4KNCA

Structural and functional characterization of pseudomonas aeruginosa algx
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
423
structure length
410
Chain Sequence
GNLCPAAAYDSRYNTKYLGFFTHLVQAQDDWLFRTTYDLRTDFGTSAEGWRELRALRDELKRKGIELVVVYQPTRGLVNREKLSPAEKAGFDYELAKKNYLATIARFRQAGIWTPDFSPLFDEKEEHAYYFKGDHHWTPHGARRSAKIVAETLKQVPGFEEIPKKQFESKRVGLLSKLGTFHKAAAQLCGNSYATQYVDRFETEPVGNPQIALVGTSNSGPAYNFAGFLEEFSGADILNNAVSGGGFDSSLLAYMTSEEFHKNPPKILIWEFATHYDMAQKSFYRQAMPLVDNGCSGRKTVLSRKVKLRQGRNEVLLNSAALPIRSGSYVADVTYSDPSVHELKNTIWYMNGRREQLKIEQSKAVDTGGRYVFQLRNDSDWADQQFLSLEIEAPDMPQGLEVQASICQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alginate biosynthesis protein AlgX
publication title Structural and Functional Characterization of Pseudomonas aeruginosa AlgX: ROLE OF AlgX IN ALGINATE ACETYLATION.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 128
structure length 410
sequence length 423
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16822 ALGX SGNH hydrolase-like domain, acetyltransferase AlgX
A PF16824 CBM_26 C-terminal carbohydrate-binding module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1380 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4kncA02
4KNCA
chains in the Genus database with same CATH superfamily
3VBSB 3NQHA 1EY2A 4Y33A 4CCOA 2QQLA 4AHYA 1VAVA 3AJZA 4IV3B 2RM23 4YW3A 3GZEA 5A32A 3K3NA 5CAZA 2ZHNA 3JQWA 3RWNA 1S2EA 3GJBA 4CE8A 3L9JT 4AEDA 3M4FA 2FMDA 4AWDA 1AYN1 3L2HA 4N7IA 1NX9A 2IFWA 4Q1PA 2A70A 3CJIA 3D8CA 3CJIC 3PIJA 1H2NA 2FZ2A 1CD3G 2K0GA 1RUE3 2ZABA 5A7PA 1OFNA 1TMF1 4JKLA 4BLJA 4BMEA 3IDAA 3SISA 5ERLA 2YZ4A 2ZMKA 3UKVA 1WGPA 2FCUA 1AL23 2QE3A 1DYOA 1OLRA 1COV3 1WW4A 5F2SA 4G3YC 5I8TA 2DVFA 4ASKA 1AXZA 5A3TA 2YYOA 3HIFA 1GNYA 3HN3A 5BV6A 3H1YA 2BW8A 1QJX1 2XMLA 3OGGA 4C91A 3CMGA 2WNUB 1UZ0A 2BVBA 1UY3A 1DZTA 2JG8B 2BZDA 1L7QA 2VZTA 2JDHA 3VZMA 5DPNA 4U2AA 1CAWA 2IXJA 2D43A 1QQP1 4ZKTB 4HFSA 5FZ9A 3T2OA 4NHKA 1Z7S2 1C5HA 1OF3A 1UPIA 3TEXA 4IV1B 4V1PA 4QQLA 1MZEA 4QDQA 2BGPA 1VBE1 1W6OA 3D4KA 3NMBA 4QKFA 4AVTA 1QNWA 4QX5A 1KGYA 4A6OA 2HWF3 3TN93 3F95A 4FOVA 1RB8G 4BIFA 5CKQA 1GFF2 2Q8EA 4Y26A 2WZEA 3RZJA 3T4HB 1LCLA 2W1SA 1DZRA 3H1MA 5IVJA 1HXS2 3OPZA 5DG2A 1GKBA 1CR7A 3JUUA 3T30A 1BVP1 3IPVB 2NM1A 3MIEA 1XSQA 2XG3A 1S0JA 1RHI3 1R1A1 2WUHA 4P9JA 1J3PA 3DN7A 3ZXJA 1W2UA 2PHLA 1IQDC 1IPSA 1AR82 4XHBA 1GNZA 1VRH2 5C3SA 4C0HA 1DQ1A 4FFIA 2GSYA 2V5DA 5FZOA 3ZYIB 1MVQA 5FFOC 5GLVA 1RUF1 2A6XA 4YG6A 2E51A 2VTXJ 5L9RA 1W9FA 3NV4A 4LHKA 1WMFA 1UMZA 2ZA9A 4DOUA 3DPRA 3LCPA 3MIHA 4FP3A 3SH4A 4K7JA 3ZO0B 3AMQA 4AK3A 2WNUC 2ZTNA 1W9WA 3P6BA 1MS3A 1RIRA 3JB4C 2GC2A 4LLOA 5CFCB 3JXSA 3AFKA 5LWBA 1DYKA 4QQPA 2PLV2 2IXHA 4RQPB 1NXMA 3SC7X 2BOIA 4X8PA 5FMCA 4AAXA 2WJSA 1NCQB 3AFGA 2HH9A 2BGCA 3DECA 2ZPXA 3DYOA 1NCRB 1QJX3 1ND3B 1JU3A 4IV1C 5L9BA 1AX2A 4E2SA 4UW4A 4BQ5A 1HV1A 3U37A 2JDNA 5L7OB 1YFUA 5A6QA 2QQPA 4AYUA 1H2KA 1X36A 1YNAA 4IUGA 3FUQA 4RSUA 1QQP3 4CTEA 5F5AA 4RGKA 2YBSA 4HKWA 3WW3A 4N53A 4Q4Y2 3FFZA 3U78A 4OHWA 3BGAA 1LEDA 1S0FA 3GZTB 4BQ1A 5T5OA 2RV9A 4DFSA 1QU0A 1VBE3 2Z2SB 2GZWA 4YWAA 4OYUA 5CB7A 2ARXA 4OQ9A 4YG0A 3O1MA 1UF2C 3M2MA 3VUOA 1NT0A 3RZMA 2W1QA 2ZGKA 4QHZA 5CIRA 4B4QA 4NPMA 4P9YA 2RJKA 1QXPA 1BXHA 3ZVXA 1ONAA 4CDQA 4YZ4A 4DO0A 3LA3A 4JZRA 3S5AA 4LITA 4XILA 1YWKA 2YDEA 1YXWA 1DIWA 3EB7A 5FYCA 1QKQA 1QHDA 5DZGA 4CP1A 1R1A3 5JXHA 4HPKA 2AYHA 2WLPA 1UY4A 3BTYA 4A2UA 2X09A 1JBCA 2GNTA 3K46A 4RS5B 3I54A 2PHRA 4E9KA 4MGYE 5D2AA 1QDCA 1ZBE1 4AVSA 4B3NA 4DINB 1RUF3 1LOAA 1IS3A 1E5RA 4QX1A 2UWBA 1BKZA 1NCQC 3KVBA 3KB5A 4CDXB 4QGMA 1ND3A 1ND3C 1YQ2A 3OCPA 4Y1YA 4JX0A 4Y1ZA 2Z69A 4NMIA 2JIJA 5L7OC 1SLCA 4ISQA 2C6SA 2EF6A 1EUUA 2XJRA 4L97A 4XAAA 3DXUA 4FSJA 1FPN3 1YCIA 1HQNA 5FZBA 1AYN2 2PHTA 2E32A 3BOPA 2DURA 1OLQA 5BY5A 2O14A 2O8OA 1ZZ7A 3BODA 2JJ6A 3DYPA 4LBQB 4RR3B 1TMF2 4QDSA 4WVMB 4CEYA 3CIHA 3VBFA 5IW0A 4UF0B 3H3ZA 3WEZA 4XMAA 2ZMLA 3WQ0A 1K3IA 1UZVA 1FV3A 1CPNA 2OUJA 2W1WA 1QEXA 3VBUA 1XXNA 5BNPA 4D6QA 5BNPC 2ATFA 5J48A 5CVRA 3PU8A 4I0AA 1GP5A 2WT1A 1CAVB 3PDQA 5HCBA 1CGPA 1RYYA 3FE5A 3FL7A 1CZTA 4MGQA 5C33A 1QJX2 2RS11 3KF5A 4WZFA 3ORJA 1M06G 4RHV3 1RJ7A 1PVC1 4YW6A 4X6QB 1OKQA 1PM4A 3C7FA 1QQP2 3A0KA 3OEBA 1ND2B 5A6YA 4MGTA 4OUMA 1W28A 4GJZA 1JTZX 2DVBA 3EMRA 3RI9A 5I93A 4C90A 1HB2A 2R061 4YRDA 1D0HA 4DRVA 1DGWA 3G7DA 4AG4A 4XFFA 4CP2A 3WDXA 1VBE2 4PHZA 3WUDA 5GLWA 2W3JA 4JRAA 4CDXC 2C9KA 3KT7A 1X9PA 3KCYA 3I3QA 3WQ7A 4A44A 4OUSA 4I30A 3O0XA 2EALA 3BCWA 4TSVA 2C5DA 3I59A 4ASLA 1OKOA 2N7GA 4ZONA 3HWJA 4FPJA 2WKKA 3VBRB 3CZJA 1KD7A 1VJ2A 3AXEA 2PAEA 2ARAA 1QWRA 3SCGA 3JZVA 2RR11 1DF0A 2BGOA 3AKRA 1IS4A 2OIIA 1QIQA 4RR3A 1R1A2 2DBIA 4RR3C 4XJ9A 1QJFA 5CG9A 1UAIA 2XL7A 1KITA 3K4AA 1ODMA 3AYEA 3MUZ1 2WNVA 4OHXA 4UF0A 5EQUA 5GLTA 2IXCA 3MPPG 4ZPIA 5FR3A 2VZUA 4CCNA 3PUIA 4CUBA 2ZX2A 3VZNA 1GUIA 5K0UC 1ST8A 5A3NA 3POEA 2BOJA 3JD73 3OYWA 1IPKA 1RUF2 1AUYA 5FOBB 1P8JA 1CAVA 4L2NA 1VB4A 1DG6A 4FPHA 1KQRA 2ET7A 2PTMA 2R1DA 1UX6A 4XFBA 5A7SA 3B94A 1AX1A 4NROA 4XF9A 3AKTA 1QH7A 3J9SA 2VMEA 2WYSA 4I01A 1CX4A 5F6KA 4NIHA 1AJKA 1XE0A 2E9QA 2WZR1 1H4GA 3WW2A 4I02A 5FXXA 1REDA 1UU4A 2WO1A 5IVYA 4LO5B 5FY8A 2DVDA 3I3EA 2WA3A 4DZGA 5IT6A 3HBKA 1YQ6A 1XE8A 5C8CA 5I0SA 4YG3A 4BOWA 1GU3A 1HN0A 5IK7A 1GANA 3ZFEA 1SFNA 2L9LA 1H8TA 3Q8FA 3ETPA 3MHZA 4LK7A 4WVVA 1Y9GA 2B5HA 2GDFA 2J1TA 5A7WB 3O0WA 1RINA 2R063 3IDCB 2WL1A 5F8PA 5IAVA 3SXWA 3THCA 1ZRCA 4OUEA 3JCIA 4ONUA 5HV0A 1V6NA 1ZRDA 2DDUA 3ETQA 4BXFA 5FZ7A 4BQXA 4B7KA 3KMHA 4P9IA 2QQUA 2RDSA 4L9BA 2WNOA 2DU1A 3GBWA 1APNA 1OVSA 1C28A 1GBGA 4AFAA 2WQ8A 1V6MA 4YZ5A 1S0CA 2WIIB 3HJRA 3H7JA 3PUHA 2QZ3A 3WDYA 1IQAA 4JAAA 4C1XA 4LBKA 5JDBA 4PIYA 4QB2A 1SPPB 2CTVA 3VZJA 1OH3A 3DCQA 2UY9A 4XFHA 4BDVB 1X82A 1ZRFA 3R4DB 2DTYA 4AXOA 1BYHA 5DG1A 2PMWB 2X05A 3ES4A 1H1MA 1N47A 3V56A 1S4CA 5F2WA 4LUMA 1FV2A 1TE1B 5FZKA 4K40A 3W20A 4NRMA 4N7UA 1ZBE2 1JYWA 2RDQA 1ENSA 3CNAA 4ATEA 5J37A 1MVEA 2ZBJA 3BN6A 1KDMA 3LF7A 5FZ4A 5KHIA 5LK5A 5FBJA 4MZUA 4M4PA 2P34A 5FYVA 3ZN6B 4UI9L 3ZIXA 4Q4V1 3HOBA 5DAXA 2CGPA 5A3MA 3KT4A 1J84A 3EBRA 2WO7A 4AFBA 2XLGA 4UWDA 4YW5A 1RUJ3 1JU4A 4L0PA 3O1TA 1ZZBA 1W8OA 4Q8LA 3VGIA 1S0BA 1WW6A 5CYYA 3KD4A 1NZCA 1LOBA 1XBFA 2CU5A 1TNRA 4LIVA 4ZS3A 5LW9A 3WNMA 2ORXA 1TEIA 2ILMA 5CADA 1LGCA 4QQ2A 4NWWA 4CDWB 5EJ3A 2BBVA 1HB4A 5AFEA 1EYBA 3MIDA 3RYKA 3KWVA 1QJZA 3AMNA 1A3KA 2RG4A 1CAUB 4YW4A 2LS6A 5BXXA 4ISRA 1BLZA 4MH0E 2Q8CA 3CHXA 4EJRA 4DXRA 1S0DA 1GZWA 1JHNA 1ULDA 3WXPA 2B39A 5C9AB 3N36A 4N43A 1OVPA 4MUVA 2RS12 5FPVA 4I3GA 2Z4FA 2YV8A 5F3IA 4AFDA 5JPNB 5T5PA 3R4SA 3BB6A 4Y1XA 1TME1 4BWOA 5E8AA 5AC91 2HEVF 2XHKA 1H2MA 4PDWA 1PVC2 1W04A 4PDWC 4EZ4A 1HKDA 4UT5A 2VE1A 2FDJA 5C70A 2XXZA 4J25A 4KWJA 1GZTA 1ODNA 3BYWA 2BJSA 1NG0A 2F4PA 3CJXA 2R062 1OQEA 1QH6A 2QFEA 3SHRA 1DP0A 2XR4A 1LOFA 4GB31 3T2PA 1LOFC 2DCZA 3LPGA 3V64A 3VBOC 3VBOA 3S7IA 4MXWA 1RUC1 3RRDA 3E6CC 1ULGA 5FLIA 2J42A 1MS5A 5FKBA 2W5FA 5K8SA 1JZ5A 4GWMA 5A3UA 1GYKA 2C4XA 4JHTA 1KXGA 4LLFA 4AZZA 4QQHA 5BNQA 4DUXA 1DQ5A 2OZJA 2VQTA 5HCHA 1H2LA 3DKWA 1W6QA 4BU2A 1ACCA 4IE5A 3RJRA 4FT8A 1MEC1 1Z78A 2W92A 3ALQA 4UW6A 4FAHA 1PGL1 4XF1A 1R64A 2RR12 5KHGA 1JYTA 4V2WA 3WR0A 1F4HA 4KG8A 3VD4A 1ZZ6A 2OPWA 4LE3A 3ST7A 1ZA4A 5I0RA 1OPMA 2XKOA 4PBPA 4NIIA 4BA6A 2A1XA 1LU1A 2Y38A 4EE2A 4UBGA 1LHUA 1UKGA 4TXWA 1BK0A 1R081 5JSPA 1N3PA 2ZX3A 4HMZA 1CAUA 1O4ZA 2JDAA 4MSVA 4Y5TA 2W95A 2UY8A 4GKXA 1AR91 2E33A 1GWLA 2VW2A 3UK9A 5JAXA 5ISLA 2FQPA 5FWJA 5C9AC 4UFLA 2WFF3 3S57A 5F39A 2VMCA 1RJ8A 3SLIA 3HAGA 5KXBA 2XHNA 2FDGA 3HT2A 1UZZA 3E6DA 5FZ8A 2VMFA 4CCCA 1V70A 2EAKA 2R071 2RS53 1W0OA 3LKJA 1JN2P 2R041 3AB0A 3TWIA 1HB3A 4EQVA 1B35A 3HEIA 4Y5Z0 4YLZA 1Y9QA 4NR1A 1S2KA 2WZR2 2HWB1 3AP9A 3NJVA 2JG9A 2VXJA 3J8F1 2JG9C 3AL6A 4HETA 4QXKA 3R4UA 2FDFA 3M3CA 4FOQA 4KQ7A 2LROA 4JQTA 2VD7A 5E1RA 4Q4W1 4UAPA 3E5UA 4IEYA 2KA3A 1J59A 2D6OX 2UYBA 2ZX0A 2V4AA 3CZUA 1DZQA 3BUCA 2VTXA 1V6LA 1UXZA 2JD9A 2Q4SA 2QDNA 3OY8B 3PMEA 4MADA 5JWPA 4JTNA 1IKPA 5KHKA 4XBNA 4QPIA 1KS5A 3PTYA 4QPIC 3GYDA 2A6VA 1XOYA 4B1MA 1SCRA 1YEWA 3ASIA 4Z82A 5ANNA 1F15A 4BLIA 3B3QE 2PXJA 3K75B 5GLZA 3FX3A 2D98A 2PHUA 1ZYBA 4P02B 2ZAAA 3IB3A 4GB33 2BFUL 1NY71 5A33B 1UU6A 4Q0VA 5IK4A 4FPCA 2XBO1 3SKVA 1RUC3 2YMZA 3AYCA 4OI2A 1SG3A 3ZLIA 5IVBA 3I97A 5JR2A 1PX4A 4LBLA 4I09A 3ZYRA 2P2KA 5APAA 4AGVA 2D97A 3VZOA 1GV9A 3LEIA 4Y22A 2GH2A 1LECA 4YZ3A 3LEKA 1KJRA 4GH4A 5JXGA 2P4EA 3EXUA 5LZ6A 3NKGA 3VB9A 3TB0A 2GMEA 2W1UA 4EROA 3KGLA 3THTA 5FLHA 3TYJA 1D4M3 1SACA 1CESA 5FZEA 5HCFA 1O5UA 4W6YA 3C7OA 1ULPA 2RM21 1DHKB 2DV9A 3DV8A 4JGYB 4W65A 3VKLA 4F8AA 2EXKA 3J7MA 5FK7A 1LENA 3E1F1 3SH5A 1W6NA 4XXAA 4XZUG 3SCHA 4J1WA 1REEA 3WNKA 1BVVA 1FNYA 5IYYA 1ENXA 2K9ZA 1R093 3OBRA 1AR93 2JE7A 4XETA 3UGGA 4GULA 2ZCWA 3N4MA 3ECQA 2IXLA 2LUWA 3ZXDA 4AGRA 1GQPA 1DU3D 1FAYA 5A32B 4Q8KA 1RUE1 4MGZE 3RDIA 1TVGA 4Q1RA 1S55A 3LSDA 1LRHA 4Q4V2 4IESA 3C7EA 5FY9A 5GLUA 1OA3A 5EIYB 5C4WA 2A3XA 4LEJA 4MO3M 1AL21 5C4WC 1CIYA 4XVHA 1COV1 3UJQA 4P00B 4AEDB 4CUAA 1ZBA1 1A8MA 2QBXA 4COWA 4EN7B 5JZGC 1JZ2A 2BWAA 1S1AA 3KCCA 4IGPA 3CJIB 4JTOA 3K77A 4M3CA 4NHXA 4Q4W3 5FY7A 2Y33A 5IVCA 3LFIA 1VALA 1DLCA 3RYRA 2YU2A 4YGDA 4PLOA 4QKNA 1NA1A 1WBFA 4NRPA 2CNAA 4LE4A 3KF3A 1BCXA 3VZKA 2QQMA 3ZSEA 2C24A 2PN5A 1FNZA 2XWBB 1XU1A 3PUAA 3I2IA 1NLRA 1A8DA 3USSA 2OVUA 2HWE1 4Q26A 1J1LA 1AVBA 2E7AA 2AH2A 2ZHLA 3ZYFA 3EO6A 4EN6B 4IDZA 3WX5A 4GKYA 3RVHA 5CFDB 2EVXA 1TZOA 4W6XA 1TME2 5AC92 5D21A 1XE7A 2X29A 2Y0OA 4EN9B 1HW5A 3AXDA 3GZUC 2HWF1 1CAWB 4JGYC 4DB5A 4LBJA 2ET1A 2GNMA 2LW8A 1WBLA 2VJXA 5A70A 3WQ1A 1RUNA 4NOTA 2ZJCA 5FP7A 3FZ3A 1UO9A 2EICA 1AXYA 3WG2A 4CPBD 3W9AA 1SHWB 3U4SA 4GB32 2GP5A 3WHTA 2Z5WA 5E16A 4DUWA 3LOBA 5C8WA 4P9GA 5TSWA 1BJQA 1W6OB 1G9FA 2V4VA 1G6NA 1RUC2 4AR2A 1RUG3 5BNNA 5BNNC 5IK5A 1SDWA 1RHI1 1JHJA 1RXFA 5D8AA 5D8AC 1LTEA 2GMMA 3QD6A 1W8FA 4L8QA 3J26N 2WYFA 3ACLA 5FREA 4LKSA 3ENRA 3K48A 3E97A 2EIBA 4M3CF 1GOGA 2Q8DA 1H1IA 3T2TA 4AEDC 1MEC2 4H7MA 5FMOL 4C0BA 3BVCA 1PGL2 3HQUA 2D6LX 4B29A 2B7YA 3ON7A 3VKMA 1QOTA 5C6CA 2ADEA 1SLTA 2EIGA 3WDTA 4BMBA 1FI2A 5DN2A 3SCFA 5JPMB 1IG3A 1ULFA 4P9WA 1RUH3 2V73A 5DUWA 5HV4A 1R082 4XXPA 4OI4A 3NNGA 1W99A 4L92A 3KSCA 4LR4A 5KXCA 1JOPA 1ZBA3 4WBBA 4XFIA 5FZOB 4DXZA 3WP5A 4CSWA 2XVLA 1AR92 4KI5M 4OHVA 4AI0A 1RGSA 3B7MA 4BISA 3DPRB 4LMFA 5LBBA 1DCSA 5CFDA 2ZGTA 5CFDC 2YU1A 1US2A 4XZPA 1V6JA 4MV2A 2YG0A 1W3XA 2R072 2DUPA 1X7NA 2R042 1AXKA 3RFRA 4EWEA 5JOZA 3WLUA 3H7YA 1N3QA 2HWB2 4CUCA 1WCKA 3J8F2 2VQAA 2HWE3 4A41A 5J36A 5A3LA 2WQ4A 3O1VA 1W2AX 2I07B 4Q4W2 4MXVA 4OI0A 1J3QA 5G05L 3I2GA 2LTNA 4AFMA 4TN7A 2EAAA 3AYAA 3X29B 1UW8A 2WS93 1VAKA 3P3PA 2Q1FA 2XLFA 3WDUA 3LEGA 1RXGA 1ULEA 1DGRN 5KXDA 2J1RA 1YHFA 1JZ3A 1DYPA 5LEKA 1UOGA 5JXJA 4N53B 2J1UA 1ASJ3 2JKXA 1URXA 4JDNA 3R05A 4KGQA 3LDRA 2A3WA 4XJZA 4YGCA 3RZLA 5FDBA 5T52A 1NY72 4LT5A 4PI2A 4DMIA 2XBO2 4OMCA 3I7DA 1OF4A 1PMIA 2RMU1 4AQTA 2D6NA 1WCQA 4AOCA 4MG2A 1WD3A 4GZ9A 2VCAA 1EPWA 1S0EA 3CBNA 1LESA 3MLLA 4BK5A 5LY2A 4CDQB 2VZPA 1W8NA 1F9KA 4HKLA 4Y5SA 1TNFA 2CL2A 2QQIA 3QH6A 2NN8A 4XUTA 3VD9A 3BU7A 4COYA 1XRUA 2BV4A 5C5TA 4W50A 4W4ZA 2D3SA 1US3A 2VW0A 2WSUA 5K4LA 1QXJA 2BTVC 2RM22 4HPKB 4YVSA 2ZZJA 4NWVA 5LBFA 4CU7A 3OOXA 1J58A 3DPRC 5LBCA 1A78A 2Y6KA 3OD4A 1G8WA 1Q8VA 1OA4A 3MIBA 2B9UA 5C5UA 4I3PA 1X8EA 2R7EB 4YZ2A 1LOCA 2W94A 2RE9A 4LPLA 4QKDA 4XIKA 5KXEA 5JIUA 5KC6A 1JMUB 2YC2A 1PZ8A 1FPN1 2MPFA 2VTFA 2UWCA 1OC1A 4O9GA 4BHPA 1UL9A 2IFRA 3KV6A 3SMHA 2DCYA 5FPXA 3V0BA 1RUE2 1W3VA 1G7YA 5K7PA 3B9CA 4GD4A 3O1PA 2GNBA 4XQDA 1LNSA 4YW2A 1UU5A 1H6YA 1ZA7A 4LOSA 5DZFA 3WDWA 3IZOA 3APBA 4B4RA 1VBD1 5FZGA 2FCTA 1W90A 1AL22 1X33A 2DCJA 2I74A 3MV11 2A5ZA 1COV2 1WMXA 4M01A 3WT3A 2W39A 1UIJA 4OMDA 1BEV3 4N53C 1T6BX 2Y64A 1GICA 5J7MA 5HXVA 4XJ8A 3GXUA 3VD7A 1HX6A 1GNHA 1YRZA 2HLEA 2YPDA 2YXSA 3ELNA 4P9LA 4CEYB 4DQAA 5EPAA 5FUIA 3M3OA 3VBFB 1REFA 1UYPA 4IEXA 3CU7A 4LHSA 2ZGLA 4RHV1 4YM2A 4CCEA 3LGRA 1HV0A 3KVAA 2Z42A 1RTVA 3VBUB 5BNPB 3VHRA 5A3PA 4KU8A 4HOOA 3UGFA 4Z2WA 2PHDA 3OBAA 2ZS6B 2YHJA 2HWE2 4CDQC 2BEOA 1C8M1 2A75A 2YBKA 4NIAA 3KV4A 3SEEA 5AVAA 4BE3A 1UZWA 3BTXA 3AL5A 2RMU3 3MW2A 3QLQA 3ZSMA 4KBZA 4ZU5A 3KHCA 4KNCA 5DMYA 1PZ7A 5FZHA 2HWF2 2MNGA 3TN92 2BNOA 4CCDA 3AVSA 4CXXA 1XNBA 4MGIE 4ZXEA 3MF6A 4R8HA 1LULA 2IUWA 2PHWA 4WM8A 4FOYA 1OMIA 5FXZA 1HRV1 4QU2A 3HVDA 1UYZA 4DPNA 1MS4A 3WG4A 3D5OA 1OLME 4BCUA 4PLNA 2C26A 2VVEA 3ZFGA 3ZFGC 2D93A 1HQLA 2E26A 4CDUA 5B4NA 4CDUC 1LU2A 5M0TA 5FPAA 1RHI2 4JGZA 4JGZC 1OT5A 4HONA 1MS8A 4P08A 4Y1VA 1RUI3 3I59B 1RUD3 3JBG1 4EN0A 3SNMA 4M00A 2W9XA 5J98B 2WZPP 4H55A 2JX9A 3VN4A 1O91A 2VL4A 1BQPA 2UURA 2D5FA 4HVOA 2BVVA 2XVGA 3P3NA 4D6RA 3JD71 3HQRA 3LEMA 4YM1A 1VMHA 3OF1A 5FIXA 2D40A 4AVCA 5ANQA 3UV9A 3RYPA 4NRQA 4QX0A 3N9QA 5KHHA 4A6SA 4CEYC 3J4UH 1W9SA 2OX0A 2WNVB 1AF9A 3GZAA 3VBFC 1ULCA 1QJU1 1SBDA 1VBD3 1YJLA 2A71A 4FPLA 1NE6A 5F9TA 1F35A 2RJ2A 3VBUC 4CU9A 4IGQA 1H30A 3N9OA 1M4WA 3J7HA 1RVF1 3RNSA 3OYWB 5FUPA 3U07A 4D8MA 3PVBB 4Y3OA 4F3JA 2W87A 2D7FA 2KD7A 5F5QA 5K0UA 4A4AA 4QMAA 4OZOA 3OTFA 1YC61 4B7EA 2ERFA 4CEWB 4EYUA 5F1RA 3N7KA 2Q5TA 4BZ4A 4XCBA 2HBTA 2OYZA 1W8WA 2JDKA 1XYPA 4FQ4A 4CCJA 4DRRA 3LE0A 1LB2A 2DFCA 1C3HA 3ZMNA 5DDJ1 1PMHX 3I3MA 3M1HA 2Y0IA 4P14A 3POSA 2XONA 5CZKA 4F7ZA 3FHQA 1SLLA 2C0ZA 1QF3A 2C1FA 1C8M3 1UMIA 1VIWB 3MICA 4LIUA 1KEXA 2VY0A 3PL0A 5C8CB 4XPVA 2XJTA 4AVBA 1AHSA 4ZZ8A 1RITA 4IEPA 3TEZA 2YROA 4FPKA 1W6MA 3NKTA 2DUOA 4YGBA 3MW3A 2D3PA 3ZFEB 4Q4X3 4RN5A 1H8TB 5A1AA 1VRBA 3PURA 5FQ0A 1NKGA 5F3CA 3GNEA 5FO7B 5A6XA 3AKPA 1W8UA 1T6GC 1HRV3 2VBDA 1BBT1 1UXXX 3LIGA 3B5LB 2IVIB 4N8MA 5LY1A 3ZFFA 3ME2A 3PVOA 3ZFFC 2W2IA 3WZ1A 3O7OA 2RMU2 5FY1A 1CIWA 2XWJB 3I4IA 4XMIA 4AGGA 1MS1A 2B46X 2P17A 4HVRA 2WNVC 3JBG3 3HNMA 3AC0A 5FRAA 1NLSA 4LA3A 5FY4A 4YM3A 3T08A 3C7GA 2AENA 3NV2A 4QX8A 3GCXA 3IDBB 4NHLA 4AVVA 5H9QA 1GWMA 2B45X 2JDYA 1F5FA 4FOWA 4KGGA 4CEWA 4CEWC 4Z8BA 1CJDA 1NZIA 2VCMA 2P3YA 4XOGA 4AAPA 1QJU3 1LOGA 3NNJA 4LBNA 4UFKA 1ZRRA 3KHBA 2G9FA 3OGJA 3ACFA 1RVF3 3MDPA 4ZZ5A 1RUJ1 3MF9A 4E8CA 5IFPA 2ZX4A 1HRI3 2P37A 1FPN2 1XNCA 2OW4A 1QJEA 1LAJA 3I3BA 4IXLA 3KV9A 5C8CC 2ZGSA 3BOWA 2IWGB 4W6WA 3VHOA 3AZYA 1L3JA 3VBHA 4AF9A 3ZFEC 5DDJ3 1VBD2 2VZQA 4R52A 4HZFA 1H8TC 1B09A 1L7LA 1ZZ9A 1SFYA 4OQ8A 2R1BA 3F2ZA 4AHWA 1O4TA 1YI7A 1XNKA 4FTSA 1IS5A 2Z79A 3WUCA 1UY0A 2VXRA 3LAGA 3OBTA 4TTGA 1SFPA 1O3SA 3ZYGA 3UGHA 5E88A 3TNQA 2EIDA 1HN1A 2UU8A 3V0AA 1C4RA 3UKNA 1OA2A 1UD1A 3HNBM 4CU8A 1N1YA 1W8TA 4NO4A 4EWAA 4RHV2 2XQXA 1UYXA 2CDOA 4QPGA 5I8SA 4D0QA 5LRSA 2ZEXA 4QAWA 1SMVA 3AMHA 4B8EA 3LIHA 4GMP1 3WVJA 2VC9A 2X53S 2FDHA 1QOSA 1GZWB 1BBT3 2Q1ZB 5JOXA 4CCKA 1JOBA 1C8M2 2DVGA 3OUHA 1WLTA 4H2AA 4PJYA 4N43B 1ALYA 3LD8A 3RZZA 3NAPA 2X8KA 2NYYA 3LWCA 4YFZA 1XPWA 2VR4A 3OPWA 3UNPA 3AX4A 3OEAA 3I2OA 4WZCA 4PDWB 2NPIA 3SQOA 1LJ7A 1H8VA 4U36A 2CYFA 4K21A 4NIGA 2JIGA 2W0XA 1MZFA 3BALA 5EJ1B 1IPJA 2PAMA 1W0PA 2XL9A 1HRV2 2I2SA 1QJY3 1AR63 4UFMA 3VKOA 3PIGA 4PF5A 2MEV3 3ZKYA 3VBOB 1F2NA 4XTPA 4KWLA 3WNPA 1STMA 2G9GA 3DEMA 4BB3A 3LZZA 5IVVA 2DTWA 1XC6A 4MXWB 3ILRA 4UOJA 1UYYA 1WW7A 4GWJA 3T4VA 5I8YA 5KBFA 4XJAA 1FMD3 2VVDA 5LA9A 1EUTA 2D3RA 1O7FA 1PGW1 2BNNA 2CWSA 2WLQA 3AP6A 2WZ8A 1QMJA 3HQXA 3JBG2 3MFCA 2BPA2 5FYTA 4LKFA 4AI2A 4K3UA 1W6QB 4XC9A 1OPOA 4JVAA 5FYSA 1S2BA 3VZLA 3JD72 4E4DX 3SITA 2ADDA 3LDKA 1AYM1 1K5MA 2VG9A 2IC1A 1PO11 2WFF1 4H3WA 4NUBA 4HSJA 3CLPA 5CKMA 1MPXA 3DF0A 1QJU2 5DUXA 4B1LA 2VOXA 4NAOA 2RS51 1J3RA 1GZ9A 1EAH3 3KQ4B 4N90A 3HT1A 3U10A 5EV7A 1POQA 5EZWA 3VD5A 1RVF2 2R16A 4QHBA 4INDA 4DY3A 3HPNA 4HL0A 4ORFA 5I0UA 1DQ0A 1ZVFA 5A7QA 1Y7BA 2A3YA 2VUJA 2HYKA 2DVAA 3AZZA 2XGXA 5GZDA 4CXWA 1K12A 3N9NA 4DUVA 4N43C 3WP6A 3NNFA 3C3VA 2ZEWA 3AZWA 1I9RA 2R6QA 1QXRA 2C9AA 2VMIA 3E5XA 2VH9A 3MPBA 1G86A 2ARBA 4BIOA 4K8RB 2OUHA 2WA4A 4LOTA 5DDJ2 1B35B 2WT2A 2VULA 4GMP3 3G6JB 4A3XA 2JG9B 1CJPA 2JECA 4MGKE 1O8SA 3N9MA 4QX7A 3JB8A 2KR2A 3FC0A 4YSFA 2Q1MA 4H7LA 4WV8A 3U0ZA 1GSLA 1C1LA 1OBNA 1VBC1 4ITCA 4JC1A 3FLRA 4LULA 3FBYA 3MYXA 2X5IA 2X5IC 2ZGPA 4FO9A 3ACGA 4LO7A 2WABA 4QU1A 5FXWA 4Z1VA 2YC0A 5FAXA 2CV6A 2H0BA 4QPIB 2JB4A 5J96B 2OPKA 1FT9A 2EXHA 3Q8EA 3FHIB 2IXIA 3PVNA 4IGOA 3IWZA 1NQJA 1YO8A 3TBDA 1BBT2 1PO23 4NHYA 3ZDSA 3CQOA 4K1ZA 1U0AA 2XKPA 2BNMA 5SV8A 2UYAA 1MACA 2P6CA 3UYJA 4EZHA 5CA6A 4E2GA 5HCAA 1Q8PA 1XB9A 1WMEA 3PHMA 4QB1A 1VAMA 2J1SA 4XBQA 3U11A 5ABJA 1D4M1 1FATA 1FOD3 1VBA3 3P1IA 4LO4B 1O3QA 2ENRA 2GC0A 4A7ZA 1XU2A 1MS0A 4LNVA 3H8RA 4Y22B 3DGTA 2D6PA 1GR3A 5GZFA 3TNPB 4FQZA 1FX5A 3B00A 2WDBA 2Y6LA 1PK6A 3AP5A 3VD3A 4GH4B 3ZM8A 1MZ6A 2QQVA 4E4HA 1CONA 1R091 3OUJA 2V5YA 3WF1A 1S0IA 4YW7A 1AYM3 1JUHA 3NV1A 4E8DA 1C8NA 3ZR5A 3P5BA 3BKZA 5JR7B 5HBAA 1PO13 2H6CA 1SCSA 2EA7A 3DKQA 3PVEA 1AL0G 1W6NB 4GA9A 2XJUA 4QXBA 2V09A 4F83A 1GWKA 5C71A 1LHVA 2ZGNA 5FYMA 2GH8A 1B35C 1SBFA 2JXAA 3H9AA 3LOIA 1RUJ2 2EXJA 5FPZA 2D5HA 2JENA 4A3ZA 1NXD1 2VCCA 3AK0A 3M7AA 4V2VA 5DAQA 4AHXA 4BH9A 4CP9A 2VZOA 4CXYA 5JMOA 2VO5A 4YW1A 2E6VA 1A6CA 3NRUA 4CYDA 2G4IA 3O12A 1IGOA 1WA4A 3POBA 4OULA 3A4UA 1WCSA 4FFGA 4NPLA 1TQ5A 3UJOA 3VDDA 4XUOA 5C4WB 5I0TA 3OUIA 1J83A 1N3OA 2QZ2A 4TWTA 4I0WB 1D2SA 2QCSB 2E63A 4M3CB 4KU7A 4YVWA 3KV5A 1VBC3 1WMDA 4FI9A 3QOPA 4CCLA 2DWRA 2ZAHA 4JHZA 4XURA 4QXHA 1NYWA 1Z7S1 2LALA 2WINB 3FUOA 2H6BA 1QNYA 4XUNA 1NA1B 3H3UA 5JCTA 1LHOA 2P3JA 4Z07A 3H42B 4OZXA 2A7AA 1XYOA 3U14A 1Q8OA 1XNAA 2DBNA 4LXLA 3AP4A 4JKKA 4OLLA 3WY6A 2FDKA 2SLIA 4MYEA 4GH4C 2WSVA 3LDBA 4RD7A 4DS0A 1W9YA 5FZCA 1HXS1 4Y20A 3WSOA 1GQHA 3IMMA 4OVEA 4QX3A 3UL2A 5JUVA 3WP3A 4HG6B 1RUG1 3WG1A 3DL3A 1OQDA 2ZMNA 2AREA 2ETEA 3ZXKA 2Y34A 1VLNA 1OFSA 3W58A 3ZSKA 2WAAA 2BWCA 1U5XA 5EYXA 2Q30A 1HJFA 4EN8B 2Y6GA 4HK9A 2YY1A 1W6PA 4K9SA 4XABA 1GQGA 1WLCA 5FMDA 4XE9A 2WBKA 1N1SA 4WM7A 2XJVA 3NJZA 1OURA 4WM7C 1UNBA 4XAEA 5B2GB 1PGSA 3FHAA 4NPRA 3J7NA 2AEYA 4GIQA 4GJYA 3B9IA 5BNNB 3U1XA 1GP4A 1YIPA 3Q8CA 2OA2A 3NL1A 1MQTB 5IUQA 1UMHA 2VNOA 1PGW2 3DXTA 5D8AB 4IEOA 5FYZA 4BQYA 5A1LA 3SH3A 3AP7A 2J22A 4OCTA 2YGMA 3LPFA 3WF4A 1YJKA 5F32A 1O3RA 1RUH1 1Y9MA 2QUOA 4CRQA 4FTEA 4XACA 2PYTA 4QD2A 1X50A 2CHHA 1YFYA 4PIXA 4OHYA 3OG2A 2XLAA 2JD4A 3JU9A 3ZYHA 1AYM2 4XYXA 1HQWA 2YUEA 5BPXA 4FXKB 1EV11 5T54A 3GM8A 3O5SA 1PO12 2WFF2 4UFHA 1K5JA 2LM3A 1UX7A 2ZKNA 3LA7A 2VW1A 5DAVA 4M0NA 3QACA 3U75A 1K45A 1NA1C 1O59A 2KXLA 4XTMA 2RS52 2WO3A 3K51A 1V6KA 1UWWA 3NNLA 1UPSA 4D3WA 1UOBA 4ES9A 1DQ2A 5A3OA 5CKNA 4IQPA 1IKQA 3ROUA 2GNDA 3POYA 3POWA 5FY0A 1NE4A 4RGAA 3WP4A 4D7TA 3N9PA 1F4AA 4UW3A 2QDRA 1N1VA 1GZCA 4Q0PA 2BERA 3ACHA 1ZZ8A 1OOPA 4EV0A 1BMV1 1OOPC 4IERA 3ES1A 1Z7S3 5FWEA 3AMPA 2GC3A 3HBZA 4AW7A 1HIXA 3S5QA 2WS91 2IZWA 3WW4A 2G9ZA 4I2OA 1PZ9A 3A22A 1LKNA 3RI8A 4AI8A 5FMBA 1W2OA 2VGDA 1WCDJ 3H8OA 2DFBA 2WC2A 3MEPA 1W2TA 1YQCA 2GALA 3VDCA 3B93A 1SEFA 3D0SA 4C1WA 1JZ7A 1JI6A 1VMJA 1ZZCA 1ASJ1 5CISA 3H8UA 1JZ6A 1VR3A 3MI8A 5IJRA 4GMP0 1HXS3 1WWYA 4YFWA 4AVAA 4S2HA 5FZ6A 2R0FA 4D6SA 2WR9A 3B69A 3Q9OA 4HBNA 2PELA 2RJLA 1MQTA 4R9CA 1MQTC 2FCVA 2VOKA 2JE9A 4MHUA 3ZPOA 5JVVA 2VBPA 2DYCA 3T3YA 2XOMA 1UIKA 1JS9A 3KCXA 2MHFA 4E2QA 5L36A 1OUSA 2HKXA 4LJHA 3PMSA 1VRH3 2PFWA 3WV6A 2D6KA 2DF7A 3B02A 3K4ZA 5FBZA 5FO8B 5K9YA 2TNFA 4HN0A 4HXCA 1D4M2 3IAPA 3VKFC 5C7GA 4D94A 2OT7A 1CX1A 4IEQA 2FMYA 2VCBA 4J1XA 4DY5A 3WW1A 3WF2A 4Q0SA 4COZA 3THDA 3EQEA 2PHFA 2XJQA 4FPFA 5GZCA 3M3IA 2VVFA 4FFFA 4XUPA 1CZSA 2VBBA 3WNXA 3O1RA 4EWDA 2VOWA 5FZMA 5LA2A 3IBMA 1R092 4AFCA 2PLV3 2XQRA 3S30A 2A73B 1U5IA 2Y26A 1EV13 3URFA 4YVSB 3WOGA 2NMNA 5F3GA 5FP8A 4S2GA 3VV1A 5FP9A 1JOJA 3I2KA 3I2FA 2B9VA 4L99A 4YPJA 2GAUA 2YB7A 3NO8A 3PUSA 5JSOA 5FZ0A 2WRAA 3QCWA 4Y4YA 4XJWA 1E5IA 5JZGB 3RZKA 4GWNA 4FPGA 4M4RA 3WG3A 3ZN4A 2JE8A 3BPZA 5CNAA 1T2XA 1BEV1 5FPUA 3C8XA 1Y3TA 2QQNA 5LA0A 4MLOA 4Q4Y3 1IZ3A 3WINE 3RJ2X 3V0BB 1D0GA 3USUA 1FYUA 3ZMOA 3BIEA 3KS7A 3T2QA 3ZXGA 4K20A 3LFMA 4Q0UA 1AR71 3A7QA 3GHNA 1H0BA 2TBVA 4YM0A 4N9HA 3GHMA 5IFTA 1CPMA 4HKOA 4PQ9A 2XH6A 4BQ3A 3MLJA 4CU6A 1PX3A 3T0AA 1LOEA 1NQDA 1QOOA 4QPYA 3Q8AA 5DAPA 1G9BA 5A6ZA 3ZYBA 5FTTC 2Y6FA 4PCRA 3WNOA 2AGSA 3EYPA 4K8FA 3ZR6A 2ZGQA 3I49A 2XUEA 3VBSA 1UN1A 3VBSC 3HN1A 2WFPA 1IG0A 2ZKLA 1CWPA 1KDKA 4IV3A 2CWMA 4IV3C 2E7QA 2FZ1A 4JDOA 4FPEA 4BJ0A 2VNRA 1HJGA 3POJA 1WLWA 2H0VA 3RWKX 5F6LB 5LEJA 3ZSLA 2Q0AA 4LHLA 2AC1A 1GP6A 5J09A 3OPTA 2GP3A 1W39A 3KM5A 3ITQA 3MBWA 3NNMA 4XCAA 4YYOA 3KLSA 1RUG2 3THPA 4YVSC 3K2OA 1EPZA 2CY6A 2F6BA 4HN1A 5A7OA 5KHJA 5LK7B 2ZGUA 2D44A 4RL7A 2NMOA 1S0GA 1DBNA 1VBB1 2F4LA 1UOJA 4K1YA 1RUI1 4WM8B 1RUD1 5GKAC 4Y24A 5IK8A 4UFJA 4UYBA 3ACIA 4LK6A 1R1ZA 5GZGA 2OKXA 5A80A 5FP3A 3ZFGB 1W05A 4ZXKA 4CDUB 4ARYA 1Q5OA 3RSJA 1AYN3 5LB6A 1D2QA 4JGZB 3POIA 1G9CA 2JKBA 4JKMA 1O4YA 1GOFA 3VLBB 1UCXA 1TMF3 2YPJA 3Q8BA 4QHOA 1G9DA 1XJAA 1W03A 3WDVA 5JSRA 1LGNA 1RUH2 1I5ZA 1NLQA 2WNUA 2IXKA 5F5IA 2E53A 2JG8A 4LBQD 5FJKA 1ZBA2 2JG8C 1E5HA 2ORZA 3JQXA 4FFHA 4HK8A 3QBQA 4HLTA 5EJZB 4MX3A 3E5QA 3S7EA 1EV12 2WT0A 1V0AA 4XW3A 2J7MA 3GBFA 3PLQA 4UW5A 4XJUA 4QM9A 5F5CA 1YQ8A 4IV1A 4QPWA 1DDLA 1WCUA 2VZRA 2AUYA 1AR73 2WAOA 2K2SA 1U5ZA 4X8NA 1WD4A 4YGEA 4CPBA 3MV01 5CEHA 2Y8KA 3T0BA 1WA6X 1SLBA 4XQ4A 1C5IA 3I8TA 4ARXA 4ET7A 5EXOA 1I1EA 5K0UB 2BDRA 4FAGA 3MFAA 1BMV2 4XQWA 4ZS2A 4S2DA 2VZ3A 1RMU1 5A3WA 3FFQA 4D7YA 2WS92 2JDZA 4GWIA 2VZSA 1OLMA 2DU0A 5JOWA 5FZLA 1V9U1 2E31A 3GBGA 2GN7A 3IPVA 4Q4X1 3NW4A 2FHRA 4FPYA 4XF0A 5E6HA 5A7NA 1PM7A 4COUA 5FOJB 5HXMA 5J1XA 1WZXA 3DUIA 1J1TA 2BRTA 4KG0A 4Q0QA 3VL8A 1HDKA 1JH5A 4WM8C 1ASJ2 1O8PA 4QQOA 3HR9A 3ZIWA 4AEKA 2QTWB 3POFA 1POV1 3PJQA 5BYNA 3RG0A 4N9IA 2FDIA 2ID4A 1A34A 1W6MB 4FP2A 1NUKA 2BUKA 4JRLA 5FQ0B 4LBMA 3KZ4C 4JQRA 1VBB3 1BZWA 3ZSJA 2Y60A 4BQ4A 1JZ4A 3BTAA 3ZX7A 1PVXA 1W06A 4LTAA 4ASMB 1CN1A 2HBUA 1JYCA 3WF3A 3MGUA 2GC1A 3A21A 5CFCA 5CFCC 3ZFFB 3W59A 4ZHNA 2J1AA 4RQPA 4RQPC 1XSRA 2YFZA 1OD3A 3NVCA 5LCWL 4AEMA 1NCQA 3NSTA 4K6BA 3ATGA 5L73A 2P3KA 1NCRA 2VNGA 5FXVA 1NCRC 4ATFA 1MS9A 4NN0A 1GLHA 1C1FA 1IS6A 4LUKA 1I6XA 4AQ6A 2WN3A 4IE4A 5L7OA 2A6YA 3UKTA 2VUCA 3RS6A 5DXDA 1DLLA 3RQ0A 1HRI1 4E4SA 4OFGA 4AEJA 3S6PA 1RUOA 2IVJA 1H9PA 4MHRA 1SDDB 5HPOA 4I0BA 3VHNA 3MZHA 3W21A 1JW6A 1U5YA 4XEZA 5T50A 3R6SA 5LASA 1D7PM 5E89A 2BYVE 4QGLA 4XHXA 2J1VA 1WKYA 1HLCA 2QKDA 4E27A 4QXCA 3RMYA 1W8HA 4ZY9A 3LQCA 3O14A 5JI7A 5FZ1A 3CF6E 3BTZA 4J6GA 2BFUS 1BEV2 4O9EA 1BK1A 2CSGA 2BP6A 5KC5A 2RHPA 2W46A 2WQZC 1CVNA 1RMU3 5KR7A 2JEMA 5GALA 1ZNPA 4B4PA 1I5PA 3VBHB 1H9WA 2PA7A 2WWUA 2ZGMA 1V9U3 2DUQA 3UT0A 1AR72 2ZX1A 3AKQA 2VZVA 3FN9A 1VE0A 4Q29A 3A23A 1LGBA 3MIGA 3I2HA 4CA9A 1MZ5A 3AMMA 3M70A 1UY1A 5FYBA 1O6UA 1POV3 3V0AB 4RS5A 2EXIA 2JB8A 4RS5C 1GMMA 1V6OA 3NWKA 3NJXA 4JV4A 3K3OA 4G9SB 2DCTA 4QPGB 5JOYA 4A7YA 2OZ6A 1KFXL 5FKCA 4LHNA 2QQKA 3SKJE 1DGWX 3WNNA 4CDXA 2NQYA 3CEWA 2JDUA 4PF1A 1PMJX 1YI9A 1DGLA 1D4VB 1OD5A 2WWSA 4FVVA 1QJY1 1AR61 1YUDA 3AJYA 4QX2A 3I2DA 2PAKA 3NAPB 3TRSB 2VM9A 3ZN5A 2MEV1 1ZBE3 2JICA 2SBAA 1F8VA 4A7KA 1H6XA 1LODA 2CDPA 3O1OA 1I3HA 4P9XA 4RFT0 5FZFA 2Q8OA 3BI3A 1FMD1 4XIOA 3EHKA 1VBB2 4LBQA 1UZYA 2GU9A 2O1QA 1RUI2 4WVMA 1RUD2 2HWC1 5IHRA 4XF3A 3UESA 5FCCA 3ZXLA 2JDMA 3CO2A 3ZDVA 3KGZA 1W0NA 2O0OA 5FPLA 3D6EA 1LR5A 1NOVA 2BQPA 1SBEA 4SBVA 2RS31 4ZU4A 1BHGA 3POGA 3IIIA 5LA1A 3PTRB 3VBHC 4DXSA 2LRPA 2OQ6A 4GALA 3OD0A 4FTBA 2P6HA 4YNIA 3FBMA 1EAH1 2KM2A 1SLIA 2R30A 3RPQA 2A6ZA 3VDAA 3ZOIA 3HNYM 2PQSA 3D3AA 5T55A 2R49A 4BM8A 1K5MB 1W2NA 4PLMA 4PT6A 4PI0A 2F17A 1ND2A 2VZ1A 4DEQA 1ND2C 5FY5A 1KS4A 2OQ7A 2QVSB 5JLVA 1QDOA 5A1FA 4SLIA 5DQ0A 5GJ6A 1JODA 2RS13 1Q3EA 4QPGC 1ULOA 4R9BA 4YARA 3R0RA 3FLPA 5EHDA 1JYNA 3V65A 3RZHA 3VDBA 2W08A 3RGBA 1U12A 3INAA 1O5LA 1PVC3 3J7LA 4X6RB 5FZAA 4P5HA 2RVAA 1AJOA 1RL3A 2O8QA 4FCAA 5B4XA 4AI3A 1RMU2 1YIFA 1F5JA 1OXCA 2XJSA 3NAPC 3TEYA 2E7TA 4LBOA 3IN9A 3VBRA 1OUXA 3TAYA 3N7MA 3VBRC 1V9U2 4Q4X2 1PNGA 2FBEA 2D6MA 2UWAA 3MW4A 4UXAA 1JYIA 1HB1A 3I3DA 2AACA 2B42B 3N7JA 3T1LA 2W52A 2B8MA 2WWJA 1UKRA 4G4FA 5FMOS 5I0DA 4NIDA 1XYNA 3MO4A 4QKBA 1PO21 5JIAA 3N9LA 1KRIA 1SLAA 5SV5A 2X5IB 5F3EA 2VMGA 3AZVA 1FXZA 3IM0A 2OXBA 2XUMA 1VBA1 1FOD1 2RR13 4KBBA 4URTA 2QQOA 3RMXA 2AEZA 1ENQA 3BPSA 5GM0A 3VKNA 4CVUA 4IEVA 2HWC3 2GMPA 3FWEA 2ZHMA 3GF6A 4LQRA 4Q27A 5IAXA 4NHMA 1ZREA 5DZEA 4R4ZA 4FPOB 3BIWE 4Z92B 3AM2A 2VMHA 4XFCA 4L11A 5FJHA 1RC6A 3C7HA 5ABJB 1K5MC 5FLJA 3WHUA 4AI9A 2RS33 5EYYA 4BQ2A 1Q8SA 2HEWF 4W8JA 2Y6JA 4MGSA 4XF4A 1JXNA 1H4HA 3AKSA 4A42A 1PIV1 5IATA 1YFXA 1LHWA 2K46A 1E57A 2XJPA 3AZXA 4RA0A 5ACA1 5C3OA 3T0DA 1PK6B 2YC4A 3ILFA 5H9SA 3ZXFA 1L7RA 3L2YA 5IVEA 5C3PA 3IT8A 3GJAA 1HRI2 1JYVA 5JI9A 1OI6A 2JWPA 2WZR3 3OGSA 1TG7A 2HJIA 3ZYPA 1E5SA 4KWUA 3B01A 5A7WA 3TEWA 4KWKA 1JUIA 3FMGA 2HWD1 1KFUL 3ABZA 1UOFA 2W47A 1WUVA 3ILNA 4RFRB 3I2JA 3U4XA 2NLRA 2ZXQA 4GQ7A 5EWSA 3C2UA 3WF0A 1YQ5A 3H3LA 2XPJA 1Z0HA 4XDPA 4CP9B 4KMQA 3EJKA 5DUUA 4Y4RA 4MVTA 2YGLA 1VB2A 2J1EA 1OSGA 2VECA 1VMFA 4Z2AA 4Q2FA 4KL1A 5FK8A 4MOAA 4LO6B 3PUQA 3VDDB 2G1MA 1IHMA 1XNDA 3GALA 3KT1A 1SPPA 2R0HA 2WN2A 1PNFA 1MR5A 2WNEA 1PHMA 4IE6A 4JDMA 2VUDA 5LRRA 2CGNA 1OHFA 5JMCA 4YVWB 2GN3A 4NVPA 4DNYA 2ZZQA 1LEMA 5LBEA 1UQXA 5FYHA 3CL1A 3N3HA 1Q56A 1XQNA 4O65A 4IEUA 3W5NA 2ZGOA 1DGRA 1NAEA 5CU1A 4A45A 5ABJC 2W68A 2WO2A 2RDRA 4O7XA 1Q43A 4COVA 1POV0 4QDRA 4IE7A 2CAUA 5I91A 3LB9A 4BK4A 1GOHA 3GCWA 1OH4A 5JXIA 3VL9A 3ZXEA 3D82A 2A6WA 5HI0A 1PK6C 1W8ZA 3ZN6A 1Y4WA 1QJY2 3NJYA 1AR62 4IW3A 4CCMA 3IIAA 2MEV2 4QB6A 4Y20B 3H0OA 4D7SA 1JZ8A 3VHPA 3HMYA 4TZDA 1VP6A 4CUGA 4UFIA 3WQBA 2VMDA 3AYDA 5G04L 1FMD2 1PIV3 1AX0A 4YZ1A 3AVRA 5ACA3 5C3RA 5FP4A 1SQ4A 3MUY1 3S0MA 1W6PB 2HWC2 4Y1UA 4IEWA 3O1UA 2ZEZA 4Q4V3 4WM7B 2FD8A 3ZKUA 2VOTA 4HANA 2VU9A 3HD8B 4TYSA 4XDOA 4LA2A 4BQWA 4CDWA 4XFGA 4CDWC 5FO9B 1X9TA 1YFWA 2R32A 5H9PA 3CKHA 1H1AA 4P5YA 2QQJA 4QWNA 4RYDA 2OS2A 3GDBA 5FZIA 2YFUA 3RZGA 2TEPA 2RS32 5EFUA 4LO8A 1KJLA 1K42A 4URAA 5DABA 5T5LA 3KQRA 3UETA 5L19A 2HWD3 5FZ3A 4C8DA 2XVKA 5C9AA 2VPVA 3N7LA 3MLKA 3VDDC 4UBHA 5D1IA 4NAMA 1EAH2 3T1MA 2V72A 2VNVA 3PNAA 5KWRA 1AZDA 1W9TA 3LA2A 4AQ2A 1LHNA 5F7UA 4FXGB 4YVWC 2JDPA 4E4ZA 2VAUA 2VOVA 5IVFA 3WCSA 4AQSA 3O1SA 3E6BA 4XFAA 5FUNA 4OHZA 5T3NA 5DUVA 1TME3 5AC93 5L9VA 1QY4A 2YBPA 1CAXB 1ZRIA 1ZX5A 3H1WA 2ES3A 4R9DA 3T09A 1N1TA 4BYYA 2I45A 3M3QA 4LORA 1ENRA 5CG8A 1OOPB 2B4KA 5IWFA 4M0HA 2BU9A 4PIZA 3A0NA 1DFQA 3IKWA 2HYXA 2Y6HA 2VQ0A 4NE9A 3MIFA 1EP0A 2XB6C 1OQ1A 5T5JA 2RDNA 4WVZA 4R9AA 4IE0A 2G19A 3OBZA 1DQ6A 4QGNA 5FPBA 2ARCA 2TUNA 3QH7A 4LKDA 3BU0A 3OGRA 4GXLA 3H50A 1WLDA 1YYNA 2NP0A 3PJYA 2P5BA 4XUQA 4PQQA 1AR81 1PO22 1SZBA 3GGLA 4GAZA 4TLGA 3W5MA 4XDQA 5H9RA 1VRH1 4DEVA 3FLTA 5GZEA 2ZHKA 2QNKA 3OSDA 1MEC3 4AI1A 1QGLA 4IEZA 1VBA2 1FOD2 4O61A 5BUVA 4ZU7A 4RGGA 5FYUA 1ZM1A 5J3UA 2QJVA 4META 4XBLA 3WD5A 4AE2A 3CDZB 5BNOB 1Q8QA 2HEYF 2PQQA 4CZSA 4S2FA 1R083 3IAQA 1Y43B 2NZ9A 5C3QA 2PLV1 4HVQA 2QQWA 4QM8A 3PU3A 2CGOA 4Q5OA 5F37A 1PIV2 1UY2A 2ZEYA 5ACA2 2PHXA 2DCKA 1F31A 1WW5A 3D0JA 2R073 3OY8A 2R043 1VPHA 1CAXA 3IMNA 3OJBA 4HT1T 1IOAA 4PBOA 1O3TA 3ZPYA 2ZACA 4DXTA 2EIEA 2HWB3 3OB8A 5AFBA 3J8F3 1CZVA 2ZOEB 2W91A 4Q4Y1 5JZGA 1XNTA 3K4DA 5CBLA 1DQ4A 4JCKA 3SEPA 2P1BA 2AZ5A 1JYXA 3M8LA 4IL7A 2HWD2 4R4XA 1V00A 4HSLA 4DIQA 5A33A 1X8MA 4H14A 3TOJA 4IETA 4CP0A 2BBAA 3NV3A 4BXSV 2ZGRA 3N35A 2VQUA 4FBFA 3LSEA 3FJSA 3OGVA 4AL9A 1YLLA 3WNLA 2AR6A 4M3CE 4AHZA 2XDVA 3WCRA 1VBC2 3USUB 1CQ9A 4KH9A 4TLFA 5EP9A 4LKEA 2CAVA 4QT6A 2X10A 2XBO3 3O0VA 3M3EA 5AVPA 4ES8A 5LATA 5FZDA 3ZYJB 5FYYA 2VUAA 3IDEA 4WVWA 1V6IA 3DYMA 4D69A 5DAWA 4BPZA 4JGYA 5FV3A 1C57A 3TN91 1G9AA 2P3IA 1AR83 3ZXAC 4OI1A 5BNOA 5BNOC 3H8XA 4NJ4A 5FYIA
chains in the Genus database with same CATH topology
3VBSB 1EY2A 4AHYA 1VAVA 3AJZA 4IV3B 2RM23 4YW3A 5A32A 5CAZA 2ZHNA 3JQWA 3RWNA 3L9JT 4AEDA 3M4FA 2FMDA 4AWDA 1AYN1 3L2HA 4N7IA 2IFWA 4Q1PA 4XIOA 2A70A 3CJIA 3D8CA 3CJIC 1H2NA 2FZ2A 1CD3G 2K0GA 1RUE3 2ZABA 1OFNA 1TMF1 4BLJA 4BMEA 3SISA 2YZ4A 2ZMKA 3UKVA 1WGPA 1AL23 2QE3A 1OLRA 1COV3 1WW4A 4G3YC 5I8TA 2DVFA 1AXZA 2YYOA 3HIFA 5BV6A 3H1YA 2BW8A 1QJX1 3OGGA 4C91A 2WNUB 2BVBA 1DZTA 2JG8B 3VZMA 4U2AA 1CAWA 2IXJA 2D43A 1QQP1 4ZKTB 4HFSA 4NHKA 1Z7S2 1C5HA 1UPIA 4IV1B 4V1PA 4QQLA 1MZEA 1VBE1 1W6OA 3D4KA 4AVTA 1QNWA 4QX5A 2HWF3 3TN93 4FOVA 1RB8G 4BIFA 1GFF2 4Y26A 1LCLA 1DZRA 3H1MA 1HXS2 3OPZA 5DG2A 1GKBA 1CR7A 3JUUA 1BVP1 3IPVB 2NM1A 3MIEA 2XG3A 1S0JA 1RHI3 1R1A1 4P9JA 1J3PA 3DN7A 3ZXJA 1W2UA 2PHLA 1AR82 4XHBA 1GNZA 1VRH2 4C0HA 1DQ1A 2GSYA 3ZYIB 1MVQA 5FFOC 5GLVA 1RUF1 2A6XA 4YG6A 2E51A 3NV4A 4LHKA 1WMFA 1UMZA 2ZA9A 4DOUA 3DPRA 3LCPA 3MIHA 4FP3A 3SH4A 4K7JA 3ZO0B 3AMQA 4AK3A 2WNUC 2ZTNA 1MS3A 1RIRA 3JB4C 2GC2A 4LLOA 5CFCB 3AFKA 1DYKA 4QQPA 2PLV2 2IXHA 4RQPB 1NXMA 4X8PA 2WJSA 1NCQB 3AFGA 2BGCA 2ZPXA 1NCRB 1QJX3 1ND3B 4IV1C 1AX2A 4E2SA 4UW4A 1HV1A 5L7OB 1YFUA 2QQPA 4AYUA 1H2KA 1X36A 1YNAA 3FUQA 4RSUA 1QQP3 4CTEA 4HKWA 3WW3A 4N53A 4Q4Y2 3FFZA 4OHWA 1LEDA 1S0FA 3GZTB 4BQ1A 5T5OA 4DFSA 1QU0A 1VBE3 2Z2SB 2GZWA 5CB7A 2ARXA 4YG0A 1UF2C 3M2MA 3VUOA 2ZGKA 4B4QA 5CIRA 4P9YA 2RJKA 1QXPA 1BXHA 3ZVXA 1ONAA 4CDQA 4YZ4A 3LA3A 4XILA 1YWKA 2YDEA 1YXWA 1DIWA 1QKQA 1QHDA 5DZGA 4CP1A 1R1A3 4HPKA 2AYHA 2WLPA 4A2UA 1JBCA 2GNTA 4RS5B 3I54A 2PHRA 4E9KA 4MGYE 1QDCA 1ZBE1 4AVSA 4B3NA 4DINB 1RUF3 1LOAA 1IS3A 2UWBA 1BKZA 1NCQC 3KB5A 4CDXB 4QGMA 1ND3A 1ND3C 3OCPA 4Y1YA 4Y1ZA 2Z69A 5L7OC 1SLCA 4ISQA 2EF6A 2XJRA 4L97A 4FSJA 1FPN3 1YCIA 1HQNA 1AYN2 2PHTA 3BOPA 2DURA 1OLQA 5BY5A 2O8OA 1ZZ7A 3BODA 2JJ6A 4LBQB 4RR3B 4CEYA 1TMF2 4WVMB 3VBFA 3H3ZA 4XMAA 2ZMLA 3WQ0A 2OUJA 1FV3A 1CPNA 3VBUA 1XXNA 5BNPA 5BNPC 2ATFA 5J48A 5CVRA 4I0AA 2WT1A 1CAVB 5HCBA 1CGPA 3FE5A 5C33A 1QJX2 2RS11 4WZFA 1M06G 4RHV3 1RJ7A 1PVC1 4X6QB 1OKQA 1QQP2 3A0KA 1ND2B 4OUMA 1JTZX 2DVBA 3RI9A 5I93A 4C90A 4YRDA 2R061 1D0HA 4DRVA 1DGWA 3G7DA 4AG4A 4XFFA 4CP2A 3WDXA 1VBE2 3WUDA 5GLWA 4JRAA 4CDXC 3KT7A 3KCYA 3WQ7A 4OUSA 4I30A 3O0XA 2EALA 3BCWA 4TSVA 2C5DA 3I59A 4ASLA 2N7GA 3HWJA 4FPJA 2WKKA 3VBRB 1KD7A 1VJ2A 3AXEA 2PAEA 1QWRA 3SCGA 3JZVA 2RR11 1DF0A 3AKRA 1IS4A 2OIIA 4RR3A 1R1A2 4XJ9A 4RR3C 5CG9A 2XL7A 1UAIA 1KITA 4XJAA 3AYEA 4OHXA 5GLTA 2WNVA 2IXCA 3MPPG 2ZX2A 3VZNA 3JD73 3OYWA 1IPKA 1RUF2 1AUYA 5FOBB 1CAVA 4L2NA 1VB4A 1DG6A 4FPHA 2R1DA 1KQRA 2ET7A 2PTMA 1UX6A 3B94A 1AX1A 4XF9A 3AKTA 1QH7A 3J9SA 4I01A 1CX4A 5F6KA 1AJKA 2E9QA 2WZR1 1H4GA 3WW2A 4I02A 1REDA 1UU4A 5IT6A 4LO5B 4DZGA 2DVDA 2WA3A 1XE8A 5C8CA 5I0SA 4YG3A 4BOWA 5IK7A 1GANA 3ZFEA 1SFNA 1H8TA 4WVVA 2B5HA 2GDFA 3O0WA 1RINA 2R063 3IDCB 2WL1A 1ZRCA 3JCIA 4ONUA 1V6NA 1ZRDA 3ETQA 4B7KA 3KMHA 4P9IA 4L9BA 2DU1A 3GBWA 1APNA 1C28A 1GBGA 4AFAA 1V6MA 4YZ5A 1S0CA 2WIIB 3H7JA 2QZ3A 3WDYA 1IQAA 4JAAA 4C1XA 4LBKA 5JDBA 4PIYA 2CTVA 3VZJA 2UY9A 4XFHA 1X82A 1ZRFA 3R4DB 2DTYA 4AXOA 1BYHA 5DG1A 3ES4A 1H1MA 1N47A 3V56A 4LUMA 1FV2A 1TE1B 4K40A 4N7UA 1ZBE2 1ENSA 3CNAA 4ATEA 5J37A 1MVEA 2ZBJA 1KDMA 5KHIA 5LK5A 4MZUA 2P34A 3ZN6B 3ZIXA 4Q4V1 2CGPA 5A3MA 3KT4A 3EBRA 4AFBA 2XLGA 4YW5A 1RUJ3 1ZZBA 4Q8LA 3VGIA 1S0BA 1WW6A 3KD4A 1NZCA 1LOBA 1TNRA 1TEIA 2ILMA 5CADA 1LGCA 4QQ2A 4NWWA 4CDWB 5EJ3A 2BBVA 5AFEA 1EYBA 3MIDA 3RYKA 1QJZA 3AMNA 1A3KA 1CAUB 4YW4A 5BXXA 4ISRA 4MH0E 4EJRA 1GZWA 1S0DA 1JHNA 1ULDA 3WXPA 2B39A 5C9AB 3N36A 4N43A 4MUVA 2RS12 4I3GA 4AFDA 2YV8A 5JPNB 5T5PA 3R4SA 3BB6A 4Y1XA 1TME1 4BWOA 5E8AA 5AC91 2HEVF 2XHKA 1H2MA 4PDWA 1PVC2 4PDWC 1HKDA 4KWJA 1NG0A 2F4PA 3CJXA 2R062 1OQEA 1QH6A 2QFEA 3SHRA 4GB31 3U07A 1LOFA 1LOFC 2DCZA 3VBOA 3V64A 3VBOC 3S7IA 4MXWA 1RUC1 3RRDA 3E6CC 1ULGA 5FLIA 1MS5A 5K8SA 4GWMA 1GYKA 4LLFA 1KXGA 5BNQA 4QQHA 1DQ5A 2OZJA 1H2LA 3DKWA 1W6QA 3RJRA 4FT8A 1MEC1 1Z78A 3ALQA 4UW6A 4FAHA 1PGL1 4XF1A 2RR12 5KHGA 3WR0A 4KG8A 1ZZ6A 4LE3A 3ST7A 1ZA4A 5I0RA 1OPMA 2XKOA 4PBPA 4BA6A 2Y38A 1LU1A 4UBGA 1LHUA 1UKGA 1R081 5JSPA 1N3PA 2ZX3A 4HMZA 1CAUA 1O4ZA 4MSVA 2UY8A 4GKXA 1AR91 2VW2A 3UK9A 5JAXA 2FQPA 5C9AC 2WFF3 1RJ8A 3SLIA 3HAGA 5KXBA 3HT2A 1UZZA 3E6DA 1V70A 2EAKA 2R071 2RS53 1W0OA 3LKJA 1JN2P 2R041 3AB0A 3TWIA 1B35A 4Y5Z0 4YLZA 1Y9QA 4NR1A 1S2KA 2WZR2 2HWB1 3AP9A 4HETA 2JG9A 3J8F1 2JG9C 4QXKA 3R4UA 3M3CA 4FOQA 4KQ7A 5E1RA 4Q4W1 3E5UA 4IEYA 2KA3A 1J59A 2D6OX 2UYBA 2ZX0A 1DZQA 1V6LA 2Q4SA 2QDNA 3OY8B 3PMEA 5JWPA 4JTNA 1IKPA 5KHKA 4XBNA 4QPIA 1KS5A 3PTYA 4QPIC 3GYDA 2A6VA 4BLIA 1SCRA 4Z82A 3ASIA 5JZGB 3B3QE 5GLZA 3FX3A 2D98A 2PHUA 1ZYBA 2ZAAA 4GB33 2BFUL 1NY71 5A33B 1UU6A 4Q0VA 5IK4A 4FPCA 2XBO1 1RUC3 2YMZA 3AYCA 4OI2A 4LBLA 4I09A 3ZYRA 2P2KA 4AGVA 2D97A 3VZOA 1GV9A 4Y22A 2GH2A 1LECA 4YZ3A 1KJRA 4GH4A 3EXUA 3NKGA 3TB0A 2GMEA 4EROA 3KGLA 3THTA 5FLHA 3TYJA 1D4M3 1SACA 1CESA 5HCFA 1O5UA 4W6YA 4F8AA 2RM21 3VKLA 1DHKB 2DV9A 3DV8A 4JGYB 4W65A 2EXKA 1LENA 3SH5A 1W6NA 4XXAA 3SCHA 4J1WA 1REEA 1BVVA 1FNYA 1ENXA 2K9ZA 1R093 3OBRA 1AR93 2JE7A 4XETA 4GULA 2ZCWA 3N4MA 3ECQA 2IXLA 2LUWA 3ZXDA 4AGRA 5A32B 1DU3D 1FAYA 4Q8KA 1RUE1 4MGZE 3RDIA 4Q1RA 1S55A 3LSDA 1LRHA 4Q4V2 4IESA 5GLUA 1OA3A 5C4WA 2A3XA 4LEJA 5C4WC 1AL21 1COV1 3UJQA 4AEDB 4EN7B 1ZBA1 1A8MA 4COWA 5JZGC 2BWAA 1S1AA 3KCCA 3CJIB 4JTOA 4Q4W3 4M3CA 1VALA 3RYRA 4YGDA 4PLOA 1NA1A 1WBFA 2CNAA 4LE4A 3ZSEA 1BCXA 3VZKA 2PN5A 1FNZA 2XWBB 1XU1A 1NLRA 1A8DA 3USSA 2OVUA 2HWE1 4Q26A 1J1LA 1AVBA 2E7AA 2AH2A 2ZHLA 4EN6B 3EO6A 3WX5A 4GKYA 5CFDB 2EVXA 4W6XA 1TME2 5AC92 1XE7A 2X29A 2Y0OA 4EN9B 1HW5A 3AXDA 3GZUC 2HWF1 1CAWB 4JGYC 4DB5A 4LBJA 2ET1A 2GNMA 1WBLA 1RUNA 3WQ1A 4NOTA 2ZJCA 3FZ3A 1AXYA 3WG2A 3W9AA 4GB32 3WHTA 3LOBA 2Z5WA 5E16A 5C8WA 4P9GA 5TSWA 1BJQA 1W6OB 1G9FA 1G6NA 1RUC2 5BNNA 1RUG3 5BNNC 5IK5A 1SDWA 1RHI1 5D8AA 5D8AC 1LTEA 2GMMA 3QD6A 4L8QA 3J26N 3ACLA 5FREA 3ENRA 3K48A 3E97A 4M3CF 1H1IA 3T2TA 4AEDC 1MEC2 4H7MA 5FMOL 4C0BA 1PGL2 2D6LX 4B29A 2B7YA 3VKMA 1QOTA 5C6CA 1SLTA 2EIGA 3WDTA 4BMBA 1FI2A 3SCFA 5JPMB 1ULFA 4P9WA 1RUH3 2V73A 5DUWA 1R082 4XXPA 4OI4A 4LR4A 4L92A 3KSCA 5KXCA 1ZBA3 4XFIA 4WBBA 4DXZA 3WP5A 2XVLA 1AR92 4OHVA 4AI0A 1RGSA 3B7MA 3DPRB 5CFDA 2ZGTA 5CFDC 4XZPA 1V6JA 4MV2A 5JOZA 2R072 2DUPA 1X7NA 2R042 1AXKA 4EWEA 3WLUA 3H7YA 1N3QA 2HWB2 1WCKA 3J8F2 2VQAA 2HWE3 5J36A 5A3LA 2WQ4A 2I07B 4Q4W2 4OI0A 4MXVA 1J3QA 2LTNA 4AFMA 2EAAA 3AYAA 3X29B 1UW8A 2WS93 1VAKA 3P3PA 2XLFA 3WDUA 1ULEA 1DGRN 5KXDA 1YHFA 1DYPA 5LEKA 4N53B 1ASJ3 1URXA 4JDNA 3R05A 4KGQA 2A3WA 4XJZA 4YGCA 5FDBA 5T52A 1NY72 4LT5A 4DMIA 2XBO2 3I7DA 1PMIA 2RMU1 4AQTA 2D6NA 1WD3A 1EPWA 1S0EA 1LESA 3MLLA 4CDQB 1F9KA 4HKLA 1TNFA 2CL2A 3QH6A 2NN8A 3BU7A 4COYA 1XRUA 2D3SA 2WSUA 2VW0A 1QXJA 2BTVC 2RM22 4HPKB 4YVSA 2ZZJA 4NWVA 1J58A 3DPRC 1A78A 3OD4A 1G8WA 1Q8VA 1OA4A 3MIBA 2B9UA 4I3PA 1X8EA 4YZ2A 1LOCA 2RE9A 4XIKA 5KXEA 5JIUA 5KC6A 1PZ8A 1FPN1 2MPFA 2UWCA 4O9GA 4BHPA 1UL9A 2IFRA 3SMHA 2DCYA 5FPXA 3V0BA 1RUE2 1G7YA 5K7PA 3B9CA 2GNBA 4XQDA 4YW2A 1UU5A 3WDWA 5DZFA 3APBA 4B4RA 1VBD1 2DCJA 1AL22 1X33A 4M01A 2I74A 2A5ZA 1COV2 3WT3A 2W39A 1UIJA 1BEV3 4N53C 1GICA 5J7MA 5HXVA 4XJ8A 1HX6A 1GNHA 1YRZA 2YXSA 3ELNA 4P9LA 4CEYB 4DQAA 3VBFB 3M3OA 1REFA 4IEXA 3CU7A 2ZGLA 4RHV1 4YM2A 3LGRA 1HV0A 2Z42A 1RTVA 3VBUB 5BNPB 3VHRA 4KU8A 4Z2WA 2PHDA 2ZS6B 2YHJA 2HWE2 4CDQC 2BEOA 1C8M1 2A75A 5AVAA 4BE3A 2RMU3 3MW2A 3QLQA 3ZSMA 4ZU5A 4KNCA 1PZ7A 2HWF2 2MNGA 3TN92 2BNOA 1XNBA 4MGIE 3MF6A 4R8HA 1LULA 2PHWA 4WM8A 4FOYA 1OMIA 1HRV1 4QU2A 4DPNA 1MS4A 3WG4A 3D5OA 4BCUA 4PLNA 2VVEA 3ZFGA 3ZFGC 2D93A 1HQLA 4CDUA 4CDUC 1LU2A 1RHI2 4JGZA 4JGZC 4Y1VA 1MS8A 1RUI3 3I59B 1RUD3 3JBG1 4EN0A 3SNMA 4M00A 5J98B 2WZPP 4H55A 2JX9A 3VN4A 1O91A 4HVOA 1BQPA 2UURA 2D5FA 2BVVA 2XVGA 3P3NA 3JD71 4YM1A 3OF1A 2D40A 4AVCA 3UV9A 3RYPA 5KHHA 4CEYC 3J4UH 2WNVB 1AF9A 3GZAA 3VBFC 1ULCA 1QJU1 1SBDA 1VBD3 1YJLA 2A71A 4FPLA 1NE6A 5F9TA 3VBUC 1H30A 1M4WA 1RVF1 3RNSA 3OYWB 3PVBB 4F3JA 2D7FA 5F5QA 5K0UA 4QMAA 4B7EA 3OTFA 4CEWB 5F1RA 2ERFA 5K0UC 3N7KA 2Q5TA 4BZ4A 2OYZA 4FQ4A 1XYPA 4DRRA 1LB2A 2DFCA 1C3HA 3ZMNA 5DDJ1 3M1HA 2Y0IA 4P14A 3POSA 4F7ZA 1SLLA 2C0ZA 1QF3A 2C1FA 1C8M3 1VIWB 3MICA 2VY0A 5C8CB 4XPVA 2XJTA 4AVBA 1AHSA 1RITA 4IEPA 2YROA 4FPKA 1W6MA 3NKTA 2DUOA 4YGBA 3MW3A 2D3PA 3ZFEB 4Q4X3 1H8TB 5FQ0A 3GNEA 5FO7B 3AKPA 1T6GC 1HRV3 1BBT1 3B5LB 3ZFFA 3ME2A 3PVOA 3ZFFC 3WZ1A 3O7OA 2RMU2 1CIWA 2XWJB 3I4IA 4XMIA 4AGGA 1MS1A 2B46X 2P17A 4HVRA 2WNVC 3JBG3 5FRAA 1NLSA 4LA3A 4YM3A 2AENA 3NV2A 3IDBB 4NHLA 4AVVA 5H9QA 2B45X 1F5FA 4FOWA 4KGGA 4CEWA 4CEWC 4Z8BA 1CJDA 4XOGA 1QJU3 1LOGA 4LBNA 1ZRRA 2G9FA 3OGJA 1RVF3 3MDPA 1RUJ1 3MF9A 2ZX4A 1HRI3 2P37A 1FPN2 1XNCA 2OW4A 4IXLA 5C8CC 2ZGSA 3BOWA 2IWGB 4W6WA 3VHOA 3AZYA 1L3JA 3VBHA 4AF9A 3ZFEC 5DDJ3 1VBD2 4R52A 4HZFA 1H8TC 1B09A 1ZZ9A 1SFYA 2R1BA 4AHWA 1O4TA 1YI7A 1XNKA 4FTSA 1IS5A 2Z79A 3WUCA 2VXRA 3LAGA 3OBTA 1O3SA 5E88A 3TNQA 2UU8A 3V0AA 1C4RA 3UKNA 1OA2A 1UD1A 1N1YA 4NO4A 4EWAA 4RHV2 5I8SA 4QPGA 5LRSA 1SMVA 3AMHA 4B8EA 4GMP1 3WVJA 2X53S 1QOSA 1GZWB 1BBT3 2Q1ZB 5JOXA 1C8M2 2DVGA 1WLTA 4PJYA 4N43B 1ALYA 3RZZA 3NAPA 2X8KA 2NYYA 3LWCA 4YFZA 3AX4A 4WZCA 4PDWB 2NPIA 1LJ7A 1H8VA 4U36A 2CYFA 4K21A 2W0XA 1MZFA 3BALA 1IPJA 2PAMA 1W0PA 2XL9A 1HRV2 2I2SA 1QJY3 1AR63 3VKOA 4PF5A 2MEV3 3VBOB 1F2NA 4XTPA 4KWLA 2G9GA 3LZZA 2DTWA 4MXWB 3ILRA 1WW7A 5I8YA 5KBFA 1FMD3 2VVDA 3SXWA 3AP6A 2D3RA 1O7FA 1PGW1 2BNNA 2CWSA 2WLQA 1QMJA 3HQXA 3JBG2 3MFCA 2BPA2 4AI2A 4K3UA 1W6QB 3VZLA 1OPOA 4JVAA 4E4DX 1S2BA 3JD72 3SITA 1AYM1 1K5MA 2VG9A 2IC1A 1PO11 2WFF1 4H3WA 4HSJA 3CLPA 5DUXA 3DF0A 1QJU2 2VOXA 2RS51 1J3RA 1GZ9A 1EAH3 4N90A 3U10A 3HT1A 5EV7A 5EZWA 1RVF2 2R16A 4QHBA 4INDA 4DY3A 4HL0A 4ORFA 5I0UA 1DQ0A 1ZVFA 1Y7BA 2A3YA 2VUJA 2HYKA 2DVAA 3AZZA 2XGXA 5GZDA 4N43C 3WP6A 3C3VA 3AZWA 3MPBA 1I9RA 2R6QA 1QXRA 2C9AA 2VMIA 3E5XA 2VH9A 4XFBA 1G86A 2ARBA 4BIOA 2OUHA 2WA4A 5DDJ2 1B35B 2WT2A 2VULA 4GMP3 3G6JB 4A3XA 2JG9B 1CJPA 2JECA 4MGKE 3JB8A 3FC0A 4YSFA 2Q1MA 4H7LA 4WV8A 3U0ZA 1GSLA 1C1LA 1VBC1 4ITCA 4JC1A 3FLRA 4LULA 3FBYA 3MYXA 2X5IA 2X5IC 2ZGPA 4FO9A 4LO7A 4Z1VA 2YC0A 5FAXA 2CV6A 2H0BA 4QPIB 5J96B 2OPKA 1FT9A 2EXHA 3FHIB 2IXIA 3PVNA 3TBDA 3IWZA 1NQJA 1YO8A 1BBT2 1PO23 3ZDSA 4K1ZA 1U0AA 2XKPA 2BNMA 5SV8A 2UYAA 1MACA 5CA6A 4E2GA 5HCAA 1Q8PA 1WMEA 3PHMA 1VAMA 4XBQA 5ABJA 3U11A 1D4M1 1FATA 1FOD3 1VBA3 4LO4B 1O3QA 2ENRA 2GC0A 4A7ZA 1XU2A 1MS0A 4LNVA 4Y22B 3DGTA 2D6PA 1GR3A 5GZFA 3TNPB 4FQZA 1FX5A 3B00A 3AP5A 1PK6A 4GH4B 1MZ6A 1CONA 1R091 2V5YA 1S0IA 1AYM3 1JUHA 3NV1A 1C8NA 5JR7B 5HBAA 1PO13 1SCSA 2H6CA 2EA7A 3PVEA 1AL0G 1W6NB 4GA9A 2XJUA 2V09A 4F83A 1LHVA 2ZGNA 2GH8A 1B35C 1SBFA 2JXAA 3H9AA 3LOIA 1RUJ2 2EXJA 5FPZA 2D5HA 2JENA 1NXD1 3AK0A 3M7AA 4AHXA 4BH9A 4YW1A 2E6VA 1A6CA 4CYDA 2G4IA 3O12A 1IGOA 1WA4A 4OULA 3A4UA 1WCSA 1TQ5A 3UJOA 3VDDA 5C4WB 5I0TA 1N3OA 2QZ2A 4TWTA 4I0WB 1D2SA 2QCSB 2E63A 4M3CB 4KU7A 4YVWA 1VBC3 1WMDA 3QOPA 2DWRA 2ZAHA 1NYWA 1Z7S1 2LALA 2WINB 3FUOA 2H6BA 1QNYA 1NA1B 3H3UA 5JCTA 1LHOA 2P3JA 4Z07A 4OZXA 2A7AA 1XYOA 1Q8OA 3AP4A 4OLLA 3WY6A 2SLIA 4MYEA 4GH4C 2WSVA 4RD7A 4DS0A 1HXS1 4Y20A 1GQHA 3UL2A 4OVEA 3WP3A 1RUG1 3WG1A 3DL3A 1OQDA 2ZMNA 2AREA 2ETEA 3ZXKA 1VLNA 1OFSA 3W58A 3ZSKA 2BWCA 1U5XA 5EYXA 2Q30A 4EN8B 4HK9A 2YY1A 1W6PA 4K9SA 1GQGA 1WLCA 4XE9A 1N1SA 4WM7A 2XJVA 3NJZA 4WM7C 5B2GB 1PGSA 4NPRA 4GIQA 3B9IA 5BNNB 1YIPA 2OA2A 3NL1A 1MQTB 5IUQA 2VNOA 1PGW2 5D8AB 4IEOA 3SH3A 3AP7A 2YGMA 1YJKA 1O3RA 1RUH1 2QUOA 4CRQA 4FTEA 2PYTA 4QD2A 1X50A 4OHYA 1YFYA 4PIXA 2XLAA 2JD4A 3JU9A 1AYM2 4XYXA 1HQWA 2YUEA 5BPXA 4FXKB 1EV11 5T54A 3O5SA 1PO12 2WFF2 2LM3A 2ZKNA 3LA7A 2VW1A 4M0NA 3QACA 1NA1C 2KXLA 4XTMA 2RS52 3K51A 1V6KA 4ES9A 1UPSA 4D3WA 1DQ2A 4IQPA 1IKQA 3ROUA 2GNDA 3POYA 3POWA 3WP4A 1NE4A 4RGAA 4D7TA 4UW3A 2QDRA 1N1VA 1GZCA 4Q0PA 1ZZ8A 1OOPA 4EV0A 1BMV1 1OOPC 4IERA 3ES1A 1Z7S3 3AMPA 2GC3A 3HBZA 4AW7A 1HIXA 2WS91 2IZWA 3WW4A 4I2OA 1PZ9A 1LKNA 3RI8A 4AI8A 2VGDA 1WCDJ 2DFBA 2WC2A 3MEPA 2GALA 3B93A 1SEFA 3D0SA 4C1WA 1ZZCA 1ASJ1 3H8UA 1VR3A 3MI8A 4GMP0 1HXS3 4YFWA 4AVAA 4S2HA 2R0FA 3B69A 3Q9OA 4HBNA 2PELA 2RJLA 1MQTA 4R9CA 1MQTC 2VOKA 2JE9A 5JVVA 2DYCA 1UIKA 3KCXA 2MHFA 4E2QA 5L36A 2HKXA 3PMSA 1VRH3 2PFWA 3WV6A 2D6KA 2DF7A 3B02A 5FBZA 5FO8B 5K9YA 2TNFA 4HN0A 3VKFC 1D4M2 4D94A 4IEQA 2FMYA 4J1XA 4DY5A 3WW1A 4Q0SA 4COZA 3EQEA 2PHFA 2XJQA 4FPFA 5GZCA 3M3IA 2VVFA 3WNXA 4EWDA 2VOWA 3IBMA 1R092 4AFCA 2PLV3 3S30A 2A73B 1U5IA 2Y26A 1EV13 3URFA 4YVSB 3WOGA 2NMNA 4S2GA 3VV1A 1JOJA 4L99A 2GAUA 3NO8A 5JSOA 3QCWA 4Y4YA 4XJWA 4GWNA 4FPGA 3WG3A 3ZN4A 3BPZA 5CNAA 1BEV1 1Y3TA 4MLOA 4Q4Y3 1IZ3A 3WINE 3RJ2X 3V0BB 1D0GA 3USUA 1FYUA 3ZMOA 3KS7A 3ZXGA 4K20A 4Q0UA 1AR71 3GHNA 1H0BA 2TBVA 4YM0A 4N9HA 3GHMA 1CPMA 4HKOA 4PQ9A 2XH6A 3MLJA 1LOEA 1NQDA 1QOOA 4QPYA 1G9BA 5FTTC 4PCRA 2AGSA 4K8FA 2ZGQA 3VBSA 1UN1A 3VBSC 3HN1A 2WFPA 2ZKLA 1KDKA 4IV3A 2CWMA 4IV3C 2E7QA 2FZ1A 4JDOA 4FPEA 2VNRA 1WLWA 2H0VA 5F6LB 5LEJA 3ZSLA 2Q0AA 4LHLA 5J09A 1W39A 3KM5A 4YYOA 3KLSA 1RUG2 3THPA 4YVSC 5KHJA 1EPZA 2CY6A 2F6BA 4HN1A 5LK7B 2ZGUA 2D44A 4RL7A 2NMOA 1S0GA 1DBNA 1VBB1 4K1YA 1RUI1 4WM8B 1RUD1 5GKAC 4Y24A 5IK8A 1R1ZA 5GZGA 3ZFGB 4ZXKA 4CDUB 1Q5OA 3RSJA 1AYN3 1D2QA 4JGZB 1G9CA 2JKBA 1O4YA 3VLBB 1UCXA 1TMF3 2YPJA 1G9DA 3WDVA 5JSRA 1LGNA 1RUH2 1I5ZA 2WNUA 2IXKA 2E53A 2JG8A 4LBQD 1ZBA2 2JG8C 3JQXA 4HK8A 4HLTA 3QBQA 4MX3A 3E5QA 3S7EA 1EV12 2WT0A 4XW3A 3GBFA 3PLQA 4UW5A 4XJUA 4QM9A 1DDLA 4IV1A 2AUYA 1AR73 2K2SA 1U5ZA 4X8NA 1WD4A 4YGEA 1SLBA 4XQ4A 1C5IA 3I8TA 1I1EA 5EXOA 5K0UB 4FAGA 3MFAA 1BMV2 4XQWA 4S2DA 1RMU1 3FFQA 4D7YA 2WS92 2JDZA 2DU0A 5JOWA 1V9U1 3GBGA 3IPVA 2GN7A 4Q4X1 3ZYGA 3NW4A 2FHRA 4FPYA 4XF0A 4COUA 5FOJB 1PM7A 4Q0QA 3DUIA 1J1TA 4KG0A 3VL8A 1HDKA 1JH5A 4WM8C 1ASJ2 4QQOA 3HR9A 3ZIWA 4AEKA 1POV1 3PJQA 5BYNA 3RG0A 4N9IA 1W6MB 4FP2A 2BUKA 4JRLA 5FQ0B 4LBMA 3KZ4C 4JQRA 1VBB3 1BZWA 3ZSJA 3BTAA 3ZX7A 1PVXA 4LTAA