4KNSA

Reduced crystal structure of the nitrosomonas europaea copper nitrite reductase at ph 6.5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
285
structure length
285
Chain Sequence
b'KTVQVTLHAVETDVAYDNKGSTYRAWTFDGKVPGPVVRVTEGDTVEFTLINDKNSKNSHSMDFHAARLDVVEDFESIKPGETKKYTFTADNPGVFFYHCGSDPMIQHIARGMYGVIIVDPKDANALPKADREYVLIQAEHYENPDDKTAMMQNKWSNVVFNGGVFKYDPVHDSEATSWLQAKPGERVRIYFVNAGPNELSSLHPIAGIWDRVYPSGNPKNVQYALQSYLIGAGDAATLDLISPVEGANAIVDHSMRHAHSGAIAVIMFTNDADPEAGRGENILIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multicopper oxidase type 1
molecule tags Oxidoreductase
source organism Nitrosomonas europaea
publication title Characterization of a nitrite reductase involved in nitrifier denitrification.
pubmed doi rcsb
total genus 88
structure length 285
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4knsA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4knsA01
1ILSA 3QJSB 3PAVA 1L9PA 1W6WA 2BWDA 3T6ZA 3ZIYA 1MZZA 3JTBA 2CCWA 2J5WA 3QJTB 1SFHA 1AANA 4YSPA 4E9TA 3WI9A 1KDIA 2OCCB 2QDWA 4G7SB 4YSAA 2XXGA 2XVBA 2XXFA 2VM4A 2IDQA 3FSZA 3MBWB 4YSTA 3CDZB 3TBBA 3WIAA 4DPAX 1SFDA 4WKXA 3C75A 3TASA 1WA0X 4YVUA 5PAZA 1TEFA 3L45A 3GDCA 1OCRB 1AIZA 5B7MA 2HZHA 4A67A 3MX0B 4DP1X 1AS6A 1OCCB 1DZ0A 2B08A 4YSQA 2FQGA 1NIFA 1WA1X 2R7EB 4AKPA 1E30A 1EHKB 2PPAA 2PPFA 2BP0B 4MFHA 4YSSA 3NSYA 1L9TA 1BQRA 2YAEA 1ET5A 3EH5B 2PPEA 3NJFA 1ZPUA 5B1AB 2XV0A 1OV8A 2VW6A 1N70A 2BP0A 2DWTA 3PXLA 4TXVB 3AG1B 1NPJA 4GXFA 2CUAA 2H5UA 3FU7B 3EHBB 2WSDA 3CVBA 2FQFA 2HXAA 1HFUA 3UABA 1SDDB 3BQVA 3H56A 1PLAA 1RKRA 1PAZA 1OF0A 1NICA 5D4HA 1NTDA 2AVFA 7PCYA 3T71A 3OMNB 1AS7A 4BXSV 4FAAB 2YAHA 3FSWA 1HAWA 1ZV2A 2DYSB 1SDDA 5B7FA 4QLWA 2HX8A 2JXMA 1TKWA 3NJKA 5I6MA 1CUOA 3N55A 3N2JA 3EF4A 4KNUA 1WS8A 1AACA 3DTUB 2YAPA 3OQRA 4DP0X 4NAJA 1GS7A 3CDZA 1X9UA 3X1GA 2P80A 1W6LA 2BHFA 3NSFA 5D4JA 4GP4B 2HX7A 3QJQB 5B1KA 4ZK8A 2TSAA 3ASNB 1KBVA 4BWTA 4YSRA 4UAHA 1WA2X 1VLXA 2YAFA 1W8EA 1SHWA 3D12B 7PAZA 4KNTA 3H4FA 3NP4A 1KGYE 1J9QA 3UGEA 4AKQA 1JVLA 3AG2B 3FYEB 4DP9X 3S3CB 1MG3C 1PLBA 1IKOP 2J56A 1N68A 1SF3A 1E65A 3V9CA 2YXVA 2VW4A 1JOIA 4KOCA 5B7EA 1ZDQA 1J9RA 4AZUA 1M9WA 1RCYA 2IDFA 2GSMB 1OE2A 3X1NA 3WG7B 1E67A 2Q5BA 2EINB 4BK5C 2CAKA 2I7SA 3TA4D 4W9ZA 1NINA 2YAOA 3AG4B 4YL4A 3WNJA 3S8GB 2HRGA 2YARA 4A2FA 1F56A 2GBAA 1J9SA 3KW7A 3S3DB 5B1JC 2UXGA 1AZRA 5F7BA 4F2FA 4ENZA 2IH9A 2UX6A 2FQEA 4DPBX 4YSDA 2VN3A 4E9SA 1ILUA 2PPDA 1BYPA 2Y69B 1CYXA 2IAAC 3NJLA 3OD3A 2YQBA 2VMJA 2PCYA 2X87A 2ZWNA 4AI7A 2BZ7A 2WO3B 4KO9A 5TK4A 3UACA 4HCFA 2B3IA 1KBWA 1OOWA 1PMYA 5B3SB 2AFNA 3PPSA 1L9OA 2BP8A 3CVDA 3PCYA 4UF7C 1CYWA 2ZOOA 3S8FB 2GC7C 1PNDA 1KCWA 2VSKB 5LDUA 2PLTA 4E9QA 1NIAA 4Q89A 1FWXA 2BZCA 3GYRA 2QPEB 2BW4A 4P5RA 4DP4X 3EH3B 5IY5B 1KV7A 3GXUB 3KW8A 4A2DA 3HEIB 4YSCA 2EIJB 2OV0A 2FWLB 1AQ8A 4Q8BA 2LLNA 1DYZA 1ASPA 4CSZA 1NZRA 2J57A 3X1FA 2Y1AA 4M4RB 1QHQA 4HZ1A 3T6VA 2ZXWB 1L9QA 2IWEA 1ZDSA 2MRYA 4DPCX 2XV3A 3FU8A 4YSEA 1BXUA 2X88A 1ZIAA 2XUWA 1NIDA 2GI0A 5I6OA 6PAZA 2XLLA 4RH4A 6PCYA 1PF3A 1BEXA 1E5ZA 2AANA 2IH8A 3V9EA 4YSUA 2FTAA 3NJIA 4E9VA 1KCBA 1XMEB 1XB6A 1MDAA 3ZBMA 2PP9A 1PCSA 2UXTA 4PCYA 3TBCA 3IE9A 2E86A 1GR7A 1ASQA 1PZAA 5PCYA 4DP7X 3QPKA 1PZCA 9PCYA 4A2EA 1GSKA 1I53A 3NJGA 5B1JA 1GS8A 1V55B 3IN2A 4KO5A 1SF5A 2W8CA 4DP8X 3HB3B 1BXVA 1XB3A 5I28A 1AR1B 4X4KA 2FT6A 4BWUA 3ABMB 2JKWA 1JZGA 1NWPA 4P5SA 2HRHA 2XV2A 3AZUA 1OE3A 5I6NA 2HX9A 3ZX1A 3AG3B 2XX1A 2UXFA 1RZQA 2AZUA 4HHGA 3T9WA 4G7RB 1L9RA 3FT0A 1A4AA 1WS7A 3FQYA 3S3BB 1JXFA 2CBPA 1PY0A 2EIMB 2A3TA 3FYIB 3OMAB 4HHWA 3UAEA 3NJHA 1J9TA 2DV6A 2IDTA 4JHUA 2RACA 1BQ5A 4A68A 1ETJA 3IEAA 1JZEA 4FA7B 1MG2C 4L0PB 3PLYA 4A66A 4JHVA 4BXVA 3UAAA 3NT0A 8PAZA 3JT2A 5D4IA 3QQXA 4YSOA 4CSPA 3WNIA 4DP5X 1AS8A 1AOZA 3CVCA 3G5WA 5EHFA 2I85A 2J55A 4JKNA 1NIEA 4G71B 4DP6X 3NSDA 1V54B 2JFCA 1ASOA 1TU2A 4QKTA 4GP8B 5F7AA 5I5JA 1GY2A 3X1BA 3FQ2A 5A7EA 1FA4A 5I6KA 2CJ3A 4G70B 3NYKA 2PP7A 1BAWA 3BVDB 3CZUB 1QLEB 2MTAA 4F7KA 3SBPA 4K9JA 2I7OA 1R1CA 5E9NA 2Q9OA 3U25A 3NJJA 2ZONA 2GIMA 2IWKA 1PLCA 2EIKB 4E9XA 2PCFA 4KO6A 3X2QB 1NPNA 1NDTA 2BO0A 1URIA 4HIPA 1PNCA 3SBRA 4GY4A 2XWZA 2QT6A 3OM3B 2FT7A 1V10A 4E9WA 2VM3A 1SHXA 3RYMA 1JXDA 5B1BB 1GW0A 5I6PA 2WO2B 1X9RA 2DYRB 2H3XC 4HCIA 3ZDWA 3DIVA 1A4BA 1IBZA 4KNSA 3UADA 2XYBA 1J5DA 1L9SA 2NRDA 3AY2A 1OCZB 4HAKA 1CURA 2GHZA 5TK2A 2AZAA 2H47C 3NSCA 3QJRB 1QNIA 3AW5A 4WTQA 1T5KA 1UATA 4N8UA 4BWWA 2BWIA 2OJ1A 4G7QB 5I5MA 2GC4C 1ET8A 1IBYA 3FU7A 3FPYA 1JZHA 2VW7A 1ZIBA 1NWOA 3TU6A 2IDSA 5AZUA 1BXAA 2XU9A 2N0MA 1JZIA 4KOBA 4HALA 4GP5B 3X1EA 1ADWA 1IC0A 1AG6A 1OCOB 2QDVA 2UX7A 3SQRA 4E9RA 3OMIB 1JZFA 2BW5A 4W1TA 5AFAA 1AZCA 1BQKA 1WAEA 4AKOA 4PAZA 1FFTB 3FS9A 5I5IA 1TEGA 4NERA 3FPXA 4UANA 1GY1A 2FJSA 1XB8A 2DY2A 3FU9A 4N4YB 2IWFA 2DWSA 3FQ1A 5I26A 4GYBA 4EF3A 1JERA 1A3ZA 5I6LA 4HCGA 3PAUA 3ASOB 3NJMA 4KO7A 2XX0A 4E9YA 1AZNA 5FC9A 4A2GA 2PP8A 2GB2A 1PZBA 1KYAA 2VSMB 1M56B 4BDVB 2YXWA 1RZPA 3T6XA 1JVOA 4YVNA 1AG0A 3WKPA 1JZJA 2UXVA 4F2EA 1GS6X 4NB7A 2HLEB 4A2HA 3NJNA 3T6WA 3FSVA 3ERXA 4DP2X 1A8ZA 1AZBA 1SNRA 1M57B 2BP8B 3ABKB 4M3HA 3QJVB 3H4HA 2W88A 3QJUB 1SJMA 3ABGA 1ET7A 3CG8A 2FQDA 3IN0A 3FSAA 3IBOA 1NIBA 3SBQA 1BYOA 1B3IA 1CC3A 3EH4B 5ANHA 3PAZA 1ID2A 4G72B 1GYCA 3WKQA 1AZUA 2YAMA 2IDUA 4BDVA 1EZLA 1AAJA 1HAUA 1KDJA 1OE1A 2CALA 2TSBA 1A65A 2QPDB 4AX3A 2PPCA 2EILB 1YLBB 1J5CA 2R7EA 1JXGA 1A4CA 2P80D 5AKRA 2YAQA 1MZYA 2FNWA 1E5YA 2FT8A 3DKHA 1IUZA 3ABLB 3NP3A
chains in the Genus database with same CATH superfamily
4Z0XA 1NCDH 3CFEA 1KJMA 2CJUH 5ITFB 2Z7YA 2Y9RT 2MCPH 4R7DB 5TTRA 1KFAH 4LB8A 2JELH 5AW1B 4HULB 3VO0A 1HHGB 5CSZA 1TTFA 2QMKA 3ARBB 3D0LA 1H8SA 1QABA 2BNQD 2YK1L 3IE4A 1M7DB 4OB5L 3CDZB 3TBBA 4AUYA 1CWVA 5KYWB 1U95A 4LLVB 4PLOB 4DWHA 2VJ8A 1CD0A 1N5YL 5A3ID 3UPRB 2AGJL 1QA9B 1M3IA 3BP6B 4FTVA 1MCLA 3CFUA 4NBYB 4O5LL 4HMDA 3SDXE 1KMGA 3FTUA 4HX1A 5C07B 1T04A 4A6YA 4RVBA 1F6AA 4M8QB 5C0BD 1WBXA 1G9NL 4KV5F 4Y9GA 4HT1L 3VD1A 3E1F1 5CP3H 4MKMA 5FS5A 3KZ8A 4AEIH 1NDMA 1DFXA 4IBTA 3T0VA 5MEQB 2OXGB 1IGCH 1AGFA 1P4BH 2CBOA 4JRXE 4X83A 3SDXB 3ARGD 1FIGH 2BP0B 3L3KA 5C07E 3QUXB 1BQRA 2WD0A 1SM3L 4PUBH 1MAMH 1L0YA 2XPGB 3RWFB 1F58H 3U4KA 5B39A 1JTOA 4GMTL 3VYNA 4N0YL 2GT9B 1BFSA 3I6LE 4NJ9H 3PXLA 4MJ5A 2ZIDA 2CD0A 3OF6A 5I30H 3C5ZA 2R2BA 1BJ8A 1X7SA 4B60A 5IB2B 5IMLB 1UB5A 4NFCA 2ESVD 1K4CA 4UNIA 2WM0A 4JRYB 3CSBA 3D2TA 3CVBA 5D6DC 1NKRA 1FSKC 2HB0A 2HXAA 4HWZB 4YO0A 5E2UL 3T3ME 2A9AA 4G7VL 3K6FA 2X38A 2CBTA 3MJ9L 4Z77A 1RKRA 4DUVA 1OF2A 3POCA 3P4NA 4QHMB 2NNFA 1BFOA 1XGTB 3OMNB 4R90L 1NGQL 2QELA 5SWQB 4XCNB 1G7QA 2WMPB 3L7EB 4AJWA 4KDTC 3MRDB 2Z7WA 1OAXL 4X2UA 5E2WL 4UQAA 4WUUB 2MTPA 2ATPA 1LVEA 3IDUA 5IVXF 1QO3B 3GSUB 3CGTA 3ULUD 2F54E 3NCWA 1N12A 3PDDA 3QZBA 1BQSA 1J88A 3WSQL 3QJQB 1P7KB 1PYWB 4YBQC 1SDYA 2L7QA 2E7CA 2F6AA 2BIPA 3MRLA 5CD5D 4YSRA 1OVZA 4MJ4A 1SLUA 3BIBX 1KZQA 1J8KA 4M5YL 3PWPA 4JCWA 2NSMA 3NIFB 1XZ0A 4JRXA 1IGFH 4U1MB 3FOLB 4JZJC 2WB7A 3VI4A 3WL9B 4OCXL 2I26N 4ONHA 2OZNA 4AKQA 1XEDA 2VQUA 2IV8A 3FYEB 5D93C 1DLFH 3ZKXC 1G6VK 1RU9L 4HU2A 5GRWA 3VE0A 4JMXA 3RTQA 4ESKA 3MV7E 3QEQB 2VW4A 4PRIE 4UBDC 2E9GA 2G9HB 3CFCH 4Y2DB 2HWZH 4CC1A 2ENJA 1FNEA 3U6RA 4NOBA 2BVYA 3HAEH 3SDYL 5EC2B 4XVJL 1M1XB 4HPYL 3QNXB 4AK2A 4LL9A 2NR6A 3WIIL 2EO1A 3OX8B 5B4MC 5LUMA 5JHLH 3UCQA 5EO1A 1HEZA 1PS3A 3AG4B 3GO1L 5CJXC 3W82A 4K55A 3MPCA 5F6IC 5KVGL 3WNJA 3OZ9L 2AV1A 3LKNB 5DC2A 3GBLA 2E5EA 1F8TL 1J9SA 3V0GA 4B9JA 1P1VA 3P0YH 5JOFB 5A16A 3KDMA 1ODUA 1S5IL 4TVSa 1E8WA 2JIXA 2I60H 5IM7B 2ADIA 3DHPA 1GJIA 1NMBH 1F1GA 1RZIB 3O9WD 4YN3A 3K91A 3C8HA 2Q6WB 3WY1A 1AGDB 4QRRB 5D7IF 2F5BH 4OF8A 5IJDC 4WHDA 2WZPA 3NIDE 1RQ5A 4MZ3A 3U1SL 2NY5L 4AM0B 4JZOB 4M3JA 3LIZH 1QSEA 4AQ8A 5I0DA 4KPHL 4NXSA 1KN2H 3TIDB 3VW3H 2UYLA 3RILA 3SKNA 2X4SB 1NCCL 3B3IB 4PRPE 5LG6A 4XVUD 1L9OA 2E9JA 5T33H 4IGBA 1NCWL 4UF7C 4XO4A 5EF3A 2NSQA 4ZODA 1G4MA 4C4KO 1KCWA 4YHPB 4EEEA 3CZGA 5GJTL 3EGDA 4ZTPL 3G5ZB 5LDUA 3HC4L 5G5DA 1MWAA 3KLDA 5SV3A 4HHAB 5LNGA 4JPSA 4WFED 4RESB 4KZ0A 4FJ6A 4PGBB 4PRPB 3MDJA 3EO1A 4R5VA 4MMYB 4OCSL 4I18B 1CQYA 1FN4B 4D8OA 4YHNA 2V8MA 2R0KH 3UTSB 3P3YA 1IQDB 2VC2L 4HKZB 3O0LA 4CSZA 1HZHH 4BFJA 4QIRA 4D0CB 4Z7VA 1BD2B 2XI9A 4HZ1A 4FZ8H 5FGRA 4C8XA 1IBHA 4M6AA 3DUUA 2X6UA 4DESA 3Q44A 1Q0EA 2WNGA 4UNUA 4M43H 4TLTA 1XGYL 4DTGL 5ID1B 2WIIB 1DANT 3ZYZA 4YSEA 4C4KT 1R5WA 3GSVA 3VWKA 2WTPA 4PGEA 4J39A 1MI5A 1CGWA 4F7EB 1BX2B 5DJYB 4RH4A 5AD0A 2ESVE 1U3JA 4PTTB 2IG2H 2R29A 1T83A 3MRMB 3SKJH 3CIAA 2Y5TA 3MBXH 1QBLL 4CN1A 2VITB 1EDQA 3VXTB 3ZBMA 4POZC 1QFHA 3GSXA 4GSDL 1KTJA 4N2AA 1U95B 4K3JL 2YBRA 5INDA 1BLNB 3HBPA 2YGOA 3UBFA 3WIHH 3L4ZA 4L3EE 3JZ7A 3S88H 3WNPA 5E8EA 1EA9C 2ESVB 4FL4C 4ATTA 4DP7X 1T04B 2WLIA 4NM8H 2AEOA 2VZ3A 4OJFL 4KK6D 1NCTA 1MCBA 5LAPA 4LSSL 4A2EA 4OLUL 1J1PL 2F74B 5CWSA 3EGXA 4R4ND 3U2IA 4APQC 1LO2L 2CNYA 2NXZC 5AYQA 4ZMVA 1SXZA 4YHYC 1KSRA 1A9EB 4MWFB 5JW5A 3FB7B 3X3GL 4MKTA 2VDNH 4I3RL 2XV2A 5C0AB 3ZSTA 5AAWA 5EWIH 1OP3H 1N67A 5F96L 5DZAA 4MAUL 4OD3H 4ZQTA 3TFKD 3PHAA 3QZMA 2H26B 2GBUA 2YPLE 3BMWA 4F58H 1WRFA 1E5BA 2UZPA 4K94L 4MQTB 1IE4A 2EYTA 2KKQA 5LCVA 4ZNCD 4HLZG 3OJDA 4RGNE 4HWZA 2WXMA 4NN7C 4FXTA 4A68A 2FR4A 5EEWA 2AK4E 3PP4H 2VABB 3QHFL 4NQUA 1HU8A 1MHPH 2ZUQC 4JHVA 1KJ3H 4ELKB 1JFQL 3EYOB 4AVKA 4CSPA 1TEYA 5FKPA 3JV4A 5K9KA 1YMHA 4YFLF 5HHOD 1MCDA 3GM8A 1DN2A 5FPIA 1U8PA 3V0FA 2O26U 2VLME 2CDEB 4G71B 4RZCB 5I74C 1M1SA 3KYKL 3QR0A 1P7QB 1Y1UA 3NCXA 3V55A 2MOQA 2FWOA 5F7AA 2PO6D 2HTLD 3L5WA 4F37K 2P5EE 2XZQH 3V4PB 2A5UA 4XP4L 1EZVY 4QRUA 3NFNA 2ZXEB 5DLMH 1FJ1B 3V4PL 3DDFA 3OR6B 1NLBH 3ZLQC 4JM4H 3QPXL 1U8IA 1I9EA 2HH0H 4HH9B 3VTMA 5I74B 4QO1B 2EE9A 5ITBH 1Q1PA 2VLRD 2QKIA 4FXKC 3GI9L 4CKVX 4L8CB 2Q1EA 3FRPA 3HZVB 1TZ8A 1GGUA 4JPVH 5B38B 3HCVA 4JGUA 2YD8A 3QXTA 3U1SH 3D1MC 2A6KB 3KWWA 5D2LA 4BUGA 5KAQG 4DN3H 2XZAL 3AS2A 3PWPE 4KJPD 2W9EH 3O9WA 4J6RL 2XKNA 3TT1H 4MAYA 2QT6A 3BVXA 2HP4A 2EE6A 3FN3A 3NZUA 5EZIL 5D96C 2DMHA 3QQ4A 3FHQA 3AFLA 5B1BB 5E1AB 4FCHA 4JJHA 4WU7B 2APBA 3IRPX 1X5FA 3D69B 3DIVA 3OKMB 1ZRUA 2H9GA 2QVIA 3SPCA 1F4YL 5JW4N 2BWQA 1B0IA 3O6ML 1TQTA 5KSUB 5HHME 3VXSA 2COVD 4AZ8A 4IBVA 5FR3A 5I1HH 3QAZB 4JFDA 4LQFH 2OJ1A 7FABL 4Y7MA 5I5MA 4M5TA 5EEZA 2VXQA 1ET8A 1SMDA 2R2EA 3QUZA 1YY9D 4FX5A 4JZJB 4NP4H 4PJXB 2WXKA 3KL5A 4OV5A 1DQJA 3GMMA 5A16B 1JZIA 5DUBA 2UZIH 4GEIA 4O00A 4OF7A 1K2DB 5IM7A 3LKSB 2EXWC 4M6NH 5IFAL 2P46B 4ABVA 1PD6A 1WAAA 3QXAA 2VQ4A 4HLEA 5LBVA 1LE5A 2XA8H 2PCXA 3C08L 3KPPA 4QT5B 2YD6A 3SCMB 3HE6D 2KH2B 4FCAA 4CNIB 1UWEL 1GGCL 3G3LA 1ZSDA 3ASOB 3D25B 3EJZD 3C2SA 1X5LA 4A2GA 2EVHA 3MV7D 2W38A 4OJDH 1GRWA 1EXUA 1WQVT 3WNMA 1L3WA 2VDQL 5FUOH 1EVUA 1NKOA 4U1JB 3HB3C 4Y1AE 1MWAB 1ACXA 4LSRH 2OKMA 3X3FL 1R0AH 2K6WA 3ZKXB 2SEBB 2Z4QB 4LEXH 3B9VA 2IGFL 1A0QH 2CLZA 3NEOA 3HFMH 4O02B 3F04A 3HI6L 3ESUF 5CCHE 4I77H 2RALA 1I1AB 4YE4H 4LASL 2ZP0T 1OANA 1OTUC 3E9UA 4OFDA 1I3VA 2Q8AL 4CC4C 3TO2A 3C5ZD 2J1YA 1EAOA 4L37B 2XBZA 3BVUA 5IBTH 3A6CH 1AAJA 1KDJA 4AM0Q 4BCXA 4PGEB 4PJXF 3TLRA 2PPCA 1UCBL 1VFOA 5AD0B 4QYAA 2GBTA 2QADD 5CZXD 5GGRB 4CGTA 5HGHB 2DM3A 2YAQA 2X4QB 3L5JA 3P30H 3QUYA 4BZYA 2ZG3A 5EOQH 4FXGC 1CGVA 3JWDC 1JMZA 4KK6C 4OD2A 2D4FA 1CGSL 3S96A 3PV6B 4KX9A 1N8ZA 1W6WA 4KKLC 3T6ZA 1L5GA 1R5VB 2EC9T 1HQRB 1DVSA 2F19L 4K15A 3CSPA 1GGIL 2HVKA 2GJJA 1IC1A 1FUNA 4Z7WA 2QTVA 3RWEA 4JDZB 2HT2C 1AFVL 4NGHH 1QHOA 4XXCC 4NQCA 4PB0H 1KDIA 5E8NB 4NNYB 1PZSA 5JXAH 4F24A 3UJJL 5CILL 1F6FB 1E4KA 1PGRB 1NOAA 2JI1A 2NLJA 1YNKH 3TEUA 3V0VA 4X4XB 1DQMH 2NR6C 4X6FB 3WDIA 1WA0X 4YHZL 2EDWA 3WHXB 1TR7A 5EEVA 1PPIA 2BP3A 2K78A 2H6PB 4OCNC 3RWGB 3ULVL 1HI6B 2LLGA 1H3PL 2XG4A 3A5VA 1WWBX 1EWHA 3G9VA 4MMXA 5CZVH 4XO5A 5GSVA 3RHWF 3V10A 4F1ZA 3CXHK 1U92A 3PNWA 2YWZA 3CZFB 2B08A 5IGXH 5H94A 1AXSA 4UDTB 4IIQC 4NKDB 5ERWA 3O6LH 4JFZH 1XBDA 4G9FE 1QSFB 2YA2A 3EH5B 1JFHA 3MTXA 4KK8D 3FCTB 4N2BA 1ZPUA 5C2UB 3W9DB 1L9MA 1FVCA 1QBML 1Z5HA 5CLTA 3UZEC 5J9PB 4KROD 2K1MA 3BC9A 4H8PA 1ZLVK 1G7JA 1F2XK 4KXBA 2J1XA 2Z31B 2CUAA 2Q0ZX 5JA8B 3KPRE 2DLFL 2CKNA 3CVHB 1E50A 7FABH 2WXPA 3WEAA 3RIFF 1OD9A 1SDDB 3V7AE 5IW1A 1N6QL 2C1PB 3SN6N 3DTXB 1D5MA 1MCWM 1UASA 3UMTA 1OO2A 1RVFL 2IPTL 1U8QA 3KR3H 4HH9A 1IGTB 4NS0A 2Z8VC 5T1LB 5DF0A 5J6HB 2D2OA 2XRAL 5DJ0B 2JXMA 4JFFA 4JFFE 2JB6B 4LHUG 1L3NA 3PQYD 4KY1H 3ETBF 4FULA 5KVFH 3OQRA 2E7LC 4NKIL 3P9MA 2DQEL 3X1GA 3OAZH 4LDLB 2DN7A 3DSFL 1S7TA 1YG9A 1NM9A 4MZ2A 2YUVA 1T5XB 4NHCH 3MRBA 4JEGB 2V2WA 3EO9L 4HBQA 1TCMA 4YHKL 1T1WB 4KTDL 1AOHA 3N1QC 2YEZA 3M1OA 4RAHA 3H4FA 4XN7A 3KJ6H 5EUOE 5LO7A 3LNFA 3CVIL 4M48L 2BCKB 5CU5A 2GK0A 4HS8H 3OAYK 4Q6KA 2J56A 5FUCE 4KI5D 2N7BA 4FG6C 4U6VL 8FABB 3D07A 1O5PA 3ARGA 3QXUA 1MFBH 2R2EB 3QUZB 4JZJA 4DN4H 1MIEH 4P2QB 5AW8B 4OV5B 4TS6A 4YHYB 4KJWC 1A7BA 2CG9X 3LD8C 3MV8D 1OE2A 1NBVH 1NOFA 1UQSB 4OLZH 4J1UA 3IFLH 2YGQA 4PUBL 4NO5A 4R3SB 2PYFB 2XVKA 1T0OA 4UDUB 4BK5C 1ORQA 5IJBC 3WTSA 4KUZL 4YPGB 4HG4J 1J0HA 2FX7L 1LDPH 1A1NA 5GIRB 1JPST 3KBEA 4WNQA 2HRGA 4ODBD 3S36L 1MLCB 3APMA 1UCBH 2FB4L 3HI1A 4S1QL 1YQ2A 5F71A 1PG7X 1QFWL 5J11C 1E3ZA 1JK8B 3U0TB 2DMBA 5T3ZL 3JWNH 3UYRL 1ACYH 2WXLA 5I0VA 5JW4M 1NC4B 1E9QB 5DXWA 3TNMB 3HZYA 1GGIH 3EYFA 1JYNA 2DF3A 1DVQA 2IBGA 4Z0BL 1RLBA 2B2XL 2DBLH 1JSYA 5LKNA 3IJYB 2EP6A 5F70A 1EAQA 4ANWA 2AJZA 4EZKA 4Y2DC 2X09A 4ELME 2BZ7A 4IDLA 3V5DA 5TK4A 5EO9B 4FMFA 1TFHA 1D7DA 2NNCA 5C3LD 5ADPH 4YZWA 5HBBA 2JCCF 2XFXB 5DJ8A 1JD7A 4RGMB 4G1EB 4ZUTB 3EH1A 4PRAA 4E9QA 1RULL 2YXFA 4ELMB 5DRNB 3BGMB 2E27H 3PGDB 2VIRB 3TWYA 4G83A 3GJFA 1KV7A 1TETH 4L4TE 4LLMA 1TJHL 4UIMA 4JJ5B 3NRPA 3VGAC 2WWKT 1AY1L 5DRXA 1J8HB 2OP4L 4ZS7L 4BH8B 3WIIH 4AEEA 2PTVA 4KGJA 4JFZL 5F0LB 4H25A 3VI4F 1P7HL 3PL6B 4NQEA 5JIQA 3CC5A 1ROWA 5F2FA 4CSSA 3PXHA 3R1GH 4ZS6C 2DQGH 2C9SA 2Y6SC 1NGQH 1MKFA 1QAWA 1Q9KA 2YQ2A 5LBSA 5I75B 4ZXBD 1JI2A 3FUIA 4K3EL 4LSPH 5JIHA 5JHAA 2NTSP 1CDJA 4I4WB 1IKNC 3FQRA 4KU1A 4QXGH 2GSGA 2O61B 3FTXA 4LARH 5L7XH 1LEKB 1TZOA 2I60L 2K0RA 3M88A 4FQJL 3WS6C 1EAPB 3DXAE 4AV5A 5I6OA 3BJLA 3P4OA 1CF8H 4E9VA 3TO4A 2QHLA 1NANI 1XV8A 4N20A 3QJFA 5F1KC 4PWHA 3L3GB 2EIZB 1XGPB 1TIUA 1RSYA 4HH8A 4KHTH 5KS9B 1FVEA 3WJLA 5I1AA 2BOLA 1P4LB 3GBEA 3ULAB 4JO8A 3HHMA 1MCWW 4F7CB 5JUEH 1UJ3A 3IXTA 4G59C 4KY1L 1YEDA 1XCTB 3UG4A 4OZIE 1SBSH 2DB8A 5I6XB 1RIUL 3AB0C 4NKMA 1RD6A 1FRGL 3BH8A 1UCTA 1IGMH 4EN3D 4EKXA 1HSAA 3Q8BA 3P3RA 5GSVB 3DROA 1X44A 2DQEH 2OK0L 4L29A 2IQAB 3DOIA 3ZTCC 4XN5A 5IHUL 4S1SH 5I66B 3KM2A 3A6OA 4G11A 5KBKA 1YJDL 2JKSA 3MJ7B 3BEWA 4JM2A 2FT6A 3RX9A 2PO6B 2H0EA 2Q8BH 3BPLB 3MRNA 4GKZA 1QSFA 2BINA 1MWOA 3D87B 2HVJB 4P49A 4RISH 2F54D 1DDHB 3VXMA 3W9DA 2QGCA 4OCRH 1M53A 1MJ8L 4AL8L 2B1AL 3GMLB 5I1CL 3UO1H 2GW5A 3MLWL 3HC4H 4M7JH 3QH3A 5E2VL 1R47A 4FFYL 1OB0A 4JO4H 4X9HA 3GO1H 1A6AA 2KLTA 2V9RA 2UY6B 3OKKA 4JHUA 4C59B 1SN5A 2KZ1B 3DTXA 1MIEL 3I9GL 2A6JA 4B9GA 4HKJB 2QZ5A 4PJAF 2FCBA 2PR4L 3QHZH 3G6JB 5D4IA 3NPZB 5I76B 4WJG3 4U1GC 5FF6A 1NMBL 5HHXH 4LRIC 1TCRA 2AMGA 3FW6A 3G5VB 1Q0XL 3WAJA 2JB6A 4RAUB 3UZQB 1TPXC 4L9LB 3QI9D 3X1BA 4NT6B 3VD7A 1J12A 1DLHA 4K9EH 1FLRL 1NPUA 2IEPA 4FNTA 3VVWA 1M7XA 4QHKJ 1QFWH 5HI3C 5MENE 4LCVA 2MTAA 2XWTA 4DKDC 1GYVA 2DLIA 1HIMH 2OPCA 3CHRA 3V5HA 4YGVB 3EUDA 4FNLH 3C5XA 3NN8B 5ENWB 2CO2A 2E56A 1X5ZA 3LNIA 3D09A 3RIKA 3EHBC 4U33A 5SV4A 4MNHB 4G8AC 4AEHH 3T0EE 4RQQA 3VFRB 1MVUB 2BIIA 2FYYB 3LEYL 4KO6A 4PG9A 3FO1A 1DJXA 3BI9X 2IV9A 4DSYA 3B9KA 4ZW7A 1I7RB 2WQWA 3EHBD 4QI3A 4XOAA 2HJKA 2ARJA 4NEHB 4GBXA 2EUVA 3MU3A 1SHXA 3ARGB 3GUTA 5ADPL 1CDUA 4YAQA 4RGND 3N85H 1TO5A 3GGWA 4Z7QB 1TJGH 3TEXA 3K5RA 3JUZA 5FDWB 3FUDA 4UILL 1B4JH 3ZQ9A 2B7DT 3U0PB 1T7XA 5F7WC 4YXKL 2XBTA 4LO9A 4F15C 3QHFH 1AP2B 1G6RA 5T5NF 1BM3H 3FAWA 4YPGA 5F96H 2FX9H 4GIAA 3P77A 4ONGH 1W72B 4RFEA 4H1LH 4IOIA 3RTQD 3RPIB 1FC2D 4LCUA 4K5MA 1JPFA 5IJKC 1Y18B 1HVXA 5CEXA 3KJ4B 2Y36H 2OCFD 3AWEA 1GGYA 5LBGA 2FSEA 3BUIA 1CL7I 2CLVA 3VNZA 5A2AA 3OMIB 2CDGA 1HINH 4BRVA 4MJIA 1FL5B 2R29H 5F21B 5F7NC 3L9RB 2CGYA 2BSRB 3OV6A 5DVKA 3LRHA 1DE4A 1ES0A 4F33B 2XJKA 4LSSH 4P05A 2ARJQ 5C0JB 2VXUH 3KPQA 3KYAA 1JERA 3GJFK 1MJ7H 3HIZA 2B1HL 3ILEA 5KEZA 2VERN 4ZXBC 3ULVE 1LDSA 4KJYA 2AJSL 2WBXA 4D0BA 3F00A 1CE1H 2OJZL 2V7NB 2P7TB 3I84A 4ODHH 4XO9A 1VA9A 1FFNA 4M61A 3KBHE 3L4CA 1JVOA 1VCBC 3CMGA 1AG0A 4MAUH 4HFWA 1ADQL 4OGQC 2OTUA 1W80A 5F7KC 3GIZL 3AWGA 5JZ7D 1INEL 1A5FL 1XEUA 4TOYL 1VFUA 3MLVH 4PJIE 2VYRE 4L3ED 3O6MH 1R3LB 1G0YR 4G3YL 2CHDA 5F1IA 4PJFA 4NUGH 1ZGLM 2ITDB 5D7LB 1WZ1L 3IJHA 4H1LA 3PL6A 1YEIH 3QJZA 4MJ6A 2OMWB 5JQ6H 2OMVA 3CDGA 4HJJL 1BYOA 3QE5A 1F41A 1HHJA 3TBTB 3EH4B 4EXPX 3K6OA 3BKJL 4NCDA 3BPOC 2X6MA 2YPVL 3T2NH 2VH5H 4MJ2A 2M26A 5JLZB 3LIZA 4J3BA 2CQVA 3WNOA 5HYEA 5IFAH 4OJYA 3LZQA 2PCPB 3B7UX 3FT2B 3MRJA 2NZ9C 4JPWL 1QI5A 3I2CH 2F53D 5DHXB 5I18L 2J8UE 1BZ7B 3EW3B 1E5YA 5A6LA 2WN3A 2J44A 4O2FA 5FYJL 4JFVA 4F7PB 2F18A 3VDBA 3MV11 4Y9BA 2YSSA 4ADGA 4OVUA 3F58L 4K3DL 4RRPA 4TUJB 4Y5YB 3ARDD 4EOWL 4JPIB 4F9PC 3VXUA 1JHKH 3VRLF 3RE0A 3ROOA 3JTBA 2BRRL 3UFIA 4EVNB 3EG9B 1L9NA 1OZUA 2J8UB 4UOW0 2X4NB 3UX9B 3D39E 1QA9A 2W9EL 3BP6A 4J6RH 5DJ6A 3S35X 5DHVB 3FSZA 2ZXAA 3GMPA 4WI8A 2DQFB 3NABH 4CN6A 4GI9A 1T89A 4PJIA 3MJ7A 4JM2B 4YDLC 3SYQA 3RB5A 3MRNB 5KG9A 5BJTB 4RGMC 4BE6A 4XCCH 1M2VA 4AGMA 5CR1A 2J12B 4K5NA 4AEHL 4PD4J 3LN9A 2CUMA 5F7EL 5D7KE 2FDBP 3FCBA 1I8AA 2EC8A 2XTJB 2X10A 3FQ4A 4HXBH 3CXFA 3VWJB 4I77L 1TZIB 1J5OH 3MUZ1 3HMXA 4Z3IA 4GAYB 3V4VH 4YSQA 4ZJ9A 2FQGA 1UZ8B 3GXFA 2CRYA 3LPOA 3QIWC 4G7YH 1HILA 4CL7A 4N6QA 1EHKB 1YC7A 2AJYH 1NM4A 2N0KA 4K7FB 1ZHKB 2X70B 2P8PA 2PPEA 3HE6C 5EU5B 5IBTL 3QZPA 4R7XA 4AGLA 5BQ7A 5LQBL 5I6XC 2BSSB 2H1PH 4IKLA 3QDGE 3RVUC 3MFFB 2WP3O 1TCRB 1URLA 4YE4L 1SDAB 4LLUB 2MKLC 3EF7A 1D6VL 2G5BA 3B83A 2X3CA 1BFOB 1XGTA 1Y6KR 1G6RL 1MXDA 1NCGA 3GK8L 3L7EA 3DOSA 3PABB 1OF0A 2XQBL 3WV0A 1NTDA 2A0LD 5B1CA 3T71A 2XWTB 3T09A 1CT8A 4IHOB 4MVBC 5LGHL 4LXFA 3HRZC 2LR4A 5DYOB 1ZANH 2VLJB 1F42A 1X4ZA 5I6MA 4FZEH 3OKEA 3UJJH 4RMTA 3E2HC 3EF4A 5HP5A 1I9JH 4LIQH 1PKQB 1ZT7A 5D7KD 3RJDA 3VFWB 2J6EL 3QR2A 3CDFA 1XAUA 2XG5B 3PWJA 3QUYC 4N90E 4XMPH 3W81A 2XWXA 3K7UA 3BAYA 4L1TA 3ZMNA 3QIWD 4GKNB 2BNQB 4F93B 2C3VA 4X6EB 2B1HH 2OMYB 1RPKA 4O2EB 5I1IL 1EBPA 2O93L 2VLJD 2C26A 3CFJB 3QHTC 4D9RD 2AK1L 5C2BL 5IROD 2X12A 5GZOA 3DVNB 1O7SA 1R24A 3PY9A 3U0PA 4X8CA 1ADQH 1JMXA 3IGUA 1CLOH 4ODVH 3KS0J 2BNQE 1FNEB 2WWMC 3H1ZA 5HD8D 3WLBB 4Q97A 3KYNA 1PLBA 1QBMH 3D08A 5TE4L 5EBMA 3ZE1B 1M1XA 2YXVA 3S37L 3Q6GL 3QFJD 4W4OA 4ZSOA 5B7EA 2I9TA 3OKNA 4FFYA 3FB6B 1IFRA 4NCC2 5LXGL 2F58L 5CEXB 1M9WA 5I8KL 3RX5A 3BWSA 4J6IA 1YEEH 3RDTA 2NNAA 3QUMB 2ICWI 5IFJA 2W0LA 2Q5BA 3OR7A 4XPBH 2O5YH 1I3GL 3HMXL 2MIZA 4WNSA 4B96A 5KANI 1FL5A 2I7SA 1LHZA 2VKWA 3KR3L 4PTUB 1LO5A 1H19A 2F19H 3BIAX 3NA4A 3PJSB 3DWTA 1E6JL 1KNOA 2YARA 4N6RA 3EO0B 3B9EA 3MLZL 1AGDA 1TU2B 5EC1B 2LOEA 3ZKND 4OLVH 1MCEA 1C16A 3W56A 3VFGL 5ESAB 5HYFA 2B8OT 5IQ9B 1NCIA 2B4CL 1TITA 3DA0A 1YVLA 3UTTB 3IU4L 3VFPA 5HI4D 3TZVA 2V7NA 1BYPA 1FFNB 4JANA 3B5GA 2X5PA 4JQVC 3DVGA 3SPVA 1EQWA 3L4TA 5DQDL 2MPAL 2R23A 2VMJA 4OLWH 3L7FA 4GIPD 4R83A 3DGGA 2D0GA 1JGDA 4ZOAA 2J7LA 2A83B 3H3PH 3R7QA 4HDIA 3TJPA 1RUKH 3UACA 3VSQA 4FG4A 4CVXB 3MRGB 5C0DB 2YD9A 4BKLB 2R2CA 3ETSA 5F1IB 1INDL 3H42L 5JHDB 4JRYE 5ACLA 3EO1B 4U3HA 4BRJA 4ACTA 2VSKB 3LZFL 1V7NH 2PLTA 5DDHB 2KMWA 2BZCA 4NHCL 1KGCD 1TZHA 1GGBL 4P2RA 5DMGD 2EDTA 2OMBA 4J8RB 2IGTA 5F97E 3OG4B 4P2QD 4X98B 3UTPE 1KXQA 1WF5A 4WHYG 3ZE0B 1L6PA 3BD4A 2W81C 4ZI8A 5GRZA 3QSKB 1PQZB 4G7YL 5JHDE 1XSOA 4WU5B 1J9CT 3GXMA 4HC1A 4F1SA 5AVZB 3N40P 2ED6A 4HS8L 1CDIA 2G3XA 1EJOL 4JFOB 3CZJA 4WUUE 4PR5B 4AENB 2JLLA 4OIFA 3ZGIA 3BQUA 1N9PA 3SDDA 1KB9K 1UC6A 2QLVB 4DPCX 5J6SA 4P4RA 1JYXA 4J4PD 1SY6A 4HC1L 3VMNA 3MRMA 1KXVC 2Y5TB 1ZIAA 4RMVA 4TSAH 4ZMWA 3CX5J 4YL9A 3VXTA 3ZDXE 4Y5XC 1KT2B 4DGIH 1UVQA 3LN5B 4P4KC 3BVVA 1G6RH 3HR5B 3I9PA 5EBGA 4BFFA 4LBAA 1QFWM 3BE1H 1AIFB 1R3KA 3EZJB 3K8LA 2FTAA 1YN7B 1K5NB 2IH1B 3ARSA 2X2JA 4PJIF 1OGSA 4KXDA 4L0ZA 1H5BB 4J2QA 1AO7B 3QXDA 4WF7A 2AAAA 2PTTB 1TSHA 4DETA 2ZCHH 4AYMC 2AJUH 2A6IA 4PBVC 1F4WH 1S7VB 3ES6A 4PJ5E 2IH3A 3MV7B 3QEQE 1QNZH 4MMZC 4I85A 3FFCB 3X11A 1BZ9B 2J4WL 3D18A 4G1MA 2I69A 3VFTB 4XMLL 4YZFF 5AEAA 2D7MA 1GS8A 1MWAH 1V55B 5HJDA 4LLWA 4PB9L 5IHBA 1RUPH 1J8SA 1W72L 3QG6A 3ME0B 4M7ZC 3EJQA 5F3BA 1IRAY 1QRNB 2P5PA 4KKNA 2X2HA 3D52A 2JJUA 4RZKA 4Y4FA 3PXJA 1DBML 1EFQA 2OR7A 2Y1YA 3F84A 3HG0A 3V4UL 4A7GA 2JKWA 5AW6B 2WLJA 2KZKA 1ZHKA 2VXVH 2V5TA 3CN0A 3C09C 3JYCA 4KJWD 1IMHC 3F6LA 1O9VA 2BVUA 2BSDA 4Y16C 4OLYH 5FAAA 4ONFH 1NCNA 1R5IA 3N1FC 2APWA 2FR4B 3DK0A 1A9BA 5DO8A 3GLZA 3BYTA 4H88H 1KB5B 2Y1VA 2ZSVA 3CFKB 4FFTA 1N2RA 4HIQA 3S36H 4ZMYA 2VB5A 2V2TB 3L4VA 3U9UB 4PJDE 4RZCA 8PAZA 1RL1A 4E36A 1GPOH 3OLEA 4V11A 3J8F7 3E8UH 4HIJB 5L4IA 3WNIA 1AOZA 5J3HC 1M2OA 4X9GA 2EC9U 3NVQA 1K3IA 5FUCC 1ZT7B 4K71B 3FT9A 4DP6X 4AIXA 4HUVA 1J05B 2VDNL 2D4DA 2HKHL 4PJ8A 1WLHA 3CZUB 1ZS8A 3CK0H 5CIPB 4YX2H 4KROC 5E9DA 4U1SA 2VDOL 1TNNA 3N41F 3P9LB 3B2UD 5D1XE 3O3AB 4X99A 1TZGL 5HGAB 2A74C 2X4RB 3WN5B 2W95A 4HJIA 4AWJC 4YNYA 1FO0H 1UA6L 4ODWB 3NA9H 5GXBB 1C5DA 1F11B 1CGTA 1IIIA 4FQ1H 4PRDB 1RK0B 4X7EC 3VCLB 1BZOA 4BINA 2OFQA 3L08A 5AVSB 4M62H 2OYKA 3WJMA 5DT1L 3ZJAA 2WCGA 2AKRA 3ESOA 4KTEH 3EAKA 3FO9B 1P5VA 4MD0A 5CSGA 5C09B 3UTZB 3BLKA 3TONA 3RWDA 3KLSA 3UO1L 5E2VH 1ZY9A 3G6AA 4FQ2L 4WZ9A 4XCYA 1BMZA 1L9SA 2R1WA 2NRDA 3M7OA 4AYFA 4P9MH 3QULA 3COOA 2AZAA 1DSFH 5SWSB 4N22A 3ZDYE 1CGYA 3K2KA 5AW9B 1D6EB 2QGDA 3UCRA 1NCAH 5I1GL 1NMAH 1MW1A 4OCLC 5I1EH 1KJ2H 2ICCA 3MV9D 4M4RA 5H37A 3VXNB 3VUAA 5FO2A 3CHPA 3ZK0A 3KS0H 5MENB 1JZHA 5C70A 5LBSH 2ETWA 2LV4A 4PQXA 4Y19E 3SYCA 5I8OL 3D34A 1XVSA 5EC1A 4KOBA 1AC0A 4R7LA 1RUQL 4JLRA 4HAFA 2HMIC 2AQQA 5I30L 2X1PA 1U58A 1AYRA 5E03A 3TTYA 2ADFL 2BW5A 3KGRA 1YNLL 4NXKA 1DCLA 4RAVB 2W9LA 3D85D 2WAQA 4OTXL 4Y19B 1DBKH 3WY3A 1DFBH 3VG0H 4Z7OE 2FL5A 1EDYA 3VYOA 2R23B 3TXAA 1IGML 2P47B 1NUGA 4TLKA 2AGJH 1FZKB 3RWIB 3FUJA 4EN3B 2A83A 1W0WB 3GFUA 4HEPG 1LEGA 1OAKL 3ESNA 4LLAA 4OGZA 3V4VB 3W9EB 1CE6A 3AQYA 3TPKA 1P6WA 5FO9B 3OTTA 2PP8A 3HHRB 4MBRA 2IC2A 3IETA 5AOZA 3ZXAC 4KQ3H 1ODAA 2JKLA 4C56D 4X5XB 1GS6X 3UYOD 2VR9A 4YLCA 1ZA3B 4WJKB 5LHDA 5GS2D 3F12A 1IJNA 3ERXA 3PQYE 3CFTA 4L8SB 1SNRA 2OLDA 4NN7B 4UTBL 4AQZA 1IKFH 2EKSA 3LVTA 5GISL 4Z0XB 4F37F 1BM3L 5IHLB 1WBZA 2FQDA 2KC0A 3IRZA 1HXKA 3I9GH 4WI0A 1O6TA 3K1KC 3AADB 3KPMB 3T0DA 2DD8L 2DJ4A 4ZS6D 4G8IB 2HKFL 4MMZA 3D4YA 1FAIH 3QWRD 3E6FA 1RU9H 5HGHA 2G4GA 4LCCC 3IRCA 3SDCB 1OW0C 3SY0B 6CGTA 5E4IA 1QPKA 1SXCA 5LB1A 3UZVA 4AQAA 5BVJB 4L3AA 2JKRM 1OARL 5EDSA 1BOGA 3WFZA 4BA8A 3ABLB 4PLNC 3IDGB 4M8QA 3SDDD 1MFEH 3AT0A 1FC1A 2O6FA 3APCA 4TUOB 4ZXBA 3K74B 1T5WB 5CJOH 3T0EA 3QPQC 3NACH 5F9DC 4J7RA 3LQAC 1FGNL 1PSKL 1ZA6B 3BN3B 3QWRA 4ORGA 4JHAL 3QDME 1NGWB 2WYIA 1WISA 1FV1A 3AITA 1NLDH 1UYWL 4P46D 5EBLB 3Q1SL 1SFDA 2NY4C 4XPHL 2DEWX 3CJJA 1S78D 1I85C 4Y4FB 4MJ5B 1WBYB 2V3DA 5PAZA 1YNTF 1TZGH 4DOHB 1MRFH 1NGZB 2VDKH 1NMCC 4L23A 4TSBL 2XN2A 3V8CA 3WXWL 3QQDB 4P2OC 5E5RB 4DZ8A 1FYTD 3N6YA 5TFSH 3QDMB 1AXSB 4FQ1L 4JE4B 4QHPA 3A67L 1OCCB 2CSPA 1A1MA 3GS4A 1A9BB 1DN0B 3HG1D 4LT7A 5DJCA 3RVVC 1VKXA 3VG9C 1ZVYA 4Q6IB 5JXEC 1OF2B 3V6OC 2R7EB 2PPAA 1YMME 3NSYA 1CGXA 1UFGA 4GRWH 2NY3D 1HCYA 5ISZB 1G7JB 4JFHD 5CEYA 1KXTB 1T1XB 3D9AL 3IJ9A 4DQAA 1HHHB 1HQ4A 3NZ8B 1KPRB 1H8LA 3RNKB 3ZHLA 2YD4A 1N70A 5ESVB 3O2WL 1OSPH 1GZQA 4TXVB 4NGHL 4L9DA 3QORD 4NFDA 2RQ8A 3I6SA 1YEIL 1HH9B 3BUYB 3FU7B 2D73A 5CILH 3OWRA 2ARWA 1K6QH 1SJVA 2Q86A 5IESH 5DZPA 2E0PA 3HG5A 5HYSA 4NHUB 3UABA 2JCCA 4C83B 5J6HA 3C5SB 2V6HA 2VKXA 3EDFA 4F20A 5LVEA 1PLAA 3FT3B 2J43A 1HDMB 4XP6L 2CR3A 4NQDB 5D55A 1WV7T 5C6WH 3MNMA 4FNQA 4M43L 4R8WH 2Y7QB 2ZOTA 4JO1L 4FFZL 5A2FA 5MEPA 1TKWA 3K71B 2NY6B 1E4XI 1RJLA 4HZLA 1CLYL 4KNUA 5GGQH 1OCWL 3QEQA 1P5UB 1XMWA 3CN2A 3SKJL 5T33L 1VHPA 5K9JL 3WFEL 1AZZC 1G1CA 2BS9A 4GQZA 4M7ZB 2AXGA 4PWJA 3VRJA 3ZE0F 1K8DB 1GC1H 1SOKA 2E8ZA 4CU6A 4FLRA 1F1AA 2LU5A 3Q06A 3WIHL 4IMLA 5F9OH 3T8MA 1I1FB 3T2OA 3V0WH 1QQDB 1L0PA 4FFVD 4TUKL 3RWDB 2K9UA 1B88A 3MXWH 2V3EA 1KGYE 1TTAA 1UXLA 4FA8A 3EDKA 3NESA 3EJZC 4AYFB 2GCYA 5TH2B 4ZAKA 5I1LB 3N1MC 3OC8A 4P2QA 2JTYA 1HZHL 2JK5A 3AXLB 3NQKA 4FQQB 4KQ4L 2VH5L 2W1NA 2A74B 1IKOP 1SF3A 2WK2A 3V9CA 1UQSA 5E6RB 3RZCA 3IF1B 3CSYB 3BAKA 2ADIB 4KOCA 3BUBA 5MENA 4PRPD 1YRKA 2VXTH 2NQDA 4PI0A 4HIXL 5TD4A 3X1NA 2A9NL 4WNQB 5T3XH 4JY4A 1U8OA 3KBFA 4DCQB 2QHRH 2JKIS 2W94A 1YAIA 4LGRB 1MCJA 2F9BT 4W9ZA 2LU3A 2D9QB 5BZWB 4AQ1C 2WLYA 2H32B 5FFLA 4JO2H 2WNXA 1I9JL 3HZYB 5IV2A 5KBPA 1D9KD 1OM3L 3VMPA 4Z8FL 1JYVA 4UTAH 5K69A 3D30A 3Q9PA 4DKEL 5E8DL 3UP1A 2N1KA 5G5DB 2IMNA 3I9IA 4UWQB 4Y5YC 4BSVB 3D51A 4MNGE 4YSDA 4QCIA 3M86A 1I8MA 1AE6L 5I0WA 1RURH 1UXSB 2C9XA 2A4CA 2H6UA 4LRNL 4U7MA 2IAAC 5AKTA 4UQ2B 5IJVB 4FZEL 1E3XA 4U3SB 1D7FA 2PCYA 4LSDA 1UXWA 1FE8L 4WO4C 3LCYA 3MGOA 4JDTH 5IUSA 4OI7A 4ENED 1DUYB 4F2MA 3HFFA 3EFOB 3ARUA 3LS4L 4Y4KA 1KUMA 4N25A 4PREB 1TTUA 1HYSC 4N2KA 3KPRB 4AGOA 5AWNL 1FZJB 4ADJA 1DO6A 1NIAA 4Q89A 1P1ZA 3S37H 2QPEB 5D9SA 1OAZH 3TOPA 1NJ9B 4Z3EA 3RRQA 1MI5B 1DVYA 1S9WB 4F7EA 4U6TA 4PD4K 3PP4L 4BZ2H 1XTMA 1XCQB 3D3VB 2IFFH 3L5IA 3HC2A 4HUUB 1NZRA 1E9PA 2Z35B 3MLUH 3R8BB 4Z3FA 3VD4A 2HUHA 2JI2A 3T6VA 1H6TA 1F4YH 2ZXWB 1OWRM 1MI5E 4HSCX 1G7PA 5JHDD 4M8UA 4XCFL 3SDXF 5EF2A 3RWCB 2E8YA 3VRJB 4CU7A 3IDGA 4Q56A 4NYLB 2GTQA 1LTXA 3WFHB 3TO4B 3A21A 4XNZC 1BXUA 1ZOXA 2C9PA 4KMTH 3JWDL 4PJBE 1XGPA 5D72H 3RG1C 3P02A 5J5EA 1BEXA 1E5ZA 1CBVH 5B3JF 3O2DH 5BOZG 3CWGA 3VACA 2D31B 1U8LB 2CHWA 1PCSA 2GITB 1SXBA 3AAZB 3H7BA 4G42B 3T65A 3TBCA 1R3JB 2P1YA 2F68X 3QRGH 2BNUA 3F05A 3DROB 4U6YB 1VDGA 4L29B 4LLQB 2QGBA 1NFDF 4H8UA 4U7KA 1M05B 4WTZG 3T1WA 3QPKA 4ZS7H 1INDH 3H42H 4TTDD 1N0XH 1FHNA 3NCEB 1I53A 2BHYA 4KO5A 1G9ML 3JVGC 2R1YB 3VB8A 3HS0C 4Z3GA 5EEYA 1A9VA 2MPAH 1W0VB 3EYOA 1NFIA 1BZDA 4BWUA 2Z93B 3TF7C 4F15B 2GIXA 3HR6A 3K5SA 1IARB 1KXTA 1MFAH 1T1XA 3MBED 4HWBH 4QRBA 4XR8C 3S5LB 5I6NA 5I71B 5IP4A 5KSBE 1HQ4B 3NZ8A 4NPJA 4ODUA 2CDEA 2R0LL 2UXFA 4UU9B 4U0RB 5I23A 2WXIA 3C12A 3K4ZA 5DS8A 2CJUL 3HUJF 3FMGH 2PW2A 3FUNA 4MCNA 4NP4L 3QUML 4XC1L 4HKJA 4BFIB 4FFWC 3UZEA 3NJHA 1J9TA 4OZGA 1H6FA 1UUNA 4YDZA 4I1NB 1EO8L 1Q8MA 2DKSA 3ECBB 4H8HA 4LASH 3GIVA 4L0PB 3WTVA 1AC6A 2WWOA 3UAAA 4NO2A 1FPTH 2BC4A 3OJVC 4AC2A 3QA3B 3CVCA 3G5WA 5FO8B 3O81A 5JMOC 3WO3B 2XFGB 1HNYA 5DK3A 2O4EA 1NCBL 2ENSA 2HT3D 1EMTL 3NSDA 3ARPA 4JFXA 4Z23A 3GHBL 4GP8B 5KYXB 3FQ2A 3PV7A 4QAMB 2X3AA 3JTSA 5FHBH 5SWSD 3QRFM 3KPNB 4E5XA 2COQA 2MPVA 4F8NA 4YHOL 3GLAA 1MY5A 4DGIL 1OM3H 2P5WE 4DT2A 4MNHA 4HP5A 5TDPA 1FIEA 4IMLB 3RZCD 4XMLH 3HNTL 5JIDA 4NNPH 2F53A 1I1FA 1R0AL 3MBEC 4WCYL 1X4YA 1J1OH 4WWKA 3MLWH 3G6JF 1GMIA 1JV5B 4QY8B 3O41A 3PGCA 4LPUA 5F9AC 4JFHE 1EZUA 1IGJA 4GBXB 3X2QB 2ITCB 1VEMA 3O3DB 3LS5H 1U6AH 2OMXB 4MDRA 4XTRD 3AXLA 4NZTH 3SBRA 3SQOL 4FL4B 2Z7ZA 3GMMB 1IL1B 5T1MA 5J7CC 5AB1A 4FQXA 3MGAA 4GBXC 4PJDB 2H0PA 4X6CA 1XGUB 1EJOH 1U3HC 1GZPB 1B90A 1JWMB 3H53A 3HUJB 4P9HL 5F3FA 4W81A 4J5VA 2GHZA 5AAMA 3HG1B 4N0CD 3VXOA 1S8DB 3GSNL 1BYNA 3S7GA 3B9KC 3S48A 1GGTA 2ZF8A 2Z91A 1R33A 5ESQB 2XY1A 2CBMA 3QYNA 3IU3A 4XXWA 2WVVA 2CCVA 3QYCA 5L88L 1T2QH 2YD5A 5BRZE 1IT9H 5MERA 4ODSL 1OD7A 4GP5B 4W9EC 3KPOB 1IC0A 3TVMB 1RK7A 2X6BA 3NG5A 4JVPA 3VFUB 4NAQA 4B0MB 2H0FA 1BVLA 3K6SA 1NCUA 3BHBA 3ATEA 3SOBL 3KPQB 1ADQA 4ANKA 3DK2A 1D7CA 3O6KH 5CZKA 3VJ6A 3ZMRA 3ZT5A 1N6QH 2DY2A 4AQEB 4UQ2A 1ECZA 2QSCL 3X17A 4YHZH 4DUXA 4O02A 4DO6A 2V9TA 3S9DB 3QC5X 5C09E 5KOMC 1Q94A 4WSKA 1IM9B 5DC9B 3ULVH 1RHHB 2XX0A 2EH8H 2PF6A 1A6UH 4V2BA 1XTLA 5HY9B 4FYTA 1Z5LB 4JB9L 1JUFB 3WUWG 1NANH 1OHZA 1FZJA 3N1PC 2YXWA 2NUTA 4F5CE 2QPUA 2XTJC 1QLFB 2EE0A 1JZJA 2GABA 1KPUA 3TNNA 2ZF9A 1YHPA 4K8RC 1UTDA 2L3BA 4OLXL 2ITDA 2V9QA 1I8LC 3K8MA 4GRLD 4H1LB 3RVXD 3MO1B 4F57H 5JHLL 3QZNA 3QIBD 4ABUA 3IAPA 1SJMA 5EN2B 3ABGA 2OI9B 3NJXA 4PGZA 2X9YA 3GRWH 3ZTDC 4N9GB 3PGFH 1HQRA 2FBOJ 2G2RB 1JF1A 2Y7OA 3H9SE 1G7PB 3GKWH 3JV0A 4R7VA 4R5XA 5DK2A 1A6WL 4PJGE 4PRHB 1DCEA 5FA4A 3TJEH 3NTCL 5JW3L 2BVQB 4G72B 4LL4A 3TIEA 3PWPD 3BJ91 2J5LC 1OHQA 3KCWA 5E8NA 1QSEE 5FKAB 2CALA 4OZGE 1BVKA 1A6ZB 1UM6L 1DSFL 3LRLA 4FOMA 4KKCC 3VXQB 3ISYA 1A14H 4X6FA 4X6CE 2A9DA 7CGTA 1QW8A 1CICB 4PJAA 1Y1DA 1FYHB 2YC1A 3CK0L 1IUZA 3DX8A 4K07A 4F8TA 5JORB 2AHIA 1YUHB 5CJQH 2J8UA 2FJHB 5KYYB 2DJUA 3MRQB 3RL2A 1NCWH 3C60C 3Q13A 4IW4C 4I48B 1U92B 4LLQA 1Z7JA 1OEZW 3CZFA 3U7AA 3GI8L 1SEBB 3QJTB 3C9NA 1KN2L 1N64H 5A7BA 1DEEB 5HVFB 3DLQR 1L0XA 2QDWA 4OY9A 5BJTA 5T3ZH 1TTGA 1I7ZA 4O02L 3L2LA 4WHTA 3IK2A 4O51A 1LILA 5KSAB 3QS3A 2EDLA 4KTEL 3BAWA 4MDIB 4Z7OF 2AV7A 1ZHLB 4NNPL 4UMGA 5ICZA 4MQXD 1TZIA 1CU4H 1AKJA 2I32A 2WQXA 3HB3D 4E68A 4HS6B 4QHUA 3CCHB 1RZ7L 2PWEA 4Z3JA 2H1XA 3PWLB 3BPLC 5J13B 4KTYA 1IEBA 4NJAH 4ZAKD 4PGCB 4BFIA 4QTHB 2G30A 1UKSA 2BSSA 3KWUA 4LEBA 3BH9A 1V3MA 5ACZB 3DBSA 2Q3ZA 4FZ8L 4HFUH 2A38A 5KSAC 3FQWB 5T1LD 1OV8A 3CHOA 4YDIL 3GEWB 4NO2B 3FN0L 3M45A 4IYKA 3M7FB 3UXFA 3GJEA 5GGTH 1U8KB 5ETUB 2YPLA 4P0DA 1HTYA 2Q2EB 2VR7A 3EHBB 3FAXA 4U1KB 1PD0A 2E7BA 3I6LD 3GSNA 2FQFA 4MAZA 2ZWZA 2OMUB 4DGYH 4OZFH 1DBAL 5GGVL 1QTSA 2X1QA 3O4LB 2MQGA 3BWAB 4Y9EA 2E4FA 3SGDI 1D5XB 5F9JA 2YEZB 3TS8A 2VRKA 1ZV2A 2WKGA 2OMZB 5TDPB 5CIPH 3B2UC 4YWGH 5KSBF 1P6FA 2XG5A 3B56A 2ID5A 4UINL 3SCMC 4IGBC 4BK5A 1D5BA 4G6KL 2VMDA 4OZIA 4WJ5B 3GUFA 4U1GB 2GAZB 1J1PH 3PG2A 2YKKA 4LHQB 1D2OA 2WOBA 4ECNA 3DMMA 4FF9A 2RCSH 1JGLH 4ERSH 4LSUH 1LO0H 1FDLH 2ICWA 3D8MA 4ZPVA 1JF5A 2J21A 4Q14A 4BWTA 2Z1PA 4E0RB 4MRCA 2Y6SD 4ZQKA 3OXSB 1NGXA 1A6UL 1BZEA 1SLWA 5JUEL 1BBJA 1EHAA 3TPUB 2J1KA 1LMKA 4FQIL 2IALA 2RR3A 5HJBA 1UUSA 1UM5H 2WQVA 32C2A 3SDAD 5HPOA 4LHUA 3K72B 2NY2D 2NY4D 1JWMA 4LVHB 1XF3B 1G1YA 3FCSB 3L9BA 5IT2L 4Z78B 3U30C 5BV7L 3QUHA 1GOHA 1E28B 5AZ2H 2FEDD 2YEVB 3MBEA 4OUUA 3U0TA 2DQJH 3RDTB 1MLBB 3RU8H 4P06A 2ZXGA 3LEVH 4DQOL 3FHAA 4PJCE 2F61A 3O0RH 1DJGA 4LSPL 2P5EA 2ZP9A 1JGEA 3JV5A 4HISA 1FVDB 1LO5B 3QIUA 3FBQA 3TCLB 3LV3B 3DARA 3OKLA 4HWBA 5H8DA 5BRZA 5GGTA 1E43A 3BDYH 1O6VA 4LF3A 4KK9D 4NKQB 4AGQA 4XXDB 2YAOA 3VI3A 4NQVB 2AXJA 1U9KA 4TQHA 5KJ7E 5EO9A 2OZ4L 3ZE2E 2AJVL 4EIGB 3UTTA 1FG2B 4GRMA 1E40A 3PHQA 1U93A 1VFBA 3I3BA 3VQ2C 4X5WB 1R4XA 4P57A 4POUB 4IOFC 1R75A 5IKCB 3SPJA 2XTJE 1LK2B 4ELMA 3ILPB 4NN5C 5HY9A 5IF0A 5CP7A 4FADA 5BO0D 4ZX6A 4OZ4A 4DAGH 1JUFA 3BXNB 4OT1H 5TF0A 2YJLA 3MBWA 4RDBA 2BVOA 3GTNA 1D5RA 5D6CA 4X7TB 4MDJA 3VXRA 2EYSA 1WT5C 2ZWNA 3LIUA 1YQVH 4X5RA 2HVBA 5J89A 1IGYB 3MO1A 1HL9A 3QQ9C 4Y4FD 4NQSA 4WI7A 5JYLA 3MNWB 2X4UA 4OF6A 2WCPA 3DO7B 1T7YA 2IPKB 3MRIA 2D3LA 5IOKA 3IMVA 1GKEA 2QMJA 2JQMA 3BP7A 3GYRA 1CFTA 2BM3A 3A3YB 3HS8A 4P2AA 5DD0H 4WU5A 4GI6A 1JNJA 5I8EB 1EAPA 5GS0D 12E8H 1NEZG 3SHSA 4XN2A 4MBOA 3HEIB 3P4OB 5M94B 2LVEA 1QHPA 3F7VB 4NJAL 3B6SA 3DX2A 1AQ8A 2KQMA 4RA0C 1OP3K 1CVRA 1DQTA 4IRJD 1KYUA 4L4VA 4W70A 1KCSL 1ASPA 3N42B 3FCGA 5ANMA 3ELQA 3X1FA 2X4TB 3L3IB 1PKQE 3LKQB 4RGNC 1AD9B 1CXLA 3C8KA 3QW9A 4JQIH 1JZ3A 4JGMA 5KYUB 1F4XH 5E7BA 5ICXB 1YN7A 2IH1A 2M83A 3LD8B 4XWOC 4J4PA 4P2CG 5JIIA 2H3NB 5T3XL 3INUL 4A55A 1IAIH 4N2DA 4GG6E 4NWUH 2XLLA 4RWHA 5GRJH 3DV6B 1DEEA 1RMFH 3UTTD 3JVFC 2ITFA 3GRGA 3US1A 1VEPA 3V4LA 1KZYA 5K9JH 2VLKA 4MJID 4O51B 1AXIB 4ZMNA 3W0WB 3FFCA 4PVLA 1Z5YD 2UXTA 5FCUL 2C3HA 3X11B 3IGAA 3SDXA 3IPEA 5D7LD 1RZFH 4FP8H 2ENQA 3L3KB 3PS6A 2YZ8A 3GNML 1CDHA 1QFUL 3IWUA 1PZAA 4XO8A 5DD5H 3PP3K 2MSPA 3IGLA 4ABQA 4CC4A 3DBXA 5E5LA 1S7UA 4PRBA 3OKKB 3FO0L 4Z7UE 5C0ND 1GSKA 3SE3C 2DBJA 4KDTA 4JFPA 3QCVH 1H8OA 1AQDA 3D3VE 1BW8A 1FCCA 3A6CL 4LLDA 1K4CB 2B0SH 2MCG1 5I28A 1A4KB 1AXTH 1SXAA 3Q2CA 1AR1B 2QV2A 4I0KA 5DEFB 4CJ0A 1IFGA 4TRPH 1QX1A 5HGGS 2K4WA 4JHZA 3S4SA 2E9BA 1ZWIA 2FX8L 2VDMB 4RAUA 4OB5H 4QHMA 4UV4L 3INOA 5AL0A 5SWQA 5CBEA 1N2RB 4DVBB 3KYOB 1SMOA 2L7UA 2Q10A 1JXFA 4PJBB 3VRLE 3T3PB 3FYIB 5AZ2L 1K4DA 3R06B 1L7IH 3DX3A 1ZLWH 3FU6A 4WDIB 3ELAT 3WE6A 3DECA 3V5HB 1S3KL 3KAAA 1EGJH 3RAJH 1BFVH 1ZK9A 1GW6A 1WGVA 3BKYH 3JT2A 4LMQI 2FGZA 2IANE 3LX9A 2FHBA 1HCZA 1LK3H 5FO7A 4ICXA 2ZCZA 5SX4I 3ZVVA 2CK0H 5ECJE 3LEXB 3LKRA 4RFOH 2VL5A 1W72H 1IU1A 3DHJA 4JRXB 5A7EA 5C1MB 1MEXH 4JK0D 4JKPL 4OGXH 5I6KA 3EBIA 2FJFA 3DIFA 4E42B 3OSKA 4YNYB 1UOVA 4H8WC 4NQXA 1TOXA 2KZBA 2CBQA 2XHNA 3L9YA 1N0XL 4ZQKB 1CFQA 1FL6B 2NYYD 3VTTA 3UAFA 4P2QE 4HKXA 1MH5B 5JXEA 2EIKB 1T7ZA 1FORH 1P5VB 1KIQA 4U2YA 5C09A 2WANA 1TXKA 2AK4A 2ED9A 4L4JA 4LCUB 4GY4A 4XNXH 3RX8A 2HKAA 3OM3B 5DJAA 5E95B 2O6EA 4BD4A 5GQBA 2V5MA 4NM4H 3QFDB 2F8OA 1MLBA 3LRGA 4FFZA 1JXDA 4IIQB 2YPVH 2WQ8A 1P69B 5JPMA 2ZUTA 3ZKNC 5JW4Q 3A4DA 3NSCA 3FONA 1FYTA 3LDBB 2PWGA 1UWXK 2H45A 5EPMA 3ARFD 5FEBA 5J4MA 1FFPA 3IPFA 4HK0B 5FUZH 5AOLA 1FBIL 2X7LB 5LGJA 4JUSA 5DR5L 3TU6A 4XC1H 2E3VA 2XNAB 1A7QL 3PHQB 2P5ED 4HALA 3NRQA 3MKKA 2H1PL 4P57B 1N10A 5HHOA 5ICYA 5D2NE 1P4IH 4MS6A 4XZUA 3BAEL 4GEJA 2BS71 2XY2A 4CW1A 4QTIL 5BRZD 3RWIA 1SOXA 4F8OA 1QRNE 1FFTB 4FI8A 3N43B 4M00A 3LRKA 4TQ8A 1XR8A 4WVRA 4ZW5A 4UANA 2FJSA 2VLLA 2DQTH 5D6CB 3P11H 1S7WA 4L4TB 3MCLH 2EYSB 4K8RH 4MNGA 4OLEA 4PY8J 1L7TL 1U3ZA 4M9OA 5IB5A 4ZO6A 1GJWA 3E7JA 4UT7L 2GPZA 2FK9A 2VO5A 3J27A 1AZNA 1IQDA 3T4AC 4N8VA 5CO1A 4CDGC 1H6EA 3NMEA 1DBBL 2FEEI 3ESPA 4HUXA 4W9KC 1ETA1 1DBJL 2FJGB 1IC7H 3ULSA 1NBVL 3CN1A 2GFBB 1KJ2L 3QO1A 3WFBH 1JK9A 2R0LH 1PAMA 2M1KA 4RA3A 3GSWA 1WBZB 3VXSD 4WI0B 3QUMH 2V5YA 1AZBA 3GS0A 4O2FB 3CXDL 1SEQL 4UV7H 2Y7NA 3H4HA 3UJTH 4HBCL 3LIZL 2FB4H 3AUVA 3GSNH 1GYWA 3CG8A 4TUJA 1CIUA 4Z5RA 3APNA 1I1AD 3NCBB 3SYAA 4APQA 1BIIA 2AS5M 1YECL 4GW4B 4IRZL 4YXHH 4C4UA 3RY4A 4DPRA 1DFBL 1MCKA 2OQJA 3LXBA 3VG0L 3FT4A 5JPNA 1MNNA 1T2QL 1FNHA 1H5BC 5JNYA 5AAMC 1C12B 5KYNA 1E9OB 4Z7UF 1WWCA 4NPKA 1KJVA 4ENEC 4R4BB 1I4FA 4GUPB 1IEAA 4XAWH 3ALXA 4NRYA 2EILB 3B2XA 1BF8A 3CFQA 2YMXH 4LPWA 3NCFB 4POYA 4AYSA 1B0RA 5J1SC 1MUJA 5L4FA 1C7TA 2X0VA 3DSNA 4ZO8A 2HJFA 1ILSA 2O5YL 4JHBA 3WMQA 2NW2A 4NN5B 3ZIYA 3HNTH 4J8QA 5H4YA 4TQPA 2NXYD 4EUPH 3SCMD 3ZDZE 4HQQH 3S37X 5F7HA 1JS4A 2J25A 1U8CA 4JHWL 4QEGA 2FEJA 4PWGA 4XP5L 2H26A 3Q6FA 5D5MB 3U46A 4I0PC 3GT6A 1NGZA 2XIIA 1ZEAL 3FTZA 4DPAX 4X7FC 4YHMH 4P4KB 3REVA 3AT8A 2VAAB 3ENEA 4AT6B 2EXYD 3S0PA 1TEFA 3JZYA 4MHHI 2VABA 3DPBA 3MV8A 5DJCB 5HDRA 1OCRB 2BOBB 3B7SA 4Q6IA 3ULUE 2H8PA 2Z64C 4WW1B 2EH8L 1FORL 4N5EC 4P5TC 4YLQT 1PDKA 5GGUA 4ELKA 4RWYL 2ZKHH 1SVBA 1YPZB 2G60L 4M6ML 5EOCJ 1ZCRA 3DOSB 2F58H 3WGUB 5H37H 3IM1A 3EJCA 1QSED 4LKCA 5ESVA 4C55A 4I0PA 1MN4A 2OAAA 2P28B 1ET5A 1R3HB 3W57A 4KAQH 4XPBL 4U1HB 3O4OC 5JO5A 2ZKYA 2OI9C 5D1QA 4KH2A 1YPZE 3KVDD 1MFDL 1JGUH 4V1DE 3VFWA 4C57C 1WFUA 1IM3B 4PVBA 3LZLA 3MUJA 5FO7B 4XNQA 5KJ4A 5T8IA 3CPLA 3NTCH 1U3YA 1BFTA 1PG7W 1OAYH 1ICTA 1HFUA 1GHFH 2Y7QA 3LNDA 4XP9L 1SUHA 2OMYA 3CZSA 1MRFL 4KFMA 5D4HA 1ZXQA 4C56E 1T0NA 3GI8H 4NQXB 2K7QA 4BXSV 2NR6D 2YUZA 5EU4B 2WBJD 1G0XA 2BIHA 2XN9E 1EEUA 2HX8A 4Z7QE 1OK8A 3QUZD 5AW0B 5HSFA 4PJFE 5IMOA 4O02H 3VGBA 5I82A 3APDA 3BAJA 1BWMA 1RZ8B 1KTLB 3Q8CA 4Y19D 4P99A 2WUBL 1WS8A 5K1VA 3RIAK 4NAJA 3QWQB 3PYCA 3VVVA 3DGDA 4ZSOB 1ZV9A 3VFSB 2AK4B 1BJ1J 2Z65C 4WEUD 5D4JA 3QG7L 1PU0A 1I7UB 4EUPA 3L1OH 4UM9B 1KBVA 25C8H 4I3GA 1WYJA 1H0DB 4JRXD 3ZR6A 4XMVA 1T22A 5IHHA 3GHEH 4PJCF 4ZFZA 1KG0B 4K3HA 2AXFA 4MNQD 1K6QL 4JKLA 2J4WH 2QSTA 1OGTB 4LESA 1T7WA 1DQLH 3WN5C 1Q0XH 3IFOA 3PWVA 2BLFA 3QXAB 1CDGA 4G43B 4HFUL 4Y9FA 5KSVB 4N0YH 4Z3HA 2FSDA 3MNZA 3MAWA 1F3DH 5DS1A 5IQ9A 4EPSA 1Z9SB 1ZDQA 3NDYE 5TE6H 3O8XB 1A14L 1I1YB 1VFAB 1IAMA 3OL2A 4OGAC 2JCWA 4HETA 4KVCL 1GZHA 3O11A 1QLRB 4QXUL 3ZT7A 2J71A 2PABA 3DV4A 2K6ZA 2R56H 3N0AA 3QP3A 4LMQE 1ANUA 3FUEA 1MF2H 2VQ1A 2PWFA 1JTPA 2BRQA 5T1DL 1E4JA 3JWOC 3T5WA 1V3LA 2OXHA 3CE1A 2D7OA 4TVPD 2F8VA 3GLDA 4XNYH 3RA7L 3LKPA 1KGJA 3VXUD 4CUCA 4BSVA 2Z31C 4QCIB 2BVPB 2SEBA 5B1JC 1I8MB 1AZRA 3I02B 1G7HA 2X28A 5EIVA 4HMEA 4Y1SA 3MACH 1JGLL 4L8SC 3WEOA 4N8PA 4ERSL 2B4CC 1VESA 1BJMA 2FJGA 4FLQA 3QDHA 4ZPTA 1XF2A 1DTUA 3F7YB 3EFOA 2V9UA 3CFBB 1DJWA 2X9WA 3TO2B 2WLMA 4XP5H 3CFEB 5A2KH 2RJMA 2Y5QA 5KANG 1E2WA 1ZLVH 2VXTL 5DJ2B 1S7XB 1U91A 4YK4B 5DS2A 3PL6D 2VJ0A 1UJTA 5IQ7H 5J3HD 1B0GB 3HKZA 4DFIA 1NC2D 1E2VA 3GS7A 2CHZA 1BZQK 2BNRA 5LNDA 2FECL 4XODA 4H20L 3O6FA 5DFVD 4FNRA 2DL2A 3HR5A 3P9WB 2CZNA 4C58B 3GXUB 1V3JA 1R3KB 1UM5L 5DA0B 1I8LA 2OV0A 3L3DB 4KKBD 3T77A 1I4FB 4Z8FH 4HS3B 1RFDH 4Z7WB 1SY6L 1GPOL 2LLNA 3EIFA 2CGZA 4A37A 5IVOA 3D6GA 5E00A 3Q8AA 5D4QA 3S34H 3POHA 4A6YH 1E3FA 3OC5A 3MV7A 2IWEA 3DSNB 2CM6A 4HD9A 4LRNH 3LEVL 4DQOH 4QRFA 2XV3A 3IFPA 4QRPD 5BZDB 2QADB 3WHXA 3ZYJA 1WAAF 1MI5D 4ODHL 4RSVA 4KX8A 1LNUB 2F7RA 4GAAA 2FZ3B 5F1SA 4YX2L 3CX2A 4HWEL 2GSIA 1QRNA 2Y06L 6FABH 1AD0A 3KPRD 3Q6FB 4PJ9B 5D5MA 3C5ZB 4FI7A 1XMEB 1EEZA 1OTTC 4BEIA 2CPCA 5JPMC 5FOBA 2OZ4H 5L9DH 5EDXA 2E46A 5KVEL 2Z0UA 4X6DF 4AH2B 1Q9OB 4P2RE 1QTPA 2R1YA 4BA0A 4APXA 4Z77B 2TRYA 3D5OF 1CJYA 1KB5A 3N0PB 1W8OA 4JFEB 4LLYA 4M7KL 4CVUA 5I1DB 5GGVY 5AAWC 3NJGA 3VM5A 1VPOH 2P8LA 4X50A 4JKKA 5CN3A 1DP0A 3S5LA 3I6GB 1QRKA 2HFFB 1F90H 4UT6H 3BLBA 5TF1L 1BXVA 5EBWA 3VFVB 1PW3A 3QDJB 2EDBA 4CMMA 2DQJL 25C8L 4QXVA 3RUGF 4BQ9A 1OSYA 1RI8A 3MCG1 4NO3B 4XNUH 5L8JB 2HRHA 1X5HA 2DQHH 2E4TA 3T4AB 2R27A 2EUZA 3FDWA 3SO5A 5D1QB 2YIHA 4Z9KB 3MZGB 5LAXA 3ARRA 2VLJE 4P07A 2DM2A 4KXZH 4LVHC 4D9RE 3GXIA 3VD9A 1UT9A 1TVBB 4BZ2A 3S3BB 2QEJA 1JAEA 1JE6A 2JXMB 3GIVB 1WZAA 2D2CC 3QDJE 4KRPC 4NO0D 4V1DA 1ZS8B 3DUSB 4XNMA 4IK7A 1JCKA 1QSVA 4WUKL 1TVDA 2UUDK 3ARDA 4U1MA 1M9SA 3P9LA 4O58L 3WL9A 4JPWH 5DJZB 2AJXH 5GS0C 3TH3T 1A7RH 2Z8WC 5FYJH 4EJ1C 5K9QI 4B53A 3INUH 5CCJA 3AY4C 1KCSH 3RTQB 1PFCA 3SKMB 1RK0A 4J3WA 2I85A 4ZMTA 4JKNA 1FFOA 4R4NC 4Y2DA 4PVNA 4APQD 5T3XD 4XCEA 1CLVA 4EI5B 1ZGLP 4GSDH 1RZ8A 4R4FL 4HF5H 2CXGA 4XT1C 2PP7A 1BQHA 1YQVL 3CIQA 3HZKB 3OX8A 4LOVA 4ZD3L 1JV5A 1BAFH 1MHEA 4UM9A 5AYUL 4U1LA 2Q9OA 2R1WB 5F88B 4GAGL 3V52H 5F6HI 2CJSA 4OLUH 5D7JC 1WC7B 3QULB 5F3HA 3EFDH 1XZWA 1PLCA 3MACL 1E7UA 4MA3A 1RVFH 2ORBH 3GXDA 5SWZA 3TF4A 1A3RH 2FH8A 3D50A 4PWIA 2Z31D 1A22B 1USZA 4H26A 3L3OC 4M7LH 3QEUA 2Q6WA 4G43A 3JBG7 2X4PB 4E41B 1A1NB 2IBZX 2ALAA 1DQQA 2ZOKB 3GK8H 3LMJH 1E0OB 5MI0C 1QSFD 5C0NC 1FAIL 2GUOB 2H3XC 3B5HA 3BIKA 5C08A 3BVNB 5FYKL 2FATL 1JK8A 1AXTL 1BWWA 2W0KA 4WIQA 1KTDA 3SKNB 1OCZB 1SOSA 1J48A 3DV4B 2PO6C 5GRXG 1JV2B 4K7PX 1XIWC 4LP8A 1GMEA 5DJDB 2BWIA 5DTFA 1VACA 2DMGA 3FPYA 3D9AH 1R6VA 2MHAB 3O3EB 2BVPA 3KYKH 1Z3RA 2XPYA 4LVEA 2VDLL 4PRPA 4XAKD 3T1FB 1NGYB 1RIHH 2MMXA 3ULUC 1O9WA 2ZUQB 4JY6A 2H4EA 2LGNA 2RA1A 3BFQG 1WCBA 1B4TA 5DJ8B 2NY6D 2HH0L 1EHLL 5IESL 1BD2A 2WSPA 4G1EA 3RY5A 2VR5A 1IM9A 3DUUB 4KTGA 1XF2B 2B15A 3IJ8A 3R7RA 4AITA 1EERB 1EJFA 1TVHA 4NFBA 3PIQB 3CZEA 3FO0H 1GTFA 1YEJL 5JQIB 2Z7UA 3VGGA 4JN2B 1JPSL 2NUTB 3QQ9D 5EZJB 1J8HA 3VM7A 4DZBB 4BH8A 5E2TH 1TPXB 4FGMA 1KB9J 3E6FB 4TYUA 2BSBA 3MRKB 1RZPA 4Y2NA 4NUJA 1N8OE 4NENA 2E6QA 1BV8A 2ADGA 3PWNA 3DX0A 5CGBA 1BG1A 1Q9KB 4AQ8C 2FGWH 5BOJA 2QQQA 5AVVB 3WTWA 2E76C 1YSOA 2HPOA 4I4WA 4IU2B 4TNFA 4DP2X 1AR1D 2G2RA 4ZZFA 1LEKA 3GB7A 3PF2A 1TQUA 4FTVD 4FQLL 4W68A 4MX7B 1S3KH 3W11D 2BPBA 3WUWB 3AM8A 4K23H 2V4LA 1AR2A 1B3IA 2MQ3A 5KS9A 2HG5A 1I3GH 1P4LA 4R2GD 2Y2TA 3KBPA 1CICA 3WAKA 1S6NA 1NGWA 4H1LG 5DFTA 1G9HA 3PHOA 4IOFD 2FO4A 2Y6TE 4WTXA 2ZNXA 4EN2A 3MFGB 4HXAL 1AD0B 4O58H 5I1JH 5TDOA 1M6UA 1HSAB 3SE9L 3TJHD 4JB9H 5E0FA 3THMH 4I48A 4X7CC 2GQHA 4OLVL 1XR9B 2C9UA 2Q76B 1G5AA 1ZLUH 2R4RH 1MCPL 1CB4A 4POZD 3C9NB 2MEJB 3OJDB 2OYPA 3STZB 4GMSL 1JWSA 3N43F 3O45B 4M7LT 1BGXL 4GRWB 2VDQB 4LOEA 3HA0A 3G6DH 4QNPF 5KSAA 4OGYH 4X7SH 4FTDA 3FOMB 3SE8H 3MRFA 1ZHLA 2K6YA 1UKTA 3HI5H 2WKOA 3R0NA 2AEPL 1AKJB 4YSTA 1HJBC 1U8PB 5KAQF 2Z34A 2OMNA 1KPRA 1WD9A 3ASWA 3RNKA 1P7QA 3X3FH 2QGEA 4NM4L 3V52L 3OKOA 2JVUA 1M71A 1ZVNA 4DW2L 5IW6B 5HDBF 2GJ6B 1CG9B 3LN4B 1NC2B 4QTHA 5DZ9A 5EOCH 5G55A 1A02N 3DVIA 1C5BL 3RHWK 1JZ4A 2EDFA 2OJEB 2DAVA 4C83A 4HC1H 2HYMA 1HEJC 3LNEA 4JDTL 4XHJD 4X6BB 1X3DA 3VFMB 4X6DA 3STLA 5AOMA 3K2UH 2HTKC 3PU7A 2A0LC 3NIDB 4G80B 1XAKA 4QRRD 4R5TA 3ZZLA 1DVXA 4BJLA 4NRZA 4R2GB 5DR5H 1U8KA 5ETUA 2Y3AA 3EJUA 4AL8C 5B1AB 4FEMA 4HZLB 2EXSA 3RPBA 3EGSB 1U8MB 3QBTB 1B9KA 1P5UA 3TWCH 3ZDZB 4MZRA 5ENWA 1MNUH 3MR9B 4A7QA 3FULA 1U8NA 1JZ5A 4KK5D 3F7RA 1OPGH 2H2PD 3UJIL 3SSGA 1F0LA 3MLUL 2JWYA 3C5ZC 3HG2A 4PY7B 1PAZA 2B1AH 3VXSB 3QO0B 3HZKA 1J5HA 3S3JA 2YAHA 3FF8A 1HAWA 2DYSB 4H5SB 1DBMH 1AI1L 5JDSB 1CUOA 1XH2A 2E9IA 5K5YA 2QADC 5CZXC 2WWMD 3ECVA 1I7TA 3TBVB 5C08D 2ICWB 2DKMA 4J3TA 4RFNB 1YEFL 1P4BL 3RZCB 4D94A 3PDOA 4UZGA 2HFEB 3BPOB 3BGAA 2HRLA 1W6LA 5EEXA 1G6RB 1ACCA 2EDRA 3QEUB 4WGKA 4ZK8A 2UY7A 3TFKC 4YDIH 3GSQA 2C1OA 4X0KB 1PY9A 1SXNA 1SEQH 2YAFA 4OKVA 5EUKA 5IVNA 4JM2C 4YDLB 9CGTA 3MA7B 5DMYA 4DCQA 2BOCA 3AXHA 3GMNA 4XVJH 5DHDA 3U6XS 3SCMA 1ULVA 3QIBC 4ALAH 1HIML 1INQB 1MQ8A 4I1RA 1UENA 3D85A 3S3CB 1WH0A 4XNBA 4EO5A 3FO2A 2VZOA 5DO2D 1E65A 1Z3GL 3AS1A 5DTFB 1F3JA 2O6CA 4M8VA 1JOIA 1Q0YL 2UVFA 4U1JA 4HWBL 1FH5H 2MHAA 3O3EA 4ODTL 5D2LF 4Y16A 2JJVA 3VI3B 3WNLA 4WI9A 4S1DC 5D72L 1FNSH 3E8UL 2DWEA 3ZN6A 3RTLA 3UG3A 5ADOH 3H8NA 1UXWB 2NNRA 3KH3A 4NQCD 4ALAC 3IDYB 4JL2A 1I1AA 2MWCA 3LB6C 1WEJL 3IFNH 1HOCA 4PIRF 2W0FB 2G75B 4XMZA 5T3ZD 4HFWB 4UIKL 3VW3L 2OTUB 3P2TA 3QRGL 1YN6A 4P5KA 4J23A 4QHNB 1OAYL 4HIHA 2B9AA 1M6OB 2CU9A 4F2FA 4ENZA