4KNSA

Reduced crystal structure of the nitrosomonas europaea copper nitrite reductase at ph 6.5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
285
structure length
285
Chain Sequence
KTVQVTLHAVETDVAYDNKGSTYRAWTFDGKVPGPVVRVTEGDTVEFTLINDKNSKNSHSMDFHAARLDVVEDFESIKPGETKKYTFTADNPGVFFYHCGSDPMIQHIARGMYGVIIVDPKDANALPKADREYVLIQAEHYENPDDKTAMMQNKWSNVVFNGGVFKYDPVHDSEATSWLQAKPGERVRIYFVNAGPNELSSLHPIAGIWDRVYPSGNPKNVQYALQSYLIGAGDAATLDLISPVEGANAIVDHSMRHAHSGAIAVIMFTNDADPEAGRGENILIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multicopper oxidase type 1
publication title Characterization of a nitrite reductase involved in nitrifier denitrification.
pubmed doi rcsb
source organism Nitrosomonas europaea
molecule tags Oxidoreductase
total genus 88
structure length 285
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4knsA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4knsA01
3NP4A 2EILB 3NSYA 1PZCA 1V10A 3FQYA 1ETJA 1L9SA 2BW5A 2I7SA 2RACA 3FYIB 1M57B 3NJMA 5I28A 1MZZA 3CVCA 2FT7A 4A2GA 1TU2A 2IH9A 5F7BA 4A67A 7PAZA 9PCYA 2GBAA 4DP6X 2XLLA 2XWZA 2OCCB 3FSWA 2J55A 5I6NA 1IUZA 2PPEA 4RH4A 4E9VA 1QHQA 4FAAB 1ILUA 1EZLA 2ZOOA 3S8GB 4DP1X 4FA7B 2OV0A 3GYRA 1DYZA 3WKPA 3H4FA 1NPJA 4KO9A 4E9YA 4YSCA 3UACA 2UXVA 1AQ8A 5B7FA 2DY2A 2AZAA 2FQGA 1SDDB 3TBCA 3FT0A 1SFHA 1J9TA 2R7EA 1CYXA 1PMYA 2UXFA 2FNWA 1J9RA 1AZNA 1NZRA 2YAPA 2QT6A 3PPSA 1AZBA 1HAUA 1F56A 3N2JA 1NTDA 5FC9A 3S3DB 1L9RA 2UXGA 1NINA 2IWKA 3NJGA 3NSCA 1NDTA 1E67A 1TEFA 4HIPA 4L0PB 3CZUB 5B7MA 2QDVA 3FSVA 2IDUA 4W1TA 3ABGA 3KW7A 1E5YA 3S8FB 1X9RA 3CVBA 3FU8A 3FU9A 3X1NA 3QJTB 3HB3B 3KW8A 3TA4D 5D4HA 3AG4B 1NIBA 4A68A 2VSMB 1NWPA 1YLBB 4HCGA 5I6MA 2BZCA 2HLEB 2GI0A 2E86A 3FU7B 1AG6A 3C75A 2IH8A 2YAOA 3ERXA 5IY5B 4A2HA 2IWFA 5B1KA 4YSDA 4KO7A 1OCRB 3X1BA 2MTAA 1AZCA 2DWSA 2PLTA 1CYWA 3X1EA 3IE9A 3UABA 2IWEA 1ZV2A 2ZONA 2CJ3A 1HFUA 3QJQB 1RZPA 3WNJA 2H47C 4A66A 3FYEB 4A2DA 2IDFA 8PAZA 4BDVA 1M56B 1KCWA 2VN3A 4NERA 7PCYA 1JXDA 4UF7C 1XMEB 3WG7B 2Y69B 3SBRA 4M4RB 3JT2A 1AAJA 5PCYA 3NP3A 3WI9A 1FWXA 3FQ2A 3SBPA 5AKRA 3IN0A 3NJIA 4AKQA 1NWOA 1AACA 2GIMA 2YAEA 5AFAA 6PAZA 1OF0A 1J9QA 4CSPA 1NIEA 1BQRA 4DP7X 3DIVA 4WKXA 2BW4A 3PLYA 5B1JA 2J5WA 1KCBA 1E30A 1MG2C 4A2EA 1JZEA 2FWLB 1ILSA 2UX7A 2EIJB 1GSKA 4EF3A 2BP8A 2P80D 1PLCA 2YXWA 4A2FA 2AANA 4F2FA 2YQBA 4ENZA 3OQRA 1B3IA 5AZUA 3EH4B 4X4KA 4DPAX 2H3XC 4NB7A 1PY0A 3BQVA 3GDCA 4G7SB 1JZFA 1PLBA 2PCFA 2XX1A 4K9JA 4KNSA 2IDSA 1AS7A 3WNIA 1GS7A 3NSFA 1FFTB 1A4AA 2XYBA 1WA1X 1PNDA 1KYAA 1ADWA 1BEXA 2Y1AA 1JXGA 2XV3A 1BQ5A 4YSTA 1ZIAA 1JVLA 2HX7A 4BWWA 2GB2A 1HAWA 3FSZA 1BXVA 3U25A 2HZHA 1DZ0A 4W9ZA 1XB3A 4YVUA 1JZIA 1AG0A 1A3ZA 2JFCA 3IEAA 1E5ZA 2FQEA 4N8UA 1A65A 2HXAA 3AY2A 2XVBA 4AZUA 4JKNA 1NICA 1GW0A 1GYCA 2R7EB 2BP0A 4KNUA 3CDZA 1ET5A 5E9NA 2PP8A 4HAKA 5ANHA 5I6OA 1AS6A 1ZDQA 4E9XA 2Q9OA 3NJHA 2I7OA 5B1AB 2YAFA 3ZIYA 1BYPA 1TKWA 1WS7A 1JERA 1XB6A 2YXVA 1L9OA 1BXAA 1L9PA 3L45A 5I5JA 3TASA 1IBZA 3V9EA 4BWTA 1KDJA 3OD3A 5PAZA 4F7KA 1J9SA 4G72B 3ZBMA 1N70A 3PAVA 2VW4A 3QJVB 1XB8A 1GY2A 4UANA 4DP9X 4DP4X 1V55B 3T6ZA 1AOZA 2VW6A 1NPNA 4BWUA 1BQKA 1SJMA 4N4YB 2XV2A 3BVDB 2J57A 1MZYA 1ZPUA 2JXMA 2PPAA 1J5CA 3EHBB 1KBWA 1ZDSA 2YAHA 1GS6X 4GY4A 5D4IA 1URIA 1VLXA 4HHGA 2XX0A 4KOBA 3NJFA 2PPCA 2BZ7A 1ASQA 3NJJA 2XXGA 3NT0A 3QJRB 1OE3A 2FQDA 3EF4A 2YARA 2NRDA 3PCYA 1ASPA 3AW5A 3OM3B 2CALA 1ASOA 1RCYA 2XXFA 3WKQA 3AG3B 1TEGA 3EH3B 2CCWA 1RZQA 2TSAA 5I6LA 1KGYE 5I6PA 4F2EA 1CURA 4KO5A 4BK5C 3IBOA 2VM4A 2DWTA 3TBBA 4Q89A 3FPYA 2LLNA 5B7EA 1BXUA 1QLEB 4YSOA 2P80A 3EH5B 3AZUA 4E9QA 2WO2B 3NJNA 1GS8A 2DYRB 2VM3A 2FT6A 2PPDA 2XU9A 1MG3C 4AKOA 4KNTA 3RYMA 4YSUA 3MX0B 1RKRA 5B3SB 2UXTA 1WAEA 3FPXA 3QPKA 2BP8B 4GXFA 5F7AA 3T6VA 2W88A 3X2QB 4AKPA 1JZJA 2AFNA 1KDIA 3MBWB 1SFDA 1SF3A 4G71B 5I26A 3ASNB 1AZRA 1GR7A 1WA0X 4YSEA 3X1GA 1OOWA 2HX8A 1W6LA 3SBQA 2YAQA 4YVNA 4YSQA 1NIAA 2ZWNA 2XUWA 3PAUA 4G7QB 1AZUA 4QLWA 4DPBX 1OCZB 1SDDA 2BO0A 4AX3A 1SHWA 3FS9A 1M9WA 1AS8A 2B08A 3FSAA 3IN2A 4GP4B 2HX9A 1J5DA 1T5KA 4JHUA 2IDQA 1E65A 2N0MA 3ASOB 4KOCA 2FQFA 1PZAA 2A3TA 1OE1A 2WO3B 2TSBA 2CUAA 3PAZA 3DTUB 4YSPA 2BHFA 3ABMB 2B3IA 3NSDA 2H5UA 2EIKB 3PXLA 3T6XA 1SF5A 2GSMB 2I85A 4MFHA 3QQXA 1SHXA 1W8EA 2XV0A 2QDWA 4P5SA 4CSZA 1WS8A 3QJSB 2HRHA 3NYKA 2PP7A 4HCIA 4AI7A 3UAEA 4E9WA 5B1JC 3UGEA 1ID2A 4JHVA 2QPDB 3FQ1A 1JOIA 1JZGA 3NJKA 5EHFA 2EINB 3ZX1A 4UAHA 1KV7A 2WSDA 2BP0B 3CDZB 4NAJA 1BAWA 5D4JA 3S3BB 3SQRA 4YL4A 2CAKA 2DV6A 4DP5X 3V9CA 4TXVB 4QKTA 4YSSA 2X88A 3T6WA 4P5RA 2BWDA 1A8ZA 3D12B 2UX6A 3H4HA 3FU7A 1L9TA 4E9RA 4Q8BA 1A4BA 2GC4C 4DP0X 5I6KA 3CG8A 1IBYA 4E9SA 2EIMB 3OMIB 2X87A 5I5IA 1I53A 2PPFA 4DP2X 5TK4A 2GHZA 2DYSB 1GY1A 6PCYA 3QJUB 3ABLB 1ET8A 2FTAA 1R1CA 1JZHA 2OJ1A 4WTQA 4BXSV 5LDUA 1AIZA 3S3CB 1NIFA 3UAAA 2FJSA 1X9UA 1FA4A 2HRGA 1OV8A 5A7EA 1AR1B 2VMJA 2J56A 1CC3A 2FT8A 3ZDWA 3NJLA 3OMAB 4BDVB 2AVFA 1L9QA 1PLAA 3JTBA 3WIAA 4HCFA 3X1FA 1N68A 1OE2A 4HALA 4HHWA 5B1BB 2BWIA 1QNIA 4BXVA 1CUOA 1PCSA 4YSRA 1BYOA 1SNRA 2VW7A 3AG2B 5TK2A 4YSAA 1OCOB 5I5MA 1MDAA 4GP8B 1A4CA 3G5WA 4M3HA 3H56A 2QPEB 1IC0A 2IDTA 4ZK8A 1EHKB 1NIDA 4DP8X 1AANA 1PF3A 2CBPA 4PCYA 3N55A 2JKWA 1UATA 1PNCA 3OMNB 3T71A 1OCCB 2VSKB 3TU6A 4HZ1A 2Q5BA 1ET7A 2GC7C 2PCYA 4GYBA 4GP5B 4KO6A 1PAZA 2MRYA 3T9WA 3CVDA 3GXUB 4G7RB 3UADA 1JVOA 1KBVA 3AG1B 2AZUA 4PAZA 2W8CA 1JXFA 4DPCX 2IAAC 3DKHA 1ZIBA 2YAMA 1PZBA 2PP9A 4E9TA 3ABKB 2ZXWB 1W6WA 1WA2X 4G70B 3HEIB 1V54B 1IKOP
chains in the Genus database with same CATH superfamily
3ARFB 3VO0A 3NSYA 1PZCA 2GTZA 3LS5H 1II4E 2J12B 3QUMB 4G7VH 2HVKA 3UTPE 1A6ZA 2BW5A 1YN7A 3B9VA 4FMVA 2B9BA 1HTYA 3VFTB 4PJCA 5GGRB 3RWFA 3TGXA 1K5NB 3WHXA 1UWFA 1LQSR 4EIUA 4LAQH 5FDWA 1SZNA 2FAUA 4G8GE 5CIPA 4PMEA 4HG4K 1EDQA 2GITB 4HMEA 2VQ1B 4E41D 3CMGA 3SOBL 1ZS8B 2OSYA 4JFPB 4Q4IA 5FIEA 5JHBA 1MLCB 4JDVA 1HYSD 1T2JA 2JCWA 2MQGA 1B90A 2CLVB 4NZTL 5EUOB 5T5FH 1NKOA 2UXVA 1DSYA 2XVKA 3RX7A 4X6DE 3IDYC 1BVLA 4CNIA 5CM1A 3UXFA 1XF2A 1A9BA 5HPOA 2MNJB 4XP1H 5ABZA 4KRPB 3FFCB 4EQ3A 1WFOA 3IT8D 5E94B 2BNRA 2WZAA 5J12B 1KT2A 4YWGL 5TPWH 5CD5C 1WO2A 4RGNE 5D1QA 4F3FB 4JM2D 5EC1B 5HGAA 4PB9H 5SWZA 2J8UB 4I9WD 5SWSE 5F1NB 1M05B 2Q86B 5IW6A 3W5NA 5FC9A 5KEZA 2YUZA 4WI5A 4M62H 2IWKA 1FFPB 4OBSA 2GJ6A 1R5WB 1T20B 1OM3L 1I3RA 2KQMA 2X0UA 2AJYH 4YC2C 4W93A 2AXFB 3APCA 4JZOB 3ZGIA 3S8FB 2FEDD 4Y88A 4WWKC 3SPIA 1SJXA 4WCYL 3V6OA 2GUYA 4H8UA 1GZQA 3ZUNC 2B3RA 1E2WA 1UXWB 3BZ4A 3BGAA 3F6JA 3F58L 1M4KA 2QV4A 4L29A 4Q9QL 1A5FH 2LW3A 1Y18B 2R2BB 4U6YB 3T65B 4H1LA 3ZMRA 3RUGA 5I2IA 5DJCA 1U92B 3S5LB 5DUPH 2OYPA 4XBPB 4UB0L 1NANH 2C9QA 3I02B 3ERXA 1LNUA 1JBJA 2Z92B 3ASWA 4D2NA 1FLRH 1T5XB 1U58B 2BIOA 4PYHA 3QUZD 3EYUH 3EOTL 1WIUA 5CZVL 2K45A 4WEBL 5AZ2H 3T0AA 4ZDHB 2WWMC 4L4JA 2EE0A 2ZXAA 4NFBA 2EDKA 4JKPH 1Q0EA 4B9GA 4LCVA 4PTUA 4NWUL 3QI9A 4UT6L 4YDZA 5JA8B 2LVEA 4KVNH 2ZCHH 3FYEB 1YMMB 2IDFA 4TVPE 3CSTA 5IJKC 5BRZE 3LSOB 4YHIA 2HKHL 2G9KA 4HSQA 5DD5L 4KBPA 3U82B 1CIUA 2D3VA 3EFDH 3HA0A 4YUEH 1H15A 4PS3A 5EIQA 2DQDL 2P9RA 3NAAL 3VI3F 1DLFL 5DCCA 1UXMA 3GSVA 1NDGA 1ZHKB 2R56L 3NJIA 3U9WA 3T0EE 4AKQA 4NO2A 2JF1A 4Q6IB 5DS8B 1U8JB 1U91A 5DVOA 3LQAH 3MTXA 4UM9D 3TVMA 2X4OB 1P0SE 5AALA 4PS4H 3MRDA 2EVHA 1H0DA 3Q9QA 4GAYB 3I6KA 4IJTA 1FFNA 2XV6B 2NXZD 1VHPA 3SDDC 1GOGA 2Y7OA 4JUSA 3E6FA 1ZHBB 3QDJB 2R4SL 1GJWA 3SB3A 2XIDA 4HXBH 4K71C 1M9SA 1RU9H 2W38A 1MW1A 2FUTA 3LX9A 3LTVA 4NQEA 5FOBA 2B8OT 3QUXC 1S9YB 2ZUYA 1J5OH 3AWFA 4HK3N 2AGJL 2CHXA 5IB3B 1UM5L 1AR1C 1SXCA 4QXTB 2CO3A 3QEQB 4G7SB 3IJHA 5TH2B 1C7SA 4UAOB 1PLBA 3G6JA 2PCFA 3CXFA 4L8DB 3F04A 4J3VA 4OAWB 3ZZ1A 3FO1B 4E41A 1REIA 2V2XA 2JMRA 2DQUL 1Q9KA 3EJQA 4JO4H 2VQUA 5AKVA 1E28A 4FC3E 1ZTXE 3WFHB 1ND0B 5HY9A 3G6DH 1YNTA 1NCBL 2HLFD 4JFPA 4KUCF 4WW1A 5HDLA 1ZLSL 3V4PA 1EGJL 3CQPA 1XXDC 4H25B 4U0RC 1USQA 3DRQB 2VDML 1Z32X 2RALA 5EOTB 1WD9A 5BUGA 1L7TH 3AITA 3UTZB 4JM2A 2NX5E 4UTAA 5IJBC 5FB8A 1E5ZA 4BYHA 1OSZA 5T3XH 4N8UA 3RWIA 5D7IA 4W9CC 2AQ1A 3LY6A 4JG9A 4WU5A 4AZUA 2PABA 1KGJA 2WLIA 4X5XA 3A24A 4TQEH 5DEJA 5EOCJ 5KYXA 4FQXD 1EV2E 3TL5A 5DJAA 1YVLA 5ACZB 2YWYA 3MJ7A 4WI3A 3FOLA 4GUCA 1OTTC 3VXOB 4RMTA 1RSFA 1ZLUH 1RULH 2VLKB 2YBRA 5CSBA 2Z8SA 2IANE 4EI5C 4LPCA 5B1AB 4KGJA 2XG5B 1BYPA 1A3LL 3II2A 2C4XA 2HAZA 3V52L 4LDCA 5DTFB 4JBSA 5DJYB 4HWUA 3LD8C 1T0MA 2Y2YA 3IU4H 4P99A 4GNKB 4HFUH 3L48A 4P4KB 3ZLQC 2ENYA 2ZUSA 2E3VA 4PP1D 2O4EA 3GTTA 4FNTA 4CW1B 4XBPA 1MCPL 3GBMH 3QUZA 2Z35A 2EECA 5D2NA 4WNQB 1CLYL 2F1AA 1MCDA 2G75A 2BJML 4NQCE 3IJSA 4WW2B 1NPNA 3N43F 4D7PA 3EO1B 3IK2A 1EO7A 2SODB 2WXRA 1IL1B 1DHKA 1M7IB 1PD6A 1P2CA 4U1JB 1P6FA 4ADJA 1BVOA 1EJOH 3FONB 3JTSB 1DBML 3CVHH 5DMYA 2DQFB 4MSWA 4BZ1A 4MJHA 5CEZE 2CMRH 1P9MA 1RIVL 2PWEA 4W68A 4TSCH 2EH8L 3RWGB 3U46A 4HHGA 4S1DD 3VD1A 3ZMNA 3T2LA 5F7DA 2PWDA 1KEMH 4FI7A 4NZUL 1OE3A 3O9WD 4FQ1H 2YARA 3NIDB 4S11A 1SXSA 3B7YA 1ASPA 4UINH 3WNKA 2OK0L 3QAQA 2YSTA 3WIHA 5D1QC 4UM9A 3EJYC 4XX1E 3WXWL 1O75A 2FBJL 3AROA 1JRHI 5L8KB 3FTZA 4YS4A 3RVWD 5G4NA 2YSSB 3IBOA 1TT6A 3MRFA 4H2AA 1BWWA 3OG6B 4NM4H 1O5DT 1G7QB 2C9SA 4PMFA 5IW1B 1JD9A 3VXUE 3ECWA 3MKGA 2GPZA 3Q8CA 4N2GA 3BUDA 1IIKA 4KROB 3V6OC 4Q0XL 4RAUA 4R84A 4FQLL 4OKVB 3BHBB 4TUJA 4FLRA 1UCBH 5L88L 3U4BL 2ZYRA 4NBYB 1ED3A 5J6HA 2D0GA 4M7JL 2K9UA 4XCNA 1PG7W 1BF2A 2PO6C 3G04B 4L3EB 3KBEA 3QPKA 4MQXC 4X7EC 4XMKH 5FA4B 3O0LA 1PLGH 4MQTB 1PZSA 2AFNA 5GS0D 2ALWA 3KBFA 2D7QA 4PBWD 4I18B 2R83A 3D48R 1Q90A 4ELMB 4GXVH 2A73A 1LK2B 4IBVA 5MEOA 4G9FD 1OB1B 3TN0B 4K7PX 3VM5A 1N8ZB 2DJUA 2OMUA 1CL7H 2YD4A 3DPBB 1QFPA 4OVVA 1PZUB 3H3BC 3O6ML 5IMOA 3MREB 1U8HB 1ND0A 5DEFB 5FM5O 1MXGA 3FO2B 3UEZA 2OL3L 1J1XL 2BSCA 1LEGB 1CGUA 3BPCB 5BO1H 3S35H 1Q9LA 2HG0A 1WWCA 3L17A 4JHUA 3BUYA 5AOZA 3SGJA 3ASOB 1QHPA 4UM8A 1NEUA 2UZYA 1VFUA 2I60L 3B4NA 5CCKH 1N6QH 2XQYK 1N2RA 4FQXA 5F1IB 4JPVL 1SN5A 2BHFA 3L1GA 2A9ML 1A7NH 1FNAA 4QHMA 4YHPB 2IH3B 4EZJA 2E9JA 5GHWL 4DN3H 3I75B 4MFHA 4IOSD 2O5ZL 2XV0A 2R1XB 3TVMC 4XE0A 4AY0A 4JM4H 4MJ2A 3T8XA 1LP9B 4F8OA 2X4QB 2I07B 3QP3A 1NCCL 4CN6A 1CF1A 5CILL 1NOFA 3UGEA 1MCSA 4JHVA 4E68A 2OJEB 3SCMC 1FYTE 2WTRB 2WMPB 2OYMA 5C0DB 4NRYB 2ZX7A 4NAJA 4XNZB 2VZSA 1X7QB 4HA1A 5C7XH 2AJ3B 5AVZB 2J7LA 5HP5A 1A9VA 3PL6C 3MRCA 4NO0D 3D05A 4ZOAA 3QFDA 1KWGA 2X4RB 1KCVL 2ADJA 4N0YH 4YEEA 4F9LA 2VDNL 1FG2A 4BZ2H 4JFHD 2IJ0C 3CC5B 2W1NA 3GJEB 3MNVB 4MXQC 3OKNA 1JNNH 4JZNA 3UBXG 1CT8B 4K5NA 1A14H 3HLKA 2RA1A 4BFEA 3KMDA 3BIKA 1FA4A 4M9OA 4JE0A 1TYJA 1OV8A 4M5SA 4PVBA 3QHZH 4HWBA 4HUXB 3CAFA 4O02H 3P30H 1KXHA 1UG9A 3O9WA 3VTAA 2JXMB 5ADPL 3BVWA 4J3OH 1UQSA 4BRVA 2F08A 2XWRA 3A67L 3CD4A 1LDPL 3GF8A 5MI0B 3Q2LA 4KRNA 5J0BA 1A22B 1S8DA 1PCSA 2XRAL 1IC1A 1L0QA 2QVKA 4Z77A 3KH4A 2F5BH 3GMRB 1M6OA 1AMXA 2MH4A 1TZHA 3FL7A 2Z7WA 3H9YA 5FA3A 3RL2A 2AV1A 4B9YA 4X4MA 3S98A 3FNKA 1EA9C 1ZMYA 3FW6A 1L5GA 3MLYL 4TLSA 4DGVL 4LLDA 4GUPB 3UPRB 3TT3H 4IRJC 3BW9B 1ZIBA 3OX8B 4BGLA 2ETWA 1ZD6A 1CZ8H 3WS3A 3ABKB 1RUQH 3P11L 5FUZH 1WA2X 3D52A 1DVSA 5CAYB 4N1EA 3TNNB 2Y3NA 2ZAHA 1AGDB 4GIOA 1OAUL 3F3HA 4IS6B 1XF5B 3RWEB 3QUZC 2NCMA 4NXSA 2DD8L 1RZJH 3ALXA 4YDVA 4TF4A 3WNMA 2WNXA 4BKLB 2PMZA 1ZTXH 4G9FA 5JNYA 4OZGF 3CVCA 1AGBA 1HH6A 2OJZL 1TU2A 3IXTB 1DVYA 2IH9A 4N2NA 1OAYH 4HIJB 32C2A 3U0PA 3BMWA 3QULA 4TTDD 3S8WA 5E0FA 1P69B 2J55A 3PIQB 5DEFA 2YFNA 2O6DA 1WTLA 3GMMB 3S8GB 2BC4A 1P9MC 1E4HA 2IIJA 4FTVE 5BS0D 1OPGH 4KO9A 4ZW8A 2ZKHL 4NQVA 1JK9B 3BE1H 1XBRA 5A43C 1P4BL 3MLSL 5CZRA 5CCGE 1GH7A 3ZE2B 1AQ8A 1XGPA 4H20L 2ZSWA 4LCIH 5I74B 5HHXH 5D5MB 1U8OB 1W72A 1T83A 3ULUD 4UI2A 4URKA 1AJ7H 2VDOB 1UWEL 4IOSA 2NZ9C 4OCNC 3VYNA 2X0VA 2OSLA 5GRJL 4FN0A 2VDKL 4RDQF 4TNFA 4FQ2L 4KQ4H 1OWRM 1JN6B 2DJSA 4BSVB 3QDMD 5LJYH 2F74A 3ECQA 3P69A 4NP4L 2J5LC 4UDTB 5AAPA 1OW0C 1E67A 2X28A 4V2CB 2X09A 4P59L 3N44F 3G5ZA 3GMQA 2OULB 2Z31D 2GEEA 3P4MA 3ABGA 3RTLA 1QRND 2APXA 1PY4A 5I24A 3FU8A 4NO0A 4QRRE 1FHGA 4FI8A 5JHMA 4F8NA 2EDMA 5BZWA 4XNUH 3ATFA 4JMNA 2WOBA 3IDNB 4JCMA 5DC0A 3H42H 3EYQD 1EBAA 3VXTB 4FNRA 3QDGE 3KG5A 5ALBH 1JGLH 4G8FB 5H37G 3STBA 3P3TA 4JVPA 3HI1A 3W0WD 2ERJB 4BFGA 1BBDH 4Y2DD 2PTVA 4KWUA 1ETZB 3IDUA 4ADIA 4LSRL 5CEZH 2Y6TE 3C6LD 1Z6JT 1BF8A 3OR6B 2ZXDA 3UTTE 2AEOA 1I3GL 2CJTA 2DWSA 4FFYH 4LQFH 4YZFE 5TQ0H 2HLFC 3RBSA 1GCFA 5HPMA 1N8OE 4GW4A 5FW6A 1HI6B 2YLHA 4HUWA 1F8TL 4XO3A 1EBPA 3WAJA 5ICXB 2QLYA 2DDQH 4C54A 4QLRA 35C8L 4XTRC 2ZXGA 1YPZF 3K4ZA 3L4ZA 5AOIA 1QPPA 3CH1B 2I26N 1LO3L 2WB1A 2CO7B 1RLWA 1JWMA 3IKCA 4QTIL 1YEKH 3SKOA 4X4YA 1R0AL 1UZ8B 1WFTA 3MXWL 4N2OA 1MF2H 4UV7L 2CK0L 3U2IA 4NQDB 4FQXC 2CRIA 4ONGH 3L16A 5FW8A 3U30C 4X5PA 1JYWA 1NAMH 3QZWG 2CKBH 2ZUWA 2VXUH 4PM1A 3CFKB 4LO9A 4KXDA 1BDYA 4CVUA 1NLBH 5IOKA 1BQRA 1JFHA 3S96A 3Q05A 3PLYA 5AOLA 4O58L 2K8QA 1KCBA 4JFDB 1M71B 5GRYA 3F85A 1NFDA 4PBVC 1JIBA 4X99A 1F4WL 3MLZH 4YHNB 1A9EA 4JVUA 3LQZA 4QY8B 2YS4A 3FB5A 3MRPB 3TJEL 2J8HA 2Y1ZA 3HKFA 5A2IH 1BZ8A 3OC5A 3ZIMA 4M93C 2EVGA 2YRLA 1NMBL 2X53A 5C8JB 3P3UA 1IGML 3KJ4C 4KH9A 2TRYA 4GRMA 3NCWA 4H0IA 3U6RA 2GI7A 5BW7C 3OQRA 1JPTL 3NZHL 4NRXB 3SDAB 4LLWB 3V95A 3T1WA 1H5BB 4NDMA 2JCCE 3HUJB 3THML 1YEEH 4DVBA 3RX5A 3CHXA 3Q06A 1D2PA 4P5TB 3LNIA 5JDJA 4N2DA 1KJ2A 1SDAB 3BYTA 4P5TD 4XXCC 3EDEA 2Q8BH 4P06A 3RFZB 5A3IC 2AVGA 5KVFL 2Q8AH 2DYPD 2F53E 1OOAA 4QRFA 1OTUD 5D7KE 3UTSB 3QZBA 3CFTA 5BS0A 5IHLB 4KUZL 3ZZQA 1X3DA 5C0IA 4OLEA 3HBGA 3MN8A 1G7HA 4LNRB 2X1XR 3IDGB 3NIFE 1B2WH 4S1DC 4XAWL 2D7OA 2FX7H 5DLML 4MJ6A 1YSOA 2P42B 2CO4A 3O9WC 4HFWA 4ZSOA 3FSZA 5ERWB 2D4FA 3KLKA 3KLDA 1F2XK 5BOJA 4K3DL 3AQXA 4XVOA 3IU3A 4N9GA 4PRBB 2TRHA 5E4IA 1F90H 2HXAA 4BEIA 3RVWC 2DM3A 4ALAC 3QDMA 2MSPA 4DUWA 3K1KC 5EORL 2XWJA 4RGMC 2XZQH 3HR6A 4BQ6A 4YDMA 2FEEL 4Z3HA 4ZRGA 3FT4A 2C1PA 1SYVB 4PY8I 2Z31A 3F7KA 2UY7B 3EBGA 4PJDF 1QRNA 1E9QA 2NY5L 1FSKC 3TEUA 1I3VA 2YKLL 2G5BA 3MV01 1A0QH 2LLGA 1E7VA 2C3HA 4PTTA 4E9XA 1ZK5A 4OZFG 4OZIB 5IEKB 4WUUD 5EIIG 3UBXB 3ZT6A 3FUDA 3S34L 3WY3A 2AEPL 2H2PD 3DX4A 3GJFA 1WPCA 4L9LA 3U1SL 3BGFC 5DK0A 3W0WA 4TPRL 5JO5A 5GS0C 4Y2DA 1YCSA 1DBJH 3BO8B 4LBEA 3ZBMA 4C56B 5ANME 1OAQL 3JWDL 4OUUB 4G82A 1BJ8A 2NSXA 3TV8A 4JDTH 3C6LA 2FGWH 4PW4A 2H6UA 4UMSA 1GY2A 2BK8A 1FNGB 2ICEA 3PXJA 4IKIA 4UILL 1DQJA 3R19A 3RZCD 2ZUQC 1EIBA 4MS6A 4WGWB 4QRPE 2BFGA 2ZP9A 3Q6FB 3DVGA 3CPLB 4N0FA 3JTTB 3VD3A 4BWUA 1H3XA 3C5ZB 4HX1A 5A6MA 3MJ9A 2WVSA 2ODIA 1SOQA 2J57A 4N25A 1ZPUA 3NACL 3QIBC 3K8KA 3QUYC 4HC1L 5I75B 4X8JA 2QSTA 2E27L 3CLFH 3P4LA 4A6YB 3O2DA 2P5WD 5DMJB 5FKAB 3MR9B 4LSDA 2JTYA 4RFNB 3NT0A 2XXGA 5M7QA 3JV4B 2W5PA 4MVBD 4P2QB 1G7LA 1W9XA 1YC8A 2NRDA 4GRWB 4KKBD 5GRVK 1S9XA 2CALA 4P2QD 1S9VA 1K4CB 1S3KH 4DERA 3V4VL 4M48L 2BVYA 1JXKA 3EH3B 1T2QH 3I2CL 4GLRI 4E9LA 1R3HB 3HB3C 3LIZH 5I6PA 1I9RH 4RESB 1SUJA 2EDHA 4IRZH 4O2FB 4AJ0A 1D9KD 2D3LA 4BELD 4U1GC 3RPKA 2F8OA 4AE0A 2XA8H 3CNKA 3PWPB 2VO5A 1BFTA 1F0LA 1OAJA 1QFWL 1O5PA 3OB8A 4YK4B 4G1MA 3CCHA 2FRGP 3PWPD 3EDFA 3FRUA 5I17A 3ARUA 4K3JL 5I8CB 5DD6B 3LNDA 4OZ4B 3B7RL 3MCKA 1NQBA 3O45A 3QWOA 1GKOA 2BMKB 3LNFA 4NQXB 4QXUL 4EIGB 3QIUC 3MCG1 4FLHA 3MV8B 2WCSA 2LLLA 2GEQA 5I82A 2JI2A 3FPXA 1ZJBA 2VAAA 3MLPA 4AKPA 4TUKH 4Y7MA 2BM3A 5INCB 4D0CB 5C70A 4P5TA 4WUKH 4LSVL 3VG0L 4GPVA 4ONFL 4ZZKA 2ZCZA 4RWYH 2XKUA 2R29A 2DYPA 2BRRL 1RFDL 1AGFA 3VQLA 5JXAH 3RNKA 3HPLA 2WJ7A 3VH8G 4I3GA 3BAJA 1JGIA 5KZCD 4FXKA 3OKMA 2FBOJ 5HJ3A 4K3HA 4ZS6D 4BE6A 5C0AB 2DIEA 3L2LA 4CU6A 3LRMA 4PJAB 4QLWA 2AQQA 3UZEA 4PRPD 2FYYA 3MRKA 4Z3EA 3QWNA 2D8KA 3L2MA 1M9WA 3VRIB 2VISB 4B6ZA 4JN1L 5HYIA 1AS8A 2BVOB 2DH2A 4GMTL 1QBLL 3QUKB 3RDTD 2VH5L 5K9JH 3Q48A 1T3FB 3QZMA 3TEXA 1H6UA 1FVCA 1DQIA 2RD0A 4U7KA 3WUWB 1LMKA 3R8QA 2MHAB 3KBHE 1ETB1 3DTUB 1ZRUA 3IMRA 12E8L 4JHWL 4JVWA 4R8WH 4YSPA 4F58L 1YYLL 3PXLA 2A6KA 3HG0A 3BJLA 3RKDC 4BBWA 2IEPA 3HE6B 3QQXA 1W8EA 3D18B 3U2SB 4P5SA 1CFNB 1JTTA 4KUCD 2B0SH 2GK2A 3O3DB 4OJEH 2VXVH 4ZO7A 2QPUA 4J8RB 4U6HA 1HILA 1N7MH 2GFBB 1YJDH 1FAIL 2DQ6A 4WUUA 2X05A 4S10A 4FHKA 2VCOA 3RPIA 4QMEA 4KDTA 1SXZA 4XCFL 4WHDA 4LF3B 2I9TB 3NZ8B 1TYRA 4ZFZB 3CSFA 3CUPB 4RISL 2MOGA 2JJTC 2YGNA 2I27N 1MW0A 5AWNH 1IAKA 4P5RA 3IMSA 3H4HA 1EJ8A 1EWHA 1ZVNA 3LS4H 3PQYB 2IPTL 2OMXB 1J1OL 5IESH 1R47A 4H8QA 2YPKB 4ZQKA 4ZT1A 1FH5H 4XVTL 1IGTB 3TIEA 1QNZL 3IMTA 3KLAB 5A1AA 3RZCA 1WFUA 4QEGA 1FNGA 2X4SB 4KKLC 1I53A 3BP6A 3I3BA 5CS7A 1TOXA 1MI5B 3ESPA 3ARXA 2CBMA 5ESVB 2CA3A 1QQDB 3GSWA 4FYRA 2PXYC 4AIZB 2OYLA 1L9MA 4X7SL 2FTAA 3ROLB 1KG0A 1AIZA 2AJXH 4QI3A 4AVJA 1Q38A 1UH2A 2GIXA 2UVEA 3BAYA 1RZ7H 3GEWB 2IFFH 2VLRE 3SPGA 3JYCA 4Z7WF 4JANB 1U8LB 2OZ4H 1MWAA 1TZAA 2P5WA 3D5OF 4Z7OF 3ZE0B 3RNQA 3VFUA 2NW3B 3CZSA 4NKDB 1U8NB 5KW9H 1A2YB 3CMOL 5LDSA 3TNMA 1QA9B 2ZOLB 4MQ7B 2RCSL 5JIKA 1MFAL 1FBIH 1AQDA 2WCPA 3MO1A 4NLHA 3IWVA 4OM0L 3VE0B 3OXRB 5JORB 1D9KA 3BAEL 5C09D 3CFJA 1EJ6A 4N28A 5DO2D 3LS5L 4G7VL 5IFJB 3PWPA 2GK0B 5F96H 1NGWA 2EDEA 2PCYA 1JSYA 4H5SB 4RAVA 1HCYA 2X6VA 1AHWB 1AY1H 5C0GA 1FIGH 2CLZB 1DE4A 2BSTA 2FJGA 3F7VB 1THAA 1D6EB 4M8QB 4LAQL 3DX6B 3L3KB 3RVXD 4UV4H 1I4FB 4L9LC 3VWKB 1HSAA 2A1WH 4XMLH 3H0TB 2BHUA 3C5JB 4JJ5B 1GAFH 3NZSA 1Q1JH 1V54B 3O8XD 1P4LB 5D1ZD 5LCVA 3PWLB 4WFGD 3T0WA 5E1GA 1QSFB 1D2OA 3C6LC 4K7FA 3HJEA 4X4XA 3DX7A 3VB9A 1QSFD 4I1RA 5T5FL 4OT1H 3V7AG 2BOCA 4PRHE 1PZ5A 1UOWA 2V33A 3VVVA 4BK8A 3TBVA 4DTGH 1JZ8A 3MV7D 1G0XA 4U3XA 1BD2D 4XP1L 5GS1A 1MRFH 1LP9F 5TPWL 4QUOA 1IAII 4PB9L 4X83A 5IMMA 5JZ7D 4PRPA 4FHBD 3CFEA 1JXJA 4M62L 4F8TA 1MHCB 1JNHB 2F8IA 3GYRA 4L3CB 5GGQH 3SO3B 4AUYA 5B38G 3RDTA 4BA0A 3AACA 4NKIL 5LWYH 1CDHA 1IAMA 2VISA 3EYOB 4M1GH 4PP2A 3K8MA 5DO8A 4NJ9H 2AJYL 4I2XE 3QNZB 4MJIE 1D6VH 4HZLA 4AEIH 2G3NA 1DVQA 1S78D 1CGWA 1A25A 2G0LA 4XMVA 3HC0B 4Z78B 3U9PH 3WUWA 4JDZA 1FVDA 1T66D 1PIFA 2FNWA 2VLMD 1CD1B 4Y4FD 5I73B 3EAKA 1AZNA 1FL3A 1A5FL 2MQ3A 2E4TA 3N2JA 4D9RD 2ZSVB 4ONHB 1V5JA 5DHMC 1OF2A 2VMEA 3GSUB 1WV7T 2D9QB 4XMZA 3DUHA 4F1SA 3FSVA 1FLRL 4KKCD 4S1RH 3EYUL 3BWSA 1WVZA 2GUOB 1XGTB 1EXUB 4MXVF 4LESA 1HWGB 5AZ2L 5FUCE 5T1DH 5JOFA 4A38A 1LK3H 2E9GA 2YEQA 4JKPL 4PG2C 3V4VB 4F9PA 4LCWE 4KVNL 2ZCHL 5I6MA 4KKNA 3FUHA 1KFAH 1V3MA 4Y1TA 4AWJC 3NFPB 3VX0A 3W1ZA 5I1EH 2D7TH 4KTEH 4G9DB 1E2VA 4YUEL 3EFDL 3T0VA 4FJZA 3BC9A 4PIRF 1QBAA 2J21A 4JRXB 3ROOB 3FN0H 2FO4A 4KO7A 1I9EA 1A4JA 2PUQT 5DXWA 4U4IA 4L3AA 3ROLA 1MRDH 5KVDE 3MDJA 1JHTB 4U3SB 1IEAB 2DL2A 3WIIH 2KDYA 2W65A 3EDKA 2C5DC 4HS3B 3UABA 4JANA 2OKMA 4ZXBC 2I5YH 4DPRA 5HYJD 2H47C 3VFVB 3TF7C 3KR3H 2EO1A 4PS4L 3UZEC 3KPNA 4N22A 4P46B 1XF3A 1CK0H 5DHVB 1BBJB 3SE3A 1G84A 2CHNA 2VABA 43CAA 4HXBL 3A4AA 3DV6B 3JT2A 4JY4A 1KENH 4D0BB 1RU9L 5C09A 1RXLA 4AGNA 3DROB 5FCUH 3TP4A 1CTOA 3HZKA 4M6OH 3S4SA 4I3SH 1XEDA 2B1HH 4POZC 3BN9D 1J5OL 3GMPA 1CFMA 2V7HA 3G6AA 1DO5A 3INUH 5AW5B 3GT6A 2OR9H 5CGMA 4YXLH 3C87A 1E30A 2DQGH 4ZPVB 1G94A 3MCYA 3WEXA 1KXTB 4RZKA 2VL5B 5IHUH 2FWLB 2H2PC 3QDAA 3LZRA 3N1MC 5F9OH 3PHAA 2BP3A 4L8BA 3SDXB 4PJ5B 1HHIA 4L4TE 3UCQA 3L3KA 1R34A 4L5FE 3O8XA 2QJDA 5D1ZA 5IB2B 4JO4L 4JFTA 3VM7A 5DQ9A 3WHE1 1AHKA 4PI0A 4WFHD 1KBGH 5MEPB 3G6DL 3ZE2F 5JW4N 1WP6A 2F0CA 4JFWA 1DP0A 5D5MF 1KLGB 4MJ4A 5GPRA 1P1ZB 5FF6A 1BZDA 5I1KH 3MV7A 3P2BA 1BD2A 2C7UA 1I1FA 2BOBA 3AXLA 4H2CA 4W70A 4X6FB 1JZFA 1L7TL 2GJZA 3L3IB 2ENJA 4KMLB 4DEUA 5T3XL 4JAMA 2EDXA 4HUVA 3QPQC 1FZMA 1FFTB 1A3RH 1JK8B 2DWEB 1E9PA 1FZKA 1HIMH 2IF7A 1OSYA 1WA1X 3QS3A 4TQEL 2WYIA 5HYSB 1XCQB 1PKQB 3ZR5A 2BIHA 2XV3A 5KG9A 6CGTA 4QAMB 5G4MA 4MVBC 4TNEA 3OKEA 2FJFB 1RULL 1DZBA 2AMUA 3ZL1A 4UQAA 3K6OA 2HT3D 1JNJA 4R97C 2ESVE 2NYYD 4Y4FA 4G6JH 4YDJB 3MJWA 4Q56A 1IBHA 5AW3B 1U4EA 3ZN6A 4JQXA 4ZUVA 3ARZA 3FZUD 1TEYA 3IU4L 4POZD 1D9KC 3I50H 1MCWM 4HFUL 3TT1H 3UPCA 1NICA 4B9KC 4XPGH 4L18A 1CFTB 2OCFD 5LLIC 4LHUB 3NGBB 3CFQA 4ACPA 5LGYA 1CDBA 1UXLA 2BP0A 3ARGD 3F7LA 3ME0B 2WWKO 1PJ9A 3GBML 3MMEB 3BAWA 4PR5A 3VDCA 2ADYA 2FLBT 2XXCB 4YGVA 3W11C 1G9NH 4YDLC 3U0TA 2E7DA 3OAZK 5I1DA 5I71B 2NY2D 3K8LA 3STLB 3QXVA 4O2EA 5F7LB 3ZSTA 3BUPA 1N5AA 1HOCB 2XN9B 3I84A 1L9PA 3TASA 3E38A 1UFGA 1BOGB 4IOIA 1EJOL 4BWTA 2DWDA 3CVHL 2XWBA 3OD3A 2W81C 4AL8H 4Z7UE 2CMRL 1N70A 5D96C 1JGVH 1N64H 4TSCL 5DZPA 1J12A 1KJVB 2A6DA 4GKLA 1KEML 3VGFA 2CQVA 4FQ1L 5EO1B 4W4OC 4UINL 4N6QA 5A2KH 3VD0A 5BQDA 2EXTA 3B2PA 4OGYH 1A7OH 5HYJA 4E0RA 3PGDB 1FZOA 1SOKA 4HPYH 4L37B 3WJMA 4J12A 3MLWH 3RDTC 4NM4L 5CF3A 5DHVA 1JZ3A 3KYOA 1CLOH 3ZK0A 3EFOA 4ZAKD 4ZNCD 2BZ7A 3KXFE 5LQBH 4CMMB 2FQDA 2ATKB 5DJDB 3VMNA 3E6HA 1NANI 2IXQB 1K4DA 1ITCA 2ZYHA 1UCBL 2JKXA 3NDZE 3H3KA 3TTYA 3HUJF 2BSEA 3N41B 5MERA 1LXMA 3H2PA 3TO2A 4LB8A 5C0JB 2DLIA 3HW7A 4XMKL 1QEWB 3CN0A 5HDRA 4JFUA 3V5DA 1PLGL 2OI9C 4GAGH 4YBHA 2DQCH 5IK3A 1V8HA 3GZOA 1A1NA 3KPPA 4NN5C 4FQHB 4GXVL 3PE9A 3S7GA 4HUKB 1MPAH 2LU3A 3T3PB 2B5IC 2WLMA 1CL7L 3UOAB 4F9PC 1TPXC 4XNQA 3G9VA 5SX5H 4KGLA 1N26A 2BP8B 3AXIA 4XNXH 4X0KA 1JZJA 3AWEA 1R24B 1BZ7A 2BCKA 4R3SB 5BO1L 3S35L 2UWEB 4NN6B 3ASNB 2AI0H 1GR7A 4HS6B 4U1LA 3CDCA 3SBQA 1XAKA 2XETA 2X89D 5CCKL 1N6QL 4PI2A 4YSQA 4L48A 4LFHD 1A7NL 3RI5K 4WTZG 3V0AC 1XCQA 4DN3L 3GINA 2IC2A 3MRNB 4KHTH 5IB1B 3JXAA 4JM4L 3RGBA 2EDOA 4LRIA 2MJWA 3MJ8A 4LIQH 1CLZH 4WI8A 3ZYIA 5DYOB 3GD1C 1XCTB 4JGJA 4OZGA 3T4AB 3FS9A 4LPWA 4OZHE 4KKZA 2VMDA 1DO6A 3EJTA 3NA4A 1AXSB 2IH1B 5I8OH 3RA7H 2B08A 5C08D 4GG6B 1OK8A 5CXPA 3HI6H 4MD0B 5DSCA 4W81A 3JV0A 4DOHB 5C7XL 2IMNA 2OR8A 1T7YA 3WFZA 5DQJB 1KIUA 3ARGA 3ABMB 2R2HB 2WXPA 1MW2A 2LV4A 5DJ0B 5ICUA 3PP3H 2H32B 4NZJA 4N0YL 4JRYE 3PUCA 5C3LD 2V2TA 4BZ2L 4ELDA 3CC1A 4J3OG 2V17H 3RVXC 1XZWA 1C9SA 3PREA 3WN6A 1JNNL 4QHNA 4AK2A 2ITEA 1RD6A 1YO4A 2CAKA 1A14L 3O8XC 1LO4H 5D1ZC 5BQ7A 1S7WA 4O00A 5T3ZE 3SE8H 1F11A 4IBUA 3WTYA 2WXNA 5E8PA 1SY6H 3QHZL 3O3UN 3MOQA 4O02L 1QSVA 4N90E 3P30L 5KVDH 3LIUA 3WENA 2AF2A 2LOEA 4QYOB 5DLLA 2GSIA 1Y0LA 4HGWA 3FK3A 1L0YA 4HD9A 1WAAF 1XL6A 3L3DB 1HQRA 1O0VA 4J7RA 3IJ9A 5IM7B 4HG4J 1TMCB 3R0MA 1G1YA 4V1DB 2F5BL 2OJ1A 4GB9A 4B95C 1T4KA 3TOPA 3KCPA 1KWKA 1IKFL 2Y4SA 1KPVA 2J56A 1CC3A 2W0KA 4ZAKA 1S78C 2AK4D 1S7VB 4L1LA 5HDBB 4FA6A 4HCFA 4BFKA 3L2NA 1JGUH 4MAUL 4UUJB 1OQXA 4UOQA 4Y4FC 5KSUB 1KJMA 3TT3L 5D1XD 4EUPH 3WL9A 3BZFB 1CZ8L 2NY0B 4U0QB 4B7IA 1RUQL 5FUZL 5ISZE 1FFRA 2XTJE 1CCZA 1UB5A 1NIDA 1YPZA 3IJEB 4M1DH 5DZLA 1AANA 4L5FH 5EO0B 5IFAH 5L7XH 2R2CA 4FLQA 2EIEA 2ICWJ 4KKCC 1AKJD 1RI8A 5JHLH 1RZJL 1ZTXL 4G5ZH 4GP5B 2NSQA 2MRYA 5GS3A 3CVDA 4O2CA 1PAMA 4HJGB 5GISH 1WF5A 2AZUA 5IGXH 1OAYL 2GSGB 2Z0BA 5FHBH 5HGBB 1RSYA 1B4RA 1KPUB 3D06A 3RU8H 1P4UA 4Q97A 2B1OA 1U8QA 3DBXA 3MJGX 2WQXA 1OPGL 1IZJA 3DO3A 3KLLA 5MHSD 4JFVA 2CRZA 4JKKA 3FQYA 2J2ZB 4HJUA 3BE1L 2YN3A 2I7SA 2X89A 4LCIL 4H8WH 5HHXL 4F2ME 5K9OB 2APBA 1KNOA 5E08H 4IBSA 1AJ7L 2DPKA 3GXIA 4QHUB 2QKIC 5F7BA 5FGCB 4A67A 1R33A 1DL7H 2A6JA 4OD3H 1HH9B 1ZHLA 3MRQA 5DF0A 5I9QB 4KQ4L 5LGHH 1EK3A 3DVNB 4FAAB 5CEYB 1YUKB 4LLVA 4R4BB 3VXPA 1EFXD 2VERN 5E9DD 3K6SA 5C08A 4XE5B 1J05B 2V9QA 4BA8A 4QPEA 4RDBA 2R2EB 4R96A 3UACA 4HF5H 1ROCA 2W0FB 7FABH 4OUOA 5CINH 2DQIH 5I1LB 3ZDZF 3BN9C 1QX1A 2YA0A 4XNUL 2Z4TA 1JAEA 4UNIA 4NOBA 2EICA 2R2HA 3AVEA 2BY1A 3D3VB 4BIKA 2GG1A 3P77A 5E8NB 3H42L 3HE7D 3VYPA 4O9HH 1JPST 3W39A 3WTUA 5EUKA 5ALBL 1JGLL 4Y1AD 4B5EA 4DVRH 1Z7JA 5DC9B 2KL6A 4A7UA 4APQD 4XX1G 1BBDL 2EDYA 3DXAE 4HJSA 5CEZL 2N59A 4L8SA 2AEIT 2LR4A 3O3BB 4MTMA 4HIEA 3X1NA 5TQ0L 2OX5A 1G43A 3BGMB 4FFYL 4LQFL 3ZE0F 4AGMA 3P9LA 4OCYH 1B88A 2DRUA 4JM0A 1OP5H 1I8IB 2KLRA 2NNXA 4KPHH 4PCSA 4XCEA 2QMJA 4PJDA 3BVTA 2DDQL 4TKWA 3KDMB 3FUJA 4AYSA 2LTQC 2H26B 3W9DB 4G8GB 4OLXH 4AUUA 2UYLA 3QZOA 2MCMA 2OMYA 4HK0B 3U1PA 4ZYKB 1O6SB 3PNWB 1N6UA 1YEKL 3PWJA 3ZKXB 4DCQB 1MF2L 1QSEB 4YSDA 3ES6A 5DFVC 1CU4H 3QXWA 1XEUA 2BERA 2MTAA 3LRKA 4S2SB 4ONGL 4W9JC 1UFUA 1QSED 1VCBC 2MPAH 3RL1A 1NAML 4UQEA 3CIQA 2CKBL 2NY6C 3FAWA 2VXUL 2VXTH 5T1LD 4X6DB 3ULVF 2AK4A 3L4VA 2BIMA 3HTLX 1NLBL 3MNMA 4LRIC 1HFUA 4CSSA 2C9XA 3BPLB 2HT3C 5E6YA 2VKXA 2WBJC 1F1GA 5KTEH 3LV3A 5D1XA 1ZHNB 5DEZA 2VN3A 1FNHA 3PV6A 4HHAA 5SWSB 2XHNA 4LVOB 4NN7B 3GXMA 3N42B 5FO7B 4XWOC 3WG7B 3MLZL 4L0YA 5D8JH 1YY8A 3CSGA 2FH8A 1CQKA 3BD4A 1W0VB 3D1MC 5E1AB 4PHXA 2ADGB 1KGWA 3ARGC 1XGUB 2VTFA 3P3YA 1F4HA 3AREB 2IQAA 5E56A 2YD7A 4FNLH 1AKJA 3I6GA 4UIMB 2C3VA 5EBWB 3C8HA 4XO4A 5DMIH 5E8EB 6PAZA 3M07A 3BPOB 3C8KB 1ZANH 4DP7X 4AMKH 4X7DC 2NY2C 1FI8C 1SHSA 2Z4QB 3VXRD 1YEEL 3X14B 5I23A 1DJGA 4AE1A 3DLQR 2F9BT 2D3JA 4DGWC 3DURA 5IHWA 1U3HD 5F3BA 2YQ2A 3HAEB 3D39D 4R6UA 2Q8BL 4WU7A 5ID0A 1L6XA 1VB9A 1RUMH 2JV6A 1G6VK 1UA7A 2BNRE 4PJ9B 5IBUB 2Q8AL 3FF7A 1XAUA 5H35B 3UAJD 2P44B 5C07D 3DSFH 5IWLC 3M1CA 4WY7H 1S6NA 4KMQA 1B2WL 3FT9A 4QIRA 2FX7L 3H2WA 4PWKA 1SBSH 4J3TA 5AL8A 5LAPA 2GJ6E 3WIFA 2CJSA 2F7QA 2YRZA 5ENWA 4GQ9H 1JWUB 1DBKH 5EN3A 1FC1A 2NUPA 3OQ3B 3GTNA 1BVNT 1KBKA 5BVPH 2O6PA 1QO3B 1F90L 4X7TB 1HL8A 2IGFH 3V6OE 1KB5H 3IETB 5BRZB 2Z7UA 4AENA 3HRZA 3MGTB 1EFXA 3I9IA 2R23B 1UM6H 2V9RA 4R2GD 5E9DA 1OEZW 2XZQL 3DVNA 3E8UH 4Y4KD 5EEVA 5IVXB 2ZT9C 2AEQH 1OLZA 4ZAKC 3RUGE 3KPSB 1FGVH 4EDWH 3BCDA 4ENED 4K23H 4O02B 1NGZB 1IGFH 1UM4H 3T0EB 5KBDA 1A0QL 2HKAA 1R4XA 1ZSDB 3IFOA 5CZXD 1ECZA 2ROYA 4DKEH 2V0AA 3NFSH 5IEHA 4ZFOL 3N40P 5GSVA 5F71A 2X7LB 2O5XH 2B39A 1IQDB 1RIHH 3HE7A 3DX3A 1SYSB 4Y1AA 4W9EC 3PWUB 4GINA 4HKZA 4APQA 4MYPA 4YZWA 1BW8A 4S0HA 1DBJL 3RGVB 1RK1A 1L6ZA 2EQDA 3LZPA 2Y5QA 3NA9H 1NOAA 4JDTL 5E9NA 3NQIA 5KANG 2FGWL 5LB1A 5T3ZH 3RGVD 3SE6A 1T0NB 1S7TA 2L0DA 2NXYD 5KN5B 1IFGA 2JTDA 3RWCA 3ARFC 2R8SH 2E75C 4FQQA 3RURA 2G2NA 4HJ1A 1TVHA 5FYLE 1TKWA 3LH2H 4Y5XB 5JPNA 1E4XH 3BQUD 3DECA 5D7JD 4Y9FA 3QEHA 4HD5A 4D0DB 1DVFB 2CRYA 5HHVH 2OW7A 5L8LB 2R59A 3K72B 4MCMA 3FCGA 3O3EA 1DVFD 3H8NA 4F7KA 3DX9B 1S7UB 4GXUN 3LEVH 5DD3H 3CLFL 1KN4H 5F3HB 1XB8A 3LN4A 1SLVA 4GW1B 4D94A 1EUTA 5FECB 1BJ1J 4W6XB 2VW6A 1BX2A 1TZGH 3R8BB 5T1LA 1AH1A 1MY7A 4PJBA 1UT2A 1S3KL 1R46A 3E0GA 4NQEE 3ZHFA 1T2QL 4ZO6A 4K2UH 3LIZL 4APXB 1GIGH 1I9RL 1MZYA 1ONQB 4CGUB 8CGTA 1I7RB 2NX5B 4IRZL 2DWXA 1AZZC 3SDXF 3V79C 2XA8L 5E8OB 1AD9B 5AB0A 1O6VA 3LKRA 1WQVT 3E3QE 3UL4A 1A02N 3FHAA 4GEJA 5ABDE 3G6JE 2OTWA 3EF4A 5DEGA 3REWB 4E41E 1ZV5A 1TCRA 3QXDA 1HJBC 3UBHA 3CDGA 4Z7WA 3WKQA 2IANB 2CNZA 1DVZA 1UASA 2HG5B 2YD0A 3ATEA 4GFTB 2EYRA 4MD5A 3U9UB 3VXRA 1NMCB 3X3FH 4DIXA 4XWGH 1WIPA 5GZND 2X41A 4TUKL 3C09C 4KO5A 3C6SA 4FQIH 1U3HA 3EJZD 3G3LA 3TBBA 4AXWA 4WUKL 3D39A 4RWYL 5F7FA 5LHDA 2ZF8A 1IGYA 2HTLC 2A6IA 3HAEA 1YQ2A 4P2RD 3UAJA 5C07A 5JXAL 5DHYA 5LXVA 2NQDA 3O6FD 4I9WE 4OF3A 3RG1C 2MEJB 5D7IE 5H35A 1HSBB 5SX4H 2Y6SD 5CKAA 1SEBB 5FM4A 3VWJB 4ANUA 1QG3A 4NQCB 2DQJH 5D70H 3TZVD 4F24A 3TEYA 1WCBB 4TS6A 1BA9A 1FL6B 2W88A 3UBGA 3U7YH 2WLLA 5CJXC 3QFJB 4NT6B 3B37A 3HHSA 3QJFB 5K9JL 1UVQA 4EDXA 3LKSB 1TVBB 1DJWA 1FFQA 4TULH 5EG6C 4AT6B 4HMCA 3G5XB 3EJRA 4Y4KA 3IB4A 3K1DA 1P84K 2AXHA 2XBTA 4R8WL 3HPJA 4F8LA 1AMYA 5CCHE 4PJ8D 4WAFA 2YQGA 3A6OA 3LN9A 3MRHA 2B0SL 3CZFB 5D7HA 5DJ8A 2VXVL 1KB3A 3L5JA 3SQBA 5D1XC 4Q6IC 3FCBA 5EFIB 1N7ML 1SHWA 4AX3A 1YJDL 2W60B 5D2NE 5I1IH 1OGAD 2CM6A 4UT6A 3SGEI 3NRQA 5CMAA 5BRQA 5CJOH 4G43B 4ZOBA 2LU4A 3DYMA 3OJ2C 2XNAB 2A3TA 2WO3B 3NCMA 5I66B 5JW5A 4RFEB 3VXUB 4TQPA 3LS4L 5ID1B 3VJ6A 4P2OB 2CKBB 5IESL 1P7KA 3RGVA 1FH5L 3PP4H 4RMVA 2ZYIA 1IAIM 4L8CB 2CLRA 1IEHA 1J5HA 4CC4A 2BS71 1I8UA 2X9WA 3K7UA 1UB6B 3BQUA 5D7JA 4YOKA 1MFVA 3SPJA 3KPTA 4M7LH 3H9ZA 5JDSA 1DVFA 2AJXL 3NCCB 4WIQA 1RZ7L 2IFFL 1A8ZA 4HJJH 3MNZA 5DZVA 4G6FD 1K3ZA 2R4RH 1TETH 1F4YH 3FUEA 2OZ4L 4ZUSB 1S7UA 2CO6B 4YBQC 3UX9B 3NN8A 2D7PA 4EIBA 3B1TA 4N5ED 4E9SA 1SN2A 5GSRB 3VXQB 5CHNA 2OM5A 2CUMA 1FJ1A 5CP3A 5KW9L 4MZIA 1NBVH 4G8AC 4HH9B 1IM3B 4FG2A 4UDUB 3FUKA 3OLIA 1A1OA 4S0SD 3A5VA 4AQOA 1IM3D 3HRZC 3TCXA 1FBIL 5E5LA 3E2HC 4CU7A 1GJUA 2D7MA 2FUQA 4NKMB 3UAAA 5B39A 3GZPA 4K8RH 1ONQA 3EGXB 3PABA 1WFJA 1VENA 1XVSA 2R0WH 4ZMPA 4LPXA 5F96L 1ZT7B 1CBJA 2EYTB 3OMAB 4XBGA 1WYJA 4HIQA 1AY1L 5K59F 1IM9B 1FIGL 1WH0A 1EGJA 3DIFA 3MYZA 3REWA 3WE6A 4P23B 4KK5C 2Q0ZX 1QTPA 2IAMD 4UV4L 5F7WC 3DGGA 4CGTA 2EVFA 2A1WL 4XMLL 1MVUB 3D07A 3DYOA 1FYTB 4IGBD 1J0HA 1IGJB 5CSZB 5GZNA 1GAFL 4KV5E 1MDAA 1Q1JL 1C16A 1A4CA 2FLMA 2NY1B 1HHGB 4K5MA 3FOMB 1EHKB 1MNUH 2NY1D 4Y4HB 1E50A 4P4KC 1PNCA 3R1GH 4KJPC 4K5OA 3NH7H 4P2RA 1KMGA 4DETA 3EBHA 1UWXH 4FZEH 3HS0A 4OT1L 4R7DB 4XNMB 4Y19D 1HK6A 3O6FA 4DTGL 1LE9A 4PGCB 1HS6A 3ELAT 43C9B 1J86A 2WXMA 2YA1A 1ZT1A 3CBJB 5JPNC 1MRFL 4BSWB 3HLAB 2ZKMX 1OAXH 3CHQA 3DKHA 4D8OA 3TZVA 1PZBA 5CR8A 3QJXA 4MMZA 3FB6A 3PYCA 3BZ5A 4LSQH 1EVTC 4Y16B 3DOSA 2BSSA 3MRLB 4M7LT 5EBMB 4MDIB 2MTPA 4M7KH 5GGQL 5LWYL 4GW5A 4M1GL 4Z5RB 5D7LD 1GOFA 4NJ9L 1M7UA 3B9DA 1D6VL 4H1LH 2QADB 2P45B 3KPOA 2YGQA 1TVBA 3MLRH 2COVD 2FT7A 3MBED 4KXZH 3WE1A 3U9PL 4U6XA 1MVFA 3BP7A 4ZODA 3TBYB 3QG6B 1VFOA 1RZGB 4PJ8A 4UOW0 4W4NA 3VW3H 4Y89A 2ICCA 3MC0A 5EU4A 2O6EA 2XWZA 1M1SA 3FTVA 4OFYD 3VRLF 2QLVB 1BIHA 4K9EH 3B8YA 4PJHB 4UQIM 2EZ0D 1OGAA 4M9PA 3H4FA 1VGEH 4GKZA 4R4FH 2ZF9A 4RNRA 4S1RL 3S48A 2K9FB 2Q2EB 2Z8WC 2CXKA 4LASH 1JV2A 4BJLA 3TBCA 2FR4A 3FT0A 1RJLB 5T1DL 1NEZG 5I66A 2R7EA 1D5MA 5E00A 1KGIA 2K6WA 2QQLH 1LK3L 2APTA 3GKZA 4Q74A 1RJYA 1JZ4A 4PJIA 1N19A 3V6ZA 1A6WH 4KROC 3GHBH 3GSRA 4FL4C 3S37X 3TPUB 2MPVA 5FYLH 1QZNA 1NTDA 1K2DB 4TNWK 1TO4A 3MODH 3HIZA 1PG7H 1KFAL 4MDJA 3MNWA 5DU7A 1AI1H 3QH3B 1C12A 3VAEA 5DVPA 1NSNH 4HIPA 5I1EL 4FDWA 4N2EA 2D7TL 1YQVH 4KKQA 4KTEL 5CD3B 3GS4A 2B59B 2G2RB 2QZQA 4H8HA 3FN0L 4PRID 3UAJC 4WWNA 1SJEB 3B7TA 1FORH 1MRDL 1TCMA 5LBGA 4X9BA 5D4HA 1KF9B 3WIIL 4A68A 1S9KC 4ATWA 3VA6A 3WNPA 4ZUSA 2I5YL 4RA3A 1CMOA 3QA3B 3KR3L 3LAFA 4YHZH 5E6RB 2HLEB 1CK0L 1KIRB 1ZGLM 4X4ME 1AGEA 2RIKA 3RJDA 4PWJA 1A7QH 2N7AA 2NTSP 1T1WB 3CIAA 1BZOA 3FJTA 5BZDB 1TUPA 4Z7NF 1KENL 4R2GC 3GSQB 1OCRB 4FTVB 3QUMH 4Y4KC 3X1BA 5FCUL 4N8VA 3RB7A 1NCDH 4M6OL 3BP5A 4I3SL 1XGRB 4ATTA 2B1HL 3EJSA 4DFHA 1MHHB 3OSVA 4PBXA 4L3EE 4TV3A 4GS7B 1EO5A 1YECH 3QJQB 4W9HC 1QD0A 3L5IA 5CZXC 3M88A 3INUL 4RIRB 3F5WA 1R5VB 3EGSA 2OR9L 1NCUA 3KPQA 1KTDA 5EOQH 4HS8H 4YXLL 3VFOB 2DQGL 4XP9H 2QFPA 4I89A 4G9FE 3CFCH 4PJGA 5IHUL 2IAMA 5F9OL 2O5YH 2ITFA 5EPMA 4IGBA 5BJTA 5IB3A 1ZA3A 4A2LA 2OL3A 4NOFA 3VFMB 4WV1B 1CS6A 4M4PA 4Z76A 4HOMA 1PTZA 2OYKA 3DO7A 5TQ2H 2OQJB 2HTKD 1F41A 5EEYA 1KBGL 1MJ7H 1OWWA 2NXYC 4M5YH 3A4EA 4AQ1B 4UTAH 4QRRB 2ZUVA 3MRRB 4YE4H 3T0XA 4Y19A 3K5SA 2PETA 5I1KL 3VGBA 4NUJB 4R7DA 1HN1A 3BSZH 3A3YB 1J11A 3F83A 4H13C 4FYSA 4M8UA 4TUOA 5D7JC 3QVAA 1ICTA 1IFHH 2DI9A 3ILQC 1FO0A 3QDGB 4UQ2A 4FG6D 2KZBA 4MASA 1A3RL 3IWUA 4N2KA 5TF0A 4FG4A 1JVKA 1PIGA 1HIML 1TTRA 3GGWB 2JKNA 1VFBA 2Y7LA 4X2UA 4B3VA 4X8GA 2D0HA 1BLNA 4NUGH 4W6YB 5D7LA 5EF2A 1NAKH 1U36A 1VERA 3UTTB 2EEDA 4QHLB 2A83B 5AD0A 3DVIA 3EUDA 4PWEA 3MBEA 1FFOA 2P5EB 3CBRA 2YPVH 1UKTA 5IB5A 3OF6D 4IDLA 1KXVA 4WWID 2P52A 4G6JL 2P5ED 5I1AA 4JO3H 3L5HA 3QG6A 4OFYA 2J71A 4MKTA 2VWEC 4TOYH 4AOFA 3I50L 5HJDA 3TT1L 5KBPA 2M2DA 4XPGL 5AUMA 3M1OA 4OD1H 4ZX5A 3IMVA 2EDRA 3SPVA 1BJMA 2QVFB 1LO5B 2VR7A 3I6LD 4JFHE 5E6IB 2X40A 1BQ5A 5C0CB 4HLEA 2Y7MA 2Z6FA 1JVLA 5CSGA 5EC2A 5E6ID 4NWTH 1L7IH 3HZMB 1G9NL 5ECGA 1ADQH 5C0CD 1FRGH 2ICWA 4G6AD 5SWQA 1MSPA 5BNXD 1MFDH 3Q2VA 3FTYA 2DQMA 1P53A 1A65A 1B0RB 1I1YA 5LGJB 3FHQA 5GZNC 3C9NB 3AU1B 3QO1B 4LKCA 2VGLM 5HGHB 4AL8L 1G7PA 4XNYH 4CMHB 5IQ9B 5HHNB 1JGVL 1N64L 2K4WA 3IGAB 4PRIA 2GTWB 3MFFA 3KYNB 3LPGA 3O6FC 1FZJA 2VO8A 1R3JB 4PG9A 2Y6SC 4HISA 4X6DF 2E56A 4ODVH 5ITFB 2AJSH 2JCCB 3OKLB 3TZVC 4OGYL 1A7OL 3TJPA 2YQ3A 4MMZC 4NC1E 5JW4M 2QQNH 3WLBA 1RQ5A 2XVGA 2BNUB 4WFED 4YHOH 2E46A 2JKRM 5BV7B 4HPYL 3N42F 4G72B 1HHHB 1NCAH 5CN3A 4CILA 4PSPA 1R5IA 1TLMA 1YEWA 2FJHB 3P73B 1CLOL 5EU3B 1UJTA 4WTWA 3TFKC 4QF1A 3C60D 5LQBL 1NFDE 3NIFB 3HN3A 1AOZA 2E8YA 5F7UA 5HVHB 2X4NB 3LCYA 5E95B 3US0A 1UEMA 1R3LA 1FN4B 2OMZA 1VGKA 1HHJA 2OXGA 2LGNA 2AEWA 2XV2A 1L0XA 3BVDB 3FH7A 4F7CB 2F7PA 2W07B 4GAGL 4ORGB 1ZDSA 1DBBL 1I8LA 1WAAA 2DQCL 2VQ4A 1YEHH 3BXNA 3MA7A 2D31A 1QR1A 3K6FA 4NC0B 3EOAA 1L3WA 1KGXA 5CLXA 4JNXA 1A6TB 2L7UA 4C4KT 4MHHG 1DSWA 3K4DA 5K39A 1MPAL 3VCLA 1OSPH 3LRGA 2QEJA 4FFWC 2DW5A 1QPKA 4QRUB 2VR4A 5IMLB 4NZ8A 3D2UB 4NPYB 3BZDA 4GBXB 3V5HB 4XMPH 4JFED 3GRWA 2R39A 5BS0E 3T8MA 3ULVD 3FCSB 4GBXD 4IIQB 4G83A 5EZLB 2WN3A 4KZCA 3B3IB 4TRPH 4XNXL 2AS5M 2A77H 4L3FA 1CURA 1ZOXA 1PX8A 2CIIA 3K6DA 4Q89A 4ZSOE 3ULUE 2AK1H 3NIGE 1U21A 1IIIA 2NTFA 1A3QA 2EACA 4LVHB 2AI0L 2DZEA 4MLSA 5ANMB 2WZ6A 1RJZA 3ORJA 5TE4H 3GO1H 1N0LA 4YNYA 3ARDB 2FX8H 4UT7H 3MQIA 1MFBH 4JFZH 5HDWA 4N5EC 1YZZA 4LOFA 3J8F7 5CCJA 4F7EB 4KHTL 3ECUA 4J3OF 4QRPB 1BMGA 3QRGH 2N56A 4LIQL 2V5SA 3OF6A 1FC2D 3PY9A 5I8OL 4GQRA 4S1QH 3RA7L 1DQTA 1XD1A 3HI6L 5FKPB 1EEYA 4QJ5B 5JYLA 1U8CA 3ARBD 1FLTX 1Z9NA 1TQCB 1WA0X 3ZPDA 2HX8A 3X11A 3X13B 3MRGA 2YPLB 3FF8A 4LOUC 2CH8A 2XN1A 5IP4A 5GZOC 4MD4B 3OXSB 5E1QA 1TZIB 2YPLD 5AVUB 4R90H 3W0WE 2WPGA 2EUWA 2OMBA 2JSFA 5E6IA 1AZUA 1S7RA 4OCMC 5C0CA 1K6QH 3BD3A 3KM2A 5K93A 4BD4A 4PLJC 1O9VA 4XB8A 5C6TH 3VQ1C 2V17L 2IAMC 3NRFA 4HWBH 5AVRB 1T5KA 1T7VA 1U3JA 2IDQA 4PGDA 5H37A 5A2FA 4OF6A 1LO4L 4KOCA 4NQSA 3SE8L 2TSBA 4RMSA 2AJZB 1SY6L 1P5UB 2B3IA 4MNHB 3T6XA 2QPFA 4M61A 4KX7A 1K8IB 2Y5TA 5MEND 5KVDL 3ZZSA 1LL1A 3QJSB 4Q2ZA 3ZTDC 1JOIA 1R3JA 4NNYB 3OSKA 3SY0A 1S9WA 4R0LA 3CDZB 1H5BC 4MCZB 4EUPG 3CFBA 2HLAB 1AGCB 2NNRA 3V9CA 3TC9A 4MBOA 2X6CA 5DJZB 4NO5B 4F7PB 4XXWA 5GGSY 2UX6A 2EEXA 3J07A 4IBWA 4BRJA 3RFZC 2QL1A 3FT1A 5ESAB 4LPUA 1F5WA 1ID5I 3C60A 1TQBB 5F0LB 3R4RA 2DM7A 3MBEC 2EIMB 4QRTB 1BMWA 1MREH 2E6JA 4RX4D 4C47A 1F3DH 3AMLA 5AOKA 3H55A 1AP2A 1JGUL 1KXVC 1B4TA 3FB7A 2VDQH 4MBRA 5F70A 3RTQB 3C6EA 3EG9B 4ZZFA 1LEIB 1YY9D 2YC1A 1NGPH 3KHQA 5EU5A 4B9IA 3L3JA 4AQEA 4K15A 2EZ0C 1PEZA 5C0ND 4F15B 4E5XB 2FJSA 5BO0D 3LRLA 2NY4D 4M1DL 3TH3T 1VKXB 4L5FL 4R5TA 3RAJH 3RP1A 5IFAL 3CV5A 5L7XL 3MRIA 5JHLL 4M1CC 4UTBA 3W82A 4HIHA 4G5ZL 4FZ8H 4U6VH 1VFMA 1WWBX 5I76A 4YHLH 4IBTA 3AWGA 2AXGA 2JI3A 5GISL 1OE2A 5FYJU 5IGXL 4OLWH 1WHPA 2BWIA 1NLDH 2P8MA 4JFEA 1JGEA 5FHBL 3WY1A 4ZW3A 1KCLA 1M7DA 3L95A 4XCYA 4GBXA 3UZVA 2VW7A 4TNVF 3VG9B 5IOPA 1HWWA 5I5RA 3MLTA 1XZ0A 3RU8L 1W72H 3SEPA 4JFQA 3H56A 2Z34A 3GSXB 4DAGH 4Z95H 1DDHB 1J0YA 3TESA 4KZEH 5DWUH 5JXED 2G5UA 3LEXA 5K69A 4H8WL 5GRUH 5BOPA 2LT9A 3T9WA 1JFQH 5JUEH 4ZFGH 4QR7A 5E08L 1JVOA 3VFWA 1ESOA 4HKBA 2YWZA 4IMLA 1O6TA 4DPCX 1DL7L 5DC2A 1ZJAA 2WVUA 1HESA 1H9VA 4OD3L 4RETB 4WO4B 5LGHL 2WINA 1W91A 2DQHH 2RJMA 3Q01A 2Y7SA 3IMBA 5B8CA 3STZA 4X6BB 2C9UA 3L8QA 1Q94B 5BVJA 5DFTA 3ARBA 3BP4A 3EKCA 4KJYB 4X98B 3IS1X 4IEFA 5E1IA 1KACB 4HF5L 4WUUE 1P7QB 1M57B 5CINL 7FABL 2DQIL 2WXFA 2ZOUA 5I75C 1YUHB 3FU0A 1ZK9A 3L3OA 2OAAA 2BRQA 5DUBB 2J25A 2YPLA 4PRAA 3FFDA 3X12A 3NOIA 5GGSA 2X4UB 2B9AA 4K5LA 2M8XA 4N24A 4OZFA 4O9HL 5C0EA 5EIIA 1EJFA 1XR8B 4DVRL 1I8LC 4AM0B 4DHLA 3QG7H 4IBYA 1DLHB 1WWAX 3JV6B 3KPMA 3ML8A 2BSRB 3NCYP 2RHEA 2C9PA 3LZLA 4PJEF 1DANU 2H2SC 4WWOA 4F7MA 4Q9BA 2HTKC 4A37A 2XQ0A 4HC1A 2NY3D 1OP4A 2Z1KA 1U8PA 1ACCA 1J9TA 4OJFH 5T1KD 3VGAB 4OCYL 4PWIA 3DI3B 5DFWH 4YK4C 3V55A 4KAQH 5MENA 1NC4B 3DV4B 3RJQB 4KPHL 3QHTC 4NI6A 3ZTJH 4MXWH 2P5WE 1NINA 2YFOA 2GJPA 3CWGA 4OLXL 5H8DA 2O72A 1A6UH 2KBGA 3VFNA 4X8XA 2VE6B 2R69H 4EI6A 3P9MB 4P2QE 4W1TA 2HN7A 3HR5A 1CU4L 1G9EA 3HHRB 4GRWE 3WO3B 4J2XA 2BPBA 5IVOA 2MPAL 4I3RL 3UZQA 5A7BA 1S5HA 1NFIA 3T1FB 2VXTL 4PRHB 4JN2A 3LZNA 4UZGA 3UYRH 4G2AA 1OK0A 4RX4A 1T04A 3NEEA 3IVKA 1E3ZA 3MI6A 2LHAA 5KTEL 4K73A 4N26A 3PWPE 3ESMA 4EKJA 2EDFA 2APWA 3FU7B 1AG6A 3BN3B 2NMSA 4LRNH 2HFFB 5IY5B 4YAQA 5D8JL 3GXNA 1KBBA 3MGOA 3B2UC 4IMKC 1QVOB 2VN4A 1I31A 4UMGA 1E4WH 2ZXBA 4HUMB 4MJIB 4I5BB 4FNLL 2EJ1A 4IKLA 5KVEH 1I85C 4X6EB 5DMIL 3PDDA 1S7XA 1ZANL 1ZXQA 3EYSH 4NI3A 5E2JA 4AMKL 4G6AC 1HE8A 3HE6C 4U1SB 5HI3C 7PCYA 5HYQB 4OJYA 2VJ8A 3B43A 2FSEB 2VJXA 4ISVA 1G4MA 4PLOB 5D2LF 3FH8A 4CC0A 4M4RB 2OW6A 1RUML 4CVZB 5D72H 3ULUH 2JB6B 3HZYB 3DSFL 2VDRH 3K80A 5FLUA 5C0AE 4WY7L 5FO8B 1JMZA 4PRPE 5JXEA 3EUUA 5JMRA 1AACA 2VDOH 2WN2A 2YAEA 5AFAA 1SBSL 3VH8A 2BSDA 5DI8B 1QABA 2YUVA 3WMSA 2G4EA 4GQ9L 1DBKL 2AQ3A 4F37K 2F54D 4O51B 4Q9RH 1Z5HA 3NSJA 4R0LC 4LCWB 5BVPL 3HBPA 1ILSA 2EIJB 1GVIA 1KB5L 2IGFL 1DN0A 2ZKYA 1Z0NA 3U4EA 3ZY7A 4AM0Q 4EF3A 4NJAH 1BG9A 1UM6L 4FCAA 2H0PA 5EZJB 3E8UL 4PY7B 1UXSB 3BEVA 2AEQL 3C60C 4EDWL 1FGVL 2YQBA 1K85A 4K23L 4J1UB 1BVKB 1IGFL 1UM4L 1CGTA 3GJFH 3EH4B 5E5MA 1I8KA 4I48B 5ELIA 4QXGH 3SQOH 3OZ9H 4AYEC 4DKEL 4GSQA 3NFSL 1U8MB 3TYFA 4QT5B 2Q7NA 2FWSA 2O5XL 1TLKA 1RIHL 3D6GA 2Q76A 2ZJSH 1AS7A 4HCRA 4N68A 2YD3A 4JPWH 5IR1A 3FN3A 4A7GA 3ILPB 1OB0A 3ZKMD 4HETA 1KYAA 3FQWB 1S7QB 1QUPA 3OHMB 1OP3K 3NA9L 2DH3A 5HHPB 5T3ZL 3W9EB 1O7VA 3FTXA 5J13B 1IMHC 1I1RA 5A16B 2IPUG 5ICYB 3QGVA 5LNDA 2R8SL 1NL0H 2VC2H 4AVIA 3BCFA 3P4NB 5T1KA 3T6QC 3W3BA 3LH2L 5IHZA 1E4XL 4M8VA 1DFXA 1A3ZA 4YFLF 3OR7A 4CVXB 1NUDA 3D51A 5HHVL 4Y9CA 3FTWA 4X5LA 1Y07A 5AVVB 2H9GA 4JDEB 4U1MA 4L4TB 4NCC1 5A2BA 3PHOB 2HRPH 3LEVL 5DD3L 1KN4L 3HG3A 1IC5H 5DRZA 1ZVYA 4HAKA 3O11A 4HSCX 1DJSA 4G59C 3P9MA 5K9QI 1XGQB 4RRPG 3H9SD 2WV3A 4IU3A 1TZGL 1WS7A 1TJIH 2NY5C 5CBAB 2OMTA 1XH3B 5HGGS 2YXVA 5DS2A 1DVXA 1ZGLA 1X5GA 2DLHA 3DMMD 3T4YA 2ATPB 2BP5M 3BDYH 4MJ5A 5E4OA 2C26A 4K2UL 5LBVA 3OPUA 1GIGL 1BFVH 5B8CC 5IVZB 4F7TA 1RP9A 4YEFA 4OI8A 4D9QE 3PAVA 5F7EH 2Y9RT 1UUNA 3BDXA 1NGXB 2CA4A 3AS1A 2YZ1A 5J1AB 3H9HA 2EXSA 3T2OA 2FDBP 4PWFA 2LVCA 2BVPA 5CR1A 1CICD 3IDIA 4HSAC 3JWDC 1YEGH 1TZOA 1EAJA 4XXDA 3QCTH 5HHQB 2JKSA 2ZOTA 3J27A 3P02A 4HV8B 5FEBA 5T5FA 4AZ8B 2ADIB 4WFGE 5EN2B 1RPUA 4H0HB 1F00I 2ESVB 4N4YB 3X3FL 3NRPA 4XWGL 3EZJB 3AABA 5I73C 1JPFB 3IPBA 2PPAA 4B41A 2Z91A 1U8KA 3EHBB 1QSFE 3F64A 2UY6B 3WDHA 4KZDH 1U95B 2XI9A 2XFGB 4FQIL 2HB0A 1IBDA 2KDGA 2Z3FA 1NUNB 3L9RA 3MV7E 1VLXA 4G1EB 1BD2E 4LKXA 3QYCA 4N2FA 2FSEA 3FQNA 3LKPA 1ORSB 4CBZA 4PV8A 1KLFA 1OGPA 1M2VB 2PW1B 4WVRA 4RMBA 3DETD 3G5VA 4YX2H 2WCGA 1T6VN 3I74A 1EEQA 3CQFA 3B5HA 5D70L 5E2VH 4LT7A 3WDJA 1X5XA 3ZRSA 1C08A 2TSAA 5KVMC 5EBGA 2ORBH 1M1XA 2F54A 1BXXA 4P5MB 2VM4A 2NYZA 3U7YL 4EZLA 2FIKA 5IV2A 4ZBJA 4UIKH 1KTLB 2VLME 5D9SA 1KIQA 4Z7UB 2DN7A 4TULL 2K3HA 3V0DA 5B38A 4TQIA 2BXZA 4D9RE 3SDCB 2HKFH 5IMKA 1BFOB 4XRCB 1RZ8A 3MRBA 4AW7A 3T0DA 4U1NA 1UKQA 3DUSA 3MX0B 1RKRA 4GKSA 4QO1A 3AQYA 1TQUA 2R9HD 4DQAA 3U2JA 4J6RH 4GXFA 3PGCB 1JP5A 1QW9A 3N85H 2KYIA 5IFHH 1YY9C 2ISDA 5I1IL 3RWJA 1NEPA 4KX8A 5F97E 5ACMA 5F1SA 4X7CC 3TBSB 1HU8A 4KXCA 3HBQA 5CJOL 3AGWA 4G71B 3UTQB 3VQ2C 3EIFA 5IT2H 1W6LA 2EADA 4UQ3A 4LDOB 2WBWB 3OBAA 2WLYA 2V9UA 1PFOA 1BEYH 3KXFB 4DKAA 5JW4Q 1IAOA 3PAUA 3PP4L 1QUNA 3RWDA 1TZ8A 4LGSB 1MIMH 1TJMA 1V27A 2X1OA 5IF0A 3S97C 4DPBX 5A16A 3NVQA 4LK4A 5CU9A 1QACA 1UT9A 4JZJB 3MGAA 4M7LL 4NHUB 4A6YH 3BKCH 5EOCH 3WSQH 1S3RA 5DR5H 2Q1EA 1OE1A 4QCIB 3V5KB 5HYJE 3PAZA 5ESQB 2R4RL 1TETL 1F4YL 4GRWH 1ECYA 3D0VA 5C0FA 2PTTB 1H8NA 3LKNB 1VEMA 4NAQA 5IJKA 1ETA1 2EDJA 1IRAY 3H9SA 1NBVL 1JWSA 4FXTA 3ZQWA 5EB9A 2M83A 3OLEA 4N2LA 5KVGH 1KV7A 3S2CA 3EYFA 3DMMA 5IB4B 1U93A 2NPLX 2EXWC 5GXBB 2ID5A 2YBGA 4TXVB 3NABH 4NO3A 1HINH 4BFIA 3QNYB 1DEEA 2H6OA 4K8RL 3V0VB 1T2XA 3L7EA 1L9TA 1Z9LA 1KGCD 4U7SA 1T7ZA 1U8IB 2KH2B 1C5BH 4KI5F 4JPSA 5DK3A 2R0WL 3SBWA 2XZZA 1MHEA 1UJ3A 3HC4H 1CICA 5IQMA 4LPTA 3RE0A 1OZUA 3KL5A 3V8OA 1K8DB 2ALAA 2DYSB 4KZ0A 4WI0A 4PV9B 1ZAGA 2Q7YB 3UTOA 5B3JE 1KB5B 3LHPH 1D5ZA 3MLXH 1DSFH 4OZHB 1T0OA 2C1OB 3CBKB 3ZT5A 2XA3A 4HIXH 4RGND 1NIFA 4PIBA 1TTCA 1JI2A 5IBTH 1VAHA 1D7DA 1MNUL 3LDBB 2WQ8A 1E4XI 5KSAB 3R1GL 3B9KB 3NH7L 3BH8A 1B4JH 4FZEL 3QC6X 3NGBC 2QR0B 4H1LG 1NBYB 4P2CG 4P04A 1KLUB 3KL3A 4G8IB 4JRYB 5I18H 1OAXL 4RSYA 5KYYA 1G7MB 1WC7A 1CUOA 2A9DA 1WLHA 3TEZA 2WXOA 2Q87A 1C5DB 1M42A 1UZ6F 4LSQL 4L4VB 5BXFB 3JWOH 1F86A 1HHKB 5DUJA 5DZAA 4NUMA 5CBEA 4L4VD 4M7KL 1WBYA 2WYHA 4IRSD 4JCWA 4JEGB 5DVMA 4BQ9A 4TSBH 4DK5A 5D1ZI 4XNDA 4OZGE 1FCGA 5DWPA 1Y1DA 1KTKE 2Q5BA 2P8LB 1FL5A 1NBZB 2AAAA 4KO6A 3MLRL 1RHHA 4OCWH 4ZW7A 4LP8A 4HWZA 3UADA 2WXJA 2G4GA 3OJDA 4MZ2A 3VW3L 1JXFA 1HYRC 4A55A 1LD9A 1FV1A 4PJXF 4K9EL 4FKHA 3HVNA 1W6WA 1WE5A 4JY5H 4YO0A 5FAAA 3WU1A 4XP6H 1IKOP 4NSKA 1VGEL 3GSOA 1V10A 4XPHH 4R4FL 4WWKD 4HH8A 4N20A 2G30A 2E7CA 3CVHA 4MGXA 3GPSA 1GMEA 1MJ8H 4UCFA 4LASL 3DNKA 1X5HA 1MZZA 4PN6A 2MQCA 4A2GA 2QELA 2APVA 2WQAA 1CWVA 4NNPH 2QQLL 3OGCA 1S7SB 2ZG2A 3O6LL 1MWOA 7PAZA 1MH5A 1T6BX 4KFMA 1A6WL 2XWTB 5G2NA 3GHBL 5FYLL 4OQ1A 1VACB 3NJXA 4EN3D 3AJ7A 1YEFH 3MODL 2ZOOA 1PG7L 2L7EA 1AI1L 3IRPX 2YD8A 4R83A 5HGDB 1MCBA 3BVNA 1YQVL 5E6UB 5CGBA 2A74A 2VLLA 4LVNC 2ICES 2XTJB 2CR6A 3KPLB 4JZJA 5G4OA 4J3UA 4NENA 4K3EH 4U3HA 1WBXB 5TDPA 2PW2A 1FORL 5DRNB 1SFHA 3B56A 2Z65C 3WLWD 3DX2A 4CKVX 3PPSA 4WI7A 1HAUA 5CEXB 3KVDD 1VIWA 4RWHA 4W9GC 3KNBB 1Q9WA 4YHZL 4MMXA 3U36B 2WXHA 1OAKH 1A7QL 1C1EH 5GRWA 2Z93A 4X5WB 5B7MA 3WTTA 3HMXA 2EE9A 3QUML 2Y7QB 4MAYC 3WNOA 4IW4C 1EEZA 1NM4A 2WIIA 1MUJB 1NCDL 2MCPH 3D0LA 4IHOB 4LEBA 4YPGB 1NDMA 4HVBA 1G5GA 1OL0A 4NRZA 2YD1A 2LFGA 2H1PH 3SDDB 2OZNA 3FQXB 2F7RA 4F2MB 1AQHA 3GRGA 4HIIA 4RVBA 1T1ZA 1YECL 5CJ8A 1YPZE 4K71B 3E80A 4XHJD 5B21A 5EOQL 3DTXB 4HS8L 4ODTH 2YEZA 4XP9L 2E86A 1EQWA 2FLRT 3CFCL 4TUUA 3FN9A 2MCG1 4GQPH 2O5YL 3ISRA 4YHYC 1A66A 3T4AC 3QUXD 3KGSA 1RIUH 5TQ2L 5IQ7H 4G7YH 3V0FA 1KCSH 1YDPA 1FNLA 1AR1D 3G9AB 5GIRB 2ZX8A 1CR9H 1MJ7L 5C97A 4M5YL 4UWQB 4UTAL 1H19A 4AJWA 3ECBA 4YE4L 1T5WB 3MU3A 5ABAA 2D3NA 4M56A 1NFAA 2I69A 1VFAB 3BSZL 3EOBB 4PREA 5L2JB 4NERA 3WEMA 1IFHL 1ZKAA 3BRDA 3Q6GH 3S5LG 3BPNC 5EU7C 4LLQA <