4KMLB

Probing the n-terminal beta-sheet conversion in the crystal structure of the full-length human prion protein bound to a nanobody
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
AVQLQESGGGLVQPGGSLRLSCAASGRTFSSYNMGWFRQAPGKGREFVASITSSGDKSDYTDSVKGRFTISRDNAKNTMYLQMNNLKPEDTATYYCARGLGIYIIRARGGYDHWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major prion protein
publication title Probing the N-Terminal beta-Sheet Conversion in the Crystal Structure of the Human Prion Protein Bound to a Nanobody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/protein binding
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kmlB00
3C8HA 4M7JL 5EOQL 4G3YH 4M7ZC 2ADGA 2ADJB 3ELAT 1RVFL 4EOWH 3EDFA 3ARWA 4M7LH 1MRCL 3BDBA 3VJ6B 3E3QE 5GGQL 4UB0H 5EU3A 4R6UA 4PP1D 3GSUA 4ALAL 3ZSSA 4JY6B 2FD6L 1P6FA 2PF6A 3QG6B 1DR9A 1GIGL 4ZUWA 5J6GB 4Y8AA 1JRHH 5F96H 3SDDA 4LPXA 3IRZA 3WYRA 1T4KB 2CK0H 1KIQB 1VGEL 4FA8A 4ELKB 4UIMB 3HC3L 5D71H 4IRSC 4ZTOH 5FYJD 4FQXB 2F8VA 1SY6H 1WZ1H 3WS3B 3PGFH 4MQXD 1GAFL 3GJFA 5F88A 3V5KB 3HNSL 3RVXC 3S36L 5IMOB 3F58H 1OL0A 5DTFB 5E24E 3BRFA 1WICA 5EZJB 3DO7B 1CDIA 3O3DA 4FQXD 1VFAB 4NNPH 3PWJA 4ZS6D 2Y5EA 5F8QC 4UQ2A 4EDXA 4GRWE 2VITA 4R4ND 5EO9B 1NGPH 3MLTA 1FDLL 1MFEL 1T5XA 4F7TB 3CVIH 5L7XL 1F4YH 4F7MB 1P4LA 4PY8J 1MIMH 3SGKC 4PV8B 3MRBB 3MZGB 1KN2L 2ILLA 2HVKB 2Z8SA 4ZSOB 1QVOB 4Z76B 1FL5B 5C07E 3GSWB 4UILL 3I3BA 4GKOA 3MLYL 3T0EC 1VHPA 1YEIL 2HYMA 2E9IA 3UDWA 5JOFA 1FNLA 1Q94B 4WUKL 5SWSB 3HZKB 5GIRB 1AO7B 4NZTH 1KN4L 5E5RB 5EG6C 1IL1A 1EEZA 3FT2B 1V05A 1CFTB 3CSBA 1VACA 2JLLA 4GW4B 3MCKA 1BBDL 2P8PB 5ISZE 5SWSD 1WFTA 3HI5H 4O5LL 3O0RL 1K6QH 1YEFH 2R2EA 1LQSR 1AO7D 3S3JA 1BHGA 5IT2L 4XVSH 3AFLA 2C3GA 1CICA 4QXTA 3E6HB 1S9VB 1YQ2A 4JFFB 3L6FA 3VFUA 4BQCA 1KTLA 1YN7B 3ZT5A 1IC7H 3TT1H 4U7MA 4TVPD 1AR1C 1TETL 2AXFB 2H3NB 2YPKA 1EMTH 2WWKO 4D2NA 4RA0C 4HH9B 4JFFD 1QLRA 1KJ2H 4JG1L 4MAUL 4N0YL 4NCC1 1MHPH 4WY7H 2E6JA 4O00A 1G7HA 5L88L 3REWB 4N0RA 1BD2E 3U9UA 1UXSA 1EERB 3D25A 1KLGB 5DZOA 2AXJA 2AJXH 3LN5A 1N6QL 4HG4J 1UWGH 3QXDA 4Y5XB 1PLGH 3X13B 2VDLL 4K3JH 1TTUA 3RTQB 4KRNA 2EH7L 4JQXA 4Y5VB 2UYLB 5E99L 5JOPE 4PJBF 5I1KL 4OI8A 5C0AE 4P2QE 4J4PC 3TIEA 2L0DA 4PJIB 4Z7NE 3MRKA 3V9FA 2GSIB 3RTQD 4HZAA 1T2XA 3UBXG 3KR3L 1FZMA 1NC2B 4OF8A 2GUOA 1C5BH 2H2PC 4OM1H 1MIEH 2JJUA 1A6VL 7FABH 1A9EB 4GSDL 2FBOJ 5D2LF 1JN6A 4X6CB 5IFHL 1A7NL 1NGYB 2FLBT 3P40A 2G5BA 3BZEB 1NC2D 1IM3B 1XF3B 4WO4B 4EQ3A 2QL1A 4PRIB 5FA3B 3MLPA 4KMLB 3QDGA 2IQAB 4S1DD 2HAZA 3GMMB 5JO5B 2DQFB 3IDNA 2YA0A 4O2CB 2UWEF 4OFPA 1S7XA 3BPOC 3QRFM 5TDPB 3MBEC 4KUCD 5ACZA 1I8KB 4PRID 3DVIA 4L3EE 3VMOA 5E6YA 1I7TA 5C0EB 4I0PC 4U6XB 3TN0B 5BS0A 3NA4A 3HNVH 3HC0A 1JFQH 3VXOB 3QPXH 1QRNE 3P2TA 5J11C 1B6UA 4W81A 2JKXA 4ZD3H 1MJJB 4GOSA 1DBKL 4ZTPH 4RFNC 2AVGA 2UZIH 3TN0D 2LV4A 1P7KA 4PJ9A 2AEPH 2QADC 2GK0A 1Y0LA 4L5FL 3QIUC 5F70A 5E6IA 4DVRH 4LEXH 5FUCE 3UTQB 1MNUL 3VD4A 4QT5A 3BESR 3R06A 5GS0H 2G2RB 4DK6A 5MEQB 4ELMF 3H8NA 5EH1A 5JA8B 3DYMA 3L3GA 3ALWA 4Z78B 4YHIB 3VXRA 1IGYA 3OB0K 4IM8A 5I74C 4TRPL 3S4SA 3ARPA 4XBEH 2OR9H 2XI9A 2HT3D 4JZJB 1CFNB 3NN8A 1N6UA 2B1AL 1ADQH 1UXWB 3CSYB 2HKFH 4JDVB 1TIUA 2EC8A 4XNUL 1I8LA 1VB9A 4YEFA 1B0RB 1NKRA 3MRGB 1XGRA 5C6TH 1JPTL 1P7HL 4F80A 1PY9A 4NPYB 4NKIH 3RWCA 2BY3A 3DIFA 4NQDB 5KSAB 5L8JB 4XMPH 3WUWG 5LXGH 5J3HC 4N0UA 4HKZB 5C0GB 1S7RA 2CQVA 2HWZH 4TUJA 1A5FL 3AMKA 3OKKB 3O45A 3CFJA 3PUCA 5CEXB 2AXGA 4NQDD 1OHQA 3D0VA 1AJ7L 5ACMA 2FB4L 1G7JB 2WBJA 1M4KA 4OBSA 4P9MH 3CSGA 3LS5H 1LK3L 1JNHB 3GMRB 3S37H 1L9NA 5DEFA 1OTUC 3JTSA 4JFPB 3V0VA 4KRPB 4PRAB 5EUOF 4GAJH 5C6PB 1GC1H 3F7QA 3GB7B 3H9HA 4IOFD 4NO2B 4IRJB 3T4YB 4JRYA 5FECB 3DETD 4OLUL 5JW4Q 1RJZA 5GISL 4OV5B 4YDIH 5BZDB 3KLHD 3U7AA 1GHFH 5DF0A 3MGOB 3FKUS 4K9EL 1N64H 1BMGA 2JIXB 4IRJD 4P2OB 1QBAA 2NMSA 1JWSA 5J1TC 2ITCA 4P5TA 2D0GA 3GSRA 1CS6A 4YWGL 5I30L 6FABL 1NLBH 4G9FA 1FVDA 1H3WM 4LVNB 3IGAA 2YK1L 2VAAB 5J56B 3ZDZF 2JIXD 5DYOB 3CFEB 3SBWC 4P2OD 2WWMC 1MVUB 2NY1B 3MRQA 1N26A 1Z5LB 4YGVB 5FDYA 2OLDA 1Q8MA 2P42B 5DUBA 4D0BB 2V7HA 4P4RA 1YA5A 3SE3C 3WBDA 2VISA 4FP8L 5IOPA 4OZIB 4OFVA 2NY1D 2HLFD 4MJ5B 4D0CB 1QA9A 2RFXB 1FG9C 4MXQD 3NFSL 4KVNL 1AE6H 2OI9C 1DCLA 3DV4B 2YD4A 3QEUA 4WFED 4YFDB 3MRPB 2BC4A 1EEUA 2NY7H 4QOKA 3NA9L 3HI6L 3TCXA 4BYHA 5HHOE 3CH1B 4U6HB 1YMHA 4LMQI 3FB7B 1K3ZA 3CXDL 3FN3A 4HIIB 3ARFA 4WHCA 3VI3F 4ETYA 3RJDA 2I60H 1UZ8A 5FO8B 1W0YT 1I85A 2P48B 4QTHA 5IBLC 4UUJB 1GGTA 3NTCH 4OI7A 4J23A 1FPTH 3AM8A 3UBXI 1JPGB 4HJJL 4K3DL 3IAGC 1XCTA 2GQHA 2VSDA 3HZYB 1G9ML 4NM4H 4OCWL 5L2KA 2BERA 3K1DA 3QYCA 1YEKL 5TPWH 4N8CH 1BX2A 4RWYH 3CFBB 4XNZB 1H0DB 3P4OA 3WJJA 5KVGH 1FHGA 4X98B 4Z5RB 2Z9TA 3HC4L 1F4XH 4UTAH 2A6DB 3QUYA 5T3ZE 12E8H 1WSST 2A6IB 1F8TL 2DKSA 4XTRD 1I75A 4X6FA 5T1DH 3W5MA 1IGIL 4P3CL 1ORSB 4JHWL 4M4PA 3OKLA 4YE4L 3VXPB 1KULA 4XC3L 3LS4H 1P1ZA 5FA4A 2EC9U 2G5RA 1FE8L 1ZEAL 3BE1L 2CSPA 1OF2A 1I7ZB 2XN9B 1NCCH 3MXWL 2F54D 4LBEA 3TIDB 1U8PA 2QQNH 5FGCB 2R0ZH 1U8IB 2VXSH 4OAWB 2AJ3A 5GRJH 1T2QH 5CMAA 4ZOAA 4XP1L 2XN9D 3FFDB 4BKLA 3RY4A 5E1AA 2GT9B 4B50A 1OTTC 3EJJX 1ZANH 5AAWA 3IETB 4U31A 5ITFB 1HSAB 1X5HA 4MAYA 4TTGA 1CDYA 3OKMB 1QFUL 5CCKL 1KYOK 4FG6C 2D7QA 1IGJA 4LSDA 4NFDA 1KCRH 5E8OB 4KV5F 4K9EC 5C70A 1QQDB 3C6SA 2OJZH 3S35H 3VFPA 1L6XA 4PRNB 1FBIL 1YY8A 1MJ8L 4OIAA 4I3SH 2P45B 4URTB 4QHMB 1RZ7L 2F9BT 2ZSVB 2NY5H 3O2WH 3C8DA 3K8MA 1ZHLB 3VFOA 5C0FB 2J8UA 1VEPA 1DQLL 2A0LD 1IKFH 5SWQB 3QFDA 4X0KA 3OKNA 3H7BA 4Z7UA 4Z7VB 3MODL 2CLZB 2I5YL 3S88L 1VADB 3MJ6A 1LE5B 3TVMD 5DD1L 5C09B 1TCRA 4EI6A 3CGTA 4M6NH 2X4RB 3IVKB 5DJYA 2BDNL 4PJFA 2DBJA 3V5HA 1W2KT 3S5LB 3P0VL 3QIUD 4RFEA 5C09D 2SEBB 4PJ7A 4Z7QF 2O5XH 25C8L 5E70A 1NBZA 1JGUL 4RAVA 5BS0E 4N0FA 4JGJA 3ZHLA 3F7YB 1LILA 3K0WA 5HHPA 5MHSD 1P9MA 3G6JA 2YUXA 2H2SC 3CCHA 3T3ME 3MREA 3A6CL 2YA1A 4XZUB 1JGVL 1VFUA 4LAQH 2AEWA 1MCCA 2WNGA 3AREC 3UTSE 2VLJA 1UYWL 3B2UD 3FT3A 3QCTL 4FFVC 4NQUA 4WV1A 5FYKE 5FFLA 3W0WD 4ODVH 4JRXD 2CJUH 3RUGE 4OIBA 1P84K 3D39A 1RUPL 1KB9K 4PJ5A 1HKLH 3WE6A 1SVCP 2FH6A 4PB9L 3CDYA 3VXRE 5CHNB 5IK3A 4N5ED 3GNML 1VGKB 1VPOH 1GRWA 3MBXH 3C09B 4NQSB 4HHAB 4KROC 4IMKA 4KJPC 2E9WA 4GRWB 3HPLA 4I0KA 3ORJA 3UYRH 4C83A 3HR5A 5IF0A 1V8HA 3WNNA 2NW3B 4N0UE 2CO7B 1U8KB 4JLRB 4MJ6A 3UTTA 4PR5B 1I3GH 4JM2F 1IE5A 3QSKB 1EJOH 4PLNC 4FABH 1YEJH 1HINH 1HCFX 1RIUL 1R5WA 1ZS8A 5I17B 5C07B 4OF6A 1ZLUH 1KELL 1KPVA 2FX8H 2Y6SC 1K5NB 2J6EA 4U1MA 1FN4A 1UCBH 3EYFB 3NFNB 5ECJE 5GZOD 3GJFH 2CDGA 1YECH 3QO1A 3S37X 1OAQH 5C07D 3O6KL 4WNQA 2BVQB 2C1PB 3TZVC 1HCVA 5ISZB 3NAAH 2BOCB 2J1KA 4JRYE 2VC2H 1A0QH 5JW3H 4HUKB 5F7FA 3BP5B 4MXWH 1N5YH 1CLCA 5HYQB 5DEGB 1YC7A 2P24A 5I16B 4LLWB 1DN0B 4GMTH 3QUKA 4MCZA 5D9SA 3F7VA 1XCQB 3EYOB 4XCNB 3ZT6A 3O2DA 4JEGB 3H9YA 2E7HA 4H5SB 1L9MA 1GPOH 4L9LC 4G9FE 4NKOA 1OAKL 5FUZL 1YNKH 4FFZL 1B6DA 2GTWA 1MHCB 4NFCA 4OZGF 3ULSB 1MVFA 1XF2A 1MCRA 4NYLB 2GJJA 2ZOLA 4V2BA 3T0EA 1JHTA 3VWJC 2DQEL 5DQDH 4NNYB 2V5RA 1AY1L 2J5LC 1GGBH 2GITB 3NCYP 3DXAB 4MHHG 32C2B 4MA1B 4PRPE 1E4XH 5C0AB 4P2QB 4H1LG 2IPUG 3U4EA 2DQGL 3NIFF 3RAJH 2X4SA 3HMXH 4YBLC 3QWOB 1KC5L 4NIKB 4HSQA 1CLZL 5GGSA 1IC4H 1QSZA 3DXAD 2COQA 5C0AD 1MRFH 4P2QD 1S9XA 3BKML 3FQNB 4L1HA 3RWEA 1KXVC 4LIQL 4POZC 1IQDA 1RMFH 1TJIL 1BF2A 4J3UA 3BRGC 1IEAB 3IU3A 2Y7QA 4LFHG 1AFVL 4R4BA 4LSVH 3T1FA 3EO9H 3EHBC 1D6VL 4MB3A 3HZVA 4A6YL 2I9LB 4K94H 1E6JL 5E8DH 3ARUA 1H3VA 3QNZB 4CW1B 2ARJA 1XGUA 4D0DA 5ENWA 5L2KE 5CINH 4L3EB 3ZKNC 3P9LA 2ICEA 1I7RB 4ONGH 3IFNL 1Q9LB 1V7NH 1QRNB 4J4PA 1I4FB 2W91A 4L3ED 1FFPB 5GRUL 2X4OB 4KKCD 5KSVB 1NCUA 3QNYB 1AGCB 1Y6MR 4OIIL 3RI5K 1AR2A 3GSOA 4HS6A 1BFOB 1UC6A 3S8WA 3KJ6L 1XIWD 1T1ZB 1S9YB 2G60L 4BSVB 4HWBL 3KYAA 1F4HA 3OKOB 1KG0B 2IANA 2HTLC 4FZ8H 4M1CC 3QUMA 3LD8C 4F3FA 3WEXB 1PZ5A 4YHLL 5C8JB 3C5SB 4OCXL 3V8OA 4FXKB 3QDHA 1QG3A 5FGSA 1NDGA 3OBAA 5DHYB 1A4JA 2NY6C 3KPMB 2FX9H 3MBEA 5CZKA 3VRIB 4AIZA 4BUGA 4U4BA 5GRWA 2O61B 3PV7A 1N8ZB 1MLBA 4I0PA 4PRDA 5ESAB 3P4MB 4QRTB 1BVKA 5GSRB 1LHZA 2X7LB 1XZ0A 5ICZA 5IP4A 5D7KE 4H26B 4YK4B 1Z2KA 1F02I 5I15L 1KJ3H 3W5NA 5E4EC 5TQ2H 1PX4A 3B9AA 5FYKH 2QBWA 3S35X 4IIQA 3K4DA 1CN4A 4JY5L 4JM2C 3GHBL 4LNRB 4WEBH 1OP9A 1UB6B 2BRRL 1C16A 5KZCB 5HI3C 3QQ9C 2FJHA 5HYJE 5IMMB 2VUOA 1ZT4B 4HFWB 1CXIA 1FNFA 4YHNB 1R5VA 2ADFL 4WTXA 1DANU 2XZAL 2HTKC 4JY4A 3ARQA 3FHQA 4E9LA 3WFCL 5KZCD 1C8PA 4KKNA 4QF1A 3FT4B 1P7QD 3M8OL 1MH5A 4DUVA 4Y4KC 4XPHL 1X5YA 3TBSB 2B5IB 4Y16B 3FRPA 3LHPL 3NZ8A 4PJFE 4QNPE 5CEZE 3AVEA 2MPAL 1H15B 1LP9E 1MRDH 2FDBP 1NAKL 4PJ7E 4CKVX 5D70L 1NCNA 4R90L 4Y16D 5J6HB 2ZUWA 2B7DT 3MROA 5F7DA 1J12A 2MOVA 4KMQA 3TWCL 4LVOB 3I2CH 2RBLA 4O9HH 4NWUH 2FYYB 4XBPB 3I6GA 3KS0J 4KZDL 3GSVA 4QRQB 3SDDB 2B1HL 3FB8A 2ZUQB 2IWGA 2VLJE 5ABDE 3V6OC 3CLFL 3I50H 4KROD 4ESKA 1JZ3A 5DJ8A 1S7SA 4PGBA 1QBBA 5HD8C 5CJXC 5J4MA 4PJ5E 4O58H 5I1HH 4HEME 4YFLI 1IAIH 3D3VA 1ZV5A 3K7UA 4U6VL 1JPFA 1F42A 4LSTH 1MAJA 2BVPA 1XF4A 4TSAL 5DRNA 4GXVL 1RULH 4OM0H 1HQRA 2X5PA 5HHOB 4F9PC 2VITB 4MHHI 1S7TA 5B8CC 2PETA 3SEPA 3GI8H 3QPQD 5TF1H 4YFLF 4Y89A 3MX0A 3PNWB 5F6HI 3UTTE 5HHOD 1DQQB 4JFOA 1K8DA 4LRNL 3SBWA 2EDBA 3RIFF 3BD3A 3H0TB 3CX5K 4C54A 5FKAA 2OBGA 5F1IA 4ZFFB 1CI5A 4ODBD 1DUZA 2R1YB 4I13B 3MV9E 4ETQA 5HGAA 3QG7L 4X8XA 1IC5L 2DRUA 5CSZA 3SE3A 1YEGH 2VO5A 1HXMB 5SWZE 2DQTL 4JFHE 3BO8A 2EDWA 4QY8A 2XY2A 1IL1B 4FQLL 2X4NB 4F15B 4PJBA 4S1SL 1OP5K 5DQJB 3LRSA 3MMEA 3VH8B 3S97C 4X7SH 3BAEH 2FATL 2AJYL 5T3ZD 4XVTL 3GBMH 3T77B 1G0XA 1JNJA 4AEFA 3JWNC 4QTIL 4QXTB 3BP4B 3ULUH 1KIUA 3QRGL 2IAMA 3F62A 3OGCB 4LLQB 4LP5A 2VQUA 1PKOA 4UOW0 3FB5A 3N0PB 3ZYOA 5D2LA 1FL3A 5FO7A 3ZT7A 5M94B 4QCIA 5A43C 1JUFA 2VABA 3SE9L 1EXUB 1QFWI 4XHJC 1UXSB 3CC5A 2VLLB 3QBTB 1CQKA 1YNTB 5I1GH 4R7DA 3BZFB 7CGTA 2UWEA 2D7NA 4KTDH 2LAGB 1RHHA 3T0EE 3LN5B 3QXDB 3MPCA 4JZOA 1TLKA 4POZD 3ET9F 2D9QB 4K3EH 4OD3H 3RKDD 2H8PB 3KPPA 3P30H 4YBQC 1LNUA 1B0GA 1EBAA 3O3AB 4X9IA 2YZ8A 4S0TD 4KK6C 4MA7L 2VRAA 4IHOA 4YQXL 3B83A 5GGVY 2Z91B 3U7WH 2XWBA 4AEHH 3CNKA 4JFEA 4KDWA 3LCYA 1KLFA 4TN9A 3OAUH 4LLDB 5DJAA 2OTUB 1Q9OB 4HS3A 4X6DF 3TJHD 4POYA 2G5BB 5H37G 3OAZK 2LU7A 1DZBA 2IPKA 4P99A 4RAUB 3RVTD 1DQDL 2E7BA 1ONQB 1F4WH 4MZ3A 1EHLL 2HT2C 3IDNB 4GRMA 4NO0B 1B0WA 5E2TL 3KYNA 1I1RA 2BVOA 2RCSH 4P2RA 5I8EB 4YHYC 2HT4C 4P46C 3V6FB 5DVOA 3CVHB 3TT3H 3O2VH 5SX5K 1YNLH 4JN2B 1DQJA 1I1FA 4KHXH 1IAIM 4NO0D 3LDBC 4NQCA 1QFWL 4Q0XL 1S7WA 1A3LL 1QEWB 4HIEA 3BUTA 4HUXA 2YD5A 4PJ9B 3ZDYE 1SYVB 3UTSB 2GK0B 3X3FL 5E6IB 3FZUD 1ZLVH 5IEKB 3FL7A 1A7OH 5EU6A 3KVQA 1CWVA 4Q74A 2R4SL 3RUGB 2PNDA 3ILPA 1HQ4A 3MV8E 3O3BB 5I8CA 3I9GL 4NT6A 3R1GL 4R97B 3ZE1E 2QSCH 2ZUYA 3KPSA 4PTTA 3CDGA 4P2CG 4JHBA 3UTSD 4BZ2H 3VXRB 2GCYB 3WIIH 4OCMC 5HXMA 3L3HB 2X4QB 5CEZH 3E0GA 3AB0B 5EUOA 5TQ0L 1NBVL 1MCDA 4HMCA 3BT2L 1T04B 4R96B 4XB8A 3SKNA 3PWPA 1PQZA 3VD3A 4YDLC 3W2DH 1J0HA 5I66B 4UT6H 1J10A 3PABB 2DMCA 3IRPX 2ICES 4EN3C 3RWCB 4M7KH 4XNMA 1MCEA 3DHMA 2AGJH 2X4UB 5FF6B 4OGAD 2BSED 1RZ8A 1T6VN 2B2XL 4PUBH 5EZIL 4N0UB 1BQHG 1T21B 3MR9B 3MNWA 1S7RB 1QACA 4K71B 3UO1H 1M1SA 5GXBB 1EO8H 1T2JA 3CFJB 3PIQB 3VXQA 3AREA 3K81A 3SN6N 3D0VB 1C5DA 4YX2L 2XKSA 4WFHE 2PTTA 2BSRA 1LO2L 4KK8D 3RL1A 4Y7MA 3VD9A 3RVVC 5IJKA 1RUAH 3FQXA 3ARSA 4UBDC 4YPGA 2E27H 3RU8H 5IKCA 1NGXA 2FWOA 3AC0A 3TEUA 3CLEH 2Q86A 4R4FL 4Y2DB 1T3FA 2F5BL 3WXWL 1VKXB 3LKOA 5D7JC 1AQKL 4XP5L 1T83C 4FQ1H 1RJZB 1UKTA 4IJ3C 2ENSA 5ID0A 4Y2DD 4BELD 3V0WH 4H88L 1CE1H 1LK2A 4P5TB 4KK5C 5HD8D 3RPKA 3GSRB 5L0QC 3H3PH 4XNYH 1A6WL 3TBTA 2WLYA 1QSEA 1RZJL 2J6EH 5LQBH 2ED7A 2FX7H 5D93C 4UT7H 2QJDA 3IDJB 3U4BL 1A3RL 2EYTA 3OXRB 3F6IA 2AV1B 4PRPB 2DLTA 3MQIA 1CXEA 3H42L 1HE7A 3SDXA 1QA9B 1K4DB 3TZVA 43CAA 1MQ8A 2CKNA 2F5AH 4D3CH 1DFBH 1U58B 2IGFL 3QIBC 4PRPD 4RGMB 4RFOH 3T0AA 2PCPB 5CJQH 1YY9D 1KEGL 2QQKL 4OUUB 2CKBL 4OUOA 5DRXB 5CP7A 1F3JB 5FIEA 3O2DH 2HMID 3QXAA 3U82B 2ZCHL 3OPZL 1MFCH 3TBWA 4HFUL 4YXHH 1G9EA 5I19L 1MFAH 3T0BA 1FCGA 2ATPA 4L9LA 3ZTNH 1CBVL 4GUPB 1T03L 1RJYB 1XCTB 4WEUD 5L2KB 5IQ7L 5JXAL 1MJUL 3DSFH 3VWJA 1BX2B 3F65A 3BKJH 1ZXQA 3LMJH 4X83A 3VFWA 3P4OB 4XPBL 1T80A 5E6ZA 3BW9A 2X05A 1BJ1J 5INDA 2R0WH 4QRUA 5L2KD 4PGEA 5I1DA 3P73B 3ABZA 4JO1H 3S3SA 4KJWC 3EUUA 5K9OA 5ALCH 4PJBE 4KH2A 1BOGA 1AIFA 3P9WB 5ILTL 1KJMB 5EU4B 2IJ0C 2VZOA 3WFZA 3OKLB 3DGGA 1ERNA 2K9UA 1P1ZB 3IU4H 5FA4B 4CMHC 3HUJA 4EI5B 5JDJA 2NNAA 4XPTL 4M1GH 4PJGE 2R56H 1KB5L 4MJ4A 2DLEA 3DVNA 2ZCLL 1CT8B 5D2LE 3OHXB 3KYMB 4EI5D 5KVFL 3L7EA 4MNHA 5CMAB 5T3XL 1ETZB 4IOIB 4XP4L 5ESQA 5E1AB 5ID1A 1VEOA 4UTBL 5DS8B 1KENH 4I1NB 3D9AL 3SCMB 3TJEH 4RISL 1EFXB 1RJLA 3OKDA 5C0BE 5BV7L 5EOQH 1RVFH 3WUWA 1I8IA 1RJCA 1AGDA 1MRCH 1B4JH 5DJDA 4LQ1A 5DO2C 1A6AB 1WCQA 4MAYB 2W38A 5GGQH 3DMMB 2APFA 3WFHA 3STZB 2ESVE 3FAXA 2EICA 3SCMD 3C6SB 2FD6H 1EFXD 4K8RD 1PG7X 1U92B 5HDBF 4E41E 5LBSL 1BBJA 1GGYA 1YY8B 3K4ZA 1TENA 1SBSL 1GIGH 5D7KD 1O7VA 3B9EA 4X9FA 5HYJB 1I9EA 2DS4A 3DMMD 3KNBA 5I1LA 3QUMH 4F57L 1VGEH 1SJHA 3L7FB 2Y06L 3ULVF 2HKHL 3VW3L 3WIHA 3OKNB 4BSWB 3T8XA 4HUMB 3HC3H 3M07A 1MELA 3UJJL 5HYJD 4OLWL 1J0KA 2M26A 3UAJC 4ELME 5GRZA 3ARVA 4EI6B 2VL5B 2B39A 2P8LA 3HNSH 4P3WA 3S36H 5EIIA 5E5MA 4PJFB 1OB1A 3MRNA 1N2RA 1CLYL 2X1PA 1LP9B 1EAPB 3U9PL 4P2RE 4PJ7B 4XNQA 2XQBL 2PR4H 2DI9A 1BFVL 1JF1A 1L0QA 5A2JH 4N0FB 3MZTA 3SJVD 1FDLH 1MFEH 1NMCC 3FJTA 4NQCE 5HHPB 2CIKB 3DWTA 2PYED 3VMNA 5L7XH 5FOJA 5IV2A 3MREB 2EKJA 1YN6A 2CRZA 3BPLC 4UINL 4OF0A 5DSCA 1KN2H 4JM2A 5TGBB 1I1YA 4M48H 3ROLA 3LKSB 2ERJB 1OARL 1H3GA 4LDLB 3DJ9A 1R5IA 5IHUL 4WV1B 1Z9SA 3ULVL 4UILH 2LFGA 3MLYH 2FO1A 3PHQA 1WBXA 3PWVA 1CG9A 1E4WL 5B38B 2AABL 4WUKH 3G6AA 4PJ5B 3IF1A 5BRZA 5JHLL 1Z3GL 4LOUC 1KN4H 5IK3B 4Y4KA 2W9DL 3IDGB 3IAPA 1BBDH 5EUOE 1WBZA 1G6RL 2FEDD 4PJ5D 1NGWA 3O0RH 4ZNCD 1KYOJ 1OCWL 3PDGA 5LG1A 2DAVA 3IXAA 4F37K 1DP0A 3RWDB 3HPLB 3NZHL 1EHXA 5CD3B 3RY6C 3JUYA 3QQ4A 5F7EL 3RVVD 4C83B 3NABL 1MCHA 4YC2C 1RZGB 4CVZB 2EIZB 1L6ZA 1PGRB 3UTTB 1JWUB 4GG8A 2K7PA 5F1KC 1C08A 4JG1H 4MAUH 4N0YH 3TBVA 2X4PA 4GKZA 4PBXA 1ZS8B 3KS0H 1R5WB 4H0IA 4A6YA 5L88H 3MV9B 5DD6A 3TO2A 3ZDZE 1CDGA 3WCYA 3V6OA 1HHHA 3UTTD 1BIHA 2YD7A 5SWZB 4NQVA 5D6CB 1N6QH 5IB5A 3P4LA 5CJXA 5BQ7A 5FHBL 1LEIA 8FABA 2WANA 4PS4L 1FL6B 2CDGB 2YSSB 3MV9D 2VH5H 1FJ1A 3O4OB 5E99H 4HUVA 5ESVA 2J8OA 5BV7C 4M9PA 5AD0B 4M43L 1ZTXL 5SWZD 1LO0L 1I1AC 4OSUL 4LEOA 1D5MA 2Z31C 3FO2B 3KR3H 4RX4A 4QHUA 4F9PA 2R0KL 5B8CA 2P24B 5JHDA 4GSDH 3OG4B 3QEQA 5D9SB 5IFHH 2WQRA 4HWBA 3FO0L 2IH3B 4UAOB 4ORGA 5HHXL 2EE3A 4GT7A 4XNXL 2JB5L 1WISA 4TUOB 3PDOA 4NKQB 3DUUB 5GGRA 3BGFB 3DUSA 3BH9A 1KB9J 5EO0B 2BNRE 1DLHA 3IKCA 2VDQL 2ENYA 2ZOLB 4QRRA 3N50A 2YHGA 5DGQA 3H3BC 5KSUA 1D5ZA 5E9DE 1DN2A 1JGDA 2G9HB 4YHKL 5A16B 3WNKA 4LLVA 1JYXA 4YDJA 4PG9B 3U4EB 3NOIA 4U1IA 3GO1L 4DTGL 1LEGA 4PJHA 5DWUH 1UQSB 3G5VA 4X99A 2ZOKA 1DBAH 3EYUL 1DBKH 3K74B 1KF9B 4OD1H 3VD5A 5GGUA 1AQDA 5LVEA 4BK5A 1G7IA 1ITCA 4L5FH 3WNMA 4C55A 2H26A 1MNUH 3DPBA 3VGBA 4ODUA 3EBAA 3DBXA 4K7PH 4R4BB 1NAMB 1RU9H 3T1FB 2GFBB 4L4VE 3ULVC 3HZVB 1JVKA 3Q48A 2XXMB 4KFZC 4NUGL 2X1OA 4TRPH 2AXHA 1TMCB 4PYHA 3K8KA 1FLTX 5DJXA 2B1AH 1AC0A 2ARJB 1XGUB 5MEPB 3HB3D 1IM9A 2P4AB 4B5EA 3MUGB 2FNBA 4XNUH 3SGDI 4PJDF 3TFKC 3UCRA 1D9KA 3BH8B 5IVXF 3UTOA 4NM8L 1JNNH 1IMHC 3IFLL 1JPTH 3NVQA 2NPLX 1X9QA 1YZZA 3FO1B 4KY1L 4L4TA 1FQ9C 1T7ZA 4TTDD 1WZLA 4P48A 1A7RH 3NCFB 4DEPB 5H35A 4RBPK 3VD7A 4C58B 4MMZC 5IB3A 5EULV 1A14H 4A2MA 5IR1B 1HI6A 4MD5B 4NRYB 4WJ5A 3IDXH 2APTA 2E7MA 4APQB 1A5FH 3UPRA 5IHLB 1R3HA 1F00I 3PXHA 3QIWC 2DQHH 3GSOB 2DB8A 3T0DA 2FL5B 4MNGE 5DFVC 2IFFH 3UTZB 1AJ7H 1MY5A 2DKUA 4ZPVA 2FB4H 5GS3A 3MV8B 1KPRB 3PQYE 5E2WH 4M8VA 3QWRA 4B0MM 3BZ4B 4APQD 1W0WB 5JA9A 3WDIA 3RNQA 2JJVA 4X7FC 3FONA 1ZHBB 4BH8B 5L2JB 4HKBB 3MV8D 1L0YA 2CK0L 2DICA 3LQAC 4CU6A 1HXYA 3VFRB 2E6QA 1DBML 5I71B 5KN5B 4OLUH 4P46A 2GK2A 4AM0A 2DM3A 5GISH 5I1EH 2CLVA 3CFCL 4PRDB 3BFOA 2C1OA 4K9EH 6CGTA 2W65A 5JDSA 1XZ0B 2HP4A 4PGJA 1WCBB 5ICZB 4JO3H 4Z7QE 1ITBB 5D1XC 4JFDA 4YWGH 5I30H 6FABH 3GJEA 2YRZA 2YK1H 4IIQB 1CDHA 4LU5L 3RWJA 1NGPL 5I75C 5H8DA 5FV2A 5HGBB 2HH0H 5TE4H 3CVIL 4GAYA 5DRWB 1F4YL 5F1NB 4DJMA 4M93B 1MIML 43C9B 1WBYB 1NBYB 1IGTB 5I2IA 2FZ3A 3VXSE 1V3MA 2HG5A 4MCYB 4WFHD 4QF1B 2XNAA 5FCUH 3DRQA 3EJYD 4B53A 4OTXL 5CIPA 4KVNH 2ZKHL 3CD4A 5FM5M 2EYSA 3LH2L 3MNVA 2FHCA 4KKAD 4NCDA 4EXKA 3NZ8B 3S36X 4NZTL 2GJ6D 1JZ7A 4OCRL 5ELIA 2R8SH 4PBVC 3C9NA 5KS9F 1IC1A 3JV4B 4QHKJ 1PYWA 4GXUN 5FM4A 2XIDA 5J13B 1BAFH 4B7LA 3CXDH 1YEFL 1UH2A 4HWUA 3V79C 4EVNA 4LOUD 5C0DA 1U8JA 1FO0A 2XXCB 2WWKT 2ZG3A 4HJJH 3IXTB 4K3DH 2A73A 3TT1L 4OCWH 1LMKA 5DQ9A 1DEEA 5CJOL 1F90H 1EMTL 2BVTA 3WIFB 2DM2A 4ZFGL 3NCMA 2W9LA 5IB2B 3ETBF 3V6ZB 4H1LA 4DGIL 5T5NG 4YNYA 5SV4A 5BRZE 2OR7A 3LPWA 3HN3A 3IFOB 1F8TH 2CR6A 4M61B 3HE7C 1CDUA 4Z9KB 5D7JA 2JB6B 1IGIH 1T83A 1XF4B 3IDYB 1JF5A 1YQVH 3B8SA 2MQCA 1PEZA 5EN2A 5FYKU 3VG0L 4CL7A 1Q0XL 2EXYD 4ZDHA 2ZUXA 1FE8H 1E6OH 1ZEAH 5F89B 3THML 4XMLL 1WGOA 4LIQE 3VRLF 1QPPA 3GSNH 2OZ4L 3H2WA 4FQHA 4OM1L 1K8DB 1MIEL 4I3RH 4XP1H 1Q72L 1DUZB 1MUJA 1YPZB 2LU3A 3HPJA 3OB0H 4KDTA 3U7YL 4KAQL 5CEYB 3V6OE 1KTDA 4OZGE 4G42A 3LEYL 1GVIA 3BEVA 3GI9H 5JMRA 4WFFE 1NEUA 1NFDE 1FZOA 4JFQA 1QFUH 3OR7A 5CCKH 3SDCB 1F3DJ 4PJBB 3T08A 4NUJB 3LRSB 4E5XB 2Y4SA 1OAYL 4H8WL 1FBIH 1A1OA 4RNRA 4LF3A 3O6FC 4AT6A 3L3IB 3ESVF 2IAMB 1MOEA 3SDCD 2IH1A 1JFQL 1HH9B 4PJGB 2XFXA 3V4UL 5LKNA 1KLUB 3FB5B 4ZD3L 5JHDE 4ZOCA 5D2LB 4HPOH 1XGYH 4X6DA 4OGYL 4YEEA 2AEPL 1VFOA 3HE6C 2I5YH 3S88H 2IAMD 4HCRA 4D8PB 3VRJA 4LEXL 1EAJA 2VQ1A 1FIGL 2FSEB 4N0CC 5E94B 1WC7B 5GS0L 2Z8VC 1FNEB 1S78D 3C8KA 3LPGA 4NFBA 4R7DB 5C0BB 4QRRE 1RHHB 3MRCB 3F12A 2D0FA 1J7VR 3LEVL 4TNWK 4OFYA 4ISVA 4E42B 2EKSA 1BJ1H 3G08A 5D5MF 1BQSA 3KPPB 2NY0C 2PTUA 5EO1A 25C8H 1LNUB 4MJIE 1JGUH 5FOBA 2Q8BL 4BK4A 2ESVB 5C0BD 4E41B 1NJ9B 4X4MA 3GUTA 3NH7L 3FTGB 2PO6C 3T3PF 1AI1L 1JGVH 4IHOB 4JKPH 4PTUA 4RSVA 2CDFB 4NCC2 2JTDA 2ESVD 5LXGL 4XWOC 1TZHB 5DJAB 5DMIH 4E41D 3CX5J 2DWEB 2UV3A 3K2UL 2A9MH 2HWZL 4K7PX 4L8SC 1RUPH 4NKDB 3BWUC 1JTTA 2V2TA 3FOLA 5E8EB 4ELMB 2WIIA 1JPSL 1XGPA 4YO0A 5F6IC 4BA8A 1YMME 1MCQA 1HOCA 3KHOA 4GRMB 4RAHA 5TFSL 5D7IF 3C5ZC 4KKBC 5DR5L 1OSZB 4XI5D 3FQWB 5F3BB 3S37L 3BGMB 4P2RB 1A8JH 1XGTA 4CVXA 1NUDA 1DQJB 1I1FB 1JCKA 4ZO6A 4NQCB 2HJLA 1I3UA 4Y88A 1T66D 4WI4A 4PFEA 2ATKA 2NLJB 2P44B 2M2DA 4EUPG 4HK3J 5T1LA 5MI0B 2FH8A 1N64L 1RIUH 2VLKE 2D31A 3MCG1 4FTVD 2VLME 3WIHH 3LQMA 1ZGLP 3BIAX 1HQ4B 5EOTA 2VE6B 2PUQT 4PTTB 4F7EA 4TPRL 2MJWA 3O6KH 5CGTA 5D1XD 3MYJA 3I85A 2P46B 2CUIA 1IQWH 3JWOC 2VXTL 2MNUA 2MMXA 1RZIA 4H8WC 3K4AA 3ZE0E 3LPFA 3DX8B 4L3CA 5GS2D 4HF5L 1RZ8B 3I02B 5DJZB 1AE6L 4OLVL 1JYNA 2D2OA 1NGQH 1TJGL 3I75A 3C6LB 1NGZB 4FNLL 2NY7L 4JFDE 4YHZL 2XWJA 5F21B 3VXQB 2V2XB 2NY4C 3LKNA 3IJSA 5FUZH 4FFZH 1C5DB 2NYYC 4NC1E 1TDQA 4O2FB 4Z95L 5T5NF 4ZXBC 3C6LD 1JI2A 1JGLH 2MHAA 3BDXA 2FWOB 5DMGD 2V5MA 5TH2A 2BNQD 2DQGH 2Q86B 4KGJA 1FVEA 1T3FB 4TNWF 4LCUB 4QHNB 5TDNB 1ZLSL 5C9JA 2P47B 3CFKB 1CLZH 1LO5B 4PJEF 1DUYB 3BKMH 3CPLB 3MV7E 5ID0B 1AHWB 3RY6A 4G80A 1OAXL 3HFMH 3O8XC 1F58L 1BLNA 4IBLT 4K2UL 1U8NA 5ANME 5T1DL 4JQVC 1JZ6A 1LK2B 2FIKA 3RL2B 1QFOA 2AJVL 1OT1A 3B43A 2HFEA 3W81A 1CDJA 1AP2B 1XGQB 2YWYA 1D6VH 2XPGA 1KB5A 1FSKB 3L5HA 3F7PC 4A6YH 2OX5A 4I2XA 4PGZA 5JLZA 3LS4L 5IW1B 1JL8A 4M6AA 2BNRB 3TBYA 1QHOA 4WUUD 3PGCB 3VFVA 3GMOA 3P9MB 5FO9A 4FFYH 1NCCL 2N1KA 5E9DB 2QQNL 2EYTB 1H3XA 4NN6B 2BNRD 1T2QL 1UJTA 4F8TA 3IFNH 2IC2A 2Z4QB 3IDMA 43CAB 2Q1EA 5E9DD 3REVA 5GS1C 2KZWA 3T09A 4HGKC 5GRUH 1I1AA 3UBXB 1OT2A 4RMWA 1OW0C 1R3LA 2Z31A 4FHBD 2Y25A 2A6KB 4MB4A 2HJKA 1ZT7A 4IOSD 3KJ6H 1KXQE 4IRZL 2G60H 1HHJA 4XT1C 4MNQB 2A6JA 4HWBH 4BZYA 1C12B 2OJZL 1D6EB 3BUYB 4L4VB 4ZAKC 3TBWB 4MDIB 5HGHB 3QFJE 1M7IA 4J3XA 1II4E 3NACH 4OF5A 4OCXH 2KPNA 2QHRH 4MNQD 3O2WL 3G5XA 3ARDD 1W72B 4LPTA 4X9BA 5FXCH 4L4VD 4ODWA 5AG8A 4DGVH 2VOTA 3QDMD 1VERA 2RGSA 3VFWB 4MZ2A 4NOFA 3RNKA 5INDB 1XR9A 5LCVL 3BD5A 2XTJB 3S4SG 3QNXB 2D03L 5EU5B 2DBLL 2UY6A 4NJ9L 4OKVA 2ZWLT 3QXTA 5K9KA 5I15H 3P77B 5L6YH 1AIFB 4BM7A 2MKLC 3MGTB 3MSPA 4G7VL 4MNGB 1KJVA 3DGGB 2XTJD 3SKMB 4GG6F 2FHFA 5GJTH 2VIRA 1T0MB 4AMKL 2DYPB 5JZ7D 3PQYB 4NQXB 1INEL 2ADFH 1VSCA 2X70A 3DOSA 3MA7B 2XZAH 3DVNB 3GMQB 4DKFL 4LAQL 3N1FC 4LQFH 5IBTL 2FLRT 1A7PL 2EDNA 1E27B 3L7EB 3F6LA 3HAEA 2DYPD 3PQYD 4NZDA 3M8OH 3P3YA 2DMBA 3EFFA 4ODVL 2NXZB 4XPHH 5AUMB 2DL2A 2CJUL 2PO6D 4EIZC 4PLJD 3LHPH 1HKLL 2VNCA 3LRHA 4GQPH 1IGMH 2MPAH 1G6RA 3WUWB 3MV01 1ZLWK 3DRTA 2VZSA 1F45A 5DJDB 2NXZD 4F7CA 5D70H 4HGWB 1YYMH 1B4RA 1BGXH 1VPOL 3MBXL 3SO5A 1AKJA 1RHFA 4LCYB 4LP4A 4NZJA 3BIBX 3TWCH 5I76A 2QHLA 3DURB 3V7AG 3QIWA 4FXGA 2W0FA 1VFBA 4KZDH 1E4JA 3T2QA 2B1HH 3UYRL 3T2NH 3GFUA 5I1IL 5HHQB 3CLFH 3VXSB 1E4XI 1IZKA 3OZ9H 4FABL 3FRUA 2OL3B 1X3DA 4ZOBA 1YEJL 2XT1B 3I6KB 3D87B 4KU1A 3MRFA 3L3JA 2FX8L 4HS8L 2G75B 3QHZL 3SO3B 1FLRL 4RGNC 4I5BA 1K3IA 5EIIB 3BP6A 5E5MB 4R8WL 3VXSD 1OB1B 2UUDH 4FQQA 1UCBL 3MRNB 4XAKE 5EFIA 1EGJA 2WBKA 3UPAA 3VI4F 4AK1A 4GXVH 5HJ3A 2C7UA 4R7NA 1OAQL 3RZWA 2AJUH 3LN4A 3EGSB 5CWSA 3W39B 3NAAL 5IMKA 4RMSA 5A40E 1TVBA 4XH2A 1PX3A 1A0QL 4JPIA 1K8IA 3JVGC 2DM7A 5DT1H 4OQTL 4MXWL 3PL6C 1UZ6F 4I4WB 1ZHNA 5D1QC 1IEBA 1NSNL 4PGDB 2ZUSA 4U0RB 1IC5H 1IFHH 3N1PC 2BHYA 5FDWA 2Y5TB 4GLRH 1WBXB 1CG9B 2WINB 4WU7B 3G6AB 1W0VA 2AI0L 2DQTH 3T0VA 1QO3A 1NMAH 5CIPH 1YNKL 4F9LC 3PDDA 4FQLH 2P5WA 1OPGL 1A7BA 3GMNA 3QHFL 3L5XH 4J1UB 1FORL 2F19H 4F33B 5DQDL 5D2NC 1RFDL 1MHHA 1K4CA 2FATH 2AJYH 2LU4A 4XVTH 4WI9A 3VFMB 5T33L 1E4XL 4OZ4A 3QEHA 4QTIH 4FXLA 4PJ8D 5H2BA 2NYYD 3D69B 3QRGH 4JO2H 4RDQG 5JORB 3QUZC 3BISA 3HMXL 1A4KA 3QQ4B 3PF2A 3MNZA 1PVHA 1FNAA 4F2MA 5L9DH 1FO0H 1IC4L 2WIMA 1MRFL 2YBRA 4BFIA 1C08B 1IAKA 2IG2L 3ARBD 2NX5D 4LHUA 2QR0B 4XMKL 1KCSL 4JFYB 3TBVB 4A6YB 3P0YL 3LRGA 3MLZL 2Y36L 5E8NA 3V5DB 3SKOB 5MENA 4H1LH 4OZGB 2AK4A 3EO9L 3TO4C 1P69B 5IB5B 4Y5YC 8FABB 1JK8B 1U8OA 1WFOA 2XKUA 2BMKA 2AKRB 1NEZG 1NFDB 5E8DL 5IB4B 1WV7T 3HE7A 1OAUL 3V4PL 4NWTL 3E2HC 4WHYH 4AG4H 1U3HB 4HD9A 4YQXH 4ONGL 5I73C 3KHQA 4HK0B 3D85A 5J12B 3G9VA 4Z8FL 5D96C 5BVPL 1SJXA 1Y6NR 3OKYA 5F7MC 1RUKH 1TPXC 5JHDB 3RWHB 2W60B 4XCYB 1U3HD 1U9KA 3WHE1 5DVKA 4JVPA 4YR6A 2YXFA 1DQDH 1FZJA 3PDOB 1EHLH 3WLBA 3BH9B 1AGEB 4GBXB 1KOAA 4Y1AE 3AXLB 4QRRB 5K9JL 5E2TH 2FO4B 1MWAB 4JG0L 4PJDA 5T3XE 1JGDB 5IVXA 1KCVH 4KI5C 5J57B 3MACL 4MJIB 4NN5C 4GBXD 1GL4B 1S7UA 2QSQA 4HMEA 4P5MA 3OJDA 4L4JA 4QRRD 1A1MA 1F3DH 1LEGB 3PP4L 4V1DE 5FK9B 2FX9L 1A3LH 4Z7OF 3NGBC 3GGWA 3QA3A 3X14B 1MCNA 1MFNA 2GHWB 1AQDB 4MJID 3O6FA 2H9GA 3MRHA 2PKDA 3SKJH 3NPZB 4KRLB 2WZPD 3PV6B 1ZE3C 4UIKL 3I9GH 3MTRA 3R1GH 4HCRH 1OQXA 3HE6A 4DCQB 1OVZA 2BP3A 1YMMB 3LQZA 4Z0XB 4CMMB 4N90D 3MRDB 5TQ0H 1NBVH 2ICWJ 1A9BB 3ZKSD 3BT2H 1D9KB 2ICWA 1ZGLB 4JPVH 4D9QE 1MJ7L 1YMMD 5DJ2A 2J4WH 3JV0A 4GS7C 3DVGA 4HJ0C 3ZL4H 5LWYH 1RURL 3UZQA 5CZXC 5H35B 2NY2D 3KPNA 5HVWA 2B2XH 2HVJA 5EZIH 4NGHH 1UB5A 5IB3B 4YAQB 4G6AD 1DVFC 4LAJH 3DO3A 5DUML 1U3JA 3QHTC 2VDOL 3PHOA 3QCVH 4LSSH 3UPRB 1MRDL 1OGAA 4UZGA 2C3WA 2VLKB 5HDBE 4U1LB 2X89A 1CFQA 3M17B 1CVSC 1Q9WA 3KXFA 5FKPB 5JNYA 3CZFA 2R9HC 3I2CL 4LLYA 5INCA 3ZKXB 3O9WA 5DI8A 3MLRH 5F3HA 4CAGA 3DARA 4U1SA 2VLKD 1PW3A 3ULVE 35C8L 3B9KD 4NNXB 3V4VH 1UENA 1FYHB 4R4FH 5D7LA 3PE9A 2A9NL 1HXYB 3C5ZA 3WXWH 4X7TB 1AQKH 4WHTB 4XP5H 4JFZL 4LL9A 1JV5B 2O5ZL 4P46B 4AM0B 1A22B 2DWDB 1OP5H 5E8PA 4O58L 3VWKD 3WDJA 5I1HL 1QRKA 5I0ZA 3O3EB 3KYOA 5JDSB 2J2ZA 5KS9A 4J3SA 3WFDL 3L3OA 1MFDH 5CGYD 3GKWL 5IFJA 1WUNT 5E4IA 1HIMH 5FYJL 5HVGB 3HS0B 1Q38A 1A6WH 4M62H 3GJEB 5BOZG 4OM0L 2N4IA 5C0CD 2KQNA 5DJCB 1AXTH 2OZ4A 1U2CA 1LGVA 1T20B 4JKKA 3VA6A 4G9DB 2YEZB 3ZKMD 4GAYB 1FYTA 3VGFA 1T1XB 3QUXB 3U4BH 2XA3A 1N5AA 1R24B 1A3RH 3RVUC 2FZ3B 4HKXA 2OTWB 2BNUA 3QUXD 2IGFH 3Q5OA 1G0YR 5IJVB 4U1GB 4RDQF 2EE6A 4DVBA 3MV7B 4WI6A 1KEGH 2QQKH 4HT1H 2WW8A 5ANMB 4U0QB 4S11A 4YHPA 3NPSB 1JZ5A 5DDHA 2VXUL 4X80L 3M1BA 5EDXA 3OPZH 3F5WA 4HFUH 3TA3C 4G43A 4YIQA 5I19H 3MV7D 4R0LB 3SQBA 3IFPA 1U8JB 1CBVH 3RX7A 3TPKA 1KCUL 2RIKA 4ERSH 1V5JA 1YUHB 3OAZH 5DD0H 2MKWA 3H9SA 5ICYB 5IROC 5IQ7H 1VESA 5JXAH 1DEEB 4ZXBA 2YC1B 3EOBA 4HMDA 2H6PA 4OLZL 5J9PA 3LKQA 1SQ2N 3VXUD 3QUZD 2PN5A 3MRRA 4TVPL 3VG9C 5SX5H 2JJWA 1J05A 4F7PB 2HJFA 1KEML 2FJFA 4CNIA 2OM5A 3SGJC 5ILTH 1G7LA 2HLAA 2NR6C 4OD3L 1AGFA 1WIUA 1HK6A 3ESUF 4MA8L 4Z7WB 4KXZH 4RGOH 5IW6A 1KNOA 4KTEL 3O8XA 4X6CF 4JQVA 4XPTH 1PG7L 2NXYB 3QP3A 4AQ1B 2CGRL 2E8ZA 4KUCF 4PLKD 3QFJB 5D7SL 4M00A 3WS6C 3X12A 5ETUA 5JPMA 5B22A 3TPUA 3MUZ1 1KIRA 4UDTB 5DMYA 3FOMB 4LPVA 4HIJA 4U1HA 1QSFB 2GI7A 4HIXL 5JW5B 3OAUL 4JZNA 5KOVC 4P5KA 5T3XH 3RPIA 4XP4H 3KPLA 3QFJD 4PP1C 4Q97A 4PYGA 4UTBH 2YD2A 2AK4E 2Q6WA 1H3UA 3G5YA 5BV7H 3QI9B 4LLAA 1QSFD 1F4WL 2V7NA 5GJSH 3U2SB 4X7EC 5KAQF 1T1WA 5IQ9A 3HI1A 2YD1A 3KLAB 5FM5O 4JFQB 5L8LB 3DX6A 3T1WA 5GS1A 1KIPA 1BWWA 1NLDH 3T65B 2FGZA 3O41B 3MLSL 4LCCB 5E7FA 2RCSL 3ISWA 3QI9D 1OW0A 3L5JA 4KVCH 3Q3GB 4WI2A 1A1OB 4LLUA 1UADC 3RWIA 2OMNA 3LV3A 4KHXL 3BSZH 4AT6B 3H9ZA 1TVHA 3OB8A 2IH1B 2GY7B 2XKNB 4MQXC 3B8YA 1C1EL 2Y06H 4ZAKA 3VW3H 1XFPA 2NTFA 2MCPH 3UJJH 3QDJE 4AH2B 4FQXC 1EA9C 4ZS6C 4OLWH 5F1SA 5GGTL 3VRJB 1A7OL 2VB5A 2VQ1B 1N3NB 2LQRA 1DQMH 2PXYA 4JFXA 3VXNA 2JF1A 4R4NC 2I24N 4FQ2L 1N0XH 3JTTA 1H5BB 5T1KB 4NQEE 5D7IA 3KPQA 3F12B 4NRZA 1MCIA 1GZPA 2BCKB 3HCVB 4ISVB 1NCBH 3S5LG 3U9PH 1AD9A 5IVXE 1EHNA 2XQBH 3G08B 5ICXA 1HNFA 1TZGL 1TTFA 2P5EA 5T1KD 2W9EL 4XPFL 1FAKT 5F9AC 3A67L 2AQ2A 4PTUB 3DROA 4M7KL 5E2VL 2VZ1A 1OARH 2B0SL 2AGJL 2PW2B 5IHUH 4PUBL 2R23B 3ULVH 3UO1L 2AABH 5CJBA 3HAEH 5SX4H 1EO8L 4M5ZL 5JHLH 1Z3GH 2VDRH 4I3GA 2WIIB 3SE4C 4TSBL 1T5WA 4F58L 5HHNA 1HOCB 2W9DH 3LKPB 1RUAL 1G6RH 3QJFB 5MP6H 1HNGA 5HYEA 4TNVF 4CVXB 3QAZB 5F44A 4RRPG 3NZHH 4HDIB 4S1QH 5IMLA 3IT8D 4HUWB 2R9HD 4XAKD 5CUSH 5F7EH 2P49B 1FG2B 2Z8WC 4FQ1L 2XOTA 4P23A 1IAOA 3EDDA 4MD4A 4PG2C 3PGDA 1SEQL 4P4KD 4Y4HB 5LJYH 3STLA 1WZKA 4ZPTA 3BHBB 2I9TA 4QGYA 1CE1L 4U6TA 2DI8A 2Q8AH 2X6MA 5EPMB 1W8NA 3RJQB 4OZIF 4C56A 4WVRA 2DLIA 4Y5XC 4GRLB 2AJSL 1BQLL 4WRLA 5FHBH 3RTQC 4Y4HD 1UM4H 3C5JA 3FMGL 4Y5VC 3ZDXF 4F7EB 1MREL 2EDOA 3LQAH 3W9DA 5KJRH 1GGCH 3EYVB 4M6OL 2J6EL 1B2WL 1BEYL 1ZTXH 1EGJH 2DLFH 3N1MC 4M43H 4UT7L 5HYSG 4N9GB 4GRLD 3L95A 5IW3A 4JJ5A 3D5OF 1G7QB 1RK1A 4XVUD 4PJEA 4QWWD 1G6VK 4LK4A 2R0KH 4S1DC 4Y19A 4DFIA 1ORQA 2CKBB 4Z18A 1UACH 3FQTA 4Q2ZA 5C0JB 1YYLH 5KS9E 5CBEA 2V5YA 4RFOL 3I75B 2ZP0T 5HHXH 3WN5B 5IG7A 3PL6A 2JB5H 5KTEL 2XWJB 4G8GE 1ZHKB 3GMPA 3LKNB 5D1QA 3BPCB 3IJSB 3O2DL 5DZLA 4WWKA 4ONHA 4P57A 3N1QC 1AD0B 1YEEL 2DI7A 2FRGP 5B4MD 1FYTE 3QQ3B 4YHKH 3TN0C 4X8JB 2YD3A 1U8QA 3KPRA 4KKLD 2J88H 3GO1H 4DTGH 3RZCB 4PJCB 5D2NA 3VFSA 2XZCH 3LMJL 3EYUH 5DJ6A 5I8OH 4ZUTA 4PBWD 4LKCA 4Z77A 4X4XB 4HEPG 5IIEB 3L9RA 4FMKA 4G80B 1A6ZA 3RZCD 5BW7A 1U8NB 4PIRF 4PGCB 1AH1A 2CUMA 3KAAA 4PRBB 4C4KT 2JELL 4PY7A 5ADPL 2CXGA 4HWZA 1H3PL 4GMSH 4BH7A 1KB5B 5C2BL 5JLZB 1FRGL 2R1WA 1LE9A 1M6OA 3VRLE 2Y9RT 4JZJC 4U3XA 3VFNB 4Y1AB 4M1GL 2R56L 5DK0A 5FO9B 3H9SE 4XX1G 3TO4A 3EO1A 4Y5YA 4NM8H 4ZUVA 3BIKB 3R4DA 4ZUUB 1IGFL 4ODHL 4KY1H 3D0LA 2DIAA 4Y1AD 1P2CA 5EBWA 4KMTH 1D5BB 2VWEC 5KSAC 4V1DB 1SJEA 4DN4L 3REVB 4XAWH 4PREB 3WV0A 3TJEL 1GZQB 2DMKA 2FJGA 3MUY1 2R2HA 3ZYJA 4ONOA 1CK0H 1EK3A 2HJKB 2NQCA 1B4JL 5H94B 2BX5A 4V1DD 5FB8B 3MJ7A 4X6EB 2EDXA 4ZO7A 4GG6A 2QEJA 1IVLA 4Z7VF 2BJML 4KJQD 4IOFC 3RWGB 3OKEB 2PW1A 2X41A 2V17L 4EDWH 1IKNC 3DETC 5T5FL 1M7IB 5HPOA 3HNTH 1JHKH 5CBAB 4WI3A 2VZUA 4KRPC 3KLHC 2GIYA 4W4OC 2AV7A 5TJWK 5ACLA 5BO1L 1P5UA 2DQIL 4Y4FB 1G7MA 3QUML 4IRJC 1EHAA 1QLFA 4ODWB 1HH6A 3W9EA 5BMFL 3PWLB 1DBMH 2Q7YB 5GPRA 1FFQA 3BYYA 5LGJB 3AAZB 3CFCH 5DVLA 3IJYB 4Y4FD 3O11A 4P2OC 4WW1A 4YHML 1CGSL 1BECA 5D5ME 4EUPA 4D9QD 1S7QB 3TH2T 3SGDH 2R69L 2GAZB 3BP7A 2H32A 3HTLX 4L9DA 2PR4L 2JCCF 4LU5H 4G8EB 3T3PE 2NY1C 2V9TA 2HLFC 1CGUA 4OQTA 3OX8B 4P3DA 3SDAB 4DKEL 4MXQC 3HG1A 1WK0A 3SPVA 3VXTA 4MDJA 1CYGA 1A02N 4M48L 2EXWD 1BZ7A 1JPST 2V9RA 3SDAD 4HGMA 2WSKA 2CUHA 4OTXH 2ZKHH 1HZHL 5HHVH 1KBGL 3LH2H 3SE8H 4RIRB 3MO1A 2AJZA 4MD0B 2NW2A 5HI4D 2A83B 3QR2A 2VMFA 1O5DT 1I8MA 2Z93A 2BRQA 4OCRH 4M03A 1L0XA 2IALA 4OZFA 1INQA 3DRTB 1BQHB 4F7CB 3HMXA 2P5EE 1DVFA 1G1CA 1HEZB 3U6RB 5FV1L 4CN4A 4FXGB 3GHEL 3UX9B 2E9JA 3RP1A 1OD7A 1VFBB 3A6BL 4XTRC 4UNUA 4JHZA 5CJOH 3DX9B 4XNZC 2VR9A 5DRZA 1CGVA 2C4FT 2BY0A 4PJAF 3UC0H 4ZFGH 4DGIH 3BQUA 2YPLA 3PJSA 2BSSA 4JDZB 3C87A 5HGDA 2V2WA 3Q6FB 3CJJA 4PJXE 3AS1A 3S9DB 2Q76A 2GJZA 3UJIH 1CD1A 3ZLQC 1ZWIB 4UT9H 4OV6F 3VXMA 3VU2A 3VG0H 3DTXB 5JQHC 2VH5L 1Q0XH 2XZQH 4IMLB 3LIZH 4R3SB 3GBNH 5IMKB 1TVBB 3THMH 4XMLH 1L7TL 4KJYA 4JPIB 2OZ4H 5GHWH 1EEYA 4GW5A 1E0OB 2F74B 5C08A 1IRAY 1T1YA 1ZHNB 1Q72H 3DX7A 3EDEA 2Z0BA 1DE4B 1S9WB 4J3OC 3U7YH 4KAQH 5IUSA 2DJUA 3WUZA 5DHVB 5HI5D 4C56E 3LEYH 5IHZB 1JGEA 4Z7NF 1T0NB 5J1AB 4DZ8B 5A2KH 4HJGB 1OAZL 4G8FA 4BUHA 3GMNB 3JWOH 4WO4D 4ZQKB 1OAYH 2A0LC 3KWWA 4H8WH 1FFOB 2BZDA 4RBPH 3O4LE 1S7VA 5IVZA 4XBGA 2HN7A 4MSWA 5H2BB 3TVMC 1S8DB 4LGRB 5DWUL 3V4UH 3OR6A 4Y19E 2ZJSL 1DBAL 4KPHL 1A21A 3TA3A 3O6ML 3T0WA 4OD1L 4LVHB 3TCLA 4F2MB 2D4DA 4OGYH 1ZLUK 2WM0A 2X4TA 3EYQD 3E6FA 2OQJA 4BFIB 5B39A 3L1OL 4P59H 1FIGH 3E8UH 1IZJA 5IROA 4K7PL 1BM3L 1JWMA 1OLZA 2DTML 1RU9L 2AK4B 2OSLB 3TNNA 4ODXB 3LEVH 4HKJA 3RHWK 2BMKB 3E3QC 3ME0A 4G6KL 1QKZL 1ND0A 1ZA3B 5BXFA 5ERWB 2Q8BH 3B2UC 1I3VA 3EO0B 1DLFH 4ODSH 3SGJA 1JNNL 3NH7H 1AI1H 1CTNA 1BQUA 2YOCA 3PXJA 1A7RL 4QRSB 2RB8A 4PRHA 1U8MA 4N5EC 2VLRE 1A14L 3CAFA 5AZEH 3SGEI 4NHUB 2KH2B 3WS6A 1C7TA 3K2UH 3IDXL 3ARGB 2EZ0D 3QDJB 4EZMA 3BEWB 2DQHL 3FQRB 5KSAD 1JPSH 2IFFL 4CGTA 2R2BB 4DZBA 1AGBA 5E2WL 5TFSH 1NC4B 4NQEB 5DR5H 3ARGD 4AQOA 3C09C 3QDJD 2APXA 1X5ZA 3OF6A 5IVXB 2ADJA 4L29B 2N7BA 3MJ8B 2F15A 3VJ6A 3Q5TA 3OG6B 4OB5L 1NC4D 2V9QA 3OJDB 4NQED 5IWLC 1J87A 4FQCL 3VFGH 3B6SA 4MYWB 3QA3B 1BIIB 4KRPD 5I1EL 4LKXB 1PFCA 5J6GA 5GZOC 2C3XA 2H9GB 1Y18B 3WD5L 3MRHB 4M02A 4JO3L 1KACB 4UQ3B 4GG6E 4I77L 1ZVYA 3BKCL 4RA3A 3L5WB 4NP4L 3I3DA 3V8CA 1SBBA 4XCEB 1NCWH 1F3RB 4TPRH 1U6AL 3FHAA 4HG4K 3V5KA 2HH0L 4Q9QH 5TE4L 2DOCA 1CXLA 5IMOA 1EIBA 5DTFA 5EZJA 3DO7A 1VFAA 2I26N 2VXTH 4OZHF 3D48R 5DJ2B 5DK2A 5EO9A 5FCUL 1A3QA 1V3KA 2IPTH 4JRWA 5DD3H 4HF5H 4F7TA 2DKMA 3WXVH 4OLVH 4F7MA 1TJGH 4L8CB 3LVEA 4PV8A 3BN9D 4FNLH 1LEKA 1Q1JL 4YHZH 5I9QB 2R8SL 3RDTB 4B7IA 2HVKA 1QVOA 4O02L 1J8HB 3MUHL 3GSWA 1BAFL 3EAKA 4Z95H 5KSBF 3CZFB 2KL6A 2BSTB 1Q94A 5INCB 5SWSA 1EBPA 1RI8A 3HG1E 3HZKA 3O9WB 5CLTA 5CD5D 5GIRA 1AO7A 1F6LL 1RV6X 4I9WE 3RDTD 4Q9RH 4MA1C 1EUUA 3SE4A 1J8HD 2YUZA 4NN7B 1CFTA 2RJMA 4WFGE 5DFWH 1KJ2B 3W11D 2XQYG 4GW4A 4HXBH 1BVLA 5EIVA 5C7XH 3WL9B 1F90L 4FN0A 4NRXB 4N8VB 1ZLSH 3F8UB 1I1CA 3SDXF 3E6HA 5E8PB 1FGVL 4JFFA 1IT9H 3VI4E 1YN7A 1OAXH 1EVTC 1F58H 4K2UH 3KYOB 4GW1B 2C26A 2AJVH 3VA2C 4HUNB 3BJLA 2B4CL 1YQVL 4PG2A 1T7YA 4ODTH 4G8GB 2APVA 1E6OL 4U1KA 3REWA 2B20A 4XPGL 1KLGA 5JXED 5I1JH 1FYTB 1UJ3B 3L3DB 4Y5XA 1NEZA 3GSNL 3X13A 2YN3A 4G8GD 4KKCC 3RTQA 1K85A 3GIZH 4Y5VA 2UYLA 3B2VL 3BXNB 3ARYA 4GXUM 4HKXB 1H8NA 1CIUA 4I3RL 5F9WC 1XIWC 1JYVA 4WU5B 5DUPL 2BNUB 4HX1B 2GSIA 5HVFB 1DL7L 5KBNC 1J1PL 1NC2A 2FHBA 3GI9L 1R3KA 2Z35B 5FUCC 4J7RA 4IRZH 5KANG 4H20L 4X6CA 3RGVB 1NGYA 5GSVA 3HLAA 2W59A 1J11A 3HRZB 3BZEA 3T4AB 1IM3A 4G43B 4BZ1L 4PRIA 5FA3A 1RQ5A 3HUJF 4LGPB 3IFPB 2E8YA 2IQAA 1YDPB 2NY4B 3MLUL 5JO5A 3UZVB 2DQFA 3RGVD 1N6VA 2XQYK 4O2CA 1X4YA 4DUWA 3H9SB 4TSCL 5GGTA 1BZ9B 3U30B 5TDPA 1HILB 1TNNA 1I8KA 1XGYL 4HPOL 4LRIC 4CU7A 5J9PB 5C0EA 3B3IB 3BPNB 3TN0A 2P7TB 5LCVH 3H9SD 3QDGE 3VXOA 5FYLH 3MRRB 2ADIB 2DJ4A 4Q6IB 4YK4C 2D03H 4ENED 2DBLH 1J05B 4NJ9H 5F9JA 5GS0D 4GAGH 4QHLA 1MF2H 2HLAB 4G7VH 1KPUB 1CGWA 3UTQA 4L8DA 5LGKA 5EC1A 1J86A 1OGTA 4AMKH 4GQ9L 2I25N 1CDCA 2XY1A 4UNTA 3MLVL 5LAXB 1INEH 1TTGA 3GKZA 4JKPL 1PKQA 4D9LH 4Z78A 5ETUB 4DKFH 5IBTH 2FR4B 1A7PH 4IS6B 1O7SA 2R4RH 3KG5A 4G8IB 4JZJA 1CFNA 4MXVF 1UXWA 5DMIL 3CSYA 2BVEA 1O0VA 4JDVA 2B5IC 3KPLB 4Y16C 2VDKL 3ZYIA 2A9ML 3BYTA 1B0RA 2ORBL 3MRGA 4NBZB 4UU9B 2K3TA 1YEHH 4NPYA 1EX0A 2DM4A 1UKSA 3MLXL 4MA3A 4NQDA 1ZVHA 3HI1B 3GDBA 5D5MB 4HKZA 5C0GA 1L7IL 4P2YA 3IKKA 3H6JA 4LVOC 2D7PA 3OKKA 1KXTB 1FNSL 5E95B 4Z7OE 3RVWD 1CXHA 2B4CC 2IBZX 1TVHB 3RUGF 4LPWA 3SDDC 2ZUQC 2OP4H 5I1IH 4PRHE 4H0GA 4ZAKB 1DBJL 1OM3H 4KK9D 1JNHA 3GMRA 4MLIA 1AXIB 2PYFA 1E28B 1NCTA 4I48B 1BREA 3MRMB 4JFPA 4PRAA 1FNGB 4W4OA 3VGDA 3LZFH 4I18B 4NO2A 4IRJA 3WIHL 3VXNB 2PXYB 4HS8H 3QHZH 5FECA 5E0QA 3CVHL 1FLRH 4LASL 3A6OA 4R8WH 3QPQC 4LLMA 4PV9B 3Q1SL 5FAAA 4IRSA 4F8QA 3KPQB 5F7KC 4OV5A 4NRZB 1GZPB 3C2AL 3Q6GL 5I1AA 2JIXA 2VXQL 1ES0B 2PXYD 4LSPH 4P2OA 4EUPH 3O3UN 2P5EB 3EJZD 2HFFB 5EU7C 5L8KB 1IQWL 3G04B 3TF7C 1F6AB 2H32H 1VA9A 3V7AE 3I3EA 2VAAA 3CFEA 4OQTH 5IFAL 3DROB 4HV8B 2VXVH 3MRLB 1MVUA 1U93A 2WP3O 3B5TA 4XCFL 1F11A 4A2LA 5ISZD 4YGVA 3VFTB 2QLVB 4G6FB 4WW2B 1NSNH 4D0BA 2CLRB 2J8HA 5A1AA 1NGQL 3WLWD 3SGKA 2C5DC 4OZIA 2AI0H 4D0CA 1BD2B 4H0HB 1XH3B 2ZSWB 4G6FD 2RFXA 4F15C 1T5WB 4PJXB 1OPGH 5HHNB 3QHFH 5JW4R 1FORH 1XR8B 4O4YH 1RFDH 1RY7B 3AUVA 2NTSP 3OGOE 3D18B 4OZFH 1JGLL 3RWFB 3WO4B 1BD2D 5T33H 4Y2OA 5F7UA 1F4AA 1CD9B 4PB0H 3CH1A 4U6HA 5HPMB 4HIIA 5FO8A 4P23B 1VFMA 5JOPD 4UUJA 3FAWA 1JPGA 2IG2H 4ZUSB 3HZMA 4XMKH 1KCSH 3HFML 5HDQH 4QOKE 2Y07H 4WHYG 1NL0L 5EZLB 3RKDC 3P0YH 3MLZH 2Y36H 1QFPA 1PG7W 5KANI 2R15A 3CFBA 3ULUE 1H0DA 3LEXB 4NSKB 1HSBB 4C56B 4X98A 1XT5A 2H45A 5SWSE 2A74B 4CJ1A 2A6DA 2CMRH 4U1NA 3W9DB 2A6IA 2LTQB 3C60B 3QXVA 3T2OA 2QQLL 3NIGF 2IMNA 4FFYL 2EIEA 2CR3A 4KQ4L 5EBMB 1OAUH 3V4PH 4XXDB 4NWTH 5D1ZB 1KT2A 3MRJB 1ORSA 2APBA 2F54A 3O4LB 4OCSH 3TJHC 4WI8A 2XV6B 1I9RL 1OSPL 3VXPA 3C60D 1FAIL 4Z8FH 2L7UA 5BVPH 3RVTC 4PJHF 3CU7A 1I7ZA 4Y19B 2XN9A 5D1ZD 4ZFZB 1ORQB 3VGEA 4AIXA 3O4LD 3TIDA 5K9QG 1DEDA 2OTPA 4LHQB 1HHIA 1A1NB 1ED3B 3TP4A 5CP3A 1U8IA 1J18A 5F7WC 4AEIH 4OAWA 3A0OA 1QRND 1D3CA 4Y19D 3P4NB 2XWTB 1ACYL 4WWKB 1GGUA 4P57B 1U41A 5K9JH 4J3VA 2PTVA 3MRIB 4JG0H 3NACL 5ITFA 1IBGL 3GIVB 1EDQA 1HSAA 3AU1B 2BVYA 2QHRL 3MACH 1X5FA 4HLZH 3OKMA 4WWKD 1M05B 3FZUC 1DSFL 5EWIL 3PP4H 1QQDA 3Q5YA 4DGVL 1ZLWH 2VKWA 2OXGA 1R3JB 5I1CH 1U95A 3EYSL 3MJ9L 4IDLA 4QHMA 3TVMA 3BVNA 1YEDB 5E6IC 1ZHLA 4K7FA 5C0FA 1AXSB 2VLRB 5JR1L 2KZ1B 4YXLL 4X6CE 5SWQA 3TNMA 4R97C 4UIKH 4Z7VA 5L6YL 2AERT 4YPJA 5A2IH 4HWZB 2DQDL 2CLZA 2QSVA 1VADA 1LE5A 4HIHA 5FCSH 4PRIE 3QIUA 5C09A 2R1WB 1LE9B 1M6OB 3OXSB 2VLRD 3JV6B 5GJTL 3AB0C 2EYRB 4FQIL 2X4RA 5JIPA 3IVKA 4GKSB 1FH5H 4OGAC 5E2UL 5DK0B 2F8OA 2J8UE 1CFSA 3S5LA 1OP3K 1CL7I 4LQFL 4Z7UE 5C0IB 1QBMH 2SEBA 4X5XB 1MJ7H 4PP2B 3QH3B 3U46B 3D0LB 1RURH 1P2CB 5DVNA 5EBWB 3F7YA 5M7QA 2CIIB 2DD8L 3QULB 4NO3B 3WDHA 3W0WA 1Z0MA 1MLCB 3X11B 2YD8A 4TQEL 4JRXA 4XZUA 4K71C 4KK8C 5DUMH 1IGML 2VDOH 4MMXC 3ILQD 2ADGB 4ACPA 2X1XR 1UEYA 4XC1L 2JCCA 1YYML 1BGXL 5EU3B 4GG6B 4GLRI 3GSUB 4QRPA 2PW1B 3G6JE 3CXHJ 4QLRA 1PKQE 35C8H 4ZUWB 5CHNA 2H1PH 4HW6A 3X3GL 2AV7B 4QNPF 4Y2DC 3T2NL 4KZEH 1G7MB 1VGKA 2A9NH 1QLFB 1LP9F 4NQSA 4HHAA 5IBUG 4RRPA 3OZ9L 3R0MA 4JFZH 2O5ZH 3D39E 3SDDD 3ARXA 4QHKI 3O11B 1HHKA 3GJFB 5F88B 4WW1B 5IWLA 4NQDE 3WFDH 3GKWH 4EUPB 4JLRA 1U8KA 1TITA 5FYJH 3O3DB 3PWJB 1CL7L 4UQ2B 4EDXB 3OJ2C 5E5UB 4JN1L 2AJUL 5C07A 3MLTB 1T5XB 3WKNA 3RI5F 1M71A 5K59E 3HG1B 1P4LB 3EYFA 5I8KH 3NFNA 1JMXA 5DT1L 4PJAA 1YY9C 2YKLH 5EBGA 1RUQH 5HYSA 2C1PA 4U33A 5F72S 3HG1D 1WTGT 1I9IL 1IFHL 4I9WD 2HMIC 5JOFB 4RGMC 2OS7A 1JNLH 3MO1B 4AIOA 3ZTJG 2AJZB 1H8OA 4WFGD 1I8MB 1NMAL 4GS7B 5HYQA 1EEZB 1D5IH 4LLWA 1OTSD 2DQCL 2VXUH 3I6LE 4X80H 5JTWA 1VACB 3L5XL 1XCQA 3EYOA 3MCKB 5AAMA 2F19L 4XCNA 1FC1A 2R2EB 2C3VA 3JXAA 2WV3A 1CICB 4JO2L 3IS0X 3QO0A 3VFUB 1KCUH 1X5GA 3L6FB 1EO5A 1WWAX 1MHCA 1KTLB 2AEQH 3ULSA 1LDPH 3BWAA 4NYLA 3QCUL 1CXFA 5L9DL 4NNYA 1FO0L 1CD0A 2YPKB 5DRZB 4AENA 4OLZH 1CICD 5K9QI 4ZFOL 2F58H 3DXAA 32C2A 1QLRB 5C0AA 3BQUB 3EKCA 1DBBL 3PJSB 2BSSB 5GGSY 1G7HB 1A7QL 3U9UB 4TVPH 3ZDXE 5TE6L 3QWOA 1CTOA 2ZNXA 3D25B 5DJ0A 1X5KA 1NFIA 2HRLA 2ED8A 1KEMH 2Q76B 5C0ND 1EUTA 1CD1B 3FQNA 4MA8H 1B3JA 3E1F1 5E08L 1TFHA 4EI5C 4KTEH 1IEAA 3TIEB 1RZKC 1PG7H 3MRKB 3DLQR 2CGRH 4AG4L 5D7SH 1TQCB 2E3VA 1FZMB 5CLWA 2GUOB 2GW5A 3CMOL 3QNZA 4HIXH 1E4KC 1RUKL 1CVRA 1T1YB 1QOKA 2EE9A 4JKWA 1JN6B 4L3EA 1ZK9A 3SCMC 4K8RC 2O26U 4DKAA 2IMMA 2UVFA 3QDGB 2X2YA 1Q9LA 1WAAF 1XIWA 2UZYB 3ES6A 4G8FB 1FFPA 3DMMC 1S7XB 5C3TA 3MLSH 4MQTB 3QNYA 5ACZB 3G6DL 1AGCA 4DW2L 1I7TB 1KCVL 2F54E 1MY7A 3QDGD 4OCNC 3DI3B 1BFOA 1S7VB 5IVZB 5BS0B 1T1ZA 4XBGB 2HN7B 4BSVA 3HC0B 3MLWL 3OKOA 3OR6B 3IS1X 1C1EH 3TCLB 3WEXA 3JZ7A 1ODAA 1JJUA 5C8JA 5BS0D 1P7KB 2X4TB 2OQJB 1Y0LB 4MVBD 2D7MA 5GGTH 1EVUA 3SKJL 3EZJB 4ZYKA 5DHYA 3KPMA 4QT5B 4FQ2H 1JWMB 3R06B 4JAMA 4E0RA 4LRIA 3DNKA 1FFNA 2IANE 5A2FA 5J06A 4HCRL 4AJ0A 1N8ZA 4PJ9D 1BZQK 3L3GB 5ESAA 5FYKD 3V0AC 3P4MA 4QRTA 3VDBA 3HMWL 5E6ID 1IGYB 3S4SB 1TZGH 4LCWA 3S3PA 3NN8B 1ND0B 4TVSa 3HAEG 1F13A 4DQOL 2W9EH 4XPFH 4LPUA 2W0PA 2YZ1A 4JPVL 5F7NC 3VXRD 1XGRB 3A67H 4LNRA 2J4WL 1UB6A 3ZL4L 2ERJC 5E2VH 5LWYL 5ITBH 2B0SH 3ZE1F 4WV1C 1NAML 3DIFB 5IMMA 3ARTA 1P7QA 1ZT4A 4PRHB 1DTUA 4HFWA 4YHNA 4JDTH 4R26L 4NGHL 1ZVSA 3QCVL 2FEDC 4Z7VE 4LSSL 4TUJB 3UJTH 3O45B 1NMBL 4M5ZH 3V7MA 2AXGB 5GGVL 4YGAB 4TSBH 5C09E 4F58H 2WBJB 4HZLA 3TYGL 1ZSDA 3MLRL 5MHSE 1H15A 4IMKC 5DEFB 1WQVT 3JTSB 3V0VB 1GGIL 4OZHA 3U0TA 1QZ1A 3V4VL 2WBJD 5J6HA 3H9HB 3HKFA 4JRYB 2VKXA 3W0WE 4WWID 3B6SB 4G6JL 3OF6D 2FYYA 4XBPA 4JRXE 1UFUA 1S3KL 1TJHL 1SEQH 1HYSD 4O51A 3UPCA 4QRQA 4JRYD 5IM7A 4QXWA 1JWSB 1MFDL 2ITCB 2JCCE 5I6XB 3U0PA 1HIML 1A6TA 4QRPE 5KSBA 4M62L 4FFWC 1FVDB 1BQLH 2AJSH 3MJGX 4G9FB 3IGAB 4OKDA 3EDJA 3FMGH 4BFGA 4CN6A 4U7KA 1MREH 3GSNA 3O4OC 1AXTL 3MRQB 4P5TD 4M6OH 1B2WH 4WEMB 1BEYH 5DUBB 2V7HB 4G9FD 1LD9A 4P4RB 3N85H 3S34L 5CZVL 4KXZI 2VISB 5IOPB 1DJSA 5GZND 5HHOA 5DK2B 4HAFA 4EXPX 2IQ9L 3UROR 3VGAB 3D3VE 1PY4A 4ZO9A 3PNWA 4QEGA 4UAOC 1CF8L 2BHUA 3QEUB 1DQQA 1NDMA 1LEKB 2BC4B 4HT1L 3H0TA 5KTEH 4QOKB 3CFDA 1FP5A 3BGFC 4JO4H 3QT2A 4ZFFA 3AY4C 2R1YA 4XP6L 1YMHB 3QEGL 5F97E 5T1MA 1MCFA 3RA7H 3ARFB 1YEEH 1HXMA 1UZ8B 3FN0H 4QOKD 4QTHB 4PJAE 4ERSL 1MFBL 2X4NA 3ULUD 4LHUG 5DD0L 5DQJA 3VH8A 1BVLB 3ARFD 1PAMA 3VDCA 3T77A 2VDNH 4HPYL 3BP4A 1PBYA 3EOAA 1KV3A 3QUYB 3OGCA 4K07A 4K7PY 4FZEL 4LLQA 4OFKA 5KVDH 5DHXB 4R2GB 1ZMYA 4O2EA 4X6FB 1NUNB 4NC2B 3KYKL 1Q0YL 3HB3C 2JELH 2BOBA 2C4FU 5ADPH 4GKNA 1H3PH 3QUYD 2EDFA 2WBWB 5C2BH 4RGOL 1D5XA 1FRGH 1EXUA 4R2GD 1YPZF 4TTDC 3OQ3B 4U1KB 5JW4N 3V95A 1OF2B 2VLLA 4JREB 1YNTA 4UMGA 3BZFA 3KJ4B 4LBEB 1U8PB 1NEZB 1IGFH 4ODHH 2O93L 2H8PA 2AJ3B 2OMBA 3DXAE 4DEPC 4BKLB 3O3AA 2BK8A 4DN4H 1BFSA 4Q7DA 4LARL 2MCG1 4AYFA 2UWEE 2Z91A 4APQC 1F2XK 5GJSL 5HVHB 1R3KB 2YD6A 3ALPA 4PJGF 4XP9H 4LLDA 4ONFL 2VN4A 2OTUA 1IGJB 1NLDL 1Q9OA 2BJMH 5GSVB 3HLAB 5CP3H 1GJIA 1FZKA 3VFPB 4FS0A 2V17H 5SX4I 4KVCL 2NY3B 5T5FH 2VN7A 4RAUA 3BSZL 1ONQA 4MAYD 4KQ3L 4HULB 4JFEE 5BO1H 2DQIH 4NO0A 4NKMA 3VFOB 5IESH 4XX1E 2OJEA 2J8UB 1H9VA 2NY3D 3IDIA 4LPCA 4N1EA 2UY7A 5BMFH 4AL8L 5I71C 2DQUH 3GRWL 3QFDB 3H7BB 4X0KB 4Z7UB 5I8EA 2MCPL 3V6FA 3CVHA 4JN2A 2R2CA 4EBQL 1TCRB 5FHAH 1DQML 4YHMH 5A3ID 1CGSH 1N0XL 1QEWA 5DJYB 3V5HB 5F9JB 4QHLB 2R69H 1U42A 1NCBL 1SYVA 2KKQA 4IIQC 4RFEB 3UTSA 1X7QA 5IEKA 4TUKH 1NBZB 4L8DB 4RAVB 5EC1B 1TQBB 1BJ8A 5CEZD 1OGTB 3RUGA 3G6JB 4DKEH 3EJYC 3O3BA 3CCHB 4QO1A 4JANA 4M93C 5AG9A 1WT5C 4KKAC 1PKQB 1TCMA 3DVFA 2GCYA 3B5GA 1N0LA 4U3CA 1MCBA 3L3HA 4OI9A 1G9NL 2X4QA 4WCYL 2VLJB 3FT3B 4JPWH 2D7TH 5CFHA 5EU6E 1QR4A 1T04A 1X6NA 1HZHH 4R96A 1KBGH 4BJLA 5EBLA 3D39B 3P11L 5I66A 2VYRE 3PABA 2XG4A 3KPSE 3WE6B 1ROWA 2VDRL 2IADA 3MXVL 2P43B 2VLJD 4N1HB 3FO9A 1IGCH 5FUOH 4MA3B 5FF6A 2X4UA 5LGHL 4LCWE 5J13C 1T21A 3D39D 3MR9A 5J89A 2EH8H 5MP6L 1WZMA 5AYUH 3PWPE 4C59B 3PIQA 4M7ZB 3QB7C 3GHEH 2HA1A 3LB6D 4S1QL 5CUSL 3A6BH 3HR5B 3O6LL 5IF0B 5DLML 5HDOA 1JIBA 4MJ6B 2PYFB 4G5ZL 1CFBA 2EXYC 5JPNA 5EOCJ 2XYCA 4Y2DA 3UTPE 2Q8AL 1KPVB 1VKXA 2ICCA 1IAMA 3SQOH 4GRWH 3IDYC 4LLMB 2HRPH 4U1MB 1FN4B 4IRSB 3TV3H 1U8LA 1UM4L 4XWGL 3LQAL 3QO1B 5KJRL 1GGCL 1UWEL 2BY2A 3GMLA 4ZG1A 5I1AB 4OZHE 4WNQB 4S1RL 2DLFL 1EGJL 2UVEA 4IRSD 4FFWD 4JFHD 1L7TH 5IVOA 3JUZA 4K23L 3I6LD 1U93B 3RVXD 1F11B 1CE6A 1LO3L 1CDBA 1MCJA 3QUKB 1UACL 3CX2A 4MCZB 5AZ2L 3F7VB 3J8F7 1YYLL 3MOBL 3IDJA 2X09A 3OXRA 2AV1A 4PRPA 4RZCA 2VR5A 4ZMAT 5KSBE 1EZVY 3H3KA 3VI3E 1MHEA 4NKOB 1P84J 1K4DA 4CBPA 2GTWB 1OAZH 3SDCC 1XF2B 1U58A 4BSJA 1QSEE 3T0EB 1JHTB 4WDIA 4LSRH 4U6YA 2PCPA 3DUHA 4OUUA 4LMQE 4XRCA 5DRXA 2YS4A 2IAMC 1F3JA 2J88L 3SDXE 2X4SB 1MSPA 3MJ9A 3T0ED 1P5VA 3B9DA 1F97A 4OLEA 1VCAA 2XZCL 1MCOH 2ZJSH 4KPHH 5GRYA 4WTWA 3O6MH 5I8OL 1S78C 5EU7E 4R9HA 5GGSB 1S9XB 4GUPA 1GSMA 4P9HL 4YUEL 1RJYA 3L1OH 3RWEB 3OL2A 3HZMB 4YBHA 1IQDB 1BM3H 1G9NC 3IU3B 2DIJA 2Y7QB 2DTMH 4UNVA 3AGVA 5I18L 4GMSL 5IGXL 1JHLL 2YMXL 3FFCA 4UDUA 4G6KH 4U1NB 3P73A 1QKZH 1AR1D 4M8QA 4D0DB 2VERN 1SVZA 5ENWB 1KJMA 1KT2B 2F54B 5EU4A 3P9LB 1B90A 1NCAH 2ICEB 4KWUA 1P4IL 3KDMA 5SV3A 4EI5A 4KMTL 1RD6A 3QJHA 1KCLA 4J3TA 4XAWL 3INUL 4JQIL 3TGXA 4F37F 1H3TA 5F9DC 1HHIB 1CT8A 4K55A 3OHXA 1KGCE 4KV5E 4XI5C 1CK0L