4KNSA

Reduced crystal structure of the nitrosomonas europaea copper nitrite reductase at ph 6.5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
285
structure length
285
Chain Sequence
KTVQVTLHAVETDVAYDNKGSTYRAWTFDGKVPGPVVRVTEGDTVEFTLINDKNSKNSHSMDFHAARLDVVEDFESIKPGETKKYTFTADNPGVFFYHCGSDPMIQHIARGMYGVIIVDPKDANALPKADREYVLIQAEHYENPDDKTAMMQNKWSNVVFNGGVFKYDPVHDSEATSWLQAKPGERVRIYFVNAGPNELSSLHPIAGIWDRVYPSGNPKNVQYALQSYLIGAGDAATLDLISPVEGANAIVDHSMRHAHSGAIAVIMFTNDADPEAGRGENILIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multicopper oxidase type 1
publication title Characterization of a nitrite reductase involved in nitrifier denitrification.
pubmed doi rcsb
source organism Nitrosomonas europaea
molecule tags Oxidoreductase
total genus 88
structure length 285
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4knsA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4knsA01
5I6LA 2JKWA 3TBCA 2YAHA 5B1JC 4Q89A 3IN2A 4UF7C 4YVNA 4HCIA 3GXUB 1GS7A 1AG0A 2ZONA 3NJKA 3V9CA 1URIA 1GY2A 1MG3C 3CZUB 1RKRA 1AS7A 3FQ2A 2FQGA 5I5MA 2OCCB 3T71A 1NINA 1FA4A 5I5IA 4WKXA 2BP8B 5E9NA 1SFDA 4YSQA 3FYIB 4YSUA 2XWZA 4P5SA 3NJJA 2HRGA 1JZHA 2X88A 2HLEB 3AG4B 3PLYA 2TSAA 4BWUA 1OE3A 2B3IA 3OMAB 2XX1A 1ET7A 1JXDA 3QPKA 3S3BB 3ABLB 1AACA 1WA1X 2B08A 5I5JA 1HFUA 4GXFA 8PAZA 3TU6A 2EINB 4PAZA 3SBQA 2IDQA 3WI9A 2R7EB 1BYPA 2CJ3A 1MZYA 4TXVB 3RYMA 1A4AA 1ZV2A 3GDCA 1UATA 3UAEA 1OCCB 2XVBA 1MG2C 2UXTA 2YQBA 3ABKB 1AZRA 4YSSA 2UX7A 5PAZA 4MFHA 2VM3A 2PLTA 1KCWA 2XU9A 2CAKA 3ASOB 1A3ZA 2E86A 3T9WA 4F2FA 4GP4B 4PCYA 1WS7A 2CBPA 3AG3B 3TA4D 2WSDA 5I6NA 1E67A 4YSPA 3QJQB 1AANA 1KBVA 1ET5A 1YLBB 2GHZA 3FU8A 2IWFA 3C75A 1AQ8A 1ASQA 1ET8A 2OJ1A 2QPDB 1W6WA 1E5ZA 3FQYA 3UABA 2GBAA 1KV7A 1ILSA 1ZIAA 2UXVA 3EH3B 3PPSA 4UAHA 5D4IA 4BDVB 1PY0A 1BQ5A 3MX0B 4E9RA 3S3CB 4HCFA 3FSZA 1CYXA 4YL4A 3PCYA 4WTQA 1R1CA 1J9SA 1ILUA 2H47C 1ZIBA 2GC4C 3WKQA 1NZRA 1M9WA 1KBWA 4G71B 2YAEA 1ZDQA 4G7QB 2HZHA 3FQ1A 2BP8A 4E9WA 1XMEB 3HB3B 1OV8A 3FYEB 3GYRA 2XXGA 3PAUA 1OE2A 1XB6A 2XX0A 1NPJA 1L9TA 2DYSB 3AZUA 2GI0A 1JVLA 1NIBA 4JKNA 4YSCA 3WNIA 2PCYA 1N68A 1A4BA 1BQRA 2QDVA 1E30A 1V54B 2H5UA 1BEXA 3UACA 3DTUB 2PPCA 4A2EA 2YAOA 1GR7A 1VLXA 1E65A 3H4FA 1PLAA 2PPDA 4G7RB 2HX9A 2MTAA 1WA0X 1JVOA 2HX8A 3TBBA 1TU2A 2DV6A 2VM4A 1AG6A 2CCWA 4QKTA 4A66A 4NB7A 1PF3A 3CG8A 3SQRA 2BZCA 1SF3A 2CUAA 4KNUA 4NAJA 2BZ7A 1PNDA 5LDUA 5B3SB 1GW0A 1F56A 1WAEA 5EHFA 1W6LA 1NTDA 2DWSA 2GIMA 4CSZA 4F2EA 4JHVA 3KW8A 3ZDWA 3FSWA 1OE1A 2YXVA 1AIZA 1JERA 5A7EA 3NT0A 4DP7X 1JZFA 3X1GA 1PZCA 2FQDA 1NIAA 2IWKA 4E9SA 4HALA 2HXAA 4DP9X 1KDJA 3AW5A 4DPBX 1PNCA 1ZDSA 3CDZB 1NPNA 3X1EA 2GB2A 1XB3A 2QT6A 3H56A 1E5YA 4Q8BA 2UXGA 2TSBA 4YVUA 1JXFA 2EIMB 4BDVA 3FSVA 5B7MA 2W88A 1IBYA 2P80D 2I7SA 4DP2X 1MZZA 1M56B 2RACA 3FU9A 3IBOA 1PCSA 3FU7B 5I26A 5TK2A 3AY2A 4HCGA 1PZAA 2I7OA 3OM3B 4YSOA 3X2QB 2Y69B 3T6XA 2VW4A 1TEFA 4E9TA 3X1NA 4E9YA 4HIPA 1A4CA 2GSMB 4RH4A 5B1AB 4AX3A 2X87A 5IY5B 3NJLA 1W8EA 3PAVA 4A67A 3ZBMA 1PMYA 1BXVA 4A2HA 3FSAA 2FNWA 1A65A 1RZQA 2FQEA 4A2FA 1JZEA 4N4YB 1KCBA 1OCRB 3S8GB 3IE9A 2HX7A 1IUZA 4HHWA 1RZPA 3EF4A 1BQKA 2XV2A 1GS6X 2BW5A 2XLLA 1ASPA 1V55B 3H4HA 2J55A 3HEIB 3T6VA 3ERXA 5B7EA 1JZGA 1L9OA 3PXLA 1IBZA 3NJGA 1QNIA 1NWOA 4YSAA 3CVCA 3QJRB 1MDAA 2J56A 2PCFA 4AZUA 3ABMB 3NJIA 3QJVB 4NERA 1BYOA 1J5DA 1L9QA 4A2GA 1AOZA 3OMNB 2AZUA 1M57B 1FFTB 1SF5A 3FS9A 4GP5B 2IH9A 2LLNA 5I6PA 3AG1B 3NP4A 4HZ1A 2ZWNA 5AZUA 1L9RA 5I6KA 2XV3A 3CDZA 2DY2A 2N0MA 1NIFA 4KO7A 4E9VA 3L45A 1KYAA 7PCYA 4UANA 3EHBB 4DPCX 5FC9A 5F7BA 1OF0A 4HAKA 5I6OA 2DWTA 2FT8A 3JT2A 4A68A 1PAZA 1QLEB 4DP5X 1BXUA 1PZBA 3CVBA 3OMIB 4G70B 4W9ZA 2ZOOA 4DP8X 1X9UA 2ZXWB 2R7EA 4G72B 3ZIYA 2BO0A 1IKOP 3N55A 4E9QA 4QLWA 1WA2X 2OV0A 4DP6X 3S3DB 1SHXA 1SDDB 1EHKB 3WIAA 1J9QA 5B7FA 2NRDA 4HHGA 1ID2A 2YARA 1AZNA 5D4JA 4CSPA 4BK5C 1L9PA 3ABGA 3SBPA 1KDIA 6PAZA 2IH8A 2BHFA 2FQFA 2AANA 1A8ZA 1WS8A 3QJUB 2PPEA 2VW7A 1OCOB 3V9EA 2P80A 4GY4A 1SHWA 1TEGA 2IAAC 1TKWA 3N2JA 3NSDA 1NDTA 4X4KA 2Q5BA 3KW7A 4AKOA 4L0PB 4YSRA 4YSTA 2VW6A 2YAQA 3X1FA 1AZBA 4KOBA 4BWWA 3UADA 3UGEA 1NIEA 3WKPA 3QJTB 2Y1AA 3IN0A 3QJSB 2XUWA 3BVDB 2FT6A 1SJMA 2PP8A 1CYWA 2QDWA 1AZCA 4DP0X 1N70A 3FT0A 4G7SB 2FT7A 4GP8B 3PAZA 1HAWA 1L9SA 4AI7A 2GC7C 2YXWA 2BWIA 2BP0B 3ZX1A 7PAZA 2FTAA 1CC3A 9PCYA 1ETJA 5F7AA 4KOCA 4K9JA 1AR1B 3UAAA 2YAPA 4ENZA 3T6WA 4F7KA 2BW4A 1V10A 4M4RB 3NSCA 5AKRA 4JHUA 3D12B 1GS8A 2J57A 1GY1A 4AKPA 2I85A 2JXMA 3FPYA 1OOWA 4P5RA 3NJMA 3CVDA 3FPXA 1GYCA 3OQRA 2VMJA 4A2DA 5TK4A 2VSMB 1NWPA 3JTBA 2IDFA 2JFCA 2AVFA 1JXGA 1J5CA 1QHQA 1AAJA 3DIVA 4AKQA 1T5KA 2XYBA 4BXVA 3AG2B 2IDTA 1JOIA 3NJNA 1AZUA 3OD3A 1SDDA 1FWXA 4GYBA 3BQVA 2EILB 2PP7A 3DKHA 3NSYA 5D4HA 2Q9OA 1X9RA 2AZAA 5B1JA 5PCYA 2CALA 2IDUA 1BAWA 2H3XC 2AFNA 4KNSA 2UX6A 5ANHA 2EIKB 3SBRA 5I28A 1XB8A 1J9RA 3NJFA 1SFHA 2WO3B 1PLCA 5AFAA 1AS8A 1NIDA 2UXFA 2WO2B 2FWLB 3WNJA 1GSKA 4YSDA 1HAUA 1KGYE 2HRHA 1JZIA 1IC0A 3EH5B 1CURA 3T6ZA 2XXFA 3NYKA 3EH4B 4BXSV 1RCYA 6PCYA 2A3TA 4DP4X 1PLBA 3QQXA 1J9TA 3TASA 4M3HA 1SNRA 4KNTA 2EIJB 3G5WA 2W8CA 2VN3A 2BP0A 3NSFA 2QPEB 3FU7A 5I6MA 4EF3A 2IDSA 2YAMA 4DPAX 3WG7B 2MRYA 5B1BB 1EZLA 2J5WA 1DYZA 1ASOA 4FA7B 1ZPUA 3IEAA 3X1BA 1AS6A 1BXAA 2IWEA 4KO5A 4ZK8A 3S8FB 1JZJA 2VSKB 2YAFA 4N8UA 1DZ0A 2FJSA 3ASNB 2PPFA 4KO9A 1NICA 2BWDA 2PP9A 3NP3A 2DYRB 1OCZB 1B3IA 4YSEA 1CUOA 5B1KA 2XV0A 4W1TA 4DP1X 4BWTA 1I53A 4KO6A 4E9XA 3U25A 1ADWA 2PPAA 3MBWB 4FAAB 3NJHA
chains in the Genus database with same CATH superfamily
3TFBA 2R2CA 1WGVA 4HXBL 3TYFB 4PJBF 3M1BB 4JPKL 5AVRB 3K74B 5GS0D 4RVBA 1A4KB 2H0EA 1PFCA 2AQPA 1FYTA 1I8KA 4KK6D 1BZQK 1KLGA 2DJSA 4HCIA 1I4FA 1CDIA 5KVDE 4WWKB 3K5RA 1G5GA 4TM9A 2DLIA 5GS3A 3P2BA 1SGKA 2BIQA 4G3YL 4CW1B 1QSFE 4XNDA 1FC2D 3ZTDC 4ZFFA 4M7KH 5CJOH 3SDXE 4XPTL 1F0LA 4Z7QB 4YAQA 2NNXA 3IMRA 3QUZA 5HYQB 2PXYC 4X7DC 3EGXA 3DJTA 2E56A 1PIFA 3MJ7B 1CLZL 1SMOA 1F90H 4JRXE 4PJBB 1IBDA 1IC7L 5E2TL 3NVQA 3DGGB 5EBWA 3N85L 5ID0B 3P2TA 2XZAL 1DVFB 5DHYB 3EJCA 3BEVB 3HZKA 2OMTB 5I71B 3EJRA 4B41A 3N1MC 3SDAA 2E8YA 3LNGA 2IXQB 3AMLA 2XNAB 5KBNC 3FQXB 1A0QL 3RVWC 4EQ3A 2G75A 3IE4A 2P5WD 3E38A 4RWYH 3HC4L 1UENA 3FFCE 1NCBH 4RMQA 5ACLA 1MCJA 5IBTL 3RYMA 5IW6A 3ULUF 4NHUA 4CBZA 2BIOA 1QR1A 2R1WA 2LHAA 3LRHA 1A7RL 1J11A 5F7EL 3CVHA 1U6AL 4Z95L 3DYMA 5D1XE 2X0UA 2R0ZH 3S36X 2IPUG 1CG9A 1ETB1 3C60B 3TF7C 4ATTA 4N9GA 1O7DC 2YO3A 4OD3L 4JFQB 4N8VA 2BSCA 2JKLA 5B3JE 4U6VH 2R2EA 3D1MC 3DVNB 1AHWB 1JCKA 5DRXB 4HH9B 5FUCC 4FYSA 2J71A 2WVVB 4GKSA 5CJQL 5EN3A 3J8F7 4WEUD 1QBBA 4IQHA 1HYSC 3L1OL 2WSPA 1ET5A 1O0VA 2GHZA 2XQBH 2CUIA 5E2VH 1J1XH 5T1KD 4EDWH 1AGDA 5IW1A 4XBEL 3FB6A 1ACZA 3CXDH 1MREH 5DZVA 2X4UA 2QPDB 4PJ7E 4N2GA 1BSIA 4ZTOL 2EH7L 1VGEL 5JIKA 1ILSA 2BSSB 3SY6A 3BVNB 4PW3A 1P4UA 1T21B 3GSVB 4BDVB 1AQDB 1LD9B 1S7WA 4QAMB 1OLLA 2YPVL 1U8LB 4NM8L 4HCFA 5ERWB 4GLRH 3I6GB 4OLWH 5TFSL 5LJYH 1YMHB 2DQHL 2Z6FA 4WKZB 3L4CA 3ARFB 1Q1PA 4OY9A 4WTQA 5C86A 4OZIA 4NUGL 3V4UL 3VFGH 1OTUC 1TZ8A 4DO5A 4DPRA 3H7BA 3R4DA 4MA7L 5TF0A 1KPVA 4YIQA 1UACH 2WXKA 3BEWA 2BX5A 3GYRA 2A9DA 3IGAA 4RNRA 3U0TB 2VABA 3GO1L 4P2OA 3HE7C 2P8LA 5GRXG 4LSTH 4QXVA 1YN6B 1IZJA 1WGOA 2VDPB 3F84A 3ROOA 1I7TA 5ETUA 3L2LA 4XCFH 1M1XA 4ZW5A 4WV1B 5SWSE 3NSJA 3U36B 2FZ3B 2VXSL 3DROB 1M7IA 3I6LD 4AG4H 3QORC 4OB5L 3L17A 2NR6D 4AUUA 2JKRM 4EKXA 4NUMA 2WQWA 4XP4L 3EFOB 3AS0A 2UZIL 3NZUA 1AHKA 4NAJA 2BZ7A 4F2ME 2JTDA 5JTWA 1PNDA 5B3SB 1SQ2N 3QQ9C 4WEMB 2E6PA 5DJAB 1MIEH 3HNTH 4NZTL 1BVLA 1T66C 2DWSA 4PUBH 4TNEA 4B0MM 4F57L 4U3HA 1NL0L 3ZDWA 2D3JA 2OPCA 1X5AA 4J6RH 5HI4D 1XH0A 3V5HB 1UXMA 1TCRA 2VISB 2VO8A 4AVKA 4ZFOL 1NCAL 1EGJA 2J2ZB 1QUPA 4WTZA 4CDGC 3QCTH 2RQEA 4LOUD 3X3FL 1WFNA 4TULL 3QEQA 3VFNB 5E08H 1DFXA 5L4IA 4QJ3B 5G4NA 2NW2A 5IB3B 4L29B 1IGML 1IKNA 1EO8H 4FFVC 4XMTA 3WD5L 4GQPH 1BD2A 3GMQB 2HJLB 2GIXA 2YKLL 3IBOA 4JPKH 3WEAA 4JVWA 4YSOA 3RNQA 3UCRA 3VU1A 3LXUX 3IVKA 3FHEA 4R96A 3ME0A 2L3BA 1BHGA 3FDWA 4G3YH 4E2OA 4JZNA 3ECBA 3B9KB 4NKDA 2GSMB 3MRFA 1PEZA 1RZFH 2JCCF 3FONB 3QP3A 5L2JA 2MMXA 4XPTH 4WI0A 4MB1A 2HYMA 3IGFA 5EV7A 1RK0A 2ZNXA 5D72H 4Z0XA 4AEFA 5IT2L 1RZKL 3PP4L 2ORBL 3GSNB 1AGCB 5HGDA 3UTPD 1PG7W 5JNYB 4Z7WF 1CLZH 1ZHLA 4MMXC 3U6RB 2CKBB 2YGOA 1HHJB 1IC7H 5E2TH 1IUZA 5HD8C 3I75B 5ABZA 1LO2L 1OWWA 2V2WA 3N85H 2D73A 3SJVA 2XZAH 5AYUL 1K4DA 4KKZA 5A2LH 3KM2A 4W68A 3NCFB 2VB5A 4C56B 3OKEA 4GRLC 4ZFZB 4K07A 4BFNA 1XR8B 2JCCB 2EDQA 1N0XL 4YHYB 4LDLB 1A0QH 3CZKA 2CHZA 3T0AA 4PU2A 3HC4H 4FI6A 2P5WE 3V5KA 5I16B 1DN2A 4Z7WB 4V2CB 4N0FA 1T7ZA 2J56A 4AM0Q 2WLHA 1HWWA 4FD0A 5F7EH 4ZX5A 4WK4B 3RURA 4OFYA 4FG0A 1H0DA 1FFTB 2NSXA 1ZHBB 4KPHL 1RPQA 4AXWA 2IGFL 4PEEA 3FB7A 4ZTEA 4NNXA 3VXQB 1KIRA 1OOAA 5EF2A 1VFUA 4N2CA 5BS0D 5CJQH 1MCWW 4RFOL 4MA1C 1KTDA 1GZPB 2GTQA 3L1OH 2CR6A 2KZWA 4XBEH 1L5GA 2EYTA 3EOTL 3GI8H 4CN6A 4A1RA 1S7UA 5EWIL 5I6OA 4J6IA 3MGAA 1MN4A 4ZTOH 3ET9F 2EH7H 5EO9B 2ZOOA 3LPOA 2Z31B 3UTSD 3FOLA 3LZOA 3R7RA 2Z35A 2YPVH 3L9RB 1KYOK 4NM8H 4W6WB 2ZKHL 2JB5L 5D5MA 4PR5B 4MXQC 3CZGA 5TFSH 1Z9MA 2DQHH 1TJGL 2VR8A 4LGRB 2IADB 1KJ3L 2OTWB 3DX6B 5JLZA 1SXBA 4NUGH 3V4UH 3CBJB 5E4EB 1AZNA 5D4JA 4TSCL 5DEGB 3UEQA 4JAMA 1HHIB 4BK5C 4C55A 4MA7H 1S9XA 2X6VA 1N7ML 4XVUD 4ODHL 4JM4L 3DPDA 4YL9A 3RWIB 1LTXA 3RRQA 1S7TA 1FO0B 5FB8B 3OKNA 4TLKA 1QUNB 2GCYA 4CGUB 3GO1H 1WO2A 4QHMB 3U9WA 4OZHF 3UG5A 4EAEA 5FWQA 1BM3H 4EI6A 4CKQA 3GBML 3IDMA 4F8OA 3EXJA 2AHIA 4C8XA 3UGEA 1NIEA 1PQZB 1OPGH 1OZTG 3RFZB 3QZBA 1CQKA 4AEEA 1AO7A 5AD0B 1RZJL 4Y4KB 3I6LE 2F74A 4OB5H 1XBRA 1UHVA 3E8UL 3IDUA 2I69A 2V9QA 4N0CC 2FR4A 1M2OA 3K6IA 2ED8A 3ESPA 4R7NB 1K8DB 2BWIA 4N9OB 4XP4H 5E2WL 5HSFA 4Y4HC 4K9EL 1LEKA 2UZIH 1MH5A 3WXWL 3TONA 2R0LH 4QRTB 4WFFD 3MR9B 1SVZA 5DRWB 4F37K 4TLSA 5BV7B 1FYTD 3UAJA 3MBEB 4ORGB 3B7UX 2W0FA 4KGLA 1MIMH 4NZTH 1KIUB 4E41A 2ZX9A 4F57H 3HMXL 2DI7A 1NL0H 2Y24A 3JYCA 3TV8A 4M4RB 3QHZL 1M9SA 2C3HA 1PAMA 3SPJA 3O2VL 3G9VA 1JGEB 2WN2A 3PF2A 1KCUL 4NKOA 4LEOA 4DN3H 5EC1B 3C12A 1NCAH 2FBJL 4WFHD 1FFOA 3T4AA 2FX7L 1OT1A 2MOVA 2JQZA 4NQQA 3X3FH 4UT6H 3IK2A 4HS8L 4FKKA 3FOMB 5GHWL 3C2AL 4L5FL 1BIIB 2CG9X 2CRMA 1JUFA 3MO1A 5CBAA 4HS3B 2DI8A 1CL7I 2FVNA 1R5IB 5ALBL 3QZOA 3EAKA 3CVIH 3RGVA 2G9HA 2IDTA 3WD5H 3T2NH 1I7UA 3SDAD 1BYNA 5FKPB 4MAYB 4P46B 3OGCA 5HDBE 5GRUL 4Z1PA 1LEGB 1DEEA 5CJBA 2O6EA 3ZVVA 1NFDB 1QYGH 1DQQB 2ICES 4ONHA 3IJ7A 5ITFB 2ZUYA 4JFDA 4M61A 3O11A 1XZ0B 1OAKH 3HUJF 2OMUB 1T3FB 3K46A 5GSVA 4N6RB 2Y5EA 3U1PA 1EEYB 1SFHA 4HISA 1WP6A 2QKIB 5J8OA 2VQ1B 1Y6MR 5F9WB 1F5WA 3JZ7A 1RZKH 3L3IA 3PP4H 2F6AA 4I1RA 3T8XA 3TNMB 1MUJA 1HOCB 3VXSB 4X5XB 3UTPE 2ZF8A 3L7FB 4Z7IA 2ZUQC 4BFGA 5IB1B 3DRTB 4FLRA 5FFLA 3O0RL 2OMNA 5L2KB 2X3BA 4X8GA 4TPRH 5CAYB 3TJEL 3B2DC 5D70L 3LXCA 3CHQA 1FFNA 2IANB 5DURB 3HB3C 3K72A 4WSJA 3MOAL 2PYEA 4UQ3A 4GT0A 2VN3A 4RDBA 1N0XH 5C09B 2P46B 1FNLA 3HE6A 1HQ4A 1G1YA 2EICA 2I9LB 3K6SA 4ELKB 3V95A 3IJHB 1CGUA 1ZA6B 1U21A 3OKDB 4JHAL 1TPXC 4QRPA 2VR6A 3TBTA 4R83A 1WWAX 4PV8A 3U9UB 1FL5B 5DVNA 3RL2A 4N8UA 3HHRB 3MXVH 4HLJA 4NQDA 5C6TL 4LMQI 4IKJA 5EA0L 4F7CA 3ULVF 2IGFH 1DLFL 5INDB 3WOVA 1O6SA 3N44F 1MJJA 4ZUWB 1FDLL 2K6WA 2DLTA 3GTTA 5D7LA 1HU8A 2ITCA 3MAWA 4RBPK 1ADWA 2WIIA 5BS0E 4KUCD 3TNNB 4RFOH 3VTAA 3PWLB 1UOKA 1MAKA 1NBZA 4ABQA 2VDQL 1TF4A 3IFNL 4O2FA 3MRIB 4MJHA 2GBUA 5FCSH 1MRFL 1URIA 3E2HB 3IDNB 1H8SA 1NFAA 3FQTA 3M07A 1CL7H 2H9GA 3UTSE 5C70A 2JB5H 2HT3C 3F6JA 5CP3H 3LYRA 4U6YB 3FU6A 3FT4A 4MA8L 4PLOB 1FPTL 4MQ7A 1QEWB 1OL0A 2OA9A 1P7KB 5GGRA 1S8DB 2XWBB 3HHSA 4GKNA 4JN1L 4PBXA 4TSCH 1VFOA 5DD6A 1EMTH 2B9AA 1KPRB 3KPMB 4GBXB 4U1JA 4KTEL 4ODHH 4XBPA 4BWUA 2AEQL 4B60A 1FVEB 3D05A 1UZ8A 4G82A 3KPRA 1Z6JT 3D48R 2FH6A 8PAZA 1BOGA 5IK3B 3GBMH 4M8VA 1BYPA 2NZIA 4Y5XA 5ICUA 1EXUB 1B4RA 1T83C 3ESVF 3DHPA 4YHZH 2B39A 1DBJH 1G7LA 4PWGA 2FJGB 1H6FA 3FC8A 1OP9A 1RZJH 3WNKA 1UATA 3IDJB 1WBYA 3EGSA 3B5TA 3APCA 4YSSA 5PAZA 4UM9B 1BD2D 3IKKA 1XGZA 4M7LT 4Q56A 5JW4N 3GXMA 2X70A 4K9EH 4I4WB 3HLAB 5JOFB 3SE4C 4O58H 3U6XA 1G7HB 4N1EA 3CFMA 1FYTE 3STZA 2CBPA 3RHWK 5I6NA 3B7TA 1WD8A 3C5ZC 3IRZA 4ZUVA 4JY4A 2EXYD 3HMXH 1CVRA 2W65A 4P2QB 3D4GA 5DJ6B 4ZXBC 4DFHA 4AYMC 4EUPG 2X7LA 4WU5A 3BOVA 4BFIB 1PKQB 4O2EB 1KCUH 3PGFL 1Z9LA 4LVNC 1YEFL 1DQJA 1MFAL 1HWGB 1UXWB 1TLMA 1QLFA 3VGAC 4WFHE 3EH3B 2PF6A 2ESVB 4Y1AA 2ADGA 4ZJ9A 3L2MA 4LMQE 2IAMB 3D08A 2XG4A 3K2UL 3DIDA 4A7UA 1NGYB 1QSEA 1TZHB 4HS8H 4NQEB 3SJVD 4PJ6A 5GHWH 5IESH 1S78D 3PCYA 4OUUA 4QRSA 2OSYA 3PHQA 3FT2A 5C0FA 4JRYB 3ZYIA 4BEIA 5ALBH 4MYPA 4DUXA 5BMFH 3SGKC 3VGHA 3APNA 5GRUH 3DV6B 2YSTA 4BQ8A 3F7QA 2FEDC 5AOIA 5DJ8B 4KVCH 1PCXA 3G6JF 1I8UA 5D7EA 2VLMD 5BOZG 4PJIF 3FZUD 4EJ1C 2W9DL 1I75A 5FYLH 5GRVK 1KXVA 1AD0B 1F41A 4X7TB 1CDJA 1XF3A 5DK0B 3WUWG 3MV7B 3BZ4A 3LOWA 5L4MA 1DUYA 3MV8A 3QAZB 4Q74A 1B4LA 4LB8A 5I9QB 1PLAA 3H9SB 5CEXA 1OGAD 1U8QB 2OYMA 3QVAA 4LP4A 3VRJB 4XBGA 4Z7NB 4IMLA 3O0RH 4FXGC 4JFEA 2F7RA 4JMXA 3LVEA 3G6JB 4GSQA 4XTRC 5D70H 2VERA 3GMRA 3L48A 3QEUA 5HYJB 4JG9A 5EHFA 3MOAH 4Z8FL 1W6LA 5D7JB 1N8OE 2LE9A 4GB9A 4NO5B 3T3MB 4N2NA 3U7WL 1UB6A 5I76B 4NQXA 1MCHA 3T0ED 1RSFA 5J12B 2HKHL 3D69B 1LYQA 4Q6KA 4PJDF 2Y23A 3SQBA 3X1GA 2E4TA 3NJVA 4JHBA 3T6QC 4OZIE 4ZOEA 4K23L 1W91A 5C6TH 3MI6A 3WSQH 2G2RB 1D9KC 5TE7L 4L0YA 4JO8A 3AXLA 4MS8D 1KXQA 4BFJA 1XGUA 4ZMWA 1FDLH 1EDYA 5E8NA 3FTUA 3IDXL 1TTFA 1T1ZA 1M56B 3P9MA 1NA8A 1CD1A 4Q6YA 4WEBL 3QFGA 2VR9A 2F53B 2VDQH 4H26B 4BM7A 5I8EB 5TE6L 4AGNA 3IFNH 4KVPA 1OP3H 3OPUA 3DO7A 3K8MA 4ZAKC 3PUCA 5BW7C 5DEJA 4GIPD 4XMLL 4KTDL 2V3FA 3ULUL 5HYFA 2X87A 3O3DB 5EFIA 5C0RL 5BZWB 4PN6A 4AIOA 4GG8A 2NNAA 2AV1B 5HY9A 15C8H 5GS2H 1H15A 4KQ3L 4EQ2A 2WGNB 1Z2KA 2AW2A 3F5WA 3UAJD 4AYGA 4GUOA 4PJXF 5AOKA 1MLBB 3BH9A 4PJAB 2XTJD 4KC3B 4UDUA 5CIPH 5FGBC 4KTEH 4TUJA 4M8QA 1KBBA 4E41D 5JW4M 2AEQH 4R2GC 3NCJL 1B0RA 1YQVL 1HE7A 3CFJA 1V55B 3WELA 1UC6A 4UTAL 3CHXA 3ERXA 4CKVX 2NSQA 1A2YA 3KLKA 4WGKA 3UYOD 4RFEA 3ZKXC 4RMVA 4WHYH 1BZEA 4GAGL 1E9PA 1KJVA 2BHYA 3ABMB 4PJXB 2NY4C 1MVYA 1WC7A 3ARDC 2FJUB 2A73B 1JZ2A 1YN7A 1L9QA 1K2DA 2Y1VA 1AXIB 4A2GA 5T3XD 1SXNA 1N67A 1N8ZA 2IF7A 2IFGA 4LAQL 3RGVD 2R59A 4LSUL 3SDCC 1XBDA 5I19H 1BD2E 3JBG7 1UM6L 4R7DB 3O3AA 4J39A 3T8VA 1F3DJ 2X41A 3BQUD 3U46A 4X9BA 3WMPA 2J4WL 2VQUA 4KO7A 5FAAA 3EOAA 1EZUA 4JFDD 3L4XA 3QUMA 1BZ9B 5KUMA 1JWSB 1WFMA 2W9EL 4UIMA 4K3HA 2L0DA 4K3DH 2BVQA 3PGFH 1NCHA 5KSBA 1MFAH 1YECH 3UYPA 1A7NL 3PIQB 4BKLB 2NZ1A 4AQOA 3QARA 3VH8B 1ECZA 2A9AA 3MJ8A 4PJCE 4UQAA 5F2FA 1KGCD 4IU2B 5HI5D 5KS9A 3HAEH 3SJVE 5MEPA 4AQ1C 4XZUA 3QIWB 4EIBA 2V2TA 3KHQA 3NK4A 1OAYL 1VFBA 1R6VA 2DTSA 4QWWD 2NY0C 2OMZB 1N5AA 2PYED 1E28B 4PP2A 5B39A 4MDIB 5FUZL 1E0OB 3F7RA 3VI4E 3H2PA 3QJUB 4G6MH 4FQ2H 4Y5YB 1H5BB 1AH1A 4TVPL 1WEJL 5I1KH 4YQXL 3PPEA 3N2JA 5C97A 2PWEA 4ODBD 1YC8A 5TD4A 2H6PA 4BH8B 5F21B 2VLME 2W9DH 1BZ7A 2GY7B 1O9WA 5DJCB 4PD4J 4UNVA 3D39D 4KU1A 3AREC 3GSQB 4NQDD 5IOPB 2X6CA 2IC2A 3SE9H 1SJEB 3PL6B 1ERNA 1P2CB 2WKOF 3BIKA 2CJTA 1VB9A 4U6XB 4DP0X 2KQMA 3I9AA 5D7LD 3ZE1B 1T7VA 2WLIB 2VL4A 3GHPA 3KDMB 1JN6B 1QD0A 1L9SA 2XI9A 4PTTB 2PNDA 2Z8VC 3K71A 3HHMA 3NIGF 1YDPB 1ND0B 1WWBX 2N7SA 3ZDXB 3MRRB 9PCYA 3AJ7A 4P4KC 4QRRD 4XNQB 2CKBL 4K9JA 1VGKA 4MCZA 5DMYA 1AR1B 4Z8FH 3FCUB 1A6AB 2YAPA 3KLHC 3VMOA 3U7WH 1TTRA 1U95B 2EDOA 3A5VA 3GWJA 2VL5B 2HKHH 3N1FC 3ILQD 4PRDA 3T0EE 1SM3L 1DBKH 3L3OB 4N5EC 2OZ4A 1YUHA 1DBAH 5J3HD 1KTRL 4OJEH 4M02A 2QQKL 2G5RA 2VMJA 5KN5A 2R8SL 3N1QC 2ENQA 4K23H 4JFXA 4W6XB 1TYRA 1F8TL 4AIXA 4PS4H 1NC2A 3SKUD 3KAAA 2WOBA 3ESOA 4YH6A 3SO3B 1C08B 3KPRD 1RZGB 2WQAA 5FGSA 1DJHA 1JOIA 2X1XR 1I1FB 3OD3A 2DBJA 4BV1A 4YZFF 4AJVA 3QA3B 4LVEA 4WEBH 2Q87A 3REVB 4TTGA 3CZFA 2NYYD 2ZJSL 1O5DT 3HTLX 4DTGL 5TE6H 4AGPA 4CNIB 1UJ3C 1T2JA 1U2HA 3V55A 2BOBA 2LAAA 2ZOLA 5K9KB 3LZQA 3WFBH 4WJKB 4KTDH 4XMLH 5ACZB 5F6IC 4BSWB 4Z3HA 3FRPB 3G04A 4BYHA 3WFDL 4H4NA 3A4AA 1IGCL 1AS8A 5KBMA 2XG5B 3MGTB 2CK2A 2WO2B 4KQ3H 1R3KB 2NLJA 2MNUA 2KL6A 3BZ5A 4JQIL 1U8CA 4U1IB 3L81A 2W92A 3SOTA 5C0EB 2XTJE 5GZND 3V0WL 1WSST 4E41E 1OSZA 3NCJH 1YQVH 3GF8A 1WWCA 3WN5B 1FNAA 4KX8A 2XN1A 4UTAH 2N01B 1UXSA 2ZSVA 3PREA 4ANKA 2J43A 4RAVB 4LNRB 1BBJB 4NQVB 3O45A 3MNZB 4Y1AD 1KXTB 2WNWA 1OAQL 3QDJA 5JW5B 1EHLL 1HEZA 4HKJA 3HPLB 3LEXB 2DEXX 4AT6A 5GSRB 2OMXB 3PWJB 4WW2A 5HPMA 4HIIA 5D1QA 5H37G 5BVPL 4LAQH 5T3XE 4ZMTA 3KS0H 4HXAL 4V1DA 5D7HA 2OFQA 1NBYA 1Q90A 1UM6H 3LN4B 3TM6A 3BPOC 5IWLA 1BAFL 1S3RA 2VAAB 2VR3A 4GUPB 1R5WA 2B77A 3GXIA 5EZJA 3X17A 2J4WH 4FN0A 5JYLA 3U2SB 2VDOB 3FF7A 4JFDE 4LZKA 1XF2B 1VF5C 3CDGB 3PAYA 1ZLSH 4RAUA 4X6DB 3KPNA 4YPGA 3WAJA 3T65A 2DOCA 5T1MB 1Z0MA 5F0JB 1LEIA 1CT8A 5KVFE 3MV8D 2J73A 1A7NH 3NJKA 3RTQA 1HNFA 2G3XA 1WF5A 4A7GF 4Y2OA 1JWUB 5AVSB 3AWFA 3CMGA 2DQFA 4RGMC 3QCUH 1KIQA 2EABA 2GY5A 5C07B 1KGCE 4HFUL 1KLFA 5HGBB 1NDGA 3I9IA 1NLBL 3PWPA 1H3PL 5CKAA 1BFOB 3EYVB 2D3LA 3QUKB 1G7QA 2P28B 1LP9F 3KLLA 4AH2A 4KKBC 2PYEE 5FUZH 2NY2C 5FYJL 3GBEA 2NXZD 3CSFA 3MACL 4XCNB 1JL8A 1WEJH 4FXTA 3Q06A 3D3VA 3MRCA 4M7JH 4YQXH 3CCHA 2AXHA 3B34A 2RAMA 1HHHA 4P4RB 4WIQA 2IMMA 3DJRA 4PAZA 3SBQA 3SBWA 1VFAA 2HFTA 5AUMA 1T0PB 2VN7A 3EOBB 2OSLB 3D39E 2R7EB 4HEPA 4NQDE 2RB8A 1EWHA 5DDHB 5L7XL 5IQ9B 3S5LB 4IRJA 2F58L 5IB2B 3WCYA 5CCGE 2FLBT 1WCBA 5IP4A 3DPBA 2HTKC 3HG1B 3TGXA 1LP9B 3UAEA 5EF3A 4ILDA 3SDDA 1MG2C 2YPVA 1HKFA 5D7LE 3RL1A 2MNJB 2Q7NA 3F7VA 4N2FA 2F7PA 2Z92B 3OWRA 5EUOB 4BUHA 2NSMA 5AKVA 4Z78B 3PP3H 5IFHL 4NJ9H 2FGZA 4X6CF 4ZMZA 3MLRL 4JFWA 3FU0A 4JREC 1NH6A 2AJVL 4GG6A 5EEVA 5FEBA 2PW1A 3UJTL 3Q2WA 5J13C 2CIIB 4QRRE 3S88L 1P9MA 1JPGB 1YRKA 3KNBB 4FJYA 1E9OB 1FGNH 4DVBA 4H0GA 3RVUC 4LF3A 2B4CL 3FU8A 3IJYA 4WWOA 4DZBB 2QKSA 2J1YA 5I1EH 3UABA 1CK0L 1KV7A 4IBSA 5C7XL 3VYNA 1DQTA 3S37H 2QQKH 5L9DL 1JIBA 3SCMB 4XO4A 1BQ5A 3MX0B 3PYCA 4X6CB 1KY7A 3T3PE 1MDTA 1I31A 3VSVA 4ELMF 3A21A 1EHXA 1F8TH 2AQTA 5F9DC 5HVHC 4K3GA 1NOFA 3JXAA 4FNUA 2DQUH 4FFWC 2XPGB 4XH2A 1M9WA 4KAQL 3KPRE 1AQHA 2K45A 1ZDQA 1F13A 5CLZA 4J3XA 1WTLA 1E4KC 2ZJSH 4DTGH 2FSEB 3GNML 4S11A 3WE6B 5FO9B 3ZDYF 3SGEI 5AW2B 4CVZB 1OSPL 2WANA 1K4CA 1BMZA 2EADA 1E7VA 3OLIA 2NY6D 4YSCA 2EE6A 2IWGA 1TYJA 3OHXA 4H5SA 3TBSB 4YHNA 4PJHB 1OB1B 4ELMB 2NW3B 4IKKA 1ZHKB 5CWSA 5GRZA 2DYPA 1KN2L 4ZFOA 1KNOA 1S9VA 1RJLB 5E6RB 5LVEA 5FHBL 4G7RB 4LOVA 4HETA 1GA2A 2C1OA 1EFXB 3DVFA 4ZO6A 2P49B 4UYQA 3ULVL 2CDGB 3RB7A 4MZ3A 4IRSC 3ZDYB 2F8IA 3CBKB 5ICXA 3RWHB 2PO6C 5HHMB 4GW4A 1SDAB 3V0WH 1YMMA 1SN2A 1F4YL 2DKUA 1COBA 1KG0B 1XR9B 2Y06L 1NKRA 2Y7QA 4NS0A 3IJEB 4F37F 2H0JA 2GIMA 3MRJB 1MW1A 4Y88A 4Y1AE 2R2BB 1BF2A 3C6LA 1OAQH 5IMMB 1JERA 3SO5A 5EEWA 3M7OA 2Z4TA 2UWEE 3DJZA 1QSEE 2A4CA 1UXLA 2X4QA 3JV4B 2A5UA 3WUZA 2E7MA 5BVPH 3AW5A 4YDIL 1CFVH 5GRJL 3WHXB 4HXAH 3X1EA 1XB3A 4MMZC 4OD1L 1BAFH 1UH4A 4N8CL 3WN6A 3O2DL 4C4UA 1YNTF 2BVPB 4NCC1 4UAOB 2LOEA 5ES4B 5FM5O 1FG9C 3FU9A 1XVSA 3QPXH 3IDGB 3B2UD 4I85A 1T22B 4N86A 4ISVA 3AWEA 1L0XA 1QBAA 4KZDH 4MS6A 1ACXA 3T0WA 2Y69B 1QP1A 3VD1A 1P4LB 1GZHC 1TEFA 2ENSA 3QDGB 2HFFA 3MV8E 4D8PA 4E9TA 1AFVH 3QZWG 5IJBC 4R4BA 4Z7OF 3BUYB 3FFCB 4NC1E 5FOJA 4LAJH 4A67A 5D1XC 4PFEA 5F1OB 2GITB 3RVXD 5KJRL 1BFVL 1YNTB 4L23A 8CGTA 1XCQB 4K94C 1E6JL 2R1XA 2WXRA 2OQJA 1JZEA 1H3PH 1OCRB 2OP4H 4WI8A 2F1AA 4YDKH 5AAWA 4FQPA 3WTSA 2CH8A 3ARPA 2GAZA 5D93C 1L7TH 2OXGB 4CC4C 5FYJH 3JWOH 1SXZA 4HJGB 5D8JL 2PMZA 1SOQA 3MACH 5GGQH 4P57B 3AU1A 1JFQH 1WPCA 5DU7A 3VFTA 2UYLB 4U4BA 2ZKMX 3MBWA 1N64L 4NENB 4Z7OB 4BHUI 3VWJB 3CXHJ 3UPAA 3U0PB 1NSNL 2VO5A 3VD2A 3LKOB 2IGTA 3DJ9A 3NACL 4Y4FB 3IGKA 1UG9A 3K5SA 2Z7YA 2QTVA 3BPNC 3CVCA 1YEDA 2JVUA 1D5ZA 2QV4A 3IXAA 3KLQA 4OJYA 4PJ7B 4GW1B 3H3PH 1U0QA 3KPOB 1MNUL 4AZUA 3NJIA 4L3CA 4JO4L 1A5FL 4KKAC 4DQAA 2CMRL 3ZO9A 2YD7A 4A6YH 2AZUA 2HFGH 5CP3A 1J18A 4J1UB 1CFBA 5I5RA 4CADA 4XPGH 5IFHH 3GKZA 4PPTA 4CU6A 5JZ7C 3MLRH 3NTCL 4W9KC 4WUUA 3S98A 3UJTH 3S88H 4ZBJA 2YZ8A 4PIBA 3K2MC 2XA8L 4U1NA 1R3HA 3M86A 3U4AA 1S5HB 3DV4A 2L7EA 2B4CH 4HUUB 2CPUA 5FC9A 3I3BA 4B3VA 4UIKH 5J4MA 2APXA 2AJXL 2IV8A 4KMQA 4YHML 5IBLC 3B9EA 3OAYH 1U41A 1CK0H 3EKCA 1J0HA 1NBVL 3BPCA 5C7XH 5B7FA 5K93A 3O4OC 1X9UA 4NQSB 3KBEA 3UYRL 2C3GA 1A1OA 2BO0A 1XH3B 2PTTA 4NEHB 2BP5M 5FA4A 4XE5B 4C4KO 1J9QA 3MRDA 2NRDA 4H88L 3P4OB 2YD8A 1IQDB 1DSFL 2YARA 3H2WA 2N3JA 4FEIA 4KAQH 1YYMH 1L9PA 3GINA 4KJWC 3TEUA 2F54B 2PYFA 1JS4A 4YFLF 4B9CA 3GNMH 4AV0A 1NBCA 1OCOB 3IXTA 4JPSA 3AACA 3MVSA 3HS0A 5I75C 3DX8A 1ES0A 1YEJH 3QWOB 4J3OD 4YJZL 3FCTB 4ETYA 3C8KA 1F6AB 3SOBL 4XNMB 2FX8H 2YAQA 4NJAH 4XP6L 1QLRA 2GTWB 3DUUA 1A25A 1S7VA 2QR0A 4V1DD 3MRQA 4HIXL 2AXGB 2FYYA 2HWZH 3B6SB 5FHBH 1YEIL 1BPLB 3BSZL 3OAZK 4N1HB 5BQ7A 4ENEC 4GSXA 2MH4A 5IFAL 2DN7A 1KV3A 3C5SB 4K8RC 4U2YA 2P5PA 4NP4H 4ZYKB 1F4YH 1YJDC 2GFBA 5F7AA 3QNYB 4FNLL 1AD9B 1EDHA 4FYTA 2GK0B 5F7NC 2Q6WA 4QHUA 4AYID 1GJIA 2OR7A 4B9FA 1ZGLB 1ZEAH 4FJZA 5F1KC 4KK6C 4YWGL 3PGCA 4J3BA 2QMKA 3TIDB 3KGSA 1H19A 4XOCA 2YWYA 3JVGC 3VWKA 1U4FA 2DM3A 3CFUA 2E7DA 5KS9E 4X9HA 4P5RA 3A67L 4FLOA 2D7MA 4HC1L 1A6WL 2VKXA 3PWPD 5EU6D 4YDIH 4ATWA 3OKOB 5GRJH 1BEYH 2V8LA 4B9IA 3IETA 3L16A 4YDVA 4GS7C 4IIZA 1RZ7L 1MCIA 2G5BB 1YEKL 2IV9A 1R19A 2IGLA 3QEGL 4OD1H 2XACC 4PWFA 2DWEA 5LXVA 5FGRA 1I8MA 2PR9A 3D3VD 3O2DH 4BXVA 4KROB 2H2PD 3POCA 1I85A 2AXFB 1FVCB 3VB8A 2CCVA 3F00A 1FWXA 2LU4A 4Y8AA 5HDOA 1MFNA 2HT4D 1XH1A 1KSRA 3HBGA 2Q9OA 2H0FA 3MRKA 4DESA 1OK8A 4I48A 4IRJD 1CGVA 4M03A 5E6ID 2H3XC 1YVLA 1LE5A 4JFPB 3SDDD 5GS1B 1U8MB 4V2BA 5EC2A 2O61B 3NCYP 1J9RA 4KQ4H 4DK6A 1D2PA 1UCBH 2WO3B 1QFOA 4OBRA 2DICA 4L4VA 5KJRH 2VIRA 3QUYD 1BFVH 3GI9L 2MNWA 1CIDA 4JW3A 1N9PA 3RWGA 5JPNA 1E6JH 1GYWA 5BJTA 3CHOA 3T1WA 2CLRA 4FTVB 4IRZL 3BUPA 3WNJA 1KT2B 3GMOB 4JG0L 3O41B 5CD5D 2IOOA 5F7KC 2DQGL 4MCYA 1PVHA 1M05B 1WV7T 4U1LB 2VRQA 1RIUL 2OL3L 4XX1G 1NSNH 4ICXA 4OCSL 4R6UA 4EN2A 3HR5A 3NACH 3FO9B 5T1KB 1RL1A 4NN5B 4JFFA 2DLFL 4R97C 4AV5A 2A6DA 4FKEA 1KMGA 2VQTA 4JO4H 1A5FH 4KO5A 5LCVL 1JZJA 3HZYB 3AT8A 4PTUB 2OMBA 1UB5A 3J07A 3GXFA 1OT4A 2E5EA 1AMXA 3HRZC 4FQ1L 5KSAB 3L5WA 1DO6A 3A4EA 3F3HA 3NTCH 2FJHA 3UJIH 4ZD3H 2XWJB 1OPOA 1E4JA 3GSRA 2WLMA 4YDNA 2XA8H 3ZZ1A 4UB0L 4FAAB 2VUKA 3IRCA 2RALA 3MCLL 3ARGB 3MFGB 3OX8B 1USQA 5T5NF 1JZ7A 2DYPD 1MCBA 2AJXH 3K4AA 4QRFA 1J5OL 4U7SA 4YHMH 4APQB 2VH5L 3LDBB 2W60B 4HUKB 4AW7A 1NBVH 5AALA 3ELQA 4HBQA 4XP1L 1X6LA 5DRZA 3UYRH 1A6VH 5MENA 4JPIB 4LESA 1XEUA 4IHOB 2MCPL 4KRPD 3CHRA 2NR6C 2XIIA 5BZZA 4WKXA 1BQHB 5E9NA 2IJ0C 2ZOUA 3GRWA 5KVMC 5HDQL 1D5MA 1BPVA 3RKPA 1Y18B 1DSFH 5ADOH 4C83B 1KFAL 2ARJA 3S96A 1LGVA 3DBSA 5JIHA 5K59E 1J88A 5D9SA 2WLYA 3LZLA 3NIFF 2DWXA 4WW1B 1OSEA 4ZMVA 4IBVA 2O5XH 3QPKA 3C6LD 1SDYA 3QDMA 4IU3B 5AOJA 4Z5RB 1CXEA 2TRYA 1CFNA 4YO0B 2CXGA 4CJ0A 4MJ2A 4FHKA 1AR2A 1ZXQA 4EUPA 4UU9B 1RAMA 2AKRB 2RA1A 3VQ2C 3LIUA 5HI4C 3STLA 1IRAY 5IM7A 3GGWB 4TNWK 3F7KA 5A6LA 4HIXH 3M1OA 4V1DE 4LLWA 5KJ7E 1YEIH 3BSZH 1DVSA 3NEXA 4DH2A 4OLZH 4RA0C 4LOUC 2PTUA 3GBDA 5JHDD 1P5UB 2UXTA 3PFUA 3RUGE 2EKJA 2P8PB 3NIFB 4G9FB 3ZDZE 2EIBA 3UO1H 5IFAH 3FRPG 6FABL 3ZE2E 3ASOB 4WWNA 1AIFB 4L8DB 2EACA 3GPSA 1JYVA 2AQRA 2WBKA 3P9WB 5GZOA 3G6DH 3L5XL 4FNLH 1GZQB 2XWEA 3UERA 1PZDA 4MRBA 3CFTA 1JHTA 3UROR 4G6FB 5HDBB 5IF0B 1YLBB 2OXHA 1QOKA 3VQLA 2RD0A 4GKZA 3U4EA 1I7ZA 3WUWA 4NZRL 4HIEA 1QKZL 4HC1H 2WLJA 1JFHA 1FUNA 3PWPE 5EU6E 2ZWLT 5IW3A 1YNLL 1RZ7H 2GEEA 1CI3M 1YEKH 3QEGH 1KWKA 1Z0NA 4EI5B 3SQOL 1UD2A 1T5WB 4P3DA 2EDMA 3O3BB 4AIZA 5TH2B 1ILUA 2P44B 4MA1B 1U58B 1CDYA 3D3VE 4KX7A 4R0LB 5HYQA 4UMSA 4L3EA 4IIQA 5DZ9A 3RA7L 3KS0J 1XMEB 3MJ7A 4IBUA 1ZV5A 4UINL 4PJBA 4Z7UE 2G9KA 2QHLA 4KXZH 5J9PA 3DGGA 3MKKA 3H9HB 4XR8C 1OQOA 1DVFA 4UQ2A 2Z64C 3FO2B 5IG7A 4S0HA 4LCCC 1A4BA 1DSYA 3OZKA 1QRNB 1E30A 2H5UA 2BIHA 4I0PB 5F96L 2IXQA 1VLXA 5AVTB 2J72A 5L0QB 5IMKB 1EZVY 3O4LB 2ZXCA 3K6NA 3US1A 4IRZH 3T0DA 1KCKA 3TVMB 4JG0H 4WUUD 4GG6E 2AS5M 4UT9L 1TJHH 3QXVA 5J06A 4K5PA 2DV6A 1U8KB 2CCWA 2DQGH 3ZHLA 1MCCA 2Q0ZX 4Y0GA 2HLAB 4L0ZA 4KKLD 7FABL 1JYXA 5DWUH 3C60A 4NYLB 1U3HB 2I60L 5IVZB 2LFGA 1NJ9B 1F56A 2XVKA 2DBLL 1EAJA 4XCEA 4M1CC 4X8XA 5IHZA 1HNGA 3BGFC 3K8LA 1KJ2H 3DVNA 1AHWA 1Z32X 2QVFB 4HH9A 5E1QA 2WXOA 4IGBC 4WNQB 3I2CL 1TNMA 4ZQKB 2OX5B 2ZX5A 4JFHD 5LCVH 2X9XA 5EU3B 4XNUL 1FZMB 2WUBH 1LWJA 4GAJL 4PMEA 5GGSA 1E5YA 5F72S 1TOXA 4S1SL 4MB3A 1G7IB 1T21A 3GSVA 2EIMB 4BDVA 1KULA 1AQDA 3S5LG 5H2BB 1BWMA 4JJOA 4RDQG 4DP2X 5ERWA 3BIBX 4ECNA 2F9BT 3I6GA 1E6OL 3W9EB 4H8WL 2Y2TA 3EF7A 1O75A 1U33A 4WKZA 3ARFA 3MCLH 4OF8A 5TK2A 1A9VA 2ISDA 4ESKA 1MJ7L 3BUIA 5AL0A 4UTAA 4NQCA 3WS6A 2C7FA 4CL7A 3X2QB 2VH5H 3OHMB 4LRIA 3V6OA 4D0CB 1SQMA 1FE8L 1PDKB 3DIFB 5CEZL 3X1NA 5H4ZA 1NGZB 4HIPA 1JPTH 2P7TA 3U0TA 4ZPVB 1H9VA 1R3JA 3MKGA 2UY7A 2EO7A 1ZTXL 1FV1B 1YN6A 3MOBL 4A2HA 5HDQH 1G9NC 2ADFL 5SWZD 2YRBA 2WXIA 4PJEF 3N42F 5EO0B 2ZCLL 4YHOH 4DGIL 2CR3A 1TVBA 4F1SA 5ENWA 2JMRA 5DFWH 3P2DA 1DDTA 1MFUA 1XGQA 2NY7L 3QFJA 1MHEB 1KCSL 1W72B 5ELIA 4RMBA 3VWKD 4LPVA 4B3EA 4LLMB 3NMEA 4JL1A 4KV5F 3HKZA 3QCVL 3OG4B 2R1YA 3BUTA 3K6OA 1E9QA 4QKXB 3RDTB 3TA3A 5DJAA 4Y2LA 4TNFA 4PJEB 1D6EB 2PCFA 3N42B 3QUZB 2DW5A 2V5TA 3EGXB 1FI8C 1OP4A 3S2AA 5KVGL 3TZVD 1XDTT 3VNYA 3WFHA 9CGTA 1EJOL 3M17A 1LL1A 3BPLC 3P4MA 1FZOA 1T0NB 4L1HA 1SN5A 6FABH 3COOA 3DRQB 3O9WB 5C0JB 3SDAC 4X0KB 2UUDH 1IAIL 4N2AA 4NZUH 4XP5H 2R29L 4HFWB 5F71A 4ANVA 1WWWX 4E9LA 4Q9QH 4ODUA 1C5BL 2YS4A 3GMQA 4L4VD 2HJLA 3H6JA 4HSQA 5IW6B 1QR1B 4NHUB 4NZRH 3QIUC 3GD1C 25C8H 1QKZH 4HP5A 5F7DB 4AQ1A 2NZ9D 3QJFB 3QR0A 5DD0L 2CDFB 4NC0B 1MJ8L 3F05A 3QWQB 2DQIL 1HWHB 3BKML 2W0KA 4N9GB 1YNLH 4YHKL 3UDWA 1WVZA 4FQHA 4U3SA 5L8LB 2LGNA 5DQDL 1SHXA 2YD6A 5IREA 2EXTA 4HPYL 1MLCB 1SN0A 5E24E 4HU2A 5DQJB 3D33A 2CO1A 3EUDA 1FBIL 1C5CL 3W0WB 4HCRL 4GKSB 4OIIL 2AEWA 3FUHA 3GSNA 3RA7H 4XPFH 4UINH 4JFFD 2CKBA 3SGDI 1AGDB 3GT6A 1IM9B 1SMAA 3PY9A 4XPBH 3VXTA 2X4UB 4JMNA 1HK6A 3FL7A 4JZJA 2ZUXA 4B95C 3MUGA 4C56A 5AG9A 4ZFZA 1N3NA 5CU9A 1E27B 1S7WB 4L37A 1V5JA 4X5WA 1XR8A 2JCCA 5F96H 2R0WH 4QGYA 2QVMA 1C12B 4YHLL 1MW0A 1NPUA 2FT7A 4Z18A 3T2OA 4UT9H 4Z7WA 4WUUE 3UC0L 2GC7C 3SPHA 3H7BB 2QGEA 2VSCA 7FABH 4ACTA 1KPVB 1IGTA 1OK0A 3BEWB 5FW8A 2YBRB 3IGAB 4RNRB 1AKJA 2ERJB 2I60H 2VABB 3SD5A 4P2OB 2DBLH 3ZYOA 1ZOXA 1QA9B 4O5LH 1X5MA 1YNKL 4HDIA 4U0RC 4LEXL 4F7KA 3GSXA 1P7QB 2JWYA 3OSKA 4QXGL 4WRLA 3ROOB 3LPFA 1S7XA 4AVHA 3AM8C 1I7TB 3I2CH 5ETUB 3P69A 3VA6A 1M1XB 3Q8CA 1AOHA 2HA1A 4AEIL 3B2VH 4JFHE 1M7IB 2VDNL 5DT1L 4MJ5A 4RGOL 1A4JA 3FHAA 1A3QA 2IDFA 3ULSB 1HQRA 2FB4L 4GAJH 4L8SA 3CMOL 1S9KC 1K3IA 3ZE0E 4CVWA 4S1SH 4RX4D 1IC1A 4GAFB 3AROA 4JQIA 3QDMD 5CGTA 1RIHL 2DQTH 1UUNA 3TCLA 3AG2B 3L9RA 4U4IA 1UKTA 3ILDA 2YRZA 4M7ZC 1EVUA 5ABDE 5DGQA 4PJ5D 4NAQA 1RU9L 2X9ZA 1INEL 1MJ7H 1HHIA 5J11C 4M8UA 1DVYA 2CALA 5CR1A 4MAUL 6CGTA 4OT1H 1FE8H 4PLNC 2AFNA 5J1SC 3QQ3B 1Z9SB 5I1IL 5FB8A 4U33A 5I28A 3DVGA 4JK0D 1QUNA 4DEPC 1GVIA 4NNYB 3BISA 4HUXA 4L5FE 4ZZFA 3AWGA 3QEQB 2JIXA 1JNNH 2IPUK 2F7QA 4QLRA 3DX9A 1PQZA 5GZOD 2NW2B 5SWZE 3RFZA 2H32H 2D7QA 2IIJA 1TTBA 2W81C 4DGIH 1JRHL 5FKAA 5AD0A 3IFPB 4BFKA 1KCSH 5AW6B 1RZ8A 1JDDA 1MCSA 4IS6A 2EXYC 3IVKB 2VC2B 4R96B 1K8DA 3BWZA 3ME0B 4XWOC 4DOHE 4OZHA 1AYOA 4ODWA 3ECBB 4NKDB 3MRFB 2CK0H 5JYMA 4ORGA 2RTTA 5B1BB 5L2JB 1FGVH 1CBJA 4OCWL 4WWKD 3UTQB 1AS6A 3G3LA 1EXHA 1RK0B 4Z0XB 1MAJA 4FA6A 1N5YH 5HGDB 2DM2A 1UD8A 1TFPA 1ZHLB 2BWDA 2GUYA 4FNSA 1S78C 1A6PA 3D25A 2EAEA 5D96C 3FH8A 3V0VA 5DFTA 2V2WB 2EC9U 1CF8L 3R4RA 3VGFA 1K4DB 4G8AC 4QTIL 1CFSB 2JLPA 2ATKA 4W9DC 2JKXA 1IAIH 3NDZE 1TT6A 1DVFD 4XMKL 3U1SL 2R29H 1IVTA 3D4ZA 4LIQL 2VDML 4LBEB 1NANH 1C5BH 5SX4H 5FO8B 3FZUC 2WYZA 2GJRA 5IHBA 4L4VE 4MAYA 4OI7A 1JPSL 3HBPA 1Z3GL 2I9TA 5DD0H 4LDCA 4BKSC 1MJ8H 3HBQA 4AJ0A 2DQIH 3BKMH 5I2IB 2COQA 4YHKH 1KPUA 4L9LC 5DQDH 1J7VR 2D9CA 1T3FA 2OMUA 4HPYH 4NNXB 1KIRB 4PG2C 5DUML 3BZFA 4JQVC 4DZ8B 3C60D 3V52L 4N6RA 5D5MF 1EAPA 4IBQA 3ZXAC 3NJJA 2QKIA 3X14A 2CLZB 4F7MA 4XO9A 1C5CH 4G8EB 3QXDB 4G8GB 4R90H 4HCRH 3B8YA 3WMSA 4BINA 1DHKA 3HNSL 3PLYA 4TLUA 1KTDB 1HOCA 4NC2B 4OW6A 4X5XA 2EDHA 3CFBB 1NDMB 3FO1A 2FSDA 1U8OA 4JKPL 3OV6A 4JFFE 5E00B 1L5GB 5IB1A 3IWVA 3LH2L 2L7JA 3E1F1 2DDQL 5ILTL 3LNEA 5L2KA 3T0EC 2DMGA 3ULUD 1SZNA 5DFAA 4Z7VE 3DVIA 2C4FU 1ED3B 2MCMA 3WI9A 1FN4A 3B7RL 4ZW8A 1MSPA 1FNHA 2IANA 3HUJA 4AYFA 3P40A 3FOLB 3KYOA 5D5MB 2DH3A 3V4VL 3LMJL 2WBJA 1WIUA 3H9ZA 1OCCB 5HI3D 1OIOA 5JLZB 2I9LA 4MS8C 4ELKA 4K7FB 3IJHA 1ZA6A 4UNIA 5F88A 3OKDA 5CGYC 3S6CA 5BXFA 4YHPB 3UC0H 2FLMA 2ID5A 3IB4A 2BY3A 2CU9A 2VZ1A 2CO7B 3U9UA 3ARFD 1QW9A 2NYKA 1G9MC 3I50L 3ZR5A 2FWUA 3QHFL 4U7MA 2K4WA 1S7TB 4OLXL 3OKNB 5IUSA 2GCYB 1I9IL 4DGVL 3TA4D 3AG3B 3OLEA 4JPVL 5INDA 4BFEA 3DI2B 3SYAA 4ZUWA 4LEXH 3B83A 4M6OL 3L8QA 3IDMB 4QXGH 1WH0A 1ASQA 1ET8A 4LL1A 1F97A 1BECA 4Y1TA 4AEIH 1AO7B 1IGJA 1QLEL 5DT1H 1XXDC 1QZNA 4RGOH 1IAMA 2VT0A 3U30C 2FR4B 3CMOH 4NRYA 2GSGB 1MI5B 1JV5B 4ABUA 5EOCL 3IDNA 2WQSA 5ITBL 2H2SD 4L8BA 1MH5B 2NXYB 3WAKA 2XTJC 3QDME 2CBMA 3U2IA 2OSWA 1NEZA 3KD4A 4Q6IC 4XNYL 4Y8DC 3WKNA 3CSGA 1RU9H 4UNTA 4PJ5E 5CILL 3ULAB 3VFSB 3PAUA 3O6LL 1S8DA 2XWBA 1L9TA 3AZUA 1G84A 4GW5A 4OCYL 1LXMA 4MAUH 1KPRA 4GBXA 4LKXA 2OI9B 4LEOB 3VMPA 5A2BA 5I1IH 5CN1A 1FVEA 3MRLB 5EH1A 1T03L 1L0YA 5AQ0A 1NOLA 3T4AB 3ZRFC 5HDWA 1BEXA 5DS8A 1M2VB 3KPQB 1BVNT 2PPCA 4BZ1A 5IK3A 4FERA 2NY3B 1BF8A 1E65A 3L4TA 2NUPA 3RGVC 5C0DA 3LQZA 5FW6A 4OGXL 5E6ZA 5IQ7L 1P6AB 1RIVH 4Y16A 1EXUA 2D0HA 2HB0A 3IDYC 2G9HB 3CZSA 4KJPD 1JRHH 1E4HA 2FJGA 2WKGA 5A2KH 3BQUC 3CG8A 4TVPD 2CUAA 2C3VA 3DNKA 1EAOA 4KNUA 2D7NA 3FCBA 2R4RL 1WHOA 1DEEB 3VDCA 3GJEB 3MUJA 3NGBC 5CS7A 4LVOC 3GHBL 2Q8BL 5IMLA 3UAFA 4I4WA 3O11B 3HLAA 4G2AA 5JOFA 1AGFB 2MEJB 3DX4A 3J2PA 5A43C 1PZUB 3EZJB 2GTZA 1IGIL 1G6VK 3GFUA 3LIZL 2CHNA 3NT0A 3ZZQA 3DX1A 1JZFA 4KDTA 4KXDA 4X4MA 2FEEI 5C3TA 2W5PA 2X4TB 1AGBA 3NEOA 1NIAA 4LLAA 4X98B 5DJ6A 1JZ5A 1M4KA 1G43A 1PNCA 2RH0A 4KVNH 4O2EA 1CLYL 5LQBL 4Z7QE 1F2XK 5BO0D 2V5RA 1HXMB 5ESAA 2E9WA 2DQDL 2GUOB 3CFIC 3IKCA 1UXWA 2JELL 2WW8A 4R8WH 4PWHA 3QZLA 4QTIH 2BPBA 5GXBB 3BAEL 4MD5A 4PJBE 1PBYA 1ZK5A 1N6VA 1TZHA 2WYIA 3MLUL 1UD4A 2PN5A 5CINL 5IZ7A 3T1FB 3U1SH 4FEMA 5FDWA 1Q0EA 3PWUA 4LIQH 4C56D 3HE6B 4HCGA 4QUOA 3OM3B 1MHCA 2CGYA 1QFWL 4QRPB 3RZWA 1JPSH 3CZJA 4IBZA 4XHJD 1Z3GH 5DK3A 1E8WA 3RL2B 4APXB 1B0WA 2AEPL 4HJTA 1B9KA 5TDNA 5DJ8A 3LRSB 3THML 3ARYA 4NQDB 4Z6AT 1PMYA 4KHTH 5B38A 1XH2A 5JQHC 2MPVA 3V52H 3OJ2C 4X7TA 3S8GB 5D7LB 1K72A 2EO1A 2D03L 2ITCB 3GZPA 3MV7A 3VXNB 1BLNA 1E7UA 2HPTA 1BQKA 3H9SA 1P4IL 1XXFC 2QMJA 5TDOA 2P4AB 1NBZB 2PETA 1U8QA 1J0JA 2BW5A 4JKPH 3VRJA 1CXLA 4U1GC 5ILTH 4U0QB 2F7IA 2Y2YA 5B7EA 1L9OA 3E0GA 3L4YA 3ILQC 3ULUE 3G6JA 2WCGA 5GJTH 1NCOA 5T3ZD 1A02N 4PJIA 3MLXH 2CJSA 2DLGA 2JQAA 4FI8A 5J3HC 1E3FA 3VA2C 5D7JA 5JOEA 1E4XL 5EEUA 3P3TA 2EQDA 1ZV9A 3BUQA 3KYKL 3HHSB 4RWHA 4TUUA 4WO0A 5FW7A 2JKSA 4UZUA 2O4EA 4QMEA 3QXTA 4DGYL 4WEEA 3I50H 4XBPB 4N2EA 3QHFH 4U3XA 4OLXH 4KHXL 2EO9A 3OKYA 2N0MA 2BNQB 1UZ8B 1NIFA 2G2RA 3KPRB 1I3GL 3QPQD 4NQCE 3GXTA 4NWTL 1BOGB 3V6OE 4LARL 2G60L 3NOIA 4Y5XC 5HJ3B 4XN7A 2CUMA 1TTGA 3EHBB 1NKOA 4QO1A 3GSUB 2MHAB 1FHNA 2BZDA 3V0AC 3BFOA 3D4CA 5D7IF 2FLRT 3GSOB 2DL2A 2AQSA 5DD5L 4GOSA 5LGYA 4PJDA 3DSFH 1X3DA 1QLEH 4H26A 1K6QH 3LNIA 4JLRB 1F18A 5I8EA 1THCA 3MLSL 3ESMA 1BLIA 3EGSB 3OAUL 1BVOA 4H8HA 5F7WC 4H1LH 3BSZA 1CGYA 4Y4KD 1A21A 3T77B 4PBVC 3TEZA 2X70B 5ITBH 2I27N 3I02B 3QFJE 5BZWA 4N87A 3OVUB 1HJCA 4HJ0D 5GZNC 3STZB 3ABGA 2AV1A 4XN5A 4XNYH 2WXHA 4ZUVB 5CILH 3WEMA 4OSUH 4X5PA 4JY4B 3KM1A 2JJTC 3ARBA 3KPTA 3O6LH 4G11A 4OFDA 2GBVA 5LGJA 4OCYH 1VADB 5BZDA 1NDTA 4X99A 3BT2L 3HN3A 1Q0YH 3X1FA 3MHZA 1AZBA 4P07A 1QLFB 1T03H 3NRPA 2ADGB 3EYSL 1MFCL 1N26A 2XG4B 2XUWA 1WBXA 3W57A 1QSEB 1J9CT 5EBMA 1YAZA 5EG6C 4F58L 2WTPA 4RZCA 3RBGA 4BD4A 2ZX8A 4EIUA 4QRSB 3PHQB 4OGXH 2C1PB 4ZO9A 1XD0A 3PAZA 3DX0A 4H0LC 5CGMA 1NEPA 3BP5B 3MLVH 1BG1A 2YXWA 4GRWH 1FP5A 4PJXA 3WDIA 3RU8L 3FB5A 1EO7A 1V7ML 4TVPE 3U7AA 1ETJA 3R18A 2E7LC 1C9SA 4HT1L 2APVA 3RP1A 3E6HB 8FABA 4MAYD 4P46D 3GHBH 1NQBA 3LNDA 3CZNA 1TO5A 3FUFA 4FNPA 4Z3EA 2DIJA 4GI6A 1R24A 5DUBA 1Q9KB 4L3AA 3LIZH 4AKPA 1XF3B 3FPYA 4BUQA 1KEMH 3BZ4B 3KWVA 1BZ9A 2V37A 4M1GL 4NC1C 3MV8B 1JWSA 4GIOA 1LNUA 5CEXB 3V0DA 2YPLA 4KK8D 3TYGL 2EECA 4ZUSA 1FH5L 3DHUA 3VXSD 1AAJA 4JFEB 1IKFH 2JELH 1UWGH 3PIQA 2J25A 4IKLA 4M8RA 3BAEH 3VH8A 3JUZA 3QC6X 4HHAB 3GMRB 4TL4A 4WCYH 1N2RB 3NJNA 3MLUH 2NXZC 3QEUB 4XVJL 1M53A 5G2NA 4YX2L 4MZRA 2WXJA 5L2KD 5CINH 4BQCA 7CGTA 2Q7AA 3QIWA 5TDPA 5DLML 1UB6B 2OL3A 4C56E 2IAND 5DURD 4H13C 4O4YL 3D0LB 5B1JA 1OP5H 2ZOTA 2JCCE 1QFWH 4MDIA 2QQLL 5EOQL 2VXTL 3MFFA 2X1PA 4Y5YA 5IVXA 5J7CC 4G6JL 5T1LA 1R3IL 2EIKB 1XB8A 3M8OL 3K80A 3OGOE 3P3RA 1XX9C 3II1A 3PABB 3THMH 2ZCZA 1ETA1 4Z7WE 3K6FA 4DVRL 4S1DD 3AXLB 1OF2B 1UWEL 1J0YA 4LFHG 1PLGH 1SJHB 2D03H 2DQEH 2Z91B 4PVMA 4PWJA 5IOPA 1TR7A 2E4FA 1SJEA 3P9MB 3PL6A 4NT6B 1CD1B 4OQTH 1ODAA 1P4IH 4P99A 4U6XA 1RCYA 5T5FH 6PCYA 1DJIA 3VFPB 3KWWA 3KDMA 2WLIA 4BK8A 3JWNG 4X9FA 4KUZL 4N8VG 3DO7B 4LGPB 4JFYB 3D18A 1AXSA 1WCQA 3DXAB 1RXLA 1ND0A 1CF1A 3MRRA 3NPZB 5T3ZE 1I8IB 3VSQA 4PJGF 4XNQA 4UTBA 5EFIB 4MKTA 5JO5A 1EZLA 4ABVA 3TO4B 1ZPUA 2NNAB 1E4XH 1KCLA 3ULVD 1FNFA 2XZCL 4PJ9A 2WKOA 1NICA 3GEFA 3KYKH 1B3IA 4L1SA 4F9PA 1IC5H 1TQBC 5B1KA 3CFNA 3BH9B 3PJLA 1SYSB 4FABL 2O5YL 1IO4C 5I0WA 4UDUB 4M8QB 3MUY1 5I8OL 1ZA3A 1L9MA 1B0RB 1FO0H 4KHXH 2ODHA 1I3GH 2D3VA 3B4NA 5H37H 4PMFA 4PJGB 1GTFA 4GBXD 1SBSL 5C0BA 4Y2DB 4LARH 3TT1L 1A2YB 2EEFA 4XMUA 3TBCA 2AI0L 3CNKA 4ZOAA 2FL5B 1JMXA 4HKXB 5TJWK 1NM9A 1QVOA 1C08A 1RZGA 5EORL 1I1FA 2YRLA 2P47B 3FTVA 3JTSB 3NCBB 3QA3A 4G5AA 3JZYA 1KJVB 1TVHB 5DD5H 2NY6B 3IFOB 4XOEA 3KPPA 3MA9L 2F8VA 1WC7B 2P45B 3MLSH 3UO8B 1HINL 3ARSA 3WDHA 1K2DB 4ADJA 3OAUH 1N8ZB 3F85A 3KGTA 2AJSL 3D07A 1IGYA 1OAXL 5ACZA 4BSWA 4NFDA 3O3AB 3EDJA 2QZQA 3S8WA 1R3LB 2WC7A 1ONQB 3NRFA 5DR5L 5B3JF 4UM9D 3U46B 4KXCA 4CUCA 3JTTA 43C9B 4Z0BL 2APFA 1X5YA 1C16A 2B3IA 4OZHE 1R3KA 3UZEA 2HTLD 4UIMB 3W39A 5I5JA 1BGXL 2BVQB 3WLBB 2BRQA 1R47A 1T2XA 5KVEL 1XTLA 2OS7A 4FFYL 5KSBB 4P2QD 2E6JA 3WTTA 2X40A 4OLUL 4CBPA 1VZHA 4AC2A 1MFCH 1ZJAA 4TXVB 3MJ8B 1RLWA 1ZV2A 2A6KB 1BBJA 2WJ5A 4LNRA 4W9HC 1IBGL 2M1KA 5MEPB 4PP1D 4F58H 3AITA 3MNZA 2ESVD 4XZUB 2SEBB 4Y7MA 1WQVT 5SX5K 4MFHA 2GJZB 3WJLC 2FX9H 4UV7L 3BKJL 3RU8H 2CAKA 1V7MH 3HC3L 4JRYD 5KYYB 1MFDL 4BQ9A 5K9OA 3B2UC 2YPKA 4F5CE 2ZCHH 4AMXA 1X5GA 1Q8MA 2VAAA 1J0KA 4ZMLA 2DJMA 2V17L 1J0ZA 5AZEL 4O02L 1NFDE 3GTNA 3H42L 2E8ZA 3A6OA 5I15L 1I1YB 4M1GH 4F27A 2WTOA 2YHGA 5JW3H 4ZTPL 4JO3L 5LLIC 4HWBL 4NGHH 3PQYA 3L4ZA 3RVXC 1F86A 3LPGA 3MV7D 3TYGH 4GSDL 1FH5H 3ZTEA 4HPHA 1Y1DA 3H9SD 3JVFC 1LJMA 2F1BA 3VXSE 1VKXA 4UT9A 5JW4Q 1JWUA 1TQCC 1U42A 3ZHKA 1AQKL 5EZLB 5KWYC 4YX2H 5C07A 1VGKB 2HZHA 5IROA 5L2KE 1F42A 2E9JA 4AEHL 3PHOA 4CSSA 2BSEA 5HGBA 3LB6D 5DS2A 4FFZL 1Q94A 2OMWB 4OZGF 1IM3B 4O4YH 2IANE 3CK0L 1WLHA 3HUJE 1A7OH 5D7JD 1NIBA 2OLDA 2QQLH 1YUHB 3WEBA 4WI6A 5EOQH 3ZHNA 5I73B 3R0NA 1SXAA 5KN5B 3T09A 3M8OH 3FN9A 4A7GA 3KCWA 2QGDA 2QLVB 3CBRA 4P5KB 5FM4A 1GR7A 3BCDA 1NC2B 1QHPA 3EOBA 4ZFQA 3E6FA 4Q4IA 5DDHA 4PRBB 5IB2A 2ZQKA 3VXPB 4OZGB 2VN6A 3SQRA 1LP9A 2X44D 2ZAGA 3H3KA 4XB8A 2APWA 2DQ6A 4L3FA 1MXGA 4KUZH 3VFRA 5C0CA 2Z92A 2P42B 4JVPA 4Z78A 1K5WA 1X4ZA 4G5ZH 1J1PH 2B5IC 2BOBB 3NABL 2F53D 2ZOLB 2CBOA 1X5LA 4X0NA 3S4SA 3MBXL 2Q3AA 4F15B 4RGNB 2H8PA 4WO4C 2CIIA 1CFTA 3RWFA 1JPGA 3KNBA 3VQMA 1J48A 4BFBD 3AGWA 5HJGA 3EG9B 1NGPL 2XZCH 3O6KH 1MPAH 3RE0A 3ULVE 4DZBA 1JK9A 2NCMA 4ZMXA 3SZKC 1PPIA 4JDTL 4XPAH 3CDZB 3HI1A 3MROA 1HH9B 3JV5A 4FABH 2MPAL 2CBQA 3QRBA 1XEDA 4NNPH 3FFDA 3ARBD 5I8OH 4LVHC 1OSZB 2EVHA 3MX0A 4X6CA 4KDWA 2EDTA 4YXHL 3QIBB 1SBSH 1UXSB 5DK2A 3TT1H 2WNGA 2Z9TA 3KJ4B 2AI0H 4NXKA 4TN9A 3K81A 5I26A 3O45B 4J3OC 4JEGB 4C57C 1Y7VA 5JPMC 2XPGA 2H1XA 1SRDA 3QDJB 5KOMC 2APSA 4WW2C 4HKJB 3DLQR 3L4VA 4AT6B 3FB8A 2NNRA 5HPMB 1TTCA 1HINH 3GJFA 1TQWA 3GLEA 4HIIB 5D1QB 5JHLL 1MF2L 2QPFA 3VE0A 2AJSH 1A6ZB 1Q38A 1NBYB 3TBSA 4XXWC 2KZKA 2ZUVA 4ELMA 1ZHKA 4D9QD 4DIXA 1R5WB 2ZWSA 3LEVL 5EZJB 2AERT 5AAMA 4Z0BH 2FO4A 4Z3JA 2XV2A 1EFXA 2ENJA 3V4LA 4RAUB 1HIML 4LQFL 4GKLA 3KPNB 2PR4H 1BGXH 3HG2A 2I5YL 5DS1A 3RWHA 4X4ME 1LEIB 1YYLL 2DQCL 1CT8B 4FFYH 1JHKL 5JDSA 4ERSL 3E80A 1IJNA 3RTQB 2DM4A 1KG0A 4UBDC 3G5VB 4Y2OB 1PD1A 1UD3A 1XIWB 1PKQE 3IJEA 2DQFB 1FH2A 3CUPA 4YBHA 2WWOA 3L13A 1KLFB 1NDGB 4HH8A 2ESVE 2R2BA 2VNCA 4MGXA 5KW9L 2DAVA 4QGTA 4XE0A 1G7QB 3FS9A 3CGTA 3JV4A 4A63A 3BKJH 2WWMD 3QIWD 12E8H 2E47A 1MFDH 2DJ4A 2EDWA 2H2PC 4JRYE 4BJLA 1EANA 1F58L 2VGLM 1KC5H 4HCRA 3MRCB 5CLTA 2WVSA 3VUAA 1GJUA 1GOFA 4HEMA 2HT4C 1ANUA 1I1AC 1F6LL 1VFAB 2V17H 2Z7WA 4IRJC 4J4PA 2OR8A 4P2YA 5E6IC 1ZMYA 2L7UA 4O02H 5LWYL 4TL5A 2BVPA 4HAKA 3JT2A 4A37A 5I15H 4MNHA 5M94B 3IDGA 3HCVA 4ZTPH 4JO3H 3DPBB 3LD8C 3BP6A 3SDDB 3TLRA 3QUYC 4PI2A 1E8XA 4WUKH 5A2FA 3MV7E 1BF5A 1IGFL 3N55A 5LXGL 3PL6D 4QLWA 1WRFA 3QDGA 4LHUA 5JOPD 3H9SE 5CD5C 4OIAA 2VMDA 3BUYA 3NBNA 4ANXA 1G1OA 1AQKH 4Z7NE 3TN0B 2GITA 3SD2A 2AJYH 4AEHH 1CBVH 5CJ8A 3F7PC 3G6JE 4IJ3B 4MDRA 4LF3B 1TETH 4FFZH 1KGJA 4AYEC 2IOIA 3CK0H 4GY4A 1MWAL 3MSPA 4PM1A 2OXGA 3ZZLA 3LX9A 4J3TA 4WU7B 4P57A 2X4PB 5E8DH 2Y72A 4DJMA 3VWJA 2HAZA 4JRLA 3SE3A 3U0PA 2AQNA 2J12B 3O6FA 3LKOA 1R9FA 1AHMA 3N04A 4S2SA 4FC3E 1Z9NA 3S5ZA 4GW1A 1EA9C 3KPOA 4OJFL 4RFNB 5C0BD 4FF9A 4NN6C 4XMVA 1MCLA 2A74C 3NPSC 4KH9A 2O93L 1QR4A 4HAFA 4N85A 3RGBA 4J1UA 1PEWA 1K4CB 3S9DB 2WLLA 5I74B 3NABH 1D5BA 1OAZL 2XIDA 4BGDA 3MBXH 2LTQC 4JX0A 3OHXB 1XGRA 4PJDE 3ZGHA 4C4KT 1FRGL 2E75C 2YUWA 4YHNB 3SE6A 2DYPB 5EIVA 4ZFOB 1KNOB 1S5HA 4XXCA 2UZYB 1TJXA 3OQRA 3MUUA 2C1OB 4KRPC 5GISL 5CO1A 3QG7L 2HVKA 2VN5A 4Y19B 3B7SA 4FL4C 4OZ4B 1FNSL 5ICXB 2MPAH 2XBZA 3DURA 1YMMB 4I3GA 2Y0SA 1XH3A 2W38A 4I9WD 4YXHH 2Y7QB 5FA3A 5I82A 5C0ND 4EOWH 2YFOA 3C6LC 1CDCA 2FHCA 4GMTH 3P4OA 4G7YL 3NSYA 4KGJA 1ODUA 3P54A 1SOKA 1CN4A 2F54A 4D3CL 3OPZL 3DUSA 4BH7B 2R27A 4NRXA 5AW9B 3B3IA 3IJSA 3SBRA 5AVZB 1MF2H 3QWOA 4CJ1A 4PHXA 5K1JA 4GKOA 1DQDH 2OCJA 3RVVC 3CFKA 3V0FA 4PJXE 5TF1L 4XNMA 2QSTA 2GTWA 2PXYA 3ZTCC 4D9QE 4EE2A 2BJML 4ZX4A 2XN0A 2AXGA 4OV5A 4W9EC 1AXTH 3BRFA 4J28A 2P8MA 2W07A 3B6SA 2VXVL 2H3NA 2J5LB 1JJUA 2ARWA 2I5YH 3UBGA 3HMWL 2W8CA 2EE0A 1YYLH 3ZKMD 1JHKH 3NQKA 1H3TA 4D8PB 2QPEB 3TBVB 4JR9H 2OK0L 4P5MB 2HN7B 4CMHC 1ZVSA 4M9OA 2EDBA 4AE1A 1AD9A 2Y5TA 4H0HB 2GK0A 3AT9A 1ASOA 3I6KB 1P84K 4XMPH 1NCTA 1N4XH 5CD3B 3HW7A 1YY9D 4S10A 4WI2A 5AAWC 2VSKB 1TJMA 2AGJL 2R1XB 2PPFA 2OQJB 2PP9A 4I0CC 3EO0B 5C07D 1MCPL 5IROD 3VO0A 2GAZB 4ZFGH 2BSED 1TYEB 4HIJA 4JE0A 4A04A 3PXJA 1F58H 3OKOA 1UD5A 4BCYA 1KGUA 3VFTB 3MBWB 3T4YA 3P11L 1FL3A 2G5BA 5CXPA 1ZY9A 1O6VA 1AI1L 1BZ8A 3Q1SH 1NUGA 3O2WL 5CUSL 4OKVA 3CC5A 4UF7C 1QRKA 5LWYH 4ODXA 2QADB 3V0GA 3IXAB 1E5UI 4XNZB 1FVCA 2DMKA 2HVBA 1QAWA 2C4XA 3AAZB 1BBDL 3Q5OA 4IKNA 5GGSY 2FQGA 3UBXB 2HKFH 3V4VA 3VXOB 3QR2A 4M48H 4FZ8L 4M6NH 4WSKA 5JOPE 3RWEB 4EKJA 5B22A 3CFDA 5C0CD 4KKLC 3EFFB 4P8QA 4W6YB 5FCUL 3AG4B 4K5MA 2WWKO 4BFFA 3O41A 1MWAH 5I0DA 1HFUA 5CEZD 3G5ZB 3TU6A 2WINB 3BPCB 2EINB 3HE7A 3OJDA 2ZUTA 3AY4C 2H7WA 4JPWL 4HPOL 4U1LA 1I1CA 4EO5A 4HKBA 2GIYA 3VTMA 1A1OB 1R75A 3LN5A 4YC2B 3JYBA 3IMSA 3VFOB 3VTTA 1AP2A 3NDYE 4N2DA 3SCMD 4BRJA 3NIGE 4OLVL 3ABKB 3OSVA 4H1LA 3LEYH 5I18L 3RX8A 4OJFH 4OI9A 3ZE0B 4UQ9A 5C0BE 2PYFB 3EH2A 3HS0C 3FN0H 3IAGC 2E7BA 5DEZA 4P23B 4FQJH 5EZOL 1T7WA 1ZT1A 2N7BA 3IPFA 1MFVA 4F2FA 3V4PL 1UA3A 5F9JA 3DX8B 4PY8I 5A2JH 1ES0B 5E5MB 5CFAA 5KSAA 2Z4QA 1KBVA 1FRGH 2XWJA 4A38A 3ISYA 1U8JA 3GLZA 4OCRL 2B14A 2QR0B 4KK9D 1T6WA 3MRQB 4NWUH 4X4ZA 3L7EB 4BBWA 1F02I 2FYYB 2W9LA 4L2YA 3ARGA 3L2NA 3NFSL 2AAVA 3KHOA 1AKPA 2OBGA 2G3MA 4PB9L 5GISH 2NDGA 4YBLC 2LV4A 4I18C 5BQ7B 1A7PL 3QNZA 6TAAA 5HP5A 1FNSH 3P3SA 1VEOA 1EFXD 2ENPA 5I1GL 4JKLA 2VUOA 4ICWA 2GFBB 3ZKQD 4IHOA 4NN7B 4I9WE 1QI5A 4LDOB 3QQ4B 2Q6WB 2J8OA 1BQHA 1UADC 4JM2F 4V11A 4E9WA 3BAXA 1QG3A 1IQWL 1HXYA 3FYEB 4JO2H 5LB1A 4G7YH 4XO8A 2XX0A 3VWKC 5AOZA 2DYSB 4JGNA 4C83A 4B97A 4D3CH 2J1ZA 2WKLA 2PCYA 2XY1A 3BFQG 5KVDL 4DOHB 2AMGA 1L0PA 4HIQA 1JNJA 3LIZA 4LLVA 2RQ8A 5CBEA 1NMBL 2PCPB 3W5MA 1INDH 2LABA 3DTUB 3BKCL 2AKRA 3E9TA 3IETB 4UU9A 4YDVB 3TZVC 3TP4A 2MTAA 4LEEA 4JM2B 2ICWJ 5CJOL 2BJMH 2DWEB 5J6SA 2CQVA 1KENL 4ES9A 4HOXA 3WY3A 1AG6A 4MMXA 5FX3A 3G5YA 4L05A 4QRQB 1A6UL 3K6DA 4XVOA 1JYWA 3TBWB 5B3NA 1F90L 4FNRA 2RCSL 3QXUA 4IBWA 4DEUA 2JB6A 3HMWH 3MRKB 4OUOA 2X3CA 1GHFL 1NTDA 4GRLA 4P9HC 1LE5B 5LBSH 4GMSL 1KTBA 2R0KH 2XCMC 4X6DE 4GUQA 2G2PA 2OK0H 1AIZA 3PQYE 5EC2B 3IMUA 1NCGA 5JPNC 2E74C 1GMEA 1WYJA 3QDGD 4PY7A 2VIRB 3FUEA 1OARL 1FLRL 3QSKB 4E9SA 3VDBA 5BJTB 2AGJH 4P3WA 4DP9X 1G0DA 1I8AA 3BAJA 4WI7A 3N91A 1OANA 2EE3A 2KZ1B 4D9LL 1NCBL 4FNTA 4WZ9A 3UC2A 1MCPH 5C07E 4K94L 5DJXA 1EFQA 4PYGA 1XFPA 1CU4L 4FE9A 2OYPA 3WS3B 4EZLA 4PCKA 1DQML 1OO2A 2I7SA 5B8CC 1S7SA 5IQMA 1UM5H 2XPZA 3P11H 4P59H 1N10A 4EI5A 1AI1H 1NAML 2VDQB 4FOMA 4U6VL 5ALCH 3O3BA 1X9QA 2PUQT 3O2WH 5TH2A 3N40P 1U58A 5B39G 3DMMC 1JGDB 1REIA 3VWJD 2A6DB 1JGIA 1DZBA 4GAAA 4KKQA 2DD8L 2E9BA 2XQBL 5FECA 3RVTD 5E2VL 1J1XL 4GSUA 4EN3C 3PAVA 5K39B 4U3CA 2A4EA 3BGMB 2FWSA 1ZSDA 5EULV 5IEHB 1QNZH 3FO2A 1LP9E 3L5WB 1A65A 4YS4A 2FQEA 3M88A 3PDOA 2HFEB 3GLDA 1QRNA 3BVVA 1JZ8A 1DJSA 2QGBA 5C0CE 2HX7A 5IEKA 2JCWA 4I0PA 3EUUA 5FCUH 5DJ0A 5L8JB 3O4LA 4RMRA 2ICEB 4P0DA 3VFGL 5E70A 4JO1H <