4KMLB

Probing the n-terminal beta-sheet conversion in the crystal structure of the full-length human prion protein bound to a nanobody
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
AVQLQESGGGLVQPGGSLRLSCAASGRTFSSYNMGWFRQAPGKGREFVASITSSGDKSDYTDSVKGRFTISRDNAKNTMYLQMNNLKPEDTATYYCARGLGIYIIRARGGYDHWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the N-Terminal beta-Sheet Conversion in the Crystal Structure of the Human Prion Protein Bound to a Nanobody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/protein binding
molecule keywords Major prion protein
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kmlB00
5IWLA 1N8ZA 4M5YL 2BRRL 1NLDH 1CGTA 1O5DT 1TZHA 1MRFH 3RGVB 4Q6YA 5TDNB 4LHQB 4J3WA 2HJKB 2IQAA 1LDPL 2X4RB 4MAYA 3GRWL 5EBGA 3R0MA 1WZMA 5KS9F 3C08H 3V9FA 1W0VB 4HKZB 4Y5YC 3WJLA 1Q9LA 1E4KC 3T0EA 5FV1L 1EMTL 3U0PB 4H26B 3LRGA 5IKCA 4AQ1B 5F7YC 2CRYA 1D6EB 1ONQA 1U6AH 4HUXB 3IDNA 4JFYB 2BY0A 3RIAK 1DFBH 4I3SL 5B4MD 1NBVL 1MRCL 1AE6L 3EKCA 4J23A 2NXYB 3LV3A 5A40E 3T4AB 3GK8L 2B1AL 4ZSOB 5H37H 5CD3B 2UWEA 1KUMA 5KAQG 1C5DB 1N8ZB 2X40A 5B39B 1QVOA 4OB5L 2Z93B 4HUUB 3RY5A 4FFWC 3QCVL 2CLVB 2YA1A 4RMQA 3SDXF 1I7ZA 2ZWLT 2IFFL 1DDHB 1JZ7A 4X5XA 1RVFL 1ZHNA 1JGEA 2DLIA 1U8PB 4JFDB 1RJYA 3FQWB 1ND0A 5T1LB 2BC4B 4NZRL 2BY3A 4UT7L 5DJ0B 4WU7A 5ICXB 3EO0B 4Y4KC 5FOBB 2EXYC 5HDLA 1JGUL 4NC0B 5DA0B 4MQTB 4R26L 3CH8A 4J4PC 3FFCA 4I5BA 4RISL 2J4WL 4QRQA 4OUUB 2R69H 5DK0B 3O6FD 5I1EH 4Z0XB 5FO8B 1YJDL 1T5XB 4UIMA 5MEPB 3OKKA 1T2JA 5DJ6A 4KDVA 2LVCA 4Y5VC 5GGTA 3P77A 5D1QC 3QYCA 3U1SL 2E7CA 3UO1L 4YK4B 4Y5XC 3I02A 4NHUB 1A9EB 4GG6E 2DQGH 1U93A 4PJ9D 2IJ0C 2QHRL 3F7PC 3TBSB 3FRUB 2Q8BH 5E1HB 4PTUA 4GKSA 4PGDA 4F7MB 1RPQA 1XGTA 1CXIA 1T3FA 4UV4L 5CS7A 1NCUA 3BUYA 3S36X 2B4CH 2P5ED 1U2CA 3UYRL 1RMFH 2XQYG 1PBYA 3D9AH 1RIVH 3MRCA 4TSBL 3IRZA 1R3LA 1CU4L 3SGJC 4ZPTA 4ZTPL 5DD6A 5IR1B 4E5XB 3MGTB 5J1SC 3PL6C 4P2OB 1OAXH 4XPFH 5C0GB 2MSPA 5DJCA 4RGNE 1VKXB 1Y0LA 2A38A 3GKWL 1A5FL 3JTSA 5E6IA 4BH8B 4HWBH 4OF5A 5BVPL 3NZ8A 3RTQB 1EGJA 1G6RB 1KCRL 3ARDD 5FF6B 4CJ1A 3W0WE 4NZUH 4R97C 1R5VB 2X6MA 3PUCA 4XC3H 3IDJA 5DJXB 3W2DL 3VWJA 5HHQB 3F12B 3HAEB 4LEOA 3RIFF 2XN9A 3FT4B 1QO3B 4ZTOL 1VFOA 3W39B 3CLFH 4R96B 3PIQA 3GNML 3FQUA 4X4MA 4AMKL 3S5LG 3WUWG 3VFRA 5SV3A 3AS2A 1NGXB 3MODH 3SBWA 2DYPB 3H0TB 4XTRD 3BIKA 3QNXA 5TE6L 4FG6D 1I7UA 4LLVA 4Y5XA 4KK9D 3FOMA 1I3VA 1TVDA 4K7FB 5C0AE 3VXMD 3A67L 1LNUA 2FECI 1OGTA 1QBAA 1TLKA 2V2WA 3ZDXE 1EJOL 4EDXA 1CFNA 2E27H 2ZP0T 2AXGA 4H0HB 3GRWH 1QFHA 1EHXA 2BY2A 3F65A 2OTUB 1OD7A 2V2XA 1MUJA 3PWJB 1DQDH 4EI5C 4PGBA 3RWCA 1E6JL 2VIRB 5JTWA 3KPNA 4PJIF 5I30H 3UEZA 1MHHB 2JJUA 3VRLE 3DLQR 4O5LL 5J9PB 1DBKL 1NFDB 4H25A 2V9QA 4GKNA 5JHDA 1EBAA 4BFBD 5FECB 4NC2B 5IEKB 1JPGB 5IP4A 5EFIB 5E4IA 4CU6A 4OGYL 2ADIB 4NFCA 3LV3B 4F57L 3L3HB 5FHAL 2N56A 3EYSH 1IARB 5C0IA 4MD0A 1A1NB 1R3LB 1WFUA 2AJ3A 4X80L 4MQ7A 2BRRH 3UDWA 5EZIH 1CXLA 3HZMA 3T2PA 5ITFA 3QT2A 1U8NA 3GUTB 4M3JA 1RK0B 4Z95L 5C6TH 4LHUG 5D1XA 1KPVA 5KSAA 3WNLA 4JB9H 1NFDF 3LKOB 1Y18A 1P1ZA 1RIUL 4P2OC 4YBQC 5I1JL 1XF4B 4RFOH 1UJ3A 4C59B 3WNOA 2OR8A 3SY0B 1JPFA 3EYQD 5JPMB 4KK5C 4ISVB 2O5ZH 2PO6A 3LB6D 1MPAL 1SHMA 2GUOA 5F9AC 4N0RA 1RZFL 4LVNC 3UCRA 1FE8H 4JE4B 4NQDE 3VXMA 2C1PA 5E56A 1VFBA 4H1LA 1MWAA 5JZ7D 1MCRA 2P5EB 3CLFL 4M8QB 2ICES 3ZDYF 1XGRA 1CK0L 2MCG1 1A7NL 2EC8A 4JHWH 1FHGA 1FO0A 1D9KD 3FFDB 4CVWA 3VRLF 1YEIL 3NZ8B 3VGDA 3BKMH 2VDMH 1NGQH 1Z9LA 3NFSL 3VGAB 4N0CD 4HULB 2VITA 4QRTB 1SJXA 4OLVL 5DHXB 4BFGA 2NY2C 5BQ7A 2O93L 5DO2C 2FBJH 5L88L 1C08A 5JW5A 1AO7A 1KTDB 3AY4A 3K7UA 1MCSA 1GZPA 2PW2B 3M8OL 4U1KB 3SOBL 1F00I 3O41B 3TVMC 2D3VA 4OSUL 1WBYA 3S96A 1IM3A 4LCUB 2Z31A 1EO5A 4DGVH 3C60B 4NNYA 4WUUD 5ID0B 7FABL 1UB5B 5DQDH 1KJ2A 1VFBB 2CLVA 3GO1H 1IGCH 1R3IH 2VITB 3HAEG 5HGBA 2ESVA 3MR9A 3S5LA 3WUWA 3K81A 4QRRA 2KZ1B 2DWDA 5FFLA 5EN2B 4QF1B 1KN2L 4NM8L 4S1SH 4RMWA 3RKDC 2Z35B 3MXVL 2FEEL 3ULUE 4AT6A 5I74C 4LLUA 2AJZB 5EORL 3ZYOA 4KHTL 1XF2B 2C3VB 4O2FA 4KI5D 5SV4A 4NQEB 3QH3A 1ZLWK 2VC2L 5D9SB 1FFRA 1RK0A 4N0YL 1NLBH 1X3DA 5C7XH 4DEPB 5IT2H 1PY9A 5F93C 1WJ3A 3DMMC 3HMWH 3WEXA 4GRWE 5T3ZL 1JVKA 3NCMA 3U9UB 4HT1H 3TF7C 4YAQB 1MI5A 5E2VH 1TJHH 1I1RA 4HIHA 1BD2A 2VLMD 3AM8C 2MHAB 1CG9B 5GJTH 5GS0L 4KJYA 3TO4B 3BPCB 2XRAL 3P4NB 2HFEB 2Q76B 1MCPL 1LO5B 4DVRL 2WWKO 3ARGA 3FB7A 4IEFB 5ITFB 1KJ2B 3HR6A 3UC0H 2BDNH 3GMMA 3ULVF 4PJBE 5ICZA 2NXZD 3HA0A 3QJHB 5IOPA 3DXAA 4DCQB 4GQ9L 1CFTB 1NAMA 4PJCE 1XT5A 3MJ7A 4OLYH 1ROWA 3R06A 3O41A 4BZ2H 1EAPA 1XGRB 3G5ZA 4IOFD 1JK8A 4HUVA 4G9DB 3BIAX 4Y88A 1K5NB 2FR4B 4B7IA 3QDJE 3WMSA 2AJSL 1VGKB 4LLYB 5F6HI 3S88H 2EDEA 2VH5H 4PFEA 3G6DL 3MRDA 4HWNA 3DPBA 1AD0A 4Z7NE 2DWEB 5I17A 4PB0L 4ZO7A 3N06B 5KG9A 2V9RA 4PLKC 3MCG1 3K3QA 5FDWA 1SBBA 5I8OL 1G9MH 2A2QT 2FATH 4J4PA 3KYKH 5SWSB 4AEHH 4NNXB 4OZFA 3MYZA 5DZLA 2D7TL 5ILTL 3TWCL 2IQ9H 4EIGB 5DJXA 2VB5A 4OFIA 1D6EA 4PGJA 1ZS8B 4NRYB 5CD5D 1XH3A 4E41B 5HY9A 2AJ3B 4XNMA 1ETZB 5EOQL 4PRBA 1A6VL 1INEL 2B0SL 1JHTA 5IW3A 4W6XB 3CGTA 3VFTB 5JORB 1DQTA 4GRWB 5BW7A 4JDTH 5DVOA 1G7MA 4FQIH 1MIEH 4LEOB 4JFPB 3U0TB 2EDLA 4OD3L 4DGYL 1DQQA 4Y19A 2YPLA 4HJGB 1TVBB 1RZJC 4P49A 5EC2B 1MFBH 3HR5B 2WIIA 5JIKA 3SDXE 2QADB 4Z7VA 2DJUA 1FFOB 1E6JH 4WTZG 3TZVD 1BAFH 3ARFB 2VZSA 5H2BB 3CDGB 4YR6A 1FH5L 1NAMH 1OAZL 1KG0A 1ACYH 2ARWA 3IDIB 4TYUA 1TIUA 3HI5L 5DVLA 5J1AA 3ZZ1A 4N9GB 5D7IB 1CGXA 1KF9B 1KELH 4KKBC 4K23L 4UT9L 5DDHA 3QDMA 3VXSA 2VWEC 2XWTB 1YNTB 4EN3D 4AIOA 2C1OB 2O5XL 1KTLB 3UJJL 2X4SA 5DSCA 3QUMB 3SCMA 1IAIL 2EE2A 2R0KL 2Q8AL 4TUJB 2MJWA 2Q20A 1PSKL 1NJ9A 1BIIA 3BDYH 3HG1E 1FP5A 3U6RB 4I3GA 4G6FD 2W60B 1IGJA 1EO7A 3SN6N 5D5MB 4PJDA 1SQ2N 3VWJB 4X98A 2UUDK 5IJVB 1IILE 2P8PA 2VLKE 3PWUB 4K3DH 43C9B 4IJ3C 5AZEL 4NSKA 3FZUD 3L7EA 1W72A 2GFBA 3QUXD 3IF1B 1F4XL 1A4KA 1MCKA 1PDKA 2BNQB 2EO9A 3ET9F 3LSOA 5ISZA 4AL8H 4JO1H 3TBWA 1YN7A 4F3FA 3V6FA 4GXVH 3BWUC 1RURH 4KROB 4LK4A 5JDJA 4QXTA 1CZ8H 5DRNB 3WHXA 3V4VH 3MLZL 1HHKA 3VG9B 3TT1L 3C6LB 5J3HC 4NOFA 4MJID 4XNXL 2APXA 4OLYL 1QBML 4FFZL 3QUKA 1TJGL 4OQ1A 4BH8A 1CD8A 3TPUA 1H3VA 3DRQB 4UQ2A 4DK6A 5F1IB 4RGNC 2Q7NA 3FRPA 3LPWA 1P7HL 4P2OA 2HRPL 3OR7A 5DFWH 1RJZB 4ODWA 4ODTH 5TE7H 2BMKB 15C8L 4PB0H 1HNGA 3OKEA 5IMKA 3HMWL 4Q9QL 4XH2A 5F89A 5IEHA 5HI3D 2H2PD 3MRCB 1UWGH 1P9MC 4YXLH 1FV1B 1ZAGA 3MV8A 2FZ3A 1T3FB 2K9UA 3DMMD 1BOGA 3VW3H 3GI8L 4EOWL 1UXWB 3RBGA 1GGIL 2A74A 4QRQB 1F3DH 3O8XC 2VJXA 4OI9A 2E7LC 3I6KA 2DM7A 5EN2A 3UTTD 1TZIB 1DFBL 4DQOL 4LSQL 3LKQB 4R2GD 2YKLL 2WK2A 3LCYA 4BZ2L 3RZCB 1I7TB 5CZXD 2EE6A 1N59B 2Q1EA 2B1AH 4FHBD 5FOBA 1PX4A 4NO5B 5D2LE 4LARH 4NGHL 3WIHA 5GGVY 3MRGB 3MRBB 4LARL 2W0FB 1HE7A 1HZHL 4PJDE 5C0CB 2AERT 4TULL 1WIUA 3PQYA 2BHYA 4WDIA 3SOBH 1RJYB 3DGGA 1QOKA 2F54D 3QHZH 4MAUL 2WP3O 4R3SA 3ULVC 5TQ2L 2AK1L 5MENB 5HHVL 3E1F1 5AD0B 3UBXG 1M05A 3HE7D 3KWWB 2VABA 1QLEL 4JKMA 4IJ3B 4HC1A 2IH3A 3FB6B 5GSRB 3D2UB 2VMFA 5DUBB 2ZOLB 1H3TA 4G7YH 5DJ0A 1NC4B 1FBIL 4K3EL 4M6AA 5E8OA 5IB2B 1RUAL 4MLSA 1CICB 4N0CC 1KYOJ 2RGSA 5DURD 5EC1B 3TO2B 1U8PA 5DRWA 1KFAH 4PJ7F 4P4KB 5DEGA 3TT3L 4YE4H 4P46D 5MENA 3DMMA 5IB4A 4PD4J 4U6YA 2J88L 3L5XL 5CJXC 4DN3L 4BUHA 1JYNA 5ADPH 5FKAA 2D0GA 2WIMA 1WCQA 1JFQH 4KKCD 3BE1L 4ZFZA 4NO0D 1LVEA 1A3LH 4NQED 5JORA 2FJHB 2G75A 2D0FA 1MJUH 2A74B 2IC2A 4GH7B 4F37K 4WVRA 3MV9B 3RIFK 1A7RH 5D5MF 3GMRB 3LQAL 3REWA 4NDMA 5JIPA 4OIAA 4KPHH 4URTB 2B39A 3EYOB 4L8DA 3JVGC 5IIEB 2PKDA 3QH3B 1TVHB 3HI6L 5GS2H 3I9GL 3M1BB 4NNXA 3ZTJG 4YHYC 3V4VL 3TCLB 2EDXA 3KPOA 3MV8B 4QOKA 3LPFA 3ARBD 2ZNXA 3T2NL 4JN1H 1IQWH 5L0QC 1IC5H 4NHCL 2EH8L 3BH8B 5E9DA 3WNNA 4M7ZB 4OCWH 3VRIA 1KJMB 5FB8A 5MI0B 5IHZB 2I5YL 3PGCB 3MFFB 1OTTC 4QRPA 2BSSA 4OZ4A 5D2LA 1FO0H 4M93B 1X7QB 2FX9L 3DGGB 3DX9B 5IESL 4Y89A 2DKSA 4YQXH 4X7FC 4BK5A 1YMHB 2FBOJ 2AEPL 3OAZH 3WJLC 2NX5B 1C08B 1MFAH 1HHKB 4PUBH 3SDYH 1T03H 1GL4B 1WFNA 4X6DE 1LO4H 2CR3A 2HTLD 4E9LA 3QAZC 4JPKL 2AQ3A 1KLGB 5T5FH 5DA4A 5MEQA 5EZLA 2HTKD 4YE4L 1XR9B 3GNMH 2R2HB 3HC0B 2YBRA 4UB0H 2DLTA 3BESR 4MA8L 5GHWH 3H42L 3HHRB 3ULUF 3UJIL 2R2EB 3JWOL 4H1LB 2P8PB 4JM2A 1L6XA 2X4TA 5DT1L 4MB4A 5CILH 5BO1L 3ZSSA 2PCPB 1A21A 4Z8FL 1G6RA 1NCNA 4TRPH 1KTLA 4YC2C 4CGTA 2R0ZH 4LLUB 2VN7A 4ZUSB 3WFCL 4TUJA 3MZGB 4PJHF 3KPQA 3V6OA 2HVKB 3P9LA 4KVNL 4D8PA 1HHHA 3W9DA 3NACL 4OZHB 4PJFE 4L8SA 5IQ9A 3BISA 4JLRB 5DMIL 3ZDZE 2D7TH 4RDQG 5KVMC 4ZFOA 5CINH 2BSRA 2NY1D 4ZUVB 2DF3A 2GQHA 5EU3A 3L7FA 2NY4C 3WHXB 4PJ8B 2J1KA 3ZYJA 2CGRL 3DHJA 1FGNH 3IKCA 4UTAL 1JF6A 5CLTA 4L9LA 5D72H 4ELME 4P4RA 5F96L 4YHPB 1X5KA 5IEKA 4UUJA 4QHKJ 3X12A 5FK9A 1VACB 4LLWA 5IQ9B 1HH6B 4QRPE 1JNNL 3FQXA 1OHQA 3U1SH 5E8DH 4CVZA 4E41A 1ZWIB 4HIIA 2CLZB 4NZUL 3OKKB 2N1KA 5GIRB 4FQHB 1AGDB 3IXTB 3U6RA 3SQBA 3G08A 3WXWL 2AKRB 2M26A 4JREC 2H2PC 5CKGA 2V5RA 1I85A 2X4TB 2DQIH 3GMPA 3AFLA 2DQIL 1BJ1J 1S7RB 4AEIL 2PO6B 2GCYA 3UPAA 1JBJA 4I0PB 4X9GA 4AEIH 3QAZB 4H5SB 3QDMB 4KI1A 4E0RA 5F7MC 1FNAA 3FT3B 4WUKL 4CJ0A 3BN9C 1FLRL 1CU4H 3B3IB 2HT4D 3TBTA 4PRHD 4J4PD 2PR4H 3S3SA 3HE6B 1XR8A 1T0NA 2I9TA 4LSSH 4OLVH 3EUUA 2IG2H 4KMTH 4PJHB 1J1PH 3FO1A 5IT2L 2Y07L 1J8HD 4GSDH 3UBXB 3MOBL 4HDIB 1JHKH 4OGZA 3T08A 2X4OA 1YNKH 5ALBL 4XNUL 5JUEH 5B22A 1F8TH 4ZDHB 1RZ8A 4RA3A 4KRPB 4ZXBD 2NX5E 4OLUL 5BV7B 1QFUL 3ULVH 1OP3H 3VGGA 1JZ3A 1L9NA 2Y5TA 4NT6B 2ZUTA 3VI3F 3N1MC 2XZCH 2CD0A 5E99L 4XPGH 2JKXA 3Q5TA 5JXEC 1OTSC 5HVFB 2KDGA 2PN5A 5FGBC 3RWGB 1OT2A 2X41A 4KWUA 3P4OB 4JHAH 4H8WH 5DC0A 5IJKA 3JUYA 4WFFE 1GC1C 4EIZC 1AC0A 4POZD 3O6MH 3VXRB 4KKLD 2YN3A 2WAHA 1J1XL 5DJ8A 1QQDB 3EYVB 1RUML 2ADGA 2X70A 4LOUC 1DEDA 3EJZD 2YRPA 1FZOA 3GSQA 4JRXD 1BLNB 2FCBA 4HAGA 3BMVA 2DQTH 25C8H 1FNGB 2Y5TB 4J3VA 4OFVA 3WCYA 1GRWA 1ZHLA 2VLJA 1V7NL 3EFFA 4B0MM 4P2RD 3UMTA 1LD9B 3IETB 3Q6FB 5E4EC 5HJ3B 5BXFA 5EUKB 2JIXD 5JW4N 1DCLA 1HSBB 4JFED 1YC7A 3ARUA 3GSRB 5DURB 4JN1L 2BNUB 2EDBA 1C5CH 1IAIH 4MNQA 3GK8H 2A6DB 2VYRE 4LSRL 4LFHG 5DJCB 5F6IB 4F7PA 2C5DC 3VXUA 2BJML 5HVHB 4LU5H 3O9WD 4JQIL 4JFQB 5EDXA 3TBTB 4JQIH 1MI5B 3LS5H 4LKXB 4EUPG 5JW4Q 3HI1A 5TQ0H 1MJUL 5A2KH 2Q86A 5C08B 3BGMB 1IAMA 4RZCB 5FDYA 4BSWB 3OBAA 4PP1D 4GS7C 4M1DL 3GM8A 3CVHH 3U48A 2H41A 2FJGA 1X4ZA 1C5BL 1TETL 1ACYL 1IKNA 3WNPA 1QR4A 2G60H 4OV5B 2ZCHH 1FSKC 3H3PL 4GKSB 4I1NB 2Y1VA 4LIQH 4UIKH 3DURA 4PY8J 4EJ1C 1Q1JL 1G7QB 2Z31C 3QJFB 4XCFH 4JRXA 4FXGA 1H3PL 3QPQC 3KJ6H 4JKLA 1ZHBB 1BFOB 1HILB 3C87A 1HWGB 5EU7C 5F3HA 1QNZL 4HUKB 5GISL 1JGVH 1PJ9A 3KDMA 5L8LB 3H7LA 2P5WB 4QCIA 2MFNA 1KCUL 3VFMA 1RZ8B 4EBQL 2NW2A 4KZDH 1LO2L 2CDEB 5TDPB 3ABZA 1QSFD 3DJ9A 3MC0A 4NQXA 3QCTH 1WC7A 4OZHE 4PJFB 2WLZA 3MLSH 3KYKL 1A7OH 5DD3L 2P4AB 2XFXB 2DQFB 3QEGL 1KIQB 1VFAA 3QUYA 5DGQA 3X11B 1C1EL 4WHTA 5C09E 3TCXA 1KIPA 1M1SA 5BRZE 2VSDA 1KCKA 2I9LB 1R3JA 3IAPA 3O3BA 3QO1A 2AXGB 2J8OA 2PYFB 1U8LA 3O0RH 4KJWD 1YY9C 5HHPB 4NYLA 3V4UL 4JDVB 32C2B 2OBGA 4KROC 3S37X 3AREC 1SEBA 2XTJE 3O2WL 1DQLL 4PJHA 1NGPH 4WO4A 4XMPH 1T21A 2MQCA 4DWHA 1T1ZB 4XGZB 1QR1A 4GW1B 1SYVA 1QA9B 5D6CA 1IRAY 3ARBA 4H8WC 2NYYD 4QTIL 5IUSA 1A14L 4P4KC 4RAUA 4CN4A 3RJQB 4IRSB 3TA3C 1NMBH 3EO9L 3FQXB 2HJFA 3TIDA 1TJHL 1ZGLM 1ZT7A 3GMNA 4JRYD 4WFFD 2FL5A 3QEQE 3P0VH 5DD1L 3HZVA 1S5IH 4OCYL 4UT7H 1X9QA 1YQ2A 3C60D 2KQMA 2L7JA 1GVIA 4QY8B 1QTYT 4XPGL 5BZWA 1YA5A 4U1HA 4YDIL 4QTHB 1VKXA 3NCBB 1HQRA 4JHWL 4ZO9A 5SWQB 4JFEB 3BKML 5FO9A 2EE3A 5GHWL 4PJEE 1CDYA 5DEFA 4MMXC 3NCFB 4YLQT 1NC4D 4NRZA 4XNYH 2MPAH 1HQ4B 1PZUB 1U8KB 4HS6A 3V52H 4F9PC 5BZDB 2ERJC 1A7OL 1DP0A 4YXHH 5D7JC 5FKPB 1P4LA 2D4DA 3QP3A 4RGMC 4XWGL 4IOIA 2SEBA 5KSAD 1DVFC 3JTTB 1K4CB 3BRFA 3WXWH 4QXTB 1FZMA 4LGSB 1GGBH 5EBWB 5BOPA 2HJLB 2L7UA 5DMIH 1QSED 4NHUA 1JF5A 1NDGB 1JWUB 1QBMH 4N8CL 1XIWA 2GT9B 3GBMH 3P77B 1T2QH 5TDOB 4P3CH 1DQLH 4V2CB 1QKZH 1UG9A 4XMLL 2PXYC 5DJDA 3HNTH 5FYJL 2J8UA 4XMPL 1GJIA 1X5XA 4W6WB 1KXTB 1YY8A 1MRFL 2WINB 4I0PD 5DHVH 2R0LH 3O4OB 5FYKH 2BSED 4KQ4L 1ZTXH 3IJSB 4S1DD 4OZFB 1ZVHA 2YPVH 4P5MB 3STLA 43CAB 3EYFA 4IHOA 4XP4L 3PG2A 1G6RL 3BN3B 3VG9C 2YWZA 2NY1C 3B83A 4UV7L 1ZA3A 1UKQA 3S3JA 5JPNB 5K9JL 3HTLX 3MRRA 3ZKMC 1O0VA 3S9DB 4ZNEE 1IKFH 4ZAKD 1V3KA 2HJLA 5FM5M 2YPKA 1MFDL 1BZ9A 3SE8L 3IDUA 1R0AL 3VG0H 1CLCA 3KWWA 2YS4A 1I9JL 4WHCA 3B2VL 3I2CL 1I9JH 2F54E 2IH1A 4LSUL 4JJHA 2B0SH 2FX7H 4B5EA 1B4JH 3SDCC 3U4BL 4RDQF 1EXUA 2VNCA 1U58B 3TM6A 1G7IA 1A6TA 5E8EB 1BEYL 4X6CF 2FWOA 1UZ8A 1XF3B 3ZYZA 1YEKL 3LRSB 4M5ZL 5CJBA 4G3YH 1N4XH 3MRBA 2DTML 2ICWB 5FCUH 5DT1H 2VXSH 5IGXL 1RULH 1PQZB 1NKOA 1FRGH 3T0AA 3QPQD 5JDSB 2R0ZL 4L4TB 2XXMB 5ID1B 3FB8B 4RSVA 3BH8A 5E9DB 4KZEH 5GGTH 4OZIE 2YN5A 5JQ6H 1OSPL 2VLJE 4Y2DB 4Q97A 3O3EA 5DK2B 1HXYB 2WBWB 1FL6A 1Z2KA 3F5WA 3LQAH 3VFMB 3MCLH 4LCCB 2P5WE 1NPUA 2HT4C 3O45B 1CE6B 4PLJD 4HUNB 4R4NC 1B9ZA 4BFIB 5C2BL 3HC3H 4Y2DD 3WS3B 4X83A 4GBXA 1RV6X 4N8CH 4P0DA 1R5IA 3GHBH 5EU6D 1T6WA 4JEGB 5T3XD 1LP9E 4YZFE 2EYTA 1ZLUK 2WZPD 2FYYB 2BC4A 3G6JE 2A83B 4WY7H 5C7XL 3CJJA 3UZEA 3V0WL 35C8H 5DMJB 1AHWA 2BFVL 2FR4A 2A6KA 1Q72H 4O9HH 3KJ4B 2AJYL 5I71B 3MJ9A 5HYQB 3IS1X 1A4JA 2Q3AA 3BP4B 4WI7A 2BNUA 3BHBB 3D25B 2NY2B 4XC3L 1N6QH 5I2IA 3AXLB 25C8L 2V5MA 3BFOA 1LE9B 1T4KB 2QSTA 4NCDA 3B3IA 5D7SH 2J7LA 3F58L 2WNGA 3NFPA 4OGAD 1KLFA 1HH9A 3PP3K 3O2DH 5F7HA 4CBPA 3V6ZA 2GSGB 3I50L 4LMQI 2HG5B 4PJBB 1L4IA 1IT9H 1CFQA 4Q9BA 2RBLA 4PJ8D 1SY6H 4FQXA 4LPTA 3CX5K 5C0EA 4YHMH 4M8QA 1IC4L 3IGAB 3CK0H 3OTTA 1AIFA 3RRQA 3QFJE 3QHTC 3MV8D 2ZG1A 3C5SA 5J0BA 2AV1B 1VENA 3B9KC 1YYMH 4OZFG 3SCMB 1GPOL 4TNVF 1ZEAH 4QRUA 4JFFD 3BZFA 5DRXB 4JFOA 4LAQL 2NY5L 1EEYB 12E8H 4JO1L 3VRJA 5J8OA 1MFEH 2OS7A 3OR7B 1FG2A 2NXZC 1KXVC 3GRWA 5CUSH 1DUZA 3LKOA 1FL5B 1X5AA 2UVFA 4HZLB 1E6OL 3QZWB 4EOWH 1TZGL 4K2UL 4WU5B 6FABL 2GTWA 4DK3A 1CDCA 5DHYB 3G04B 5CGYD 2AEWA 4JM4H 2WM0A 1HK6A 4YJZL 3GBML 4KUCD 3X3GL 5I0ZA 1I3GL 4KRLB 2V5TA 1LK3H 3IU3B 3WN5A 5DMKA 3TBYB 3LZFH 2I26N 4KHXH 1YJDH 5I8CA 1FFPB 5JHLL 3RU8L 5I1DA 1H5BC 2GK2A 2PYEA 3O2VL 2CXKA 1ORQA 2HLFD 3QHZL 5F3BB 4QTHA 1BQLH 3HE6C 1RY7B 4XNZB 4FQCH 1CXKA 5GRUH 4HWZA 1XGPB 3LPGA 2ID5A 4RMVA 4DN4L 4EVNB 1EHLL 1S9WA 4YGVB 4A6YA 1QEWB 1D3CA 2EIBA 5F1NB 1WVZA 4O58L 4KRPD 4ZXBB 2OSLA 5D96C 5MEND 5HHNA 1H8NA 1NCDH 2EDFA 3ELAT 4RFNC 4U6XB 5E03A 2L0DA 2WQ8A 2IF7A 5A43C 4X4YA 4K94L 4JRYB 1CIDA 5I75C 4OD1H 1FDLL 3WBDA 5DJAA 2VUOA 4KTEH 1G1YA 1Z0NA 4F33A 3GMQB 1MLBA 3T2OA 1FAIL 2DYPA 4IRSA 2H2SC 1TQBC 2YD2A 1I9RH 2ARJQ 1D6VH 4UB0L 3CLEL 4OCRH 1FCGA 3ULUL 2F8XC 3RVVC 5DUML 3RWFA 3HAEA 2FSEA 3U30B 5KVFH 5D7LE 3HG1B 5GSVB 4GAYA 3RWGA 3P9WB 5T3XH 4A6YB 3FHAA 1AD9B 1U8OA 3AAZB 1D5XA 1TTGA 4NQVA 1TDQA 4DGVL 2D4FA 2VZVA 2NY4B 3MFFA 4NO0B 4QRPB 5IB5B 2HFEA 2Q76A 4WEBL 4YHKH 4LVNB 2R2CA 3P3YA 4TQEH 3F6LA 3L3KB 3NIGF 1V7NH 5SX4H 4X9HA 1Q1JH 1VADA 1MY7A 4N1EA 5HBBA 1PKQB 3I3BA 3I6GA 4IRSC 3WL9A 3HCVA 3CSYB 2CDEA 3MLVH 1N64H 3U4EB 1SJHB 1AGBB 3K8MA 4JZOB 3QBTB 5CZVL 5IIEA 1F2XK 4L4VE 3ARGC 4CNIB 1RZJL 3KNBB 2F15A 1FRGL 2X1PA 1HI6B 2GEEA 4OD3H 4DGYH 1R3HB 3MJ9L 3KYAA 4XHQA 1K9TA 4ZPVA 2Y7QA 1L7IL 3DGCR 4FQCL 2NLJB 3TBSA 3R1GL 5IB1B 4JO4H 3WD5L 2NY3D 4JREB 4HPYL 1MOEA 1T7XA 3DI3B 3O6KH 4P48A 2W9EH 4PRBB 4WW2B 4M7JL 1SM3H 1T1ZA 4AEHL 1MELA 2QSCL 3OJDA 2P48B 1TCRA 2ITDB 1W0YT 4RWYH 4PRDA 5GRVL 1QPPA 4MHHI 4UV4H 2PUQT 5T33L 4GG6B 1S7QA 5IFHH 3BZEA 1AXTH 1S9XB 1YMHA 2NXZB 2R29L 3T65B 4HIEA 2YK1L 1KFAL 1KC5L 3NIGE 1G9NC 3CDYA 1OT1A 2ZUQB 1I7RB 3HNVH 4NKIL 2IADA 1UFUA 3VFVB 4MCYB 4P2QE 3QISA 3T2QA 1KB9J 2K3TA 4I9WE 4MNGA 3KXFD 3MRIB 3CC5B 1JL8A 3CU7A 4RGOH 5DJYB 1LMKA 2J8HA 2H2SD 4RIRB 4XRCA 5I1GL 3UTPD 4KTDL 5ETUB 3IKCB 4OZIA 3EFDL 4FABL 5I6XC 2W38A 1CE1L 4HWBL 5BVPH 1KACB 4M7ZC 5C0CA 3C5ZB 1T1WB 1EEZA 3RL1B 4YPGA 3EFFB 2P5WA 4QCIB 4TSCL 5HI4D 3BVNA 3CDCA 2BSSB 5HI5D 3U30C 4JLRA 1I1CA 5K9KA 1I7TA 3R8BB 4BZ1L 1CFVL 3H9HB 1NC2B 4YHLH 1JRHL 2D9CA 5ERWB 5C9JA 1JV5B 2OX5A 5JHDE 4I0PC 4JR9L 3B2VH 1S5HB 2PO6C 3VFNB 1MCOH 2R1WA 5SWZE 3TNNA 4LSQH 3MJ6A 1U93B 3ZSTA 4P5TC 2UWEE 5F8QC 1EZVX 2RCSH 1CT8A 3NFSH 3SDDA 1KB9K 2G5BA 4K3GA 3KJ4C 4OCRL 1PFCA 1RZGB 2VDPL 1CWVA 2X4NA 4UOW0 5I75B 3T0ED 4LCWD 1YUHA 4QOKD 4CKVX 1W0WB 2QL1A 4I77L 5E8DL 4DZ8A 4NO2B 3G6DH 3DVNB 3MV9A 1QFWL 2YBRB 3BN9D 1DBMH 2EICA 2IFFH 1X5FA 4M03A 4RMRA 5DVKA 1PKQA 1GZPB 1UYWH 3D69A 4CW1B 4LVHB 3BKJL 5D1QD 2QQNH 1RZFH 1N3NB 5EO9B 4ZDHA 1VCAA 3RI5F 1D5ZA 4MQSB 2CXGA 4P46C 3VXME 1M05B 3VJ6B 2ED8A 2FHCA 2FD6H 1YJDC 5ICXA 4TNVK 2VDRL 2V2XB 5E0QA 1K8IA 1NBVH 5IHLB 4HWUA 5EZOH 1WSST 3FO1B 2AVGA 5JOFA 2KQNA 5IHBA 4MNHA 1GAFL 2W9LA 4XPHL 4APQD 4YFEA 4JGUA 4H20H 5C6WH 1CICA 5C70A 1MI5D 3I75B 4NKDA 2IAMB 5M94B 4N0YH 4XVTL 4MB5A 3LOWA 3ESVF 5C0FA 3DROA 1BZ9B 4LRNL 3NA4A 1UXSB 1RVFH 4M7LT 3I6LD 3D69B 4CW1A 3MACL 1ED3B 2VE6B 5GGRB 2AEQH 2NY5H 2YUWA 3VFUB 4XI5C 1AGEB 4YXLL 2X7LB 1OGAD 1TQBB 2AKRA 3OL2A 5ITBH 5C0CE 3ALXA 4D0CB 5T1KD 2HWZH 1W72H 4HFUH 1RD6A 4OJFL 4OF0A 3WV0A 3IJSA 4NCC2 1LO4L 5F1KC 3MLXL 4R4BB 3RNKB 5DHVB 4JZOA 5IEHB 2J8UB 4RFEB 4ZFFB 1IAKB 2GI7A 5J13C 1BF2A 2R2BB 2CKBA 2FIKB 3QIWC 1A3RH 1H3GA 3GJFK 5EWIL 2HP4A 4MXWH 1AP2B 1NEZA 1VESA 1X44A 4XNZC 3VMPA 3DRTA 4I2XA 4JB9L 1QRND 3RKDD 5KW9H 3OZ9H 3DV4B 4TOYH 1JZ4A 3MJ9H 1AGBA 1PY4A 2PTVA 4FQXD 1JGDB 4K7PX 4Y5VB 4M6NL 3K4ZA 1DE4B 2H9GA 3JXAA 5GSVA 2IPUG 4I18C 1MFNA 1T0NB 1VADB 5I71C 4XVJH 5DUBA 1C5BH 3FCTA 3LD8C 4O5LH 4KKNA 4NPYB 5T5FL 4S1RL 3KPSD 1K2DB 3KR3L 3HS0B 1OY3B 1A47A 4QRSB 3BKYH 3PDOA 4IRJA 4K9EL 5IG7A 5LQBH 4AIXA 1B4JL 4NSKB 2XG4A 4K7PY 5DJZA 4CVXA 2QQKH 4LHUB 5KS9E 2CUIA 1U91B 4DW2L 1MIML 1QSFB 2BJMH 2GY5A 1LEGA 4DW2H 5E70A 4MJ5B 4QYOA 5GIRA 3VD7A 5SWSA 2VAJA 2XKNB 3ZMRA 1FZJA 5J11C 1ZANH 2VLME 3CVIL 1A22B 4S11A 3V4PH 4UBDC 3QDJA 4KK8C 4EEEA 4TTDC 1RIUH 2ENSA 4YXHL 4V2BA 4ZS6D 1F2QA 2CLRA 2WBJB 1HH6A 1QFOA 1H0DB 4R96A 2GSGA 1Q9OB 4U1IB 3V79C 5E5MB 1YC8A 2HTKC 2Q8BL 1YNKL 5ALBH 3B6SB 5I66A 2EDNA 3QDGB 3SE9H 4X6CE 3WYRA 1MQ8A 1K3IA 1NDMB 3DV6A 3I84A 3MNZA 1RUAH 3CDGA 4O00A 3OAUH 1DZBA 1FDLH 3NTCH 4AK1A 1TPXB 2NY2D 5BW7C 4ZD3H 1Z9SA 3QXDB 5C6PB 5IG7B 3WKNA 5GS3A 1A6UH 2Z93A 2VWEE 1NBQA 4NQDB 4S2SB 4D9LL 4OLZL 3QO1B 5F7UA 2DTMH 3RA7L 1CQYA 2ZCLH 1MCDA 3B5HA 3MLTB 4HBCH 3U36B 3CVIH 4OFPA 4GO6B 4NN5B 3D48R 3BEWB 5DRXA 3WFHB 3EO9H 1OM3H 2DOCA 3GSOB 3E0GA 4FMKA 5D9SA 2QHRH 4HS8L 1U3ZA 4KU1A 2ADJA 4HLZH 1M7XA 1DR9A 3NFNB 5DK2A 5F7NC 4JQVC 1FBIH 3L9RB 4K3EH 3F7YA 4FQ2L 1DN2A 3B9KB 3NOIA 3VXSE 1U36A 3PGDA 4NN7B 4GKZB 4PYGA 1IGFL 3ZLQC 3MV7A 4NUJA 3BPOB 3MO1A 1YMMA 3RX8A 1QFWI 1KB5A 3CFJB 1S7SA 3MRJB 2C4FU 2FGZA 4H1LG 2PO6D 2XZQH 5GZND 5C3TA 1UB5A 5AUMB 5HDOA 2UZIL 4O4YH 3T0VA 1G0YR 4Z0XA 3L3JA 2NTFA 4OZHF 1S3KH 3DSNA 5F9JA 3LKRA 1A7QL 5JOFB 2X05A 2JCCB 4M7KH 3EDJA 1DSFL 1BWMA 3B8YA 3KG5A 5C0AB 3GGWB 4HS3B 5E08L 4RZCA 4Z0BH 4NJ9L 3SDCB 4B41A 4KQ3L 3QEHB 2DB8A 2ESVE 3B5TA 4U1JB 2BRQA 4M6OL 2QSQA 3D39A 2ARJA 1D9KC 4PJXA 2NXYD 1I3UA 3QIBC 4RCAA 3D9AL 4PR5B 2UUDH 4MSWB 4N8VA 3D1MC 4R9HA 2H1PH 1RZKL 2E7HA 2QR0B 1VFUA 3UYOD 3K1DA 3T8XB 4IHOB 5CP3A 1K8IB 2ZOKB 3P4MB 4U05A 4OZGB 2YHGA 3O2WH 2DS4A 3S34L 1F4WL 4YX2H 3JV4A 1S78D 5IF0A 3WIIL 4WWKB 1A9BA 5HYFA 35C8L 3U0PA 3ARSA 3RUGB 1CL7H 2ATKA 1FYTB 3OKDB 4KMTL 2H32A 2XA8H 5HHOA 4AY0A 3RP1A 2IFGA 1OF2B 3QCTL 2FJFB 4IIQC 5T3XE 5F44A 1U8QB 2OM5A 1DQMH 4J1UB 1KB5L 1B6UA 4X7EC 1IC7H 1S5IL 3DURB 4G8GB 4LNRA 4NNPL 1H8SA 5J12B 3HMXA 3EDKA 3L3IB 3IJHA 3OPZH 1ADQL 1UH3A 4ZOBA 1IL1A 1C5CL 1XCTB 2DQHH 2KKQA 4U31A 4ZD3L 5FHAH 4G8IA 5IB2A 4BUGA 2BP3A 3FB8A 1PYWB 2E7LA 2X4RA 4MAYB 4L8CB 4GG6F 4U0RC 4OFDA 3EW3B 3OG4B 2VDML 2W92A 2C3WA 4DTGL 5L7XL 1S9KC 1XGQA 2M1KA 1NC2D 4GOSA 1RHHB 4NZTH 2W07A 5DUPH 3ARFD 4PPTA 3VXUB 1K85A 5E8EA 3VGAC 4M1GL 3KPLB 5DZOA 4BQ9A 2P43B 3LQZB 4G8GD 1VEPA 1KIUA 1QZ1A 2X4OB 1BBJB 1S9XA 3H3KA 4HS8H 4EN3C 2E8ZA 5CJ8A 3B9AA 2X09A 1MEXH 4WEBH 4YHKL 3W9EB 4ELKB 5E8PA 1MEXL 1LE5A 3W0WB 3AVEA 4MCYA 3QFJD 1VPOH 2A83A 3FJTA 3KYNB 5EOQH 3VI4E 2Q6WA 1DLHA 5IV2B 4MQXD 1G7PA 3V0VA 2XKNA 2X70B 1HI6A 3C8DA 1UVQB 1SYVB 5EBWA 1KOAA 4XPAL 2PXYB 2DIAA 4QHLB 5I74B 5B3JE 5FYKL 3OB0H 3KYMB 1WT5C 4NZTL 3F62A 5DGRA 3E3QC 1BJMA 1CICD 1ADQA 1A2YA 3H3BC 4WI6A 2VLLB 3T0BA 1XF4A 1WZ1H 2XZZA 1A0QH 3G5XA 4J8RB 4Z76A 5J3HD 1J0YA 1T0PB 2W9DH 1YQVH 3FOLA 3ARFA 4G43B 5FK9B 4XWOC 5HVHC 2Y23A 4UI2A 1JF1A 1OSZB 4NQVB 1ZLVH 2F8VA 1CD1A 3HR5A 4PJIB 3HN3A 5HD8D 2PF6A 4RMSA 5TF1H 3I6GB 1P6FA 1PG7W 3L7FB 1S8DA 2O61A 3TZVA 1Q9KB 4JFFB 4XXCC 4XNYL 4MS8C 4IDLA 5I73C 4QKXB 5DUPL 2G9HA 4PREA 4Z7UA 1INQB 1IGTB 1R24B 4GRLD 5A3ID 2Z92A 3J8F7 5DHVA 1PD6A 4IDJH 3C6SB 2VO5A 4E42B 2HKHL 3BI9X 4HPOL 1UWGL 3WNKA 1NAKL 3LDBB 1HKLL 4ODUA 4HFWB 4XP6H 1QRNA 1SEQH 2FDBP 2X4QA 3ARFC 4G7YL 3R0NA 3QPXH 4HD9A 4LBEB 1XGUA 3FQRA 3OX8B 5CUSL 4WO4B 2VXQL 3EZJB 3QNXB 1IEBB 4JM2B 4LFHD 2KBGA 3IXTA 4QHNA 4X6FA 2FB4L 3ULSB 4HGWB 4ONFL 3PIQB 4WWID 5IVXB 2UZXB 1LP9F 4GLRI 4JFFA 1MCBA 5DLML 2X89D 1ZA6B 5IJKC 4H8WL 3BP6B 5JO5A 1JUFA 5FGCE 4BKLA 2QSVA 2G9HB 4PREB 5B39G 3BKCL 3F6IA 2OSLB 4NGHH 3FL7A 4PJAA 1U8HB 4NM4H 5CAYB 3G9VA 1U3YA 5CJ5A 1L6ZA 1U3JA 2XA8L 1K4DA 1DN0B 3MRMA 1OTTD 5FYLD 1IGYB 2XNAA 1N6QL 4MJIA 3H9SA 1N2RB 1AR1C 4PJIA 1DL7H 1W72L 1NBYB 4FOMA 4HK0A 1D5BA 4AM0B 4F9LC 4P5KA 1HKLH 1X7QA 4X8XA 3G5XB 4PRHA 1OTUD 3KPNB 5I76B 3H8NA 4N0FA 3MREB 2DMBA 1OP3K 3U7WL 1ZSDB 1KIQA 1T1XA 4A2MA 2NW3B 1ES0B 1LEIB 3CVHA 4GAYB 4YDJA 3BDYL 4P5TA 5E94B 3QWQB 3ARWA 3MLUL 2F54B 1R6VA 3VXPA 1IC4H 2GJJA 2MNUA 1CT8B 2ZG3A 3BQUB 4YFDB 2PCPA 3TCLA 1FVEB 3BWAB 3FO9B 3VFOB 1MCWM 1BQSA 2IPKB 2XTJD 4HBCL 2VZUA 4B50A 4X9BA 1OWRM 3ESUF 4L4VD 5C0JA 4QF1A 3WFCH 4UINH 4XP5H 2UV3A 3O3DB 3WIHL 1T20A 5JQ6L 2RJMA 3H9HA 3GSWA 1HDMB 1QO3A 4G8FA 3UTZA 3LIZL 3MRPB 3SDCD 1AIFB 4EQ3A 2QQNL 4PRPD 1KLGA 1P2CB 3PV7A 6FABH 4KJPD 2MQ0A 2ZCHL 3IJYB 4K2UH 4D9RD 4YUEH 5D7KE 4PRPB 2UY6A 4GRWF 4AG4H 1A6PA 1MCLA 2BVEA 2OK0L 2Q86B 2ZUVA 2OXHA 1YPZA 2X4UA 4PLNC 3E6FB 5D72L 3Q6GL 3TH3T 1DBJL 3FB5A 1S7XA 2Z4QB 4J3SA 4Z7VF 4KV5F 4BKLB 5LGKA 1P4IH 1X6LA 3FFDA 3KPSB 4M62H 1LE9A 2BFVH 3OHXB 4M48H 2EYTB 1ZA6A 3RZCD 3D2UA 3MYJB 2AK4A 4ZOAA 1CGYA 2H8PA 4XTRC 2W91A 4QHMB 3STZB 5D7JA 2P5EA 5JR1H 5CJQH 5HGHB 1UENA 1YYLL 2HTLC 2YRLA 1X5IA 5LXGL 1ZGLA 3RVVD 4HHAA 1LEKA 5IB3B 3RY6A 4R3SB 4CMHB 4TSCH 4R2GC 2IALB 2MKLC 3LRHA 3BH9A 2AJXL 4L29A 1CTOA 4WJ5B 3IVKA 4QOKE 1U92B 2WP3T 4S1RH 1Q9LB 2CLZA 1EJ6A 1PAMA 3QUYD 5E9DE 2QQQA 5FUCC 5IMOA 3QWOA 4QRRB 4WHYH 5EULV 2ADGB 2BVQA 5CZVH 1DANU 3PGDB 2OK0H 5KSAB 4OCWL 4J3UA 1H3XA 4Q9RL 2HJKA 5EBMB 4R0LA 2ICWA 3T77A 2AQ1A 1NBYA 4K3DL 3LMJH 3CSYA 3IDXL 1F6FB 4HXAL 3FMGH 3WKMH 5IB3A 2UYLA 2AV7B 4X0KA 1FFNB 1OARL 2HG5A 4LCWE 4P9ML 3MRIA 5B38B 3VFWA 1I1AB 4YXKH 2X2YA 2BMKA 3FO0H 4MA1C 5JOPD 5T1DL 1JWSB 4PG2C 1AD9A 1U8OB 3AAZA 5ALCL 1KJ2L 1A2YB 4AH2A 4G9FB 2A0LC 3KYOA 2EDOA 2UWEF 5T3ZE 1T7ZA 4JGJA 4MNQE 4WW1A 4IMLA 3OX8A 5E2TL 4CN1A 1KIRA 3RTQD 3L1OH 1JRHI 4P23A 1FJ1B 1LQSR 3MROB 4Z7OF 5EH1A 2NPLX 2Y07H 2R0WL 4LCYA 4DKDC 2H3NA 2OMNA 1FGVL 2DQUL 1P1ZB 3DSFL 4N90E 1BQHB 3HUJE 1R5IB 2Y06L 4F58L 3IDNB 1JMXA 5DWUH 3C6LC 4XB8A 3F7YB 3PQYD 5DJ8B 3PHQA 4DVRH 4MAYC 4L9DA 2OJEB 4XP9L 4GMTL 3I2CH 4OGXL 4Y5YB 4JPIB 4PJDB 3REVB 3V6OC 5F7KC 2DICA 2VZOA 3T0DA 3TLRA 2VDRH 4W81A 2EIZB 4JRXE 4U1GC 3SDAA 4XZUB 2X4PB 3N85L 2C1OA 1JNLL 4OAWA 1F45A 3LEVH 3WIIH 2YA0A 4E5XA 1LO3H 4JAMB 2J88H 5I76A 4R4FH 2AJVL 3VWJC 4R4FL 1D5XB 1GHFL 1A6AB 1DBML 1GHFH 2RHEA 4HKJA 3MUGA 4Y2DC 4TUOA 7CGTA 3HMXL 5BZWB 5IW6B 3QRGL 5FUZH 4M6ML 3D85B 1MWAH 3GJEB 4WRLA 1BFSA 1DN0A 1M71B 4WV1B 5DMYA 2NY6C 3MPCA 4OCYH 1U95B 3HG1D 1OTSD 4R8WH 1T80A 3AGVA 1XGYL 2C3HA 3U79A 2NY3C 4KH2A 4M6OH 2FL5B 2XT1B 4JR9H 3W9DB 4LLDB 3FO2A 5EZOL 3SDAB 3UJJH 4I18A 3LN4A 4PBVC 3BO8B 3PP4L 4RISH 4Y16C 3CFKA 5ESAA 1J12A 5C0RL 1W72B 1P7KB 2GFBB 3NPZB 2GCYB 3UYPA 3RUGA 2Z31D 1OAYL 2VDKH 1EV2E 3DIFA 5HYSB 4U6HB 3WE6B 3RVUD 3CU1A 3MBEA 2R9HC 4IMLB 4YFLI 4LBEA 5CILL 2YC1B 2BNRA 1MCIA 3QCVH 5C86A 4TRPL 5E9DD 1CXFA 2R1XB 1B4RA 1T0MB 4IS6A 2X7LA 2BZDA 1JN6B 1JWUA 5HHME 2VDQH 2I9LA 2GJ6A 2NYYC 4PJ7A 5DMKB 3QEQA 3VXRE 4UAOB 1AQDA 1H5BB 3OR6A 1KJ2H 4LCCC 4L8CA 4X5XB 1ITCA 4GLRH 2XFXA 3U2SA 3K2UH 4U7MA 1WTLA 4NKOA 4PJDF 4M93C 5IFJA 1MJ7L 3MUGB 4HS6B 2R4RL 3DYOA 1DBAH 5ENWA 1NEUA 4HZLA 2NW2B 3DRTB 3NGBB 5JXEA 5T1MB 4HKBB 3VJ6A 1IM9B 1D5IL 4EUPB 4PJEA 4JAMA 5FM8A 1JHLH 3DVGB 5E24E 1I1YB 1E27B 5I1GH 9CGTA 1LO0L 1G6RH 4WGWB 5SWQA 3IDXH 1MCCA 2LU3A 4PRIE 5D71L 1OTUC 2QQLH 5EZJA 2ERJB 2CDFB 1T5XA 2EXWD 3BP5B 4UIMB 4ESKA 4RAVB 1A9BB 2C3GA 1WV7T 5FIEA 3EOBA 4UBDD 3SE9L 3OXRB 3VMOA 1F3RB 5I19H 3TN0C 5GXBB 1GGYA 3QG7L 5TGBB 2HJFB 3TIDB 1QLFA 1HYSD 4MA7H 3T4YB 2G75B 4XX1G 1JP5A 1MHEA 2NY3B 2XPGA 4OBSA 3DTXB 2F74B 2ADFH 3QI9C 3QEQD 1Q38A 4ZUUB 1P4IL 3NPSC 3MUZ1 4K71B 4UTBL 1EAJA 2FWOB 2VABB 4DJMA 5D2NC 1QUNA 1JGLL 2OQJA 3LMJL 3V5HB 3QQ9D 4EN3A 4U6YB 4XB7A 3N1GC 1CFSA 1S7TB 4AIZB 1E28B 3UTQA 4DAGL 2WUCH 1V7MH 5CP7B 2YRZA 3VGHA 1YEDA 5EC1A 4XNUH 1IM3B 5CD5C 5I1AA 2GK0A 1HXMA 3LQZA 3VI4F 1S7UB 2QADC 5ITBL 1JWSA 1WWCA 1NDMA 1P9MA 1RHHA 2EDDA 5D1ZC 4XXDB 2XA3A 4QRTA 4P3WA 5F7FA 3QDGD 1H0DA 3LEXB 4QXGH 5MEOA 4NM8H 4OD2B 3JV6B 3T2NH 2BNRB 2XTJC 5GGVL 5KJRL 4PRPA 3KLDA 3U9UA 4KVCL 1CGUA 1I4FA 1QKZL 4MJ6A 2LV4A 4XMLH 3GSVB 5FYJU 2VDKL 3NFNA 3V7AG 3LEYH 3O6ML 1JHLL 1AO7E 1X5YA 4PRNA 1BZ7A 2EDRA 2W60A 1J1XH 4HH9A 3ZKQD 4M48L 4FZEL 4K07A 4GMSH 3CVHB 1MF2H 1RZIB 3LKQA 3LKSA 1XF2A 5EIIA 3OKLA 3W11C 3VCLA 2HFTA 5F7EH 1JZ2A 3SPVB 1Q0XL 4XBPA 1G9ML 4ODSH 4M6MH 2FJHA 1UXWA 2ZCKH 4XNQB 1NCBL 5IVOA 2KH2B 4BSVB 4EZMA 3U7YH 2AK4D 4JO2H 3NN8B 4J3OC 1DJSA 3TZVC 1G7IB 1D7FA 4TUOB 1KCVH 3T0EC 3WFEL 3A6BL 5EBLB 4ALAL 1GGIH 3CXHJ 2CKNA 3HZMB 1XF5B 4P3CL 2H1PL 4RIRA 2BNQD 2ATPB 4JG1H 4PJHE 3N85H 3BD5A 2LTQB 4PJAB 3AS0A 4ODWB 2P1YA 3O8XD 4NT6A 4XVTH 1ZHKB 5DZNA 5DJYA 2X42A 1GCFA 2C3XA 2NY0C 5ESQB 1JN6A 5B3NA 1T7VA 2DYPD 3ILPA 4HIEB 3DNKA 3OKOA 3IKKA 2EIZA 1N5YH 1ZEAL 3RWIA 4XCCL 2FX8L 5BVJA 5CJXA 5IFAL 1KNOA 2GJZB 4RNRA 5FYKU 2VL5B 1ACZA 1S78C 4AIZA 3WHE1 1QD0A 2JE8A 1IEBA 4V1DE 5FOJA 3SGKC 1AKJD 2RAMA 3MA7B 4CRPA 3TJHC 1AC6A 1ZT7B 3GMNB 5D7SL 1J0KA 3O4OC 3CAFA 2CR6A 3T3PE 4OLXH 5FHBH 5HYJE 2M2DA 4WFHD 4X8JB 4CL7A 3RZCA 5L6YH 4JKPH 1WFOA 4PRID 2Q3ZA 3SKJL 3PDOB 4LLAA 2P7TB 4U1SA 3BW9A 3OKYA 2IEPA 5GS2D 3SO3B 4KHTH 2VDLH 1T1YB 1YEEH 3O4LD 1WBXB 2LAGB 3WLBB 1Y18B 4LVHC 3DO7A 3CCHA 3G5VA 1KG0B 3IDIA 1J1PL 3LS4L 1NGYB 3F12A 4G6ML 5IW1B 4QEGA 2GSIB 2XG5A 4PRAA 4F7CB 2VAAA 2VQ1B 1I75A 3C60C 5ACZB 1NMAL 1CDIA 1WBZA 4M7JH 3NCJH 3S37H 1D5ZB 1I1AA 4OFYA 3B9KD 4X6CB 2XKSA 4HK0B 3NIDE 1PEZA 3B2UC 4OKVA 3UPRA 2GY7B 3F7VB 2CUMA 5K59E 2NZ9D 2E9BA 3HZYB 2DMKA 3VFSA 5F88A 4KAQH 2QQKL 3V4UH 3PHOA 1XZ0B 4RRPG 2VLKD 1I1FB 4OI7A 5EZIL 4DVBB 3K8KA 1NGPL 4CN6A 4DOHB 4KJQC 3NBNA 3BUYB 2Z8WC 1JNHA 5DFTA 3OWEA 5I1KL 2PETA 4ENED 3WLBA 3HE7C 3QDGE 2R2HA 3VRJB 5GGRA 4L3EE 4QRRD 2FEEI 2VR5A 3CUPB 1S7RA 1F4HA 2AQ2A 3MRFB 5LXGH 4PP2B 3O3UN 4NRYA 3K1KC 5LGHH 5HGBB 5M7QA 4MVBD 4G42B 3C5SB 2FJGB 3QDME 1R0AH 1NSNL 2J5LC 4MWFA 1EAPB 3JSSA 3K2UL 2IMNA 1AFVH 2JB6A 4BH7B 4TSBH 1QFWM 4RX4D 3GSVA 1V05A 3GHBL 5SX5H 1SVZA 3ILPB 1A3RL 5ICZB 1R24A 2OR9H 3FO2B 5I1DB 3QG6B 4Q6IB 5JNYA 4YEEA 1UACL 3NH7L 4OZ4B 5I8CB 4LLYA 3K46A 1BD2D 5F3BA 1MAJA 4QRSA 5AEAA 2X4UB 1G7HB 4YX2L 1KPUB 3QNZA 4KUCF 4R7DA 2MOVA 4F2MB 5HGAA 4HK3N 3FCTB 4HW6A 1F58L 2VDNH 3TYFB 5C1MB 4YR6B 1F90L 1WTGT 1S7UA 1NH6A 4XC1L 4DOHE 4BM7A 5D7LA 1MVFA 2EXYD 3MGAA 1OSZA 1Q8MA 3IYLW 2J12B 5F7WC 3AC0A 3ARGB 1K6QL 3FB7B 3MBED 1J8HE 3QIUD 5AWNH 4EI5A 2J5LB 3JVGA 4O51A 2YPLB 3JZ7A 3WS6A 2OL3A 3OKNB 4GAJL 4RGND 1XGTB 3W11D 2H6PA 3OKLB 1QBLL 2FD6L 4KRPC 3OPZL 3VXOA 1J5OH 4EQ2A 1HHJB 1MNUH 5B8CA 3CH1A 4KK6D 3UTOA 4PRNB 2FO4B 4ZTPH 2IPTH 5I16A 4ELKA 4RWHA 3ZT7A 4X4XA 1I4FB 1ZS8A 4R0LC 1CL7L 5DQJA 2YPVL 5IKCB 1PG7H 1ZTXL 4D9RE 5DR5L 1CDGA 2RB8A 3FONA 5CMAA 4KI5C 1FC1A 5I73B 4N8VB 4KK9C 5LVEA 3MQIA 4L3EA 3IFOB 2NXYC 4OIIL 5DFVD 4H88L 5KVGH 4JCLA 1IQDA 3MROA 3ZYIA 3VW3L 3W2DH 5GSRA 1KULA 5C0AD 2I24N 4HKBA 3I9GH 4MD5A 4RRPA 1MCOL 4HDIA 4NC1C 2A6JA 3VE0A 1WLHA 2AAVA 4OF7A 1EFXB 1EUUA 2BNRD 1U8JA 3RAJH 1AI1H 3KPLA 1CGVA 1WIPA 1V8HA 4X4ME 4WUKH 4G7VL 5IOPB 3U0WH 4WFED 1GXEA 3TP4A 2HVJA 5CGYC 3H9SD 1AQKH 4ONOA 4ONHB 5BQ7B 3KPPB 4JN2B 4P2QA 2EXWC 1HZHH 1XIWD 5FUOH 1UB6A 1I8LC 4PD4K 3BZ4A 5C2UB 3CFBB 2DQGL 3JV0A 5DK3A 5EA0L 3BQUA 2BVUA 5I6XB 1OPGH 2XN9B 3L3JB 1RUPL 3MLRH 3QI9D 5CIPH 3EYOA 1FVCB 2HH0L 1CFBA 1J8HA 3ILQD 1LP9B 1MH5A 2HH0H 5MERB 3GI8H 2ICWI 4ALAH 4IOSD 3V2AR 1CK0H 1XZ0A 5F89B 4JKPL 3MXVH 5DJ2A 3MRQB 2AJZA 1EX0A 2GHWB 3QXAA 1PSKH 2CK0H 3MXWL 1KC5H 4OT1L 1CS6A 1XIWB 1WICA 2Y6SC 3MLWL 1SMAA 3WXVH 4NQDD 2DKMA 1P69B 4WI8A 1LDSA 1XMWA 5FKAB 2ZCLL 4QGTA 3BKCH 5GPRA 3HNSH 1E27A 2QADD 1ZLUH 1C8PA 4ZUTA 1VEMA 2P42B 3SDCA 4Y4FC 1CDUA 3Q1SH 3UTSB 1L7IH 1UZ6E 4QTIH 4AQOA 4KDWA 1MUJB 2I60L 1C12A 4KK6C 5C0BA 1JF1B 4OLEA 3DWTA 3EFDH 4HX1B 3PGFL 4FABH 3O6KL 2P47B 3RJDA 2GSIA 5IMKB 2V2WB 3Q5YA 1AXSB 3L5WB 1U8JB 3FOLB 1AJ7L 2GTZB 1UWXH 1PKQE 2W9DL 5F9OH 2BY1A 3CCHB 2CQVA 3G5VB 3MRNB 4NC1E 4PY7A 4JPVH 5KSUA 3EJZC 2CMRH 2LFGA 3FB5B 3MJGX 3O9WB 3AM8A 3K4AA 4EXKA 3O11A 3QCUL 4QXWA 3PP3H 3I3DA 3LAFA 1U3HB 3S3PA 1EEQA 5CIPB 2BOCB 3W39A 2KZWA 4U1HB 1EA9C 3V8CA 1UCTA 4CMMA 1KXQE 3K8LA 4YO0B 3O4LB 1CICC 1U3HD 3VU2A 4JFHD 1ZVYA 4LU5L 3VFGL 4MNQD 1FN4B 1A3LL 4W4OC 3IFNH 1YYLH 3V8OA 3R1GH 2M8XA 3BAEH 1Q9WA 3CIQA 2YSSA 5ILTH 3GB7A 2XWBB 3C8KB 4KGJA 4LLDA 4NRXA 4OJFH 1NKRA 1P4LB 1LEGB 4D9QD 1IGJB 4NO3A 5I19L 2F5BH 1KELL 1KIRB 4LIQL 3GZKA 4YGAB 3JWDC 4Z5RA 1CN4A 2Z0BA 3QQ9C 4XCFL 1F13A 1IQWL 2FO1A 1NFIA 1PZ5B 1IGMH 2JF1A 4G3YL 4LHJB 4M5YH 2VXSL 4S0SD 5ANMA 3O3BB 4XMKL 1BM3L 1CIUA 1NCAL 1OGAE 2GKIA 3MRNA 3KVQA 4UQ2B 1NFDA 4H25B 3RHWK 5D4QA 1T83C 2X1QA 3U4AA 3PGFH 4PJ5E 2WUCL 3MA9H 2XYCA 4PG9A 2CK2A 3MV9E 1SJEB 2OTUA 3PWLB 5CEXB 4XWGH 1B0GB 3GEWB 3S4SA 4F7CA 5L9DL 1KB5H 3AUVA 4NZJA 2NZ9C 3OAYH 4NO3B 1DQQB 1G9NL 2A1WL 4Y19B 3ZDXF 3TWCH 1BQUA 4OM0L 4XAKE 1QSFA 4L3AA 3VXUD 1MAML 3TIEA 5I66B 1I85C 1I7UB 2YOCA 4LLVB 4Y5XB 4YK4C 2OYPA 2V7HB 5I1LB 2R2BA 4ODHL 1WGOA 3TT3H 3OXSA 4ELMA 2W65B 2QLVB 4XCNB 1EPFA 4WHYG 4PJCA 5C07B 2MCPL 3DROB 1FLTX 4G80A 1E4WH 4JPWH 5KS9A 3V6BR 3C8HA 5CEZL 4HXBH 2D7PA 1AR1D 2DQDL 1IAOB 2AJSH 2F9BT 2UZYB 1A5FH 4LSVH 3V0AC 3D5OF 3CFIC 2ICWJ 1NCCH 1KCRH 1R5VA 5HPOA 2VL5A 2DIBA 1E28A 4FXKB 1NBZB 3UTQB 2DWEA 1EHLH 2B20A 1CLOH 1J0ZA 1LO5A 1J10A 3KAAA 2QJDA 2ZSVB 4KK8D 4GW4A 4C56B 3QQNA 3LQMA 5HHOD 2AGJH 1G0DA 3C2AH 2AGJL 1KIPB 2UYLB 4X0KB 4XNXH 4R26H 2NY5C 3AU1B 3WJJC 4M1CD 3LKRB 4WDIB 4Y2OA 3KPMA 4LLMA 3MNVB 1EFXA 4HLZG 1HHIB 3DARA 3WNMA 5LGJB 2ZUYA 1YEEL 5J06A 1YUHB 3RWJA 1MCJA 1N59A 1U8MB 4X7DC 1NLBL 5E2TH 3VD3A 5JMRA 4PB9L 3MO1B 1FL6B 3F5WB 1HXYA 4WFGE 5I9QB 1TZIA 2FJFA 1Q72L 4O9HL 3MBEC 5J56B 2LVEA 1FIEA 3BW9B 4XWOD 1HIMH 3VXOB 4UQ3A 3TN0B 1Z3GH 2AK1H 5CFHA 1UWEH 4NO2A 4Z7VE 5IMOB 4F8TA 3OJMB 2FZ3B 4TTDD 5MERA 4N5EC 4P2QB 4WWKD 3LKNA 3EYVA 1LEKB 3PWLA 5F21B 5CEXA 5MP6H 1RZGA 4XHJD 5F70A 3UJTH 2X1XR 5D8JH 4POZC 4MNHB 4HMDA 1XEDA 4JGMA 3WFDH 1BFTA 5FAAA 4HLJA 1UGNA 5I17B 2PW2A 5BV7H 5DLMH 5CSBA 2CH8A 4YDLC 3VFNA 4BSWA 4LOUD 1EH9A 4K94C 5C0FB 3QR2A 4KJWC 4TNWF 1TITA 5FEBA 2PTTA 1N3NA 5TFSH 3LN5B 1SBSH 4JANB 1S7XB 2Z4QA 5L2KD 4KJPC 1RUQL 2DLGA 4FFVC 4JY6A 4KKBD 1U3HC 1EO8H 1DQDL 1JTOA 2YUXA 5HYQA 1MWAB 1ZHLB 3QDHA 4R7DB 5KOMC 1D9KA 4XBGB 4G8FB 4TQEL 3NZHL 5LG1A 1TETH 5IWLC 5ADOL 5C07A 3CZFA 5EUKA 3G5YA 3AREB 2HKFL 2DBLL 2VSCA 4GKZA 3M17A 3L5JA 5GQBA 3TESA 2E9IA 2ICEA 3L5IA 5LCVL 3RZCC 1V3JA 43C9A 4LSTL 3ZDZF 4FTVD 2HFGL 4YHIB 4HWBA 5D5MA 4E41D 3RY4A 4FA8A 4WUUA 4HIXH 2RIKA 1JGVL 5DFVC 4PIRF 1T89A 4X4XB 4CNIA 4Y16B 5GJSH 1FFQA 2NW3A 2P24A 3TGXA 1NCCL 1CQKA 5D7LB 3T0EB 3AMLA 3UTTE 3P4OA 4WHDA 4KZEL 2VDQL 4A6YL 3SKMA 1NMCB 2W59A 4YDVA 4OD2A 1UA6L 2NY1B 2PW1A 1MJJB 3GSXA 2WQRA 4WGVB 4UUJB 3X12B 4GRWH 3X13B 4EI6A 3G9AB 3DUUB 1EEZB 2Z31B 3T8XA 1J9CT 4P46B 3K80A 3JBG7 1Q0YL 2I9TB 5ABDE 1CD1B 1T7WA 1DUYA 4F2MA 1J0IA 1KT2B 2K7PA 1P84J 4W4OA 4FQXC 1GOGA 5JHLH 3B6SA 5E00B 4YDLB 1N5AB 4DUWA 3QHFH 5HI3C 3A67H 4ZAKA 3ZKMD 4G6JH 4XVSL 1CGSL 1S9VA 3K74B 1F97A 4OZGE 2QKIA 3RVXD 5C0AA 2MPAL 5F3HB 4NP4L 5D6DC 1Z3GL 4ODBD 1XH3B 4F33B 3GJFB 1RAMA 5F71A 5GRJH 4HC1H 4X6CA 5FYKD 5C0NC 2AABL 2HWZL 2OR7A 1QA9A 5D6CB 3IDMB 5BRZA 1E6OH 1HWHB 2YPLD 4QHKI 4XT1C 1UCBL 1TPXC 5C07E 5T1KB 3RI5K 2I25N 3GI9L 4ZSOE 2IBZY 2YD4A 5H37G 5ICYA 2A9MH 2XWTA 1P53A 1P7KA 1F11B 5EZJB 1DANT 1MLBB 3ZKXB 5K9QG 5IB1A 5C0RH 1UJ3B 1QHOA 3TO4D 2Z92B 2DDQL 5E00A 2D9QB 5HSFA 4OCSH 1T5WB 3QDMD 3RU8H 5H2BA 1ZHKA 4M4PA 3VA6A 3NCYS 1FZMB 5T1MA 4PJ8A 1NMBL 2JCCF 2YZ1A 1VFAB 3QUYB 4YBLC 5TQ2H 2NNAA 4NOBA 4EI6B 4PJ5B 2G5RA 4HT1L 4M7KL 4R4ND 1WITA 5EBLA 3N1QC 3DSFH 5FKPA 1RQ5A 3MLPA 1NUGA 3P11H 3MV01 3TFKC 5D93C 3C09C 5JUEL 4W68A 2PYEB 3GSUA 2ZSWA 2HKFH 2WBKA 1I8KB 4OZGF 1T1YA 4NQDA 4S2SA 3GSXB 3IU3A 3WN5B 3PF2A 3SPVA 4JFOB 4Y19D 3MRHA 4XPTL 5TH2B 4AG4L 1XIWC 1OB1B 2DMCA 5GGSY 5T1KA 5A1AA 2IBBA 4MD4A 2R1YA 2RCSL 1X4YA 3BRGC 5EORH 3FN0H 1OAYH 3GSNL 4ZS7H 4XXCA 5LBSL 2IPTL 2BSTB 2PR4L 3FT2B 1CYGA 4I8DA 5GRXG 2HLAA 4KKAC 3O2VH 3CDFA 2Q6WB 1JPSH 4ODTL 4YGVA 5TE7L 2BVPA 4JDZB 4GMSL 4LSPH 5FUOL 4R90H 4HKXB 1S5HA 4LSPL 5FGCB 1BQHG 4J3TA 1S9VB 4P2RB 5DD3H 5H35B 3CFCL 2J6EH 5I8KH 4PJFF 5AWNL 3ARBC 2EDHA 3D2UD 4S1QL 4JJ5A 4Y4KA 1FL3A 1KBGL 5MP6L 5I15H 4F7PB 4YHOL 1B0RA 3VH8B 3HUJB 2FHFA 4QHUB 5BJTA 3GI9H 3X14B 3O6FB 5FF6A 4WV1A 4S1DC 5CP7A 3ZTJH 4HF5H 3S35L 5FA4A 5EO1B 2ZKHH 3NN8A 3QZWA 4JANA 4KJYB 2N7AA 1R3JB 5FCUL 4M43H 4XP1H 2VKWA 3WHE0 4WU7B 4FQLH 5TQ0L 4X7SH 3UPCA 2UVEA 4Q2ZB 5JHDD 5E8NB 3L5WA 3A6CL 4RMUA 2C7UB 3MLSL 4QWWC 4UU9B 1MSPA 4ZQKA 3X11A 4K7PH 4HCRH 3MUY1 2CIKA 1DDHA 3OJ2C 2QV2A 3MCKA 2V5YA 4U1NA 3WJJA 1I7ZB 2B5IC 2VLRB 1IFHH 1QLRA 3H9SE 3HRZA 5E5RB 5DQDL 3VG0L 3PQYB 2VR4A 1JRHH 3SDDB 2LQRA 3EGSB 2F54A 3B9DA 1JGUH 2UWEB 4R0LB 3BKYL 4KK5D 4NO5A 5JPMA 4PRHE 1KEGL 2C4FT 2XQBL 3BT2L 3OMZA 2JJSC 3ZTNH 4L4TA 3VXNB 3UDWC 1OF2A 3HPJB 4OQTH 4PRHB 3CZJA 1NLDL 1MLCB 3VDAA 4N5UA 3DETD 4K9EC 1FNSL 5I18L 2OZ4H 2XQYK 5LJYH 2IALA 1RUMH 3VFSB 1U8MA 4MJIB 3L3HA 4IMKC 4PY8I 1A6TB 3T1WA 1F58H 2VDNL 3RQ3A 4Z7UE 1MPAH 3QIBD 5J6GA 2N7BA 3JWDH 3QEUA 1IBGL 2XWJA 4DFIA 1G7HA 5HYIA 4ZQKB 3STZA 3FB6A 2VDOL 1P6AB 1IC7L 1FNHA 3QEQB 4ERSL 4LMQE 4NO0A 4Q6IA 5L2JA 3SE8H 5CEYB 1X5ZA 1UM6H 4KY1L 4NKDB 1HHHB 1GYAA 4C56A 3X3FH 5E6ZA 1U6AL 4WTXA 1UZ8B 3BZDA 5L8JB 3BXNB 1L0YA 1QBLH 3BD4A 3I6LE 1QLFB 4KDTA 4L1DA 2AV7A 3GDBA 3V95A 2C1PB 2IGFH 1CTNA 1KGCE 1YZZA 1SYSA 1X5JA 5C3LD 5KZCD 2OI9C 5D2NE 1PGRB 5LAXB 4EI5D 5E2UH 1FNSH 1VB9A 4LRNH 3V6FB 1J8KA 4ORGA 5EIQA 2B1HH 3S88L 2HRLA 4KROD 4GAFB 1F90H 4XC1H 3UXFA 4L4TD 2JLLA 5TDOA 3MV7D 2WUBL 1YMMB 4X9FA 5E7BA 5TGBA 1AJ7H 1YPZF 3BQUC 2P5EE 4HUXA 3DVGA 1EFXD 1KBGH 3L9RA 2WBJD 1PLGH 3TZVB 2BVOB 4HJJH 1KTKE 2O5YH 4NNPH 3FAWA 3T0XA 5C92A 1KEGH 5C0IB 4PG9B 5HI4C 1R3KB 1CI5A 3MRKB 3QUML 4X6DF 3RAJL 1KCSH 2NY0D 3KLHD 4GW4B 4OT1H 1F02I 3C2SA 3OKNA 3CLEH 1NCWL 5D1QB 5LBSH 4PRIB 5E1AB 2A73A 1MVUA 1RFDL 5F7LB 3K2MC 3MRRB 4FS0A 1JHKL 2VLKA 3T3MF 1VHPA 4Q6IC 4XX1E 1PZ5A 2GTWB 1R3KA 4M4RA 4H0IA 5ESVB 1E4XI 4OZIB 12E8L 1A6AA 3W82A 3CX2A 2VLRD 4I3RH 1QRNE 1HCFX 4GRMB 3M1BA 5D96B 5HVWA 4OIBA 2ZCKL 4O58H 4XNQA 1QLEH 3H0TA 1A4KB 4YH6A 2R2EA 3GO1L 5J89A 3UC0L 5CZKA 2OZ4A 3HPLB 3WFDL 1UM5H 2J4WH 1MNUL 3QDJB 3IAGC 5BV7L 1BVZA 3ARXA 2R1XA 3SO5A 3UROR 2WBJA 3LHPH 4H20L 2DLFL 2PNDA 2X5PA 2DLFH 4LF3B 4XGZA 3QUYC 2FHBA 4JY4A 4XAKD 4YBLB 3EZ8A 2NCMA 4D0DA 1QEWA 1JZ8A 3JTTA 3D0VB 5DD5L 4WWKC 3HFMH 2FGWH 3ZE1F 2R0WH 1N5YL 3D18A 4KGLA 4JY6B 3M8OH 1BIIB 4PJIE 1FGVH 4R97B 4C83A 1MWAL 4MZ3A 2VERN 3NFPB 5KG9B 4S10A 1SEQL 4MDJA 1MFEL 1XCQB 4U3CA 2XXCB 3QIBB 5GGUA 3TV3H 4GFTB 4NUGH 3H6JA 1T22A 4J6RH 5KSUB 3FN3A 3IU4H 4HX1A 1KGCD 1G7LB 1XF5A 2C9AA 1EBPA 5FHBL 3QIUC 1RK1B 4P3DB 3QSKB 4HKJB 1X6NA 1U8KA 4GRLC 2W1NA 3OB0K 4FZ8H 5A3IC 5C09D 4XPBL 5HGDB 2WANA 3RFZC 5EC2A 1JI1A 1Q9WB 4FQPA 5D1QA 5C0ND 3QIWD 4X99A 2V5SA 1JGLH 4JFPA 3U0TA 3MRQA 3VDBA 3FMGL 3NGBC 1HHGA 4OSUH 4XZUA 3QWOB 1OAQL 2HVKA 3P9LB 3KLHC 3GHEH 1OP5H 1JJUA 3NAAL 3THML 2DQUH 3RWHB 4Y1AB 3AS1A 3VMNA 1OSPH 4NN7C 1FVCA 1ITBB 4FQQB 1FH5H 1F11A 1NAML 3EOAB 1KJVA 4TVSa 4MDIA 2APFA 2HKHH 4HPOH 1PLGL 5DK0A 1FQ9C 3ZDYE 1Z9OA 2Z91A 3H9YA 2EO1A 2EZ0C 4ZFGH 5GZOD 4KJQD 4KRNA 4DGIH 3KYOB 3VXNA 5IHUL 4UDUB 4I9WD 2CIKB 3VI3E 2R29H 4G6KL 4I13B 2X1WL 4NWUH 4QHMA 3OF6A 3DX6A 4MAYD 4L4VA 3B43A 5FDWB 4UMGA 5C0DB 1WWWX 2IWGA 1RJZA 1T66C 5TDNA 5CEYA 4I4WB 3EGSA 5I2IB 1A1MA 2NY0B 5ENWB 5C8JB 2CKBL 4NQTA 2VXTH 2DQFA 3Q2CA 2Z8SA 3O6FA 2ZUUA 3NVQA 5TDPA 2Y72A 2FLRT 2VR9A 1CFTA 1NAMB 3ROLB 1OAZH 1IFHL 2MQ3A 4WNQA 5EUOA 5LGHL 3TO4A 4MD5B 3ULUD 3QQ3B 4JO3H 4UT9H 1J1OL 3TBWB 1HDMA 1EGJH 4P9HC 3SKOA 5EU7E 4FQJH 4MNGB 1ZA3B 5GS1A 1ULVA 3UX9B 4BQ6A 4U1LB 1IM9D 4M3KB 5GRWA 4G6KH 4OBRA 5A2IH 2B2XL 5CWSA 3X14A 4Y4KD 1FYTE 1QP1A 4CU7A 3RWEA 2P24B 4LSSL 5I1IH 4DUXA 3SJVE 4FQIL 3T04D 4GW5B 3CH1B 2Z9TA 1W0VA 4HKZA 1B90A 5E6YA 4L9LC 2OXGA 3Q1SL 2E27L 3KLAA 3IFNL 1LO0H 1OAKH 3BPLB 4MCZA 1GSMA 3GKWH 4XP5L 3T1FA 3TA3B 5JR1L 5HHXH 3CXDL 3OKEB 1UJTA 4FXGB 3O8XA 5E8NA 2HA1A 3FFCD 1JPFB 4EUPA 3FTGB 1C7TA 3E2HC 5SX4I 3WDHA 1QSZA 4ZFZB 4QRRE 2DIJA 2CIIA 3NCYP 1TJIL 3QUZC 4H0GA 5B3JF 2AS5M 3VFPA 5JLZB 1H9VA 3JV4B 2EDWA 4ZTOH 3ARDA 4KDTC 4ZAKC 1IE5A 4B53A 2AJUL 3QFDB 5ID0A 4HV8B 3VWJD 4LLMB 2YMXH 4PV8A 3LH2H 4DZBB 4X6BA 5IROC 3OV6A 5I1KH 3BEVB 5F1OB 1YN7B 5FO9B 5D2NB 3AXLA 1WZKA 4HAFA 4MVBC 4LEXL 2EDJA 5CLWA 1QSEE 5KANI 1H15A 3H9SB 15C8H 5FA4B 2X44D 5D6DA 3UZQA 3PNWA 3RNQB 2J6EL 5I8KL 3PHQB 4GXUM 3DIFB 3IJYA 3O81A 2RR3A 3FO9A 5GRVK 2Y36H 5T5NG 3C2AL 1XR8B 5IVZB 3IDMA 4X7TA 5BRZB 1IEAA 4RQQA 1N6VA 1OW0C 4MA1B 3UYRH 4GMTH 4OGXH 4AEEA 4PJXF 3FT3A 1FZOB 1S7SB 3GSQB 4LPXA 3D3VB 4WW2A 4U3HA 4O2CA 2YKLH 3IXAB 4MCZB 1AI1L 4HWEH 3ARRA 1NGQL 2Y5EA 3C9NB 1I3GH 1VGKA 4MMZC 3GSNH 3U7AA 4M43L 4XP1L 4Q0XH 1ERNA 1WISA 2O61B 3SJVA 5CEZH 2P8LB 1BOGB 1DTUA 1KEMH 5E2UL 1TFHA 1UEYA 2EDQA 1X5LA 5F72S 3GJFA 4PJEF 4D0BB 2WWMD 1DEEA 3GMLB 4Z78A 2HT2C 2NY6B 3F7VA 2F5AL 5LGJA 2P46B 3PDGA 3TH2T 3LD8B 1IC1A 1NCBH 4PR5A 4G6AD 3D3VD 3WSQH 2A1WH 5DTFA 1RUKH 5JHDB 1IJ9A 4CAGA 4IRZL 1CGWA 4NKQB 1OWWA 1W2KT 1IT9L 3HZKA 3RGVD 2CDGA 2R0KH 2IANB 1KENL 3LHPL 3P0GB 3T77B 3U0WL 2VQ1A 4YFLF 1JMZA 2APTA 1F42A 1LP9A 1MH5B 4I2XE 1YEIH 3QNYB 5I1IL 4XMKH 3ZE1E 3GMOA 4WU5A 1ZE3C 5H94B 2YPLE 1YEHH 2P5WD 2BNRE 3FQTA 4U1SB 2R8SH 3DECA 2P44B 1FZKB 1CVRA 2WBJC 4OTXH 4N68A 3LKPB 1YECH 3DX6B 3CFBA 5KSBB 4BSJA 4IDJL 1IKNC 3KS0H 3AB0B 1AD0B 1KSRA 1MQKL 4YHNB 3BH9B 4M1DH 2FEDD 3L3DA 3U9PH 1EHAA 4LLWB 4C57C 4Y16A 1DBKH 3SJVD 3CZFB 3IS0X 1TJIH 2Q87A 4YBQD 4X4YB 4FFVD 1MAMH 4V1DA 2NX5A 4JO2L 5FYJD 5TF0A 4JDVA 5IFHL 4RNRB 2CDGB 3U4BH 1BBJA 4LPVA 4PTTA 4TTGA 4YHIA 5HYJA 1OL0A 4U1KA 3CSGA 4HQQL 4OKDA 1INQA 4ZUWB 4U7KA 3ZE2F 3LN5A 3TJEH 1A6UL 2GITA 5E8PB 1LE5B 1VACA 3I85A 2YD3A 2ORBH 3L3GB 1FO0L 3QQ4A 4M9OA 3KPRA 3EDDA 3QEUB 4LRIC 4KMQA 4Z77B 3AMKA 1WZLA 3BJLA 1JYXA 4KQ4H 3WKML 4GG8B 1CE1H 3ULVE 4YHZL 5JQHC 2CRMA 3ARVA 3QULB 4ZPTB 1MY5A 1FSKB 2I27N 2LE9A 5ISZE 5B4MC 2QQLL 5EBMA 1TVHA 1GZQA 1JPTL 1VERA 2P49B 1U42A 4XVJL 3C9NA 2CUHA 4NQEA 4NDMB 3HI6H 1C5DA 2QTEA 1BFOA 1F3JA 1G7PB 3V0VB 5KTEH 4O2EA 2VLLA 2HYMA 1L0XA 5K9OA 4GRLB 4XHJC 3BZFB 3NH7H 1BEYH 4V1DD 3S5LB 3WUWB 3AREA 5F6IC 2OJEA 4XPBH 5ADPL 5TE6H 4Y4HD 4JY4B 4P5TB 4EI5B 5HYSG 1WCBB 1JFQL 4UTBH 4FP8H 1ZLWH 2VXTL 4HIJA 1QBBA 5C0EB 3S97C 3SDAC 4JO4L 1BHGA 3WD5H 3TO4C 4Y4HB 2F53D 5CBEA 4NN6B 1MJ8L 4N0FB 5IESH 1MQKH 4L5FL 3BGFB 5F9WB 3AU1A 2DD8H 2VOTA 2FATL 3U9PL 4I5BB 4X6BB 1JPGA 1EZVY 1QYGH 3MBXL 3SKNA 2JK5A 2A9NH 2YD1A 1HXMB 2DQCL 4PBXA 1MHHA 3RWJB 1OD9A 4F9LA 4TVPE 1K5NA 4JY5L 1X5HA 2C26A 1IZJA 1S7TA 1RZKH 3TNMA 4KAQL 3MJ7B 2DAVA 5J11B 3ROOB 3QI9A 2W0FA 4PRDB 4PJXB 5D7KD 2B5IB 4HIXL 5J7CC 1D5IH 3BE1H 3Q0HA 3HFML 5FB8B 1BQLL 1T83A 4ZUUA 1INDL 3KPRE 3ARGD 3VXTA 2BVPB 3T4AA 4RAHA 4NZRH 4Y4HA 4R8WL 5E2WL 4HMCA 4GXVL 3SGEH 1HNFA 4PJ5D 4NUGL 4Q58C 2F19L 2VXVH 5GGQL 1Z5LA 5IBUB 1P7QB 1MHPH 4NQEE 3PHOB 4P2QD 4CMHC 4XH2B 4ZXBC 4O2FB 3KXFE 3EOAA 5BS0B 2OMBA 1M6OA 2JJSA 5IM7A 2YD5A 3JTSB 3SKJH 4GRLA 3BZ4B 1PQZA 1FGNL 1RZKC 5MHSE 2ARJB 5HYEA 2ZOLA 4YDKH 5ECJE 3BMWA 4FP8L 3C5ZC 4ZFOL 3RL2A 4M9PA 2EC9T 1HHIA 5GRUL 2OJZL 2HT3D 1C16A 1OARH 1URLA 3OKMB 5DRZB 1AGFA 3DBXA 5KANG 4JQXA 2X10A 3S96B 5BZDA 5GJTL 2V7NA 5EOTB 4BZ1H 1G7LA 3PE9A 5HGAB 1SY6A 1AO7B 4Y4FB 1G6VK 1N7MH 4X6DB 5EO0B 5EO1A 4ACPA 2OI9B 4GUPB 3T4YA 5I1HL 2LU4A 3OAYK 2ITCA 3QO0B 2JK5B 4WTZA 3MLZH 3QXDA 4MGXA 1PVHA 3PWNB 1A7NH 3E3QE 4DQOH 5EOCH 4DKAA 5CHNA 5BRZD 5AAMA 4MA8H 5C0BD 5DJAB 5JPNA 4KUZH 4OCNC 3OXRA 4JPWL 4JRYE 2NTFB 1B0RB 2ADJB 3VH8A 5HJ3A 5BXFB 4PJ9C 4MXVE 3V0WH 3QXTA 4BQ8A 4LHUD 3IDJB 3AROA 2ORBL 1U91A 5A16A 3LS5L 3RWHA 1DLHB 2WINA 2BXZA 1BJ8A 5HPMB 4NP4H 3IDGB 1PG7L 2XN9D 2AI0L 3L3DB 5FGSA 1OM3L 1NDGA 3O3AB 3L7EB 3UP1A 5T5NF 2W9EL 1YNTA 3BUTA 4MXQC 5HVGB 2Q7YA 3OKOB 1FN4A 2GT9A 5FA3B 3VA2C 1YNLL 4ODSL 4R2GB 3CFEB 1YNLH 3PABB 4X6DA 5L9DH 2H6PB 4KRMB