4KO0A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with an anilinylpyrimidine derivative (jlj-135)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
556
structure length
555
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 159
structure length 555
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ko0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ko0A05
4QWCA 4NLOA 4KV8A 1RT3A 1J5OB 3DOKA 4IFVA 5DLGA 1IKYB 3DLBA 4K4WA 4G3IA 3LAKA 1C0TB 3OS1A 4CESA 2YNGB 4K50A 1XR7A 4TQRA 2R8KA 4J9OA 1QSSA 3NAIA 4ELTA 2UUTA 1CZBA 2E6MA 1TQLA 4IG0A 1LWCA 3H40A 3LWLA 5I42A 3N6NA 5J2MB 2XO7A 2YNFB 3V6JA 2QXFA 3NCIA 1L3SA 4J9SA 4B9TA 4RNNA 2O5DA 4IRDA 3VQ5A 2BGGA 1RTJA 4ZTJA 3C6TB 1KLNA 1TV6B 3OHAA 5CYMA 4LSNA 2YHAA 1J9AA 1WN7A 3RR8A 1Q9YA 4CJVA 1IKXB 3HHKA 3QLHA 2AGQA 4ZPDA 4I7FA 4NYNA 5KT2A 2HVIA 3VA3A 1HARA 5DG8A 5KFIA 4B8CA 1RBVA 4FJMA 1WSGA 1QS4A 3MEGB 2IM0A 5EU7A 2B43A 3OYCA 1KFDA 5KG3A 4OGEA 4BDZA 4CHQA 3MR3A 4AHSA 1N5YA 2BANB 3IS9B 4ZPAA 1QTMA 1ZBHA 4W5OA 1HPZA 4C8MA 1KHWA 1S1UB 3PW5A 3CJ4A 3V9XA 5C42B 5KFKA 4M41A 2HVHA 3LP2A 4YNQA 3S3MA 3U3GA 3QIPA 4XPCA 4NLTA 2KW4A 4XIUA 3IG1A 4ECZA 5K14A 1LWFA 4K8ZA 2J6TA 1IO2A 2YNIA 3PW4A 4E19A 5KG6A 3QETA 1BQMB 1XHXA 4HYKA 4ZTFA 2XY5A 4IRKA 3DMJA 2IA6A 3C6UA 3DRRA 4H4OB 1QE1B 3OYNA 2KTQA 2BR0A 3KJVB 1JKHB 3G10A 1RT7A 4OLAA 2YNHB 3DI6A 4RW4A 2D3UA 3HPOA 4DQIA 4WZMA 2G8UA 3T5KA 3DYAB 1BISA 3CIZA 2IAJB 3H5SA 1ZBFA 4CJ3A 5KFXA 2P1JA 3NDKA 3K5MA 2PYJA 4OKEA 5HROB 3NHGA 4NLXA 3NBPA 3M8QB 1IM4A 4CFBA 3CG7A 1A5XA 4J9MA 1CZ9A 3PW2A 1UAXA 5KT7A 1EETA 4EBDA 4KHYA 3MEEB 1ZTTA 3TAGA 5KFJA 2HMIB 4CJLA 4CIFA 1UOCA 1LAWA 4DTOA 2Y1JA 4NCGA 1JL2A 4DS5A 4CJTA 1C2PA 3VQQA 4RW9B 5DQGA 1SL2A 5I3UA 4KHQA 1JLEB 3LP1B 3OSPA 3EPIA 4KI6A 4O4GB 3IRXA 3KK3A 3NH1A 4I2PA 3V4IA 3SQ1A 1T05B 3QIDA 3DLEB 4DFPA 4IG3B 2CJQA 5KI6A 1ZBUA 3H5UA 4Q0BA 5EUHA 4IR9A 1S9EB 1LV5A 2BQUA 2G8HA 4URSA 2ASDA 4W5RA 5KFTA 3KLGB 3SUNA 2B6AB 4TY9A 4KI4A 2HHSA 1RT4A 2EC0A 2AX1A 1S0MA 2ASJA 1D1UA 3AV9A 1U4BA 3TR8A 4YQWA 4K4XA 4GC6A 4DS4A 2PZSA 3MECB 1IKVB 4WFZA 5KFYA 2XGQA 4F8RA 4FLVA 1D5AA 1S49A 3TARA 2HHUA 3PW0A 4B9NA 3AO4A 2OH2A 1HQEA 3RRGA 5KFBA 5HRPA 1UWBB 3MEDB 4ED7A 1RTHB 3RMDA 4M3UA 2R8JA 3OVNA 3PR5B 1J5OA 4O3RA 2IOCA 5F9LA 1IKYA 1NOYA 2WHOA 3GQCA 1C0TA 5KG0A 1KFSA 3OL8A 5KRSA 4MQ3A 5J1EB 4TN2A 5JS1A 3NH2A 3BQ0A 1S0OA 4YR2A 3TABA 4MH8A 3PY8A 4EP5A 4IRCA 3NMAA 1RTIB 3O3FA 3ZSRA 1TGOA 3AVNA 4OVLA 1JLQB 4EEYA 5J2MA 1S10A 2YNFA 4ZMMA 4CJ4A 4DFKA 1T8EA 1RBTA 3CYMA 4JRPA 3G6XA 3L2VA 3ASMA 1X9WA 3C6TA 2FJVA 3OYMA 4EBEA 4ED1A 2CKWA 3PVXA 2XGPA 4FJ7A 1VRTA 1RAJA 4GW6A 4Y34A 3QGIA 2AQ4A 4E1NA 2C22A 4FS1A 3G6VA 1HNIB 3PW7A 2BRLA 2W42A 2WONB 4DU1A 3QERA 1WSHA 3PJWA 4YR3A 1VSMA 3MEGA 1MMLA 1RA7A 1U09A 3KD5E 4CHYA 4DLGA 1FXXA 2BANA 4ICLB 2X74A 3IS9A 2ZD1B 4CGHA 2R2RA 3QO9B 1TL3B 1U45A 3RMCA 4CGDA 2R7YA 1T03B 2FJWA 1ZBIA 1S1UA 3Q8RB 4NLUA 4BE2A 1YTUA 4TY8B 3ZSXA 3OL9A 4AH9A 1LW0A 3C95A 1RNHA 1BHLA 4Z4IA 2I5JB 1BI4B 2R8GA 4X2BA 3AVJA 1I6JA 4FM0A 4TXSA 4HUGA 2UUWA 3G86A 3AO1A 3SI8A 1TKTB 3V1QA 2D41A 5KG7A 3M9OB 1RYSA 4IH7A 1Y97A 3RMBA 3ITHB 3L2UA 4FJHA 3V1RA 3PHEA 2VG6B 4FK2A 4DL3A 3AO5A 3ZT4A 4CK1A 2JEFA 4E7KA 4DG1B 5EDWA 4H4OA 1NOZA 1QE1A 4F50A 3KJVA 1JKHA 2HB5A 4ELVA 1RT1B 5C25B 5KFLA 2YNHA 3LAMA 4CJFA 2IM3A 3DYAA 1N6QB 3E51A 1QHTA 2IAJA 5KFSA 3OYAA 4DFJA 3PX0A 3KLVA 2V0NA 4DEZA 5E41A 2AGOA 3M8QA 3KHRA 4WYWA 3S3OA 4ECWA 3GIJA 4K4VA 3AVFA 2VA3A 4K4TA 2F8EX 5F8HA 3JSMB 4JUZA 1NK7A 2HHVA 4JS5A 4CGFA 2D0BA 3NF9A 1RBUA 1JLCB 3BSCA 1U47A 4FLWA 3SJJA 4R5PB 3I5CA 4RW9A 2HHQA 1S6PB 3TAPA 4FJ8A 3LP1A 4O0IA 1LAVA 1GOBA 1JLFB 3L3UA 5HRRA 3OYGA 4O4GA 3HVRA 5L1IA 4F3TA 1S4FA 3DLEA 4IG3A 2FVCA 3QYYA 1QUVA 1EKEA 3PX4A 1S9EA 3KOAA 3KLGA 3ZT1A 4AHTA 2E9ZA 2HAIA 1BIUA 4BWJA 5KFDA 5SZTA 3RBDA 1C1BB 3DOLB 1B9FA 3T5JA 3FSIA 2OA8A 3V9UA 4TYAA 3LPTA 2P5GA 2E6LA 3IN5A 3GV8B 3CQ8A 1BCOA 4FLUA 1DTTB 1IKVA 4F4KA 4FJ5A 1IH7A 1RT2B 3PJXA 2KFNA 2D7SA 2JEIA 2AJQA 3SFGA 2FBXA 3ZCMA 2BE2A 3I5AA 1VSFA 4PA1A 1TKXB 3ZSQA 4Z4EA 1B9DA 1D0EA 4CECA 4DTUA 2OPRB 4AHVA 1UWBA 3BREA 3MEDA 1RTHA 1JXEA 1NK6A 4EYIB 4BACA 1RT5B 4MK8A 4IH5A 3SUOA 3OYDA 4RNMA 4CJEA 3DRSB 4FW1A 3CVKA 4CJUA 4O44B 5KFCA 3OJSA 2D0AA 3KK2B 4CJPA 3KTQA 3S9HA 5J1EA 2VWKA 1NHVA 1S1VB 1EX4A 4J9RA 2FVPA 3K59A 1XWLA 2O4IA 4WXOA 3EPGA 1RTIA 1X1PA 1JLQA 4DTNA 4ZHRB 3PO4A 1TK8A 3AA3A 5JS2A 3VQSA 3O4QA 1QAJA 4EO8A 3KLEB 1L3UA 1HYVA 3AVMA 1RDCA 4B3OB 4DF4A 1QSYA 4W5TA 1NKCA 4M3YA 2IDOA 2Z1JA 3GV7B 3I5BA 1TL1B 3WNFA 1HNIA 4RNHA 5HLFB 3KLIB 2WONA 1JLBA 4CHNA 1WSEA 2YKMB 3Q8SB 3UQSA 5KT6A 1UA1A 1XC9A 3RTVA 1J54A 2RKIA 1REVB 4ICLA 2O4GA 3HXMA 2ZD1A 4QCLA 4FJJA 3QO9A 1TL3A 5KFAA 1T03A 4NLYA 1SH0A 5DG9A 4DL5A 5KFEA 4TY8A 3HPHA 2PYLA 4NYFA 3M9NB 5DG7A 3MR2A 4KAIA 2I5JA 1BI4A 3TAQA 4ZP8A 2AWZA 4XPEA 4BDYA 5DMRA 3T5LA 1HMVB 2P51A 1K6YA 2XHBA 3GYNA 2BRKA 1TKTA 4FJNA 4OKJA 5KGXA 3ITHA 4E89A 1JL1A 4M3TA 3PV8A 1QSLA 1WNSA 2VG6A 4PY5A 2R2UA 1JXBA 3LP0B 2WOMB 2IS3A 1XR6A 2ILYA 3VN5A 5CYQB 4DG1A 1HYZA 4ID1A 3ZSZA 1GX5A 4K4SA 4E7JA 2ATLA 3SPZA 3JYTB 3KLHB 1RT1A 5C25A 2RF2B 4IFYB 4KB7A 3HKWA 4FBTA 2RDIA 1N6QA 1ASUA 3V81A 4H4MB 4M95A 4HKQA 3KK1B 4CEFA 3BJYA 3SUPA 4ECRA 3JSMA 4J9KA 3MXJA 4RW7B 4PWDB 5KFNA 4DF8A 1CLQA 4XO0A 3AO2A 2AU0A 1JIHA 3BR9A 1JLCA 2FVQA 1ZETA 1D8YA 2ZKUA 3HP6A 1ASVA 1WSFA 4M3ZA 4NLGA 4R5PA 4DQRA 1SV5A 4FLTA 3ALYA 4AHRA 4WZQA 3LWMA 4HCBA 3MR6A 1K1SA 4ED3A 2F96A 1LWEB 1BIZA 4NZ0A 3AO3A 3LZJA 2XRIA 4MKAA 2HWIA 5JUMA 5F8LA 1UA0A 5L1JA 4Z4CA 5F8MA 1TP7A 2W9BB 3TAMB 4YR0A 4OPKA 3QEIA 1CXQA 4DTMA 4LD0A 1NJXA 1FK9A 3L2RA 2PY5A 3AVLA 1C1BA 3DLHA 1D9DA 3DOLA 3RR7A 2P5OA 3H2LA 1VSJA 4O3QA 3L2WA 2DFHA 2IC3B 3OLAA 2C2DA 4LQ3A 1DTTA 4DTPA 1S97A 1RT2A 5JXSA 3VQEA 4F2RA 3LANA 4DSLA 3UDLA 4WXWA 3CFPA 4ZVHA 4CJQA 1TKXA 5HRNA 1S0NA 4RNFA 4E1MA 1FKPB 1HNVB 2OPRA 2WTFA 3KIOA 1U48A 5KT3A 4TSXA 2E4LA 1RT5A 4G1QB 4F4XA 4KO0B 1BQNB 1TAQA 3DM2B 4NLDA 5FDLB 3DRSA 4O44A 4B08A 3DLGB 3KK2A 1C0MA 2FBVA 2IGIA 4F4WA 3QNOA 2WCXA 2AX0A 4ED0A 4NCBA 3QGHA 3FDSA 2NUBA 3HPGA 3PZPA 3AA5X 4Z0UA 4F3OA 4PUOA 4R8UB 3M8PB 4ZHRA 3V9ZA 3IGNA 4PQUB 4NCAA 1GX6A 3KLEA 3MAQA 1N56A 3GILA 2W7OA 4KHRA 4YP3A 4CF8A 2UVVA 1KLMB 2C28A 3RB3A 1RA6A 4B3OA 4QWEA 5KFUA 4DL6A 2XY8A 3V6DB 2YNGA 4CHOA 2OPPB 3D5MA 4AHUA 4KTQA 2E9TA 1TL1A 4J9NA 1TVRB 4BWMA 3VQCA 3ICLA 3RBEA 3KLIA 4HHTA 3N6LA 2YKMA 2C2RA 1S9GB 4RU9A 3NL0A 4EZ9A 3OY9A 1Z25A 1REVA 1SUQB 5KRTA 1RDDA 1RYRA 5KG2A 4CJKA 1MU2B 4RZRA 4DTRA 3VQ8A 1TV6A 4ID5B 3I0SB 4NLWA 1R0AB 2OZSA 3CM5A 3CWJA 4B9SA 4FZZA 2I1RA 1IKXA 5KGWA 4BE0A 4OGCA 3AVGA 2OZMA 1CXUA 1HMVA 3AA4A 3RRHA 3KHHA 1RDAA 1GOCA 3MTKA 4KFBB 4K4ZA 1KSPA 3LP0A 2WOMA 5CYQA 4LH4A 2OPQB 3KLHA 4U6PA 4CGIA 3QEPA 2RF2A 4IFYA 2WK4A 1Q9XA 2HHXA 3V6HA 5FRMA 3I0RB 2FJXA 4Q8FA 2ZQBA 5C42A 2UVUA 3H5XA 2G8WA 2GBZA 4CF9A 5HBMB 4IBNA 4H4MA 5KT4A 4M3RA 3C94A 3KK1A 3OYKA 3MF5A 2R8HA 5DLFA 4CCHA 2KZMA 2HNZB 4ZP7A 4RW7A 4PWDA 3H5YA 5KFQA 4JV0A 1BQMA 4Q45A 3RB0A 3OSNA 4CEEA 4M42A 1FKOB 5DK5A 3QZ7A 3AVIA 2VWJA 2C2EA 3CM6A 3BDPA 3UPFA 4KRFA 5DQHA 3VA0A 1JX4A 1LWEA 4KBIA 3ISNC 5HROA 2HNDB 3NF6A 3T1AA 3H98A 5EWGA 2VA2A 3LP3A 3QINA 2D5RA 1WSIA 1VSLA 4HTUA 3K5LA 5EWEA 3CFOA 4O55A 5SWMA 4MK7A 2W9BA 3MEEA 3TAMA 4QWBA 4C8LA 4DSEA 3F9KA 2HMIA 3FFIB 2G8VA 3AVAA 3O3HA 1HYSB 3SV4A 4M3WA 4RW8B 2VG7B 3L3VA 1S6QB 3FRZA 4NLSA 2ALZA 2XY7A 1JLEA 2IC3A 4Y2CA 1RTDB 2QV6A 4FLZA 3P83D 3QNNA 4CFDA 4B9LA 3VQ7A 4ECXA 3DLRA 4KB1A 5D3GB 4Y1CA 1ZBLA 1T05A 3ZSYA 3PR4A 2GIRA 3A2FA 3OS0A 1FKPA 1HNVA 3O4NA 1TK5A 4NLVA 4N5SA 3HVTB 5L1KA 4DTJA 2W9CB 1S9FA 3RMAA 2B6AA 4G1QA 3EZUA 4KO0A 1IKWB 1BQNA 3NFAA 3DM2A 5FDLA 4TLRA 3QGGA 4Q5VA 2JEJA 3DLGA 4J9QA 1Z4UA 3N6MA 4E3SA 2XC9A 4KKOB 2RPIA 2X78A 2G8IA 3MECA 1EETB 1VSHA 3ZSWA 3B6OA 2DTUA 1DLOB 5L1LA 1D9FA 4O3OA 1NK4A 4CEZA 2V9WA 4KSEB 2Z1HA 1VSEA 4R8UA 3M8PA 4EP4A 2GV9A 2A1RA 4PQUA 3LALA 3MFHA 4WE1B 2W9AA 1C6VA 3QEWA 3TVKA 3KK3B 2B5JB 5HP1B 4MFBB 4OLBA 1KLMA 1ASWA 1B92A 4U7CA 3NGDA 3V6DA 4QWAA 3NAHA 3VQ4A 4ELUA 4J2AA 3UR0A 2XI2A 3NF7A 2OPPA 1YT3A 2HNYB 4FW2A 3PO5A 4KHNA 4IR1A 3LDSA 3Q8QB 3K57A 5FRNA 4BE1A 3OYIA 2IM1A 3RAQA 2RN2A 3TAFA 1S9GA 1RDRA 5KTQA 4QWDA 1WNEA 4CF2A 1OS5A 4CERA 4I9QA 1SUQA 2D0CA 3CDEA 4ZVEA 2YKNB 2XCPA 1MU2A 2KZZA 3FQLA 2J6SA 4Z4HA 1IG9A 3AVCA 4AILC 4ID5A 3I0SA 1L3TA 2YHBA 4O0JA 1LW2B 3CO9A 4DSJA 2Z1GA 3OYEA 2QKKA 4H54A 4GMJB 4KFBA 1NHUA 1KVCA 1NJYA 1JLGB 3H4BA 2X6NA 4CIGA 3CDWA 4Y1DA 2VG5B 4O3SA 2Q3SA 1NK8A 4KHSA 4W5NA 2GIQA 2R8IA 3E01B 1EP4B 3NKYA 3Q8PB 1T7PA 4ECSA 4NLPA 3GV5B 2OPQA 2IMWP 4FJLA 2IBKA 1S1XB 4KAZA 3I0RA 1C1CB 2R2TA 2KQ2A 4OL8A 3VQBA 1W25A 4C8KA 3GIMA 4N41A 3F73A 5HBMA 2QKBA 1X9MA 3KKRA 3H4DA 1RBSA 3WNHA 4HUEA 3K5OA 5C24B 2RDJA 1ITGA 2HNZA 1NJZA 1W9HA 1VRTB 5DGBA 3PUFA 4B8AB 3SYZA 3D45A 4JS4A 2G8KA 4ECVA 5KFOA 1FKOA 4E0DA 5EWFA 1WLJA 5F8GA 3GIKA 4B9MA 2J6UA 1O1WA 3OLBA 1WAJA 3L2QA 4IH6A 2DPJA 1XR5A 4IKAA 4EYHB 4FBUA 2HNDA 4KPYA 5F8IA 4DWIA 3VQ6A 2BQRA 3DLKB 3HM9A 4FM2A 3HJFA 3HL8A 2X6SA 1LW0B 4Q8EA 4AHCA 4CGJA 3SNNA 2XY6A 4E7IA 3FFIA 4FK0A 3BSOA 5KFHA 4RNOA 1BL3A 1HYSA 4EBCA 1WAFA 4RW8A 3SFUA 2VG7A 3OHBA 1S6PA 1S6QA 2V4RA 4Y3CA 2HHWA 2Y1IA 3I8DA 1VSDA 1RTDA 4HCCA 3IGVA 1JLFA 2QK9A 4I2QB 4ZVFA 4FS2A 5J2NB 1VK0A 1DTQB 1VSKA 3DDKA 4CFCA 5D3GA 3NGIA 2ETJA 3SPYA 3UIQA 3V9SA 3DRPB 1YVFA 4JRQA 4NLQA 2DY4A 3HVTA 1RCHA 1NK5A 2OPSB 2W9CA 4DU4A 2WRMA 4CEQA 4HUFA 1IKWA 4RUCA 4C8NA 2F8SA 4Q43A 4QW8A 1RT6B 4CEDA 2IM2A 4ED2A 2UVRA 4CHPA 3ZT3A 1HQUB 3HT3A 1G15A 2D3ZA 1SKSA 2ITGA 1W0HA 3M8RA 1NKEA 4KKOA 3SI6A 1VRUB 1ZTWA 5DQIA 3KLFB 4FVMA 1N48A 3P1GA 4DMNA 1RDBA 1X9SA 1DLOA 4CK2A 5CZ1A 3NF8A 3KNAA 4LQ9A 3B6PA 3CDUA 3BQ1A 4FK4A 1BCMA 3QZ8A 4GC7A 4WE1A 1SH2A 4F4ZA 1TK0A 4M45A 2B5JA 1NK0A 5HP1A 4CHZA 3EZ5A 4MFBA 4R0EA 5KFGA 4J2DA 3OYBA 4DL4A 4FYDA 2JC0A 4M3XA 3KD1E 3WNEA 1JLAB 1I3AA 2HNYA 4IQXA 5F8NA 4WFYA 1HJRA 1S1VA 3OL7A 3WNGA 3SQ2A 5KT5A 4J9LA 2ZE2B 4L8RB 4KREA 2BDPA 3G6YA 3EYZA 5J2PB 1QQCA 4URGA 4NYZA 1C0UB 1L3VA 5KFWA 5DGAA 2DPIA 1S1WB 4Y2AA 4CJRA 3RWUA 2OYQA 3HVAA 4YFUA 4FLYA 4C8OA 3EY1A 5J2QB 5KFZA 4LH5A 4I9LA 1S1TB 3V1OA 2YKNA 2LSNA 1A5VA 4CEOA 3SV3A 2HWHA 3NE6A 4WYLA 3GIIA 3AVKA 2BE2B 1U04A 4K8XA 4F2SA 2JLEA 3OYJA 4MK9A 1LW2A 5KFFA 3BGRB 1F21A 3AA2A 1TKDA 2KFZA 4IDKB 5HLFA 1Q8IA 1KHVA 4WFXA 3T5HA 2FLLA 3NGZA 4QAGA 5F8JA 3NGYA 1JLGA 3HSTB 4RG8A 3VQPA 4ED6A 2W8LA 3CJ0A 2VG5A 4LSLB 2YV0X 3P5JA 2WB4A 3E01A 3SZ2A 1EP4A 1HRHA 4F4YA 1CSJA 3T19A 1S1XA 3BQ2A 3OYFA 3KHLA 4RW6B 1C1CA 3QESA 1SH3A 4BDPA 4EO6A 3HYFA 1TKZB 1L5UA 2EX3A 4ZPBA 2FBTA 4KV8B 1RT3B 2IJNA 1KRPA 3DOKB 2V4QA 3S3NA 4IFVB 3ZT0A 5C24A 2F8TA 2E9RX 3CJ5A 3FQKA 1RILA 3M9MB 4ZVGA 4FXDA 3THVA 3BSAA 3K2PA 4N47A 4DL2A 3TQ1A 3M8SA 3TAEA 1U49A 4FJGA 1YVUA 3KKSA 4NRTA 1BGXT 2GUIA 4E7HA 4IG0B 3ZSVA 4QPXA 4JV1A 3TWHA 3U3YA 2AGPA 4DTSA 1XHZA 1LWCB 3CJ3A 1JLBB 4K4UA 3KMQA 3JYTA 4ED8A 3TI0A 3QEVA 5I42B 3V6KA 5CY4A 3CFRA 1RBRA 4ZP6A 4FZYA 4NRUA 4N76A 3HP9A 2RKIB 4CJSA 3HVWA 2ATQA 4CF0A 3SUQA 3AVBA 1RTJB 3DLKA 5CYMB 4LSNB 3HO1A 4TYBA 3HK2A 3MXIA 1KVBA 1Z26A 4ECUA 4KTZA 1SL1A 3OS2A 4KHMA 3H59A 1J53A 5T7BA 3QLHB 3MXMA 3ZT2A 3TANA 5KFPA 4I7FB 3MR5A 4Q44A 3LZIA 4FJ9A 4CGGA 5C5JA 3OYLA 3RAXA 4KB0A 4K4YA 3SCXA 4CK3A 4FJIA 4QOZB 4OKKA 4NLRA 1JXLA 1A5WA 4I2QA 2B4JA 5J2NA 3K58A 1DTQA 2ILZA 2GC8A 3QEXA 1N5YB 5KFRA 4KE5A 2UVWA 3BSNA 3OYHA 1ZYQA 4H8KA 2HW3A 2IJFA 1I39A 5T14A 1HPZB 4DL7A 4HVJA 4W5QA 3DRPA 1XI1A 3KHGA 4UQGA 1EXQA 4DQPA 3CJ2A 4J2EA 2OPSA 4MIAA 4MIBA 2DFEA 4FZXC 1QAIA 4CF1A 3LP2B 3V81B 1TAUA 3QIPB 4ECQA 3D0PA 3U6FA 1RT6A 2EHGA 3IG1B 1SL0A 4RUAA 1T3NA 4CEBA 4JV2A 5K14B 2FVSA 1HQUA 1LWFB 4DSKA 2G8FA 3D28A 5FROA 1KVAA 4FM1A 1VRUA 3ZSOA 2YNIB 3KLFA 3VQDA 2HHTA 4O3NA 3VQ9A 3DMJB 4N56A 1NNDA 3C6UB 4J9PA 1S5JA 5KG5A 3DRRB 4CJWA 4CFAA 1SV5B 4J2BA 1RT7B 5CZ2A 4O5BA 3SQ4A 1NJWA 3DI6B 4RW4B 2R2SA 2XCAA 1SKWA 2Z1IA 3L8BA 1C1AA 2FLNA 2QE5A 4KTWA 4YMEA 3NBPB 4FLXA 4JLHA 4E7LA 3NAEA 4IOBA 2JEGA 1JLAA 4DFMA 3OJUA 3RB6A 2W8KA 4OJRA 2A1SA 1VSIA 1K1QA 1S48A 2ZE2A 4DTXA 4OPJA 1KTQA 3AVHA 4DQQA 5F9NA 1FK9B 4NCGB 3SQ0A 5J2PA 3RB4A 1C0UA 4IKFA 1T94A 2FBYA 2FLPA 2XI3A 5I3UB 4TQSA 1S1WA 3NH0A 3K5NA 5J2QA 4ZPCA 1S1TA 3IRXB 2W7PA 4I2PB 3V4IB 4ECYA 3ULDA 3OL6A 4CEAA 4Q0BB 4Z4GA 3T3FA 1N4LA 5KFVA 3BGRA 4DSIA 4DSFA 3V9WA 5KFMA 1TVRA 4IDKA 5KG1A 1KCFA 4B9VA 1RT4B 4KHUA 4DLEA 4FJXA 4URQU 4KHWA 4O3PA 5L9XA 2DFFA 4GVMA 1NKBA 4MKBA 4DQSA 2FVRA 4ZP9A 5HRSA 2XWYA 4DU3A 3PX6A 3VQAA 3ISND 3MFIA 4ECTA 3G0ZA 4O4RA 1SKRA 1WSJA 2BQ3A 4Z4FA 4LSLA 3H08A 4CE9A 4B9UA 1GOAA 3IAYA 1YTAA 2ASLA 3O3GA 1NK9A 3KMSA 3LPUA 4PUOB 1R0AA 5KG4A 4RW6A 1HQEB 2JC1A 2JGUA 4CJ5A 4FJKA 4EZ6A 3QIOA 4FCYA 2FC0A 4CIEA 4LY7A 4QW9A 1TKZA 4M94A
chains in the Genus database with same CATH superfamily
1RU2A 2N3LA 4DXLA 4K4WA 2O66A 3OS1A 2CPJA 1FDDA 1GTHA 4K50A 4M7YA 3N5FA 3NAIA 5LOQA 1J5EF 3J80O 1LWCA 3OR2A 5I42A 3V6JA 2QXFA 2DHAA 2GVDB 2O5DA 1X0FA 3C6TB 1S3XA 3D3CJ 2YHAA 1NDKA 3MPWA 4NXNK 3HHKA 3DGPA 5F0UA 2F9JA 4B3SF 2QA2A 3O1BA 5DG8A 4X4TA 4B8CA 1JJ2M 3PACA 4OGEA 3OQ2A 2HHHK 1FF2A 2BANB 1QTMA 2Q79A 5K8OA 3L95X 4W5OA 1U0HA 1RE1B 4RO0A 4OHYA 3PW5A 1Q7LB 3PNIA 2E5LJ 3ZZOA 1V3RA 1JXVA 4YNQA 3S3MA 2KW4A 4DR7F 3ENHA 1WUAA 3N4PA 2UUCK 4CZJA 2QWLA 4K8ZA 3R5CA 1HNZK 3CCSS 1PAUB 2E7WA 2YNIA 1VQMS 5KG6A 1FXDA 2VOOA 1BQMB 3DMJA 1GLDG 4YDDB 3DRRA 4E98A 2Q31A 3G10A 2JVRA 4OLAA 4RW4A 1ZXOA 2LYVA 3VERA 4WZMA 1Q81O 5K8PA 4CJ3A 3PFOA 3NDKA 2P6SA 4P2XA 3NHGA 2O1PA 5A8WA 1RWXB 3M8QB 2K06A 3KWGA 2MMYA 1VC5A 1IM4A 4CFBA 4OX9K 1A5XA 5K8MA 3LW5C 3HULA 3K5PA 4A61A 4J9MA 4DUZF 1BDGA 2DNPA 3PW2A 2AJ0A 4M7XA 1EETA 4EBDA 3MEEB 4L73A 3GPAA 5KFJA 1F9EB 2HQFA 4CIFA 1UOCA 4DTOA 2Y1JA 1U25A 3ZZUA 3GBTA 4WKYA 4CJTA 1F60B 3FCWA 1OPIA 1VQON 4KHQA 3LP1B 4GMKA 4H5NA 2GEMA 4CI6A 3ZZRA 1HHSA 3MOJB 4ENOA 4DV6F 1AZSB 2KRBA 2YKQA 1T05B 4DFPA 2F7VA 1NH8A 3A5OC 5KI6A 4F4AA 1B0VA 3IXQA 1S9EB 3LGHA 2G8HA 2ASDA 2YX1A 4KC5A 3C3LA 2AX1A 1S0MA 3C14B 1D1UA 2Z57B 4YQWA 2CWKA 4AL7A 4U8VA 3UCUP 2PZSA 1X3NA 5AE1A 3ONQA 2KXNB 1D5AA 2NRHA 4FPBA 5A76A 4LRCA 2OUGA 2WSCC 5HL7L 3RRGA 2R7RA 4IOCL 1UVLA 3GWCA 3RMDA 2E1MC 2JWKA 3FZ2A 2LKZA 1YDLA 3CCZA 4AL6A 3Q7CA 1IKYA 3R1LA 4FO0A 2WHOA 4DV3K 4WFNQ 5KRSA 4MQ3A 4TN2A 1YKWA 3BQ0A 3PY8A 2FUG9 4OX6A 4JAXA 1LWXA 3O3FA 3ZSRA 2ZWPA 4OVLA 4C0OC 4EEYA 2V2QA 5J2MA 5LSOA 2HHHJ 4DFKA 4IDHA 3IUCA 4WP3A 1X9WA 4KH6A 2V6AA 3JSBA 3TNVA 2DNKA 4JBCA 4LF7K 2FJVA 3EX7B 4ED1A 1QUPA 5GAHU 4FJ7A 3PLAA 3G9CA 2RILA 2ZBPA 1VRTA 3TTDA 3QGIA 4E1NA 2UUCJ 4FS1A 4JI6F 1ATRA 1QHAA 1HNZJ 2BRLA 2CQDA 4DX6A 1NM2A 2J7KA 2JH3A 1I51B 4YR3A 3CJCA 3UNYA 1Q7YT 5A8KB 1VSMA 1NWKA 2CQIA 3MEGA 4A8YA 1RAAB 4DLGA 4JI4K 1IBKF 1FXXA 2DXEA 2ZH9A 4CGHA 1K0VA 1TL3B 3NGRA 3RMCA 2KU7A 5EX3A 4ALZA 1QZ5A 4KH5A 2FJWA 2EKYA 1ZBIA 3A0IX 3ZSXA 2P9LB 4AH9A 1M5VC 4PWUA 1BHLA 4ES3A 1UFWA 1ZS6A 4FP9A 3UDEA 4OX9J 5GIOA 3QGPA 2ZJPQ 1TKTB 3J8AA 5D0RA 3ITHB 2NRXA 1Q16B 3PHEA 4FK2A 2YHWA 4GV9A 4C0HA 3ZT4A 5E5NA 3D0GE 2JEFA 4DG1B 5EDWA 3W8PA 1NOZA 2DY9A 1QE1A 2RQMA 2G9OA 3VTIA 2YNHA 4IJAA 3Q2TC 4UZCA 3MM8A 3DYAA 1N6QB 3CXCM 2IAJA 5KFSA 2M7SA 1KAXA 4ES2A 3KLVA 4GV6A 3T1YJ 3P4IA 2KVIA 2Q6BA 3V4MA 2KB2A 4YUDA 1W7AA 1QAXA 2P9SA 2HHVA 2D0BA 4NXNF 1VQ6S 3MMBA 3GL1A 3L7OA 5FPDA 2Y1LB 4Q7AA 4USVA 3SJJA 3TZYA 4R5PB 4RW9A 3MCAB 3TAPA 2LQBA 2QLJB 2K2PA 2ZH4A 1JLFB 3L3UA 4ZN1A 5L1IA 2LA6A 1U02A 4X84A 2QL7B 2MXYA 1T6DA 1DFDA 1QUVA 5ETSA 3KOAA 1IR0A 3KLGA 2MLZA 2XMMA 1YAGA 1U1OA 4X64J 1R8CA 3ZTPA 4RBVA 5LJVA 2HQCA 4DV3J 4BWJA 5SZTA 3CD6N 2XMTA 3EGWB 1B9FA 2VGNA 3CQ8A 2H65B 1DTTB 4OYMA 1IKVA 3O9QA 5B0EA 3F9MA 3F44A 2KFNA 2GVZB 5L39A 1YITS 3C15B 4LFAK 3SFGA 5CHCB 3ZCMA 1X4FA 3I5AA 1VSFA 3GFHA 1B9DA 2OPRB 2Y3YA 2GZOA 4HT7A 3BREA 3MEDA 1Y64A 2AJ4A 2LVWA 4LF7J 3W7BA 2FYXA 4MK8A 3QBCA 3QSIA 1PAEX 3EDRB 4OZNA 1FJGK 4I6WA 3SMPA 4ZPWR 3U02A 1BOTO 2E1AA 4OI1A 3THYA 2VBYA 4WF9Q 4CW7B 3MCSA 3AAQA 2RS8A 3J81U 5HOOA 3AJ2A 3CCTA 1H1VA 1RKJA 1NLVA 3EPGA 3WDOA 1S76D 4Y00A 3TW0A 1N5VA 1OH5A 3A1YG 3VEZA 1JLQA 4CBUA 4JI4J 1R0BG 2ZBQA 3AA3A 2EFGA 2ZH7A 4C11A 3FSYA 1QAJA 4DPYA 4B02A 4LRBA 3HX9A 1SJFA 3AOBA 3JSRA 4B3OB 4W5TA 3QRPA 4MLEA 1YRXA 4M3YA 3KFWX 2BACA 3WNFA 1Z1ZA 4NLCA 5CABA 4XAKA 4Q2LA 4ZLJA 2WONA 1WSEA 2LU1A 3R1XA 1SJ1A 1ZPVA 2VBXA 3AXMA 4QPTA 3MAAB 3MI7X 2ZD1A 3BEGB 3QO9A 2H4WB 2DH8A 4QS7A 1E6VB 1YG0A 1IM6A 3HPHA 2PYLA 5DZ6A 2Z56B 3M9NB 5DG7A 3KUEA 4ZP8A 2AWZA 2FJEB 4JKGB 1R43A 3G82B 3T5LA 2XHBA 4QJVA 2BRKA 4YOEA 5E7OB 3PV8A 2HG4A 5T7LA 1WJ9A 4BR7A 4USTA 4ID1A 3ENBA 4K4SA 2C3UA 1YI2S 2CQBA 1O5JA 2RF2B 4DR1F 3A8IA 2AIRB 4JI5K 4C4WA 4F0MA 4A8FA 3ZTQA 3LM9A 3VHQA 2LU2A 2VFUA 4TVAB 4A8SA 2A18A 3V81A 4I64A 4C3MA 3BN7A 3VVTA 1GFWB 4NA2A 1REGX 5AXKA 5IQ6A 1YJNN 4CEFA 4WBFA 3JSMA 2X3DA 2ZKTA 2BUNA 3QT5A 3A5LC 1JLCA 1D8YA 4AFFA 1WSFA 1SV5A 4FLTA 4HLBA 1F1BB 4HCBA 1SVDA 4DR6K 3MK6A 3I6PA 1YJ7A 3JSYA 1BIZA 4LFBK 1T9VA 2FHJD 3FMWA 2XRIA 2HWIA 2V7ZA 5F8LA 3AGRA 3EGZA 1UA0A 4Z4CA 3OVSA 1FJGJ 4CD1A 4PXEA 3TAMB 5JMVA 5E84A 4OPKA 1M1KO 4X65F 4YDUA 3AVLA 2J0WA 1C1BA 2LQ8A 3AT1B 3CCSN 3I55N 2M88A 2IJRA 4LQ3A 3A3NB 1IBLK 3DC2A 1RT2A 2O8BB 3FNNA 4F2RA 1N36K 1R7IA 3GG1A 1TKXA 1S0NA 4RNFA 1HNVB 4WP8A 2FDNA 4DJBA 1DURA 4UT4A 4TSXA 2E4LA 4G1QB 1TL4A 4KO0B 4F4XA 1JCFA 1TAQA 3S1TA 4NLDA 3DRSA 5GAEI 3CCQS 1M5HA 3TJAA 3VEXA 2IGIA 4PYDA 3ATVA 3DRYA 4FVCA 5BXIA 2Q0RA 5JVHQ 1SZ2A 3QGHA 2XNQA 3R9LA 3PZPA 1YJWS 4C8YA 2NXCA 3QJPA 1T0TV 2VCPA 4R8UB 4ZHRA 4L74A 2V8HA 4K2XA 1GX6A 3KLEA 3AH6A 1BMQB 3GILA 3RAMA 4KHRA 1T44A 4YP3A 1M5PC 2C28A 2DNQA 2DHHA 3LO3A 3R2CJ 2CADA 1BU6O 4L6V3 3BGOP 4AXIA 3PIOQ 1U2VB 1RDWX 4U7UD 4LSZB 3CJ9A 4CZFA 1X60A 2SXLA 3N6LA 2YKMA 4OZ1A 5THWA 2C2RA 2HSTA 2X1AA 1S9GB 1RHJB 4OHXA 3RYLA 3EEQA 1Z6RA 4B3RJ 4OPHA 3WXIA 5AJ3K 4RCHA 2JX2A 5JLHA 5CZVA 1SUQB 5A2QO 1KVKA 3WBZA 4CJKA 2P2CB 3WQPA 4WWSA 3GSDA 4JI5J 3UE2A 1TV6A 1PKUA 1JNRB 4LFAF 4ID5B 1Q4RA 4NLWA 2R7SA 3VEOA 2OZSA 2KT2A 4B9SA 1Q8LA 4BE0A 3R97A 3RGIA 1B7YB 1H73A 3MN5A 3KHHA 2CGKA 1GOCA 4DR5K 2NLWA 5RUBA 5ADZA 3J7A1 3MM7B 2Q6CA 3VVUA 4BRFA 3T41A 2KDOA 3VF6A 4M5MA 3THXB 2DISA 4W92B 2QYGA 5ETQA 3F0NA 1WC5A 3OUYA 2F8HA 1Q9XA 2QMXA 1SIWB 3V6HA 3VF0B 4Q8FA 1N8RT 3A8JA 2UVUA 2ALYB 4IBNA 4H4MA 2O8DB 3HFKA 3LF0A 4DV0K 1V6HA 3VAMA 3OYKA 2HNZB 4PWDA 3H5YA 5KFQA 4CLWA 3PIPL 2OSQA 4WPAA 1QDUB 3WC2A 4UY8O 2MPUA 3UPFA 1N36J 4U9RA 3VA0A 3A3OB 3VF4A 2XSJA 1LWEA 2PFUA 2DNOA 4KBIA 1NDCA 3ZFVA 3J7YP 5DRKA 5F0XA 1GLBG 3QINA 1RLCL 3IFRA 2CG4A 3AJ1A 1H74A 4OZ2A 2D5RA 3B8AX 2YJEA 1WSIA 1VSLA 3ISZA 2W9BA 4MAKA 4QIGA 3MD3A 1MWMA 3W2VB 5AQMA 2G8VA 2NS1B 2KYZA 1FESA 3O3HA 3OFEA 1RHMB 4WIQA 5GMKa 4M3WA 4RW8B 2X51A 5HN0A 3D67A 1JLEA 4Y2CA 2V51B 2QV6A 4FLZA 2IYGA 3QNNA 3R8EA 2BKOA 3CCWA 5D3GB 4Y1CA 2F63A 4CYUA 4DCJB 3ZSYA 4JKBA 2GIRA 3CC4S 3OS0A 1FKPA 2FQQB 1TK5A 3G25A 1WOOA 4NLVA 3HVTB 4YDXA 3CTRA 2XZDB 4OZJA 2CJKA 3EZUA 1IKWB 3NFAA 4P52A 3QGGA 3KYLA 4JI0F 2JEJA 4LF1A 2AMCB 1Z4UA 4A8QA 1HD1A 3M3ZA 5K9FA 2P8IA 4QR1A 3SQOP 1YTYA 4YOTA 4A2BA 3BV8A 2AP1A 1CQNA 2O01C 3RG6A 4ISGA 4BLGA 2RPIA 1EETB 1YLXA 2OHDA 5CR4A 1JJ2R 2DTUA 4EGLA 1OVQA 1NK4A 5AJ3J 2HZAA 3M8PA 1RBAA 4PQUA 3FSXA 3MFHA 4WE1B 2W9AA 1C6VA 4ZLLA 4DR6F 1CVJA 2D1CA 4LFBF 1F6TA 1TMMA 4QWAA 3UR0A 3NF7A 4ZVQB 4C1NK 1F9FA 1YT3A 4KHNA 3M6VA 4IR1A 1VJWA 4OJ3A 1GTEA 2DNGA 3N28A 4DR5J 2KFYA 1WKKA 3RRKA 2GA7A 4DV5K 5EOYA 2FHKA 4U96A 2N7CA 4YOVA 2RN2A 3TAFA 4K42A 4JI1K 1MNEA 4Y28C 4O23A 4DV7J 2DXDA 1OS5A 4CLTA 4CERA 5E3CA 1IBLF 2D0CA 3CDEA 2YKNB 2J6SA 3NXZA 1IG9A 3I0SA 2YHBA 5AE2A 3CO0P 1LW2B 3B4DA 4H0XB 1NGIA 5M1FA 4DSJA 1WG4A 1HHQA 2QKKA 2Y8YA 2XYGB 3W1YC 2B3TB 1KVCA 3NS6A 1IWGA 3ETOA 3CDWA 3H0PA 2VQEK 4RKUC 1HL6A 4Y1DA 2VG5B 2BMBA 1NGBA 1WB9A 2GO8A 2R8IA 2WSEC 1ZM3A 5BYRA 1T02A 3CJAA 3DDIA 1JJCB 2LDYA 2F8MA 1XMOK 4BC7A 3I0RA 2GCFA 4B17A 1AYEA 5DM7L 4YHHK 1EO1A 2X7IA 6FD1A 3KKRA 3K5OA 5C24B 2RDJA 3UKUB 1ITGA 4RPFA 1NUEA 1W9HA 2DRBA 1VRTB 3PUFA 3KUGA 2YX7A 4JS4A 2ZH3A 5KFOA 1FKOA 1WHXA 3GIKA 4B9MA 4UF4A 5ELZA 3W5YA 3L2QA 2H5EA 2L48A 4I6YA 3WT0A 1R27B 2EG2A 4M5DB 3M6UA 3EGVA 1HBOB 4IKAA 3O9UA 1BC6A 1JWWA 2RD5C 1XTZA 2HNDA 3VQ6A 2BQRA 5KPTA 1VR6A 1P9YA 1NHKL 3HL8A 3HI9A 5CHIA 3BGFA 1ZAWA 3BB5A 4FF1A 4RL1A 4AHCA 4CGJA 5GADU 3FFIA 3BSOA 5KAKA 5KFHA 3BUZB 4RNOA 4EBCA 4CZEA 4FKYA 3C0BA 3SFUA 5HATA 3G71S 2NUUG 4ZJLA 1S6QA 3EKUA 1Q8BA 1CZAN 1RTDA 2QK9A 4I2QB 4ZVFA 3MM6B 4MKYA 4H4KA 4BRCA 3U27A 3VAKA 4FWOA 2F7TA 4WQ4C 2ETJA 4IUFA 1S12A 1RI7A 3QNWB 3SPYA 1RU1A 3UIQA 3DRPB 3BH7B 1YVFA 1URNA 2EW9A 3UCGA 4GV3A 2W9CA 4ILHA 4O8KA 4DR3K 4MLHA 4C8NA 2OI2A 4QW8A 1RT6B 3Q8VA 2BEFA 3GZ7A 1G7CB 1QQNA 1NRKA 3H8YA 1W0HA 4DV0F 3SI6A 1VRUB 1N48A 4X62K 4DV5J 1RDBA 1X9SA 3MN9A 1DLOA 2OTJS 3NF8A 3MMBB 3KNAA 2RSQA 4JI1J 2VFVA 2KN4A 4LQ9A 5HMYA 1RP5A 5KOXA 4FK4A 1BCMA 3QZ8A 1BHNA 1Z2LA 4M45A 1DARA 2HBKA 1NK0A 3TA2A 1ZZFA 4CHZA 4MFBA 2FC8A 3WNEA 4UQTA 2VFRA 1BXNA 5F8NA 1Z2ZA 2B9WA 3CCMN 1S1VA 1U1RA 2E2OA 5KT5A 4J9LA 4KREA 1WHWA 3J81Y 2W6LA 2VQEJ 3WIVA 1P90A 3SQGA 1GT8A 2JFDA 4QYRA 1E6YA 3JTOA 3HRGA 3MMAA 5KFWA 5DGAA 2DPIA 3DOMB 3FJ2A 3WIUA 4FPIA 3R9PA 5KFZA 1T9WA 1S1TB 3V1OA 2IBOA 3CXCR 1NGAA 1XMOJ 4DV2K 2PFDA 2UXBJ 1SQGA 2HWHA 3H3OB 4FNIA 5D15A 3AVKA 1U04A 4K8XA 2ROGA 1NDPA 1SKUB 4YHHJ 2XLKA 2ZVSA 5KFFA 3D68A 3OVBA 3BGRB 4IDKB 2FLLA 4QAGA 3QPIA 5F8JA 1AUSL 3AD9C 2UUAJ 3A13A 1YJWN 1TYQB 3CCEN 2G1DA 1HRHA 1OMSA 5B0DA 4FWSA 4RWXA 3T19A 1S1XA 4KGXB 3W3DA 3KHLA 4RW6B 1VAZA 4LF4K 4BDPA 4LF5K 4EO6A 4OV6A 2GTDA 3HYFA 1L5UA 1BWFO 3EM1A 5HO4A 2E9RX 2AA4A 3TJ8A 3O2IA 3MCNA 1OSDA 4DL2A 1A0OB 2R7XA 3AD8C 1BGXT 1UW9A 2WBMA 4JV1A 3U3YA 4ES1A 1KVIA 4DTSA 3TRGA 3JYTA 3TI0A 1CJTB 3I32A 1HKGA 5C12A 2XWXA 5D4PA 4JN4A 5ETRA 4DMZA 1CLFA 2EKNA 2ATQA 3IR7B 4CF0A 2HGMA 3AVBA 3M6XA 2O3DA 1RTJB 3DLKA 2BBEA 1EWQA 3BGUA 1Z26A 5AQVA 2VZ9A 2NSCA 2VQFK 3MXMA 3ZT2A 2GFFA 1ZA2B 5KFPA 3CULA 3MR5A 4Q44A 4CGGA 2NXEA 4K4YA 3QFWA 2DPNA 5T7LB 4JV5K 1DTQA 3GOIA 1N5YB 2L41A 2XMAA 2UVWA 4FDFA 4H8KA 1OIAA 3WXMB 5BR9A 2IJFA 1PILA 4BRIA 5T14A 4DL7A 4W5QA 1YJRA 4DQPA 3CJ2A 1VYAA 3D1QA 5AQNA 4MIAA 4MIBA 1QAIA 4CF1A 3V81B 1N54B 4CNYA 1SL0A 4RUAA 3AAWB 5K14B 2FVSA 1KQFB 1HQUA 3UVJA 4DSKA 2RRBA 2YQ0A 1D3WA 4CH7A 3KLFA 2HHTA 3VQ9A 3DNCA 5J1PA 5KG5A 5GINA 4CJWA 1VQPS 3W61A 5DETA 1SV5B 4ISFA 2K8GA 1RT7B 5CZ2A 4O5BA 1T3VA 2O8EB 2XCAA 4DV2J 2V4JB 3CEDA 4DR2K 3D0HE 2FLNA 1HBNA 3RU0A 1ROFA 2DR7A 1JLAA 2C2OB 4EWTA 5AQWA 4RWWA 5BR8K 4PAAA 2WW8A 3FEXB 1VQLS 3AVHA 1UFKA 2EWSA 4IWVA 4YORA 5J2PA 3RB4A 1XC3A 1EKSA 4PR6A 4IKFA 1B0TA 5I3UB 2HIYA 3M30A 1S1WA 5A6WA 2OMLA 3VAHA 1H72C 4BR5A 2FSKA 3NH0A 4QIWD 3K5NA 5J2QA 4UOFA 1H6KX 4LVOP 4LF4J 4LF5J 3KJQB 3CMAS 5ETKA 1VS3A 4NL5A 2NCKL 2UXDK 1TVRA 4BRGA 2WUSA 2LQJA 4DR3F 3JAMU 1HA1A 3G2XA 3LPEA 3CMES 1XNRK 4HT5A 4GVMA 2PAVA 4ZP9A 4EFAC 3RW6A 2XWYA 4DU3A 3HBTA 2M4MA 3VETA 2PE8A 2H3EB 5C2GA 5I4MA 4Z4FA 1HKAA 4X62F 1FHTA 4JD2B 4KR0B 1GOAA 1ATNA 3A5NC 1HBMA 2ASLA 3VWSA 3D1HA 4WFNL 4J37A 4Z37A 2JGUA 2JC1A 3VGMA 1NDLA 4EZ6A 3QIOA 4QW9A 3ILOA 4LMZA 2PA8D 1VMBA 1FNXH 1F2GA 4NLOA 1JCEA 1RT3A 1VQ8S 3AA9A 1J5OB 4B1YB 4L75A 2VQFJ 1IQZA 1C0TB 4P7TA 4TQRA 2DCLA 4DV4K 4J9OA 1QSSA 5ETTA 2CQPA 1CZBA 4PYAA 2E6MA 3HSDA 1FW6A 1CJUA 3BO2A 3NCQA 3H40A 4CT8A 1KOOA 2CPIA 4JV5J 1EQMA 2MZRA 3N6NA 3NGUA 4KYZA 1S22A 2XO7A 1SJRA 2YNFB 3SEOA 4FPRA 1L3SA 4B9TA 2A42A 1Y3KA 2MTLA 4IRDA 1HKBA 3OXGA 4OX8A 3VQ5A 1G1XA 5G0RA 3BZKA 1KLNA 4LR9A 1TV6B 1DKGD 3OHAA 2EBEA 3I33A 3R8YA 1PBUA 2MHEA 2V69A 2RE2A 4ZIVA 4DR4F 3QLHA 1ZM2A 4NZ7A 4ZPDA 1NMNA 2J0SD 3VA3A 2ZH8A 1IWAA 4H5VA 5EGYA 3T1HF 5LMNK 3QRQA 1RBVA 3B82A 4FJMA 3OBYA 2J9CA 3ENOA 1Q1KA 5EU7A 1KAZA 3MR3A 2G0CA 3D6RA 4QU7A 3IS9B 4UUWA 4BC5A 4C3KA 2YKAA 1VQ4S 2FGCA 3DWLA 1HPZA 4DR2J 2K7JA 1KHWA 3ET6B 4RJVA 3A4TA 3CJ4A 2CVEA 4OYIA 2HRUA 2FJBB 4AYBD 3QIPA 2ZITA 2QA1A 2OEKA 3IG1A 4PKIA 7FD1A 3FZBA 5BR8J 1S72S 3DU6A 4FPAA 3EDQB 3UCZP 4LBHA 4V1Ak 3QETA 3DXKB 2FPHX 2GV1A 3U1LA 3EO3A 2IA6A 4H4OB 4XDCA 3OYNA 4B3TF 2BR0A 3KJVB 2JLFA 2M2BA 2ZGYA 3DI6A 5CXTA 2D3UA 3HPOA 2G8UA 4V19X 3W2WB 1BISA 3UN2A 2PYJA 3K5MA 2M70A 1U24A 4NLXA 3D6TB 3NBPA 3VOVA 5AQYA 2CNNB 2HFSA 2UXDJ 5BPMA 3OTCA 2HS4A 2XHWA 2BX6A 2W40A 3UDCA 1ZTTA 1UW4A 5M1OA 1XNRJ 3TAGA 1N88A 2YX4A 2FY8A 3G71N 1KAYA 1JL2A 3PTWA 2GS8A 4DS5A 4DN0A 5GAEP 3J80U 1JLEB 2BKNA 3OSPA 2N82B 4FKXA 1Y0HA 1NXIA 2MGZB 4O4GB 3TA0A 3IRXA 3KXDA 3NH1A 2RT3A 1RAFB 2VBWA 4N7TA 3Q8UA 3QIDA 3DLEB 3AY0A 4IG3B 2CJQA 1DEJA 1MMNA 2YH1A 2ZOFA 3W64A 4F04B 4TU8A 1LV5A 1HI0P 3NVKA 2RQCA 1K8AO 4HDHA 4HVZA 2DGOA 2HHSA 1XQIA 4J5OA 2EC0A 4N77A 2Q2RA 2P9KA 2DO4A 4PG8A 3CJ7A 3TR8A 3CC2N 1MG7A 4DV4J 3O5TB 2OTJN 3IC1A 4ZVTB 5ITHA 2XGQA 8AT1B 4FLVA 3TARA 2YKPA 2E5JA 3W9HA 4B9NA 3ID8A 5KFBA 1QZ6A 5HRPA 3HLUA 4NI2A 4ED7A 3K2YA 1RTHB 3HD2A 2FSJA 4DR2F 3U8XA 1HKCA 4JHDB 4ILJA 3VGSA 2OEJA 4O3RA 2YHYA 4OYWA 5F9LA 5A6PA 5KG0A 1NPRA 1SC3B 1LEOA 2GAGC 3OL8A 2DR6A 5JS1A 2OTLS 3I9V9 3NH2A 2H48B 1S0OA 4YR2A 3TABA 4MH8A 1QLNA 2LEPA 4RWTA 5LMNJ 4KIAA 1X4GA 4YB7A 1X4DA 3MHYA 1S10A 3DN9A 3FE1A 1F5AA 3UW1A 3R27A 2ASMA 3CYMA 3G6XA 3L2VA 2KVQE 2GVDA 4HACB 1OQ3A 3GG0A 3ASMA 2YKOA 4OZLA 2Y8WA 4F67A 2RUSA 5AZJA 2NXUA 3C6TA 1Q53A 3OYMA 2FIUA 4EBEA 1VQKN 2GJFA 1F3FA 3W60A 1KN6A 1F2HA 2AQ4A 1HNIB 4ZLPA 3R1HA 3PW7A 1YIJS 1ICEB 3W5XA 4FN5A 2QI2A 3HT0A 3UKRB 2ZJRQ 3QERA 1XNRF 3PJWA 4K59A 3WX8A 2QA4N 1XQSC 1MMLA 2X3GA 5AQSA 4PHTX 2BANA 4ICLB 3POTB 2HVEA 7FDRA 2R2RA 4L3QA 4CGDA 2R7YA 2N4CA 5C2FA 1T03B 3C46A 3EN9A 3J81j 3E66A 3MX5A 4NEYA 4P7VA 4TY8B 4DU7A 2MQOA 3OL9A 3R5GA 1LW0A 1UJ4A 1GK8A 1VJQA 3GJQB 1BI4B 3AA8A 2AV5A 2R8GA 3AVJA 1I6JA 4FM0A 4TXSA 1F9HA 1I1GA 3AO1A 4FYXB 1HLUA 3PHTA 3V1QA 3TUIC 2I38A 5KG7A 4DB3A 3WEEB 3F5TA 4OYAA 3Q7BA 3DJCA 2VG6B 2K3KA 1KQSM 1D9AA 4DL3A 2C2ZB 4OYOA 3EXYA 3C16B 3MUMP 4OLPA 1RT1B 5C25B 1K8KA 2ABYA 4X4VA 4CJFA 2RIJA 4HR2A 3H42A 1H7XA 4DFJA 4CO1A 3HSCA 2G2YA 3M8QA 5AQGA 3KHRA 4UOCA 3BYRA 4R0JA 1UWAA 2F8EX 4LFCJ 1NK7A 2KT3A 4BQZA 1R8AA 4CGFA 5K8NA 1UETA 2DGTA 4FLWA 1RLDA 2OD4A 1WC4A 1Q81T 2HHQA 1WHVA 3KVGA 4YB5A 3E9PA 4GKKF 3LP1A 4O0IA 1IVZA 4E1JA 3HVRA 2AEJA 4F3TA 1AZSA 1YSJA 3UO0A 3QYYA 2F4VF 2BABA 4JKEA 4FSVA 2VWBA 1S9EA 2VPZB 2YWHA 2DNZA 1UEVA 1Y5NB 4DPXA 1RAGB 4AHTA 4KH0B 2HAIA 1XNQK 3C14A 2HOEA 1NSKL 3P3DA 3FSIA 1FO1A 2QXLA 5E26A 5HJYA 1WTBA 3IN5A 3GV8B 1W97L 4F4KA 2O8FB 5IC4B 3HM8A 3FBEA 3PJXA 2D7SA 1YX2A 3R5AA 2JEIA 2ZM6K 3CIPA 4WU3A 1NSQA 1FX2A 2VIHA 1D0EA 1S5ZA 4CECA 2QG9B 3PRVA 2NZ4A 2CAJA 1NK6A 4EYIB 3OYDA 4CJEA 1GAOA 3CVKA 4CJUA 1OVYA 2DH7A 4BRMA 3R6MA 2I9SA 4DPOA 3C65A 5CD4A 1S57A 2OP5A 1VQLN 2VWKA 1S1VB 3FZHA 5LL6d 2FVPA 2BXJA 2O4IA 2AHOB 3P38A 2PFFB 1VRQC 4TLQA 3KUHA 1EQYA 3HI0A 4F0KA 2W24A 3MMAB 4K8RA 1HFEL 4FWNA 2XZWA 1WF2A 3PIOL 4I67A 3AVMA 4LF8K 3CMAN 1YWXA 4CZKA 2XHCA 2HBLA 1NKCA 2B51A 3BKUA 4USWA 3U4LA 2FZCB 1ULRA 1IBMK 3I5BA 3CMEN 1TL1B 3MM5B 4RNHA 2OAUA 1VHXA 3QICA 2YY3A 1R0CB 1Y5LB 1GXUA 5BPNA 2R7TA 3CGIA 1J6ZA 3Q8SB 5A8KA 3P4UB 3WUHA 3RTVA 1J54A 4P75A 4JYAJ 4LF9K 4H5TA 1REVB 3HXMA 1RTZA 4FJJA 4B3MJ 4E8UA 1Q7YO 1TL3A 1GMVA 5KFAA 2CJBA 2CNKB 4DV1K 1G99A 2Q43A 4M5KA 2LQ5A 3HHDA 3IKMA 3CF5Q 4NB4A 5KFEA 2P9LA 1RCOB 2GHWA 4OLOA 4NYFA 3THWB 4C7QA 3MXHP 2W25A 2XMUA 4S0MA 3MR2A 1NG9A 1VQ8N 2EK1A 4X66K 1RWPB 5DMRA 3PRDA 2P51A 5K5MA 1K6YA 4BRKA 1TKTA 3AODA 3CCUN 1VBXA 3ITHA 3ENVA 2CPYA 1QSLA 1WNSA 4HH1A 4PY5A 4WK3A 3LP0B 2PT0A 2IS3A 3DFEA 1VBYA 5CYQB 4DG1A 1HYZA 2GO9A 2PI5A 4A2AA 3OPKA 2MY7A 4A46A 3SPZA 1TUGB 3JYTB 4FWMA 5IV3A 4IFYB 4KB7A 3HKWA 4BVPA 3W9JA 2RDIA 1RAHB 4F25A 1N6QA 5J1NA 3U1MA 3UR3C 3I82A 3A3PB 2WSFC 4HEA9 1CC8A 4JI8J 2GQCA 3VV2B 3MMCB 4RX6A 4NYPA 1V3SA 2KLAA 3CPWM 3BBFA 1M5KC 3DLLQ 4RW7B 4CLLA 1XNQJ 4DF8A 1CLQA 2NXJA 2AU0A 2Q1NA 5HANA 1N34F 3BR9A 1S7HA 3HP6A 1ASVA 3E9LA 3M32B 4R5PA 2J4RA 3ALYA 4LF6J 4WZQA 4MJKA 5F41A 1CJVB 1K1SA 2E20A 2FSNA 1SI9A 1ZC6A 2KG0A 3CQYA 1VQ4N 8RUCA 3AO3A 3LZJA 1QTNB 4ZITA 2JNJA 5JUMA 2GWJA 5ADXA 1Q5YA 4K0KJ 1HBUB 1TP7A 4YR0A 2MKHA 4J9UE 3SMZA 1K9MT 4K25A 3QEIA 1CXQA 4BREA 4OZ3A 4LD0A 2BJDA 1X5TA 3L2RA 3ZNJ1 2PY5A 1WEZA 2AJ1A 1D9DA 3UVJB 3OTOK 1VSJA 4O3QA 3L2WA 2DFHA 3OLAA 1TFWA 1DTTA 1S97A 3GCXP 1ZH5A 2GVZA 1M5SA 3C15A 2DR9A 1RHKB 2AEFA 4ZVHA 1RAIB 3SSQA 2ITMA 5HRNA 2OPRA 1BQXA 5KT3A 3RVCA 2XO6A 3R7SB 2L3MA 3W3SA 3DM2B 5FDLB 1QQMA 3D3BJ 2HVDA 1YBUA 4B08A 3JAMY 1IBMJ 4EI2A 1C0MA 3P49B 4QS8A 2FBVA 4F4WA 2FLOA 2DEIA 3KNGA 4BBYA 4EU0A 2I7NA 3KG1A 3QNOA 2NYHA 2WCXA 2AX0A 4UTGA 5B0BA 3FDSA 4TU9A 3DAWA 2FTRA 3HPGA 1U6BA 4Z0UA 4F3OA 4U95A 4PUOA 3DCAA 3JS9A 3EWGA 5DDPC 5DDOC 4LF9J 2PDAA 1V5IB 3V9ZA 3FZLA 2KI2A 2MJUA 3W65A 5E33A 3K17A 4CF8A 4B3OA 1N33K 2Z2ZA 4QWEA 4DL6A 1NLKL 3V6DB 4AHUA 3I4HX 4KTQA 3GU0A 4Y65A 3MDQA 1TVRB 3VQCA 4BS2A 2P9EA 2P9IB 4IYQA 1N32K 3EUNA 3BBBA 3ZTRA 3DXBA 2D9PA 5IOLA 1WACA 1UEKA 4RU9A 3NL0A 1WD6A 4EZ9A 2NNWA 2QLBB 2PO4A 3MAAA 1Z25A 2NXNA 4DDFA 3PXGa 4JI3J 1RYRA 4RZRA 4DTRA 1KC8T 3G6EN 2ZM6F 1E6VA 1LQ9A 1EZZB 4ZKAA 2B9EA 3OT9A 2HZVA 1G3OA 4FZZA 2MQLA 1IKXA 5KGWA 3PEJA 4JKGA 1VLYA 3G82A 2MKSA 3AA4A 4C1NI 2VU5A 4H5WA 4TKTA 3MTKA 4K4ZA 4WCEQ 4QZVB 4ISEA 2XYHB 3ENQA 4ZIWA 5BRHA 2OIHA 4V19S 2OSRA 5GAGU 1IBCB 5HVHA 2HURA 4LIRA 5LXYA 4LJMA 4CGIA 3QEPA 2RF2A 3MPVA 2WK4A 3W9IA 2HHXA 2CQGA 2FJXA 1R3NA 3VMFB 5C42A 2KRRA 1AW0A 3OXFA 3H5XA 3BO4A 4CF9A 1S6OA 5HBMB 2E7VA 3C94A 4LF8F 3L4BC 1CJKB 1W26A 1CPZA 2R8HA 1YJ9N 3EL2A 4C3LA 1V9OA 3W63A 2HAFA 1UVIA 1HJOA 1X7VA 4KRWA 3OTOJ 2HLUA 3VAIA 1NPKA 2VWJA 2Y0BB 3CM6A 1XMQJ 4CZLA 4KRFA 3IM8A 5DQHA 1CG2A 1FVSA 3EVMA 2G2OA 5HROA 3VGVA 2E29A 1U1NA 2IDLA 4DV1F 3CUNA 1RWOB 3TUZC 5E2QA 5EWEA 4BC9A 4O55A 3VZHA 4MK7A 3TAMA 4QWBA 4DSEA 2V67A 1FE4A 4H0OA 1KD1O 2OD6A 3MMJA 3AVAA 4X66F 1HYSB 2YJFA 2VG7B 3QAEA 2HBMA 3J80Y 4B9LA 3VQ7A 4ECXA 4CLZA 3PEHA 5A2QU 1JNZB 3A2FA 1HNVA 1X4CA 2W4CA 4QIFA 3E9OA 1N33J 4G1QA 4KO0A 2HBZB 5AQXA 1KKHA 4Q5VA 5AQOA 4UZBA 4J9QA 1M1GA 1KR4A 3CERA 4KKOB 1RZMA 3BDEA 3EJMA 1N32J 1MWYA 1DY3A 4WJBA 2NRZA 5AQUA 2UXCK 3NS7B 1D9FA 4O3OA 4QYZJ 3D2WA 4XH5A 5DDRC 3O8MA 4CEZA 4KSEB 1VSEA 4NE9C 4R8UA 3S41A 3MN6A 3EZWA 1RCXB 2A1RA 3QEWA 4OHZA 1C4CA 5AZIB 3KZBA 2B5JB 3AQPA 2DVIA 3ILIA 5HP1B 4OLBA 3L09A 1VQ5N 1ASWA 4OYXA 5AQPA 4QU6A 3NAHA 4J2AA 4X4PA 4FNHA 4FW2A 3VAFA 1U6ZA 3LDSA 3C66A 2ADCA 1APSA 2JJ4D 2FF6A 5FRNA 2VONA 3CNQP 3OYIA 2QWQA 2IM1A 4I69A 1S9GA 2M9KA 5HQ8A 1FTRA 2KXHA 4PKDB 2E7XA 5KTQA 1U8SA 4CF2A 2BUPA 1SUQA 4OYZA 4ZVEA 3CD5A 2XCPA 4BHQA 3GDQA 4Z4HA 2DIVA 3AVCA 2VDIA 4C8ZA 4AILC 1HNWK 4ID5A 2EG1A 4O0JA 2EWHA 1FDBA 5KQ8A 1KS2A 4NWBA 1ZAVA 2E5HA 4IOAQ 1BA1A 2ZF5O 3OYEA 1VQ7N 4PXDA 4FWRA 5B7WA 1JLGB 3P96A 5AFUH 3IR5B 3MM7A 3CDBA 4XTTA 4GRSA 2XTJP 2ACYA 2M8DB 4KHSA 4J9VA 4W5NA 3THXA 1EP4B 2YBVA 4NLPA 3GV5B 4YEAA 5AQJA 1KTVA 5L8RC 1CBKA 5LMUF 4FJLA 1FRMA 1C1CB 2YVSA 4OL8A 3NGTA 1QVGR 4C8KA 4N41A 2P9UB 2QKBA 1X9MA 5AZJB 1N8RO 2O8DA 5D0EA 3H4DA 1RBSA 4HUEA 4ETZA 3M2RB 3CMQA 4WIIA 2HNZA 1Y5IB 4CBWA 1YJNS 4B8AB 5AE3A 3A8YA 1W2BM 2UUBK 3SYZA 3QATA 2G8KA 2NRVA 2DNNA 3MAHA 2QC3A 4E0DA 1WAJA 3ZX2A 1FEEA 4CP5A 4QQBA 2PMZD 1V4SA 3PSFA 4JI7J 3TTCA 3E2EA 5F8IA 4DWIA 3L4QA 2AEMA 3AAPA 3HHNB 1JQGA 3HJFA 3BBCA 5CAAA 1LW0B 3SNNA 5F1XA 1MROB 1X31C 1NCLA 3W2VA 2VYPA 4FK0A 3QT7A 5HAOA 2W2NP 1WAFA 4RW8A 2V4RA 2UXCJ 2P9NA 3I55S 4FS2A 5J2NB 3ZC4A 4AQYF 1VSKA 3DDKA 1YQHA 1UP1A 3IBFB 1QVFR 5D3GA 1NSAA 3NGIA 4ATNA 1RB0A 2J9EA 3CCRN 5IWAJ 3QMQA 1K8KB 4NLQA 3TA1A 3HVTA 2DY4A 3VAJA 4X4QA 3G96A 1X4BA 1NK5A 2X1BA 3I4PA 1IKWA 4RUCA 1GMWD 4CNZA 4Q43A 4CEDA 4ED2A 1HNXJ 4CHPA 3ZT3A 4UOHA 2ITGA 4DZDA 1NB7A 2G4BA 1RWNB 4GO7X 4K41A 2QX0A 4CK2A 2OFHX 3H25A 3A5MC 3A8KA 4I56A 5GAHI 3K8VA 3RBZA 2HKEA 3B6PA 3HTVA 3RSEB 4JNEA 1RHRB 3AOAA 4WE1A 1V5VA 4M5NA 1SH2A 2X1GA 4Z7YA 4F4ZA 3OHRA 1XBWA 2EBGA 1HNWJ 2K1RB 1AUDA 2RNEA 5KFGA 4J2DA 4D3HA 3OYBA 2QIFA 1JMTA 2HBQB 3T1YK 4L72B 4IQXA 2DHXA 3OL7A 5L46A 3WNGA 3SQ2A 1KQSR 2ZE2B 3M1VB 1QQCA 4NYZA 1C0UB 1L3VA 4CO2A 3BP8A 2V8PA 4CJRA 4CO5A 2OYQA 4YFUA 4FLYA 4C8OA 3N4QA 2IVFB 2YKNA 2LSNA 3SV3A 5IM0B 4A5AA 4CI0B 3GIIA 1ATSA 2JLEA 2E44A 3DXSX 1Q86T 2HBYB 3W8GA 1LW2A 5H1SV 1F21A 2UU9K 2CQ0A 2POKA 1NGCA 3AD7C 3NGZA 2IVPA 2FHJA 2E5LF 4X64K 1N52B 4MO5A 2UUBJ 1P1TA 3VQPA 5JLFA 2VG5A 4LSLB 4J90A 3P5JA 4F4YA 2UYTA 3CHWA 3BQ2A 3NVMA 3IO1A 2XNRA 4CLYA 1SH3A 1R6YA 3ADAC 4JI2J 3J7ZO 2L9NA 2ZDPA 1TKZB 2EX3A 4OPAA 4KV8B 3BPSP 1U2FA 1KRPA 3DOKB 2V4QA 2I8EA 4IFVB 3ZT0A 5C24A 1R8BA 3THPA 3UKUA 3CJ5A 2F8TA 4DUTA 1F0XA 4WTOB 4WFAL 3THVA 2F9DA 5CCLA 5A8RB 3TAEA 1U49A 5M1NA 4QR2A 1WORA 1ITPA 4E7HA 2J7WA 2ZHAA 3MR7A 4IG0B 3CJ3A 4K4UA 2VOPA 3TEGA 3BKFA 4M5DA 4FZYA 2B7CB 1HBOA 4IO9L 5D0HA 1U8WA 2CDRB 3TZXA 2U1AA 5CYMB 4LSNB 3T7ZA 3HK2A 1HNWF 1KVBA 2D9OA 2JSXA 1KBRA 3O9RA 3AGKA 2CFXA 3A12A 4I7FB 1CS4B 1UVMA 3BR8A 3LZIA 4FJ9A 2BJEA 5C5JA 3LL3A 2JFKA 4KB0A 4CK3A 3BY5A 5GIPA 1JXLA 5C7PA 4I2QA 2B4JA 2R42A 3MM6A 4FYVB 2J5AA 5BN9A 2DEJA 1M90T 3R5DA 2GNKA 3OA9A 3NY0A 2G0IA 3DRPA 5E3PA 5ETOA 1Q8KA 4D3GA 2Z4PA 2LECA 3LP2B 4BC4A 1TAUA 3H3NO 2IFXA 3LA0A 3U6FA 1RT6A 1SB6A 4B1XB 1LWFB 3R5BA 1VRUA 5LSLA 4BRNA 2XS2A 3VQDA 1PJ6A 2YQ3A 4JKHA 5EVZA 3JB9k 2QA4G 3C6UB 1M5OC 1ZPWX 2NRRA 4F7VA 2XMWA 3ZETB 5MLCV 4MDAA 1NJWA 1R89A 4CO3A 3L8BA 1C1AA 4OZ5A 4ZCMA 2KHDA 2HHHF 4CT9A 4YMEA 1UZDA 3R2DJ 3QWPA 4E7LA 1E3MA 2UU9J 5AQRA 3VR1A 3BZQA 1WF0A 3D1OA 1EARA 5FLXY 2W8KA 1HW8A 2JWNA 1GLLO 1S48A 2RU9A 4DTXA 4OPJA 1KTQA 4DQQA 3PKMA 4NCGB 4HTJA 2F1FA 2FLPA 1WF1A 2UUCF 1Y00A 2MLXA 2F40A 3QT8A 2CQHA 3DOMA 1HNZF 1NMEB 5AXLA 1MLAA 4ZPCA 1S1TA 4I2PB 3V4IB 2XG8A 4RBTA 3ULDA 1MW7A 3OW2M 4PKGA 4Q0BB 3MGJA 3CPWR 2QZ8A 1N4LA 2E5GA 4C9DA 5KFVA 4ZPVR 3BGRA 4DSFA 4IDKA 3RUBL 4CTAB 1RT4B 3MOZA 4FJXA 4KHUA 1QM9A 4URQU 4G9ZA 4ILMA 2DFFA 1NKBA 1HIYA 4MKBA 5M2RA 4DQSA 2MSSA 5HRSA 3PX6A 1Q79A 4KGZB 4OX9F 3G0ZA 1S77D 4OO1J 5AQZA 2E1RA 4CLSA 4LR7A 3EKSA 2JDJA 1WSJA 1TYQA 4C0BA 3HD1A 3IAYA 1VISA 3DLJA 1Y7PA 1NK9A 3LPUA 4PUOB 2VC0A 2P9PB 3O1WA 4RW6A 1HQEB 4CJ5A 4G6VB 4FCYA 4A62A 1NU0A 4CIEA 2NYIA 1XIQA 3CCVN 3DRXA 2LP4A 2EI5A 4M94A 4QWCA 2MKIA 1HR0K 1B99A 2DHSA 2W2MP 4CDIA 1YBTA 3FUYA 2A6MA 3DLBA 4U7BA 4YB1P 3B6BA 3T1YF 1XR7A 2R8KA 4WFBQ 3MWPA 1VHIA 4ELTA 2UUTA 1TQLA 4DPWA 1CJTA 4I6AA 3CJKB 4DHVA 3HHLC 4TNOA 1TUUA 3NCIA 1I94K 1FXLA 4J9SA 2J7UA 3ZXWA 2QM1A 2BGGA 4I68A 1RTJA 4P10A 2CUYA 2PIIA 1J9AA 4PEOA 1YGYA 4USHA 3O6WA 3RR8A 3D2EB 5M1QA 4CJVA 1H2VZ 2YWFA 1IKXB 2VFSA 4GKJJ 2ZWHA 2N7YA 4NYNA 2Z2MA 4MT1A 1WC0A 4ED4A 2AZ1A 3L0QA 4X64F 2DGQA 4DV3F 1QS4A 2IM0A 3OYCA 2B43A 5KG3A 4BDZA 2A2CA 4AHSA 1N5YA 4B3RK 4CO4A 3LTOA 1ZBHA 3D6MB 5JVGQ 2GELA 3ID6A 3O9SA 1S1UB 3BO3A 3PFEA 5C42B 5KFKA 5IS2A 2HVHA 5EX5A 2HF4A 3U3GA 4DUYK 4XPCA 4NLTA 3K9KA 2DT9A 4PQAA 2CNLB 5K14A 2GMJA 4NO7A 4LF7F 4OHWA 4FZVA 1NEEA 1IO2A 3PW4A 3RZAA 4HYKA 2XY5A 3TZWA 2QWNA 1U1KA 2J76E 1LCUA 2V2ZA 3MPDA 3MX2A 2KTQA 4HI2A 1JKHB 1RT7A 1MWZA 1RFQA 2O8EA 5A2QY 3M2UB 2V4JA 2ZUGA 4KHPJ 1VOMA 5LT5A 3H5SA 5KFXA 4PXCA 1FWPA 2P1JA 3D4JA 3OBIA 5HROB 4JI4F 1WOSA 3ULEB 3K7RA 3GLJA 2QEXN 4F3QA 1CZ9A 1N5TA 1VK8A 3G8SA 5KT7A 4KHYA 3CJ1A 3CCMS 1LAWA 4WQ5C 6FDRA 3NWRA 3VEWA 2PI4A 1IJEB 1SL2A 5I3UA 4CH0S 3M6GA 4A5BA 1FERA 2D0OA 4OFZA 3QMLA 2HFNA 3SQ1A 3TWZA 1ZBUA 5EUHA 1VC6A 1OH7A 3GYXB 1HD0A 4NMXA 1HR0J 4MMOA 4W5RA 2BVZA 4NXMJ 3SUNA 4TY9A 1RWUA 2GIFA 5D4NA 2ASJA 3C8YA 4Y0WA 4M8LA 1U4BA 4Y2KA 3QBWA 4K4XA 4GC6A 4DS4A 1TL7A 2RRNA 4FF4A 3PYFA 1SXLA 2JOQA 2Q3PA 1RXOB 4F8RA 2ZFHA 4JD2A 1S49A 3GJTB 3DKDA 2RB7A 3IWNC 2HHUA 3PW0A 2E5IA 3CCES 4NA3A 3TSUA 2QWMA 4NPOA 1I94J 3AO4A 2BW2A 2OH2A 1WOQA 3UN5A 3MPUB 4FXWA 2HQIA 5FPNA 1UWBB 3Q83A 2R8JA 3OVNA 3PR5B 1J5OA 2HFZA 2KJWA 1FKAF 1NOYA 3F41A 4ZVRB 2QWRA 5IT9U 1C0TA 1UTAA 5C10A 2KHOA 4QIVA 5J1EB 4NZ6A 3TR5A 1PC5A 3KJNB 4EP5A 4IRCA 2YPZA 3NMAA 1RTIB 2C3OA 2BV3A 3NG8A 3ZZTA 3W5ZA 2YNFA 4CJ4A 5U47A 2R7QA 1T8EA 4JRPA 4BRQA 3FZFA 2CA9A 2ZNZA 1OYDA 3CT9A 1GQEA 4PPDA 3VZIA 1GLCG 3QWUA 1AB8A 2CKWA 4GNIA 2XGPA 1KDNA 4DUYJ 2ZBCA 2QRRA 2LEBA 2RHSB 1I5OB 4ZPTR 4DX8H 2QMWA 3FRYA 4Y34A 4P2FA 2VPWB 1GNKA 2C22A 1J2VA 1EWRA 5DM7Q 4DPUA 2W42A 1IQTA 3P45B 1FJGF 3CF5L 4DU1A 5EHHA 1WSHA 1TMJA 3U7JA 3KD5E 1MN9A 4CHYA 1WDTA 2V63A 2VKRA 3ILLA 2X74A 3IS9A 3EE3A 1WKJA 1U45A 1PGZA 2XS5A 4DV7K 3VGKA 3J7Z5 1PBAA 3ET6A 4DUZK 4LREA 2BJ1A 3Q8RB 4NLUA 1YTUA 2V7YA 3IMQJ 1RNHA 4Z4IA 4CO0A 4DCPB 4YS2A 3EVWA 2I5JB 2UUWA 3G86A 1UVKA 1TFYA 1RYSA 4IH7A 2W01A 4FJHA 1OY8A 3H1VX 3DXKA 3FFKB 2ZBRA 2HQ3A 1OSCA 2E2NA 4H4OA 1K0TA 3IWXA 3KJVA 1FJCA 1ZA1B 2D1KA 2HB5A 4ELVA 5KFLA 1CC7A 3DLLL 3B8HA 3LAMA 2VL1A 2HRYA 4FOIA 2ZC4A 3C19A 3WQUA 1RUSA 3W2WA 1QHTA 1X5PA 2IRXA 2U2FA 2B4OA 3OYAA 3PX0A 1HW9A 3Q22A 2KKZA 5F3ZA 4WYWA 1FT8A 3S3OA 2Y9HA 4K4VA 4K5SA 4FF2A 2VA3A 1J5EJ 3PSIA 4K4TA 4JUZA 3GYGA 2VV5A 5BJRA 4JS5A 4NEZA 1KEKA 4LT6A 3NF9A 1RBUA 2CJYB 4CQ1A 4IXCA 4QR0A 1L3KA 2MKJA 3HSZA 4JB8B 1GOBA 1LAVA 2P9NB 2W2OP 1FRHA 3OYGA 2MGZA 4O4GA 4LF2A 9ATCB 3KDNA 1TZ0A 3WZ0A 4BRAA 3DLEA 4IG3A 4B3RF 2FVCA 1FI4A 4B3SJ 3M2VB 4JI5F 3FBCA 3DGVA 2E9ZA 3HKZD 1B7FA 1W2BR 1BIUA 5KFDA 3RBDA 1NB2A 2B8PA 5EXWA 2BW7A 3DOLB 3FMBA 1SC4B 4TYAA 2F5GA 3LPTA 2MKCA 4TU7A 4FF3A 2P5GA 3IM9A 4FLUA 1TU0B 3UFCX 3SDEB 4BG9A 1GH8A 2EK6A 1IH7A 4H0TB 2AJQA 3HOTA 2OEMA 3ZSQA 4Z4EA 4DR7J 1EB0A 4DTUA 3N9UC 5EX0A 4AHVA 5BPLA 2ZZTA 5D4OA 4FL9A 1RTHA 4BACA 1RT5B 3CETA 1Y11A 2V50A 4IH5A 4JHDA 4FW1A 4O44B 5KFCA 5KQDA 3P8BB 2D0AA 1MWQA 3PG9A 2HRTA 3KK2B 3VF2A 3DHXA 3KTQA 1FNOA 3S9HA 1NHVA 1EX4A 2BOPA 3K59A 2DNYA 4ZN3A 3SAHA 1X1PA 4J91A 4W90B 2MKKA 5FIIA 5GADI 5JS2A 3O4QA 2WVCA 3RJMB 4BR2A 2B56A 4BRDA 4HACA 4DUZJ 2Z2LA 3ILJA 5B08A 4M5JA 3J7YU 1S79A 5E3RA 4B1VA 5GMEA 1N36F 4CVNE 2KJVA 2CZVC 2MJNA 1BUPA 3G4SS 1FFWB 2W41A 5C15A 3UDVA 1NSPA 3ZZYA 2KXFA 1HNIA 1WC6A 1B70B 3KLIB 5I3QA 4CZIA 3UKRA 1PCAA 2XMKA 3D7EO 2WVBA 5B0GA 3NMUA 5KT6A 4DV6J 2YWGA 1VHFA 1NM1A 4C98A 4ICLA 3POTA 5HMXA 1RKIA 2M3DA 4WCEL 1T03A 1F5CA 3UNGC 4NLYA 4LVNP 1SH0A 4DL5A 5DZ7A 3EICA 4TY8A 2UXBK 1XJWB 5IFMA 4KAIA 1BI4A 1P6TA 1HMVB 1VK3A 3OR1B 4OKJA 3S8SA 5KGXA 4E89A 2EVZA 3WEEA 2VG6A 1JXBA 1KXPA 2WOMB 2UUAK 1XR6A 2ILYA 3VN5A 4X4UA 5LL6Z 3H20A 4ZVSB 2RVJA 4E7JA 1WKLA 3C16A 3KLHB 4JKFA 1RT1A 5C25A 1Q95G 4CZMA 4FBTA 2LCWA 2IVNA 2MDAA 4OMFG 1ASUA 1IUJA 4U8YA 1UFLA 5AJ3F 2FXUA 3O4WA 4M95A 4HKQA 3KK1B 5LXRA 3BJYA 3SUPA 4ECRA 2CJAA 3MXJA 3SBTA 3LUYA 2CWXA 3SCKE 3LH2S 1U1PA 1ZETA 2FVQA 4M3ZA 4PRFA 1U6FA 2CPDA 4DR5F 2JVOA 2C3MA 4QBUA 3GTYX 3MR6A 2F96A 2QT7A 4B1UB 3TX8A 1SPBP 1RDUA 5D0GA 1H3DA 2HVZA 4PWWA 4MKAA 2GJIA 4DV7F 5GAHP 4JI6J 4PPZA 1FA0A 1VI7A 5F8MA 2MKYA 1NGEA 1HHTP 1QAYA 4DTMA 2E8AA 1NJXA 2HS3A 1FK9A 5D77A 3N0VA 2RQ4A 3HHLD 3DLHA 3RR7A 1IBKJ 2G0JA 3H2LA 1FNMA 2RAQA 2DGVA 6AT1B 2IC3B 3PCOB 3CC2S 5EY4A 1KQGB 2C2DA 3MM9B 2O8FA 5LSRA 4X4RA 1TL5A 3VQEA 5H9FJ 4KT0C 3LANA 5IXUA 1X5OA 3CFPA 4WXWA 4KJIA 3OXLA 2E2QA 2BH1A 1U48A 4PCQA 3P6YC 4MTPA 1BQNB 1FCAA 3DLGB 4DI6A 5D8HB 3OBWA 5EN1A 2DNLA 4DZ6A 4OV1A 1Q78A 3JXUA 2DGUA 3BH6B 4ZCKA 3N01A 4ED0A 1B0PA 4ANDA 1T9UA 3R6LB 2GGPB 3AA5X 1ZZNA 2BOAA 1FWKA 3MUTP 1RSCA 2MZJA 1P1LA 2RE1A 4K5RA 1N56A 3UD4P 1R31A 4AT1B 4ANEA 3QSYB 2AYEA 3Q24A 1KLMB 2CPHA 1H0HB 1RA6A 4NXNJ 4I0WA 1P27B 2XY8A 2DH9A 2YNGA 2OPPB 5BYSA 3D5MA 1TUYA 1VQKS 1MMDA 1TL1A 4J9NA 3MM5A 4F26A 2UV8G 3CJBA 3OTDA 1R8PA 1EX8A 3CCLS 1KVJA 5AT1B 2MQMA 4DR1K 4CWBA 1VQ9N 1Q82T 2IVYA 1BD6A 3QB0A 4IOAL 1SS6A 3OY9A 3H46O 1WELA 4CLKA 4N8OA 2Q36A 4ZJQA 2QA4S 4WYBA 1REVA 4GVBB 5KRTA 3CC7N 1MU2B 2YXLA 2V9KA 2FJAB 4C2MA 2B4UA 2IVOA 1PO6A 5CQGA 3CWJA 3THWA 2HBJA 1HWKA 3AVGA 1FD8A 2OZMA 2COLA 1FFGB 3HDSA 2RJZA 2B8QA 3RRHA 1RDAA 4Y2IA 2HK2A 4KFBB 2IYIA 1ZBTA 1KSPA 2KL8A 1CQMA 3AQOA 2JL9A 3LP0A 3M1FA 3GE1A 2ZEJA 5CYQA 5AQHA 1UVNA 2XBPA 4ED5A 4KGMA 2OPQB 4DV5F 4IFYA 4ZS6A 1ELOA 3H6EA 3OW2R 4A8XA 4C6AA 2OJ3A 4JI1F 3AFGA 1T3OA 4X65K 2G8WA 3U9ZA 4LRAA 1C0FA 3MMCA 3SBMA 4QIEA 2KZMA 4ZP7A 4RW7A 1RAOA 4GO5X 4JV0A 4H5RA 4P2MA 4Q45A 2ROPA 3TPQA 4CM2A 3RB0A 3KDOA 3DDNA 1KP6A 3OSNA 4P2SA 3M32A 4M42A 5DK5A 3QZ7A 3AVIA 1DJ0A 1NNEA 4RBUA 5KPZA 3BDPA 4UUXA 3TUPA 1VLOA 1CJVA 2VQEF 1JX4A 3LPYA 2NQPA 4WQ4A 4K7QA 3J7AN 2VH7A 3VGTA 4CLPA 3UN3A 2VA2A 3H98A 5EWGA 3LP3A 1DBDA 1BE4A 2HGLA 1T9XA 1XMOF 3O9TA 3EZOA 1HBUA 2UXBF 2GUPA 4C8LA 2ZHOA 2QTDA 2HMIA 1BWEA 4YHHF 5LJWA 3W66A 3SV4A 2GX9A 1SJQA 3L3VA 3FRZA 1K9MO 3Q0AA 2XY7A 3VEYA 3CQXA 3B4MA 5LM7E 2FY1A 4UY85 2UUAF 4CFDA 4WU2A 3S6EA 1VBKA 4KB1A 3DU5A 1ZBLA 1X9JA 2DO0A 1RACB 4EHTA 2MB0B 5L1KA 3RMAA 2B6AA 3BF3A 3IAS9 3DM2A 5FDLA 2ADBA 5AQKA 2GWKA 1YRUA 5B0CA 3N6MA 1P8ZA 4YDUC 2XC9A 4NX9A 3GJSB 2H3GX 2G8IA 3MECA 2MZ1A 2MQNA 1VSHA 2A3JA 4DR1J 4NYOA 3Q2SC 1VDHA 3CJTA 2Z1HA 5TKWA 2NREA