4KMTH

Crystal structure of human germline antibody 5-51/o12
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
218
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain O12/KAPPA
publication title Antibody modeling assessment II. Structures and models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 218
sequence length 222
ec nomenclature
pdb deposition date 2013-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kmtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kmtH01
1TNNA 4HHAB 1HHIA 1NBVH 3JWNC 2AGJL 4EN3B 1DQLL 1FBIL 3WV0A 2VC2L 1L6XA 2YN5A 2QQNL 3GIVA 3QIWB 1BJMA 1C16B 2OP4H 4HIJB 5BW7A 2NX5B 2R0LH 1BBDL 1X5HA 3NFNA 3DIFB 4M6AA 4YIQA 1CDGA 2HRPH 4NC1C 3G9VA 1I1YB 3CC5A 1DBMH 4MNGA 2H26B 5CAYB 4JFPA 4LVOC 3TBVB 2GK0A 4KI5D 2BJMH 2J8HA 1LGVA 5A40E 2NTFA 3C2AL 4RZCB 4EI6B 5IB4B 4TSAH 5JR1L 1ZWIA 4FA8A 2QSCH 1BD2E 5F7DA 3FOLA 4Y16C 4PJEA 1FQ9C 4UUJB 2LU3A 3MRLA 1YEGH 5I30L 4C83B 1KGCD 4H0IA 4XVJL 4U6YA 5DK0A 1CXKA 3RTQA 1XGRB 4PJXE 3MLRH 1CLYL 4KV5F 3MV8A 4X8JB 1C1EH 3SJVD 4LLMA 5IB1A 4LEOA 2BP3A 1WBZA 1JI2A 2Q76B 5KSAA 2DYPA 3LS5L 4XAWL 3O2VL 4NQCD 3OKMA 4ZNEE 3U1SH 2HJKB 2UYLB 3F5WA 1F4XH 1UFUA 2LVCA 4IOFC 3WFCH 4TN9A 2EDNA 3IDXH 4GS7C 3JV5A 4U6HB 3TN0D 5C0RL 1FNSH 4G6JL 1KYOJ 3O4LB 1N6QL 1DUZB 4XNQB 4XH2B 5C0IB 3DMMA 1HIML 4OZFH 1EBAA 3BO8A 4OIAA 3D39B 4Q58C 5I1IH 3UTZB 4PJDA 5B39B 1A4JA 3U4BL 2DWDB 4YAQA 2H45A 5IWLC 1TLKA 1G7PB 3KLSA 5D2NA 4MAYB 2BFVH 1EPFA 3KLHC 5CJ5A 3GK8H 4IIQB 3LEVL 5GGQL 3EFFA 1PKOA 3UMTA 2J6EA 4QT5A 1FAIH 2XRAH 2BNUB 1NAKL 3GSWA 2L7JA 3QPXH 3RP1A 3CVIL 2RCSL 3RZCD 3FQRB 1CDUA 4P5KA 5FYKU 4LVNC 1CT8B 4OTXH 5JLZA 4P2QD 3RDTC 4CADA 5H35B 1FO0L 1BX2A 3HS0B 1G6RL 5EO9A 2P42B 2B2XL 4RWYH 4UQ3A 3RIAK 4JFED 3OWEA 1LK3H 2N4IA 2V2WA 4HG4J 2I5YH 5F7LB 2OK0L 4HD9A 4X80H 1MFDH 3TZVB 4Y4KA 4IDJL 3H7LA 2APXA 1KB5B 1IC1A 1TJIL 3QI9D 1Z6JT 1SJHA 3B9VA 3FZUC 1YYML 3KS0H 5C09A 4PJ5E 3ZTNL 1JGUH 1KEGH 1ZT7A 2FEDD 2VDNL 3NIGF 5E2VL 5CD3A 2DF3A 4CMHC 3QIBB 4XP4H 1RD6A 3N1PC 2A6IB 1TTGA 1YEEH 4NQSB 4OQTH 2BERA 5JHDA 4TSCH 3ARYA 1ITCA 1J1OH 1OW0A 5LBSL 4UAOB 4BH8A 2D7TL 2IPKA 3FHQA 2G5BA 4YZFE 4ZO7A 3MLTB 3DLQR 1JNNL 1FV1B 3A6BL 1BOGB 3MFFB 1LO5B 3NFSL 4RGOH 1J0HA 5HYJD 4PJ9D 2XKNB 1OARH 4PGEB 5I1GL 1IGJA 3BRFA 4YNYA 4WHDA 1ZTXH 5C92A 5C0CE 4YH6A 2V5MA 3BH9A 2Y5TB 3CUPB 4PS4H 3GJFK 1SMOA 1EEYA 4M1GL 1IGTB 4PJ7A 3X11A 4HEPG 3A67L 5HI5C 1MVFA 4YXKH 2W0LA 4JPKH 4MS8C 4XPFH 5BV7B 4GMTL 4OCXH 5KOVC 3IYLW 2OS7A 3ULUF 4PRHE 3F12B 2R0KH 3C60C 5C0NC 5KTEH 4HT1L 1NAMA 1NMBH 1XCTB 4CAGA 3CZFA 5KVEH 2YMXH 4OCSL 1T5WB 4OZGB 4I18B 1FCCA 1K3IA 3QUZA 2N56A 1ZVSB 4OLXL 3IAQA 3ZDXF 3CPLA 2E5EA 5KG9B 4M3JA 1CD9B 4P23C 1NUDA 5FYLE 3UTTD 3QQ3B 5C0BB 4WV1C 5A43C 5F8QC 3NPSC 3MV9A 4C4KO 4Y19A 4EIZC 4F7EB 1DQMH 1QSEE 4PJBB 5HGHA 4FQCH 4R6UA 4M8QA 4LHJB 3OR6B 4HIHB 4KI5E 3RUGA 4LVHB 2JIXD 5IJKC 4RIRA 2LV4A 3U4EB 4PRPB 5AWNH 1QNZH 3OKNB 5JZ7C 4PJHB 4QNPF 3JTTA 4MNQB 5DJDA 1QFUH 5IVXE 1QBLH 3BGMA 3QXDA 3EO1A 3VI4F 1NCTA 1KGCE 1A6WH 3U0PA 2BVPB 5CIPA 1R3KA 1CICD 2IANA 4XCFL 4HWUA 3SJVE 4J3VA 5E8PB 4PV8B 4CN6A 2VLJA 2VE6B 1YMHA 5K9OB 4JFDB 4XBGB 3N9GH 2E7BA 4M1DH 4POZD 1X5GA 3SDCB 4NQCE 2LAGB 5CJQH 3MZGB 3T2OA 5AG8A 1QRKA 4PLOB 1PG7W 4NM4H 3QG7H 2W9EH 4M5ZL 5BMFL 4S0SD 3REVA 3CAFA 4ZFZA 3HMXL 3TYGH 4X9GA 2C7UB 1MCOH 1NC2A 4U1JB 3DVIA 3GM8A 4U3HA 1ORQB 4H88H 3PWLA 5E4EC 4ONFH 3PNWA 5JPNB 3W39B 2NR6C 1OSZB 3QQ4A 4U33A 3TFKC 3NA9L 3D2UB 3IJYA 5A3ID 5I0DA 1UA6L 1U2CA 3OAZK 1K4CA 3T0ED 4FFZL 3GMNA 4MVBD 2VZUA 3I02A 5EOCH 5MERB 3B8SA 5I74B 5K9QG 2MTPA 2KUTA 2EZ0D 4R26L 4OCWH 3PUCA 4FQIL 3ULUC 1F6LL 3IU3B 4ONHB 2VKWA 4OZHB 1UWEL 4Y4HA 3CDCA 4OGYH 2GKIA 4HLJA 3L3DA 1U93A 3TESA 3TPUB 1M05B 4NZRL 1S9XA 5JXED 1CZ8H 1QSFA 3M17A 4PIRF 3NMEA 4X4YA 4IRJB 4LP4A 2Z91B 4X7TA 4M6OL 1HSAB 2IADA 3DRQB 5EPMA 4Y88A 1A02N 3RWFA 2YD7A 4YBQD 5F70A 2OMBA 1ZVHA 1F8TL 2ADIA 4P2QE 5D7JB 5FOBB 3VFPA 2YRPA 1KCVL 1MCSA 5D2LA 3FQWA 1RPQA 4F7PB 1OQXA 5DQJB 2D9QB 4F7MA 4EQ3A 4JFEE 4WDIB 5D8JH 3L3GA 4JFOB 1NCBL 2BOCB 1Y0LA 5JW3L 2EKSB 5FM5M 4GAJL 2EH7H 2YS4A 1BVLA 2DKMA 3MOAL 4X8XA 3Q2CA 4HFWB 5D1XB 1D5BA 2BZDA 1ZA3B 5IHLB 3VI3E 4IMKA 5C0GA 1BVKB 4XGZA 4HZLA 4XZUB 1AC0A 1I1AA 1MJUL 1X5JA 2EEAA 3SE9H 2EYRB 4XNYH 5JA8B 5DGRA 3JWDC 5D7IF 1ZHKA 3HMWL 3HAEB 1GZPA 1I9RH 3GSQB 1Z3GH 5JW4M 5J6GA 2YRZA 1A7OH 2H3NA 3VG9C 3H0TA 4XCNB 1ZLSH 5DQDH 2J1KA 5F7NC 4M48L 5I1AB 2F8XC 4WW2F 4Y5VB 1IGIH 1TZIA 5CGMA 5FV1L 3ARSA 3CMGA 1F90L 2DTMH 3MFGB 4PJIF 5FM5O 5DHXB 4OCRL 4LCYB 3LB6D 4LLDA 1FFPB 3ALXA 3BXNB 4JRWA 1DVFA 5TDNB 5I76B 4F7CA 1HK6A 1TVBB 3OKDB 1JHTB 5JW4N 1BQSA 1JGDA 4HJJL 1P9MA 3BZ4A 3OQ3B 3EJYC 1ZSDA 2BVEA 1WGOA 1Q0YL 1A7NL 5I75C 3DV4A 3BSZH 1TFHA 4BZ1H 3D48R 1NGWA 3PQYA 4HS3B 3BESR 3GMPA 3JWOL 1INDL 1P4BL 3NA4A 2NY7L 5TE4H 3KNBA 5L2JA 1OAXH 4NHCH 1FO0B 2W9LA 5DJYB 1TZHA 3ARFD 1G6RB 4DAGL 5D1QD 1KXQE 1CDYA 1KT2A 1D5IH 1KSRA 1N3NA 1VCAA 1YPZA 2CPCA 1GGIL 4PJAB 3NACL 5DI8B 5BRZB 3OGCA 1EIBA 1S9WA 5F7YC 3FO9B 2FWOA 1XT5A 5LXGL 4XHJC 4M7LT 4Z7VE 1EO8L 1NDGA 2Y6SC 4DN3L 2BCKB 1R3JB 5KVFH 3MLUL 2EIDA 3HUJA 3C5ZA 4PY8J 4FXGB 2R1YB 1JHLH 4PJCF 3LPGA 5DO2C 1YY8B 4L4TD 1A64A 1XF5B 5E5RB 4NQEA 1U41A 3DUUA 3DX7A 2IAMA 5HDBE 5T1MB 3RIAF 2CH8A 3IFOB 5MEPB 4Z8FL 1UYWL 4P59L 4TTDD 1MHPH 4RSVA 4P2OA 2Q20A 2CKBH 3SOBL 1I4FB 4FFYL 4P5MB 2Q3ZA 3NCYP 4H8WH 4X5XA 1AR1D 3ECBA 5GSRA 4DN4L 5CCKH 5I66B 4Z95L 4RQQB 4GLRH 1ZKAA 1BBJA 2DLFH 4Q6IA 3CXHJ 1FNGA 3SCMC 2EYTB 3RX5A 2P5WD 4U1HB 3V7MA 3MO1B 1XF3A 1HH9B 2X70B 2A6DA 3KR3L 3U4AA 4FTVE 3ULVH 4ODSL 5HHXH 4MB3A 1S9YA 1UXWA 1IBGL 1RZKC 1KELH 2QQKL 4JN2A 1B0WA 4DKFH 5I1EH 2V5RA 4AH2A 3HE6A 2XQYG 2CO6B 3WXWH 3KYMA 5IEHA 4B53A 3ULVD 1YEHL 5T1LD 5T5FL 5FGRA 2JCCE 4G8GA 1U6AH 4MDIB 3NIFE 3UTOA 2HT3D 3VXTA 2EXWC 4GBXB 3X14B 2B5IC 5ALBL 3HE7B 4OZIB 4S2SA 5JDSA 4WW2C 3S4SG 4PJGF 2E9IA 4JZOA 2YD3A 2ICEB 1J5OL 1ZLVH 2Y06L 2DQTH 1GXEA 3BQUB 3HPJA 2AJSL 4C56E 4R96A 4CUCA 1JZ4A 2DM7A 3B9AA 2JK5A 1UJ3B 2DQUL 2HN7B 2UWEB 4H20H 2HFGH 3CFEB 3T0EE 3G6AB 4Y0GA 4X98A 2NY6D 5TPWL 1DLHB 1EJ6A 2JE8A 5D7LB 3WFDH 4X0KA 5D5MA 4ZPVB 5CKAA 3KXFB 2IFFL 4AMKL 5D71L 5DA4A 5LAXA 1MFEH 5ERWB 3FQXA 4NO0A 1B3JA 1CGTA 2AK1H 5KBNC 4Z7WB 4DKEH 2FL5B 3TIEA 4PJ8D 5LGHH 7CGTA 3CLFL 1OGAB 4I3SH 3RGVD 4K8RC 3WJJA 1AFVL 5CBEA 1V7NL 4GKOA 5H94A 1B0GA 5EU6B 5SWZE 4WY7L 4MWFA 2FEEL 3QUYD 3VH8A 4ZS6C 3E1F1 3FRUB 2J4WL 2P47B 1JYXA 1ZEAH 1N6UA 1TCRB 2E6QA 1A1OB 3KYKH 1AGCB 1JVKA 1G7IB 2YK1H 3B9KA 1H5BC 4Y2DC 4NO3B 3IJSB 1KJMB 5J6HA 1BM3L 3QUKA 1N0XH 2VAAB 2KZ1B 2CDGB 1LE9A 1YUHB 4KUZH 4OF5A 5CP3A 1J05A 1FFOB 1RJYA 5GHWL 4HFUL 4PRDB 5EO0A 5LCVL 3L3JA 5BOPA 1IGFL 3VD4A 2Z35B 3F7VA 2NY5C 3U9PL 2P8LA 3VCLB 5IB3B 3MRGA 1CF8H 3T8XB 1A3LH 4LDLB 4BSJA 2V7HB 1BGXH 2XFXB 3QNYB 2AJ3B 1I85A 1QQDB 1XCQB 1EFXB 1NJ9A 1P7QA 4XC3H 2PTVA 5J57B 1SM3L 1SJEA 3VWJA 4R97B 5HHPA 4TSBH 4QRPD 3N1FC 1YC8A 3PHOA 3FFCB 2W1NA 1YJDC 2QSQA 2NY1C 4J8RA 3QZWB 3MRNB 2LE9A 4ZMAT 2Q7YA 2AV1B 1KN4H 1EFQA 5JIKA 2Z93B 3WIHL 3SGEI 4WRLA 3TNMA 1FIGH 5ID0A 4MCZB 3EYOA 3Q48A 4FQ2H 4TUOA 2X4NB 5C8JB 4KTDL 1XIWA 4NCC1 3UBXB 1DN0A 4GAFB 4M7KH 2CKNA 3ZHDA 3QUXA 1HQRB 4JZNB 4I0KA 5IBUG 4QRSB 2WSKA 1BFTA 2DICA 4KDWA 1A9EA 1C08B 1IC4L 2CLRA 4G43A 4IMLA 2ZOKB 2A6KB 1HQ4A 1V3KA 5DUPL 1OGTB 3VFSA 3RGHA 1IEAA 1BZ7B 4F3FB 3MSPA 1WT5A 4D8PB 4IOFD 3SKOA 3PWUB 1LK2B 4DGVH 5L9DH 4LGSB 3U6RA 5IGXL 3U0WH 4WI4A 2GJ6D 2F54B 2IH3A 2VLRD 5MHSD 1EK3A 3GMMA 3RPKA 3PGCA 4QWWC 2VH5H 2FD6L 4HUXB 5L0QB 2HLFC 3EW3B 5TE7H 5HYJB 2Q87A 4M61A 3PHQB 4H5SB 4IOIA 4N8VA 1RUQH 3QJHA 3FN0L 4XMKL 5BXFA 4JJ5B 4J3SA 2O5ZL 1CIDA 2NY2B 1WJ3A 5T3ZL 1U95B 4XP5L 1W72A 4LKXB 4Q9BA 1DBBL 5HI4C 4NRZB 2DQDH 2RR3A 4MAUL 4HH9A 4LAQH 1QLEH 5C7XH 2PUQT 5IMOB 1JWSA 3ARDB 2W07A 3C6LD 1HDMA 4N1HB 4ELMB 3BKJL 3L5WB 5ACZA 4PRHA 5IFHH 1LO3L 1XGYH 3WO4C 1JHKL 3L6FB 3LPWA 3C9NB 3L5HA 1S7SB 5J89A 3OJDB 4Y8DC 4CRPA 2ZJSL 4P4KC 1YDPB 4WI9A 1LP9E 5EOCJ 1QEWB 3VXUB 3UTTB 3W2DL 1G7MB 2P5WE 2JJTA 2FCBA 4NFBA 4LLAA 2PO6B 3MRJA 2OZ4A 1I9JH 3OAYK 3QHFH 5E00A 1RK0A 2HT4C 3QQNA 3EO0B 1TENA 3NTCL 4K23H 1QSEA 2W91A 5EB9A 3O6FC 3H9YA 3V7AE 5IBLC 3ULVE 1I3UA 1RZ8B 1GC1L 3PL6D 4PY7B 4AEEA 3FZUD 3KLAB 1WZ1L 3D85A 4JDTL 3MBXH 3OX8B 3LKQB 3RNKB 2B4CH 5BQ7B 1KB9J 2NX5E 3DSFL 4XP6L 3WIFB 4E0RA 2MOVA 2BSRA 4OV5A 3J8F7 1QD0A 3U9UA 5IVXA 3B5HA 5C08B 3NAAH 4O9HH 2NY0B 3QG6B 2Q86A 4GQ9L 4XXDA 1R0AL 4Q9QL 3SY0A 2FLRT 5F6IC 4JM4H 3SDDC 2X4OA 4MNHB 4NZUL 1AXTH 4OLUH 3KPRB 2LTQB 4DVBA 4YPGA 1AO7D 2APBA 1MY7A 4XCYB 5T5NF 3MQIA 1SY6H 1PG7L 3VXRD 4YUEL 5A16B 2A2QT 1VACA 1MJ8L 5DMYA 5GS1B 5E8NA 3MA7B 4Z77B 4KK8C 3B2UD 4GRMB 2P46B 3QO1A 3DX6A 4KJYB 3TPKA 1D5ZA 4PB9L 4NSKB 2VUYA 5GJSH 1F58H 2BVQB 2D3VA 1G84A 2AEIT 4ZD3L 3RNQA 2QKIA 3WUWA 5FA4A 2R2HB 4KKCD 4GG6E 5MEQB 1UZ6E 1I7ZB 5FKAB 1E4WH 5LWYL 3H9SB 1G9ML 2WBJA 3FT3B 3RY5A 5H2BA 2AGJH 5HDLA 4V1DB 3VFWA 2VC2H 4HS8H 5EU7C 5C07D 2QQNH 4JHAH 3TIDA 2ZG2A 4HKBA 1PX4A 5J56B 4QRQA 5ECJE 4LARL 5I8CA 4QHNA 1KJ2L 4OCYL 1O7SA 5DVLA 2MHAA 5I1LB 1H9VA 3IFLL 3Q5YA 5AZEH 3LRSA 3WUZA 3TO2B 2FATH 4QRPE 5CHNB 1ZVYA 5ICXB 5CP7B 3A0OA 1MNUH 1SYVB 5SV3A 2HFFB 3EYVA 4JFHE 5CGYD 3GSNB 3F65A 1H3UA 3QIUB 4YE4L 1U8IB 3MRQB 2FJFB 2IWGA 1J87A 1I8KA 2QQLL 5T33H 4NOBA 5DHVH 1HZHL 2YXFA 4HV8B 2ADGA 1KULA 5JOFB 1XR9A 4P3CH 2A73B 1M4KA 4PV9B 4IBLT 1MF2L 3IDYB 4Y5YC 4L8BB 3GSRA 4D3CL 25C8H 3LD8C 4QRRD 1AGDA 4EVNA 1Q9LB 4IRZL 3SPVB 1UM6L 4XCEA 3SGDH 1KTLA 3LRGA 4X7SH 3BN3B 5TF1H 3LS5H 4S1QL 3T3ME 4M6NL 4JREC 3SBWC 2GJ6E 1F4WH 2VLRE 3VA6A 4W4OC 4Y1AB 4G6JH 1U3JA 1N6QH 4NGHH 4K94L 5BJTB 3NFPA 4JDZB 3TFKD 4XNZC 2CDFB 1AGFB 1ODAA 4MQXD 3VGEA 3RA7L 4CU8A 4U1KA 4DKDC 4YBLC 4D0DA 3SGKC 3WXVL 1T7YA 1AD0B 3QR2A 1F13A 4FNLH 4GKNB 3ULUD 5BVJA 1QR1A 4HQQH 1U3HB 2OXGA 2ADJB 4UBDC 3MLVH 3LEVH 1Z9SA 4ZUVA 3TVMB 3WCYA 3BP6B 5TGBA 3OKKB 1Q94B 4QGYA 5J3HC 5JMRA 2YSSA 3FFDB 2CR3A 3CVIH 2P45B 5HGAA 4A6YH 3ROOB 1T89A 1MWAH 3GIZH 4JFFD 1JPSL 5JNYA 4WCYH 1TETL 2CSPA 4UOW1 1DQDL 4E41B 1QPXA 2A1WH 1NLDL 1N2RA 4FG6C 4QLRA 1A0QH 2EKJA 3QHZL 4L4TB 4M9PA 2EDDA 1HEZB 1TPXB 4PR5B 3EDKA 4KH2A 5EH1A 2ED8A 1LVEA 2OK0H 4KZEL 2F19H 1KCKA 3BPOB 1IQDA 4YX2H 2O61A 2AK4B 2Z31C 1TJIH 1X5IA 3D69B 4KROD 3NCBB 3BDBA 4JRYD 1XGPB 3QT2A 5F3HA 4RFNC 5EWIH 4L8DA 2VMFA 1K2DB 2YWYA 5EUKB 2XN9A 3QDJD 3RI5F 3O9WD 4FTVA 2P8PB 4PJBE 4JY5L 4PGDB 4KPHH 5E9DB 5HHOB 1ZAGA 1TZGL 3MJ9L 4MJ6A 4RX4A 4ZOEA 5LBSH 4LNRB 3W0WD 2D7TH 3Q1SH 2Z92B 3WSQL 3MRIA 4ODTL 5L2KD 2K7PA 4X6DF 3N50A 1AO7E 3OR7B 1SBSL 3P4MA 2GITA 3VXRE 4ZYKA 1AKJD 3UTQA 3WEXB 3M1BA 2AI0L 4QOKA 1OT2A 1T0MB 3VGDA 1KIRA 1MUJA 2VR4A 2ATPB 1FNFA 3KJ6L 3HR5A 4UMGA 3N1QC 4M1GH 3S97C 4O58L 1RUKL 3VG0H 4C56A 4APQD 5E2UL 3EJYD 3A67H 3U30C 3FL7A 2YPLA 3MGAA 3BIAX 4XTRD 1MI5B 1JPGA 4MYWB 4OD2A 4JO1H 4NNXB 1N64H 4ODHH 3WLBA 4M62L 2AJYL 2E9JA 4MMZC 2WK2A 3IS1X 3K2UH 5GGSB 3B3IB 4U2ZA 5C07E 4DOHB 4JGMA 4HUUB 3B5TA 1LEIB 2YZ8A 2FIKA 4NYLA 1R5IA 4XHJD 5F3BA 1QFWM 4LCCB 5SX4I 2EDBA 1VFBA 4KMQA 5SWZA 3QO0A 4GO6B 5ESAA 2CMRH 3IXTB 5EA0H 5KANI 1E28B 3D87B 2DQIH 3ZYZA 3GSUA 4PGJA 3QRGH 4H1LG 3VXOA 4PLJD 5D6CA 3OPZL 3PJSA 4PGCB 2WIMA 3TWCL 3MRHB 5D96C 1J8KA 3WHE1 1P2CA 2RAMA 3MLSL 3WFBH 5B38A 3OKYA 2K9UA 1I3VA 5DD5L 1AJ7L 5HHQA 3L9RA 1MHHB 2P5EA 3W9EA 3F58H 3FO1A 3I6GA 3UPRB 1KPRA 4ZAKC 3E6HB 3D0LB 3U2SB 2XNAB 1IE5A 4JPWH 2ZPKL 3QB7C 5HVFB 2BC4B 2OLDA 1GOFA 2DQEL 4QRRE 4LVOB 3Q3GA 2YUWA 1GGYA 3STLB 1CDHA 4MSWA 3WJLA 4GUPB 1YNTB 3KPLA 1NMAL 3WNOA 3NN8A 1M7IB 1N6VA 3MJ7B 3WMSA 2EXWD 1YNLL 5KSBB 3IDUA 4PP2A 4R90L 1RUMH 3JV4B 2R4SL 4KTYA 4Y16B 4JN1L 5IW3A 4Z7OF 2X4QB 1V7ML 3MRDA 1HE7A 1YECL 3C2SA 3WFEL 3DO7B 5CBAB 1K6QL 2EIBA 3INUL 2GSIB 4FFZH 2R0WL 1OB1B 3GJEA 4LFHG 4TNVF 3OBAA 1AGBA 3CH8A 4XXCC 3DVNB 3E8UH 3ILQD 3L3OA 5F7EH 4K8RH 4DK6A 5KAQG 4WW1B 2HFEB 2GTZA 3D18A 2Q6WB 3SEPA 4FQIH 3MCKB 1IZJA 4GS7B 4Y4FC 3OJVC 7FABL 3WIIH 1QRNB 1E4XL 4FP8H 4X6BB 1KBGL 4K8RD 4GOSA 5DT1L 1NGXB 2NPLX 2MMXA 3QUMA 4L8CA 5E99L 4NWTH 2F58H 2FR4B 3VFVB 1AQKH 4M6OH 1AHWC 3SE8L 3U46A 4KJWD 1WTLA 1P69B 5E6IA 5D72L 1BLNB 1BQHG 3CH1B 3FOMB 1BOYA 4Y2DD 5IHUL 1GGBH 3PWNA 3TH2T 5ILTH 2NY4C 3DUSA 1T4KB 2DMCA 1VFOA 2NNAB 3FMGH 4PJEF 5F9OH 4Z7NF 3HC4H 5GISL 4MLSA 4TRPL 2VDRH 4JZJC 3N1MC 4U1IB 3JV6B 2YPKB 5JW3H 3GMLB 3STBA 4QNPE 4W70A 5MI0C 1JK8A 2FO4B 3UYOD 3X13A 3HZYB 2X9WA 3U7YL 4QXTB 3RVTD 3MRRB 1P84K 1IKNA 4MB5A 5TF0A 3PIQB 5TFSL 3VWKC 4AM0A 3DBXA 4UNVA 3IXAB 3CZJA 4LVNB 4JRYE 4JRXB 2YHGA 3RDTB 4OCMC 2AXFA 3MUGA 4EI5D 1JGVL 1M7DA 1G7QA 3NCCB 3QDJE 1WIOA 4LSPL 4ZUTB 2NY1D 3MLYH 2FJGA 2D4DA 1CLOH 4HS6B 3W0WE 5L2KE 3WYRA 1A7QH 4HHAA 1FZKB 2UZXB 4KKAC 2D0GA 4PJDF 3GI8L 3JVGA 3BP4B 1FORL 1QBAA 2OJEB 2HAZA 5LQBH 4HWEL 2ESVB 2QADC 2WUBH 4LCWD 4X6CB 3QIWA 2WQ8A 5I71B 4H1LH 1NCDH 3ULSB 3HCVB 5L6YH 1C16A 4HIJA 1MLCB 4KHTL 4CMHB 2NX5A 3BZDA 4ELKB 1J0IA 2CJUH 2GEEA 4KKLD 3DIFA 1N26A 2DJSA 5EIIB 5DEFB 4BFGA 1EO7A 1WAAE 1X5ZA 4LHUB 2ZNWA 3VDAA 1I1YA 5FM8A 3TH3T 1CXIA 3MPCA 2J12B 1OSPH 4HUMB 3TBVA 5JA9A 5BW7C 3IDJB 4J7RA 2FH8A 4QWWD 1FVEB 4S1RH 1N0LA 4Z0BL 1MCJA 3F6LA 1JL8A 1RZKL 2X1OA 1ONQB 4EI6A 3U7WL 4HG4K 1Q9WB 2AJXH 4JPVL 4Z7UE 2R1WB 4XT1C 2JJSC 4AT6B 2R9HD 4OD3H 3NACH 4OD1L 4R4BB 3I9GL 3PWPD 3CDYA 3EJZD 2CDEB 4UUJA 3K7UA 1T83A 5IB2B 3MXWL 4C83A 1XR8B 3LIZL 3MRKB 4KJPC 4YR6A 1OF2B 4P9MH 1XGRA 4JFZH 4KU1A 1HWHB 2BMKB 3WS6C 4X8JA 2D0FA 1EUTA 1I8LA 2YWZA 5JOPD 3KXFE 1MLBB 3C60B 2KDGA 4PB0L 3L5XL 3LQAC 3BN9C 5TQ2L 2Q76A 4XMPL 2J88L 2UVEA 3FB5B 2VO5A 2UYLA 3QPQC 3G5YB 4P59H 4KQ4L 5T1DL 3RTQC 4OV6F 4IDLA 5SWSD 4U6HA 1DR9A 4P23B 4N0CD 2B1AL 4FFYH 2BVOB 5CWSA 2A9NH 2YKLL 1XZ0B 2D9CA 2FH6A 4XH2A 4IS6B 1RI8A 4QHUB 1TXKA 4R0LA 4WV1B 4NWUL 5KSAC 1WFOA 1FZJA 2P24A 3ZKXC 5FO9B 4QF1B 4P5TC 4LFHD 3UTZA 1HKLH 4K3DL 5B39A 2DD8L 2HFTA 2F53D 1IBGH 5DQ9B 2DWDA 3AFLA 3QWQB 3LH2L 4AZ8A 1G7PA 4B7LA 2KBGA 4MAYA 2PTTB 2K1MA 1HHGB 1A21A 4IIQA 4AL8H 1T2QL 4FZEH 1RHFA 3ZE2E 2OMNA 4O2CB 5ALBH 2DTSA 4HULB 5HYQA 3PP3H 2BNUA 4ORGB 2X4PB 4PJIE 3RU8H 4WI8A 5IF0B 1YN7B 1YY9D 3FQRA 4JKPL 4OT1H 5TQ0H 2J3SA 4PBVC 1WLHA 2QR0B 1CT8A 2EXYD 4UIMB 5E2TL 2OR7A 5IMLB 3SDDD 5TPWH 4LLVB 5H35A 1ORSB 5DS8B 4HWZB 3FFCE 1S5IL 2NY5L 3VXMB 4KK6C 2UUDK 2OBGA 3CX2A 3ARBD 5IB5B 3RWEB 2WINB 1NFKA 4H26B 3L3IB 4OFYD 1BQLH 4RGND 4LASH 1SEBB 4ZSOB 1RZJC 3TZVA 3LKSB 3CLFH 5E4EB 4OF0A 1ZANL 1KB5A 1YJDL 1HYSC 1XFPA 3MODL 1DLFL 5LGJB 4TVSa 4FQXC 4P57B 2BY1A 3S5LG 2QLVB 3QIBA 1RULL 5FHAL 2BSSB 2A6IA 4Z9KB 4C57C 4HXAH 2PCPB 4Y5XB 5KN5A 1QLRB 4Y4KC 2V9TA 4NQSA 4X4XB 2Y25A 1LDPL 3AB0C 4JQXA 5CUSH 4YWGL 3WL9A 4RAVB 4XPGL 3MLTA 1IAMA 4HWBL 1ADQA 4GRWH 1FV1A 1BOGA 3GO1L 2R69H 3MFFA 1LO5A 3QCTH 2ADFH 4X99B 2R8SL 5DR5L 5GHWH 4HFUH 4F58L 2XKNA 3LN5B 3GHBH 2H41A 4PGEA 5J13B 3KPNA 5FKPB 4ZOCA 1IGFH 1OW0C 3BOVA 5I8KL 2Y5TA 1TNMA 3CUPA 4ODWB 2R1XB 4UDTA 1IGTA 4HF5L 1SVCP 2WWKO 1T20B 4TVPL 2XQBL 4U4BA 3UTSD 3BUTA 1MRDL 3T1FB 2JELH 1D6EB 3BDYH 3BKYH 4JANB 1J1XL 3E3QE 2R56H 3F12A 1R6VA 1OTTC 1XCTA 5DC9B 4XB7A 1BFOB 1T5WA 4PJGE 4KRLB 4OZGA 4X9FA 4I18A 3QXAB 1WCQA 1ZVSA 1Q1JL 5BS0D 3PDDA 1FLRL 5KG9A 3OZ9L 5E8DL 4JQIH 5J1AB 2X89D 1DQJB 4NKMB 3VGAC 4PRIB 2DQGL 2HP4A 3QQ3A 4GFTB 4QEGA 2FX7H 2VXTL 1H3VA 3KYOB 5TJWK 1RVFH 5FAAA 1MFAL 4F7EA 2ZUYA 4PJBA 3T0DA 4NQUA 4OF8A 4CVXB 1U58B 4J3XA 3VG9B 1KCRL 1PX3A 3GBML 2JF1A 3OR6A 4PP1C 3AREB 3U4EA 5ALCL 2FHFA 2VQUA 3OKNA 4MJID 1Q38A 1RZIB 4GRLC 5LGKA 4PJHA 4MA7H 2Y07L 3H7BB 5D2LF 4P49A 5D1ZA 4FQJL 3BAEL 1C5CH 4IHOB 4QCIA 5C08E 2VABB 6FABL 4XP5H 4XVUC 2BVPA 1HXMB 2EO9A 3MBED 4MAUH 5IR1B 5I75B 5GGRB 1KG0B 2I60H 4K9EC 5E8PA 5JOPE 4PV8A 2VE6A 5DD6B 1BJ1H 5FHBL 5K9OA 4JKKA 4XBGA 5IQ7L 1C5BL 1RIVL 4UT7H 1QBML 1I7UB 1PG7X 3KPRE 2HYMA 4KMTL 1JRHH 1HCVA 1LO3H 5DMGC 5BO1H 5DJXB 1UT9A 2IBGA 5DMKB 5SWSE 3MROB 2C7UA 2VZVA 1H8SA 4U1JA 3QISA 1ORQA 5BZWB 1PSKL 1CD1B 3OB8A 3WNKA 3W39A 1OSZA 4OM1L 5LG1A 3RIFK 2W60B 4D9LL 4EUPG 4AQOA 2EYSB 4FG6D 2F53E 4MJ5B 2W9DH 5F71A 4EEEA 5MERA 2GFBB 1S3KL 3V5HB 5IM7B 5CSGA 3BRDA 3KVQA 1CDJA 3IU3A 4ONHA 4PPTA 1T6WA 2Z31D 5C6WH 2XTLA 2VWEE 2XV6B 1TJHL 2ZCHL 4B41A 3SCMB 4IRJA 2Z91A 1HSAA 3TT3L 1MSPA 3FTGB 4MD0B 1OAKL 4J3WA 5ISZB 3V0VB 3P4OB 5D7IB 4BUGA 4EOWL 3TA3C 3PGFL 4N0RA 5D7JA 1YPZF 1NC4A 4ZTPL 1SHMA 5F97E 3GKWL 4F7PA 4NZUH 2IG2L 2W0PA 4W81A 2B5IB 2VNCA 1T03H 2BOCA 4E42B 1EXUB 2EKSA 1PG7H 4WUUB 2ITCB 4RGNE 5J8OA 3OKOB 5I18L 1FDLH 3HUJF 3P0GB 4HFWA 5D1XA 3REWB 2D7PA 5DXWA 4F7TA 1ZA3A 4YQXL 2EDOA 1BVKA 2J8UB 1UKQA 4BM7A 2ZCKH 4K7PL 2B1HL 2DLGA 3H3PL 3QULB 3CXHK 5I15L 1MELA 5K9QI 4R4NC 1JF1A 1IAIM 4GLRI 1YEIL 2EYRA 1DN2A 5DSCB 1QACA 3HAEA 5LWYH 5E6YA 4I48B 1G9MH 5JTWA 1QFPA 5DJ8A 4XCNA 2OL3H 1B6UA 2FGZA 5I1AA 5F9WC 5EZIL 4Y5VA 5E70A 3RHWK 2IMMA 4G7VL 3BMWA 4GRWE 3OG6B 4LGPB 1KJ2H 5D9SB 4OCYH 3EAKA 4K71C 2ICWJ 4LCYA 1EZVX 1FFPA 2VDKL 4WO4C 3IFLH 5TDNA 5I76A 1A6UH 1LHZA 1TVBA 3OKDA 1JHTA 2PW2B 4PTUB 3UTSE 1BMGA 4PJCB 3P11L 4MHHG 1OP3H 1CGYA 3ROLB 1S7QB 4UT6L 4HS3A 4P48A 2JB5H 2EC8A 2XXCB 5K9KB 5K59F 3WKML 1DVFC 4I3RH 5CILL 1FO0A 5DJYA 1G6RA 5C0EB 3MXVL 4WTWA 1P9MC 3LMJL 2W0FB 2QQLH 4G6FD 4J4PD 5D5MF 4R8WL 1O5DT 2H32H 4ZAKD 1TTUA 4PJAA 5INDB 2WV3A 2IF7A 5BRZA 2P49B 5FO7B 1FHGA 1JNLH 3FO9A 4HLZG 5E8EB 3UEZA 3PG2A 1KCSL 4J6RH 1A3RL 1W0YT 2C1OB 2BCKA 1R3JA 2NY1B 2KQNA 2Q8BH 4OLVL 4RGMB 2H9GB 4FXGA 1L7IH 1N4XL 1JBJA 5E94B 1JI1A 2VLLB 1YEJH 1XF5A 3LQZB 5T1MA 3S34H 3IFOA 3NCFB 3ZDZE 4EUPH 5MEPA 3H3BC 4YDIL 3CFIC 4MA8L 4MJIE 3E2HC 4FQ1L 4LF3B 4R2GC 3UJTH 4KFZC 1I4FA 4M93B 4OF7A 4HEME 4P5MA 5I66A 1H3PL 1RV6X 4RQQA 4WFED 4JM2C 3GJFB 5CEZL 2EYTA 4ONOA 1VGKB 2X70A 3H42L 4ODVL 1P1ZB 2KQMA 4JQVC 3IGAB 3VD3A 3QXUA 4P2OC 1G7JB 1KFAL 1KNOB 4KHXL 3JSSA 4ENED 1WAAA 3FB7B 4Y4FD 2HKFL 3SDAD 3AC0A 1KTDA 2NXYD 3VFGL 2V17L 3LEYH 4MDIA 1QFHA 2VITB 3HG1D 1JIBA 4GBXA 3HC3H 3X14A 3HE7A 1ACZA 4PRBB 3OAYH 3RKPA 1FZMB 4YFLF 3HE6C 1I1FB 2ICEA 3IAPA 4LEXL 2WZPD 1RMFH 3PWPB 3BQUA 3VRJB 1UJ3A 2HH0L 2HN7A 3S3PA 3CFEA 5BVPL 1IM9D 1T0NB 4ZXBD 2WIIA 1RU9L 3G6AA 3V6FB 3K4ZA 2R0ZL 1DLHA 1Z0MA 5D7LA 1LEGB 1MI5E 1NLDH 5IW1B 1D9KC 2ZUWA 4QHLB 4ZPVA 3V79C 3KXFA 2E7LA 2C3GA 3QHZH 1KC5L 3WO4B 2RBLA 1WC7B 2AJVL 4RNRB 5ERWA 4J3UA 4DQOL 4Z7WA 2FL5A 1DSFH 4YHLL 5IESL 1JPST 1UC6A 4WGWB 4P4KB 3G6DH 4GAYB 3VWKD 2FO1A 2XZCL 1ZHLB 3GGWB 5KVDH 1RZFL 4DFIA 1OGAA 4JDVB 4GXVH 3BIBX 3PDGA 3ZZ1A 5GS0C 4Y8AA 4Z76B 1NGQL 5EU6A 5FM4A 3V0WL 4YZFF 2X10A 1JPTL 4OGAC 4U49A 5ETUB 3HZKB 3FRUA 4MXWL 4L9LC 1NEZB 1TCRA 4JO2L 3O6FB 1A1OA 3HFML 4OFIA 1AGCA 1CXHA 1G7IA 3T4YB 1KCUL 5KSUB 5IUSA 4KKAD 4J2XA 1WZKA 1KJMA 3EYQC 4AEFA 2VAAA 4N1EA 2CIIB 3MJ8B 3V5DB 2CDGA 1SBSH 1DBAL 1Q72L 2QADD 3FO0L 4IRSD 3CSYB 1YUHA 5KJRL 1A1MA 1FFOA 5CSZB 1EJOL 3W5NA 4PRDA 3GSOB 4HMEA 3ZE1E 3B9KC 1U0QA 4MQTB 3TYFB 1G9NC 5IB3A 3VCLA 3L5IA 5ESVB 1GIGH 2CK0L 3K3QA 2A77L 2FLBT 2V7HA 2XFXA 3QNYA 2AJ3A 2JTDA 3V6OE 1I3RB 3HMXA 4B7IA 1QQDA 1XCQA 1EFXA 2GSGA 3IT8D 4L4VB 1K5NB 1FJ1A 3MACL 3FFCA 1F6AB 4QXWA 3QZWA 3UO1L 1P6FA 4HLZH 2H1PL 2DDQH 2AV1A 2DI9A 3HKFA 2Z93A 1GZQA 3GMQB 1WIPA 3OHXB 4MCZA 3VWJC 1W0WA 2X4NA 5C8JA 1W8NA 3LHPH 1FLTX 3UBXA 1HQRA 2QTEA 4JZNA 5HPOA 5I1KH 4QRSA 5AYUH 3RIFF 4CN4A 1C08A 1M71B 3HI5H 4GMSH 4FQQB 2Z8VC 2ZOKA 1FNEB 2OTUA 3BN9D 4OF3A 1OGTA 1BP3B 1SVZA 4KRPD 4NJAH 1BZ7A 4F3FA 1IM3B 1XIWC 1CLZL 4D8PA 3QRFM 1FN4A 3PWUA 1LK2A 4HK0B 5IVXF 3DV6B 3RTQD 4OKDA 1TJGH 3DWTA 3MV8D 2F54A 3OXSB 4N8CL 5DRXB 3U36A 1CU4L 5GRVK 3MLSH 4HUXA 4NUGL 5DD5H 1WUNT 1IZKA 3PHQA 4LPUA 4NN5C 5DD1H 2DYPD 5KSAD 4I0PB 1QZ1A 4LIQL 5DYOB 1X5AA 4JJ5A 5CJBA 2OR9L 3R0MA 4ZO9A 2FDBP 4V2BA 1BJ1J 4GT7A 4HUKB 5DUMH 3QH3B 4LKXA 1Q0XH 4UINH 3L3KB 4NRZA 1OM3H 3DMMD 1CWVA 2H8PB 5AZ2L 2LABA 1EX0A 1BVZA 2LVEA 3SDYL 5IMOA 1C5DB 3ARDA 1NMAH 3HNVL 1YQVL 4ELMA 3L5WA 2XTJD 5IJVB 2J6EH 1EA9C 5EO1A 3L6FA 4F37K 5EUOB 3W9DB 1S7SA 2OM5A 4J23A 3OJDA 3BGFC 2VQTA 2DLEA 4JRXE 3RWDB 4WFEE 1YECH 2F5AL 1QEWA 3VXUA 1CQYA 1G7MA 3S6CA 1JZ2A 3LD8B 1YZZA 2PO6A 5CEXB 1T1ZB 3FB6B 1EMTL 4KK6D 3HRPA 3AM8A 4H1LA 1WWAX 3HI6L 1WQVT 2CUIA 2VXQH 3EO0A 3S35H 2VZ3A 4BA8A 3C8DA 4PY7A 5D6DC 1KBGH 1HYSD 2ESVE 2BNQB 5JW4Q 1A9BB 1Y6MR 1RUAL 3KLAA 5K33A 4AG4L 2VL5B 2ARJB 4XNZB 1A7BA 3OX8A 4YHNB 2QHRH 3LKQA 3RNKA 5BQ7A 1NQBA 2VKXA 1FNHA 5K9JL 1WZLA 3GM0A 3RHWF 3O2WH 2GJZB 1CGUA 1QSZA 4YBLB 3WIFA 5HPMB 1X5YA 5C08A 4XI5D 4KI5C 1SQ2N 1UADC 4Y4KD 3T09A 3QG6A 2YD2A 1FGVH 4OIIL 2C5DC 5C09D 2WP3O 4BH7B 4ZQKB 1AI1L 1OAQL 4MNHA 4LSTL 1OAUL 4GG8B 3VI3F 3EHBD 3KPRA 4LPWA 3RFZC 1MFNA 4XCYA 3RKDC 3KWWB 1QKZL 4PUBH 2EECA 3MLWL 3QWRA 3SGDI 1QBBA 4UILH 5A16A 3LN4B 5JHDD 4HGWB 5BCAA 4UT9L 3MV01 5MENB 5EZJB 2BHYA 2DM2A 5GS1A 3MA7A 1IGML 4L9DA 4CU6A 3T2QA 2Y36L 2E27L 4HXBH 4ZDHB 1CE6B 3CDGB 4KJYA 3IDNB 3FB8B 4NSKA 5KS9B 2BVQA 3NPZB 4K3JL 3W11D 1CFSA 3TN0C 5MEQA 3VGBA 4XPBH 1A2YB 1I7ZA 5FKAA 1EVTC 3TBWB 1EHLL 1X4XA 3H9SA 4JPIB 1UGNA 5E24E 3FT3A 3VXNB 1HSBA 1PAMA 4KTEH 4ZTOL 5EN2B 4OJFH 1FORH 4V1DA 4O5LL 1UVQB 4Z7OE 3R1GL 4WUKH 4XX1E 4HWEH 1ZLVK 4DCQB 1OP5K 5AUMB 3LQAL 2AXJA 4Z0XB 1UCBL 1B6DA 1P4LB 4RFNB 3DXAB 5CZXC 3NH7H 15C8H 5GGTL 1H3TA 3GKZA 4RMSA 5CD5C 4GSDH 3KG5A 3OV6A 2VDQH 1RZGB 2BRRL 3QUZD 4WTZA 4P2YA 1JWMA 2J5LC 5I1LA 3D0VA 3SKMA 5MEOB 3TO2A 5CHNA 4PP1D 5ICXA 5CP7A 3SGJA 3PV6B 1SYVA 3MGTB 4TUJB 2HFFA 2NQCA 3RZCC 3T0WA 4HAGA 4Z0BH 3V0AC 1E27B 2ZKHH 3CFBB 3MV9D 3P0YL 2V2XB 5CJOL 4Y19D 3QIUA 4Z7VF 3U7WH 2V2TA 4HBCL 1TQBC 1U8IA 5HHMB 3MRQA 2FJFA 4BZ2H 4G9FE 4OD1H 1H0DB 3RJQB 3Q6GL 5EBGA 4HV8A 4EBQL 4ZFGL 5HDBF 2C3HA 5CIPH 5EIQA 2A73A 4PV9A 4URTB 3WFHB 4RDQF 1TQCB 3OJMB 4L8BA 1LNUB 2A38A 4Z7NE 1Q9LA 2W0KA 4PB0H 3SPVA 3H9HB 3L5XH 4J3OC 4XMPH 3QI9C 4Q9RL 5DMGD 4FQLL 5HYSB 2IAND 4LRNH 4N9GB 1A7PH 3MV8E 2Y5EA 1YYLL 2UY6A 3BVNA 3EOBB 1FFNB 2VLJD 3UJIH 1C12B 4Y1AA 2XKSA 1CBVL 3AMKA 3BEWB 3IETB 2NLJB 5IFJB 4XPHL 4JDZA 5CS7A 5E08H 2CDFA 4C4KT 5FYKD 3VMPA 4MD5B 4I5BA 2JCCF 3B2VL 1RZJL 3MLXL 4K3DH 1NC2D 5IV2A 5ITBL 3NIFF 3ARWA 4RWHA 4ZUUB 1NUGA 4UQ2B 4U0RC 1AD0A 5DF0A 2XY1A 1NFDB 3BT2H 1EAJA 4GKNA 1QSVA 4PJ9C 3UZVB 2X2YA 3O6ML 1U3HA 3FRPA 4KZDH 3WE6B 5D96B 3O2DL 3V8OA 2D03H 1AY1H 3CVHL 2BOBB 1EH9A 4QXGL 2XTJE 3OXRB 3RWHB 5HHNB 4GW4B 4RA0C 3TVMA 3FAWA 5JUEL 3BP6A 1NGYB 3OKKA 1Q94A 3OKEB 5D2NE 4NC0B 4O2FB 3TCXA 1TITA 4ZAKB 3BHBA 4Q0XH 1RAMA 2VXVL 2VDPH 4JKPH 3S37L 1B0RB 4Y4HD 3D6GA 1ZLWK 3IDMB 5J12C 3WIHA 5EZOH 1H15B 4NKOB 3GBLA 1WICA 3C5SB 1QSFD 3C08H 3UJJL 5FB8B 1IAOB 4E41A 3AUVA 2BX5A 1BZQK 4X6DB 4UU9B 3KGRA 5F7UA 1HEZA 2EDXA 5I8EB 1GOGA 3KJ4C 4YHKL 1I9IL 1INEH 2IPUG 4U7SA 4MJ4A 2EE2A 4CN1A 4GJTB 2AK4A 3BH8B 1V3JA 1U8OB 1KXVC 4UB0L 5DVOA 4FMFA 1VGEL 3D69A 2APFA 3BKML 4R4ND 1XGPA 5L7XL 1YMMB 4ZO8A 1NFIA 1WISA 4PD4K 5EUKA 1DE4B 1UACL 1FAKT 2X9XA 2P8PA 3A6CH 2ZUVA 3NABL 5C09E 2DQJH 4PGDA 5E9DA 2A74B 2IQAB 2YZ1A 2FSEB 5HHOA 4U6VH 5T1KA 4CVZA 4LNRA 1KLFA 5DK2B 3BWAB 1I1AD 2Z92A 2Q3AA 5FYJL 2IPTL 4HWBH 2FYYA 2J2ZA 3VH8G 3OR7A 1IKFL 3GO1H 4GXUM 5JHDE 4M9OA 5DR5H 1CICC 2R8SH 4CMMA 4EZMA 1FVDB 3WEXA 1AHWB 3IF1B 3U0TB 1I8IB 1P6AB 1A6ZB 4Z78B 4JFYB 4NM8L 4DEPC 4POZC 1HKFA 4U0QB 4KJQD 2NY4B 5DMJB 1NCCH 4PG2A 3PE9A 3X3FH 3DURB 1MRDH 2A9ML 3VFMB 4GXUN 4JZJB 5IROA 1MI5A 1QA9B 1J1XH 4NNXA 4PJ7E 4WU7B 4I8DA 1DVFD 1CFVL 3ZSSA 1YEKH 4GQPH 3OF6A 1MIML 4LDEB 2APVA 1ZA6B 3QNXB 4K9EL 3FQTA 5A3IC 1OAZH 3B3IA 3T0EC 4F37F 2OJZL 3VXPB 1K8DB 4MVBC 4UV4H 3PQYD 3BUYB 4XVTL 5F6HJ 1CE1L 4HUUA 3OZ9H 5IFAL 4LCCA 5FDYA 2CRIA 3BD3A 2EZ0C 5DZNA 4QYOA 4NQXB 1AQDA 1F4YL 2XWTB 4L1HA 1A6AB 1I7RB 4C55A 4MA1C 2VLKB 1FG9C 1MFAH 3IXTA 3S3SA 1E28A 4RMWA 5JXEC 1S8DB 2R29L 2WNGA 3MMEB 4U1GB 3MRHA 5IMMB 3S88H 3CMOL 4Y19E 5ALCH 4NQVB 5CINL 1F11B 1NUNB 5EORL 3C5ZD 2CRYA 3KAAA 4YBQC 2CRMA 4BQ6A 2D2OA 1IQWL 2N7BA 4FQPA 2C1PA 3AU1B 3T2NL 4HUVB 1MHHA 4OGXH 3RUGE 4NQED 1DBKL 2IAMD 4L29B 3QQ9D 3UPRA 3TJHC 5HYEA 1MAMH 3E6HA 3I2CH 4P2OD 6FABH 3D0LA 3U2SA 1H3WM 5ISZE 2XNAA 1F3RB 3QFDA 2BC4A 5ADOH 3ZKND 3CCHB 1HYRC 4N8VG 5FHBH 1DBJL 4MA3B 5K93A 1NCWH 3STLA 1RIVH 4PTTB 2HJLB 2PYEB 3HTLX 3K4DA 5I0ZA 4GUPA 4KVCH 1YNTA 2IANE 1M7IA 2HKHL 2QL1A 2FX9L 4N0UB 4YIQB 4KAQL 1FYTE 4XNUL 5FUOL 2DLIA 4WFHE 2K7QA 1MCCA 5KSBA 3HE6D 3QDMB 2D7NA 3JV4A 3UAJD 4Y16A 4JFPB 5E1AA 1A14L 2X4QA 4ZUSB 4OLWL 3VJ6B 4K7PX 1CR9H 5FOJA 1XF1A 1BAFL 4G8GD 2XZQH 4NZDA 3DO7A 4OM1H 5CBAA 3ULVF 4TPRL 4XNMB 1CK0L 1FSKC 4X7DC 3VRIB 5HSFA 5HGBB 1OB1A 4AYFA 4GAGL 3DVNA 4LBEB 1S3KH 5GS0H 4XB8A 3KPSB 1XAUA 4WW1A 3BPNC 1JGLH 1JN6B 2HFEA 1KJ2A 5DK0B 4PYGA 3HNSL 2Q6WA 3RTQB 3ESVF 1DDHB 1IGCL 3MCKA 3V4VL 2VIRB 2ICWI 4HC1L 3BPCB 1QRNA 3LB6C 4X6BA 1MREL 2XYCA 5GS0D 3BRGC 5E56A 5KSAB 4HPYL 2ZCHH 5C71A 4NO0D 5KZCD 2FR4A 3VFVA 4P5TB 3DROB 3LS4L 1T7WA 2X4SB 4RFEB 3RRQA 2DQHH 5IWLA 3D3VB 3O45B 1QSFE 3CH1A 3RL2B 3DGGB 4XC1H 4DGIL 3FOMA 5FIEA 3ARFC 4AEIL 3KPMB 3H9ZA 1DQQB 4ZTPH 5D1QC 1T4KA 1VSCA 1YNKH 2NNAA 1G9NH 2DLHA 4DKAA 2Z4QB 4PJDB 1A4JB 4U1IA 3JTSB 2YPKA 3B43A 5EG6C 3GMLA 1E6OL 3MJ6A 1ZXQA 5CP3H 2FO4A 5D2LE 3B9KD 3HZYA 3L1OH 4YFDB 5I18H 4QXTA 3MRRA 1IT9L 4QHMB 5FO8B 1PYWB 3IXAA 3LAFA 3EOAB 4JLRB 2BNRB 4QT5B 4JRXA 1BHGA 1FE8L 2MWCA 1T7VA 3RDTA 1MCLA 4I4WB 1QP1A 4FFVC 3BWUC 1J8HB 4AJ0A 4ZUTA 3IVKB 1RFDL 3FT2B 3ZHLA 4KDTC 2EDLA 5TE6H 4HS6A 4NRXB 1AR1C 2IEPA 4I2XB 1CS6A 1AXSB 5JLZB 2PXYA 1FZKA 4P2RB 5FFLA 1P7QD 1D6VL 2K3TA 3VWJD 3MV7E 3J7HA 5IW6B 5EO9B 3BP4A 2VXSL 1U92B 2ZG1A 4NNPH 4DTGL 2OJEA 4FS0A 3WUWG 2ESVA 5B3NA 1Z5LB 4X6CA 4H8WC 4QRTB 4KWUA 3P40A 3HI1B 3MCLL 4FQXB 2Y9RT 3ULSA 4WVRA 1MLCA 4K3GA 4LU5L 4P9HL 4ELKA 3CGTA 1IEHA 1BEYL 3ULVC 3MLZH 4POUB 5EIIA 4JHBA 5DEFA 2C4FT 1XIWD 3AB0B 2VZTA 4HW6A 4M00A 4LHUA 3GFUA 1NGPH 1N59B 3AS2A 3QUXD 3QCUL 5L8JB 3L7FB 1FGNH 1FL6B 4FXKB 4LSUL 5F9JB 2ID5A 5B8CC 1FVEA 1PZ5B 3WKMH 4JVPA 1ONQA 2N7AA 3MXVH 2R1WA 4AT6A 5ANMB 4WJ5B 4X83A 2NY6C 2FX8L 4R4BA 2FNBA 2CDEA 2RFXB 5IB2A 5HI3D 1XR8A 1W72H 3MRKA 1OF2A 1MY5A 4UV7H 4M43L 1IGJB 2BMKA 1S9KC 2X1QA 2CUHA 3IS0X 2E7MA 4QXUH 1IVLA 1MLBA 3C60A 4P46A 4HJ0C 3RGVC 3FB5A 3HNTH 3G5YA 3QUYC 3HUJE 4LSRL 5I1JH 3VGFA 4R4FH 4P23A 4AIXA 1BECA 2CGRH 3MJ9A 5AAWA 5LKNA 2BVOA 3VGAB 4NQEE 4PRHD 5D7SH 4IS6A 2FBJH 4QHUA 1HCFX 3CFJB 1NAMB 4UTBL 4I77H 3CZFB 1VFUA 5FYLH 5FO9A 4QF1A 1X5XA 2WQRA 5ITFB 2OZ4H 1MHEB 3O8XA 3ME0A 3NZHL 4Q74A 4ZFFB 2WBWB 1JZ6A 2E8YA 5IJKA 1CTNA 3A6OA 1FVCB 5FYLD 3THML 2PTTA 4R0LC 2HJFB 2MPAL 3RY6C 4O4YH 1HHGA 4GRLB 3O6LL 1WF5A 2ENSA 4O2CA 1QSED 5KVMC 4DW2L 2X4PA 5IF0A 1YN7A 4G9FA 3L7EB 1UWGL 3VXQB 4G8GE 4OM0H 2I07B 1I1RA 5JXAL 4R7NB 4EQ2A 4IIQC 3D85D 2QR0A 3V4UL 3WHXB 3BW9A 4UIMA 5F7WC 5IMLA 2GAZB 4LLVA 1CL7L 3UYRL 1ORSA 5DS8A 4HWZA 4U05A 3VXMA 3RKDD 4LP5A 2VXUH 1PEZA 2HVJB 5IB5A 5K59E 3BZFB 4ZFOL 2WINA 4I1NB 4H26A 3L3IA 1G7HB 1LMKA 5D5ME 5FUZL 1SEBA 2WMPA 4ZSOA 1RZFH 3LKSA 4OI9A 4PJBF 1PKQB 3W81A 1F5WA 3QEQB 1NGQH 5LGJA 3G6JB 4TOYH 5F93C 1VEOA 1IC7L 4P57A 1P84J 5L88L 4F57H 4RDQG 4AENB 4MXWH 2BSSA 1X4ZA 2PCPA 1T1WA 3TZVC 4Y5XA 4L4JA 3PWLB 1QLRA 3FAXA 1MRFL 1KCUH 5JQ6L 3U48A 5LJYH 1CN4A 1T04B 4RAVA 3GSVB 4LLUB 4ZNCD 5E95B 2Z9TA 1QYGH 3I02B 2X42A 3QIBC 4X99A 4G6KL 5C0AB 2DQCL 2EE9A 5CZXD 1B88A 3LN5A 1JRHI 2EDFA 2WBJD 4HJGB 5FKPA 3CLEH 4JQXC 5CD5D 4W6WB 2IJ0C 4MX7B 4UAOC 4B5EA 1T5XB 3C6LC 2CK0H 3LKNB 3TA3B 1B2WH 2R23B 2BVTA 3DARA 5JIPA 1IGYB 5DUBB 1T20A 4G7YL 2YD1A 2C3XA 2WBKA 2XA8L 4IJ3C 4XPTL 5F96H 4MDJB 4TUKL 1D6EA 4YDJB 1TCMA 4JANA 4FHBD 5I73C 3ARGB 3UO1H 1LEKB 1S5HA 3WDIA 2XZAL 2SEBB 1UKSA 3LPFA 1P4IH 1UZ8B 5EUOE 4DZBB 2DKUA 1BFOA 1MCDA 1GPOL 4CDGC 3QXAA 1T66C 5HHVH 5J06A 5DURD 4K3HA 4LNVA 3L3GB 3VXSB 4NKMA 3RAJH 4NO5B 4PRIA 3BKCL 3PP4L 5TDPB 4W4NA 4OBSA 4K2UL 3SDXB 1JFQL 3ZKQD 2XPGB 3PL6C 3KYOA 4HIXL 4RISL 4LQFL 4YHOL 1RK1A 4CVXA 1U58A 2HLAB 1J0JA 3WD5L 3AREA 3EO9H 4WHYG 1IAIL 5F9WB 1ZE3C 4N0FB 1MFBL 5C0FB 1ZHNB 2UZYB 5DVNA 1RZIA 4G5ZH 3PGDB 1NSNL 4LCIL 3H7BA 2B4CC 3ORJA 3STZB 8FABB 2YPVH 1JZ5A 1EHAA 4IHOA 1NBVL 4E5XA 3MR9B 5B4MC 4WO4B 5ID1B 4WENB 4F9PA 1A22B 4OCNC 1HXMA 1QPPA 4EDXB 4TULH 5B38G 1RJLB 5IR1A 4OI7A 1KG0A 3N85H 5DRWB 2OP4L 5ICYB 5D1ZC 2R0LL 1J1PL 4QHKJ 3B2UC 1I7UA 3MNVB 1HH6A 4KDVA 3DX8B 5GRJH 3MA9H 3LN9A 4U1MA 4NQDB 1MCWW 3GHEH 4LDOB 5SX5K 5FGCB 1VERA 1QR4A 2HRPL 5DRZB 2FHBA 1KLGB 5DMKA 1DBML 3DV4B 3MROA 1NGWB 1H3GA 3MZTA 2BJML 4LPVA 4NPYB 5BZWA 1CD1A 4KKCC 3L95B 1L7TH 3HB3C 3QCVH 4TSAL 2VAJA 2W60A 1LO2L 5I1HL 2EYSA 2QSCL 1YPZB 1ZLUH 1EMTH 4MJ5A 3G5XA 5DWUH 1OL0A 3C87A 1HWGB 3V2AR 1YEGL 5DZOA 3V5HA 5T3XH 4D9RD 5IM7A 1UB6B 1A7RH 3T3PF 1YEFH 2I9LB 4R2GB 2AXGB 3MLRL 4HK3N 1MJ7L 4OSUH 1C1EL 1MIEH 1RUAH 5T3XD 4JM2B 5ICZB 1U91B 3SCMA 3GZKA 3U1SL 2WANA 1F4XL 1EVUA 4JG0H 3WFCL 4KY1H 1QHPA 3DPBA 3FTGA 4OFPA 3IDXL 5CGYC 1T7XA 5ISZA 4K07A 3V0VA 1FNSL 4XNXL 3P4OA 1N7MH 4R3SB 5D7IA 4RFOL 3ECBB 3HR6A 1B9ZA 5DZLA 1E4KA 3Q6FA 2FGWH 4PJAF 1PQZB 4X9HA 4NT6B 5I1IL 5CEYB 4PJFB 1T80A 1V8HA 2D31A 3ALPA 2N1KA 2R2BB 2E6PA 2XN9D 5KVGL 1UXWB 3I50L 3P30H 1F3JB 4FTVD 1X44A 3QSKB 4E42A 1QKZH 4OB5H 1EXUA 4WUUA 1FYTA 4AH2B 1A8JH 4UT9H 3WN5A 4PLKD 3ES6B 4EDWH 4RX4D 4Z7QE 1SJXA 4X4ME 1IGMH 1U3ZA 4NP4H 2Y36H 3GK8L 2E27H 5DMIH 1X6LA 4N5ED 2YA1A 1CXLA 4O00A 4CNIB 2J8UA 1FAIL 3VXTB 3BZEB 4NZJA 3G04B 1ROWA 2XRAL 5C6PB 5JDSB 1BZ9A 4QOKD 1D9KB 2Y4SA 4RMTA 3PABA 3QPXL 1BD2B 1R5VB 4X7EC 5DSCA 2CD0A 1ACYH 4X7FC 2JK5B 4C56D 4I48A 2E6JA 5C0DB 5GJTH 3LKPB 4OTXL 3TCLB 4Y2OA 2ENYA 4MQXC 3PP3K 4OGZA 4ZTOH 4PJXB 2YPLD 4BQ8A 3VFNB 5E2WH 4ODUB 1FH5L 1WAAF 1GGCL 4S0TD 4RWYL 4R9HA 1F6FB 5IT2H 5JHLH 1LK3L 2G9HB 2GK2A 5D9SA 3V7AG 4L9LB 3TIEB 1OTUD 4WHYH 2BRRH 5DHYB 4PTUA 3S8WA 2PW2A 4JB9H 2B0SH 4Z7UF 3DJ9A 3NCYS 1JGUL 5SWZD 2IFGA 3ROLA 4ERSH 1S7QA 1WBXB 4ETQB 3KPOA 4V2CB 1W2KT 4L3EE 4CU7A 3VDBA 5CJOH 3CXDH 3EJJX 5K9KA 4L1DA 3TV3L 1JCKA 1YEEL 2X7LB 4OQTL 1PW3A 1Y6KR 2ZUSA 4PRAB 1GGUA 3S37X 4TSCL 5C0EA 4D0BB 1J1OL 3TJHD 2W0FA 5SWQB 3ARRA 5J6HB 3QUKB 3P4LA 4NKDB 5INDA 4YXHH 3IRZA 2DOCA 3Q6GH 2AS5M 3OKLB 5FO7A 5E8EA 4ZFOB 2GY7B 1F97A 4Z7WF 4WWKC 4RGOL 1A1NA 2YBRB 5EO0B 4N90D 2IMNA 1RJZA 2P5ED 3L3JB 2C1OA 1ZTXL 1A6PA 3IDIB 3F7VB 1NLBL 2P8LB 4JFQB 2H9GA 4HPOH 5DD0L 4PS4L 5E94A 1FFQA 2VDML 2VLLA 4KROC 3JV0A 3LQZA 5GS3A 4MCYB 4NZTL 4YXKL 3PWJB 1L9MA 5DFVD 3MV7A 4OLYH 4LF3A 5EC1B 4OCXL 1DZBA 3O9WC 2O5YH 1SMAA 1YEDB 2AJUH 5EIVA 4OFDA 2AEQL 3DVFA 3TF7C 5KTEL 4YO0A 3T4AB 1X3DA 5IIEB 1NMBL 4HWBA 5HGDB 5KVEL 3GJFA 2DBLH 2VDOH 1VGKA 1IC5H 2DS4A 3JBG7 4MHHI 4XWOD 3CFKB 3MLXH 4NO2B 1P1ZA 2D7MA 2YOCA 3ZE2F 3IGAA 1RIUH 1XIWB 1G7JA 1T1YB 3NGBC 5INCB 1KNOA 3E6FB 4QTIH 2YC1B 2AP2A 12E8H 1QFWH 2XI9A 4PJ5B 3FB7A 5CJXA 3CK0H 3CVHH 4W6XB 4QXGH 3QDGB 3IRPX 4IMLB 1GAFL 2V7NB 4KK9D 1A5FH 4NN5B 5B39G 2VITA 4APQC 5LVEA 2MCPH 3U79A 4FRWA 1SEQL 4PRBA 3QUMH 1P7HL 3SKOB 1FZMA 3BX7C 2GIYA 1L9NA 1I1FA 3LOWA 4M7LH 3TEUA 2VXVH 1KEML 2IH3B 4XTRC 3C5JA 2IQ9H 4JO4H 2FBOJ 3VRJA 4TNWF 2OSLB 3C8KB 1T0NA 1GH7A 4N8VB 2NY3D 3V6FA 1E6JH 3WLWD 1QFUL 4LMQI 4G80A 5C0CB 1LEGA 4JY4B 5IW1A 1QBLL 4QHLA 5IK3B 3LSOB 2R4RH 5F6HI 4D9RE 5E6ID 1A6WL 3I3DA 1WC7A 4TYUA 4RNRA 1ZS8B 1FZOB 5C9KA 5MP6H 2OI9C 4YDLC 3ISWA 4O51B 4P4KA 1NL0L 4GAYA 1ZHLA 3GGWA 3N9GL 4M1DL 5DEGB 5T3XE 4LGRB 1HDMB 4JDVA 4LLQA 4Z76A 2E7LC 5CJQL 1UXSA 3BKMH 4BELD 5L7XH 4FFVD 4NCC2 4PLJC 3QG7L 3TYGL 4WIQA 5ETUA 3HZKA 4D2NA 2BXZA 4FABL 1NEZA 4F2MA 4M03A 4KVNH 4WEUD 3O6FA 4H88L 1ITBB 4ONFL 4MXVE 3T4YA 1IJ9A 5KSUA 1L6ZA 5FYJH 1CGSH 1JV5B 2XN9E 5CKGA 2HMIC 4XPAH 2CIIA 3MJ8A 3GNMH 3V5DA 1CQKA 2LAAA 4DVRH 3CSYA 5EOCL 2P8MB 2EEBA 3EDFA 3QFJE 1R24B 5CSZA 3RWCB 3O4OC 1KPUB 3GSOA 1FG2B 1P5VA 4OCWL 2AJZA 4NM8H 2PR4H 3TYFA 5ESVA 2BY3A 2EDWA 3K0WA 1S7RB 2CLVA 2DJ4A 3D85B 2CUMA 4QOKE 1I3RA 3QIWD 1DUYB 2ILLA 3EOYG 1CZ8L 3F7YB 3CFDB 1WCBB 5DD3H 1U8KB 4L4VA 2FECI 4NHUB 2BSRB 1RUPL 2NX5D 3LZFH 1OP5H 5DJCB 4DGYL 1R3IH 4OLEA 4N0UE 2KL6A 3GSNL 1MIMH 4KXZH 4FFWD 2YPLE 3QDME 1HHJB 3SJVB 4JG1H 3GMQA 3UPAA 5EBLB 1LO4L 2Z8WC 4XVTH 3EOTH 3ILQC 5D8JL 4NNYA 2F15A 4NQCB 1X5LA 4JFXB 5GZND 5I6XC 3KS0J 3CX5J 4WNQB 1JTPA 5E8NB 1F4YH 3TN0B 1M71A 5GRVL 4FQQA 4CKVX 1FNEA 32C2A 4HJ0D 4HAFA 1IM3A 3K2MC 2VZSA 4HK0A 2W59A 2Y7QB 1RHHB 1UENA 5DRXA 3OXSA 4KJWC 3SE9L 4XNYL 3NCJH 5I1CH 5IHZB 4JEGB 4OZFB 1JTTA 3PXHA 1I9RL 3P4NB 5D70L 4G6AC 4I0PA 1Z3GL 5DYOA 1A6TB 4K7FB 1A7OL 1RURH 2Q8AL 4IM8A 2J5LB 1ZLSL 5DQDL 1U8LB 3ZDYF 4LKCB 2ZSVB 3D3VE 3QH3A 3VU2A 1IGIL 4OZ4B 4N90E 2P5EE 3L3KA 3E0GA 2H8PA 4QRQB 2DTML 4QHNB 3RZCB 1DCLA 1R3LB 3RVTC 1VFAA 1C5DA 3ILPB 1VPOH 5C2BL 3L5JA 4YHYC 2NY2C 2FX9H 1T22B 3DYPA 3RWGB 4P2QB 2O5XL 5FUOH 4PGBA 4H0HB 2X4RB 4PG9B 1X4YA 5KAQF 4EI5C 5EUOA 5CMAA 3W9DA 3BSZL 3FT4B 1MCRA 4MAYD 5GGSY 4BZ1L 2AABH 4JFHD 4JFEB 1ZGLM 3RWDA 5TE4L 2UZIH 4F9LA 1OAXL 3E3QC 4JHWH 2WLYA 2LU7A 4NHCL 1RZ7H 1MCPH 3FJTA 1U8HB 5CEXA 1OP3K 4F15B 1D5IL 1XGUB 1T1ZA 3FB6A 1A6VH 4HCRL 3QI9B 4RBPH 4LSQH 2A83B 3SBWA 5EBMB 2OTPA 3NIDE 4YHMH 1CGXA 1B90A 1KLUB 2VL4A 3KPTA 1IGCH 1NBYA 3RI5K 3V4VH 1ZLWH 2IH1B 2PO6C 4EVNB 4XP1H 4KUCF 4KKLC 2BNQA 1A9BA 4QTHA 4YDKL 2VL5A 2ARJA 1KB5H 3AM8C 2HVKB 4YHNA 1OAYH 1XGTB 5GIRB 4M4PA 2GJZA 5HPMA 3DGCR 1MHPL 4U0RB 3TZVD 2CKBL 1T2JA 3DOSA 5C9JB 1QVOA 4PJ9B 1HXYB 2JB6B 4H8WL 5CCKL 1OPGH 3LCYA 4LCIH 1AE6H 4W6YB 5EULV 3RVXC 3UZEA 3DRTB 4ZS7H 4BH7A 4ZQKA 2DLFL 5GRUH 2R9HC 4BK4A 3TJEH 4M4RA 3VFUB 3FONB 4GG8A 1GCFA 3V4PL 3QIBD 3EJZC 5HHXL 1ADQH 2CRZA 3UC0H 3QNZB 1KELL 4POYA 3SKJH 3KHQA 2NY0C 5I1EL 1HI6B 3LN4A 4HIIB 4HGWA 5F7MC 4HKXB 1NCUA 5MENA 5EZJA 1IT9H 3SE4C 1PVHA 3P0VH 3RL1A 1JF5A 1ZGLP 4HMCA 4ZDHA 4KKNA 1CE6A 1MFCL 1U6AL 3CDGA 4FZ8H 5C6TH 3IDNA 3ARUA 1S7TB 3FB8A 3IU4H 1FL5B 1RIHH 2VDLH 5KS9A 2CK2A 2KZWA 1AH1A 1EEQA 1BFVH 1JNHB 3O3BB 1X5KA 2DQTL 3R06B 2NW3B 4N0CC 5BV7H 2C3VB 2VSDA 1ZGLA 4OUUB 3O6KL 2HA1A 1BIIB 3KJ4B 1A2YA 4H20L 3TBWA 2DI7A 2HFGL 4GRWF 4JPIA 5IKCB 1MPAH 3VXNA 4Z7VB 5DDHA 2UY7A 1HINH 2FB4H 1T66D 5JPMB 3TNNB 1DFBL 1UVQA 3HRZB 3WFDL 2EH8H 4DCQA 1ZHBA 5AUMA 3HAEG 3MCLH 4WFFD 5FYJE 1KV3A 2FZ3B 4Z0XA 3LKRB 4A2MA 1P4LA 2JIXB 3DXAA 3MUZ1 4DKEL 4S1SH 5HGGS 4N0YH 1BEYH 5LGHL 3O0RH 1RZGA 5IG7B 5JO5B 4I3SL 3MRBB 4X4ZA 5MEOA 2EDRA 2VWEC 3PV6A 3SKUD 1U8PB 3MGTA 1L0YA 1CD0A 2GQHA 4TUJA 5FECB 4L8DB 4XBPB 2NW2B 1YY9C 1IFHH 1CICB 1E27A 3CFBA 1ZEAL 2V2XA 4NBXB 1PLGH 1NANH 4L8SC 3KYKL 1JUFB 2YK1L 2EXYC 4XVSH 2YD8A 5B4MD 4CJ1A 4X4MA 2C26A 2FX8H 5ADPH 5I17B 3SGJC 1H0DA 1N0XL 2WWKT 2KH2B 2EDYA 3IFPB 4G42B 2JCCB 4KUZL 3ARBC 3FQNB 3UTQB 3ZDZF 3EDEA 8CGTA 4ZPTA 4KMLB 3MNZA 5D1ZD 4XCCL 3BISA 1LNUA 4RGNC 4M7JL 4NFDA 5IBTH 3AXLA 3H9HA 4YDVB 1A3LL 4UOW0 5HYSA 5ESQA 4N9GA 4G6MH 4TNVK 3T0EB 4XBEL 3EOBA 1FFNA 4TSBL 3U82B 3C6SB 1JPGB 3DETC 1C12A 1G0XA 1EZVY 3BEWA 3HB3D 3IETA 5IFJA 1BREA 4B0MM 2BSTB 2OTWA 1KN4L 1W0VB 3JZ7A 1JE6A 4YXLL 3W5MA 1DQLH 1FBIH 5C0JB 4MA1B 4MD5A 1WSST 4MZ3A 3O4LE 4ZUUA 3NZHH 2V6HA 1GHFL 3DTXB 4YBHA 4UQ2A 1FRGL 4M7KL 1NFDA 2YUZA 1DJSA 1BBDH 3WE6A 2OQJB 3D39E 2MPAH 2BOBA 3AS3A 3OXRA 3Q5OA 5ESAB 5HHNA 3DX9A 4L3EA 2EIZB 3MYZA 2V9RA 3OKEA 2NZ9D 4O2FA 3K8LA 1K4DB 4DGVL 3D5OF 5L9DL 1U3YA 5J1TC 1U3HC 3U0WL 1EGJL 3AY4C 3BJ91 3IDMA 3C2AH 5DEZA 1H15A 2VH5L 4NKOA 4LSSL 5JR1H 1G7LB 3C5SA 3L9RB 2HT2D 1CL7H 3UYRH 2Y23A 4IRJD 3FO1B 5FB8A 1IAOA 5I30H 4S1DC 3DYMA 5F1OB 4UU9A 4XVJH 5GZOD 4LOUC 5I8EA 3GMOA 1CLYH 2DQDL 5D7JD 4LAQL 5C7XL 5ELIA 1NC4D 2A6JA 5F89B 3AS0A 2PNDA 3F8UB 4GKZB 3BH8A 1U8OA 5IFHL 2FHCA 4XAWH 3O2VH 4HDIB 1KTRL 2D4FA 1R5WA 2E3VA 1FSKB 1KPVB 2DMKA 1OP9A 1NMCC 1YMMA 3QEHB 2M8XA 4D0CB 3SDXE 3ARQA 4HMDA 5C0RH 1Y18B 1DE4A 5D1XD 3BPOC 3TO4A 1HIMH 1MRFH 2A74A 2IQAA 2FSEA 3HAEH 4ODXB 1HNGA 3FCTB 3ZE1F 2ICCA 1HILA 5DK2A 3BWAA 2X05A 4KRNA 1Z9OA 1I9JL 3U4BH 3QHFL 5FGSA 3I85A 4LRIA 4GKSB 3ZT7A 4G6KH 2DQCH 3MBEC 4K23L 3D18B 3IF1A 4QGTA 3RX7A 3U0TA 1I8IA 5HD8C 1A6ZA 3MUY1 4Z78A 4JFYA 4QHKI 3WHE0 5GGQH 3BMVA 4AK1A 4F8QA 5KSBF 3ARFB 1PJ9A 5EOTB 3MBXL 2MQ3A 1NAKH 4L8CB 3QWOB 5D1QB 2XA8H 2B4CL 3RWJB 3DURA 2NXZC 3AAZB 2RCSH 3U46B 4JZJA 3V52L 1OHQA 1QA9A 3NAAL 4WU7A 3VW3L 4O9HL 1U8JB 1CGVA 3EZ8A 1ZA6A 4NUJB 1FO0H 3QNXA 1G6RH 1GPOH 5ENWB 4JM4L 2B2XH 3VXPA 3IKKA 1K8DA 1RY7B 3BUYA 3LKOB 4WFFE 5IROC 4OLUL 4N1CA 4KRMB 5D4QA 3QZWG 5IVZA 4WWKD 1DQTA 1SY6L 1I9EA 4NQXA 4OZGE 3BP7B 1IILE 1JFQH 2XWTA 4IDJH 1A6AA 3EGSB 1I7RA 1YYMH 2VLKA 1WVZA 5BRZD 3MRCB 3UBXG 3MCG1 3ZTNH 1LP9B 1S8DA 2VDNH 5C0BE 2P5WB 5E2VH 4NRYA 2CKBB 1F58L 1IAIH 1TVHA 3OG4B 3IFNL 3WNLA 3GSXB 3V5KB 1M6OB 3FKUS 4IOSD 3QFJA 5FCSH 1E4WL 1EHNA 3AU1A 5J11C 4HUVA 2BVYA 4L29A 3K8MA 4PRPE 5T1LB 5B3JE 3V6ZB 1JNNH 3QXTA 2BHZA 3A6BH 1FYHB 4HS8L 1C7TA 4PJHE 2X41A 3NFSH 4MNQE 2H2PC 4JHAL 3EUUA 1WBYB 2EDEA 4Q7DA 5I1GH 4TQEL 2Z0BA 3CCHA 1VESA 3MNWB 3PV7A 4MA3A 1J1PH 4PTTA 2HJLA 5B8CB 4PJFE 2PYEA 1II4E 4HUWB 5AZEL 4N0UA 1Z9MA 1ERNA 2CLZB 2XICA 2JJSA 4YFLI 3WO3B 2NY6B 1GL4B 2FATL 4JFDE 3QDMA 5F88A 1MNUL 3GMRA 3V6OC 4GMTH 2B7DT 3T08A 1MEXL 4ZUSA 1G1CA 3VJ6A 1A4KA 3Q0HA 4HT1H 4RMVA 3HC0B 3UTPD 5AAMA 3WS6A 1I8MB 4GBXD 4OCSH 3F62A 3HE7D 4YHIA 1OQOA 2I27N 4XNMA 1LO2H 4UIKL 5I1HH 4PJ8B 3VRIA 5FUCE 5T33L 4OLXH 5HGBA 5DGQA 4X6CF 3RGVB 4LBEA 5FYJU 3BQUD 3KPSA 5JQHC 2L4OA 4D94A 1G9MC 5GGTA 1GVIA 1JN6A 3QUYB 4YR6B 4P3CL 3LEXA 1DDHA 1MJ7H 2VIRA 1J12A 3T65B 3BPCA 25C8L 5D7LD 4ALAL 3KXFD 4YC2C 2MNUA 4X7SL 2EO1A 1R3HB 1OT1A 5TF1L 4GG6B 1TDQA 1F4WL 4P5TA 4OZHE 4MQ7B 4DUWA 2IBZY 2YEZB 1ED3B 3QAZC 2ZZUT 3DROA 3KDMB 1T0PB 2X4SA 4UDUB 4RFEA 4HGMA 5FA3B 5TDOB 4XNXH 5CWSB 3D3VA 1OGAD 3O45A 4RFOH 3TBSB 3RL2A 4ISVB 3DGGA 4NGHL 4R0LB 3KPMA 5EU6D 3ULUL 4RRPA 1DQQA 4J4PC 5GGRY 1FZJB 2P24B 2HMID 4FXLA 1XGQB 4PD4J 4PLNC 2Z4QA 5KVGH 3I50H 4XCFH 1MJJB 3JTSA 2HTLC 4FNLL 3F7RA 4WU5B 4HUNB 3BJLA 4QRPB 4HQQL 1IRAY 2PETA 3I6KB 1F2QA 3CDFA 4QHMA 2H2SD 5FO8A 1PYWA 3MLVL 5C3LD 3BP5B 3VRLE 3VFTB 3EOAA 5GGUB 3H6JA 4JLRA 2BNRA 6CGTA 3RBGA 3KYAA 3L3HB 1U36A 5HYQB 5BMFH 4M5ZH 1Z9LA 4I4WA 2A0LC 3HMXH 5H8DA 1J8HA 4A6YL 3IVKA 3FT2A 1MWAL 2M26A 3GIZL 4WCYL 4NRXA 3ZYIA 1S7VB 4I2XA 2VR9A 3NA9H 1AXSA 1UA6H 4KGJA 1EFXD 4P2RA 4NDMA 3SKNB 5IW6A 1JWUB 1U92A 2A1WL 4F33B 4M02A 3TM6A 3FFCD 1FH5H 1A0QL 1GGCH 1Z5LA 4K94C 2HRLA 5I9QC 4QRTA 4R26H 2VN7A 3O2DA 4ENEC 3HI1A 4FQXA 3CVHA 1H8NA 3RVWC 3G5ZB 2GJ6B 5DA0B 1AIFB 1UWEH 2VLRB 1F42A 2XWBB 3GI9L 3HZVB 2PXYC 3I84A 1EUUA 1N8ZB 2F19L 3SDAC 1NCNA 3JWDL 4YX2L 2NXYC 4NZRH 1IL1B 3R0NA 3RPIB 2HWZL 1N59A 1ZMYA 5I71C 4ACPA 3T3PE 1U2HA 4G8FB 3L7FA 3QDGE 1FL6A 4FXKA 5EWIL 5F9JA 2X4UB 4CW1A 1F8TH 1PZ5A 4WTZG 3TV3H 4R7DB 5KN5B 1MAJA 2ERJC 4KPHL 4G6AD 1KCVH 2G2RB 4ZXBC 5ANMA 4WJ5A 3WL9B 3Q1SL 1JJUA 3C6LB 4LK4A 4IEFB 2F54D 4BQBA 43C9B 1NCBH 4MD4B 2ORBL 2RFXA 4IJ3B 1FL3B 2JJWA 4GAJH 3S4SB 4MXQD 4U1LA 3CJJA 1CLCA 3MOAH 1UM4L 3KPNB 4PJAE 5DFWH 5I73B 5BRZE 4JKMA 3K1KC 1NLBH 1AGEA 5DD0H 2NY2D 1Q9OB 3O41B 4UDTB 2VDMH 3VG0L 2DQFA 2J7LA 2EC9T 1MJUH 1AR2A 4NZTH 1ZT4B 3TLRA 1J88A 1VA9A 4JO3L 5FGBC 4PRNB 3HMWH 3VD7A 3T1WA 3ARDD 4KKBD 4JO1L 1VKXA 1N64L 4ODHL 2AEQH 4P46C 4WI6A 3CFJA 2HTKC 3K2UL 3MJGX 3PL6B 4EN3A 1P5UA 4M48H 4M3KB 4H25B 5ITFA 1EV2E 1MHEA 4IRSC 3IKCB 5SX5H 3RVUC 5JORB 1F90H 4ZFFA 3VXUD 1FVCA 2ATKB 1HOCB 4OCRH 2HJFA 2PO6D 3V8CA 4GRLA 1CFBA 1GAFH 1YN6B 2CMRL 2IGFL 4HJJH 5EA0L 4Q9CA 3O8XC 2DQIL 1SEQH 1Q0YH 3QRGL 1A7NH 5DTFB 2H26A 3FRPG 1KEMH 3JWOH 4LCUB 3O3AB 1INDH 1P4BH 1T21B 3L7EA 3VXQA 1AO7B 2I07A 3UTPE 2NY7H 1G6VK 1QO3B 4R7NA 1F4HA 4RZCA 3VXRB 4PBXA 5IB4A 4PYHA 3WFBL 4OZIE 1PBYA 3RVXD 4DAGH 3WHXA 3VD9A 5D1ZB 2GAZA 1MVUB 1GGIH 3F58L 4QCIB 5C08D 3HPLB 2UWEE 2DAVA 4JPWL 5LXGH 2NY0D 5E1HB 2HVJA 3BZFA 1GYAA 2CXGA 3VMOA 1EO8H 4DN3H 3K4AA 5D7LE 1G7HA 4WEBL 1N5AB 1NL0H 3MLUH 5KOMC 2AQ2A 4JR9L 4Q2ZB 1JYVA 1PKQA 4KRPC 2LU4A 3KPRD 1FFRA 3QEQA 4Z7WE 2HJKA 3G6JA 3QWRD 3RY4A 2DJUA 3K8KA 4Z8FH 1UYWH 1RUML 3P9LB 3MOBL 5C07B 3SOBH 1OGAE 4AENA 4X6FB 4FABH 3O4LA 4DN4H 1DUZA 4XNQA 4Z95H 5C0IA 5EU6E 1EAPB 5IBUB 2VRAA 3M45A 1KIPB 3NPSB 5DJZB 3D39A 1T04A 2FRGP 3GSVA 3KR3H 2EIEA 4LLUA 4ODSH 2QQKH 3E8UL 5F7EL 4K8RL 3P2TA 5C0AA 4Y5XC 3H9SD 3DMMC 1QTYT 4HJGA 4PREB 1YEHH 5T5FH 4PJ7F 4MX7A 4YHPB 5D7KD 4YHZL 3ESUF 2IPUK 1T5XA 4V1DD 3WIIL 3B6SB 5IQ9B 4FP8L 3LKNA 1TTFA 3WNNA 3TA3A 2WP3T 1JMXA 2XTJC 2R23A 3AVEA 3N1GC 1MCFA 1IGYA 3EFDL 5DUBA 4BQCA 4NWTL 2F58L 1J5OH 2AQ1A 4HKJB 2AQ3A 1AQKL 2Y06H 1RUPH 5D2NC 4MDJA 4DGYH 5J13C 4BFEA 2AJSH 4YDJA 1WWWX 2DQUH 3ARGA 1LEKA 5J7CC 3GSNH 2SEBA 4KUCD 2CO7B 1UZ8A 3QYCA 4C59B 4DZBA 1GGBL 1NC4B 3OTTA 4O2EB 5HJ3B 5ILTL 4QRRB 2NYYC 5DHVB 3HS0A 3RWIB 4BK5A 2IFFH 1LO4H 3FMGL 5D71H 4AMKH 3BEVB 5F9OL 3HC4L 3QA3B 4NKIL 1J7VR 2VDRL 3LQMA 4UOJA 3VXSA 4NO5A 2PTUA 3QIUD 4HC1A 1D3CA 5TDPA 5IVNA 1D5MB 1VENA 2C9AA 5GGVY 3SDXA 3O11B 2XPGA 1AFVH 4F7TB 1V7NH 3S96B 5GS2H 3RUGF 4WY7H 1P7KB 2QBWA 2HLAA 3UDWA 3GB7B 5EU4B 3ZYOA 1JF1B 1BF8A 3DETD 2J4WH 1EEZB 4N0FA 4RMUA 5C0FA 4XI5C 1ZHNA 3MLYL 1OLZA 5F21B 4LPXA 2AV7B 5GS2D 3PGDA 1CLOL 4OKVB 5D70H 2G75B 3AROA 1VADB 3STZA 3HLAB 1BM3H 4RMRA 1A7QL 1JF6A 8FABA 2F54E 5DJ8B 5CGTA 2Q8AH 1PEWA 3MR9A 5ID1A 2L7UA 4WO4A 3AREC 1L0QA 3EHBC 5HYJE 4Y1AD 5LQBL 3UPCA 4EDXA 2WUBL