4KO0A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with an anilinylpyrimidine derivative (jlj-135)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
556
structure length
555
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 159
structure length 555
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ko0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ko0A05
3HSTB 3PUFA 1RTIA 3WNEA 4TN2A 1C0MA 2FVRA 5DLGA 5KT5A 1C1AA 1EETA 3UR0A 3OYEA 3BREA 1S6PA 4MK9A 3OS0A 4GMJB 4QOZB 4BACA 2BQ3A 1HYSA 2FBYA 2YKMA 5J2PA 3OSNA 3CM5A 1T05A 3CDUA 2VA3A 1DLOA 4DLEA 4O3QA 5DLFA 3IS9B 1DTQB 2W7PA 3BSAA 1U48A 4I2QB 3HPHA 4BE0A 2OPRA 3DLHA 1EP4B 4F4YA 3NHGA 4CIEA 2W8LA 4F4WA 1XR6A 2C2RA 2B6AA 5CZ1A 3NCIA 2DFHA 4LSNA 4CJFA 4N5SA 3AA3A 4DS5A 3OL9A 1X9SA 3MFHA 3K5LA 2RF2A 3K5NA 4Q8FA 3V9WA 1QE1A 1JIHA 3T19A 2KW4A 2W7OA 3C95A 4DTMA 4DLGA 2X74A 2FVSA 4FZZA 1D9FA 4RNFA 3RMBA 3VQ7A 1RT2A 2UUWA 4DTUA 5KFBA 2HAIA 2ZE2A 4QPXA 3GQCA 2IOCA 1O1WA 4LQ9A 3C94A 3HM9A 4CHPA 1IKWB 1RT4A 5F8MA 4JV1A 3HVTA 3KLEA 3ZSRA 4KO0A 4N76A 1LW0B 5DQHA 3BR9A 3AO4A 4FLTA 1UA1A 1ZTTA 4LSLB 3AVNA 3DRSB 2AJQA 3LWLA 2IM1A 1RYSA 4O3NA 2JEIA 5DGAA 3MEEB 3V6KA 4JS5A 4Q5VA 1SV5B 1OS5A 4J2DA 3VQ5A 1S1WA 2E9TA 3OSPA 3BGRA 1RTDA 4MIAA 3NGYA 3LANA 2V0NA 4B9VA 4CGGA 3EY1A 5KG1A 1S1UA 3PJXA 4NZ0A 4M3RA 4DL5A 3V6DA 2AX0A 2IGIA 1X9WA 4Z4CA 1BQMB 3TAQA 2ILYA 4FJHA 2VG6A 3E01A 1N5YA 4JV2A 5KFQA 3L2WA 3HPGA 1JXEA 1S1XB 3WNGA 3KHHA 3KKRA 4LY7A 2FLPA 5J2QA 1JLQA 4CFDA 5C42A 2FJVA 4RW8A 2XO7A 2XCPA 4M3YA 4ECRA 3Q8RB 3KLHA 4QWBA 2HHTA 1CSJA 4B9NA 4CF1A 4NLYA 4ID1A 3KLEB 5CYMA 5KI6A 4I2PB 4PQUB 1RNHA 4Q45A 2F8EX 4RW9B 3LP0B 2W9CA 4FBUA 1Z25A 4HCCA 3H4BA 3KOAA 3T1AA 3LWMA 3L8BA 3KLGB 4MKAA 5EU7A 4DQSA 4O3SA 2EX3A 1C1CA 3H5YA 3QETA 4CF0A 3AVMA 2HNYB 4B8AB 4ELTA 2IJFA 3S3NA 1UAXA 5JS2A 3AVIA 3AVHA 3LPUA 4AILC 3ZT4A 4RW8B 1XHXA 3ITHB 2V9WA 4OLAA 3OJSA 1IKXA 4CJQA 2W8KA 5DG9A 4Q43A 4TY9A 1GOBA 3ZT3A 2I1RA 3ULDA 2OPSB 3GIJA 5J2MA 4QWAA 1N48A 3TABA 4CJKA 3N6MA 1EETB 1XHZA 2BQUA 2RPIA 4EBCA 5FRNA 3TAGA 2QKBA 2E9RX 1RT1B 1J9AA 3RWUA 5CYMB 3O3HA 2XWYA 3PV8A 3KK2A 1D1UA 3C6UA 3OYGA 4FYDA 1YTAA 1ZTWA 2RKIA 1UA0A 3SQ0A 4FBTA 3OYLA 4CJ4A 3LZJA 1RBVA 4BDPA 3H98A 4E7LA 4QWCA 1J54A 3F9KA 4K4UA 4QAGA 1LV5A 2ZD1A 4OPJA 1L3UA 3PW7A 4DTPA 2IBKA 2G8FA 1LAVA 3AVBA 4MH8A 4CGFA 1VSFA 4B3OA 4Q0BB 3V6JA 1HQEA 3QEIA 3DM2B 3TVKA 4ECZA 3SCXA 3KHLA 3FRZA 3D45A 4CHQA 2FLNA 1D8YA 1WSGA 2QXFA 4ZP9A 4ECWA 1EX4A 2HHVA 4KV8A 3QIOA 4WE1B 1VRUB 4FS2A 4KI6A 5JXSA 4KFBA 5KT3A 3TAEA 1S1WB 3QESA 4NRUA 3RR8A 4KHUA 3FSIA 3CFPA 1EXQA 1VK0A 4CFAA 3VQDA 1W9HA 2OH2A 4F4XA 2HVHA 3EZUA 1SUQB 3NMAA 4DMNA 4OPKA 4IRCA 5KFIA 4O4RA 2GUIA 2YKMB 5J2PB 3I0SB 4CECA 1HNVB 4WFYA 1TV6B 1KLMB 1JLFB 2YNIB 5HRNA 4DSIA 1RTJA 5KFVA 4GC7A 2EC0A 4ED3A 3CM6A 3S3OA 5KFAA 1S9FA 1KSPA 4WE1A 2VG5A 4H54A 3NE6A 4F3OA 1NKBA 1WSIA 2FBXA 3KNAA 4DSJA 4H4MB 3GYNA 2ILZA 3CQ8A 4AH9A 4EYIB 4R5PA 2KQ2A 4DFJA 1LWFB 1S97A 4M45A 1KFSA 2WOMB 3U6FA 1KVBA 3LPTA 5C42B 2QKKA 3IS9A 3FQKA 1XR7A 3OYMA 2B5JA 3F73A 4RW4A 2IM3A 4DTNA 1T03A 2UVUA 3NF9A 3OYNA 4FJLA 4ECQA 1VSHA 5F8GA 2E9ZA 3KD1E 3V9ZA 2RF2B 1JL2A 3JSMB 1RT6B 2XI3A 4G3IA 1FKOB 4BE2A 4ZPCA 1U4BA 3SPZA 3O3GA 2PY5A 3DI6B 3DLBA 4KBIA 1L3VA 4FJ7A 1S9GB 4URSA 3NAEA 3V9XA 1NOYA 3ZCMA 1C0UA 5KFTA 3SUPA 4ZP7A 3QINA 4CJ5A 1L3TA 1RT7A 2OPSA 4G1QA 1YVUA 1ZYQA 2IDOA 4RW9A 4W5RA 1UWBA 4ZP6A 3PR4A 2OPPA 4J2BA 4B9SA 4LSLA 2AU0A 4ZHRA 5DG7A 3ZT1A 3HK2A 4CFBA 1TK0A 1RTHA 4FXDA 4ZPBA 3WNFA 4TXSA 3FFIB 4NCGB 3VQSA 1HYVA 3P1GA 3DOKA 3V81A 4N56A 3ZSOA 4DTOA 1REVA 4JV0A 3MR2A 4HCBA 1KHVA 2YNGB 2XHBA 1JLAA 3CJ3A 4E3SA 4ECUA 3BDPA 4FLVA 4I9LA 3JSMA 1UWBB 3C6TB 1NJWA 3HP6A 3LZIA 4MQ3A 4E19A 4GC6A 4I2PA 4PQUA 4RW7A 1BQNB 5HRSA 2DTUA 3LP3A 2R2TA 4HYKA 3N6LA 2JEJA 1U45A 2WTFA 1FKPA 3NH1A 4I7FA 1BHLA 4F8RA 1U04A 2CKWA 2G8KA 2IS3A 4R0EA 2R8GA 2HNDB 3OYAA 1JKHB 1TAUA 2FLLA 4FZXC 3QGIA 3KKSA 4OKKA 4IOBA 1JL1A 5KFNA 3IG1A 4FLXA 2GBZA 4CEEA 4KAZA 4YR3A 3DYAA 4O4GB 3ZSVA 3G86A 3RB0A 3HYFA 5KFOA 5J1EB 4O44A 3CJ2A 2V4QA 3NH0A 1TL1A 1GX6A 4KREA 3IGNA 1I3AA 5EWEA 3AO5A 4K4SA 1QAIA 2BANB 4J9SA 5JS1A 1W25A 4LD0A 2PZSA 1K1SA 2BQRA 1NJXA 4CESA 2HW3A 1QSSA 4IRKA 5KG3A 4NLWA 3QEXA 2IC3B 1S4FA 3BSNA 1QQCA 4PY5A 2R8IA 2VA2A 1FK9A 3IG1B 1JXBA 1IH7A 5CYQB 1WAFA 4CJWA 1S0NA 4KB1A 3NAHA 1SL2A 2YNFB 5F8NA 4E7JA 4DF8A 1VSDA 1N5YB 4TSXA 2BGGA 1QAJA 4OJRA 1C2PA 3BGRB 2RDIA 3TQ1A 2HVIA 1CXUA 1A5XA 3Q8SB 2ITGA 3SUQA 1QHTA 2I5JB 4OVLA 2Z1IA 2YNHB 2X6NA 5FDLA 5EWFA 4ED0A 2B4JA 3SZ2A 4IFVB 3MEEA 4EZ9A 3GIIA 5L1IA 2DFEA 4EBEA 4M94A 1D5AA 1GX5A 4PUOB 3PZPA 2E4LA 5HBMB 1VRUA 1J5OA 3MEGB 1HQUA 2FBVA 1RYRA 3O3FA 3OYDA 3NF6A 4IH7A 5KFDA 3H5XA 2GC8A 1WN7A 4ECTA 1NK4A 3P83D 3NF7A 4CEQA 5KFYA 4ZPDA 4DU4A 4BE1A 4WFXA 3M9MB 4MK8A 3I5BA 4ECYA 4N47A 3HT3A 1SL0A 4DSLA 2P1JA 3MXMA 1RTJB 4WZMA 2ZE2B 1N56A 5KG2A 4KKOB 1FXXA 1NKEA 1Q9XA 1IKWA 1RT4B 3CG7A 3MR6A 4YP3A 3O4QA 3OJUA 4IH6A 1T7PA 2XGPA 1SUQA 3DRPB 1KVAA 3BQ0A 3NGDA 5K14B 4NCBA 1FKOA 4Y1CA 4DL3A 3DLEB 5HROA 1ASUA 3SUNA 1IKYA 4O4GA 3ICLA 3K57A 2R7YA 2B6AB 1C0TA 5KGWA 1U09A 3PW2A 4Y1DA 3OYBA 5J2MB 1JKHA 3MF5A 5C24A 3RB6A 3P5JA 5FROA 2RDJA 1S1TB 4CJEA 3QZ7A 3PW5A 3SV4A 4Z4GA 5KFGA 1DTQA 3V4IB 4K8ZA 3WNHA 4KHSA 4B3OB 4Q0BA 5L9XA 3CYMA 3BSOA 2RKIB 3M8QA 4U7CA 5SWMA 1FKPB 1RBRA 3AA4A 1QUVA 2IA6A 3ISNC 3KK2B 3PX6A 4K4WA 1RDCA 2BE2B 2Z1JA 1A5VA 1RT1A 4KB0A 4HKQA 1RA7A 3IRXB 1Z4UA 2D0CA 1WSJA 3ZT0A 2BRLA 3QO9A 2YHBA 3ZT2A 4NLRA 1UOCA 2GIRA 1JX4A 3KJVB 3Q8PB 3H5UA 2O4GA 3LP2A 3DYAB 3HXMA 5HROB 4NCAA 2HMIB 4FW2A 4FK0A 4CFCA 1VRTB 4W5OA 5J2QB 1NJZA 3JYTB 3V6HA 5I3UA 3K58A 4E7IA 4ED1A 3KLFB 5KFKA 1HNIA 1C1BB 4DTRA 3T5KA 3ZSQA 3EPIA 4I7FB 5I42A 3DRRB 5C25B 4ZPAA 2AGQA 3RR7A 4WXOA 3OHAA 4KB7A 4FS1A 2RN2A 3LAMA 3QZ8A 4KV8B 1S1TA 4J9RA 3M9NB 4KFBB 2UVRA 4WFZA 5KT4A 3BJYA 3AVCA 3DM2A 4FJGA 1JLEB 4CIGA 5KFUA 3NL0A 4QWEA 3DLKA 3KD5E 4NLTA 4KTZA 3M9OB 4EBDA 4LH4A 2J6UA 1G15A 1RT2B 3QIDA 1T03B 3LP2B 4E1NA 4RW6A 1VSJA 1TL3A 4CK1A 3HVRA 4CHOA 1CZ9A 1BCMA 4DSKA 3AV9A 3SYZA 3OS2A 2B5JB 3KHGA 2WB4A 3OYFA 3K5MA 4J2EA 4ZVFA 3EPGA 4F50A 4Y34A 2V4RA 4FCYA 1WNSA 2VWKA 3NGIA 4BDZA 1RT7B 4IFYA 3QEVA 4JRPA 4RNHA 1TL1B 1CLQA 2OPQA 3K2PA 3KLIB 3MXIA 1EKEA 3G6XA 3PR5B 3CFOA 4H8KA 4FLWA 3KK3A 2XY5A 3KIOA 4GVMA 1WSFA 3DI6A 2FVPA 3T3FA 4LQ3A 5KFCA 4F2SA 2ZKUA 1NK9A 4MFBA 1TKZA 1KRPA 2W9AA 4Z4FA 4WXWA 4M42A 4B9UA 4Q44A 4I9QA 5D3GA 5J2NB 1WSHA 1TKXA 2AX1A 3VQAA 3NBPA 4RW4B 3L2UA 1HYSB 5FDLB 4NRTA 1S6QB 2J6TA 2G8IA 4DFMA 1T05B 4DTJA 3RAQA 1MMLA 3MR5A 5CZ2A 4RNNA 4H4OA 1S9EB 4R8UA 4J9PA 3OYKA 1JLGB 1BGXT 3RMAA 4ED2A 4O3PA 3GIMA 4C8OA 2HHWA 4BWMA 1J53A 3TAMB 1JLAB 2BDPA 1L5UA 1RT3A 3DOKB 2R8JA 2ATQA 3KHRA 3KLHB 3CDEA 3V9UA 5KT6A 1TGOA 2YNIA 3MECA 3QIPA 2LSNA 4K4XA 5SZTA 1R0AB 3MEGA 4CJSA 4DL4A 5KT7A 4M3WA 4J9QA 4M95A 2XC9A 4BWJA 5HLFB 3T5JA 1HPZB 4QWDA 5DMRA 4DU3A 4HTUA 1JLCA 1I39A 1S6QA 3ZSZA 1QS4A 2D0AA 4XIUA 4DTXA 5F8HA 1RBUA 3I0RB 1S5JA 5KGXA 4DQQA 1RDAA 1RBTA 3AO3A 2G8HA 5KFZA 2W9BB 1RAJA 2HMIA 3S9HA 1NNDA 2EHGA 1K1QA 3IAYA 1VRTA 4Y2AA 5HP1A 2R2UA 4EP5A 1TKXB 4TYBA 2YKNA 4URQU 2JEGA 1WSEA 3AVLA 2AQ4A 1T94A 4CF9A 1KHWA 4DSEA 4IKFA 3D28A 4CHNA 5T7BA 3H08A 4NLDA 4ICLA 1HJRA 1NK6A 5FRMA 5DQIA 4CGIA 3OYJA 4FZYA 4FJMA 1C0UB 3NF8A 5KFFA 2VG5B 2XCAA 2GV9A 3SJJA 5KFHA 4M3TA 1B9DA 5C5JA 4KSEB 3KMQA 2BE2A 3HJFA 3RBEA 3IN5A 3KMSA 2W9BA 4M3UA 4KTWA 4ZTJA 4TYAA 4JRQA 1KLMA 2OPRB 5CY4A 4FJ5A 5J2NA 4J9OA 4Z4IA 3HHKA 1NHUA 3VQEA 4XPCA 1HMVA 1DTTB 4W5QA 2FVQA 3M8PB 1IKXB 4MFBB 1QSLA 4IDKB 3OL8A 5KG5A 1TKZB 3S3MA 3N6NA 5F8LA 3VQCA 4FM2A 3L3VA 2QK9A 1NOZA 4E7KA 4PA1A 4DS4A 3FDSA 4N41A 1D9DA 1GOAA 4B8CA 3JYTA 2OYQA 1W0HA 2AWZA 1I6JA 4NLVA 3V9SA 3AVFA 4EP4A 4DWIA 1BISA 5KT2A 3OL7A 4IG3A 3ZSWA 4DTSA 4TY8B 2X6SA 2P5OA 4KHYA 3I0SA 3LP1A 3I5AA 5KFSA 2KZMA 3PX0A 3HVWA 2C2DA 2F8SA 4HUFA 2FBTA 4CEAA 2YNGA 3KTQA 4FJKA 2ALZA 4KE5A 1S1XA 1NHVA 1HRHA 3HO1A 5KG6A 4ED8A 4O55A 1BQMA 5HRRA 4KO0B 3TANA 3THVA 3RRHA 5EDWA 2IMWP 4O5BA 4K4VA 2VWJA 2A1SA 3QGHA 4DQRA 3SPYA 3SI8A 1S1UB 4CK2A 3NKYA 3TAMA 1TK8A 2DPJA 1S9GA 4K4YA 2IAJA 5F8JA 4ELVA 1LWCB 4M3XA 1Z26A 4CJVA 4YQWA 2Z1HA 4FVMA 3C6TA 3B6PA 1B92A 1N6QA 1RT6A 1WLJA 4K4ZA 5KFWA 2F96A 3T5LA 3AO1A 4YFUA 2BR0A 3OHBA 1JXLA 3V1RA 2Y1JA 4Z4HA 2IC3A 4YR0A 1BIUA 1VSEA 1NK7A 4GW6A 3OVNA 3RB3A 4IH5A 1NK5A 3VQQA 1VSMA 3DLEA 1XI1A 3BSCA 5KRSA 2DFFA 2HHSA 2D3UA 3PY8A 4FJNA 3MEDA 2F8TA 2HWHA 3KK1A 4HHTA 1C6VA 4ICLB 4KHMA 1S10A 4YR2A 3RMCA 2W9CB 2HHUA 1RTIB 3VQ9A 2WK4A 2Y1IA 1VSIA 1HNIB 1JLEA 4K50A 3KLVA 4F3TA 1HARA 3EZ5A 3H2LA 4NLGA 2E6MA 3PHEA 1T8EA 2P51A 1CZBA 4B9TA 4W5NA 3SQ1A 4B9LA 1TVRA 2KFZA 4NYNA 4AHCA 1S1VA 4RW7B 4PWDB 3GV5B 1QTMA 1BIZA 2NUBA 3QEPA 3TI0A 3TR8A 4UQGA 5T14A 3D0PA 1NK0A 2HHQA 5F8IA 1ITGA 2W42A 2FVCA 2IM2A 1HQEB 3G0ZA 4CEDA 3MXJA 1TK5A 2JGUA 4CIFA 4KKOA 3KLFA 4J2AA 4DFKA 3PO5A 1TL3B 4KHNA 3NGZA 1QSYA 4NLOA 4TLRA 4ZHRB 4AHTA 3HVTB 3I5CA 4ED7A 4OKEA 3FFIA 4FLUA 1IKYB 1B9FA 1XC9A 4RNOA 2WHOA 2ETJA 3FQLA 4DEZA 4RUCA 3V6DB 3OY9A 3QNOA 1IM4A 1XWLA 1LWEA 2FJXA 3IRXA 4B08A 3QLHB 1ZBUA 4YMEA 4EYHB 4DG1A 3LP0A 1HYZA 3SI6A 1LW2A 1QE1B 4O0JA 2WONB 5D3GB 4IBNA 2J6SA 3LALA 1U47A 1U49A 3HP9A 3VQ6A 1KCFA 4J9NA 5KG7A 3L2RA 4M3ZA 4X2BA 5KFMA 4ED6A 2O5DA 2PYJA 1SV5A 1RDDA 2DPIA 4URGA 4Z0UA 4FLZA 2UVVA 3TAPA 3MAQA 2G8VA 2P5GA 3MEDB 2G8WA 4RG8A 3PX4A 4CJUA 4C8KA 4OKJA 4H4MA 1RT5A 3OL6A 1BI4B 2AGPA 5KFEA 2JEFA 3NAIA 1TV6A 1S49A 1ASVA 3ASMA 4OLBA 1YVFA 1S48A 1SH3A 1HPZA 2BANA 3VA0A 3KK1B 3H4DA 3GILA 1JLQB 4KPYA 3OYCA 3H59A 4CGJA 1MU2A 1RCHA 2R8KA 4NLPA 1R0AA 1NKCA 3TAFA 4H4OB 4ZVHA 3VN5A 4KHWA 4RZRA 2QE5A 3H5SA 3EYZA 3AVAA 3CJ0A 4WZQA 2JLEA 5KFPA 4KHRA 4NLXA 2UVWA 3VA3A 4CJRA 3ZSYA 4DU1A 3CJ4A 1EP4A 4CEBA 1CXQA 3K5OA 2IAJB 4DL2A 3DMJB 4FJIA 1RBSA 1JLBA 4CF2A 1LW2B 1S1VB 2XY7A 5DGBA 1BL3A 3L3UA 5KTQA 3KK3B 2AGOA 4FW1A 3OYIA 2X78A 4E1MA 5CYQA 4DL7A 1S6PB 4ZTFA 5KG4A 3U3GA 3DRRA 5C25A 2ZD1B 1RDRA 3G6YA 1BI4A 1D0EA 2OZSA 3K59A 1KFDA 3DLGA 3B6OA 4IFYB 2WRMA 2HB5A 3PW0A 4EZ6A 2KZZA 4IR9A 3CFRA 3BQ2A 1SH2A 1LW0A 2D41A 1F21A 3KJVA 4FM0A 2XY8A 2D5RA 2HNDA 1HQUB 4B9MA 3RMDA 4J9MA 1S9EA 1TAQA 4O3OA 1K6YA 3D5MA 4CK3A 5F9LA 3NFAA 4FK4A 3SQ2A 2WOMA 3C6UB 4TQSA 2JC0A 4WYWA 5E41A 4HVJA 3TARA 1JLBB 2ZQBA 4QW8A 4FLYA 3NBPB 4RUAA 1Q8IA 3A2FA 3VQPA 2UUTA 5DG8A 2BRKA 5KFJA 4IRDA 3DMJA 4ECVA 1BCOA 3GV7B 4C8LA 3QEWA 4EO8A 1NJYA 5DQGA 4IKAA 4CJTA 4DSFA 1IG9A 1HMVB 5J1EA 2B43A 5HRPA 3AO2A 5KFRA 4JLHA 4PWDA 1WNEA 1A5WA 2KFNA 1VSLA 4Z4EA 1C1BA 2HNZA 3RTVA 4CF8A 3DLKB 3MR3A 5L1JA 1DTTA 4FJJA 4BDYA 2Z1GA 1C1CB 1SKRA 5KFLA 1RDBA 4CEOA 3M8RA 4R8UB 4I2QA 1RTDB 2QV6A 2R2SA 4CERA 3AVKA 4FJXA 3V81B 4ZMMA 3ITHA 4DFPA 3E51A 3M8QB 2XGQA 4EEYA 4O3RA 3PVXA 4F2RA 4JS4A 1LAWA 4Y3CA 2Q3SA 4QW9A 3OLBA 3GV8B 4OGCA 3NH2A 1RA6A 4E0DA 4TQRA 1IKVB 3KLGA 2DY4A 4ECSA 3LP1B 2D7SA 4CJ3A 1ZBHA 1TKTB 4F4KA 4J9LA 3AA5X 1RT3B 5HBMA 3CDWA 3SQ4A 4NLUA 2XRIA 1YT3A 4AHVA 5KG0A 3OLAA 1Y97A 2YKNB 1TP7A 3DOLB 2YNHA 4PUOA 4RNMA 3PO4A 2I5JA 2WONA 1TQLA 4EO6A 4IFVA 3UIQA 1ZBFA 2OPPB 1RILA 3ISND 1LWCA 4U6PA 2FJWA 5L1LA 3CJ5A 4LSNB 2O4IA 1ZBIA 4W5TA 1TKDA 3U3YA 3DLRA 4CJPA 5I3UB 1IO2A 2OA8A 1LWEB 3QLHA 1SH0A 3LDSA 3RAXA 3MTKA 2ASLA 2PYLA 3MFIA 1Q9YA 2CJQA 4ZP8A 4CEFA 3DRSA 3VQBA 3HL8A 3NDKA 4E89A 1LWFA 3UQSA 1REVB 3L2VA 3T5HA 3UPFA 2IM0A 4IG0B 4AHRA 3PW4A 5KRTA 4MK7A 4Q8EA 1RTHB 3O4NA 4JUZA 5JUMA 4KRFA 3RBDA 1J5OB 4IR1A 4E7HA 1FK9B 1KTQA 2GIQA 3MECB 3QIPB 5HP1B 5L1KA 2C22A 1ASWA 2ATLA 2D0BA 4LH5A 3E01B 2ASDA 5EWGA 4K8XA 4TY8A 2YHAA 4CE9A 4DF4A 4O44B 3QNNA 1L3SA 4F4ZA 1RT5B 3V4IA 3SFUA 4M41A 3RRGA 4RU9A 3G10A 5C24B 4WYLA 3I0RA 2G8UA 5DK5A 1C0TB 3AVGA 2A1RA 4CHYA 3AVJA 1TVRB 2HNZB 2XI2A 3CO9A 3M8PA 3KLIA 3H40A 4IDKA 4ID5A 4AHSA 4NYZA 3CWJA 3BQ1A 3DRPA 1VSKA 2R2RA 3UDLA 2KTQA 4CGHA 1MU2B 3SUOA 3ALYA 4NLQA 1XR5A 4KHQA 2FC0A 4DQIA 4DQPA 2YV0X 1SKWA 4NLSA 4L8RB 2C28A 4O0IA 3AA2A 1S0MA 3SV3A 1BQNA 4XO0A 4HUEA 4DL6A 2HNYA 4R5PB 3ZSXA 1WAJA 4C8MA 4AHUA 4ECXA 4FJ8A 3QO9B 1T3NA 1KLNA 2ASJA 1JLGA 4J9KA 3TWHA 1YTUA 4QCLA 1JLFA 3G6VA 4KTQA 2OZMA 1ZETA 4CEZA 4IG0A 1X1PA 2R8HA 4ELUA 2WCXA 5KFXA 3CIZA 1SKSA 4OGEA 3DLGB 3OYHA 2C2EA 3I8DA 3DDKA 4Y2CA 1HNVA 2IJNA 1IKVA 3VQ8A 5EUHA 3HKWA 2VG7B 4YNQA 1N6QB 1SL1A 3GIKA 4CHZA 3V1QA 3VQ4A 4CGDA 4ID5B 4CCHA 4ZVGA 4RW6B 3QYYA 3CVKA 4DG1B 4IG3B 3RB4A 4CJLA 5K14A 2VG6B 3IGVA 3OS1A 3SFGA 3HVAA 3L2QA 1NK8A 5F9NA 4HUGA 4C8NA 4FJ9A 4FK2A 1KVCA 4K4TA 2E6LA 1DLOB 2YNFA 3Q8QB 2JC1A 4MKBA 1JLCB 1TKTA 5I42B 3HPOA 3M8SA 1N4LA 4IQXA 4ZVEA 2HHXA 5HLFA 3QERA 4MIBA 4NYFA 2HWIA 4KAIA 4FM1A 3QGGA 2XY6A 2OPQB 4OL8A 3DOLA 4XPEA 3SNNA 4KI4A 1X9MA 1GOCA 2VG7A 3V1OA 1ZBLA 2D3ZA 3PJWA 3LAKA 4G1QB 4NCGA 1S0OA
chains in the Genus database with same CATH superfamily
3HSTB 3PUFA 4OYPA 4PABA 1SVDA 4TN2A 4JI7F 4CZIA 2FVRA 2KJVA 5DLGA 3D1OA 4NXNK 5JVHL 4MK9A 1JJ2R 3TTDA 3OS0A 1R0BG 5KAKA 2BQ3A 2FBYA 2DO0A 4LVNP 5E7OB 4KGXB 4G9ZA 2YJFA 5GVQA 3RSEA 2FPHX 2XNQA 3BSAA 1U48A 2WSCC 3HPHA 4BE0A 3DLHA 4F4YA 4CIEA 2B6AA 3VAIA 3HFZB 2QMUB 2P2CB 4LSNA 4CJFA 3AA3A 1NBEB 3Q2TC 2MQQA 4M5IA 1X9SA 4JI2K 2PMWA 3K5NA 4Q8FA 3V9WA 3HD1A 1QE1A 1VGYA 1JB0C 4ZVPB 4DLGA 4DR3F 2IJRA 2YWHA 4LF8J 5LMUF 4IO9L 1D9FA 1RT2A 2UUWA 4DTUA 2X7IA 2AP1A 5ETKA 4LQ9A 1TL7B 1GLBG 4NXNJ 3UKRB 3QBXA 5CD4A 1RT4A 4USHA 2AP6A 2LP4A 3JQMA 3HVTA 5A8RA 4RWXA 4N76A 2FD2A 4IYQA 2YBVA 3BR9A 4FLTA 3CW2C 1UA1A 3WXMB 4ZCLA 3P5BP 3DRSB 3JAMO 3G9CA 1NHKL 2BXJA 4P7VA 4YORA 2GMHA 3DXSX 1RHUB 4QYRA 5AQKA 2O8DB 3WHIA 1R31A 1XMQK 1SV5B 1LOTB 1SB6A 1CJUA 1S1WA 4DU7A 3C7NB 2M8DB 1WKJA 3LANA 2V0NA 4B9VA 3MWTA 2E5GA 5GIPA 1HWIA 5KG1A 1S1UA 3PJXA 3SIPB 3V6DA 5AQXA 2J0XA 3TAQA 1BQMB 1HA1A 1VQKS 1KAYA 1XBWA 3MMVA 3CJSA 2VG6A 3E01A 1VQ4S 4USVA 5H1SQ 3ZZZA 3DXKA 4H4KA 4X4SA 2W2QP 1V6HA 3G71S 3O6WA 2FLPA 4DUZJ 4RUHA 2JFKA 3CC4S 3N4PA 4JI7J 4M3YA 4DR3J 3Q8RB 5A8RB 2FHJA 1CSJA 2BABA 1IUJA 3LTOA 4NLYA 2GWKA 3KLEB 5CYMA 4I2PB 2CADA 4Q45A 2W9CA 4RW9B 1Z25A 1YHQN 3EGWB 3H4BA 3KOAA 3Q7CA 4DMZA 3T1AA 2R7UA 3LWMA 4HEA9 3KLGB 4MKAA 5EU7A 2E1CA 4GVLA 3PYDA 3HM8A 2RUGA 3JSYA 4BVPA 3QT7A 4CF0A 3FZFA 1UPPA 3S3NA 5JS2A 4AILC 1XHXA 3ITHB 2V9WA 3OJSA 3WC2A 2DY9A 2QFIA 1CS4A 2F8MA 3ULDA 5T7LA 1OYDA 4JV5K 1YXQA 3R8EA 1RZMA 2XULA 1UVMA 2BKOA 2RU3A 1Y5LB 1XHZA 4LC9B 3TAGA 2LEBA 3O3LA 2E9RX 1IV0A 3N0VA 3H6EA 4LBIA 1Z05A 5CYMB 2L08A 2YXLA 1HLWA 2DR5A 3QPIA 4AM6A 4FYDA 4YHHJ 3UVJB 1YTAA 1ZTWA 3AHPA 3WZ0A 4FBTA 3BGFA 1H1VA 1ZPVA 3SDEA 3PRVA 3IRWP 1DARA 4E7LA 1BO5O 2X1AA 1J54A 4KRWA 3K9KA 3RJMB 2KM8C 1LV5A 3NS6A 3EKSA 2ZJRQ 4BG8A 4OPJA 3MX5A 5A76A 3PW7A 2YHYA 3CCUN 4DTPA 5HAOA 1S6OA 3GJRB 2A2CA 4MH8A 3POTA 1CJKA 4B3OA 1Q7LB 3QEIA 2VFUA 4ECZA 4BG9A 3KHLA 3FRZA 2HAFA 2FLNA 3KDOA 1EX4A 4KV8A 1M5PC 3QIOA 3FUYA 1VRUB 1VAZA 2F4VK 4KFBA 3O1WA 2B3TB 1HHQA 5LMNF 2JJ4D 5DDPC 4HH1A 5F0WA 5AQZA 1DQ9A 1ELOA 3MUTP 2DR7A 2XMKA 3EZUA 3KXDA 4IRCA 5KFIA 4O4RA 4WFYA 4IFEA 2DRDA 2HQFA 3ENVA 5HRNA 2L3MA 4MAKA 5IC4B 1Y4ZB 3CM6A 1FT8A 4JKCA 1WC1A 5KFAA 4F3OA 1ZM2A 2FBXA 2IVPA 3LA0A 3KNAA 3FZHA 1IWGA 1VQ5N 5LM7E 3ZLJA 1F6TA 1X4DA 4IOXA 4LFAK 3ENAA 3CQ8A 2B4PA 4AH9A 4R5PA 3L95X 4DFJA 4P73A 1LWFB 1Y11A 3ZTOA 3FK4A 3MM6B 3U6FA 1N33J 1HR0J 5C42B 1D09B 3FQKA 2OTJN 3OT9A 4RW4A 5CXTA 1O5JA 3NF9A 4DV1F 1SJRA 4TVAB 2RF2B 2XI3A 2LDIA 4WKRA 2PA3A 4M5JA 2XYGB 3BUZB 2YX7A 4NZ6A 4X64K 3NS7B 3V9XA 1NOYA 1C0UA 3ZXWA 1IQZA 3FC9A 2V5HG 3M8WA 4P72A 3FZMA 3QINA 3MEKA 1FERA 2A6AA 2OPSA 4G1QA 4LF9J 2IDOA 3GLJA 5IT0A 4W5RA 1W7WA 3DU6A 4LSLA 2QA4S 3ZT1A 1FRLA 4M5LA 3P4UB 3HK2A 3MOJB 2BJ9A 1B3TA 4FXDA 3TUZC 3WNFA 4JI4J 2YH1A 1HYVA 4OX6A 2ZNYA 3O4WA 2JWKA 1YJWN 3DOKA 3IMXA 3V81A 4DTOA 1NNEA 2O8CB 2VASA 2P9UA 4HCBA 1F5AA 1KHVA 2YNGB 5GADP 2XHBA 1FNMA 2VQFK 5K8PA 1WHWA 3BDPA 4LFBF 4I9LA 3JSMA 1UWBB 3C6TB 1U25A 4MQ3A 4I2PA 2M5YA 3N79A 4FF1A 1BQNB 5HRSA 3LP3A 3HHLB 1LCUA 4OHXA 1IBKF 5ETNA 2CKWA 4CLSA 2G8KA 2QYGA 3O8MA 3NCQA 5B0EA 4R0EA 2R8GA 3SQGA 1WWHA 4BRIA 3OYAA 2W41A 3PSFA 1RK8A 4IOBA 5KFNA 4QR0A 3EUNA 3GG4A 4CEEA 4YR3A 4LFCF 3BEXA 1DZ5A 4PXCA 4YEAA 4ZLLA 3CJ2A 1GX6A 3CCWA 2EG1A 4ER8A 2J4RA 2IY5B 1DEJA 1RHKB 5K8MA 2CA9A 2RIJA 2DD8S 2KLAA 4OHZA 2LEPA 4CESA 1QSSA 5DDOC 2VCPA 4K8RA 2IC3B 1QZ5A 4USWA 3UCUP 3IG1B 2ZHAA 1HNXJ 2YI1A 2ZGZA 1S0NA 2CPIA 1NLKL 4JI6J 2YNFB 1TELA 5F8NA 4F26A 1RWMB 3CCJS 2BGGA 1QAJA 1HJOA 1SJ1A 1NSAA 2EK6A 2HVIA 3CC7S 1CXUA 3BH6B 3HMJG 1U1QA 1A5XA 5AQGA 2FY8A 3IFRA 3Q8SB 2ITGA 1TTHB 4PWWA 5DM7L 1X8DA 4EIAA 2KN4A 2N82B 5A6WA 1RTZA 4ED0A 3MEEA 4EZ9A 4LBPA 3A5OC 5L1IA 4M94A 1D5AA 3T1HJ 1VRUA 3MEGB 3RSEB 3BO2A 3WT0A 3C3LA 3OYDA 4UT4A 2PFFB 1R6VA 1LNQA 1VBYA 1DURA 1S77D 4JKGB 3P83D 4CEQA 4JI3J 4FVCA 1BXNA 2XWXA 5HSPA 5D6GA 4ZPDA 1EQYA 5AJ3J 4WFXA 2NXUA 4RJVA 4DSLA 2BMBA 3SAFA 3THTA 4JI5F 3BH7B 4C97A 3MXMA 3B4DA 2CQDA 1RTJB 3AH6A 1Z2LA 2LQJA 1N56A 3MD1A 3HCXA 1FXXA 4A61A 1IKWA 4MKVA 3CF5Q 7AT1B 3CG7A 3O4QA 3OJUA 4C3MA 4X4UA 1L3KA 3DGVA 2UXBJ 3DRPB 1KVAA 3W8PA 4QR1A 4BRQA 3SAGA 1FKOA 2ZBRA 3MPDA 5LMNK 2W2MP 4H5NA 5HROA 3SUNA 2LDYA 2WVDA 3QJJA 4O4GA 2B6AB 1RBOB 4C8ZA 3WDOA 5KGWA 3A0IX 4WFBL 3ZZUA 4CO5A 3OYBA 4MT1A 4LR7A 2M4MA 1U0SA 2HBQB 3NXZA 4QR2A 4KT0C 3OR2B 2RDJA 3P96A 1K9MO 1S1TB 2CQ1A 5C10A 4Z4GA 3DFEA 1SC1B 3IBFB 4WPAA 1DT9A 1FKPB 3ZZPA 3ISNC 4K4WA 4YDXA 2BEFA 1RDCA 2V8VA 1W97L 4JEPA 4ED5A 5B0DA 1Z4UA 2D0CA 1WSJA 2YHBA 2RRBA 4NLRA 2GIRA 3ENOA 3KJVB 2DH8A 3Q8PB 2ZJQL 3DYAB 1RCOB 2G13A 4X4OA 4FO0A 3HOSA 2MMYA 3DXMA 3R3TA 4UOGA 4YS2A 5C2GA 2QO3A 2JVRA 1MN9A 4HH0A 2YWFA 1X5SA 4CVNE 3K58A 3A8JA 5DETA 1CLFA 2GMLA 5M1QA 4NASA 3ZSQA 4I7FB 4ZPAA 4DR4F 2Z4PA 2OEMA 2RN2A 3QZ8A 2BZ2A 1NGGA 4KH1B 2Y3YA 4J9RA 2UVRA 4KFBB 3B8AX 3RGIA 5DDRC 2ZJPL 1NEEA 5ITHA 4CTAB 5K20B 4DUZK 2ASOA 1JLEB 4CIGA 3P38A 4JKAA 2J6UA 1G15A 1V9OA 3QIDA 1YITN 4Y28C 3Q0AA 3CERA 4CK1A 2GNKA 3WBZA 3OYFA 3HZEA 5FLXU 4ID8A 2A5XA 4CIOA 2JVOA 2N4DA 3HTVA 3OFEA 4KHPJ 2GCFA 4JRPA 4RNHA 3WXLA 3W2VB 4PG6A 2ZVIA 4DPXA 3G6XA 4CD3A 4FLWA 3QRPA 4FXWA 5M1KA 4LFCJ 4F2SA 2HQCA 1NK9A 2QZ8A 1VISA 3B82A 4WXWA 1T6CA 4I9QA 3VQAA 3CJKB 3NBPA 1HYSB 5FDLB 1T05B 3TZYA 4A8KA 2A3JA 1BC6A 2KB2A 4M1KA 3CUNA 4JYAK 2YY3A 4NX9A 2CJAA 3BKTA 1TUGB 1SIZA 4C8OA 3GIMA 1SC3B 4JI4K 2WVFA 4OZ1A 1AUDA 5I4MA 4F9OA 5BR8K 2MQNA 1OVQA 3DOKB 4FYYB 2FXUA 4KGKA 1TGOA 2LSNA 3GU0A 4DX6A 4K4XA 1R0AB 3MEGA 3U27A 4ERDA 1WF0A 1HR0F 5E3RA 3UKUB 4M95A 2XC9A 2MLZA 4CLYA 4H5RA 4RBVA 3CCVN 1U0HB 2KXFA 4QWDA 4HR2A 3ZYYX 1JLCA 2QA2A 4JI8J 5IT9Y 1QS4A 3H3NO 1AT1B 4J8FA 3I0RB 4UUXA 1S5JA 1Q8LA 4DQQA 1HL6A 2QLBB 1RDAA 1RBTA 1VBXA 1YRXA 4A8FA 3OW2M 2W9BB 3F44A 2QA4N 3S9HA 3CXCM 1NNDA 4RTFD 1T3VA 3IAYA 1VRTA 5CR4A 1SPBP 4Y2AA 4P2XA 1XMOK 2R2UA 3JTOA 4TYBA 1RAOA 1VQ4N 1WSEA 4BRPA 1KHWA 4WIQA 1LFPA 2MYFA 4CHNA 5HN0A 4NLDA 2VPZB 4ICLA 1HJRA 4U8VA 1VK3A 4WTOB 2QLXA 5EGYA 2JL9A 1C0UB 3P5TL 4AXIA 3GPAA 2OJ3A 2VG5B 4DV7J 2UXDF 5KFHA 1X9JA 1K9MT 3TU5A 1G3OA 2GGPA 3W66A 4RCHA 1XK8A 4JRQA 5B09A 2D3OR 1HMVA 1F0XA 2FVQA 4DX7A 2LQ9A 3VEWA 4UY85 3S3MA 3ZZTA 4QIWD 4FM2A 3L3VA 3VAJA 3D7SB 4DS4A 4USIA 2HZAA 1GOAA 4JN4A 5BR8F 2OYQA 3E66A 2N7YA 3ENWA 4USTA 3AVFA 5LOQA 4EP4A 1WDTA 3RW6A 2CQIA 2A10A 3ID8A 4DTSA 3MN5A 3KVGA 3FGUA 4KHYA 3I0SA 3GG1A 3PRBA 3IWXA 4LFAF 4IO9Q 3HVWA 1D9AA 4X64F 3VAKA 4WQ4A 2E5IA 2BUNA 5F3TA 1REGX 2NXCA 4A59A 3A8EA 2YNGA 3KTQA 4FJKA 3KYLA 1NHVA 5KG6A 4ED8A 4KO0B 3TR5A 4DV1K 1YX2A 3N28A 1JJCB 2HSEB 4GV3A 3SPYA 3SI8A 1S1UB 4CK2A 1RP5A 3TAMA 2ZWOA 2Q0UA 1YJTA 1FWKA 4C3LA 2MZRA 1SQFA 4ELVA 4J9VA 5LJWA 1P8GA 2P9PB 1X31C 4CYUB 4B3TK 3WXIA 4QJVA 3I4HX 2DEIA 4WFNQ 1NGJA 1JCEA 1M1GA 5A2QO 1CULB 4QIVA 4YR0A 1VSEA 3O9QA 5G4DA 2OCEA 2QLWA 5AQOA 4BRAA 4IH5A 1NK5A 3ZC4A 2V63A 4DQ8A 2EFPA 4FVUA 1WTFA 1VSMA 1XI1A 2DHSA 2GZOA 2D3UA 3PY8A 1QUPA 3MEDA 2F8TA 3KK1A 4M8LA 3I96A 1WD6A 1LK7A 3CJBA 3ZX2A 1AZSB 4YR2A 3RMCA 3L0QA 2WK4A 3G87A 2I6WA 2IVOA 1HNXK 1VSIA 2OUGA 2CQ0A 4FF3A 1WBBA 4LF6K 4OX9F 3TSUA 4NA3A 2CQPA 1GMVA 4W4MA 3T1HK 2ACMA 4XK8C 2FGCA 1UFWA 3DGPA 4LF4K 3VTIA 4LF4J 3VEZA 2ZWPA 2QWNA 2P6TA 5IXUA 4OZNA 3I32A 2W6KA 2NUBA 3QEPA 3O1LA 4UQGA 4QIEA 3M2VA 1NK0A 4JI0F 3PYGA 3GDQA 5AR0A 3G4SN 1HQEB 1MWZA 3D3BJ 3CMEN 4Z94A 4CEDA 4CZHA 4CIFA 3U02A 5RUBA 2V8GA 4Z37A 2RB7A 2V7YA 1TFYA 3PO5A 3C19A 4LF6F 4G65A 3AJ1A 1F60B 1VQMN 1IKYB 5JJBA 1EARA 2GVZB 4Y00A 2B51A 2QTWA 4NYOA 3CETA 3V6DB 2VKRA 3TX0A 2FJXA 2DO4A 1YIJN 4DCHA 5ETQA 3DXKB 4DG1A 3LP0A 3K17A 1F9EB 5CHIA 3UD3P 3F41A 1F2HA 3IWLA 2HMPA 4M63A 4EAHD 3LALA 1I1GA 5EN1A 1YITS 4WU2A 2ZH2A 4H0XB 1RJJA 1RLCL 3HOTA 5KFMA 1IWAA 2EFGA 2B0GA 1RDDA 4CBXA 2MHNA 2WZ1A 3L9ZA 3MAQA 2G8VA 5HMWA 2P5GA 1SZ2A 2ZZTA 4EGLA 1FI4A 2WBRA 4H4MA 4DV4K 3OL6A 1BI4B 2R3VA 3H90A 2E5JA 4PPZA 1VOMA 3PTWA 4F02A 2YPZA 3VA0A 4MYUA 2KYZA 3OYCA 4NEZA 2RRAA 2UV8A 2VODA 1RQ0A 1B64A 1NKCA 1BLUA 4ZVHA 4RZRA 3H5SA 1H7WA 2HS3A 4WZQA 2JLEA 4KHRA 3IA0A 2UVWA 3KJQB 2RS8A 2OMOA 3NOGA 2NNWA 2AKWB 3CJ4A 2D74B 3K5OA 1GAOA 4ZVOB 1HHSA 1BWVA 1XNRJ 3HFVA 3S41A 4Y2MA 2EFOA 2V2KA 1LK5A 1LW2B 2KL8A 5DRKA 2XY7A 3VESA 3EGZA 2H65B 4IDHA 3TNVA 1ITPA 4OPHA 5H9FK 1M1KO 5CYQA 4DR7F 3H46O 1QAXA 1BI4A 3L6QA 1D0EA 3SBGA 1H7XA 2UUCF 2CDRB 3ZZYA 4WP3A 2WRMA 1KVJA 1X3MA 2FQQB 1ZZFA 4EZ6A 2MSSA 3UN5A 4IR9A 3D2FA 2MY7A 3H0PA 1O51A 1D4XA 2UXDK 4NLBA 2VOPA 2D41A 4DUTA 3MM9A 3O5TB 4BBYA 2VFVA 1ATNA 3BKFA 2BJ8A 1KOHA 4BR2A 2Q97A 5EVZA 2UXCJ 5D8HB 5L39A 5GAEI 5CA5A 5E41A 2M8HA 1V5VA 2BVZA 1LFWA 3LUYA 4CO1A 4QW8A 3NBPB 4RUAA 2ZH6A 3VQPA 2VFTA 1FTCA 4DOZA 2BRKA 3KWMA 1WG1A 3R5JB 1BCOA 1G99A 4DKWA 2YWKA 3I55N 1WOQA 4PL7A 5J1EA 1M5OC 1YBUA 5HRPA 3CQXA 2HF3A 3CTRA 1WNEA 3ZETA 4LFBJ 1C1BA 3MR3A 2AV5A 4U7UD 3M8RA 1DKGD 4GKKJ 3AVKA 4FJXA 2GVZA 4ZMMA 4JI1F 4NZ7A 3M8QB 2XGQA 4EEYA 1Y3JA 4FWOA 3U9ZA 2ZKTA 3WXJA 2P5VA 4ILRA 3D2EB 2HVEA 4LF5F 4Y3CA 2Q3SA 3BP8A 4PXBA 2H48B 4OGCA 4E0DA 1U8WA 2AZ1A 1CEZA 2C2OB 2BUPA 3EEQA 3M32B 4I6YA 3ZETB 4ECSA 1CC8A 1TKTB 3R97A 4UQTA 1P27B 1RT3B 1WG5A 3FNNA 5KG0A 3US5A 4DV4F 3MXHP 2XZDB 1U24A 2MKCA 1TP7A 2XLIA 2YNHA 5LJ5Y 2AW0A 4IFVA 1AFJA 3ISND 2P9LA 3CJ5A 1ZBIA 3TSQA 5IT4A 3U3YA 3DLRA 3QLHA 1SH0A 4CNZA 3LDSA 3SCKE 1RAFB 4CLFA 1T9WA 4ZP8A 2EWSA 3DHXA 3W61A 3HL8A 2MQLA 4L72B 2BOPA 1ZH5A 4IG0B 1C4AA 5E0OA 1MROA 1RTHB 3PKMA 1LOUA 3W2WB 2MPUA 1K8AT 3QIPB 2O67A 5HP1B 4X62F 5CAAA 4I68A 4FWMA 1ASWA 4B1XB 2LECA 4WIIA 2YJEA 2DTJA 3JS9A 4DX8H 1G1XA 4CW7B 4ILGB 2BACA 2PC6A 4OI3A 2KM8B 3QNNA 2HOEA 4JB8B 3VERA 3Q2SC 1L3SA 1FDDA 1V4TA 3RRGA 1KN6A 3G10A 4WYLA 3FSXA 3BEGB 5DK5A 4BC3A 2RUSA 2JRSA 1FDBA 3PNIA 5KQDA 1VC6A 3OHRA 3BQ1A 1RWUA 4LSZB 2KTQA 3OTOJ 4MMOA 4ZLPA 2AJFE 2AEJA 1O6XA 3FCHA 4NLQA 4KHQA 2QWQA 3W60A 5I9EB 4DQIA 4DQPA 3PM9A 2YV0X 3T6JA 1FJCA 2R7WA 1J5EJ 2C28A 3AA2A 3CJAA 4WFBQ 3SV3A 4HUEA 3HHNB 2E2NA 5AQLA 3M6VA 3MCAB 1OO0B 4AHUA 2DXDA 3QO9B 4RLEA 2BM0A 4OX9K 1JLFA 2V6AA 2OZMA 1DHMA 1GTHA 4K0KJ 4X66J 1XEZA 1AB8A 3CCLS 1TL7A 4NLCA 1NH7A 3ZZOA 4NEYA 3OYHA 4UY8T 1HNVA 3FJ2A 5BYQA 3O6QA 1N6QB 1SL1A 5D4OA 1PG5B 4HHUA 2RQKA 1MA9B 3V1QA 3MN7A 5I3PA 2GEMA 2HRUA 3CVKA 2MGZA 1R6YA 3ZEUB 4IG3B 1N5QA 3RB4A 4OMFG 3WQTA 2OKQA 4CJLA 3IGVA 1NK8A 5F9NA 1HNWF 3DLLQ 1UTAA 2AYBA 3JQKA 1FEHA 1Q8KA 1OPZA 4MKBA 4ZCKA 4FWPA 3HPOA 1N4LA 1OH6A 3VF6A 3DGPB 1G6BA 4FM1A 1ILYA 2XY6A 4YB7A 3DOLA 3ATVA 4CI0B 1GOCA 2VL1A 3V1OA 4X65J 4N77A 4KHPK 3DXMB 2HWTA 4NO7A 1YJNN 1UP1A 3V5RA 4UOCA 3WNEA 3ULEB 4ZKAA 4RPFA 5C2CA 1C0MA 4EFAC 4I56A 3TW0A 4JI5K 5U47A 3CQYA 3UR0A 3OYEA 4C2MA 3BREA 3FGVA 1FW6A 3MAAA 4GMJB 4OZ3A 4BACA 4JK9A 5AQTA 4QOZB 4I6MB 1ZM9A 5JMNA 3OSNA 3CM5A 1T05A 4PYAA 2UXCK 2E5LF 5JVGQ 2I7NA 2NRTA 4JI0J 2OPRA 3KG4A 2J9CA 5FIIA 2C2RA 1WDDA 4Q7AA 4N5SA 2DVIA 3MPWA 3MFHA 1SJFA 2WC9A 1V3SA 5GAGI 1JIHA 2GQQA 2DCLA 3A1YG 5J1NA 2X74A 4FZZA 2W25A 4ZA1A 4IOAQ 2W2OP 1NZAA 1RGVA 4EMDA 5EXWA 1O1WA 3C94A 3HM9A 3PIOQ 2HK2A 2DHHA 2B9EA 4A62A 1NPPA 2UUBK 3ZSRA 4KO0A 2H4WB 4GKKK 3DWLA 2XYPB 1BOTO 4LSLB 1YQHA 3HSJA 3AVNA 5KOXA 2EXUA 2E2QA 3CCLN 4RWWA 3LWLA 2QEXN 2LXUA 1U2CA 3MEEB 3V6KA 4JS5A 5LY3A 3EX7B 4C0OC 3MMJA 4YOWA 3OSPA 3BGRA 2HBZB 2CPXA 4ATNA 2ZM6F 5B0CA 2AX0A 2IGIA 3QFPA 2JX2A 1YWXA 4CLZA 4WP8A 2VFRA 3ZNUA 2ILYA 4H0OA 1KAXA 2FHMA 5KFQA 1K0VA 1JXEA 2YX4A 3PJ9A 3FZLA 3MZIA 1JMTA 2CQ3A 2QA4G 3M8YA 4LY7A 4EU0A 1NM1A 5C42A 3I6PA 2IDLA 3KLHA 2AJ2A 2HG4A 2A6MA 4ID1A 3I31A 2ZC4A 1T9YA 2F8EX 4FBUA 4OI4A 4HCCA 1NB7A 4U67L 2BW7A 1WOSA 4AD6A 3RBZA 1UJ6A 1RI7A 2A42A 5AJ3K 3W9JA 2F65A 4O3SA 1ZM4A 2VIHA 3NMRA 3AD8C 5TKYA 5M1PA 2FHKA 4KC5A 4ELTA 1IBMJ 4AQYJ 2MQMA 4QS8A 3AVIA 1VS3A 1IG8A 2FZGB 3CJKA 1V3ZA 4BC2A 1HLUA 1V5IB 2W8KA 5CD4H 4Q43A 2R7VA 3ZT3A 2BJDA 4M5DA 5GAGP 2QSFA 3D1HA 1N33F 2OMLA 3AD7C 2LCWA 2QL9B 4ES1A 1Z2ZA 3R7BB 2V51B 4CJKA 3CDBA 3IBWA 3O1BA 1AROP 2RPIA 3R27A 2CDQA 5JLHA 2QKBA 2HHPA 3LF0A 2F5GA 1RT1B 2PT0A 1J9AA 4I4BA 4GMKA 1RBLA 2IBOA 2KFYA 2BJEA 2LU2A 4XEIA 1HKCA 4CJ4A 3NNAA 3LZJA 4OJ3A 1RBVA 2UUAK 4DV4J 3HJVA 1RWPB 3W9HA 2O8BB 1L3UA 3TTFA 2MZ1A 3GR1A 1ICEB 4CJ7A 1WBDA 2B7BB 5B0BA 3G71N 1EO1A 4CGFA 5IWAK 1VSFA 4Q0BB 5HMZA 3HHLD 2H9ZA 4CHQA 3BYRA 1FNXH 2X51A 1FHTA 3OVBA 1WSGA 2HFZA 3J7YI 4WE1B 3HD2A 3RAMA 5KT3A 4BR5A 1Q86O 2MQOA 3KFWX 4NRUA 3CC2S 2R7QA 8AT1B 1X5OA 2H51B 3VVUA 4ZK7M 3OTDA 3UCZP 4PKDB 3AJ2A 2J9EA 4LRFA 4CLUA 3CC2N 2KVQE 5DO2A 5JVHQ 2YKMB 5J2PB 3CC4N 5H9FJ 2V8PA 1HNVB 3TRGA 2WFBA 2LFVA 3Q24A 3H2UB 4WFNL 4WP9A 4A2BA 2ZM6K 2VG5A 1XNRK 1NKBA 2QTDA 2WVCA 1HPMA 1E3MA 1RHMB 2B8QA 1HBNB 1K8AO 4OI2A 3PCOB 3PFOA 3MM7B 3IO1A 2KQ2A 2WOMB 1KVBA 2DNMA 3LPTA 2QKKA 5ADXA 3IS9A 5BPNA 1XR7A 3WUHA 2B5JA 3GB0A 3F73A 3FEYB 3P8BB 1RKIA 3MAHA 3ZTPA 1VQSA 1U26A 1H0HB 3TSPA 3M8ZA 3V2UC 2P9PA 1VSHA 2YPYA 4DR4J 3AAPA 3V9ZA 5MLCQ 1RT6B 4ED4A 2HEKA 1X4HA 4G3IA 3W62A 4OYMA 2QM1A 3DI6B 4KBIA 4GKJK 1S9GB 2UUCJ 2YQ0A 5CZVA 3ZCMA 2I9SA 5KFTA 3SUPA 2YQ1A 2D0OA 4DV3F 4LJMA 1RT7A 1L3TA 1YVUA 3J8AA 5AZIB 3P39A 4P74A 3M5RA 4WK1A 2V69A 4LF1A 3PR4A 2OPPA 4J2BA 2AU0A 4ZHRA 5DG7A 5HJYA 4ZS6A 1TK0A 3QQCD 3QT8A 1RWOB 2Q1NA 4NCGB 2RDDA 3MPYA 2HQ3A 3GL1A 3ZSOA 1REVA 3ID6A 1LQ9A 1XC3A 4C8YA 3CDAA 1QDUB 4E3SA 4KPCA 2V2VA 4FLVA 3HP6A 3LZIA 4E19A 4PQUA 2WSFC 3QICA 3SDEB 2R2TA 3R2DJ 1U45A 2VBYA 1FKPA 2L9WA 4F8RA 1U04A 4DV7K 2COLA 3THYA 1X60A 2RD5C 2RSQA 4FZXC 3QGIA 2DGOA 2QG9B 3BYPA 5E2QA 3AGRA 5E5NA 5HJXA 1JL1A 3I55S 1FX4A 2GBZA 4FYWB 3MCOA 4O4GB 2VD3A 2FDNA 1NDLA 2X1FA 1HWLA 3LDQA 1XTZA 1JNZB 1MWYA 2V4QA 3IGNA 2VZ9A 1I3AA 5E33A 4K4SA 1QAIA 4M63C 1TYQA 2BANB 2K2PA 4J9SA 4GKJF 1I94K 4P52A 5JS1A 4LD0A 3FMWA 1TMJA 2WUSA 2AYMA 2QIFA 2HW3A 3ZX3A 3OPKA 1PO6A 5KG3A 3QEXA 2NXEA 1QQCA 1PIEA 2R8IA 2VA2A 1IH7A 1WAFA 2M2BA 4CJWA 5L8RC 4E7JA 1WUUA 4DF8A 3TOQA 1N5YB 5AXKA 4FPAA 1UFKA 2V2QA 2O1PA 2CWKA 1J5EF 4NPOA 4C0HA 4YDUC 4DR7K 2ZJRL 1DQAA 5CH7B 3QGPA 3SUQA 2I5JB 4G1IA 2DISA 2DR8A 2CNKB 2YNHB 1QVFM 1VQ8S 1MSWD 1VHIA 4YB1P 4IFVB 1F9FA 1N36J 2F9DA 3GYXB 1GX5A 4PUOB 1BMQB 2MHEA 2LA6A 1UEVA 1KDNA 5HANA 1HQUA 2UP1A 2CGKA 4AXJA 1SQEA 4B3TJ 3FZKA 1KC8O 4LBHA 1VQPN 1XNQK 1OWXA 5KFDA 1WN7A 3EXCX 2NPIA 4K42A 4DR5K 5HATA 1JJHA 5KFYA 1E6VB 5IT9O 5JICA 1H3DA 1ATSA 1YZ6A 2ZC3A 3M9MB 4ECYA 1QD1A 4N47A 1J5EK 1T9XA 1H98A 3GSDA 2P1JA 2KRBA 5DM6Q 2ZE2B 1Q16B 2NYHA 3CCES 1VQ6N 1T7PA 2XGPA 4RU2A 1GFWB 2HQDA 3A3NB 2B8PA 5D0RA 3NGDA 3A8IA 5K14B 1S72N 2RQMA 4NCBA 5AQFA 1ZAVA 2OELA 3EL2A 5E84A 2GO8A 1HWKA 2HRYA 4CLTA 1IJFB 1EHWA 4ENOA 1WC3A 5C24A 1CULA 4P71A 3K0JA 4F04B 1F3VA 2ATCB 3JTNA 5KFGA 2AD9A 4K8ZA 3CPWM 4Q0BA 4USUA 1I3OB 2RKIB 3HHLA 3M8QA 4U7CA 3Q89A 2CJBA 3AA4A 2IA6A 4JI4F 1WKKA 2HHHJ 4RO0A 4WKYA 1V3RA 2BE2B 1FF2A 1A5VA 4HKQA 4PG5A 4GNIA 2BRLA 1KEKA 2BM1A 3OTBA 3BF3A 2R7XA 3MM9B 3ZT2A 1GT8A 3G8TA 4CI6A 2O4GA 3CO0P 1FRXA 1N36K 4YN3B 1ZAWA 2DB1A 5C0YA 4FW2A 2ZH7A 1VQON 2ACYA 5GADU 4CFCA 4RWTA 1VRTB 4OJ1A 2PI5A 3CCJN 2EG2A 5AQSA 4ITSA 3HF5A 3V6HA 3IR5B 3KLFB 1HNIA 3T5KA 4LF5K 5I42A 4WXOA 3OHAA 2K7KA 1IJEB 5M2RA 4FOIA 4BC5A 2J8SA 4WFZA 3BJYA 2FB0A 1RB0A 3EVOA 3W0LA 3ELHA 5D4PA 2Q1LA 3DLKA 3KD5E 1BWFO 4EBDA 4LH4A 1OY6A 4N8OA 1T03B 3LP2B 1XNRF 1XJWB 3HVRA 3BM7A 4Z7YA 5CABA 4CHOA 1CZ9A 2CPEA 2J5AA 2VQEF 4DV3K 3OR1B 3AV9A 1VIXA 2MZSA 2IA0A 3EE9A 2B5JB 3VAGA 4ZJQA 3THXA 2XNRA 3K5MA 4J2EA 3RYLA 4ZVFA 1Q82O 4UUWA 4Y34A 2VWKA 3EM1A 1HNZF 4BDZA 4Q2LA 1DFDA 4IFYA 3H25A 1TL1B 1FO1A 3VF2A 1CLQA 2OPQA 3K2PA 3KLIB 2IPOB 4A5AA 4EK2A 4HT5A 4DHYA 3U8XA 3KIOA 4GVMA 4J91A 3DI6A 2FUG9 1X4AA 1GLJO 3SSSA 3G8QA 1B99A 1NAQA 3P6YC 2W9AA 4Z4FA 3AB2B 2CYYA 1LWXA 1WI8A 2F9JA 4OHYA 3CULA 3L2UA 1S6QB 2G8IA 4DTJA 4FKYA 1T9UA 3F9MA 1MMLA 3BB5A 3MR5A 1FDAA 1EX8A 1S9EB 4R8UA 4J9PA 3OYKA 2ZBPA 4AQYK 3CHWA 4O3PA 2VFSA 1J53A 1SAZA 5GAGU 2MKKA 2XMJA 3WEEB 4KH5A 3CDEA 3M7VA 3Q7BA 1PC5A 2C2KB 1Q7YT 2RHSB 2PMZD 5IWAJ 3ZZ0A 3VEOA 4DV6F 2LQ8A 4M3WA 4J9QA 5ELZA 2IRXA 3CMQA 1HPZB 1VQOS 1R8AA 5DMRA 1QJHA 4UY8O 4FF4A 1DJ0A 2HQIA 2D0AA 4XIUA 3CD6S 1C0GA 4DTXA 4C98A 5HK4A 4LUBA 4A8QA 4ILLA 3GCXP 4HI2A 4M5KA 6FD1A 2XSFA 5KFZA 2OP5A 2IDEA 1FCAA 4KY3A 1YJVA 4OV1A 3UNGC 3ENQA 3PRDA 3BO3A 5HP1A 4AE5A 1TKXB 4O0NA 4WBFA 4CT9A 2YKNA 3OQ2A 5IQ6A 2AQ4A 2AYEA 1SCJB 1T94A 4DSEA 3PIPQ 4IKFA 1T6DA 1GH8A 2QRRA 2VKZG 2GAGC 3H08A 2PE8A 4IEIA 1NK6A 3GTYX 1BY9A 3OXLA 4USKA 4FJMA 3NF8A 1JK9B 3ONQA 4M3TA 2POKA 4KSEB 3HJFA 3RBEA 3E9PA 1QTNB 2NLXA 3IN5A 4DPWA 1NMEB 3FBEA 4TYAA 5TKWA 4ZTJA 1KLMA 1S6UA 4J9OA 3HHKA 1NHUA 4EHUA 1DTTB 1NGHA 3DXBA 3IKMA 3M8PB 3OBYA 4MFBB 3NRBA 1RE1B 4IDKB 1IR2A 2J7KA 3OL8A 4JI6K 2YTCA 5LSLA 2DITA 2VF3A 4PA1A 1FVQA 4FNHA 5BN9A 3FDSA 4N41A 5K9FA 1FESA 3JYTA 1IM6A 3D4JA 2AWZA 3TEHB 3DOMB 1I6JA 5THWA 4NLVA 1FVSA 3V9SA 2P9KA 2UUBF 4DWIA 3C15A 2Z2ZA 5L38A 3MCPA 5F0XA 5ETPA 3OL7A 3AY9A 4IG3A 4WCEQ 2Y0SD 2X6SA 2VH7A 1NSQA 3LP1A 5KFSA 3TZWA 4IOAL 4BCAA 2C2DA 4JK8A 3Q86A 2HS0A 5CQGA 3PIOL 3F2KA 1MW7A 1J6ZA 3J81U 5F2RA 4KE5A 4BRGA 3HO1A 1T0TV 2Q3PA 3IBCB 5LXYA 4O55A 4CO4A 2AJ4A 5EDWA 3VTHA 4O5BA 5BYRA 1XQIA 3LOUA 3HZ6A 2RQ4A 2E5LJ 4K4YA 1RDWX 1T3OA 3AQOA 5F8JA 4M3XA 3HSGA 3MCSA 3QFUA 4YQWA 2Z1HA 2CPDA 4K4ZA 5KFWA 2OIHA 1TL4A 2F96A 3AO1A 2BR0A 3OHBA 4I6WA 2JSXA 2Y1JA 4BRLA 4A4JA 2PBDA 1NK7A 2RU9A 1QHAA 4GW6A 3UN2A 2VB6A 4B02A 3VQQA 2VDIA 1RAAB 3BSCA 2HHSA 3VOVA 2VOOA 3A12A 4AYBD 4NYPA 2W9CB 1OSDA 2EBGA 4FPIA 4JI5J 2A6OA 1HNIB 4YOEA 1UEUA 1PJ6A 2Z57B 3KLVA 1MMNA 3MN9A 2AT1B 3EZ5A 2C3MA 4BLGA 3W7BA 4NLGA 2M3DA 4HDHA 4XDCA 3TVYA 1NGFA 1YJRA 3CB4A 2P9EA 4FDFA 4KGMA 4AF1A 1S12A 4AL7A 3VR1A 5LJ3Y 1UW9A 4PEOA 4B1YB 1QTMA 3CJRA 1YIJS 3R7SB 3D6MB 5E3AA 3ZNJ1 1HBMB 2C3YA 4A57A 4PXEA 1JQGA 3TYTA 2VC0A 4X65K 5F8IA 3CJ9A 1ITGA 2FVCA 3G0ZA 1PKUA 3MXJA 3TA2A 2JGUA 4J2AA 4DV2J 1OQ3A 5C2FA 4DFKA 1RFQA 2P8IA 1TL3B 4KHNA 3QB0A 2WTUA 4BC4A 1NMDA 2M70A 4B3SK 1X4EA 4NLOA 2WB1D 4TLRA 4ZHRB 3WXKA 4AHTA 4FYVB 3HVTB 4OKEA 1RAHB 1OJ4A 1IBLF 2JLGA 3I8BA 5AZJB 1HBMA 3VGUA 4YY3J 1ATRA 1BUPA 5DZ6A 1QVGM 1KTVA 2ZOFA 3IRXA 5A0YB 2LEAA 4B08A 1H72C 3GFZA 4YOUA 2ALYB 4MJKA 3EXYA 3RVCA 1HYZA 2D1KA 4O0JA 2WONB 3TX8A 1U1MA 1U47A 4IBNA 4GVEA 3C8YA 4J9NA 4H0PA 3RW7A 2FHOB 3CJQA 4M3ZA 1SQGA 4X2BA 4HTLA 2DNKA 4ED6A 1SV5A 4BRMA 4IQMA 2JOQA 4U7UK 3LL3A 4URGA 2MLYA 1U1PA 4FLZA 1VQ5S 4R79A 1NJIO 4RG8A 4CJUA 1Y7PA 3VF4A 1OPIA 2K3KA 3G82A 4HL9A 2Q79A 4RKUC 2C3PA 3NAIA 1S49A 5FJ4A 9RUBA 2IVYA 4GKKF 1YVFA 1SH3A 1U1LA 4DPYA 2UV8G 3H59A 5HO4A 1VK8A 1GNKA 1RCHA 3TAFA 4H4OB 3R1XA 3ULHA 3CJ0A 3AAQA 4GVBB 3BBBA 3M3ZA 4CJRA 4JKHA 1ZM3A 4B3MF 4JI8K 1EP4A 4CEBA 1NZ8A 1EWRA 1PILA 1U1NA 3E9OA 2IAJB 4ZITA 3DMJB 4C3KA 1KP6A 4AT1B 4DPOA 1KD1O 1CQNA 3THXB 2AGOA 2QC3A 3U3GA 2ZD1B 2MQ8A 1RDRA 4LRAA 5IOLA 2O8FA 4NXMK 4WJBA 2VPXB 2E20A 3B6OA 3OFFA 4IFYB 2HB5A 3PW0A 3R6GB 3W2WA 4W92B 2YCHA 1VQ7S 4EHTA 3G6ES 4FWSA 1AA1B 1RGIA 1RAIB 1F21A 4B3TF 3HZGA 1R8HA 2D5RA 3C2PA 4B9MA 2MLXA 3MMCA 4J9MA 2G2YA 3CCSN 4O3OA 2HFVA 4WTYA 4B1WB 5F9LA 4FK4A 2RE1A 4B3MK 2DR6A 2JC0A 4WYWA 1BA0A 3TARA 3R3LA 4FLYA 2GVDB 1Y64A 4ZJOA 2VJVA 2AA4A 4B3SJ 4ECVA 4Z2XA 4O23A 3MTJA 3PHTA 4EO8A 1UW4A 4OYBA 5IM0A 5DQGA 3ET6A 2E29A 2H3GX 2DPNA 4LF9K 3H45C 1A7GE 2B43A 5KFRA 3F0NA 3NOCA 1A5WA 1NGDA 4UZCA 2G1HA 4CF8A 1R8BA 4ZOSA 5L1JA 4FJJA 1XNQF 2XB2D 3JAMU 2PFDA 1SKRA 4CD1A 1YUWA 4CEOA 2W2NP 2FJAB 3W2VA 1UJ4A 4CERA 1UVNA 1IQTA 4OYIA 1D8ZA 1LAWA 1WELA 3VCDA 4QW9A 2HGNA 3CCRS 3GV8B 3CMAS 3NH2A 4HHJA 2QFJA 3U1NA 2H5IB 2RMLA 3TJ9A 4U8YA 2BYCA 2GFFA 2DY4A 1S59A 1O8BA 1RWVB 3LP1B 1IBMK 2NRRA 2GA7A 4OYAA 5HBMA 3AOCA 4NLUA 1YT3A 3TPQA 4AHVA 3Q23A 3MK6A 3HBTA 4PUOA 3PO4A 2E7XA 4IO1A 4EO6A 3CCQN 2ZH5A 2OPPB 4U6PA 2FJWA 1K47A 4LSNB 5F1XA 3TZZA 1TKDA 1LWEB 3VHQA 4D3GA 2ASLA 4O8KA 1ZBTA 1XNQJ 1Q9YA 2CJQA 4FN5A 3DRSA 1IBLJ 5AQNA 4PYDA 5E3CA 1TMMA 3T5HA 3T6BA 2IM0A 4CLPA 3PW4A 5T7LB 5KRTA 4MK7A 5JUMA 4IR1A 1KTQA 4USMA 3MECB 4LT6A 2ATLA 2NZ4A 2WBMA 3CCSS 3NY0A 3X1LB 5D78A 2VPYB 3J7Z5 4P6QA 4DF4A 4O44B 2DGQA 4NXMF 2NPFA 1RT5B 5AQYA 4G1PA 3SFUA 3W63A 4RU9A 2HLTA 5C24B 2MZQA 3I0RA 3PKYA 4GO5X 2G8UA 1C0TB 3AVGA 1MDUB 2A1RA 2HNZB 5ETMA 4MO4A 1YBTA 5BRDA 3M8PA 3KLIA 4NL5A 2RAQA 4IDKA 4ID5A 4AHSA 3NCPA 2AEFA 3SQGB 2Z2MA 1VSKA 4F4AA 3H8YA 3N5FA 2Q6BA 2XZTB 3QT6A 2DT9A 4YB6A 1MU2B 4WU3A 3TQEA 1K8KB 3SUOA 2BBEA 3NGRA 2C2ZB 4L8RB 4O0IA 1B7YB 1NGAA 2AJ0A 1X5TA 2PO4A 4XO0A 1W2BR 2HNYA 2PAVA 1S0VA 4R5PB 1IBLK 3D66A 2PI4A 3ZSXA 2CPHA 4PCQA 2ASMA 1WJ9A 1RU2A 2W4CA 4QCLA 2BV3A 2I2YA 3KG0A 3RU0A 2CPYA 2F4VJ 2JDJA 1U6ZA 4QPTA 1X1PA 1NPKA 2R8HA 1HI1A 2LMIA 3J7YP 1F3FA 2WCXA 3DDIA 2L48A 2ZITA 4CP5A 3O80A 3MCMA 4I1TA 1HW9A 2HKEA 3I8DA 2FTRA 3C6AA 2UUAF 3VQ8A 4EI2A 4WWSA 1S99A 4CZEA 4YNQA 1R89A 1VR6A 5IV3A 1SC6A 2NUUG 4A5BA 3TP2A 3VQ4A 4CGDA 4ID5B 3GWCA 2NS1B 1Y0HA 4U95A 2E1ZA 1PAUB 4IUFA 2K7JA 1RU1A 5K14A 4ZPTR 3OS1A 3L2QA 3HVAA 3FKBA 4FJ9A 2O01C 1E4GT 3QAEA 4P2SA 2E6LA 3SBTA 1DLOB 1WC0A 1MN7A 1TKTA 5HMYA 2V4JA 4LIRA 3NMUA 4NYFA 1KKHA 4Y0WA 3QGGA 2OPQB 2MEWA 1EWQA 4LRCA 2FGOA 2HRTA 4KI4A 3WIUA 2HGMA 1ZBLA 2D3ZA 3PJWA 4RBTA 1T02A 1N5VA 1A9NB 1WF1A 3VEXA 1FRKA 3UKRA 5GAEU 3UE2A 5KOWA 1HD1A 1C1AA 5IWAF 1NG9A 1S6PA 3CMAN 2HIYA 2VICA 2YKMA 5J2PA 3CDUA 1RADB 1N33K 2N3LA 5HQMA 1DLOA 3HULA 2XS2A 3DU5A 5DLFA 3IS9B 1DTQB 4R0JA 1VBZA 5FPEA 4I2QB 5EOYA 4TU9A 3NHGA 2W8LA 4UF4A 5CZ1A 3NCIA 2CQHA 4DS5A 3J80O 3OL9A 3QDKA 3K5LA 3MPUB 3JS6A 2UXDJ 4L3QA 2DXEA 2OEKA 2ZOGA 3ADAC 4J5OA 3T19A 2W7OA 2ZZMA 2FVSA 3SMSA 4L3KA 4RNFA 3CIMA 3RMBA 3VQ7A 1UFLA 1GXUA 2FZKB 2HAIA 2OO4A 1U1OA 5GIOA 4DV6K 3MWPA 3GQCA 2IOCA 3ATUA 1N34J 2XEXA 1YGYA 1I94J 1IKWB 5F8MA 1NH8A 4R25A 3KLEA 1FA0A 1NSPA 2WVBA 3T1YF 5DQHA 2LVWA 2GO9A 2RHQB 3AO4A 1AYEA 4LVOP 1U2RA 1CQMA 1VQ9S 2A41A 2X3DA 1JWWA 4O3NA 5DGAA 5ETVA 3VGSA 3VQ5A 4PXDA 2V67A 1HKBA 3M2UA 1HKGA 1RTDA 1T11A 3ET6B 3NGYA 3BZQA 3HLUA 2DIVA 2DXFA 3A3OB 4M3RA 4DL5A 1IN0A 1FFSB 1X9WA 3I56S 4Z4CA 2P9IB 4FJHA 3KG1A 1Q8BA 4NA1A 2F7TA 3L2WA 1CPZA 1S1XB 3WNGA 2GUPA 3G4SS 3KKRA 3GFHA 2KRRA 1VQLN 5SUHA 4CFDA 5GAHI 3RBXA 2FJVA 2XO7A 2XCPA 4ZVRB 3PSIA 3R1HA 2B7CB 4E2FB 4LRDA 2YHWA 4TKTA 4QWBA 2HHTA 4GY2B 2KXNB 4BR4A 4CF1A 2ZZNA 3R1LA 1RNHA 3LP0B 3L7PA 4E98A 1VQMS 4YB5A 5ETOA 2C2NA 3WIVA 4ANCA 3D2EA 4ALZA 4YOXA 1M5VC 2HVZA 1PAEX 4DQSA 2XMUA 2EX3A 3H5YA 3J80Y 1K73O 3QETA 3AVMA 3ULEA 2HNYB 4DX5A 1UAXA 1X4BA 3J7A1 1NWKA 3JAMY 1WF2A 1LXNA 5CCLA 3BGOP 4CTAA 1VHXA 2E1RA 2QWPA 4DI6A 4ZCIA 1S5ZA 5DG9A 2AJ1A 4TY9A 3QJPA 2HBYB 2E5LK 2F63A 5J2MA 3MR7A 4QWAA 1N48A 3EDRB 3VV2B 4CQ1A 3MMAA 3N6MA 4ZCMA 5CE3A 1EETB 2XS7A 2BQUA 2CAJA 3OFGA 4EBCA 5BR9A 2EKNA 2EFVA 2VQFF 3JSRA 3RWUA 3M2RA 4BQLA 3KDNA 3KK2A 5HL7L 5ETSA 2NSBA 4MKYA 2J7UA 2JH3A 1UA0A 3SQ0A 4OFZA 2GX8A 3CC7N 4QWCA 3F9KA 5HVFA 4K4UA 4QAGA 2CZ4A 1DBDA 1Q18A 4HHHA 1N32K 2V4JB 2Q36A 2G8FA 1LAVA 1YG0A 2ASYA 2G0IA 1N34F 1HQEA 3I4PA 4I67A 3DM2B 1RCXB 3TVKA 2KHDA 3D45A 2GW8A 4DR2F 1B4SA 5M1OA 1HX1A 3CCTA 1D8YA 1VJWA 4ZP9A 1R43A 4ECWA 2HHVA 4P7TA 4DR2J 4KI6A 2ADBA 3QESA 3LM9A 3K2YA 4FWLA 3RR8A 1NXIA 1SKUB 4KHUA 2IRUA 3HRGA 1EXQA 1U1KA 1VK0A 4CFAA 3F56A 2BA9A 5IFMA 3VQDA 2DHGA 1GMWD 4U96A 4F4XA 2OLWA 1SUQB 5K8OA 4QOTA 3NMAA 1UWAA 2GUIA 4GV9A 3UVJA 2CNOB 1FWLA 1TV6B 1KLMB 4A8OA 1RTJA 3D2FB 3AGKA 3LH2S 5JVGL 5KPTA 4PHTX 1S9FA 1KSPA 4H54A 3NE6A 1HKAA 1WSIA 1JXVA 3W65A 2MKSA 2A18A 2WAQD 3J80U 2XLKA 4H4MB 3VGLA 3SK3A 2ILZA 2FJBB 2Z2YB 4EYIB 2ZHBA 3LPEA 1S97A 4M45A 2B4OA 4K2JA 3LQVA 3D67A 2VPWB 2IM3A 1HFEL 4ISEA 4WQ5A 4DTNA 2UVUA 2C1EB 4DR6K 4ECQA 4XAKA 2VBZA 2KKZA 3KD1E 2R9LA 1JL2A 3JSMB 3SCIE 1FKOB 4BE2A 4ZPCA 1U4BA 3UD4P 3O3GA 1E6YB 4DU8A 1L3VA 3VQTA 1VQKN 2NCKL 3R5DA 2ZBIA 2CIMA 3LDOA 2QX0A 1ZYQA 5D15A 4RW9A 1UL3A 2GQ2A 4MLHA 3QFHA 1RISA 1UWBA 4OZ2A 1GLCG 4KR0B 4C23A 2YKOA 4LF7K 2UUBJ 3A3PB 2IIRA 2CQCA 1X4CA 4CH1A 3FE1A 3MGJA 4ZPBA 3THWB 4TXSA 2J9DE 3QFWA 3FFIB 3L7UA 1WC5A 3NG8A 3P1GA 1H73A 3K8WA 3GR0A 3DRYA 1X7VA 4JV0A 1MWQA 4FL9A 3FFKB 4PG8A 4JI7K 2YX6A 1JLAA 2BOAA 4DV0K 3CJ3A 4ECUA 2ERRA 4X66F 1NJWA 4RW7A 2W1BA 2D9PA 2NZTA 2DTUA 3N6LA 2JEJA 2CRLA 2HIQA 4BR7A 1ZXOA 4I7FA 1CJTB 1LKZA 3N4QA 4I6AA 2AIRB 2M9KA 3AA9A 1TAUA 2FLLA 3KKSA 4OKKA 2K1RA 2P9NA 1EZZB 3IG1A 4B3RF 4FLXA 3QRQA 3NS5A 2R7OA 2IFXA 1ESVA 4KAZA 3MAAB 4ZLJA 5B7WA 3ZSVA 1RWXB 4DR2K 3G86A 3HYFA 3L4IA 5KFOA 5J1EB 3NH0A 4KREA 5B0GA 5EWEA 3AO5A 1Q82T 1IJJA 2ZF5O 1XN9A 3TWZA 1CJKB 3GFXA 2VGMA 1AUSL 1P6TA 2PZSA 2FC8A 3CCMN 1K1SA 2Z2LA 2XO6A 2BQRA 5C2DA 1M1KT 4IRKA 4NLWA 3DC2A 2RQCA 4PY5A 3SEOA 5HMXA 1JXBA 1MWMA 1VRQC 4JI8F 3NAHA 2E66A 3JQJA 2JNJA 2RILA 1VSDA 2F4FA 4TSXA 2BJ1A 2W2PP 2CH5A 1I51B 4OJRA 1VMBA 3BGRB 3TQ1A 5A2QU 1XMOF 5IQQA 1TU0B 4ES2A 3B54A 1OVYA 3QSIA 3WX8A 4YUDA 2QWLA 4OVLA 2Z1IA 3GFYA 1BU6O 3TTCA 2X6NA 3R5GA 5FDLA 5EWFA 2B4JA 3QNWB 4JI3K 1S72S 3GIIA 2DFEA 4EBEA 4J7CA 1FE0A 4DN9A 1B0VA 1SQKA 2X1BA 5D0EA 4BS2A 1RYRA 2OSRA 4LF4F 4IH7A 3H5XA 2GC8A 3Q83A 4ECTA 3M6WA 1NK4A 4DL0C 3A8KA 3CE8A 1Q5VA 3ILOA 2NXNA 2XHWA 4LREA 4PPDA 1H74A 1URNA 3GE1A 4DV5F 4BE1A 1NGCA 4QU6A 4MK8A 3GJTB 5CHCB 1GEHA 2BKNA 3MM6A 4DN0A 5A8KB 3T41A 4F3QA 3AARA 5HVHA 3BBFA 3EKUA 1NKEA 1Q9XA 1RT4B 2I0XA 3BZCA 3MR6A 1WOOA 4C4WA 2B9YA 1ULRA 3E8OA 2VBXA 4XH5A 4Y1CA 4DL3A 3OTEA 1ASUA 1IKYA 4M5DB 3MMAB 2HBMA 4JAXA 2Q31A 1C0TA 1U09A 3PW2A 4Y1DA 2UUCK 3AD9C 1JKHA 5B08A 3P5JA 5FROA 1HW8A 4MIWA 1X4FA 4CJEA 1Y9OA 3QZ7A 3SV4A 3V4IB 4B3OB 3CYMA 3BSOA 5SWMA 4BHQA 1QUVA 3PX6A 3SSRA 1HWUA 5D77A 2O8DA 4QS7A 2V52B 1TYQB 3T9ZA 3ZT0A 3QO9A 1Q0NA 2SXLA 1UOCA 3MURP 1JX4A 2NLWA 3ENBA 3UB5A 3LP2A 1K0TA 5BPMA 3HXMA 3M6GA 2IVNA 4FOEA 3QMQA 4NCAA 2HMIB 5HQLA 1HI8A 4FK0A 4LR8A 2CXEA 1NJZA 2YKAA 5I3UA 4E7IA 2XBPA 2GVDA 4X4RA 1NDPA 1T9VA 5AE2A 1N36F 5KFKA 7FD1A 2E2PA 2GJFA 1VQLS 3E2EA 2Y9HA 3DRRB 5C25B 3RR7A 5A6PA 4KV8B 3K7RA 5C12A 1S1TA 4CO2A 5KT4A 1U6FA 3NL0A 3BF4A 3LGNA 3I82A 4NLTA 4KTZA 2QL5B 4FSVA 3HDSA 4PWUA 5LL6Z 4M5GA 1ZPWX 4C7QA 2HZVA 3MMBB 1GK8A 3W8GA 4RW6A 1TL3A 4DSKA 1BCMA 5FPDA 1RAEB 1U6BA 3OS2A 2LYVA 2HBLA 2WB4A 3NEKA 3L09A 3C14B 1WNSA 3NGIA 5BXIA 2F3JA 3C6HA 2FHJD 2GHPA 1KQGB 2UXBK 3T1YJ 1EKEA 3D7EO 3OVSA 3PR5B 3CFOA 2JLFA 4A8XA 1WHVA 4H8KA 1IBCB 1BWEA 3SCLE 3U7JA 2XY5A 1I94F 1BUXA 2QA1A 4YDDB 2FVPA 2G2ZA 2ZVSA 5KFCA 4CZJA 2ZKUA 4MFBA 3A5LC 3MPVA 1TKZA 2D4WA 1K8KA 4CO0A 4DV5K 2FF6A 2EFNA 2FSNA 4IZ9A 5D3GA 2HZCA 2AX1A 2NQPA 1BDGA 4P9SA 4ANEA 4NRTA 2E88A 5DDQC 4JKFA 2J6TA 4OI0A 1N54B 4FPRA 1VQ9N 2DGXA 1UVIA 2LU1A 5CZ2A 4H4OA 2MJUA 5E3QA 1BGXT 3RMAA 4QIGA 2O8CA 4ED2A 4BWMA 3AAWB 1JLAB 2BDPA 1L5UA 4K25A 4GRSA 4BRCA 4CO3A 5IZHA 1U8SA 2R8JA 3KLHB 5KT6A 2DGTA 1H2UX 3MECA 1GLEG 2DEJA 1FD2A 5SZTA 4M7XA 2CQ4A 4DL4A 2MGZB 5MAOA 4P10A 5HLFB 3T5JA 1LXJA 4YOVA 5DS7A 2K1RB 2P9NB 1S6QA 4AQYF 1WUAA 1OKJA 3K5PA 4DHVA 5F8HA 1RBUA 1NCLA 4OJGA 5KGXA 1VQNN 1URRA 4DV3J 4HI1A 1QVFR 3MM5B 3KK7A 3NGKA 5EX3A 2G8HA 1GMWA 5DM6L 3VETA 2DNRA 4U7BA 1WC4A 4NOHA 2EHGA 3MX2A 1VQ7N 2NR0A 1P1LA 1UMJA 4NMLA 1MMDA 2KT5A 4RR5A 1FXRA 2BW2A 2XM3A 2RRNA 3AVLA 4ES3A 4H0TB 3D28A 5T7BA 1AFIA 4H03B 3BF1A 2ZH9A 3HSDA 5FRMA 3E1YA 1HD0A 2P9KB 1A6LA 3S6EA 4DPTA 2QJ3A 1Z6RA 2G0CA 2XCAA 3G25A 3SJJA 1UVKA 4K7QA 5B0FA 1FJGK 1PJ5A 3DCAA 3GSIA 1MROB 1B9DA 5C5JA 2BE2A 2IMOA 4M3UA 3GCWP 1EQMA 5CY4A 2OPRB 4FJ5A 1U2VB 5J2NA 2CG4A 4Z4IA 3VQEA 4XPCA 4FWKA 1TZ0A 2GQCA 4MDAA 4W5QA 1YJNS 4JD2A 1Q86T 3N6NA 3VQCA 2CPFA 1NOZA 3UCGA 2IHR1 1P9YA 3UWTA 1D9DA 2QLFB 4H5VA 2HGLA 4B8CA 1W0HA 3EMTA 1A0OB 2XMAA 3FVYA 1YJWS 2FY1A 1JCGA 3GIRA 1BISA 1QVGR 5KT2A 3QBWA 3K9JA 2ZFHA 4P75A 4Y0FA 4TY8B 2P5OA 4ZVQB 3I5AA 3PX0A 4LF8F 3C65A 2F8SA 2FBTA 4JP8A 2R4FA 4JI2F 4X64J 5I3QA 2ALZA 1B0TA 1S1XA 1HRHA 1R3NA 3HSCA 5JMVA 3FRYA 1BQMA 5HRRA 3THVA 3BPDA 4K4VA 4OYXA 2VWJA 2A1SA 3QGHA 3CCUS 4H5TA 2GJ2A 2ZOMA 1UCNA 3V4MA 3CF5L 3PYFA 3W5YA 4C9DA 1M5KC 1TK8A 1SBRA 2FYXA 4DV6J 1S9GA 2GAHC 2XYHB 2KH9A 4YY3F 2ZNZA 2EC2A 1Z26A 3O9RA 4OX8A 4CJVA 2VU5A