VADA 3HS0A 5I6XC 4BSWB 3FN0H 2ZOLA 1TETL 5IV2B 3HMWL 3D0LB 1LO4H 4CNIA 2UUDK 4KVNL 1DANU 5MHSE 3MRIA 1BIIB 4UOW1 5HYJB 3IFNL 3V0VB 1U41A 2DQIL 5CAYB 5FECA 5KN5B 3A6OA 3DSNA 1NMAH 4XZUB 4JZNB 1EH9A 1J88A 5KSVB 2BXZA 4MGXA 1IAKB 4ZAKC 5T1MB 5I19H 4HJ0C 2IEPA 4XAKD 4PJ7E 1ZA3B 4N0FA 3EW3B 4Y88A 1G1YA 3IJHA 1HXMB 2XT1B 4Y0GA 3Q5OA 1R3KB 5ADPL 4NRZA 1CF8H 2X4UA 2WIIA 4HV8A 3LKQA 1QLFA 4EXKA 4NFDA 1VDGA 4HBQA 5D7LA 5IESH 4F33A 5EO0A 2CIKB 1UA6H 5JO5B 3IJYB 3LKPA 4RRPG 2FD6H 5ID0B 3PL6A 5IQ9B 3S3JA 1EIBA 4AY0A 5DD1L 1FNEB 1G7IA 4C57C 5IGXL 3P3YA 2YEZA 3ZDXF 2B5IB 3AB0B 2ATKB 1RMFL 1FGNL 1ZLWK 5C8JB 4KRNA 2FZ3B 4R4NC 2HT4D 1WBYB 2HLAA 3CVIH 3CX2A 1D6EA 1JNHA 3SHSA 2WAHA 4H1LG 3X3GL 4IDLA 4TQEH 3OG6B 2SEBA 4M6OH 3KYNA 4N8CL 1R5WA 1H3TA 1A1NB 3CSGA 2G75A 3MBEC 4XVUC 4OCLC 4X7DC 3MFFA 3NTCH 1O7VA 2GKIA 3V9FA 1WWWX 15C8L 1MQKL 2CR6A 1JP5A 2PYEE 1NFIA 1F90L 1MVUB 3GSNH 2O5ZH 1LVEA 3GMNB 1TZIA 3RU8H 4WV1A 4PRHE 1N64H 4HHAA 5MEOB 5DFWH 3W82A 1FZJA 2VLME 3PNWA 4EN3C 3OKNA 1GH7A 1QBLH 3WMSA 3HKFA 4F3FB 4EQ3A 4XNXH 1D9KC 1RQ5A 2AEPH 3QJHA 4O51B 3VGAB 5JMRA 4ZTOH 4L8SA 2AEQH 1CTOA 3MLRL 1NJ9A 5GGVY 1WICA 4AMKL 1ZGLB 3FO2B 5JXEC 3QWRD 3C5ZA 3T3MF 5C71A 8CGTA 1DBAH 1JPTL 4YDJB 3E2HC 4LP4A 5FHAL 3BVNB 2NY7H 4X8JA 2QADB 5I0DA 2BJMH 1DCLA 4GRLD 4JFOA 5EIQA 5TF1L 2FATH 4HJGB 3PV7A 5IHUH 5EOTA 1I85A 2IAMB 5D1ZA 1LE9B 4GMTH 3GRWL 5IBUG 5C0BE 3RY6C 3W0WD 2A73B 1NLDL 5BO1H 5D7JB 3HC0A 4S2SB 2WQRA 1T1XB 2RGSA 4XPFH 3K4DA 2IADA 4WUUE 4CRPA 3DHMA 1BD2E 1IGFL 4P4RB 1FZMA 1KB9J 3C5ZD 5F3BA 4EDWL 3L3OB 3SGDI 3CMOL 1WJ3A 5DJZB 3BW9A 3EGSA 4B53A 4PBWD 1QG3A 1CFBA 2E27H 5EIIA 4YNYA 1HSBA 4JB9H 2HJFA 1CLZL 2WP3O 3T2PA 4JO4L 4WUKH 3GMMB 2FSEB 3VA6A 1I1AC 4J7RA 4AT6A 1N4XH 1MFDL 4WHTA 2BVOA 4D9QE 3S37X 2BSSB 4M7KL 2FX9H 3O0RL 2P5EE 3THMH 4IDJL 1EAJA 4PRBB 2P5WD 5IOPB 4KKBC 4LLMB 2NY6C 2ARJB 4JQIL 5KN5A 3IAQA 1JNNH 2OSLA 3TH2T 2C7UB 5DR5H 2BZDA 1YDPB 2NY1D 5HYIA 3EOTH 3WO4C 3Q1SH 4TUKL 1OOAA 4O4YH 3U1SH 1OP5H 2DQGL 2KDGA 1PKQB 1ETZA 4NQDE 2QSVA 3P0GB 4PP2A 4GRWE 5HY9B 4J2XA 1JGDA 2XICA 3Q2CA 5KANG 3K7UA 5AUMA 5FUOL 3FJTA 4OZIA 3MJ7A 1JE6A 1MLBB 4N9GB 3JVGA 4X6CA 3AROA 4C56A 1CR9L 5LWYH 3TO4B 2K1MA 1SJHB 4MCYA 4Z7UE 4WEMB 1BQHA 1SEQL 4KGJA 4BH8B 1PKQE 4LSTH 3VXUA 3X17A 4O02L 2DTML 2VN7A 3GBML 3GKWH 5DJ8B 1EEZB 1G9NC 1DLFH 1YY8A 3MOBH 1HE7A 3B3IB 2QHLA 5GS0L 1UWGL 2HLAB 2OL3H 1HK6A 1JF6A 4TULH 3IFOB 4YC2C 4JKPH 5E8EA 4JQVA 1OF2B 3H9HB 1A3QA 4OGZA 3WD5L 3IDXH 3HA0A 4H0GA 4QRTB 3JTTA 2G75B 1KEMH 2N7BA 1QBAA 4R26L 3V6ZA 2C1PA 1WLHA 3PJSB 5E6ZA 5I30H 1G9MH 4ZUVB 4I3SL 5MERB 1GGCL 4QEGA 1VFAA 4JPVH 4PRDB 1IT9H 3P9MA 4F57L 2Z93B 2I5YH 3IETB 4Y5XA 1AR1D 5HDQH 4LCIL 2H1PH 3VXUD 4I3GA 1NMBH 1E4XH 2MCG1 5KZCD 1HQRA 1LE5A 2R4SL 4JVUA 4PRPA 2RCSH 5I30L 4NPYA 4IRSC 2ZCHH 4RFEA 3MLXH 4JFEA 5GXBB 3W9EA 4PJHB 1RU9L 4GBXC 4LVNC 1HHGA 1PX4A 5EU6B 4AIZA 3EOBA 4RWYL 3ZHDA 2NX5E 3VFWA 1T0PB 5FO7A 3MOBL 5EB9A 1NSNL 1JPSL 4F80A 4LPVA 3UX9B 3WIFB 4TVPE 4XWOC 5M7QA 4PUBL 4M1CC 2O5XL 3MRRB 3QDHA 3MRJB 3VWKC 3QNYA 4PJAB 4PREB 4LOUD 5CCKH 4PY7A 1N59B 1PZ5A 5IVXB 4R26H 5D7KE 1I8MA 4WEBL 3PGDA 2A73A 2XYCA 3V6OA 3FT2A 3VXOB 1NBQA 5FV1L 4JG0H 2QJDA 4K7PY 3F12B 4NZTH 5DJCA 1B90A 1X7QA 3VFGL 3LQZA 3CUPB 5JDJA 4ENEC 2OL3B 3NCJL 5IMKA 2VDPH 3MUY1 4PY8J 1UFUA 2J12B 4UV7L 3QAZC 4PYHA 4OM0L 2L0DA 5CJOH 4UINL 3GSVA 4JQXC 4PPTA 3GIZL 3RWFA 1W0WB 5T5NG 4ZAKA 4ZTPH 1S7XB 3D6GA 1QTYT 2XOTA 4M48H 4HUVB 1IC5L 1C08B 5GRUH 5LAXA 5F9OL 4DGIH 5BZDB 4HSQA 1QLEL 3QHFL 3LS5L 2FHBA 1A2YA 1H15B 4ZFZA 3H2WA 4G3YL 2VC2L 4I5BB 1E4XI 1A5FH 3OKYA 5C0AB 4PJHF 2XZCL 1N7ML 3GBNL 3E6FB 4HS8H 5F9JA 2XA8H 1KFAL 3B9KA 5DFTA 5LBSL 2FO4B 3PP3H 4HKXB 5KSUA 2DYPA 2BVYA 4HWEH 2O5YL 5F1KC 5JPMA 1Y6MR 1AGEA 4HIHB 2KKQA 1NUNB 2R1XB 1MIEL 3V4VH 2OZ4H 3KVQA 4PJCB 1KIUA 4BSVB 2R1YB 2OJEA 4LSPH 3G08B 1EO8L 5D2NB 1CG9B 3T08A 3FN3A 2CDFA 4HT1L 3VGGA 3O0RH 1RMFH 3AS2A 3GHBL 4TSBH 1MUJA 4G80B 2A6KB 2MCPH 5IEHA 1WBZB 3ARRA 4PLKC 5ENWB 5IEKB 1BQHB 4BH8A 5EU5A 4R7NA 3TT3H 3S96B 3VCLA 4JPKL 3QXDB 4PFEA 3H3PL 2X4PB 2CRYA 3B9EA 5D6CA 5DJ2A 2Q7YA 1ODAA 3QDGD 4XCYA 3IKCA 1UH3A 1BVKB 3U1SL 5DT1L 3TYGH 5F1NA 5A2FA 3MRKA 4AEIL 2Y07L 4FQ1H 4FQLL 2WWKO 4P2RD 4TNVK 4NRYB 3BP7B 1A4JB 1F3DJ 1NBYB 4Q0XL 4CJ1A 1VFAB 5ACZA 3D9AH 4O9HH 1FAIL 3S36X 4C55A 4NCC2 4XPBH 4Z7QE 4DVRL 3BPOB 4WUKL 1RZ8A 4MHHG 2CRZA 2GJ6D 4PJGE 4BFIA 1IAIL 1DBAL 1NMCB 3UO1H 4POYA 4J4PA 3P77A 1AP2A 4CGTA 2E9BA 4PRPB 1OQOA 2JIXB 1PLGL 1XGTB 3LN9A 2WW8A 3GHBH 4TSBL 1BWMA 2QQKL 1KLFA 4GQ9H 1E28B 1NBZA 4PLJD 5HVHB 4MNGE 4LBEA 1FORL 1G9NL 2FR4B 2WIIB 1BFSA 4HV8B 2ZUYA 3IS0X 2AXGA 4WWKD 5HGHA 1QFWH 1U3YA 3GMQA 4F33B 2DQGH 4I9WE 2JCCE 2Q8AH 2PW1A 3HCVB 3MLUL 3IU4L 1JGEA 4OGAC 2GJZA 4P5TA 3BD5A 3LEVL 3GDBA 3VXNA 1UJ3A 4X7SH 3ZZ1A 2Y5TA 1NLBH 4HC1A 2HVKB 4ODSL 4X6DB 2FDBP 1C12A 2J8UB 5E8DH 1BJMA 4NKMA 5F7WC 5KVMC 5SV4A 3SE4A 5DJ0B 3RA7H 3HZYB 3VRJA 4DVRH 3O2VH 1LHZA 3MNWB 1JZ5A 4HCRH 4KKCD 2DJ4A 1UWXH 1FFPB 3BEVA 4J3TA 2WINA 2LTQC 2CK2A 2HN7A 4MD0B 3GMNA 4G8GB 1T7WA 2BVPB 4MJ5A 2M8XA 1O7SA 1FIGH 5DEZA 1PYWA 4LLDA 3G04B 4X9HA 3MLWH 3FQUB 5A3IC 4OI7A 3UDWA 2AXFA 5BXFA 4Y2OA 3LPWA 5EOQL 3RWEB 2C3VB 4HWZA 4LHUB 2IPTH 4WGWB 4IRZL 1M6OB 2YMXL 4LIQH 1MCPH 1QSFA 3S6CA 3RDTD 2ZKHH 1KCKA 5I8KH 3SQOH 4GG8B 4RA3A 4X6EB 4KROC 2V2TB 4WUUD 4OJFH 4DEPB 3GEWB 5CBAA 3AGVA 4KTEH 1RJZA 5E2UL 3UXFA 3U46B 4R7DB 2ICEA 2R1YA 4B7IA 1BJ8A 2DKUA 3DROB 5ESQB 3LKNB 1MCFA 5KW9H 4XBGA 3EO1B 4Y4HB 2VMFA 4ELMA 1MIML 1I8KB 4GAYA 3LKSA 3U4EB 5FYLE 2GFBA 2Z4QA 4ZUUA 4I0CC 1A7PH 2PXYB 4S1SL 1RPQA 4HK3N 4CU7A 1CGSL 2ZSVB 1NMBL 4JVWA 5FO9A 5C0EB 2VUOA 5HYSA 2X4PA 5DJ2B 4JPKH 4PJFB 1MEXH 4LCYB 5EIIB 2Q7NA 1KACB 3M1BA 1WK0A 3CZFA 1HOCA 4FQJH 4Z5RB 4HFWB 1HHHB 4JM2D 4ODXA 4NKQB 5H94B 3WFHA 5A1AA 1KTLA 2FH8A 4P2OA 4XGZA 5JHLH 1FFOA 4PRBA 1W8NA 4U6YA 1D5ZB 4N0YH 5IKCB 5BRZA 5C07B 4I0KA 3ARPA 3B6SA 3QUZA 4EUPA 3TF7C 1XGPB 3GSOA 5EFIA 2YPKA 3S7GA 1WFOA 4PGDB 5GGQH 4F9PC 3MXWL 2LFGA 1MREL 1KJMA 2XY1A 4F58H 4RISL 4YHOH 3SKMB 2IPKA 4QYOA 2XZQL 3X11A 4FXKA 3PXJA 5DD3H 5IR1B 4P9MH 2NXZC 3JV0A 2WANA 1PSKL 1FG2A 1FYTA 3INUL 5KSBA 5IB4A 3T0AA 2FECL 4CU8A 1E28A 4P2RB 4Z7VF 3HB3D 5T33H 5E8PA 5J6HB 1CDYA 4TTGA 3GSUA 3RVVD 1MNUL 4XAWH 5DK2A 4KZEL 1KBGH 3TFKD 2X4OB 3BXNA 2X44D 5MHSD 1CLOH 3BHBB 4DOHE 2ICWA 1ZVSA 2DAVA 3UYOD 3V4VL 3VH8A 5HI4C 4GW5B 2PTTA 4K8RD 4ONFL 4DCQA 3OXRA 2NTSP 4OT1H 3L3DA 5DF0A 1HILB 4PGEB 4UV7H 3PQYB 2DQTH 2G5RA 3P40A 4QRRA 1CGYA 1DQQB 2X1QA 5ESVB 5D1XA 4NKMB 4WI4A 2CIIB 5I1LB 3QI9A 1PAMA 5F7FA 4FQHA 3TN0D 3VFSA 1P7QB 1KELH 4H5SA 4OM1H 5DJXB 1E27A 5HJ3A 3SDCB 2J88L 1CE1L 2DQFA 5CSGA 5TJWK 5L8KB 3C8DA 2FX7H 1QFPA 3T2NL 1PSKH 1VENA 2JKXA 1EHAA 2HN7B 1SMAA 1WZMA 4O2CB 3WXWL 4HUXB 1IJ9A 5FUZH 1KYOJ 1R0AL 4N5EC 4XVSL 4OKVA 1GL4B 5HYJE 3D5OF 1MFEL 2VDPL 1I1FA 3S5LB 4QRRD 4N90E 3RTQB 3KPLB 4DKFL 2OL3L 5ANMB 4KUCD 3MLXL 3QZWG 1K4CA 1V05A 1YN7A 1MLCA 3DI2B 3IXTA 3HAEA 4M1GH 3VRIA 5AZEL 5AG8A 1OARL 5F7UA 4XPGH 2EE9A 4XVUD 2A77L 2R2CA 1FN4B 4Q74A 3LS5H 2X5PA 4OF6A 4Z95L 2R0KH 3J7HA 3S4SA 3VFTA 1BD2A 4Y16C 3ROOA 4CMHC 1NAMH 3MLVH 4KQ4H 3NFPB 4X4XB 5F1SA 1N0XH 3ET9F 1BOYA 1LQSR 2NY0D 3V6FB 2CKBB 1RFDH 1KEML 3IDMB 3OKLA 3P0VL 4PJ8B 4QRPB 3BKJH 2C3XA 4FFYL 3TBWB 1PG7L 1ZHKA 2ZCHL 3F12A 3MJ8B 3RWIB 4WI6A 2K7QA 2VLJE 4OCSH 1C5DA 3SCMB 3VWJC 3VFVA 5E2JA 3QXAB 1F3JB 5HXMA 1KJ3L 3QCVH 1TZGH 3BH8A 1ZHLB 4FNLL 2ZCLH 3CXDL 3BDYH 4ZSOE 2H3NA 1FO0L 2G60L 4O58L 5CJBA 2CUIA 4Y4KC 1A9BB 2VKXA 2GITA 4OCXL 4XVJH 5D72H 3ZDYE 2IH3A 3ZKXB 1L6ZA 1M05B 1A2YB 1YYLH 3NN8B 3QUKB 1FV1A 5CWSB 1G9EA 5D96B 1D5BB 4HZAA 5I66B 2CMRL 3BGAA 1A21A 5E94A 2EEAA 2ILLA 2OX5A 2AKRB 3T0DA 3U4BH 2QSCH 1AGDA 5GGQL 1FIGL 4NN5B 4EI6B 2IF7A 3G6DL 4FXKB 1ACYH 4PLNC 4QCIA 2J5LB 4OLVH 1RUAH 4J8RB 1XR8B 1M4KA 1X5LA 5SWZB 4PJ5D 1S78D 5TFSH 3AM8A 1OAXH 1BFOB 1EMTL 1YMMA 3OAUL 4G9FB 3VFGH 5CSZA 3DX7A 1MAKA 4DZ8B 1LEIA 5J89A 4OCSL 1QFOA 3FB8A 3SGEH 4PJDA 4ZXBA 1M1SA 2X6MA 3HC3H 4JFXB 3QIWD 5I74B 4DKEL 4BK4A 5B8CB 1OPGL 4RGOH 2EIDA 3MFFB 3KLSA 3MRMA 4XB7A 4Y8AA 1BVLB 1FJ1A 1IC4L 1Y0LB 3BPLB 3PGCB 4X0KA 1JMZA 4D8PB 3EYQC 4MX7B 3WN5C 1XMWA 4DKAA 4XP6L 2GT9A 3U82B 2H32A 3S4SG 3HR6A 2A6IA 3CXHK 4H8WH 1G7PA 1OCWL 3MTRA 4LP5A 2NW2A 5D1XB 3RQ3A 4JG1H 4RIRA 2IALA 5GSRB 3WS3B 3JWOL 1YEEL 4MB3A 1YY9D 4O51A 3RPKA 3BZDA 3BMWA 3GSXA 1NFDA 4WO4B 3BKCH 3HAEG 3VJ6B 1FC2D 4OF8A 3HUJE 1VEPA 4C56D 4LVOC 5E8OB 2PO6A 5H37G 1FNEA 1G7IB 5J12C 1ERNA 1EUUA 4DN4H 1XGQB 1QD0A 4MAYA 2PYFA 2MOVA 4XCEB 4K71B 5FCUL 3TNNA 5CSBA 4WFGD 2JIXA 4M93B 3ZSTA 3HHRB 3KYNB 5BMFH 3D3VA 3D18A 2HT3C 3MV8E 2WUCH 1MIMH 4HWUA 4UIKL 1FGNH 2P24A 2D0FA 3MV9E 4F37K 5JHDE 2FR4A 2VRAA 3PIQB 1XGUA 4JHAH 4NHUB 5DEFA 1F4HA 3H9SB 1CE6B 2XKNB 1IEHA 1H0DA 3UTSA 3W5NA 1JTPA 2X7LA 5F3BB 1L9NA 2FATL 4HJJH 4X6FB 1FFQA 2Q6WB 4B50A 3UZQA 3MO1A 5HHPB 4H26B 4P0DA 1ORQA 3DGGA 1EJOL 1A14L 5TE7H 2Y5TB 2GSGB 1IQWH 1BLNA 4EI5A 2CUHA 1MCPL 4N1HB 3WFDH 5DMYA 5ABDE 1QA9B 1PX3A 2CRIA 1KBGL 2DM3A 2W0FB 3MRPA 1UKTA 4NGHH 5BQ7B 4FQXD 4GKZA 5IWLA 3GJEB 5FOBB 3KJ6L 1WFUA 1AO7B 3BWUC 2MFNA 4KJYA 2XXCB 4QKXB 3BQUC 1TVDA 1SBBA 4JFZH 4JZOB 5JMOC 4ODUB 4WGVB 3L5XL 3NCFB 4WTWA 3E6HA 4S1DD 1IKFH 2HVJB 4JGJA 4FHBD 1ZAGA 4JANA 3MXWH 4WI5A 4B0MM 2JJSA 1E0OB 1FE8L 3BGMB 4MS8D 2Z8RA 4UOW0 2Y6SC 2P7TB 5DTFB 4UB0H 3X3GH 1FV1B 3RVXD 4TQEL 5ADPH 3L3OA 1PQZA 4GSDH 1XF1A 1WWAX 3KLAA 1U8NA 2AKRA 2GTWA 4WY7H 1AXSA 4FTVE 5KJRL 1F97A 2I27N 1NCBH 3MR9B 2DQCL 1CFQA 3LEXA 4HX1B 3EDEA 4ZAKD 3NCCB 2CK0L 4ESKA 4KK5C 2R9HC 5FYKD 2BC4A 1S3KH 1Z3GH 1LO2H 4OZFG 4U6VH 1YMMB 1YNLL 2Y5EA 4NZUH 4TYUA 2V9QA 3IFNH 5L6YH 1AQDA 2R0ZH 4GSDL 4EQ2A 4HK3J 1N5YL 2F5AH 3QUXC 4U1SB 4Z7VA 2AEWA 5CZVL 1VFUA 5J9PA 2D03H 2C7UA 1I3RB 1OT2A 3F7YA 2E9JA 3UBXG 4DK3A 1SBSL 2IFGA 3VE0B 4OCNC 1QRKA 1DLHA 1D5IH 1M7DB 1U3HA 1KTDB 4HIXL 2OK0L 4FQXC 1A9EA 5EU4B 4U6VL 4ZFFA 3MUJA 5ELIA 4MX7A 3BDXA 3WIHL 5D2NC 4S1QL 5SWQB 1RZJC 3RX8A 1NUDA 3HRZA 4L1HA 1FAIH 1JGLH 2IALB 5GSRA 2HT4C 5I1EL 5L0QB 3V0WL 3GB7A 4EIZC 1EMTH 4TVSa 3A67L 5IIEB 4IMKA 4ZYKA 1MCHA 4CKVX 3C8KB 1IGIH 3MMEA 4L8CB 1T66D 1FNAA 2EH8H 2E6QA 3SE8H 4NKOB 3QUZB 5D8JH 4BQCA 3VXUB 4WNQB 5MEQA 1HHGB 4AIZB 2V2XB 1IC7H 4K8RL 1N0XL 5MI0C 5T1DH 3W9DB 4JCLA 3MRGA 5EO9B 4BH7B 3F6IA 1UEMA 2GSIB 4F7MB 3Q48A 3WIHA 3WL9B 3ULVE 4JO2H 4DAGH 1KCUL 2AP2A 2CDGB 1D5XA 3V4UH 4Z7OF 1EDQA 3MRRA 4J3OC 2NNAA 5DSCA 3L6FA 4O2EB 5C08D 3QCUH 4ZUVA 2CSPA 3ARGA 1NGWB 2YD2A 1AC6A 1W72L 3JWOH 4MD4B 5E2VL 4U7MA 1H3XA 3VWJB 5GGSY 5DUBB 2W65A 5C6TH 1S9VB 3IFLH 1BHGA 3DRQA 4YUEL 1T7YA 3QWRA 3QYCA 4XVSH 1CCZA 3HE7C 3Q3GB 4XC3L 2BVEA 3EBAA 2XNAA 3CCHA 6CGTA 1AHWB 3D69B 5HHME 2EDLA 4FG6D 3GSVB 2J6EH 3RVWC 3W39A 2IGFH 2RFXB 1YEGH 4QOKE 5LKNA 1AGFB 1KB5L 2P49B 3DIFA 1EFXB 2EDWA 4KJPD 5T3ZE 5JPNB 1TJIL 1QEWA 3V7AG 3TJHD 5EN2B 5BZDA 4HKZB 3TV3H 3OZ9L 1UQSA 4XCNB 2ED8A 1P7QA 1MCJA 4H5SB 4RGMB 4G6ML 1KG0B 4F7TB 1P5VA 4Z0XA 1LWRA 1T0NB 2K9UA 3E3QC 1VFOA 1RY7B 2DQDH 4BFGA 5DDHA 1JPGA 4XP6H 3RWHA 1KCUH 1U3JA 1HHJA 4HDIB 1I1RA 4ODUA 5DRXA 4PD4J 4ZFOL 5BVJB 1PY4A 1JIBA 4F7PB 5JPMB 5E5MB 4AYFA 5C3LD 5KVEH 3VXOA 4JO3L 2XV6B 4WI2A 4EDXB 4Z8FL 2ADJB 4Z7WB 4TULL 3O3EA 3E3QE 3M17B 2HLFC 3U2SB 2DWDA 3TBYB 3NZ8A 4NC1E 2P5WA 4G9DA 1LD9B 3LZFH 5FYJD 5SX4H 3I6LE 1D9KA 2KZ1B 3MR9A 1UKQA 1D6VL 3IS1X 1KN2L 4XT1C 4RA0C 2DQJH 3I6GB 1QFUL 2N4IA 4JGMA 3DURA 4P4KD 4FQQB 3K4AA 4HUKB 3REWB 4XH2B 5IVZB 4BQ6A 2DWEA 3BFOA 4JRXE 4WTZG 1JWMA 3JUZA 3GMOB 3EZ8A 1GC1C 1JNNL 3BPCB 4U1SA 1INEL 2GJJA 3V79C 2DLGA 3P73B 2EC8A 1IE5A 1SYSB 2E8ZA 3ARZA 1SEBB 4ZPVB 3U0TB 1H3PH 3Q1SL 3SKOB 3VGEA 1DLHB 1ZT7A 3TJHC 1NEZA 3DUSA 1BAFL 4I1NB 3BP4B 4Y5YB 5GGSA 1CL7I 4XCCL 2UWEA 3OAUH 4A2LA 1OAXL 1MWAB 3BUTA 3JV6B 4YK4C 1BX2B 4K71C 1LK2A 3UP1A 1U8JA 2A1WL 2WBWB 4DFHA 5KS9B 4LNRB 3KLDA 5I74C 3LN5B 1RJYA 3IDJB 1CG9A 3QNZA 2CLZA 2FX9L 1WWBX 4AM0B 5I71B 1J1PH 4Q9QL 1WSST 4MA3A 1Y6KR 1FG9C 5DMGD 4P2YA 4LCCA 5I18L 4JFHD 5DURB 1FIEA 5HDOA 3GMPA 3HE6A 4HLZG 2WBKA 4CW1A 4PJBB 4Y2DB 5MENE 4JY5H 4KDTA 4RSVA 3H7LA 1QLEH 4NCC1 1T7XA 4YBLC 1IKFL 4ZO6A 1GSMA 2GSIA 1A7NL 4LEXL 4UUJB 4OIBA 4LDEB 4JFEE 4ZTPL 3TZVB 2ZCLL 3CXDH 1KFAH 1UXWA 4OB5L 1G9ML 1QUNA 4XWGL 4QOKA 1CL7L 2ZSWB 3AXLA 4UNTA 5DJDB 1MCKA 2PYED 3OPZL 5LGHL 4ZXBB 4ZFGL 1SHMA 3FFDA 4U7KA 5F7HA 1OSZA 1HXYA 1BMGA 1TZGL 2B7DT 4OSUH 1T1ZA 1BECA 1S7UB 1TVBA 3V8OA 3HG1B 5IFHH 3DV6A 4LARL 2XXMB 1OTUD 2OTUA 3BEWB 3OR7A 4UNUA 1F90H 4NHCL 2NY4C 2JJUA 4Z77B 1RSFA 5JIHA 2LVEA 4MQTB 4OLWL 3GGWA 4RWYH 1QVOB 4U3HA 4UILL 4QOKD 4CDGC 3LS4H 1BOGA 2F53B 1AY1L 2YZ1A 1T5WA 1FSKB 2P46B 4QTHB 4JFFB 1KGCE 4ENED 1G7QB 2I5YL 4YXHL 4HF5L 4H20L 2VISA 4OQTH 3HFML 4KWUA 2UZIH 1CGUA 2X41A 4X6EA 4Z0BL 4GBXD 4QXTB 1RIUH 5JIKA 5I1IL 5IW6B 5EOQH 4WW1A 3V5DA 1BP3B 4ODVL 1RK0A 4M9PA 4ZFGH 1YECH 3EO0B 3IVKB 2OI9B 4HCRA 4FRWA 3S35X 4XWOD 5ICZB 3VRJB 5IVXF 1Z3GL 3G5ZB 5JORB 1KEGH 4F7CA 1DVFA 3P4OB 3GFUA 2PW2B 1CGXA 3CSYA 2XN9B 5EC2B 4JO2L 5M95B 1YNTB 2ICCA 4OZHB 3RL1B 4X6FA 3NIGF 4HGMA 3O2VL 5T3ZH 3BE1H 4PG2C 3FQUA 2X4RA 4M7ZB 3RNKB 4L9DA 4AH2B 4M6OL 4N8CH 3O6KH 1E6OL 1OW0C 5FA3B 5FHBL 4LPXA 1JHTA 4X6BA 4K7FB 2D7PA 5MEND 1V3MA 1GAFL 2EO1A 2PXYD 4Y4FA 5CZKA 1CIUA 5CGYD 3HLAA 2DQUH 1C16B 1F00I 4OQTA 3PHOB 3MGOA 2EXYC 4X80L 3DUHA 1B2WH 2Y1VA 4UQ2B 1KLUA 5A40E 5F3HA 2VQTA 5E6IA 4GRWB 5ID1A 1CQYA 4KJWD 2H32H 4IMLA 2IGFL 5TE6H 2OI9C 5KSVA 5FYKL 4P4KB 2BK8A 2W9EL 2ORBL 3DROA 4GAGL 4HEME 3OKOA 5I8KL 4Y16D 2DM7A 1ZA3A 4M93C 1OGAD 4NQDD 4HXAH 1SBSH 2VIRA 1IZJA 2MCPL 5CBEB 4JQXA 3RWJA 4AK1A 3RPIB 3C9NA 3DX6A 5ICXA 3ARGC 1SJEA 4XHQA 4BQ8A 5MENA 2M2DA 4M03A 4PJIB 2HFGH 1XCTA 3LD8B 4KHXL 4G6FD 2BNRB 4RISH 4YHOL 1G9MC 2BSTB 4JCMA 2GTWB 4H25A 1QRNB 3N9GH 2IC2A 3M1BB 1S7QB 5IB1A 5HD8C 1YEFL 2L7JA 5MP6L 1VADB 2E7HA 2EDJA 3PWLA 2LQRA 3CFEA 4JJ5A 3WFBH 3EJZD 2FEDD 1KCVL 3PWPA 4JDVB 3RGVD 4EKXA 5D2LE 2GJ6A 3MRIB 4EUPH 4NQDA 2X89D 4Z7UB 1MNUH 4NQCE 4QF1A 1JNHB 4LVEA 3D2UD 4R2GD 3GI9H 4JZNA 3M8OL 1UADC 5TGBB 3FL7A 2FYYA 3SKNB 3GIVB 1J0ZA 1WQVT 2JCCB 4HZLA 4YDKL 3OGCB 1S7UA 5KW9L 2UV3A 3IJSB 4MLIA 2HA1A 2X1XR 5CGYC 4XB8A 3DV6B 4OLUL 3HI5H 4FFWD 3WO3B 3S37H 5EC1B 5EDXA 3NIFF 1C7SA 4P5TD 1P4IL 2C5DC 2WQ8A 5F6IC 5EO1B 3RGVA 5T3XD 4OZFA 3T4YB 2R2EA 5BV7H 4BKLA 5DHVA 3TWCH 1HYSC 4JHBA 4ZXBD 3GSWA 5BV7B 5FO8A 1LK3L 3LKPB 1S7WB 1U8HA 3O2DL 1WAAE 4MJIB 4L3EB 5D93C 3V52H 4RAVB 3HFMH 2ATKA 3O4OB 1JPST 2X40A 4UDUB 5GPRA 5IB2A 2UYLB 5LCVH 1JPSH 3ROOB 1FNGA 5FYLL 3NFPA 1WITA 5DYOA 4ODHL 5CP3H 5IVOA 4UTBL 3ULVC 4UIMA 1KIQA 1INQA 4XNQA 4YBQD 1A7OL 1OT1A 1C5BL 2WZPD 4Y5YC 5LG1A 2VWEC 3BZFA 4HIIB 5DZOA 4FQLH 2Y07H 3KR3L 3ZT6A 5DUBA 1QSFD 1LO3L 3MCLH 1C5DB 4TUJB 4OF7A 3WE6B 4NQSA 4JHZA 3HPLA 3UPCA 4M00A 3BH8B 4GBXB 4LVNB 4WUUA 3W81A 5CJ5A 3TA3B 2A74A 5FA4B 4AQ1B 3L5WB 2QADD 3WCYA 1NEUA 3MLZL 5K59E 1F3DH 2BSRA 4M6MH 3UJJH 5EUOB 4U1HB 2ZCKH 4YX2L 2GITB 1MLCB 1CI5A 4K7FA 4G43B 1ZHNB 1FL5B 3NPSC 4M6NL 2BRQA 1I7TA 1IAIM 4YHLH 5IB5B 3OZ9H 5CIPA 1X5FA 5FYJU 2B1AH 4G8EB 4JM4H 5I1AB 1KLUB 2YD8A 3NIGE 3H3KA 4DN3H 4DAGL 5DC9B 3SY0A 5EBMA 5E4IA 4OCYH 4PJ7B 4JY5L 3C60C 2XZQH 5D7IF 1JFQL 1RIHL 4WENB 2Q8AL 5ETUA 3ZE0F 3F5WA 3RWJB 3HI1B 4WW2C 1DUYB 3KYOB 1WBXB 4RBPK 4UU9A 3HPJA 1QFWM 2NX5D 3O4LD 3KPMB 3U2SA 4P2OD 3SDDC 3TJEH 1MLBA 5HHQB 5BZWA 5C09B 3JTSB 4RQQB 3TT1H 5K9QI 3NA9L 3MC0A 3TO4C 3O81A 4O4YL 1W72B 4MCZB 1HHKA 2BOBB 2DICA 5AZEH 2OTPA 3TIDB 4F37F 2W9EH 4LMQE 3PWPB 4JDVA 4PJFF 2HT2D 1UM5L 4K2UH 3MNZA 4QHLB 3GMOA 1N5AB 1UVQB 2OSLB 3H9SE 2XQBH 3SBWC 3R06A 4E9LA 2MPAH 1TPXB 4JM2C 5C0ND 4RFNB 1KF9B 3DBXB 4LLVB 4LVOB 2ZPKH 5J06A 3KPTA 3W5MA 1PG7W 4NT6B 3FQNA 1SEQH 4PRDA 3BPNB 4LPYA 1MAJA 4Y19B 4I48B 4PP2B 5HY9A 1IL1B 1K5NA 4XTRD 5GGVH 3FZUD 5GIRB 3MACL 4HLZH 1ZA6A 4C56B 2FL5B 2C26A 4NPYB 2ATPB 1CFVH 1FCCA 1DR9A 2HTKD 1U8QB 2JJWA 3PV6A 2XKUA 1NCDL 2MTPA 3VFNB 1T04B 6FABH 2D4FA 4PG9A 3U36B 4K9EH 5CS7A 4Y2DC 4M43L 3IAPA 1U3HD 1YY8B 1C7TA 1K8DB 3O8XA 1FDLH 3WIIL 4YQXL 4NC0B 1TQCB 3WLWD 5FUCC 3IFOA 5L0QC 3OR6B 2VDQH 1F13A 2W92A 4MHHI 4U1NB 1FZOB 3UTOA 5DQJA 1ZKAA 1P7HL 5IF0B 1INQB 3U4BL 4BELD 1A4KA 4XVJL 1UC6A 5IMLB 5TDNB 4UBDC 2X1WL 4ZO8A 1RUMH 4ONOA 1GGIH 1MF2H 2AERT 2Z31C 5TDPB 5I1IH 2XIDA 1Q9OA 4WU5B 1IEBA 3QDGE 2VXQH 5I1DB 5I2IA 2R2BB 3CFDA 4OSUL 4PGZA 3O8XD 4TUOA 4AEFA 1W0WA 5CJQL 1JYVA 4PUBH 1HZHH 4QT5B 2IFFL 3HMXL 4HW6A 4RFEB 2J8HA 3I02A 1BD2D 1S7RA 4GRLA 3O9WB 5GS1C 2BSRB 5E9DB 1MJUL 4UT7H 3ZKNC 5FK9B 2BHZA 5D7IB 1A7BA 2EYSA 4OM1L 2F8OA 1N26A 3FKUS 4KHXH 2Z35A 1WEJH 2X4QB 3FOLB 1XZ0B 4NRZB 3FRUB 5GZNC 2R0KL 1JWUA 1G7QA 1S9YB 3MYJB 1UWGH 2HTKC 3EOYG 4AG4H 1HI6A 1F4WH 2P5WE 4EI5B 4OFYD 5ITFA 2Q8BL 1LDPH 2V2WA 4N9OB 5F7KC 2ADFL 3FT2B 1J18A 3E0GA 2YD9A 3RHWK 2R1XA 4G6JH 1XIWD 3L3GB 2P5EB 2HFTA 5DEGB 1T1WA 3S36L 1B2WL 2APFA 2IBBA 1K4DA 2ZUQB 4CL7A 1II4E 5JORA 4HK0B 1JK8B 4HIEB 1A3RL 4PJFE 1MUJB 5KSAB 1AR2A 1T2QL 1WZ1L 4HC1H 5EZOL 7FABL 5AD0B 3WKMH 3P4LA 1UYWH 2YD7A 1MQKH 4JFQA 3RL1A 5DS8A 3ULUD 4YHPB 2XN9E 1V8HA 2V17L 3W0WE 3TCLB 1YUHB 4JZJB 5T3ZL 1BBDL 5ALBL 5C0CD 5DI8B 2VZ1A 1AD0A 3BYYA 2P7TA 4WV1B 4MA1C 1ZLVH 5L88H 1M7XA 4PJ5A 3LHPH 1H5BB 2DL9A 3PNWB 2ADGB 3UYRH 4YDVB 1WZLA 4NN6C 5J8OA 3NPZB 4LLVA 1DUZA 5AZ2H 3RU8L 5JO5A 5DD1H 1AGEB 1MPAL 2YN3A 4LPTA 2Y06L 3BDYL 1AH1A 3WSQL 4WWKC 3IRPX 4G6JL 3O4LE 2ZUUA 3AU1A 3DUUB 1CDHA 2ZOKA 1AGBA 3S88L 4L3CB 2OMNA 3N50A 2E7LA 5DHYB 3QEHB 2MJWA 5C0CA 1IILE 3PWJA 4MDIA 1QQDB 3ULSB 3KXFB 4LPWA 5IQ7H 1R5WB 4DUVA 4YHIB 4LQFL 2A6KA 1MJJA 1KIPA 1SJXA 2CKBH 3INUH 5DJAA 1S5IL 4BYHA 5HGBA 2PETA 3S34L 4G8GE 1ZT1B 3BRFA 1DTUA 3S88H 2HJKB 3DVGA 5GSVB 1CGVA 1XAUA 4XCYB 4UNVA 2YRPA 5J4MA 3WJJC 2NW3A 2NY1B 1HEZA 4WVRA 4E41B 2ITDB 3D3VE 1FNSL 5C2BH 2NZIA 4MAYD 2EYTB 4IOIB 1GZQA 1KNOB 4XXDA 5C0JB 4ONFH 2CO6B 2OR9H 1MAML 4PV9B 2QHRH 4QTIL 3VH8G 3SJVA 3ULUC 4PJIF 5FGCB 2BVQA 1B9ZA 1ORSB 2FJHA 2JIXD 4PRPD 3SGDH 3WFDL 1MCWW 2P48B 3MRCB 4JFED 4WNQA 2BY0A 3C6SA 2BVOB 4M3KB 2B1HH 4L4TB 4LRIC 5HYSG 4DTGL 1Q9WB 2KQMA 4M4PA 4CN4A 4Q9RH 5I1DA 2JCCA 4W6YB 1P1ZB 3QEQB 4HULB 1OP9A 3TO4D 4XPHH 4JO4H 4J3XA 3UTSD 4OD2A 4F2MB 3FONB 1HHJB 5DRXB 1D5IL 4QHMB 4U05A 2BVPA 4FZ8H 3RAJH 2X4NB 4MB4A 3CVHH 3ARGB 3VFRA 5D7IA 4WW2A 3QXVA 1KXQE 2HMIC 3SDXA 5ECJE 2F19L 1N5YH 4X5WB 3ARFD 4AZ8A 2PYEA 3D1MC 1YEHL 4UT6L 2RHEA 4EUPG 4K3DH 3BKYH 1MCNA 1PG7H 5D96C 4M5YL 4NP4H 3T1FB 4N9GA 3VXNB 4ZTOL 3C2AH 4UV4H 1QR4A 5E00B 4XBPA 5DMIH 2QR0A 1I1YA 2C3WA 2V2TA 2E7CA 5C0BB 2P8PB 1QEWB 1T7ZA 3T8XB 1PEZA 5E24E 4GXUM 32C2A 3H9ZA 3CLFH 5DJ0A 2E7BA 4R6UA 5CMAB 1JGLL 5L6YL 1UB6A 4GS7C 5BW7C 4S1RH 3TPKA 4IRZH 3ARFA 3OBAA 3H3BC 3G6JA 4IS6A 4APQD 3GRWH 4LSSH 2H26B 5JA8B 3HI5L 3AY4A 5FGBC 1YEDB 2YUZA 2DQHL 4ZUUB 2DQTL 2IMNA 5DS8B 3VXTA 3BP4A 5GJTH 4GAJH 4R90L 1PGRB 2DYPD 3P9MB 1XH3B 2VB5A 3BD3A 4H8WC 5CP7B 4MQXD 3BRGC 4GBXA 4WUUB 4YK4B 1UH2A 1WGOA 4P3DA 3VI3F 3WLBA 4L8BB 4RGNC 1BFTA 3TBYA 3MJ7B 2HRLA 5K9KB 4Q0XH 4YBHA 1JNLH 5H94A 4EBQH 1T89A 2VXVL 1GOGA 5IMMB 4HKBA 1TNNA 5E99L 4R4FL 1AD9A 2R56H 1U58B 2CPCA 2I26N 3MLTA 2CK0H 1A8JH 2VAJA 2AJVL 1DVFD 4LPUA 4NC2B 3AAZA 1FNHA 4JFZL 1EXUA 4QHKI 5FKAB 5I1AA 2R8SH 2E3VA 1QBBA 5AEAA 2ICEB 4K94H 4J3WA 3B3IA 1LO3H 2AK4E 4OUUA 5EU3B 3RVUC 2B4CC 3W11D 3V7AE 3CX5K 5C0IA 2P1YA 3HAEH 3KXFA 2OQJB 4S1RL 4GUPB 2R56L 4Z78B 3JTTB 4ZFOA 3QNYB 2IQ9L 4OF0A 1BM3L 4PJAA 1IEAA 4P2RA 3WHXB 3UO1L 4GW4A 1F58L 3KPMA 1IQWL 1HYRC 2A6JA 3KYAA 2PXYA 4KUZH 2Y7QA 4Y4FD 5EPMA 2DI9A 5H35A 4GG6B 3GSUB 4XC1H 5JW4M 5F8RC 2Z93A 1NUFA 2JTDA 2IBGA 3IDIA 4S1QH 1W8OA 2CRMA 1RJLA 3LQZB 1Q1JL 3LV3A 3CIQA 1UZ6F 3U6RA 1IBGH 4Z5RA 3FQWB 2ICWB 4HFWA 4LQ1A 2FEDC 3WSQH 4M61B 4N0CC 1MEXL 4QHUB 4WFED 5SWSE 5C6WH 2CH8A 5TQ2H 2YN5A 8FABA 3TIDA 2NCMA 3B2UC 3HR5B 5I8CA 4NZTL 5E03A 1L9MA 4ZDHB 2VO5A 3IU4H 4U6YB 3GJFA 2VDLL 1NAMB 3HUJB 1ORSA 3R8BB 3KXFD 5CFHA 1CXIA 4ELKB 4N5ED 4CW1B 4ONHA 2FLBT 3GK8L 4N0YL 3HTLX 3EDDA 3P9WB 5F7DB 1XGRB 4H1LH 3I3EA 1P4IH 4M5ZH 4FQPA 5MEPB 4R3SA 3GSRB 4PB9H 3I3BA 3BP5B 2QQKH 4GQ9L 4M8QB 5TQ0H 2EKSB 4P3CL 4CMMA 4PJEE 4UQ3A 2A83B 1QSFE 5F7NC 2DBJA 3VMPA 4NFCA 3I50L 5HD8D 2Z31B 4QOKB 4WJ5B 1JHKH 2X1OA 4WW2B 5DJ6B 4KUZL 1FNLA 2VDKH 4XNUL 5DK2B 4PGJA 5HI3C 1X3DA 4QTIH 4LHQB 3QPQD 4ISVA 2EYRB 4NIKB 2APBA 2E8YA 3FFCE 4DZBA 4PJXB 1P7QD 2F5AL 1N6UA 4QRQA 3U7WH 4MWFA 4UTBH 5HGAB 1JZ3A 3FT3A 2DTSA 1NCAL 3VXQB 3CSYB 5JTWA 3BDBA 4WFHE 4M7LL 1TFHA 4U3XA 4Z7UF 1KCRH 2GK0A 2BP3A 2FRGP 5EU6E 1QBML 3HC4L 2YHGA 2IQAB 1T4KA 5J1AA 2Z91B 5F1NB 1J05A 3DRTB 3SOBL 1NDGB 1F4XH 3HNTL 3K8LA 3OQ3B 3B2UD 2Z8WC 4MXQD 5KVDH 5LGJB 1MJ7H 4BUHA 2I60H 1S9KC 4UB0L 3HNVL 4UT6H 4KJPC 1Q9OB 3VXUE 3L3HB 1T80A 2NMSA 4ZQKA 5DC0A 3X13B 1D5MA 3RDTA 5GRWA 5JW4Q 4XP5H 1OCWH 5D2LB 3ZDZF 3BT2H 5IJVB 4U1LB 5F7MC 3RUGE 4HH9B 3OF6A 5AZ2L 4OLYL 2OTWB 1S7RB 4AEHL 5BS0A 3DV4B 4L29B 2Y4SA 5E1AB 2HKHL 1U8OB 4YWGH 5HHXH 3LN4A 2DB8A 4HUUB 1AD9B 1XZ0A 3GUTA 5CUSH 5IEKA 3UTQB 4RMVA 1DL7L 2PCPB 3TNMA 5ALBH 1YEKH 4ZPTB 2BNRA 2X4RB 3OB8A 4OLZL 3RNKA 3CSPA 3ULUL 2EH7H 2NYYD 3KS0J 1I7RA 2FJGA 3WNMA 3LEVH 4WO4C 5C0DA 4YE4H 3AFLA 5B3NA 4M02A 3TBWA 2VZTA 3DO3A 3ECBB 5L8LB 1H3PL 4UINH 3C60B 4G6FB 4NO5B 1QFWL 5IHLB 4LSQH 3UTTD 1INDH 1PG7X 4PJXF 2F54A 3OX8B 1TNMA 4PJDB 2ZUXA 3RWGB 3WFCL 3KHQA 4LRIA 2A1WH 5CKGA 1JYNA 1OSPL 1HNFA 5HI4D 2MHAB 1NGYA 2O61A 1TCRA 1ZK9A 3MNWA 3BO8B 5SV3A 4EDWH 1UYWL 1KT2A 4Z7QF 5DVLA 3P77B 1FGVH 2AJSL 4MQ7B 3HR5A 4O58H 4ZDHA 4TSCH 2HKHH 3F58L 3IU3A 3WD5H 4OTXL 4I3RH 4GKNA 3HUJA 3LKOB 4U6HB 4PJ5B 3QH3A 5K33A 4ONHB 2A38A 3S36H 1MFCL 4RGNE 1RZJL 1Z5LB 4M7KH 3ARBB 1AGDB 3O3BB 2C4FU 4D9LH 2F54D 3CVHL 4D0CB 2R23B 3BP5A 1PVHA 1DUZB 4U6TA 5T1LB 1BQHG 1GHFL 2DLEA 5DMGC 1M6OA 5A2JH 3TPUB 3PL6C 2FIKA 1RZIB 1TITA 3SQOL 4YGVA 2R29H 3DVFA 2HFEB 3AU1B 2VQ1A 1XGQA 3C8HA 3MOAL 4DZ8A 3AC0A 4DGYL 2DLHA 5CJXC 5DHYA 5L7XL 4NJAH 3FB6B 2DQJL 2IJ0C 4OV5A 3U46A 4R7DA 2ARJQ 3KPOA 3BI9X 5D9SA 2F74B 2V5SA 5D1XD 5BW7A 3QI9D 3BIBX 5H2BA 3VMNA 3G9VA 1ZEAL 4BQ9A 3QDAA 5DJYA 5B39B 4ZODA 1TQBC 1FFPA 3AY4C 4PS4H 3I75B 1A7NH 4DGYH 3NFNA 4DUWA 3G5XA 3KHOA 4LCCC 5EBLA 2XZZA 1WIOA 1VPOL 4CN1A 2DL2A 3ES6B 4EN3A 3N85H 4I8DA 3KJ4C 1R3KA 4N68A 3ALXA 2I9LB 1T3FB 2AJ3A 4YIQA 1KJ2H 4QRPE 2BVQB 5E08H 5SWSD 1EGJA 4C83A 4WHYH 3LB6C 5GRXG 5JXEA 2NY4D 1FL5A 1RHHB 2P8LA 3C2SA 4G42A 1P4LA 4NKDA 5IB5A 1D5ZA 4QXGL 4W4NA 4P3WA 4GAFB 5ID0A 3MOAH 1P1ZA 3UEZA 3KPRB 1J0YA 3P11L 4LVHB 1IAOA 3QUXB 4FQ2L 4L5FL 1NMAL 5EBWA 1D6VH 3GHEH 3KYMB 4H0IA 3O3AA 2FECI 4QHMA 1KB9K 1RULL 4XNQB 1A6TB 2YWZA 4JKMA 5LQBL 3MRLA 2HWZH 4LLAA 3BZFB 3IJHB 4HIIA 5D7LE 4MVBD 3UC0L 1QSEA 1VGEL 3BGMA 2AK4D 3SO5A 1N3NA 2VDOH 3T09A 1NCWH 2Z4QB 1ZHBA 2BJML 1UGNA 4OZFH 3TNMB 3OSKA 5FKPB 4U6XB 5C0EA 5FO9B 3TBVA 3WEXA 4G6AD 4E42B 4G7VL 2YA2A 3I50H 5F96H 4BFBD 1ZGLM 3N1GC 4ZUWA 2AQ3A 3UTZA 4YPGB 3QIUC 5E6ID 4Y4KA 3RJQB 1QSEE 3W0WB 2F5BH 32C2B 5KSBE 1ZV5A 3HC3L 4OFVA 4CNIB 4JE4B 3L3DB 1OGAA 4OF3A 1HN1A 5M94B 4K7PX 3SGKA 4U1IB 5DMKB 4NQCB 1D6EB 2D7TH 4G7YL 5FM8A 3DO7B 1UXSA 4PRHB 1AQKL 3VG0L 3MLYH 3PQYE 1IC1A 3V0AC 1SVZA 5C6PB 4PJGA 5FYKU 2H26A 4PJEF 1XR9A 1NC4B 1KPVB 3DXAA 3DBXA 3S35H 5HJ3B 3GJFH 4JFOB 5HHOD 2IANE 5FF6A 1A7OH 4OIIH 3KDMB 4X7EC 1BFVL 3D0VB 3LPFA 1DQLL 4UU9B 3MOQA 4MNGB 2NY3B 1XIWA 4OCRL 4W81A 4KJWC 5C3TA 5I76B 3ARTA 1YMMD 4PRIE 1T1XA 1QYGL 1F6LL 1OGTA 3KPLA 2OR8A 3D2UA 5HYFA 3C8KA 3PUCA 4X6CE 4K3EL 4PV8A 1FVDB 3MJ9A 3MLZH 2VDRH 2FJFB 3PDGA 3QIWA 4XP9L 5DZNA 5BJTB 4FTVB 2W0LA 1XF5B 3VFNA 4MVBC 1JBJA 3OJMB 2PUQT 5JLZA 2GJ6E 3KNBB 4QNPE 4JO3H 4Z8FH 5DGRA 4V1DA 4JFPB 5HGGS 5HI5D 4PGEA 1AQDB 3WNLA 2CDEB 3EFFA 4JRXA 3RP1A 2MSPA 1GRWA 3KJ6H 2WBJD 2VXSH 2Z8SA 3JV4A 2DI7A 3CVIL 1A1NA 2G9HA 3VE0A 5DLML 2F58L 1CFTB 4HS3A 4M4RA 4OZ4B 2QQLL 5LJYH 5ESAB 5B39A 4ZUSA 1WISA 5KSAC 1FP5A 1KB5A 5FDWA 5JHDA 1EJOH 1Q0XL 4ZG1A 1C5CH 2PO6D 3ABZA 3B5HA 4I2XA 4KKBD 4PJAF 1FZJB 4HUMB 4U1GB 1J0IA 3IKKA 1QRNE 3MCLL 1A7QH 2YC1A 1GVIA 4OKVB 3MRHA 5H37H 3CH1A 1AHWC 4BFEA 1U95A 5IGXH 1U8KA 4ZNEA 3ZE1F 1OD9A 3K8MA 4JFFE 3TM6A 1EHLL 1WAAF 3R1GH 1VGKB 3D3VD 3A67H 5I9QB 2Q86B 2A6DA 2VL5B 3ROLB 2V2XA 4XNMB 1WCQA 3EIFA 4YAQB 1T5XA 3WYRA 1CWVA 1JZ6A 3S37L 4XC1L 1JJUA 3CFJB 1XGYH 5DJ8A 1CIDA 4O9HL 1JRHI 3FFCD 4ZXBC 5TQ0L 3UMTA 1YDPA 5EOTB 5TPWH 5TF1H 1FZOA 3GO1H 1QFWI 1R3JA 1HCFX 1CE1H 1FRGL 2G2RB 3UPAA 2V2WB 4NP4L 1OF2A 1RIVL 3H9HA 5HGDA 1N6QL 2NQCA 1S8DA 2HWZL 3IFPA 1FAKT 2YD4A 3O45A 3SJVD 3MRFA 2HKFL 1YEEH 2C1PB 3V6OE 2X9WA 3BGFC 4ZS6D 4KJQD 3L3KA 3KPPB 2UWEE 4KKAD 5IJKA 5DD6A 1F3JA 5HBBA 2HTLD 4MD5B 3RKDC 3MV7D 1FRGH 4IHOB 5D2LF 5T1KB 4UZGA 3TO4A 4M3JA 3D9AL 2X42A 3TT1L 3T3PE 3QSKB 5DUPL 3DLQR 3PP4H 5EZJB 5I75C 4XCNA 3H0TA 4I13B 2KUTA 15C8H 4X6DF 5KOVC 3VFPA 4MSWB 3OKMA 4FXGB 5DRNB 5CEZL 1PLGH 3VXSA 4YDVA 1QO3B 2NX5A 3WUWG 4NUGL 3VFWB 3HZKB 3LRGA 5BVJA 5BV7L 2JE8A 2FWOA 1D5MB 2NLJB 1GGBL 3NA4A 3KPSA 4NZRH 3UJIL 1JPFA 2BHUA 5LWYL 4HUWB 5GGUB 2VLJD 3EYSH 1GOHA 2VR5A 3JXAA 1DQDH 1TDQA 1HSAB 4P99A 3SDAD 1S7VA 4G8IB 3LSOB 1JK8A 2NY5L 3CFBB 4YHKL 3QUMH 4LGPB 1UKSA 5DO2D 1E6JH 3I6KA 4MCYB 4OCXH 1K3IA 4FQXB 2XFXA 4HKJB 4PJBA 4Y2DA 3EDKA 2EDNA 3QPXL 1AO7D 3REWA 2DM4A 2HT3D 2VITA 5HHOB 5FO7B 2H41A 2H32B 2FJGB 2YKLL 3L5XH 5KVFH 3U9UB 4NOBA 3BRDA 2AK1H 1JN6B 2ADGA 4FFVC 2BNRE 3SEPA 3ECBA 1ACYL 3BKCL 1MSPA 1OTUC 3LQAL 2CLVA 3NIDE 4G5ZL 5BVPH 1B4RA 2ICES 4I0PC 4JRYD 4JHWH 3QEGL 3JV6A 3NVQA 1SY6L 1X5IA 4JG0L 2ZUWA 3OKKB 4L4TA 2EDHA 5CD3B 4Y2DD 4GS7B 1BIIA 4F8TA 2YXMA 3JWNC 5BS0E 5DVOA 1F42A 4J1UA 2YC1B 1FPTL 1ZWIA 3VFUB 4NBXB 3TC9A 3D85B 1HQRB 1LE5B 3AREB 3QUYD 3MUZ1 3O6MH 1WZ1H 4HIJA 1G6VK 1NGXA 1U8KB 3G08A 5EZOH 4HUVA 1NQBA 4JY4B 5I17B 4M6AA 1AQKH 3VG0H 5IMOB 4GW1A 1QSVA 4JANB 2XQYK 4WFFE 2Q86A 2A6DB 3REVB 1XCQA 2GUOA 4X5WA 1S7SB 4H8WL 5EU5B 3UTSB 2Q76A 5KS9E 4R0LB 5FUZL 4NO3A 2DF3A 1YJDL 4KVCH 1ED3A 4MMZC 3C5JA 4LARH 1HWHB 2DQEH 1UXWB 1LP9A 2VERN 4HS6A 1J0HA 5D5MA 1NDMB 2AW2A 2CIKA 4N90D 3WS6A 3IJYA 3QZWA 5DK3A 4NOFA 1P4BL 4YFLF 4ETQA 1U3HC 5C0GB 4JY6B 3MZTA 3MRFB 5I1JL 1DBBL 4P48A 1CBVH 4WI3A 5CEYB 1PEWA 5C8JA 1MCDA 5D2NA 5EWIH 3ZE1E 3CAFA 4KK5D 2W07A 4JM2F 2YBRB 4KY1L 1B0GA 4KI5C 3DX8A 2NY2B 5C0RH 4G80A 5DVMA 2IFFH 4R4ND 3MCKB 3NFNB 1HCVA 3RVTD 4NDMA 2HP4A 4U0QB 3VRLE 1F8TH 2R2HA 4LKCA 1KTDA 5B21A 3MV8A 1DQML 2I60L 4JHAL 4JRYE 3N1MC 3WXVH 4OFYA 1P9MC 4HWEL 4QRUB 2HFFB 4QY8A 3WN5B 1NBZB 4LPCA 1XIWC 3FB7A 2YA0A 4X4ME 3E6FA 2OXGA 5GGVL 5IQ7L 2F53E 4NRYA 5JIIA 1G7JA 3DYOA 1LO0L 1U2HA 1GJIA 1AY1H 3GMQB 3UYRL 5GZOC 2W60B 4OIAA 1CDGA 1I1YB 4K3HA 1JGEB 4NKIH 4HX1A 5CJQH 1C1EL 4V1DE 1D9KD 3B83A 3GMRB 1WIUA 3PGFH 4RAUA 3X3FH 4K9EL 1ITCA 4P4KA 3H7BB 1HSAA 3CLEL 1DL7H 4X8XA 1LMKA 5D7JC 3MV7E 3BVNA 2LABA 4NN7B 3HE7A 3MRLB 2MWCA 2AJZB 1M71A 1EFXD 4CVXB 5C7XL 1ZS8A 3MA9L 1FNFA 3SE3A 3QG6B 2EIZB 3RFZC 3QFJB 5MENB 3X3FL 2ITCA 4U1GC 3BN9D 2MQCA 1A0QH 3LMJH 3MBXH 4KRPC 4OZGB 4H25B 4NWUH 5FHAH 2VLRB 2ADFH 5TFSL 3IXAA 5CP3A 5IT2L 2IAMD 1MRFL 4CUCA 35C8L 5I1HH 2KZWA 1O5DT 1EV2E 1AHWA 4XCCH 1V7MH 1ZTXL 5BS0D 1KULA 3MJ9L 4A6YB 4MNQB 4LL9A 1YEGL 3HE7D 5LXGH 2ZG3A 4LHUA 2FX8L 3EOAB 3TVMB 2WM0A 2J8UA 4ELKA 1CD1B 5DGQA 3H42H 1D7FA 5TGBA 1UCTA 1UQSB 4KC3B 3SKNA 2MQ0A 2QKIB 1X5HA 3FHQA 4P23C 1R5VB 4WU7A 3OGCA 4OD3L 2BNRD 4GH7B 4YO0B 1AJ7L 1CT8A 4NQEA 4TTDC 4BFIB 5IVNA 3O6FB 5GS2D 4LK4A 3ILPB 4MXWH 3RPIA 5B39G 3QCUL 4M7JH 1RZ7H 1PFCA 1ETZB 5EPMB 1A7PL 3WUWB 5F88A 5C70A 2W65B 2NR6C 3NCYS 4R2GB 1H5BC 5IFAH 2R69H 4NQXB 4ZSOB 4U4BA 4R0LA 4FTVA 5J56B 4FQIH 4TNWF 1LD9A 5IP4A 1WC7B 3MGAA 2EH8L 4JFPA 1T20B 3WNNA 5E99H 4KAQL 4Z7UA 3QUYB 2VE6A 3VI4E 2UYLA 2DKMA 2ZOLB 3EFFB 3MX0A 2APWA 2O5ZL 2BOCA 1RJZB 2ZZUT 1J10A 1P4BH 4HFUL 3EAKA 1U8IA 2FYYB 4QLRA 3GIVA 1N8ZA 5ESQA 4MS8C 4EUPB 5J1TC 3V4UL 1IGTB 1L4IA 5I73C 5B8CC 4KMTL 1GGBH 5DDHB 1KB5B 2XACC 4PJ7F 1P84J 2A9ML 2YPLD 1CK0L 5GRVL 1I8IB 4Z95H 3WE6A 1EVTC 2JCCF 1BF2A 3ULVF 2DS4A 4POUB 2XQBL 3BIKB 4HMEA 5D8JL 4D9RE 3RZCB 3KYKH 1I7UB 4KGLA 4OBRA 5CLTA 1HOCB 3DV4A 4L8DB 3P0VH 3FO9B 5AYUL 1MY5A 1JNLL 1G7MA 5D7LB 4U1MB 1HH6A 1DN0A 1XF3A 3WDIA 1XEDA 2D3VA 3SJVE 4UOJA 4QO1A 4WFGE 1B0RA 4IEFB 4P2RE 1MHCB 5CILL 2YPLA 2CD0A 1KJMB 4KTDH 1YPZF 1G9NH 4NN7C 4XBGB 3NCYP 1I4FB 1NCDH 2CIIA 1NGZA 2VABA 5B38B 1RIVH 5KSBB 1I7ZB 4JHWL 2GHWB 4GAYB 3U4EA 5SWSA 3EYFA 3SKOA 3BISA 4NNXA 5DWUL 4IDJH 1OGAE 5GJSH 5CEXA 4JFFD 3L3IB 3O2WH 1LK2B 4LOUC 3ZTJH 2GY5A 3CUPA 3GSNL 2NZ9D 2HFGL 3C6LD 4URTB 1Y6NR 3ZKMD 5L8JB 4MNHB 3BAEL 3R4DA 1LP9E 5INDB 1OAYH 3QUMB 4U0RC 2K3TA 4EBQL 5F6HJ 5E95B 3M8OH 1F45A 3B9DA 1AFVL 1F4YH 4OFPA 4Z77A 2HG5A 5ACMA 5D70L 1UVQA 1QSED 2AK4A 4KDWA 1UM4L 2ERJB 4PGDA 5GISL 2R1WA 2GAZA 3O4LB 5KVEL 4MA1B 4K94L 2QKIA 4KI5D 4PGBB 5GHWL 1E27B 4BQBA 4QTHA 1TPXC 5KANI 5DRWA 1TJGH 1KCLA 5IHUL 2Q20A 3BSZH 1N64L 5D1ZB 2R4RL 4R4BA 2G5BB 2BMKA 3KYOA 3C2AL 3MA7B 5ISZE 1SY6A 4NYLA 2YUXA 3HC0B 1ZA6B 3PWPD 3QHTC 1I9RH 2K7PA 1WV7T 3IDNB 2X89A 2ESVB 2VZSA 1TJGL 4LLWA 1DFBH 1ZANH 3QISA 3NCMA 2V5RA 1HHKB 2VXSL 4PJEB 2XG4A 1ONQA 3BOVA 1X5KA 4L3EE 1LK3H 4ELME 1UCBH 1EEYA 2PW2A 3FO1B 5FGCE 1ZLVK 2OZ4L 4G9FD 1BPVA 2D31A 1ZLSL 4M8VA 5HHOE 1QOKA 1P9MA 4NUJA 2QSQA 4EN3B 3U83A 4FZEL 1H8NA 2VLKB 3EDJA 5EZIL 1W2KT 2QHRL 1RZGB 3X14A 4Z7WF 5EORH 4OB5H 3KG5A 3KGRA 3MGTA 4C4KT 2JJTC 5A16B 5CD3A 4XMPL 3DJ9A 3SCMA 3FT4B 4YFDB 5IW3A 2H8PB 4MA7L 1IGML 4OV5B 2JB5L 2B39A 3TH4T 5J11C 3MNVB 3K8KA 5I1CL 4AMKH 2UWEF 2DN7A 1A9BA 3ZL4H 5EUOE 3FB8B 2WBJA 3DX9A 3QEQE 1J8HB 1HDMA 1T04A 3HAEB 4OM0H 1FZKB 4PG9B 3SKUD 4TSCL 2WIMA 2YOCA 1YMHB 3QQ9D 2AJSH 2GEEA 2R4SH 4DQOH 4HH8A 4P5KA 4YXLH 3MXVL 5CWSA 3OR6A 4PJIA 1JWUB 1F2QA 1S9YA 4D8PA 4P9HC 2A9NH 2LU4A 3MJ6A 3QPQC 4OV6F 4PGCA 4QXWA 2D4DA 4ONGH 3IKCB 1YEFH 5MP6H 2NY6B 4J8RA 1Q1JH 1XR8A 1N7MH 3OF6D 4GXVH 4XI5D 3T0EA 2EZ0C 5A2LH 5CEYA 1FE8H 2EDYA 2FHFA 5IWLC 1V7NL 2Z92A 3VFVB 3OHXA 4R9HA 1JUFB 5L9DH 3EJZC 2B2XH 3AMKA 4C59B 1X6LA 2YBRA 5FAAA 5HDQL 4Q97A 4HWNA 5EBWB 4NRXA 4JPIA 3BX7C 2NPLX 1NC2B 5JNYA 1BJ1H 4GMSH 4PTUA 4XCEA 2DQCH 4UAOC 4R2GC 3FFCA 4PD4K 1A6AB 3PWUA 1A7RH 1QPPA 2VAAB 4A2MA 2DM2A 4NQCD 4YWGL 2HFFA 2B1HL 4G7YH 2PKDA 4NJAL 3ULUF 3LKRA 4JN2B 2CXGA 4GQPH 4OQ1A 3T0ED 4D9QD 1YYLL 5I9QC 1AGCA 4BSJA 3DWTA 5I66A 2OJZL 4YHNA 1FBIH 2GAZB 3O4LA 1RZ7L 5HGHB 3UTTA 3S35L 3H9SA 4EZMA 3B43A 1OP3H 5FHBH 3TGXA 4XP5L 4NN6B 3DXAE 3MCG1 3MV7A 2PW1B 4POZC 2QTEA 5E8OA 2XWBB 3L5HA 4Y19E 1KXTB 3KNBA 5F9DC 4R4BB 1DBJH 1KJ3H 2R0LL 5JZ7D 4L1DA 4QXGH 4V1DB 2XWJB 1CDBA 3JZ7A 3ARVA 1CFVL 3DX7B 1TJHL 2DLFL 4GKSA 5IB2B 5L88L 1MF2L 5A2IH 3OKDA 5HHMD 3RDTC 5L7XH 1T1YB 4PJCE 4YFEA 3OWEA 5DYOB 5FYJH 4AEIH 3QWOA 4DKEH 4OFKA 3R8QA 4YGAB 5HYQB 1QPXA 1Y18A 2VDQL 1K8IB 4ODTH 5IW1A 4UI2A 1I8KA 3JSSA 1EUTA 3PWNB 3DOSA 1P7KB 5EG6C 1BZ9A 3V6BR 4OFIA 2VLJA 1LO5A 5E7FA 3MO1B 4X80H 1X4ZA 4YXKH 5J13C 2EE3A 1FVCA 3L9RA 1K2DA 1RULH 2NXZD 3T2QA 2AI0L 3TA3A 1ZT4A 5DD0L 4N1CA 2ADIA 3CZFB 4N0RA 1T21A 3HS0B 3QIWB 4MYWB 4S1DC 3PHQB 3NPSB 1CLZH 3S3PA 3UC0H 1F4WL 3WHE1 3MYZA 5EO0B 4P2CG 5A16A 5EU7C 1E4KA 4W70A 3THML 3O8XC 3QO0A 5DQDH 5C09D 3UTPD 3VDAA 1AO7A 4KTDL 5CCKL 5D72L 2VH5L 4JR9H 4AQOA 1CT8B 4NQEB 5JDSB 1LILA 5TDOA 3HI6H 4X9BA 2YEZB 1B88A 3U7YH 3VXRE 2GI7A 4KI5F 5I1GL 1HKFA 4YHIA 1RVFH 1MRCL 3ULVH 4UAOB 1UENA 3ARWA 1WBYA 4LGSB 4EN3D 2AJUH 4HT1H 4KXZI 1KB5H 2NTFA 3U30B 3X12A 1OM3L 3ZHLA 2JJVA 1IAKA 5T1MA 2VDKL 4XNUH 4J23A 3UAJC 4A6YL 4M1CD 2GFBB 2FX8H 4OGYL 5F8QC 2GCYB 5JXED 1IC5H 2W0KA 1D3CA 2Q8BH 3TN0C 3KYKL 4FQCL 2EXYD 2R29L 4L4TD 4U1JB 1KPUA 4IOIA 1KGCD 1VPOH 4XBPB 1EVUA 5C0JA 1HQ4B 4D3CH 4LCYA 4UT9H 4WI7A 4GKOA 1W72H 5TE4L 4DFIA 5BV7C 3QUYA 4GRLC 3B9KC 4ZS7H 5IK3B 5C08B 3MRNA 3VXMA 4BSWA 4M6NH 4U1HA 3MRCA 5IHZB 5EZJA 4KKLD 1ZSDA 1XFPA 1TQCC 2V7NA 4D0DB 2NXYC 3WUZA 4OTXH 4Z7VB 5T1KD 1DQQA 2Z9TA 4F8QA 3V95A 3ZMRA 3P4MB 3D39A 4M48L 5TQ2L 3ZDXE 4NO2A 4CJ0A 2ZPKL 1PKOA 4B7LA 3MRGB 3SKMA 5DK0A 2IPKB 4QYOB 2QEJA 3HZMA 4CVZB 1G7HB 4NQTA 3FQXB 4OLXL 4QRSA 5KJRH 1RHFA 2OLDA 3O9WC 3SDXB 3BT2L 2CLRA 4TN9A 1OM3H 3TLRA 3VXMD 5C6TL 5E2VH 4P46B 4HQQH 3WLBB 5E8PB 5SX5H 1PQZB 1TIUA 1NFIB 4YH6A 2NY0C 3GB7B 1S9VA 5HVGB 2IADB 1IKNC 1RURH 3RTQA 3GI8H 5T1KA 1X5JA 3V5KB 3BHBA 3CFCL 3MLTB 3O11B 4XNZC 2XNAB 3PL6B 2YD5A 4RRPA 1ZVSB 1P84K 1NFDE 3L7EB 4X7SL 4XVTL 4F3FA 3EGSB 3MACH 2FB4H 4IOSD 4ZUTB 2N1KA 3OXRB 5D7JD 3GSNB 4LSRL 2R0LH 2IPUG 2VITB 5HHOA 4MA8L 1ZGLA 2EO9A 1T2QH 4F7MA 2OP4L 4U1KA 4HKZA 3G6JB 5E9DD 5C09E 3UTPE 4B5EA 2VXVH 4OCYL 3HZKA 4LNVA 5ITBH 2I07A 4D9RD 1UG9A 3UBXI 3RL2B 5I1EH 3IAGC 4ZFFB 1KCRL 1CD9B 1JHLL 2X70A 2Y9RT 1RUQH 4GLRI 5JW4R 1DBMH 2RAMA 4LCWE 3RHWF 4LLDB 3G04A 5I2IB 4V1DD 3QUMA 1R3LB 3LQAH 4KV5E 3QNXB 2E7LC 4P4RA 1ADQA 1NGXB 2AXHA 3QDJA 4HIJB 4IJ3C 5AUMB 4PJXE 5HHMB 3U79A 4JRXD 2P5ED 1U8QA 5L9DL 4LHUG 5DR5L 5IMOA 4XPAL 3UPRA 2HJLA 2X2YA 5IBLC 5MEQB 4LCUA 3U36A 4FS0A 2FLRT 5F7DA 1DP0A 4N0UE 1K8DA 5CILH 2EE6A 1DLFL 5EU3A 3ZLQC 2ARJA 3V4PL 4QNPF 5JHDD 3ZE2E 1D5BA 1R5IB 2BSSA 3T3ME 4DTGH 1JPGB 4Q6IC 3KLHD 4M1DL 4U1NA 3BZ4A 1DEEB 5DSCB 1GYAA 2IAMC 3VD5A 1JYXA 2VSDA 1GCFA 1CDIA 3FOMA 4ODBD 3QDJD 2AV1B 4IRJD 5D6DA 3L3GA 2P5EA 5C92A 1IARB 3A0OA 2F54E 3RWIA 1BQLL 3OAYK 5CSZB 5BVPL 1F6FB 3BPOC 5A2KH 4Q6YA 1S3KL 1X4YA 4DZBB 4WWID 5T5NF 2DJUA 1Z0NA 4ZNEE 4X6CB 4O2FB 4F15B 4IJ3B 3NFSL 1RUPH 5FCSH 3W39B 4NQED 3FQRB 3TO2A 3N9GL 1ADQH 1CLOL 5IK3A 1CDJA 3QNZB 4DQOL 2B8OT 3QIWC 3CK0H 4XPAH 1K9TA 4GXUN 1Q9KB 1BQLH 4L4VB 1SJHA 3FQTA 4D0DA 3QUKA 2VLKA 1R6VA 3FRUA 2VLRE 3QUML 3RI5K 2JF1A 3HG1D 4YHZH 3MLSL 1ZLUK 2AAVA 3GO1L 4M1DH 5A3ID 4P9ML 1A7QL 1U8MB 3LY6A 3QIBD 5FV2A 4ZOAA 1FYTB 5JW4N 4LAQH 3GM8A 2AGJH 4HMDA 1WIPA 2W9LA 2KPNA 1J5OH 1UCBL 5J1SC 3S8WA 4JDTH 3ZYOA 3H7BA 1OAUL 4G8FB 2DI8A 3NH7H 4WO4D 5FM5O 3WFBL 3O6LL 5JHLL 3HN3A 1CZ8H 3PDOB 5DJCB 3FN0L 1QR1B 1CN4A 4PJGF 4ZD3L 4DJMA 1IBGL 4JFEB 5IMKB 1MCEA 4JLRA 3B8YA 2BRRL 5E9DE 4KK6D 3VH8B 4APQA 5FGBA 3VGHA 5C0NC 2R2HB 4Z6AT 1JVKA 4DCQB 4MDJB 3QEQD 5EU6A 5D5MF 5I16B 1MI5A 2VLRA 1Q38A 1I9JH 3HE6C 2AJVH 3KPSD 2ENSA 3QIBA 2FGWL 4LSSL 1JWMB 2VC2H 5DD5L 3CJJA 4OLUH 1HWGB 5C0FB 5EZIH 5HHPA 3QULA 3E8UL 1H15A 4ZFZB 4NJ9L 4Y4FC 2J5LC 4HQQL 3V6ZB 3SDAA 1I9EA 1Q0YL 3AXLB 5DJDA 5GGTA 2Z92B 3CC5B 2XN9D 1RUAL 1QKZL 4XP4H 3CFKB 2ZWLT 4PREA 1OSZB 4U3CA 1J12A 4C4KO 4GOSA 5E2TL 2EDEA 4MZ2A 3QEQA 4YHMH 5EU6D 1AKJD 5GS3A 5I73B 2ZKHL 3DPBA 2FEEL 1MI5D 2W9DH 4NZDA 4ZOCA 3MUGA 3BZEA 5I19L 4HG4K 4CVXA 5DUMH 1Q94A 4Y8DC 1SMOA 3U0PB 3UCRA 2X4NA 1E6JL 1RUKH 3UPRB 1CFNA 3Q5YA 3CLEH 5HDBF 5IBTH 3OAZH 4ORGA 2PXYC 2EDKA 3QEUA 2XA3A 4Y89A 1FN4A 3L1OL 5DEFB 3O6FD 4JRYA 5T5FH 5BOPA 2R23A 1NFDF 1BZ7B 2F15A 3QI9C 3VRLF 1S7TB 5C0DB 3ELAT 2HMID 4TRPL 4PRIB 5D6CB 1RZIA 4PJBF 4X5XB 1EZVY 1LO0H 4JDZA 4WDIB 4HF5H 4HKXA 5EBGA 3C6LC 1OWRM 1WAAA 4PV9A 3CMGA 3BKJL 1WVZA 1YEHH 4GT7A 2J88H 3CNKA 2VDNL 2XI9A 3V5HB 1QSZA 3QQNA 3V5DB 3IVKA 3OMZA 1NGPL 1U8IB 4GKZB 2V17H 3BKMH 2MNUA 4QHNA 3S97C 1Q9WA 4QRRE 2VLKE 3QDGB 4PR5B 2O61B 2B0SH 5I1GH 1L7IH 5C0AE 3O6FA 5FYKH 5J11B 2AJXH 4AEEA 2ORBH 4FP8L 4FNLH 1OLLA 1S7XA 5IW1B 5IEHB 2APVA 3V4PH 1NL0H 2DLIA 4C54A 5CJOL 3GIZH 3MREA 4E5XB 5F21B 3S98A 1A6WH 3RGVC 1GGIL 3P2TA 3RIFK 3ARBC 4YDIL 4PG2A 1IVLA 3SPVA 1V7ML 1ZTXH 5K9KA 1OL0A 5E94B 2D9QB 1IKNA 3KLAB 4D3CL 3BP7A 3KWWB 1MHEA 2P8LB 4YGVB 2J2ZA 4G42B 1IZKA 4YXHH 3MGOB 4L8CA 4LLQA 5IQ9A 3LMJL 1EAPA 5K9JH 3T8XA 3DSFL 4YR6A 4Z0BH 3QA3B 4WWKB 5IROA 2OJEB 3MV8D 4JPVL 4OUUB 4PB0L 4OD3H 3W9DA 4BH7A 4M1GL 2FZ3A 3HZVB 5F72S 3B2VH 4K2UL 1EK3A 4F15C 1MRDL 2QQQA 4JLRB 3LS4L 5SWSB 2VR9A 5EC2A 3RY6A 5JW5B 1IC4H 5TH2A 3QO1A 3ES6A 5JOPE 2H6PA 1OAQH 1BQUA 4OQTL 3GHEL 3QIBB 1BVKA 5CGMA 1RURL 3IT8D 4YIQB 1MWAH 2FX7L 3G6AB 1GGCH 1TLKA 5DHVB 4BZ1L 1HKLH 2HVKA 1XF4B 1OSPH 2GJ6B 5JA9A 2C3VA 4HWZB 3NZHL 3C08H 3D39B 1B3JA 2OP4H 4NHCH 4XC3H 3DNKA 3KYMA 4WIQA 5CEZE 3P30L 6FABL 4FQCH 3WJLC 2FIRT 4LAJH 5CUSL 2ZNXA 5DRWB 4KZDL 1U42A 1WT5A 1DE4B 2IAMA 3Q5TA 5FOJA 2NNAB 3L3JA 1YN6B 2VQUA 2YMXH 2JLLA 4MNGA 1HIMH 3SGJA 1SM3L 3BEVB 3FMGH 2LAAA 3F7VA 5GRUL 4KK9C 3O3EB 4ZUWB 1MRFH 3STZB 1DDHA 4TUJA 3DMMA 1JFQH 4NC1C 1PW3A 3NZ8B 2H9GB 2Y36L 2C3GA 4JO1H 1FL6B 1I8LA 5DJZA 4PJFA 4UTAH 5HI3D 1SYVA 3SQBA 3JVGC 1ZLWH 5B3JF 3W2DH 3NCJH 4NQCA 2W0FA 3MRPB 5EN2A 5KTEL 1CD0A 1GIGH 3JV4B 1CICB 3N06B 1XR9B 4NN5C 2NR6D 1MJ7L 2X05A 4W6WB 4M8QA 5IBUB 3ZYZA 4JM2B 4N8VG 5KS9F 4D94A 1YEIH 2V5TA 3DMMD 3NACL 3RWHB 2G5BA 2VDMH 5J6GA 4PJ8C 1QBMH 4FTVD 2KL6A 3O2DH 2VWEE 5DXWA 1PYWB 4MXQC 5C07D 2PF6A 4P46C 1UM6H 2DQEL 3T65B 3T4YA 4FA8A 1KJVB 1KLGA 1MFBH 5FEBA 3MNVA 4MJ2A 1RJYB 3LN5A 4XBEL 3M45A 1HHHA 1U36A 2WBJB 3BJLA 3DX9B 5EUOA 1JYWA 4Y1AE 4CVWA 4XNXL 1NAKH 1YQVH 4YBLB 4MJIA 4MA3B 2PNDA 3GSQA 3NA9H 3BXNB 1GC1L 4RQQA 3TVMC 1NCBL 1ZE3C 4XNMA 2DTMH 2XRAH 2AJXL 4P49A 4U7SA 1KTLB 1CVRA 4NUJB 3D0LA 2D7NA 2EH7L 1XF2A 1UACH 2VKWA 5BRZB 3IGAA 4OZGF 3MBXL 4ZO9A 5AAWA 1KELL 4N8PA 1EERB 3SE9H 3VMOA 1H9VA 4KHTH 3VD7A 2AV1A 25C8H 4M62L 3ETBF 2WV3A 3HI1A 4TSAH 3OXSB 3C60A 2X4TB 5EULV 3PJSA 1RI8A 1MVFA 1ZT7B 4CAGA 2ZSWA 1A1MA 1CU4H 1NLDH 4MJID 5JW5A 2JJSC 2OXHA 5D1QC 1ZVHA 1R0AH 3HPLB 4KFZC 1HXMA 1DANT 4IHOA 5C09A 1Q0YH 1U8JB 3TZVD 4LEXH 1LEKA 1CVSC 1MCOH 3SDDA 1TCRB 4PTUB 3G6AA 5J13B 5JOPD 4NGHL 4GW5A 3V0WH 1CR9H 4G43A 4H0HB 5GS0D 3STLA 2IANA 3UJJL 4HUUA 3MSPA 3RWCB 4KUCF 4RZCB 3PV6B 4KK8D 1AFVH 4OCMC 2GY7B 2DD8L 4G8EA 3HE6B 1N4XL 2PTTB 1N5AA 1KENH 3MV11 4GAJL 3ARDB 2ERJC 1LO2L 3SKJH 3BWAA 5DO2C 2MPAL 1DEDA 1OP5K 4JFFA 3MV7B 3PXHA 3O9WD 2J7LA 2SEBB 5CZVH 5HDBE 5ETUB 4Y19A 3T0EB 5AWNH 3TWCL 2FO1A 2DRUA 3CDGA 3FAWA 1KPRB 3MRJA 5J57B 4Y4KD 1INDL 5K9OB 3WLWC 1T0MB 5EA0H 1CD8A 4QGYA 4D9LL 5LVEA 4MD4A 4LLYB 2EDRA 5EUKB 2F53D 4X99B 2IAND 1X5AA 5HHNB 3RZCC 1QR1A 1IGIL 5TDPA 2H2SD 2AJYL 2R9HD 5KSBF 5JUEH 1INEH 12E8H 3Q3GA 1LGVA 4ODSH 1G6RL 3BAEH 4XNYL 2Y72A 3D39D 1T1ZB 1OAYL 2NY0B 2V9RA 2XFXB 3PWUB 1FCGA 4HKJA 1JI2A 1I9IH 1IC7L 4IMKC 4K8RH 4XMPH 3DXAD 4GRLB 4XXCA 3P9LA 2OYPA 1K4CB 1YN7B 2VTFA 4JEGB 3SE8L 3FO0L 5LAXB 5GGRA 4YDIH 3QH3B 4P2QA 3BN3B 4OZHF 1IRAY 5JQ6H 1CICA 4D0BB 1BREA 2FGZA 1OAUH 3IDGB 5GS0C 1K85A 5CEZH 2GIYA 9CGTA 5ANME 3RTQD 2XWBA 2FCBA 4GXVL 4NM4H 5LBSH 4MQSB 5KAQF 3V6FA 4WU5A 4Q7DA 2VDML 2DQHH 3Q6GL 3QXAA 3H6JA 1T66C 3VW3H 4WW1B 3PP3K 4QT5A 3K3QA 1CZ8L 1W0VA 2IH1A 5ANMA 2Z8VC 5C0CE 4ZD3H 2B1AL 1A22B 5I17A 5HYQA 5KTEH 3QIUA 4G9DB 2P5WB 1CICD 3U0WH 1M05A 1A7RL 2EKJA 3QEUB 5KSAA 5ERWA 3R1GL 5D7IE 5HYEA 4LIQE 5IFJA 3PF2A 5F44A 3WJJA 4R7NB 3S96A 1PBYA 4WHTB 2MKLC 5DD5H 2QQLH 4Y16B 4CMHB 1KPUB 2DWEB 4LFHG 4X5XA 3SCMD 2NY1C 4EI6A 1HI6B 4HS6B 3MLUH 2GTZB 2CKBA 3CDYA 4LRNL 2AJ3B 4X4YB 3MRNB 3WS3A 1TXKA 1LNUB 4O00A 1ROWA 4P5TC 3P0YL 4DW2L 1UJ3C 4H88L 3MODL 4KKAC 4HFUH 1NKOA 4QHNB 3PHOA 3QIUD 4XMKL 5EIVA 4R97C 2HTLC 4KK9D 3RKDD 1UWEL 2AQ1A 5AYUH 4U1IA 3RNQB 1YNKH 2ESVE 1R3HB 4MXVF 4YHYC 1RD6A 4EVNA 1MELA 1S5HB 1EHLH 4B41A 1IAOB 1Q9LB 3S5LG 1GC1H 2OR9L 3AREC 4KMTH 4NCDA 3SE4C 5DMIL 1S9WB 3G6DH 4NDMB 1RZ8B 1UA6L 2JB6B 2WWMC 4DVBA 3IJSA 1L0YA 2CKBL 4KROD 3UBXB 3DVNB 4PRAB 5F71A 3CLFL 4WCYL 5DI8A 4NUGH 4KRPB 1A3LL 2P8MA 3BH9A 3GMPB 4BZ2L 1NPUA 4JFDB 3KPRE 5HYJD 4ETYA 3H3PH 4WTZA 3MV01 1QYGH 3MZGB 4NM8H 4I4WA 3EFDH 2Y36H 1ED3B 4OZFB 1CE6A 2XKNA 4I9WD 3UDWC 3DTXB 4HAGA 5FO8B 1G7PB 2Q6WA 2GJZB 4P5TB 2BDNL 1G84A 3T4AA 4IIQA 3VFMB 2UY6A 2RB8A 1KPRA 1TZHA 4K23H 3F8UB 4RAVA 3VJ6A 2ZOKB 5DQ9B 4YHYB 2JJTA 1BGXH 5INCA 4HGKC 4O5LL 3SCMC 4KVNH 2CXKA 2VDRL 3PWJB 4U1KB 4YC2B 4PY8I 2AI0H 3C6SB