4KO0A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with an anilinylpyrimidine derivative (jlj-135)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
556
structure length
555
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 159
structure length 555
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ko0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ko0A05
3AVIA 1IKXA 5HRNA 1S9GB 3M8PB 3QGGA 4RNHA 1RT5A 1KHWA 5CYMB 5KT3A 3CQ8A 1QSLA 3AVGA 1QQCA 1HYVA 3WNEA 4EZ9A 3OYHA 3B6OA 4KSEB 4QWCA 4TY9A 3M9OB 1HJRA 3OS1A 2XI3A 3MTKA 3VQ5A 3SV4A 2PZSA 2XRIA 4NLRA 1LW2A 3WNHA 1DTTA 5F8HA 3SUPA 4KHWA 4ECZA 2D0BA 4M42A 2B6AA 3H4BA 2FBYA 3IS9A 4E3SA 1S1XA 3MEGB 4CHYA 4IH6A 4O55A 2ZE2B 4Q43A 3SI8A 2HHTA 3DLEA 1ASUA 4KBIA 3U6FA 4E7JA 4JV0A 2Z1IA 3F9KA 4FJNA 4Z4GA 4O3OA 4TSXA 4PY5A 2RPIA 2C2DA 3DOKB 4DU1A 2XO7A 4CIGA 4KV8A 4CF8A 1IKXB 3O3GA 5KFWA 3QGHA 2WHOA 3OHAA 1HNVB 1D0EA 2R2UA 2IC3B 2V9WA 4J9MA 3CFRA 3QEXA 1D8YA 4J2AA 3T19A 1D9DA 3C95A 4CK3A 1CZ9A 1WSHA 3AVNA 1HQEB 2QKBA 5KRTA 4F2SA 5KFJA 4CFCA 5T7BA 3ZT1A 2F8TA 3Q8QB 1RT6B 4W5TA 4KHSA 3NCIA 1D1UA 2GIRA 4YR3A 4KAIA 1YT3A 1ZTTA 4J9LA 4ZPAA 5KG7A 1TP7A 4DTMA 1SV5B 2FVCA 1TV6B 3OL9A 3DLGB 3SQ1A 3SV3A 3OL6A 2Y1IA 4C8NA 4HUGA 4YR2A 5C25A 4M3ZA 3CFOA 4URSA 1QE1B 1EP4A 3QIOA 4CCHA 4HCBA 2OPRB 3G6XA 4OPKA 4WXWA 4JUZA 3GV5B 3K5NA 3BGRA 4URGA 2OPSB 4E7IA 1FK9A 4ELTA 4WXOA 1HNIB 1XHXA 4GVMA 2I5JB 2IGIA 1S6PB 3RR8A 4CEFA 3EY1A 1TK0A 4FZYA 3HVWA 5FDLB 4DL7A 4N76A 1LWEB 3GYNA 3SQ2A 2W7OA 3T5HA 5D3GA 4C8LA 4ZP9A 3V1RA 3AO5A 2ETJA 1L3VA 2XC9A 1S9EB 1REVA 2HWHA 3EYZA 1R0AA 4IFVB 4DQRA 5C24A 3AVJA 4K4UA 3VQ8A 3ISND 1VRUB 4RW9A 5JS2A 3KK1B 2BQUA 2R8JA 5KI6A 4NLUA 3OS2A 3GIJA 1JLGB 1NJWA 2R8GA 3OYGA 1W25A 1XC9A 4K4TA 3HVTB 4FZXC 1SKWA 2G8KA 5JUMA 5KG6A 1RTIA 3VQ7A 1IM4A 5KFAA 3NGDA 1S49A 3KK2A 3QNNA 4PA1A 3OYKA 3CJ2A 3EZ5A 2HNZB 1KLMA 4M41A 2WOMA 4CJ5A 4NLVA 5KG5A 1W0HA 3Q8PB 4FLXA 1ASWA 4NLDA 5DG8A 3KKSA 2BANA 2UUWA 3ZCMA 3ZSVA 1B9FA 4BDYA 5HLFA 2IJFA 4DQIA 2FVPA 3RMDA 2QV6A 3RRGA 3V1OA 4LD0A 3MEEB 1R0AB 2YV0X 4OKEA 1S1UB 1IKWB 4HCCA 2G8UA 5HROB 1MMLA 1T8EA 1TKTA 3GILA 1VSIA 3THVA 4PWDB 4CFAA 3TAQA 4AHSA 3VQQA 3QETA 4TQRA 3DI6A 4RW6B 5I3UA 5L9XA 1RA6A 2ALZA 4MQ3A 3IG1B 1WSIA 2JC0A 3KLGA 1IKYB 1BI4A 5HP1A 4O4RA 2OPQB 1T03A 4ED1A 1OS5A 4QOZB 3DYAA 4O3PA 3LZJA 1VSDA 3I5CA 1NK4A 4BWMA 5CY4A 4KO0A 2J6TA 3OSPA 1I6JA 3KLEA 2YKMB 3OYIA 3KMSA 2DFFA 2E6MA 3DLKA 1ASVA 2F8EX 3HPHA 4FLYA 1LW0A 4YP3A 4IG3A 1SKRA 4CHNA 4IKFA 3OLBA 1RT4A 3ZT4A 4QCLA 3HYFA 1SL0A 3ZSQA 4Z4IA 3AO1A 4JV2A 4B8CA 1ITGA 4WE1A 3PO4A 1NHUA 1N6QB 4B08A 4FBTA 3M8RA 3SQ0A 3LWLA 2RF2A 1TK8A 4Y3CA 4KKOA 4ECTA 3I0RA 1ZBFA 3T1AA 1KFDA 3K58A 3ZT2A 3RB4A 3SQ4A 3H40A 5CZ1A 3NH1A 5KT5A 3Q8RB 2R8KA 3KKRA 4QWAA 3MEDA 2ZQBA 1NOYA 3N6NA 5KFYA 3BR9A 3VQEA 4FXDA 3RAQA 3QGIA 3HSTB 4KB1A 1QTMA 4I2QA 4FJKA 4IDKA 3KLEB 3CJ4A 5K14B 1CSJA 4J9PA 4IR1A 3SI6A 4OVLA 4CGIA 3RTVA 1RTDA 4MK9A 3BQ0A 4R8UA 2YKNB 1UWBA 3T3FA 4DQPA 4FLZA 3DOLA 1BL3A 1RYRA 2VG6A 4ED6A 2FVRA 3ZSOA 3KHLA 1KCFA 4J9OA 1HMVA 4M3TA 3NBPB 2W9BB 3VQ4A 4ZP7A 4HYKA 4KKOB 4LH5A 4C8MA 4LSLA 4RUAA 4IG0B 3PW0A 3V6KA 3TR8A 4DG1A 2XI2A 3NFAA 4PQUB 4RUCA 4ZHRA 3GIKA 1JXLA 2VWKA 4E89A 3QLHA 4EO6A 3JSMA 4Q0BA 4DSEA 3HP6A 4N47A 2YNIB 5L1IA 1S1TB 3NF8A 1VSJA 3V4IA 1RT7A 5J1EB 1QHTA 1BHLA 4XO0A 4M3UA 1BQMB 4ED2A 4B9TA 1JLQA 3O3FA 2VG7B 4K4VA 3AA5X 4TXSA 1EETB 5F8JA 4CJLA 2KW4A 3TQ1A 1TGOA 5KT7A 4L8RB 4JS5A 4R8UB 3EZUA 3MECB 3ASMA 1X1PA 4ED8A 2HNYA 3G6VA 4CK2A 4R5PA 2UVRA 1RT3A 3VN5A 5J2PA 2HHSA 3IGNA 4KHYA 1A5VA 4FLWA 2DFHA 1JLEA 3V9SA 1RDAA 1N56A 1N5YB 1K1QA 3RR7A 3MR6A 4LQ9A 5F9LA 4DG1B 5F8NA 1Z4UA 2A1RA 5KFLA 4CF9A 3T5JA 3UPFA 4O5BA 2RDIA 1RYSA 3JSMB 1G15A 4E7KA 3VQPA 3S9HA 3ICLA 3VA3A 5F8LA 3JYTA 4CJ3A 2UVUA 3ZSWA 2FVQA 4F4ZA 4MK8A 4YQWA 4LQ3A 1RBVA 4KHQA 1SKSA 5KFXA 2WCXA 3C6TB 1TKZA 3QZ7A 4Y1DA 3UIQA 3OYNA 4FJ8A 3RWUA 5F8IA 2J6UA 2AGOA 1VSMA 3AVCA 4CJKA 1NKCA 2J6SA 4CJTA 4KTZA 2FJVA 5KT2A 4DS5A 1BIZA 4ICLA 3ZT0A 1WSEA 1C1CA 2E4LA 5DGBA 3IRXA 2E9TA 4ZPCA 3VA0A 4EO8A 4UQGA 2BQRA 3RB3A 2IDOA 3DRPB 2R2TA 3AO2A 4FLTA 1S9GA 3M8PA 3V6JA 2F96A 3DRSB 3MR3A 5CYMA 4EBEA 3PJWA 3LP0B 4FLVA 3AVHA 4DSJA 1QAIA 4EP4A 4YMEA 1VK0A 4CGHA 1DLOB 2R2RA 2PYLA 2YNFA 5KFFA 3ALYA 1WAJA 5KFUA 3GV7B 3QESA 3MEGA 2IS3A 2ZE2A 1FXXA 3AVBA 1T05B 1RTHB 4KE5A 4HTUA 4I7FB 5HRRA 1K6YA 1NK0A 4M3RA 1L5UA 3FFIB 4H4OB 4NLYA 5EU7A 1RA7A 2QK9A 3DOKA 2R8HA 3N6MA 4F4YA 1KRPA 3OSNA 2D0CA 3H08A 2JLEA 3GIIA 4ZTFA 1HNVA 2IM0A 4MK7A 4ECRA 2IC3A 3SPZA 1XHZA 4MKBA 5SWMA 2QKKA 1JLCB 1WN7A 5KFGA 4IFYB 1HQEA 2Z1HA 1BCMA 2PYJA 1ZBLA 4QW8A 3BQ2A 2YNHB 2GC8A 2Z1JA 2I1RA 2YNFB 3PR5B 1RT6A 2IOCA 5EWEA 2XHBA 4ED3A 3PVXA 4E1NA 4OL8A 1C0UB 4F4XA 3NF6A 3ZT3A 4I9QA 1SV5A 3GQCA 4Q8FA 1TV6A 3OL8A 3DLGA 3DRRB 1WSGA 2IAJB 2DTUA 4CEDA 4O0IA 3OYCA 5J2QB 1QE1A 4B3OB 3PY8A 5KFKA 5KG2A 1TVRB 3D5MA 2OPRA 2D3UA 1GOCA 4EZ6A 3I5BA 1KFSA 2CJQA 4O4GB 4DU3A 2O4GA 4DFKA 4CEOA 2GIQA 3K5LA 4F4WA 3LP2B 2O4IA 2OPSA 2X6NA 2KZMA 2XGPA 3PX6A 4J9NA 1RCHA 3TARA 1NNDA 2WRMA 3AA4A 4CEBA 1MU2B 1HNIA 1RT2B 2JEFA 3NMAA 4NCAA 1YVUA 2I5JA 3RBDA 3F73A 1S6PA 4FM0A 2GV9A 3NE6A 3V81B 5FDLA 3VQBA 3VQ9A 1LWEA 4ID5B 1VSLA 5KGWA 4PUOB 3KLHB 3L2WA 5KFEA 4BDPA 4K4SA 2ASJA 3K59A 1S9EA 3V6HA 3AVKA 4CGGA 4IFVA 4MIBA 2KFNA 4J2EA 3CFPA 1U47A 1VRUA 3KK1A 4KREA 4M45A 1JLGA 1RBRA 3MF5A 3AO3A 3MFIA 3C6UA 1X9MA 3HVTA 3SFUA 1VSKA 1RTJB 5JS1A 4FCYA 1JIHA 3KLFB 4K4XA 3P1GA 4DL3A 1CXUA 1Q9YA 4DTNA 1B92A 2AWZA 1HQUB 1BISA 1U45A 2HHQA 2HNZA 1JXEA 4J9RA 1J5OB 1NK7A 4G1QB 3QIPB 3L2VA 3ZSZA 1S4FA 3IGVA 3NGIA 1ZBHA 4EYHB 4W5NA 2Y1JA 3QEWA 2WONB 4CJVA 4RG8A 3QYYA 3TVKA 4W5OA 4ED7A 1BQNB 4RU9A 4CEAA 2G8WA 3MR5A 3IAYA 1JL1A 3MEEA 4B9MA 2C2RA 2GBZA 1S1UA 1IKWA 4Y2AA 1JLFB 3VQ6A 5HROA 1HYZA 3OYJA 2W9CB 4DTUA 4PWDA 3TI0A 4CJQA 1J53A 4ZTJA 2BE2B 3KMQA 3C6UB 4DTRA 2BRLA 4RW6A 4K4WA 2LSNA 4CHPA 3OJUA 5DK5A 4BDZA 1YVFA 4ECUA 2XY5A 4RW8B 4KRFA 3IG1A 4FS2A 5JXSA 3EPIA 3QERA 1IKYA 1Q9XA 5DLFA 2OPQA 1JLBB 5F8GA 3TAMB 3PX4A 3BDPA 3LZIA 1RDCA 4Y2CA 4RW4B 1W9HA 4AHVA 4MKAA 3LANA 1LAVA 4BE1A 4IRDA 1NK8A 2D7SA 4NLTA 4NLGA 2YKMA 3LAKA 2HNDA 3IN5A 3PUFA 4CFDA 3KJVB 2RN2A 3AA3A 3CJ3A 3BREA 5HRSA 3M8QB 1XR5A 3NAIA 2OZMA 1NHVA 3SZ2A 4KB0A 5KFNA 3OLAA 3BJYA 2P5OA 4DSKA 5KG4A 1WSJA 2FC0A 1TKXB 1ZETA 2FLLA 3PR4A 4TY8B 4GW6A 1NKBA 5HBMB 3KLIB 1N6QA 1NJZA 3KIOA 3H5UA 3QO9B 2V4RA 4F4KA 1XR6A 1KVAA 4CHOA 1J54A 1LWCB 3S3NA 3OVNA 4FS1A 4I9LA 3TWHA 3SUOA 1UA1A 2F8SA 4KTWA 2XWYA 4F2RA 2ASLA 1QS4A 5F8MA 4ZP8A 4WZQA 3SPYA 5FROA 1S10A 1S1VB 4DEZA 3QZ8A 1T3NA 3T5LA 3H59A 2HHXA 3EPGA 3OYDA 5K14A 2HNDB 4EP5A 4CECA 4NRUA 3SCXA 2IM2A 2YKNA 4CF2A 4DFPA 1A5XA 2B4JA 3I0SB 4FJ5A 2FVSA 4N56A 4M3WA 3PZPA 4I2PA 4HUEA 4H4MA 4CJPA 4ECQA 1C6VA 4NCGB 3L2UA 1C0TB 3NBPA 4ZMMA 1GOAA 3HJFA 2W9BA 4DFMA 4H54A 2CKWA 1BIUA 1HARA 4IG0A 1KVCA 2E9ZA 2WTFA 3CDWA 3QNOA 1VSEA 4O3RA 1C1BB 4PQUA 4KTQA 4WZMA 1DTQB 5DLGA 3HVRA 4NLSA 2XCAA 4OKKA 4EYIB 3KHRA 3P5JA 2YNIA 1S1TA 4CJWA 2X74A 4YNQA 5J1EA 4FLUA 3CDUA 1S0MA 1BQMA 2XY6A 4JRQA 5KFDA 3CVKA 2VG7A 3QIDA 4NYZA 1EETA 2ZD1B 3ITHA 2RDJA 4E7LA 3N6LA 5KFMA 3MECA 3PHEA 2JEGA 4Z4HA 1EX4A 4WYWA 4NZ0A 4I2PB 3KHGA 4FJ7A 5J2NB 4ECXA 1WLJA 4H4MB 4EBCA 4CFBA 4HUFA 4O3NA 2ATLA 4JS4A 3K2PA 1N5YA 4B9VA 2FLNA 1YTAA 3KOAA 3M8SA 2R8IA 3C94A 1N48A 4O44B 4RW7B 4LH4A 3H98A 1I39A 2HMIB 3OL7A 1U09A 3SFGA 4CF1A 2D5RA 3H5XA 4QWBA 3NAEA 4MFBB 4DLEA 3C6TA 1S97A 3ITHB 3BSCA 3CYMA 5KFOA 3OYAA 3LALA 1WSFA 4F3OA 3CJ5A 3OS0A 1XWLA 2UVVA 4NCBA 3P83D 4M95A 2ITGA 1SH3A 4IRKA 3PW2A 3WNFA 5L1KA 3GV8B 3KNAA 3HT3A 3KK3B 4EEYA 1JL2A 5DQGA 2XGQA 2ZKUA 5FRNA 2D0AA 4ECYA 1JLAB 4ZVHA 4KB7A 4W5RA 3DRPA 2HHUA 3NGYA 3DRSA 4XPCA 4FJ9A 3TAFA 1D9FA 4U6PA 3V9XA 4HVJA 3DLBA 2IMWP 4HHTA 3RMCA 4XPEA 3LP0A 4K50A 1TL1B 4AHCA 1UAXA 3OY9A 4K4YA 2VG5B 3HO1A 3WNGA 1DLOA 2V4QA 4M94A 2G8IA 3MXIA 3SJJA 5J2MB 3BSOA 3NDKA 2QE5A 4YR0A 4CJEA 4DF4A 4Y1CA 5SZTA 3U3YA 2NUBA 4DQSA 4ID1A 1NJYA 4CERA 1T05A 1RTHA 1TL3B 2HB5A 3OJSA 1S1WB 1QUVA 4I7FA 2DY4A 2KQ2A 4NRTA 3BQ1A 4OGCA 4KAZA 3OYEA 4H8KA 4FVMA 4Q5VA 3FFIA 3SUNA 4H4OA 3LPUA 1KTQA 3ULDA 3CWJA 4U7CA 3HP9A 2E6LA 1SUQB 3AVMA 3BSNA 4CK1A 2D3ZA 4F8RA 4Y34A 1TK5A 1JKHB 2HVHA 3L3VA 1FKOA 4BE2A 1J9AA 3BSAA 1WNSA 4B9NA 1SL1A 3VQAA 3LWMA 3CO9A 3MXJA 4QW9A 4GMJB 4DSFA 1JLCA 2PY5A 3QINA 1NK5A 4IFYA 1YTUA 2YNHA 2D41A 5C42B 2ATQA 3DM2B 3I8DA 4IBNA 4FK0A 4OJRA 5KFTA 2W9AA 1C0UA 3HM9A 4KHUA 2BRKA 2W8LA 4WFZA 3DRRA 3PJXA 2IAJA 3LPTA 5J2QA 4IR9A 3G10A 2V0NA 3V9WA 3UDLA 3SUQA 4F3TA 3DLRA 4B3OA 5KFRA 2HHVA 1TVRA 5I42A 3ZSRA 3GIMA 2C22A 1SL2A 4ECWA 4AHRA 4NLXA 4O4GA 3HKWA 4DTOA 4FK4A 3V6DA 3LP2A 4NLQA 3I5AA 3L2QA 2ASDA 3D45A 1FKOB 2HHWA 1NJXA 2W8KA 3MR2A 4KI4A 4N5SA 1MU2A 3E01B 1C2PA 1RT2A 1UA0A 3LDSA 3CIZA 3NAHA 4KFBB 2YNGB 3V81A 1LAWA 4OLAA 3CM5A 4ID5A 4FK2A 5EWGA 3CDEA 3NF9A 1L3UA 4PUOA 3KLHA 3NH0A 1FKPB 3NHGA 1RDBA 2VA3A 1K1SA 2RKIB 1RBTA 5KRSA 1CLQA 1IKVB 3UR0A 4RNNA 4DTPA 2FLPA 1NKEA 4IH7A 3H5SA 1RILA 4OKJA 4K8ZA 5KFPA 4NYFA 2OA8A 4CJSA 2XY8A 1RTJA 1L3TA 4FJXA 3KLFA 4BWJA 2AU0A 5I42B 2B43A 1S6QB 5KTQA 2DPIA 2OPPB 2B5JB 3FQLA 1HQUA 4C8OA 4F50A 4Z4FA 5KGXA 3V6DB 3H5YA 3HL8A 3TAEA 1LWFB 4JRPA 1QAJA 1HYSB 1J5OA 4G1QA 3QIPA 1Y97A 4CHZA 4JLHA 3ZSYA 4Q44A 3VQCA 3DMJB 1RNHA 4TYBA 4Q45A 1VRTA 5CYQB 2AX1A 2FBVA 3FSIA 2WONA 3NKYA 3SNNA 3L2RA 2IA6A 3PW5A 1S5JA 1BQNA 1RT5B 4DTXA 3TABA 3MFHA 3LP1A 3NF7A 4E1MA 1JLFA 4J9KA 4XIUA 2W9CA 5F9NA 1TQLA 1VSFA 5E41A 5KFBA 4FJJA 4E19A 2BE2A 3NH2A 4CJUA 1LW2B 1DTTB 3VQSA 2QXFA 2HAIA 3DLHA 2BDPA 2B6AB 1CXQA 1RDDA 3IS9B 3AVLA 1S1XB 4OLBA 4FW1A 3FDSA 5KT4A 4DFJA 4RW8A 2C2EA 2KFZA 3DLEB 2KTQA 1JLBA 1U48A 3TAMA 4N41A 4K4ZA 2EX3A 1HPZA 4RW4A 3K5MA 3QEVA 3G86A 1BGXT 1VRTB 3O4NA 4OPJA 4KV8B 3KJVA 4FJIA 4R0EA 5DQHA 2AJQA 3M8QA 4GC7A 4KHRA 2FBXA 2R7YA 4IOBA 3LP1B 2ILYA 3S3OA 4IQXA 1TKXA 3V9ZA 4TY8A 4WFYA 4CESA 4DF8A 5HBMA 3KLIA 3LP3A 3T5KA 4IH5A 3B6PA 4K8XA 3QO9A 2BGGA 3HK2A 4AHUA 1Z25A 1LWCA 1KSPA 1VSHA 5KG3A 1L3SA 4KHMA 2P5GA 3UQSA 4J9QA 4URQU 5C25B 2AGPA 4ZVGA 4RNFA 1EP4B 1S1VA 4DSLA 1HPZB 4FJHA 3CJ0A 4TYAA 1ZTWA 1RT1A 3MAQA 4CEQA 4X2BA 4Z4CA 4AHTA 5KFZA 4ZP6A 4CGJA 4NYNA 5L1LA 3BGRB 1TAUA 3AA2A 4Q8EA 1FK9B 3L3UA 1CZBA 3I0SA 2IJNA 1I3AA 5CZ2A 2FJXA 4NCGA 1C0TA 5D3GB 2X78A 4M3YA 3D28A 2BR0A 4B9LA 1REVB 4LSNA 2WB4A 4DS4A 3CM6A 4FW2A 5C24B 3PW4A 5DG9A 3M9MB 4RW9B 4CE9A 1C1BA 1DTQA 5EUHA 1QSSA 1KLNA 4ZPBA 1U4BA 5KFHA 2OH2A 2JEJA 1RTIB 3OHBA 1RT1B 4B9UA 3K5OA 4CGFA 3FQKA 3RAXA 3KK2B 5DGAA 2WK4A 2DPJA 4OGEA 2ZD1A 1SH2A 4BACA 4DTSA 1KLMB 2WOMB 4WYLA 4QAGA 4E7HA 3RMAA 1JX4A 2UVWA 2R2SA 3H2LA 4NLPA 5J2NA 3PX0A 2BANB 1NK9A 3HHKA 3HPGA 4J2DA 4DTJA 3TAPA 4KI6A 3NL0A 1X9SA 5HLFB 4WFXA 2Q3SA 2AGQA 2E9RX 4LSNB 4Z0UA 4CF0A 3DDKA 3O3HA 5KFVA 2GUIA 4IRCA 1TKTB 4DU4A 3RB6A 3A2FA 4O44A 1IO2A 4RW7A 3D0PA 1U49A 1NOZA 2X6SA 4AH9A 3G6YA 2HMIA 4M3XA 3DI6B 4LY7A 5I3UB 2OYQA 3AO4A 1QSYA 2YHBA 3LAMA 3K57A 1T94A 1EKEA 4ED0A 2XCPA 3PO5A 4MFBA 4O3QA 3KLGB 4FZZA 1BI4B 5HP1B 4IKAA 1T03B 1EXQA 2O5DA 3DYAB 1ZBUA 4KO0B 5KFCA 2W42A 1HRHA 3U3GA 3KK3A 4DL2A 4O0JA 2AX0A 1UOCA 3DLKB 4QPXA 1LW0B 4IG3B 4ZPDA 1JLAA 2AQ4A 3KD1E 4DL5A 2FBTA 1RT4B 4DSIA 4FJMA 1Q8IA 1A5WA 1Z26A 4FYDA 4WE1B 4ZVFA 1T7PA 4FJGA 4CJ4A 4JV1A 1KVBA 1GX5A 2IM3A 2RF2B 3SYZA 1TL1A 1N4LA 5L1JA 2VG5A 2G8FA 3I0RB 1ZBIA 4CGDA 5HRPA 4CIEA 2ILZA 4ELVA 3AVFA 1IG9A 5J2MA 1WAFA 2BQ3A 2DFEA 5T14A 3KHHA 1ZYQA 2OZSA 1S9FA 3MEDB 3PW7A 1BCOA 2VWJA 1TL3A 1S1WA 3RB0A 2A1SA 5KG0A 4I2QB 4TN2A 4TLRA 4IDKB 5KFQA 1GX6A 3VQDA 3KD5E 1D5AA 1RTDB 3FRZA 2Z1GA 1UWBB 3DOLB 2VG6B 1SUQA 4CIFA 1XR7A 4DL6A 4E0DA 1JKHA 4DMNA 4CHQA 3KLVA 3RMBA 4BE0A 4J9SA 4B9SA 5KT6A 2JEIA 3HPOA 1HMVB 4FBUA 4RZRA 4C8KA 1NK6A 4CJFA 2HW3A 5KG1A 1F21A 4Z4EA 1O1WA 4LSLB 4DWIA 1XI1A 2JC1A 4DLGA 5C42A 3DM2A 2P1JA 4O3SA 3OYFA 2UUTA 4ZHRB 3OYBA 4ELUA 4DQQA 3QLHB 4Q0BB 4FJLA 4G3IA 2JGUA 3CG7A 1TKDA 1B9DA 2HVIA 3V9UA 2G8HA 3HXMA 3V4IB 1RT7B 1LV5A 3MXMA 4B8AB 4KHNA 4CEEA 4J2BA 1JLQB 2EHGA 5KFIA 5C5JA 1TAQA 2P51A 4ECVA 1RAJA 2IBKA 3Q8SB 3RRHA 1C0MA 3NGZA 2G8VA 1C1AA 4FM1A 1SH0A 2HNYB 5DG7A 5FRMA 3H4DA 5KFSA 1GOBA 1S0NA 4R5PB 3E51A 3E01A 1RT3B 4QWEA 3L8BA 5J2PB 2C28A 4KFBA 5DMRA 4CEZA 2YHAA 2YNGA 1JLEB 1JXBA 1X9WA 1FKPA 3OYLA 2RKIA 4YFUA 4RNMA 1IKVA 2FJWA 5EWFA 3O4QA 4GC6A 1WNEA 2IM1A 3G0ZA 3QEPA 4MH8A 1S48A 3AV9A 2XY7A 3JYTB 5DQIA 4AILC 4DL4A 2W7PA 4W5QA 1RBUA 5EDWA 4NLOA 1KHVA 4TQSA 3KTQA 2EC0A 1IH7A 1RBSA 4ECSA 3OYMA 2HWIA 1TKZB 1S0OA 4HKQA 3TAGA 3RBEA 1S6QA 3HVAA 2OPPA 2B5JA 4EBDA 3QEIA 3S3MA 3V1QA 1RDRA 3TANA 4KPYA 4ICLB 1LWFA 3PV8A 1HYSA 1U04A 1C1CB 2VA2A 3M9NB 3ISNC 3IRXB 4RNOA 3ZSXA 4MIAA 3DMJA 4ZVEA 5CYQA 4CJRA 3AVAA 4QWDA 4FM2A 4NLWA 2KZZA
chains in the Genus database with same CATH superfamily
1IKXA 1FDDA 1Q81O 3DLLQ 2DTJA 4RNHA 2W40A 4A4JA 3AVGA 2YHWA 2YX6A 4KSEB 3RBZA 4GKJJ 3IWLA 3I56S 2XI3A 2XRIA 4NLRA 4OZJA 2FF6A 1LW2A 1FX2A 1S12A 1ZM3A 2M3DA 2XS2A 3SUPA 4ECZA 2YWKA 3IS9A 1AUSL 2VUGA 2F5GA 2LEPA 1BD6A 1V3SA 2QGFB 4CHYA 4O55A 2FD2A 5CA5A 2J0WA 2XG8A 2OMOA 2LMIA 2GAHC 1NB7A 4E7JA 4Z4GA 3FBBA 3ULEA 2HBZB 4K2XA 1JJ2R 4LF7J 3UR3C 3MM7B 1X31C 3EZOA 3QDKA 4DU1A 3ZEUB 2XO7A 5ADXH 4I4BA 4CIGA 2EG2A 5KFWA 3A8IA 3QGHA 1U2CA 4NE9C 5D4NA 3GMGA 1D0EA 3J80U 2IBOA 4QYRA 4DPUA 3QEXA 4P71A 2E2NA 4J2AA 1D9DA 2OFGX 3DHWC 1WSHA 4UOFA 4JKFA 5T7BA 5FPEA 5AQFA 1N33F 3I55N 1YT3A 1ZTTA 4ZPAA 5KG7A 1EARA 4WYBA 5K8MA 2A2CA 2FGOA 3L4IA 4X4PA 5C25A 2MZTA 3BBBA 4M3ZA 3EE8A 1M5OC 1S79A 3PRBA 3CCWA 4OPKA 2PAVA 4WXWA 5A0YA 1YQHA 3VEXA 3ISZA 3BGRA 4CQ1A 3VAIA 4H5VA 1FK9A 3J81Y 1EZZB 3PTWA 1O6XA 1S6PB 1HNWF 3EY1A 2E29A 4I68A 5FDLB 4DL7A 3POTA 3IC1A 4C8LA 1SVDA 1SQGA 2XC9A 1REVA 4KRWA 2HWHA 4OI4A 3EYZA 4IFVB 3DFEA 4OYZA 2R7OA 3KK1B 1W97L 5IT9O 1JLGB 5THWA 2HWTA 1W25A 1HUXA 4K4TA 3O1WA 4BVPA 5JUMA 4NMLA 1RTIA 5LMUK 1IM4A 5KFAA 3NGDA 2G0IA 1Q82T 3O9RA 2F9JA 4PA1A 3CC7N 1KBRA 3OYKA 2PA8D 4P72A 2HNZB 3OPKA 2HBRB 4DU7A 2ZH2A 4CJ5A 4FWPA 4CLKA 4OI1A 5KG5A 3D7SB 5JLFA 3AAPA 1RQ0A 1CJTB 1YJVA 1MLAA 6FDRA 1K47A 3QFUA 3ZCMA 1L3KA 1B9FA 5JJBA 5LSRA 2FJEB 2VKZG 5L8RC 3LDOA 4DQIA 1EAYC 3V1OA 5HVHA 4FWKA 4CLPA 1YJTA 5AE3A 1R0AB 1VYAA 4OHZA 5HROB 1MMLA 3G4SS 1SI9A 1VSIA 3H25A 4PWDB 3TAQA 5ADXA 3VQQA 2D4WA 3MD3A 2P9IA 3QETA 3VGSA 2CPJA 3DI6A 1CC7A 4E98A 2EPIA 3C7NA 3SMPA 4P9SA 2WVDA 1DHMA 2Z58B 3KLGA 1Q86T 1FDNA 3W7BA 1T03A 4ED1A 3JAMY 2EKNA 4QOZB 4O3PA 2DVIA 4AM6A 3LZJA 1VSDA 3IMXA 4ZJLA 1MN9A 1V4TA 3B8HA 5HSPA 2YKMB 3OYIA 4NI2A 2KT2A 1FNMA 3DLKA 2UUCK 2F8EX 4FLYA 3FUYA 3MMBB 3FCHA 3OLBA 3BF4A 3ZT4A 4OYMA 5K8PA 5F3TA 2OLWA 3AO1A 4U96A 4WE1A 1YIJS 2Z2ZA 3M8RA 3SQ0A 1VLYA 1GAOA 2RF2A 1J5EF 4Y3CA 1RHJB 3W64A 3WT0A 4IXCA 1ZBFA 3T1AA 2AJ1A 5HK4A 5LMNF 1ZM4A 2YKQA 5HMXA 3NH1A 1PG5B 3TA1A 1XNRJ 4X64J 2PGCA 3MM8B 4U7UD 5KFYA 3VQEA 4FXDA 2HAFA 4KB1A 3P5TL 3MURP 3FFKB 5K14B 3MD1A 4ANCA 1IBMK 4OVLA 2JHEA 2HG4A 4OIXA 3BQ0A 2YKNB 3CT9A 3VAMA 3VEOA 3T3FA 1KOHA 3CMQA 4FF2A 5F3ZA 4JI7F 2FVRA 2C3YA 4M5DB 2HIQA 3GBTA 4C3LA 2KM8B 1KCFA 2MJUA 4FPIA 2CIMA 4FP9A 4WIIA 1WBBA 1HMVA 1VQ4S 5K5MA 4BR0A 1RI7A 1IM6A 1YRUA 4LH5A 4KKOB 4LSLA 1YBTA 2XULA 4IG0B 3PW0A 3FGVA 2V2KA 4TLQA 4EHTA 3TR8A 1PKUA 2H54B 1RAOA 3O3LA 3G87A 4E89A 2MSSA 2UUAF 3V4IA 5J1EB 1ZPWX 4IJNA 3CMAN 4RBUA 4M3UA 2CFXA 4B9TA 2G2ZA 1JLQA 2VG7B 1VQ7S 5F8JA 3IM9A 3ID6A 1I1GA 1TGOA 4ZIVA 3QT6A 4ED8A 1AUDA 2HNYA 1M5VC 4JI5K 3LGNA 4CK2A 1FEEA 1F60B 4ZLPA 2FZKB 3VN5A 5GVQA 4KHYA 1A5VA 4NZ6A 5EN1A 1N56A 1Y7PA 1Q82O 2ADCA 5AQIA 1HNZK 3MR6A 4CLSA 2WW8A 3HHLA 4IQMA 5CABA 2RDIA 1FE0A 3I87A 3JSMB 1KDNA 3EWGA 2AP6A 2RUSA 2CJBA 3PIOL 4DCPB 3AY0A 3HSCA 5LJ3Y 2ACMA 3MCOA 5M2PA 2G2YA 3M1VB 3I8BA 4FJ8A 3DOMB 2P9NB 4A8YA 1HFEL 2G1HA 1RHRB 3AVCA 4F0MA 4ZVPB 1VISA 2FJVA 2MQQA 5KT2A 4JNEA 3DU5A 1WSEA 3FMWA 1HR0F 3TZYA 3CCES 4BLGA 1VQLN 2BQRA 3RB3A 2YCHA 3DRPB 4BRDA 2AJ0A 1Y5IB 3M8PA 2W4PA 2F96A 1Q1KA 1Q86O 1UCNA 3PJWA 1HHTP 1XNQJ 3T41A 4JHDA 2XHCA 4RUBA 2E20A 2ZJPQ 1TYQA 4C1NK 2YNFA 4WBFA 2J9CA 1WAJA 3GV7B 3CDAA 1T9TA 2ALYB 3Q24A 2Y9HA 1XC3A 1FXXA 2CPHA 3HBTA 3CMES 4I7FB 4AL7A 4CLTA 3MPWA 2K3IA 3CCVN 4AXJA 1K6YA 2OI2A 2MZQA 3AOBA 1L5UA 3VMFB 1YHQN 2HFNA 3ZXWA 2MTLA 1GH8A 5EU7A 1ICEB 2R8HA 2KHOA 3DGPA 3EMTA 4NEYA 4NA3A 2QEXN 2D0CA 2M88A 1W2BM 2JLEA 3RGIA 4USHA 4J91A 1TL7A 1V5IB 2P9GA 3JSYA 1PIEA 2DXFA 2P5VA 2YVSA 4M1KA 5KFGA 2Z2LA 1ZBLA 4XEIA 3L7UA 3BGFA 2GC8A 2Z1JA 2I1RA 1SJQA 3PR5B 1RT6A 2X51A 3PVXA 3ZZRA 2WBMA 3PXGa 1NRKA 4F4XA 1R3NA 3ZT3A 3GQCA 2OO4A 2YHYA 3OL8A 3DLGA 3DRRB 5E3PA 2IAJB 2YX1A 3O08A 3P4IA 5IOLA 1QE1A 4EMDA 3G71S 3OFEA 1YITS 5KFKA 4JI8J 2PEHA 2O8FA 5KG2A 3D5MA 2AD9A 3FEYB 3TOQA 2AV5A 4ES2A 4KGVB 4LVNP 2OPRA 2D3UA 5H9EK 2ZZNA 3I5BA 4D3GA 2CJQA 4DFKA 3DXKA 3K5LA 2CZVC 1T44A 2X6NA 1RCHA 1NNDA 4D3HA 1RT2B 3PYGA 2B9WA 2HF3A 3V81B 4DV3J 1M5PC 1LWEA 5KGWA 4PUOB 2B56A 2H1YA 1XTZA 2CYYA 2HFSA 2NXCA 3LOUA 4DV5J 3O9SA 1S9EA 3AVKA 3J7YU 4NA2A 1MSWD 5BREA 2E44A 4ILMA 1CJKB 2VQEJ 2RHKA 1RBRA 4DB3A 3W9HA 3MFIA 3C6UA 2P9LB 1JIHA 3W1YC 2AYGA 1RTZA 1KAZA 3HHDA 2QLFB 1Q9YA 4JYAF 1KQKA 2KU7A 2AWZA 2FZGB 2J0XA 5AQJA 3BKTA 3M6VA 1F1BB 3AJ1A 4FF1A 1S4FA 4MO4A 5DDPC 4A8KA 4K0KF 1GLEG 2ZH8A 4ETZA 4EYHB 4W5NA 1HBNA 4RG8A 1HKGA 2C42A 1HHSA 5GAGU 4PG5A 1KD1T 4LFAJ 1ITPA 1RWKB 4ANDA 4B9MA 3C15A 1S1UA 2GBZA 2E7WA 3OYJA 4DTUA 3TI0A 1OJ4A 1UTAA 2BE2B 1VQ6N 2CGKA 3QRRA 2YI1A 4DTRA 2FIUA 4ID8A 3MZIA 4RW6A 1VQOS 1EJ7L 4DR7F 1N36F 2LSNA 1UJ4A 2EK1A 2V7YA 4BDZA 3M30B 4V1Ak 1S77D 3EPIA 3THWB 1Q9XA 2OPQA 1PJ7A 4KR0B 2BJ8A 3TAMB 4OI2A 5GINA 3BDPA 2UZAA 3LZIA 3R97A 2XMTA 1LAVA 3LANA 5D4PA 4NLTA 2MGZA 4I6MA 4NLGA 2HNDA 4RWWA 5H9FJ 1AW0A 3AA3A 3QT5A 4CZEA 1J5EK 3RYLA 1JWWA 4H5TA 4CIOA 5HRSA 8RUCA 2WUSA 3TJ8A 3OLAA 3M2RB 3BJYA 4OX7A 5KG4A 1WSJA 3VGLA 1C4CA 1R43A 3S7RA 4GW6A 3VGVA 5AZIB 2D0OA 3WXMB 4CLUA 3KIOA 4NOHA 3GB0A 2V4RA 1XR6A 3Q22A 4LRDA 4F3QA 4H0TB 4A8QA 1LWCB 2O8EB 5FIIA 4CZFA 1V3ZA 4KTWA 3G4SN 2XWYA 2ASLA 3KFWX 5F8MA 4ZP8A 4LREA 2GMJA 4OX9J 3MM5B 4JI7K 1NMNA 1TELA 2QA4S 1S1VB 3MTJA 1CJUA 4DCOB 1T3NA 4Y6IA 3T5LA 4C4WA 2HHXA 3EPGA 4EP5A 1N52B 4CECA 4NRUA 3SCXA 5JLHA 4DR1J 4P7VA 2GW8A 3OXGA 2ZH6A 2B4JA 2LXFA 1R8HA 3HZEA 1GTHA 5HVFA 4RL1A 5F0WA 4KGXB 4JI2J 4ECQA 1C0TB 3NBPA 1GOAA 3IFRA 2UUAK 2JNJA 4DV4J 3LDQA 4LBIA 2A5XA 2PN6A 4OI3A 1HARA 1K73T 4CNYA 2FJAB 4CJ7A 2WTFA 2YPZA 2GO8A 3HJVA 5G4DA 4KTQA 1MWQA 1YIJN 2IHR1 3U1LA 4ILRA 1RP5A 3HVRA 1JNRB 2HHPA 4OKKA 3CJ1A 4UUWA 2YNIA 5G0RB 2FJBB 4CJWA 3A3PB 4FLUA 2RQ4A 1S0MA 2XY6A 4JRQA 5KFDA 3CVKA 3NS6A 2ZOMA 1S99A 3KJNB 2RDJA 2JL9A 2ROEA 5AQTA 2QZ8A 4R0JA 3MECA 4LT6A 5IQ6A 3AJ2A 4Z4HA 4OHYA 1EX4A 2CPDA 3NOGA 5HI7A 4FJ7A 5J2NB 4QR2A 5BR9A 4FNIA 3OTBA 3AD9C 1TUYA 1CULB 3QMQA 2MXYA 4O3NA 1NHKL 3VGTA 4M63C 3DKDA 1F2HA 4JS4A 3DXMB 2DISA 3TYTA 1R8BA 2DNPA 2LDIA 1PBAA 3H90A 3N4QA 3DU6A 1N48A 4RW7B 2XO6A 1I39A 2GV1A 1VQ4N 2OTLS 3OL7A 1HBOA 4QWBA 3ENOA 4DR5F 3NAEA 4MFBB 1U2VB 2CJXB 3ATUA 2XTJP 3TTFA 3QFWA 1FWLA 3BSCA 4PEOA 3JAMU 3CD5A 3UI3A 2MY7A 4LUBA 2F4FA 3U27A 3WNFA 3OHRA 3HT3A 4EEYA 4GRSA 3UDCA 2QT7A 3JQJA 2XGQA 2B0GA 2Z4PA 5FRNA 1WI6A 1NCLA 4ZVHA 3ZNJ1 3SBGA 4BRMA 4W5RA 4X66J 2QTDA 3BEXA 5D15A 1M5HA 3DRSA 4XPCA 4CBWA 2VDIA 3ZTOA 4HVJA 2P9KA 3BBCA 3HT0A 4MT1A 1HHQA 2UXCJ 2ZOGA 2RJZA 4AHCA 3P38A 1G1XA 3G9CA 2HMPA 1NH7A 2K1RB 4YR0A 2QE5A 1ZZFA 2AJ4A 3ILJA 1R0CB 4PWWA 1TMJA 5AQYA 4X4VA 1FXRA 1FJGF 1T05A 3LO3A 1TL3B 3OJSA 2KQ2A 4NRTA 3BQ1A 2GGPA 5AQXA 4JKAA 2DHSA 4QYZJ 4JKBA 4H4OA 3LPUA 3B4DA 2HIYA 1SUQB 3KKFA 3J80O 4J9VA 4DR2J 3L3VA 1WF1A 3FZBA 4YOVA 4ZS6A 4B9NA 3CCEN 4NL5A 3RSEB 4MIWA 2MKSA 2OANA 4RUHA 1RADB 3IR5B 1ZA1B 1NK5A 1TL5A 4IFYA 1AT1B 3L7OA 1YTUA 1URRA 1TTHB 2HZVA 4HR2A 3K17A 3VEWA 4IBNA 5RUBA 3ZTSA 2W9AA 3W5ZA 1C0UA 5E5NA 2POKA 4KHUA 2H5EA 5DETA 3CCZA 2QWMA 3E1YA 2ZITA 3M32A 3W9JA 1JCGA 2UXDF 3TUJC 5J2QA 3KWGA 2V0NA 2ZVSA 3UDLA 2ZM6F 3BGOP 2HRTA 3DLRA 4B3OA 3CI5A 4LR8A 1H7XA 5KFRA 5HMWA 1TVRA 5I42A 3VTIA 3GIMA 2YQ0A 2ROPA 2YPYA 3RUBL 1U6BA 3SIPB 4NLXA 1QHAA 3CMEN 4RR5A 4FK4A 3LP2A 4USIA 1U1NA 1A6LA 3D45A 4MTPA 1NJXA 2W8KA 1A7GE 3E01B 4GV9A 2G4BA 5IWAF 3CIZA 1ELOA 3NAHA 1RDWX 4X62F 2OKQA 2B8QA 5L9NA 2EFPA 5D78A 1W7WA 3PDNA 4FK2A 2GEMA 3NH0A 1RDBA 3I6PA 1GNKA 2IRUA 1S3XA 1RBTA 4JYAK 1HW8A 1IKVB 3UR0A 3J7YI 3TVYA 1VBYA 3R3LA 3CJ7A 3VZIA 1E6YA 3EJMA 1RILA 5K8OA 3KZBA 2H5JB 1NM1A 2XLKA 4H0VB 4U7UK 2V51B 2XY8A 3EGVA 2AU0A 3D54A 2G9OA 1NXIA 2OPPB 1FWPA 4ETXA 5DM7Q 4CM2A 1QAJA 1Y5NB 1HYSB 1UKUA 3VQCA 3G71N 4NYOA 1YITN 2NUHA 1FXLA 2DH8A 1EKRA 1RNHA 4Q45A 1VRTA 2FHOB 3CJTA 2GZOA 4JK8A 2AX1A 3W60A 3H46O 4HTIA 2WONA 1CVJA 2A6OA 2HQIA 3E9PA 2P2CB 1N36K 5GAGI 3MFHA 3LP1A 3VWSA 1WC4A 3FZ2A 2W9CA 1N0UA 2KJWA 1TQLA 1VSFA 1F9FA 5E41A 5KFBA 2J7WA 3I82A 4BR5A 3NH2A 1LW2B 3FR0A 4EWTA 5BRFA 1R89A 3QSYB 4C23A 3DLHA 1RDDA 3IS9B 3T69A 2B51A 3FDSA 2YJEA 4AQYJ 5HATA 3T6JA 3LDPA 4JV5J 3HZ6A 3KG1A 2BOPA 4N41A 4V19X 4DV7J 1G3OA 2LYVA 2ZBQA 2EVZA 1FI4A 1I94J 2CNKB 3G86A 3ULEB 3J7YP 2WBNA 3O4NA 2XSFA 4OPJA 3QJJA 1OSCA 5DQHA 3G6ES 3M8QA 2FBXA 2BABA 2R7YA 4IOBA 1WKJA 7FD1A 3S3OA 5HJYA 4IQXA 3ET6A 1YJWN 2H51B 3UE5A 2QYGA 4UW2A 4K8XA 3JTOA 3MDFA 4USUA 2LLZA 2DNZA 2DEIA 3HK2A 4BR9A 1KSPA 3C6HA 1F9HA 3AXKA 3MAHA 1SB6A 3UQSA 2RQKA 3VETA 4DV6J 2BH1A 3CUNA 3FKBA 5C25B 3S41A 3FGUA 3VVUA 1VQON 4FJHA 3CJ0A 3MAQA 4CEQA 1NBEB 1N5SA 1TUWA 3MWBA 3W2VB 4AHTA 2EK6A 5A0YB 2L9DA 4CGJA 2ADBA 1U1RA 4QIWD 1P8ZA 3BGRB 4X4TA 3AA2A 1DFDA 2P9CA 2PI4A 1FK9B 3RAMA 1UEKA 4M5LA 2EG1A 1HI1A 2QSFA 3I0SA 3VERA 2DIUA 2IJNA 2JFKA 3GFZA 5E26A 5LL6Z 5A2QU 2DBBA 5H1SQ 1U6ZA 1UVKA 2KB2A 2X78A 4A8MP 4OV1A 2BR0A 2IDLA 1REVB 2VC0A 3WEEB 4I64A 3CM6A 4BC5A 2QFIA 5D0EA 4PQAA 1LFPA 1LOUA 2M8HA 1X3NA 2F7VA 4LF4F 3X3UA 5TKYA 4A46A 3ETOA 3UKUA 3AH6A 1U4BA 2OH2A 2JEJA 1RTIB 4RCHA 3FQKA 3MN5A 3WIUA 4OLOA 4ZJOA 2WK4A 2ZD1A 4DTSA 4WYLA 4QAGA 3CE8A 2QA4N 2KVIA 4FZVA 1IV0A 3VF0B 3CJKA 2HHHJ 1QVGM 3T1HJ 3WXJA 1X9SA 2Q3SA 3H8YA 3TUIC 3VAKA 4CF0A 4DR5K 4H0XB 2MSTA 2WVBA 4IRCA 3RB6A 3A2FA 4O44A 3PACA 1U49A 4FWMA 1NOZA 4JI1J 1GXLA 2X6SA 3ZZZA 2RQCA 4X4OA 3IP0A 1D3WA 2P9IB 5BYQA 3DI6B 4M5GA 3B6BA 4DKWA 4USWA 2G0JA 4X4RA 1EKEA 1IBKJ 3A8YA 2OIHA 4B3RK 2ZWOA 3KLGB 3D2EA 4FZZA 4X84A 4IKAA 1T03B 4DR4F 2DR9A 3UN5A 3NGTA 1ZBUA 5KOXA 2DR7A 2W42A 3U3GA 3IFEA 4WCEQ 1ZH5A 4O0JA 4DL2A 4NI2B 3DLKB 3O1BA 3UCUP 5AFUH 2V8VA 4DL5A 2FBTA 3R5AA 2RVJA 2MQMA 3Q2SC 3WIVA 2BJEA 4WE1B 4JKGA 4CJ4A 4JV1A 3MCSA 3P8BB 4JI6K 2RF2B 1Y3JA 4DJBA 2A6AA 2CGJA 2AEJA 2VG5A 2GQQA 1ZBSA 4A59A 2ILZA 3ZTQA 1QD1A 4ELVA 2KO1A 5J2MA 2UXBK 4H0OA 2W01A 1RB0A 1S9FA 4W90B 2OTLN 4J8FA 3TP2A 5KG0A 4BR4A 4DMZA 2KHDA 1VQ8S 5KPZA 3NCPA 4OLPA 4B3SF 4B3TF 1GX6A 4A57A 2BZ2A 1PBUA 2KYXA 3CPWM 1BWVA 2DY9A 3OFFA 3TR5A 4HT7A 1RAIB 4E0DA 4GO5X 4BR2A 3W3DA 4DMNA 3KVGA 1HMVB 3NRBA 4C8KA 4DR6F 4F7VA 4CJFA 1HJOA 4Z37A 4Z4EA 4DWIA 4LSLB 1KOOA 2JC1A 2ZM6K 1YSJA 3M6GA 3NMRA 1B0VA 1RAFB 2P1JA 2UUTA 1UVLA 1PC4A 4DQQA 4PKHA 4F04B 2HVIA 3Q83A 5B0EA 3F56A 3CJBA 3V4IB 3EVOA 1LV5A 1SS6A 3GG0A 2VYPA 5IWAK 2D3OR 1JLQB 2EHGA 1PJ6A 2P51A 4ECVA 4NXNF 1P27B 3Q8SB 2ZJQL 1FESA 3RRHA 1C0MA 2RS8A 4K25A 2HNYB 5KFSA 3CXCM 1IQZA 3E51A 2C3OA 5FPDA 4L74A 3MCPA 4DV2K 4CEZA 1X9WA 1Y4ZB 4FF4A 3HHLB 2QSWA 4YFUA 4RNMA 3O4QA 4GC6A 3TA0A 5FLXO 2H3EB 5AFUA 1DGKN 3AV9A 1FRHA 4K2JA 4MYUA 4W5QA 2BTFA 1KHVA 2YWGA 4TQSA 3MEKA 2EC0A 4ISFA 1WG5A 4CT9A 4H5NA 1OPZA 3OYMA 1SAZA 2HWIA 1R6VA 1S6QA 1IR2A 1B4SA 2QI2A 3DWLA 3HVAA 2H5IB 3P96A 2E66A 3M7VA 2IDEA 1RDRA 3TANA 1H98A 3ZSXA 4MIAA 5AE1A 3DMJA 5CYQA 2W2PP 3AVAA 1WI8A 4QWDA 4WJBA 3Q8YA 3NWGA 4DI6A 3M8PB 2DH7A 5JVGQ 1RT5A 4FDFA 1ZA2B 3BH6B 2V6AA 3WNEA 2YJFA 3OYHA 3B6OA 2CQBA 3JXOA 4JHDB 3L6QA 3O6QA 2DGOA 3MTKA 3ELHA 2NR0A 3SV4A 2PZSA 1TYQB 3FNNA 3MMCA 1DTTA 1QZ6A 4KHWA 4NX9A 2NRVA 1HD0A 3GFYA 1XJWB 3DAWA 5LMUJ 3OT9A 4IH6A 3BF1A 2HQ3A 2Y8YA 4YOWA 2F9TA 2F4VF 1U8SA 1ASUA 4KBIA 3U6FA 3QMLA 3Q89A 1KAXA 2YKAA 2FGCA 2RPIA 4CZGA 2C2DA 3OXFA 3R3TA 4KV8A 2W2OP 4UT4A 4DR3F 3CIPA 1RAEB 3OHAA 4QR1A 1RCXB 1TL7B 2HLTA 1D8YA 3A8KA 2RMLA 4CYUA 1WC6A 4M5HA 3HRGA 2L48A 3LGMA 1Y11A 3C95A 1GMWA 2QKBA 4OJ1A 5KFJA 4LSZB 3ZT1A 4MLEA 3Q8QB 2M70A 1RT6B 1QZ5A 4W5TA 3NCIA 4HWIA 2BACA 4YR3A 4J9LA 1FX4A 2Y1LB 1TP7A 2EBGA 4KJIA 3DLGB 3SV3A 4C8NA 4FF3A 4HUGA 1LWXA 4YR2A 1QE1B 3DXSX 2O8FB 2GVDA 2OPRB 1UVJA 2OD4A 4OYBA 2XYHB 4ER8A 3CCJS 3WQTA 3OTDA 3SDEA 3K5NA 2UUCJ 4URGA 3H2UB 4MKVA 4ELTA 4GVBA 5BR8F 3UDEA 2JVRA 1R7IA 2DHXA 3G8QA 4Z2XA 3MX2A 2Q1NA 4LF4K 3C46A 4CEFA 1TK0A 5ETPA 4FZYA 1LWEB 2W7OA 5D3GA 3EGNA 4HH1A 4BRIA 4ZP9A 3G6EN 3AO5A 1S9EB 1P1LA 1DRZA 4DN9A 1R0AA 1NJIT 3RG6A 1PAUB 1NGHA 1VBKA 3P49B 4NLUA 5A6WA 1NJWA 8AT1B 2YX4A 3AHPA 4FZXC 5ITHA 1YBAA 3TZZA 3P45B 1NH8A 1GFWB 2ASMA 3TEHB 3KJFB 4A8OA 4KY3A 2V69A 3FCVA 1IBMJ 4C97A 1KLMA 3V5RA 4QU6A 2J4RA 1S0VA 1KTVA 2DNQA 2QA2A 3Q8PB 1ASWA 4CTAA 2JSXA 1UFWA 3A4TA 5DG8A 4FVCA 4YDUC 2UUWA 2CH6A 2Z8QA 4UZCA 1KNZA 4BDYA 1TR0A 5D0RA 3RRGA 1ZM2A 3C15B 1S1UB 4HCCA 2G8UA 2OSQA 3EVWA 3CB4A 2EXUA 3GILA 1NBWA 4DR4K 1JQGA 5E7OB 1HPMA 2UUBF 2HF4A 4RW6B 1SCJB 2N82B 1RA6A 2DCUB 5K20B 4GKJF 4UY8T 4CH0S 2JC0A 1FRKA 4ZCLA 4CO0A 5C2DA 1F0XA 1NDKA 2OPQB 4O4RA 5HQ8A 1OS5A 2IPOB 3DYAA 1X60A 4C3MA 2CH5A 2W2QP 4BWMA 3OSPA 3VF4A 2MGZB 4I6MB 4JI5J 3KMSA 3ZZ0A 2J9DA 2MDAA 2E6MA 2KXHA 1SKRA 4FYYB 1SL0A 1HNZJ 3PNIA 1X4FA 4JV2A 3QSIA 3PO4A 5EHHA 4B08A 1RWXB 2FTRA 2IYGA 1TK8A 2BV3A 2VPXB 3UE2A 2MKCA 4OV6A 4KKOA 2DR8A 1XERA 2HBKA 2F65A 5MLCQ 1KFDA 2VIHA 3H40A 7FDRA 4OQJA 3K9KA 5KT5A 3Q8RB 1QM9A 2BJ7A 5IT9U 5B8HA 3MEDA 5IC6B 1NOYA 3N6NA 1CJUB 4RWTA 2RB7A 2FC8A 3RAQA 3MUTP 1QTMA 4FJKA 3TA2A 3KLEB 3CJ4A 2K06A 3JB9k 3H1VX 4DR6K 3RTVA 3AAQA 2LECA 3UVJA 2PC6A 3DOLA 4ED6A 1HLWA 2HOEA 4F3MA 4U67Q 3KHLA 1IXKA 3OV7A 1K9MT 3JQMA 2R7RA 4J9OA 3NBPB 2J9EA 4ZP7A 4HYKA 4C8MA 3BB5A 4CLZA 3UW1A 5D77A 3NFAA 1UP1A 4ZHRA 3GIKA 1PYSB 5KQ8A 4EO6A 3JSMA 4CI0B 3DLJA 1SKUB 3OTCA 2K2PA 2YNIB 1S59A 2E5HA 4LIWA 1RE1B 4GMKA 4ED2A 3O3FA 4Q7AA 4K4VA 3AA5X 5ETTA 3DOMA 5B7WA 4R8UB 3MECB 4Z94A 1EWQA 1NJIO 3ASMA 4W4MA 1X1PA 3TJ9A 4RWXA 2QW9A 4O23A 4DV0F 2DHAA 3AB2B 1VQ8N 3GYXB 2UVRA 3DRXA 5A8WA 3PEHA 2I8EA 3M4XA 1UEUA 4Y28C 2RS2A 2DFHA 1JLEA 3V9SA 2QG9B 3W0LA 4B9QA 3UFCX 2E1AA 1RWNB 4DG1B 2MEWA 5F8NA 3T5JA 2MPUA 4YEAA 2XMWA 5FPMA 3HHEA 3VA3A 4YOUA 4MAKA 3JYTA 4CJ3A 1HBOB 2FVQA 4IEEA 2V9KA 3TZXA 3HI9A 4YQWA 5KFXA 2O3DA 5B09A 4Y0WA 1TKZA 3UIQA 4IUFA 3OYNA 1KKHA 3WZ0A 1UJ6A 2AGOA 1VSMA 4BC9A 1F5BA 5H9EJ 5M1FA 2GO9A 1SQEA 4DS5A 1BIZA 2KJVA 1GLAG 3ZT0A 1Y00A 4ZA1A 3ADAC 1C1CA 3IRXA 1GK8A 3GFHA 3HX9A 3VA0A 4QQBA 4QZVB 4ZKAA 4A2AA 4UQGA 3NCRA 3M2VA 2IDOA 3BS9A 5C7PA 2R2TA 3TJAA 4UY8O 3DRSB 2VPWB 5AT1B 5CYMA 3GFXA 4EBEA 3NY0A 2P9KB 2ZC4A 3D0IE 3J80Y 5JVHL 1FXDA 3PG9A 3PFOA 4EP4A 1VK0A 4CGHA 2VFSA 1OH5A 4C48A 5KFFA 3LPYA 5GIOA 5IXUA 1R8CA 3I96A 3QESA 2P8IA 3A5NC 4DR3K 2ZE2A 3AVBA 1T05B 5DJBA 1SIWB 2ASOA 4ERDA 1WHVA 5L46A 2WW4A 2GGPB 4DPTA 4LF6F 4C0HA 1NK0A 3QWUA 1RHUB 3VENA 1YAGA 4H4OB 2E1RA 4NLYA 4FN5A 1BMQB 2VU5A 1WHYA 4X64F 4ED5A 2HBMA 3OBIA 4ENOA 2RT3A 3QAUA 3OSNA 2Q2RA 2E1ZA 3H08A 3GIIA 4HH0A 1HNVA 4MK7A 4ECRA 3SPZA 1DAXA 4ITSA 3QRQA 2RAQA 4IFYB 1HQEA 4X65F 3NG8A 1WSVA 2IOCA 3GLJA 2UU9F 5EWEA 5AQQA 4E1NA 3T1YK 1FD2A 1C0UB 3NF6A 4J90A 2IJRA 4F36A 1U02A 3M32B 5J1PA 1QQNA 4O0IA 3OYCA 5J2QB 4FYXB 2P9LA 4P73A 3J7ZT 4B3OB 4CZMA 1R27B 1TVRB 5F1XA 1JXVA 4WFBL 3CCUS 4EZ6A 2OFHX 1KFSA 4P7TA 2VBYA 1FE4A 2BA9A 4OZ0A 4F4WA 3LP2B 1J5EJ 3D1OA 2XGPA 4QIEA 5EGYA 3NWRA 4A2BA 5A2QO 1OYEA 1HNIA 3GP9A 2JEFA 1YVUA 3RBDA 3F73A 2BUNA 3EKUA 4YOXA 3OUYA 3SJHA 1VSLA 5AQOA 4ALZA 5KFEA 4C0BA 1ZBTA 1HL6A 2GS8A 2DITA 3K59A 4ZLNA 1S76D 1V6HA 2LU2A 4Y2KA 2DR6A 3VGUA 2U2FA 1VRUA 1E6YB 5GMKa 2DNOA 4IYQA 2GELA 3AO3A 1X9MA 3LM2A 1FFGB 1UFKA 4FCYA 1QQOA 4JI7J 3P1GA 3A3OB 3TTDA 3T9NA 2AEMA 1P6TA 3DNCA 3R6MA 1H0HB 2F7TA 1YJ9S 4J9RA 3ZSZA 1HKCA 2NZ4A 3E8OA 3NGIA 3CCRS 3EE9A 2Y1JA 3QEWA 2WONB 4CJVA 4OPAA 3TVKA 3CCJN 4I6WA 4KHPF 4ED7A 4LF8F 3MXHP 4DX6A 3C16A 3TZWA 4I69A 5LXYA 4CEAA 2UUAJ 2G8WA 2JWKA 3IAYA 1JL1A 3MEEA 3M2RA 2W9CB 3V2UC 4HHUA 2GHPA 3RW7A 1J53A 4K4WA 1YI2S 3HF5A 1K8AT 1WDDA 1M90O 5GADU 2W25A 2B4VA 1YVFA 4ES3A 4ECUA 2XY5A 2DGXA 5D8HB 5LJWA 1IKYA 5GAHU 3PX4A 1NGJA 4LJMA 3KJQB 3GZ7A 4ZPVR 4IZ9A 3UDVA 4IRDA 1NK8A 2O8BA 1UVIA 3LAKA 3IN5A 4P6QA 3PUFA 1F5CA 2J9DE 5DDRC 3M8QB 2IVFB 3FE1A 1NHVA 2B9EA 2HVDA 3CEDA 4DSKA 2P5OA 2FC0A 3QT7A 3ET6B 1IBLK 4HDGA 4DCHA 2PEBA 3BKFA 1SC4B 1EKSA 2GFFA 2L9WA 5IV4A 1N34K 4CZLA 1NJZA 1KN6A 2D74B 3NS7B 3CIMA 4AFFA 1KVAA 1D9AA 1J54A 4CBUA 3S3NA 3SUOA 3TWHA 1UA1A 1TUVA 3SCJE 4O5FA 3A3NB 4F2RA 2FYXA 1S22A 3SPYA 2IVOA 4JEPA 1YJUA 1YK9A 2QRRA 2UYTA 3QZ8A 3GU0A 5CAAA 5G0RA 4FXWA 4EUVA 3OYDA 4BY9C 2MZJA 4NPOA 4OZ3A 3GJSB 4L73A 2IM2A 3BYPA 4DFPA 4H5WA 1A5XA 1RGVA 4JI8F 1EB0A 3I0SB 1VLOA 1GEHA 2I2YA 2C2NA 4N56A 5HANA 1TU0B 3IWNC 1C6VA 3J7ZO 1ROFA 3R1LA 2CKWA 1BIUA 2VQFK 2HS3A 1X5TA 2E9ZA 3SCIE 3U9DA 1VSEA 4O3RA 3VVTA 4PQUA 3FVYA 4NLSA 3HSJA 4EYIB 1KQGB 4DV5F 3UKUB 4IO9L 2R42A 5CR4A 4DV0K 1S1TA 1U1LA 5D6GA 4OZ1A 1UVNA 1SC3B 2OP5A 2VQEF 4NYZA 4YUDA 1EETA 2ZD1B 4E7LA 1IBCB 4JI0F 5KFMA 3OTOF 3MAAB 3PHEA 2JEGA 3CC2S 4C6AA 1NUEA 4I2PB 5BXIA 3CJKB 3KHGA 4ECXA 4GNIA 1KC8T 2BM0A 4L6V3 5AXMA 4FWNA 1FNOA 4YDXA 2R9LA 1CS4B 4UQTA 4USJC 4B1UB 4B9VA 3R7NB 3PSIA 2FLNA 4N8NA 4O44B 4Y65A 2J8AA 3H98A 3NOCA 2W2NP 5BPNA 1G2EA 4KH6A 2XQCA 2CUYA 2ZDOA 1YZ7A 2NS1B 4DLEA 2K1RA 3NCQA 3C6TA 2LQBA 1S97A 1K44A 3ITHB 5JICA 5KFOA 3WX4A 3LALA 1WSFA 3OYAA 4F3OA 3CJ5A 2WB1D 2N7CA 3P83D 2ITGA 1AZSA 2FHJA 1OH6A 3D2FA 3GV8B 3KNAA 2GHWA 1JL2A 3E9OA 5DQGA 3LDLA 2D0AA 1K8AO 3TW0A 4KB7A 2ZFHA 4HI1A 3CCLN 2HHUA 3BR8A 3H2VE 3HMJG 4U6PA 3V9XA 4JKGB 1U1KA 3DLBA 4JYAJ 4XPEA 1XIQA 3LP0A 1G7CB 2RSQA 2KKZA 1UAXA 2VG5B 3HO1A 4IDHA 4LF6K 1S72S 3PKYA 2QWNA 5J2MB 4CJEA 1X4EA 1B7YB 3EN9A 4Y1CA 2BBEA 4WFAL 1RABB 3U3YA 1N8RT 2W1BA 5CHCB 5AZJB 2BMBA 1RTHA 4DV1K 3W3SA 4OGCA 4USVA 4KAZA 4JKCA 1BQXA 4OYPA 1OH7A 2D1CA 4FVMA 4DPXA 1ZM9A 5AJ3F 1LKZA 3UCZP 2BKNA 1VQSA 4A47A 5LT5A 4OX9F 4X65K 5ETOA 3BPDA 3NS5A 3VQTA 2J7UA 4AL5A 3HP9A 2E6LA 2A18A 3BSNA 3AB4B 1LFWA 4XAKA 1ZPVA 4OX8A 2UU9K 3PRDA 5D0HA 1N36J 4NXMF 4BE2A 3WDOA 2MHNA 3R9LA 1KVIA 3R7BB 4C98A 4QBUA 4DR1F 5HJXA 2W6LA 4GMJB 1MDUB 4R79A 2GQCA 1JLCA 3G82A 2PY5A 2W7AA 4FXVA 5HMZA 2YNHA 5AXKA 2D41A 2XS7A 2YH1A 3I8DA 1ESVA 4FK0A 4ZIWA 2DNMA 4JI2F 2HBJA 3HM9A 1B0TA 2BRKA 3CJQA 1Q7LB 2OCEA 4DV4F 2EFVA 1NB2A 3PJXA 5DDOC 3LPTA 1LK7A 2Q79A 2PT0A 3G10A 2V8DA 5FLXY 1O51A 3SUQA 1NZ8A 5CHIA 3C8YA 3ZO7A 1FT8A 3G8TA 1UAWA 4AHRA 4O4GA 2V2QA 4IOCQ 3N4PA 2GVZA 3D2WA 2ZKTA 5IT0A 4QU7A 2ASDA 3PCOB 1YBUA 1FKOB 1UA0A 3GCWP 3OVSA 1ZZNA 4HDHA 2V2ZA 2C3UA 1QVFR 4OLAA 2WSEC 1VQKS 2VICA 4IOAL 3CDEA 5KOWA 2E7VA 2KG1A 3AQPA 2VA3A 1B7FA 2ZH3A 3A8EA 4DUYK 2RQMA 5E2QA 3D9BA 2D9OA 1NKEA 3E9LA 2ZUAA 4OKJA 2JZ5A 5A76A 1IJFB 2FXUA 4K8ZA 1KC8O 3CQXA 1ZXOA 4NYFA 4CJSA 1RTJA 1LK5A 1L3TA 2RDDA 3KLFA 4BWJA 1OVQA 2B43A 1S6QB 1RISA 5BYSA 2DPIA 3EGZA 4FWQA 4C8OA 3PIPQ 4KHPK 3R5GA 4LF8K 5ETVA 3V6DB 2OSRA 3WX8A 1BWFO 4G1QA 3QIPA 4ILLA 4JLHA 3ZSYA 3DMJB 4TYBA 1FRJA 2R7TA 1HBMA 5CYQB 4M5JA 4O8UA 2FBVA 3NGUA 4PXCA 3NKYA 2HEKA 3CCUN 2ZHOA 1H73A 3L2RA 2VGNA 2IA6A 1LXJA 2HURA 2CPIA 1RT5B 3TABA 3VAGA 1FDBA 1WOSA 3NF7A 4M63A 2KG0A 1H2VZ 3GYGA 4J9KA 5F9NA 2XYGB 4X66F 4QOTA 3MMCB 4CJUA 1X4HA 1DTTB 4N77A 1KS2A 4PG6A 2BDPA 2IIHA 5GADI 4KQZA 4L3KA 2A10A 1YVNA 2UXCF 1GLLO 3J81O 2C2EA 3EE3A 1JLBA 1U48A 2J7KA 4YOEA 5GAHI 3W65A 4RBVA 4RW4A 3QEVA 2WTUA 4JB8B 2LQ5A 3W2VA 5KPRA 1RLDA 2Q97A 4KV8B 3KJVA 2AJQA 1IJJA 3CSKA 1DEJA 3ZX0A 2O66A 2OEMA 1TKXA 4DR5J 4CYUB 2AP1A 4TY8A 4CESA 1N0VC 3CCRN 3KLIA 3LP3A 1OKJA 4OO1J 5BJRA 3M8ZA 5HN0A 2AMCB 1GTEA 2PDAA 4AHUA 1KR4A 3WEEA 1BA1A 3ZZOA 1VSHA 2G2OA 1M1KO 1L3SA 4KHMA 4J37A 4B3RJ 3M8YA 2HFZA 2AGPA 1OPIA 1YI2N 3T6BA 1RBLA 4DSLA 2D3O1 3O5BA 2GVDB 1ZTWA 2B7CB 3SQGA 2R7SA 3CF5Q 5KFZA 4YS2A 4ZP6A 2F9DA 4DBQA 3WXKA 5L1LA 3SDEB 3D3BJ 3J8AA 2ZGZA 1N5QA 2VASA 4MKYA 4GVBB 2WVEA 3EVMA 2EFQA 3UKRA 3QBCA 1E6VA 3G8SA 1T0TV 3SXLA 4EHUA 1WC1A 2A42A 2P6TA 4B3MF 5D3GB 5EXWA 3D28A 3RRKA 4B9LA 3MCMA 5GAHP 5A8RA 4JI6J 2WB4A 3U7JA 2CZ9A 1O13A 3ZX2A 5DG9A 3DCAA 1CJVA 4JI0K 3L95X 3CULA 2UXBJ 3OTOK 1KP6A 3VCDA 2KRBA 2XNQA 1Q16B 1QSSA 4DX8H 3BM7A 1EQMA 4K59A 3RAXA 4HTLA 5AQUA 1EQ0A 4Y2IA 1BHNA 4OGEA 3EKSA 2M9KA 1KLMB 4PG4A 4CLWA 4WFNL 4G9ZA 4CO5A 2V67A 4CTAB 1HNXF 2R2SA 4NLPA 3PX0A 3NL0A 2Z0GA 1ILYA 2OHDA 2L08A 2BYCA 2NYHA 1TUUA 3QAEA 4OZNA 2NZTA 4K5SA 2ZM6J 5KFVA 2YX7A 2GUIA 2XB2D 1LNQA 3K8VA 1NMEB 1RXOB 1VDHA 3D0PA 1BY9A 1U1MA 1URNA 5DM6Q 3G6YA 1WD6A 2HMIA 2NRXA 3AODA 3LGHA 1JJ2M 4TKTA 2HS4A 2MLYA 3LAMA 1T94A 5M1NA 4YHHK 2VH7A 4CZHA 2ZJRL 5IWAJ 2DY1A 2MKIA 2HKEA 1QAYA 2M0GB 3DYAB 2MZ1A 3DLLL 4J7CA 4OHVA 3QBXA 3EXYA 2E5LK 1N5VA 5AQKA 3CD7A 4EFAC 4ZPDA 2JJ4D 2AQ4A 4DV2J 2NXUA 3KD1E 4DV7F 3B4MA 2HFVA 3A5MC 1Q8IA 5K9FA 3CC2N 3IDHA 1VHFA 3K8WA 4FYDA 1NGFA 2RNEA 1T7PA 3P3DA 3MOJB 4G1IA 2IM3A 1U26A 4TU7A 3THTA 3PFEA 9RUBA 1F2GA 2CQ0A 2N3OA 2ZHBA 4NA1A 3BYRA 3AVFA 5AJ3K 2X3DA 5AQLA 4RO0A 5T14A 3KHHA 4JI3K 2GCFA 2F3JA 3MEDB 1BCOA 2VWJA 1S1WA 2KI2A 3RB0A 3UD5A 4NXMK 4IO8A 4TN2A 2GJIA 5M1OA 2F8HA 2QMUB 1KQSR 3QWPA 3MMJA 2MB0B 2OUGA 3UVJB 3VESA 3DOLB 2VB6A 1XMQF 4CIFA 2E1PA 4E8UA 4DL6A 4I1TA 1JKHA 3QGPA 3KLVA 1VCTA 2CNNB 4J9SA 3HOTA 5KT6A 3O2IA 4FBUA 3MR7A 2Z2MA 3SAHA 2XMVA 1H7WA 1F21A 3OBWA 2JWNA 1XI1A 5HL7Q 4FWOA 1B70B 2GX9A 4GV6A 3DM2A 4ZHRB 3OYBA 2PMHA 4FJLA 1HW9A 4G3IA 1PGZA 3QATA 2M2BA 3P5BP 3V9UA 2E2OA 5FD1A 1MNEA 2QTWA 4OZ2A 3MXMA 1S72N 4ZDNA 4J2BA 5C5JA 1TAQA 3D4JA 2E1CA 2DJWA 1QQMA 3U8XA 2DT9A 2L3MA 2DGWA 4UOHA 3TNVA 2P9PA 4MDBA 1SH0A 5DG7A 1O0PA 1KWMA 4M8LA 4FWSA 4ZCKA 5A8WB 2G0CA 5IM0B 3BY5A 2C28A 1UFLA 2FPHX 2VFRA 4NWBA 1OY9A 2YHAA 2YNGA 1JLEB 3ENHA 1HKBA 2LKZA 1FKPA 2VC1A 3OYLA 1NGIA 4JD2A 2XLIA 2XLJA 3VGMA 2FJWA 3UO0A 1M1GA 1WNEA 3BGUA 3G0ZA 2XY7A 3JYTB 4DL4A 3D67A 4KGZB 1NSAA 1Z1ZA 2HQCA 3N79A 4PPZA 3GONA 4OJHA 1TKZB 2CQGA 1S0OA 5BRDA 4HKQA 1VJWA 3TTCA 3RBEA 4N8OA 1U2FA 1R31A 3M1FA 4EBDA 1KVKA 4ZVTB 1RSCA 2PSZA 2ABYA 2GJ2A 1LWFA 1NGEA 3VTHA 1U04A 1C1CB 4TU8A 3M9NB 3ISNC 3IRXB 4ZVEA 3VAJA 3M2VB 4LF4J 2KZZA 2ZWHA 1LCUA 1EHWA 3AVIA 2ACYA 2CAJA 3QGGA 5B0FA 1N33K 5CYMB 5KT3A 3CQ8A 1G99A 2K7KA 1QQCA 1HYVA 1GLFO 2BW7A 4WWSA 4EZ9A 4TU9A 3M2UA 4QWCA 4TY9A 4PYDA 2V34A 2MLXA 2IVYA 4PG7A 1T11A 3EICA 2I6WA 2Z57B 1VQKN 1BG3A 5F8HA 1P1TA 3G96A 2D0BA 2B6AA 3H4BA 2FBYA 5A8KB 2XZTB 1WORA 4GY2B 4E3SA 5AQVA 1S1XA 2ZE2B 4Q43A 3I56N 4RX6A 2CWKA 2Z1IA 4FJNA 4I6AA 1X0FA 1HNWK 8ATCB 1SQFA 1WBDA 1FW6A 4YN3B 4CF8A 2YY3A 3WC0A 1P90A 1NU4A 5DRKA 1U1OA 2WHOA 2C3MA 1SJ1A 3AOCA 1HNVB 3ZYYX 2CNLB 3CFRA 4J9MA 1X4BA 4JKDA 2Y1RI 3N28A 5E3QA 3AD8C 4P10A 1HQEB 5A2QY 3HLUA 4F2SA 4DR4J 4X4NA 1PC5A 1FCAA 5EOYA 1D1UA 1QUPA 2RRAA 3R5DA 2HBQB 4DTMA 1IVZA 2FVCA 4K7QA 1FF2A 2D0PA 3OL9A 3FSYA 3WQUA 4WPAA 3OL6A 3B82A 5FLXU 4WF9Q 3W62A 1Y9OA 3QNWB 1V5VA 3QIOA 2LVWA 3KG4A 3TUZC 4BRNA 3G6XA 2EFNA 2IRYA 4B3MK 3Q8VA 3AT1B 3N01A 3GV5B 1VBXA 3WQPA 5JMNA 1QJHA 1HNIB 4GVMA 3BBFA 4K41A 4DDFA 2CJKA 3OUYB 2Q0RA 1XUPO 4N76A 3GYNA 3SQ2A 2VCPA 3T5HA 3L4BC 3V1RA 2EFOA 2ETJA 4GKKF 2V52B 1WTFA 4YORA 2IRXA 2MKKA 5BYRA 4DQRA 3AVJA 1KXPA 3ISND 2HZAA 1VRUB 5JS2A 3VQ8A 2BQUA 2R8JA 5KI6A 3IM8A 3GIJA 2EBEA 2R8GA 3OYGA 3M3ZA 3UNGC 4A8SA 2L9NA 3VEVA 1Y10A 1HNXK 4C3KA 2G8KA 4NO7A 5KG6A 5DZ6A 1XQIA 1V9OA 3NNCA 3M6XA 1S49A 3QNNA 5BPLA 3FZKA 2DCLA 3CJ2A 4DR6J 2GMLA 2VKRA 3IWXA 2WOMA 2VD3A 1T9XA 2Q43A 1W0HA 4O0NA 2NUUG 2K3KA 4NLDA 5CH7B 3KKSA 1MWZA 1UWAA 3SEOA 3ZSVA 3Q86A 3IXQA 4NLCA 5HLFA 2W6KA 2FVPA 2DGQA 3RMDA 3C16B 4YDDB 3MEEB 2YV0X 4OKEA 2DNYA 5LMNK 3BZKA 2YWHA 4IEIA 1TKTA 4ZOSA 2W24A 4M5IA 4CFAA 3L7PA 4TQRA 4FKYA 1ULRA 4IOAQ 5I3UA 4DU8A 2MQLA 5L9XA 1X4AA 4JP8A 1Q8BA 1Q8KA 3CPEA 3D6TB 2ALZA 4MQ3A 1WSIA 1IKYB 5HP1A 5EY4A 3SMSA 1NK4A 3LF0A 2ATCB 5CY4A 4KO0A 3S6EA 4LRCA 3Q7CA 2O8BB 3PKMA 3KLEA 5ETKA 5LMUF 2CA9A 2DFFA 1ASVA 4CNZA 1RWOB 3P4UB 3O9TA 1DZ5A 4IG3A 2ZJPL 3UN3A 2W4CA 1B0PA 2ZHAA 5IC4B 2GA7A 3ZSQA 1U0SA 1NEEA 4FBTA 1WKKA 3HFVA 1X4GA 1RKIA 3LWLA 3VF2A 3US5A 1ZS6A 2FHJD 1CZAN 1VAZA 1DJ0A 3WC2A 1V3RA 4G1PA 1Q81T 2M8DB 3SQ4A 5CZ1A 4PXBA 1C0GA 4P2SA 4ES1A 3ENAA 3H20A 1Y3KA 4QWAA 1XMQK 3RU0A 1Q5YA 2CJ9A 3R2CJ 1UW4A 3TPQA 1JJCB 4BRKA 3QGIA 4I2QA 4KH0B 4CZCA 4J9PA 1WEXA 3HZGA 1H1VA 2I7NA 4IR1A 1FFWB 3SI6A 4DN0A 1T02A 3SAFA 3O1LA 4MK9A 3R5CA 4PKIA 4R8UA 1UWBA 4FLZA 1BL3A 2VG6A 1YJNS 3ZSOA 3TEGA 4QIFA 1R8PA 1SC6A 1SJFA 2RH3A 1NGDA 4M3TA 3OVBA 1V4SA 3UCGA 4YY3F 4LF1A 3VQ4A 3Q2TC 3M8WA 1H38A 4RUAA 2EWSA 4A8XA 1GXUA 4K8RA 4DG1A 2XI2A 4BG9A 1S57A 4PQUB 4RUCA 1A9NB 1Y64A 2H48B 3LQVA 1HBUA 4M7XA 4Q0BA 3WHIA 5C2FA 2RIJA 4P2FA 1E4FT 4DR3J 4MYTA 1S1TB 3NF8A 1RT7A 3GR0A 1QHTA 1HR0K 1SQKA 4XO0A 1KD1O 3W8GA 1EETB 3K0SA 2KW4A 3OA9A 1FNXH 4V19J 2FF3B 4M5KA 4DL0C 2DEJA 3PEJA 3G6VA 2HQDA 4FOIA 4U7BA 3FC9A 2Y8WA 3KUGA 1VQ7N 5E33A 2P9SA 1MROA 2HHSA 3IGNA 4UZBA 3CTRA 3FRYA 3THXA 1YRTA 1VOMA 1K1QA 4LQ9A 5F9LA 3BF3A 1Z4UA 4JN4A 1DQ9A 5KFLA 5C10A 1BXNA 4O5BA 3T1YJ 1G15A 1M0SA 3ICLA 5F8LA 4HI2A 2YBVA 3VEYA 2UVUA 3ZSWA 5LJ5Y 2A3JA 2DGSA 3I4HX 3NEKA 2QA1A 5BR8J 2E5GA 1SKSA 4N7TA 3C6TB 4Y1DA 1Z2LA 5ETRA 5C15A 2J6SA 3MM6A 2ROGA 1AZSB 4CJTA 1MA9B 3D2FB 3NGSA 5B0CA 5IZHA 4ZPCA 2MQNA 2XMUA 2BKPA 2CQDA 1ZAXA 4YDUA 1S9GA 5AQPA 5GIPA 2H4YB 3MR3A 4JI5F 2JLFA 3KNGA 2LA4A 3LP0B 4FLVA 4LF5F 3AVHA 2NCKL 4CZIA 2FHKA 3H0PA 4YMEA 2HSTA 3TSUA 4DOZA 2CQPA 1SJ3P 1YHQS 3Q23A 2C2ZB 1BC6A 3CD6S 3MEGA 3HKZD 5TKWA 2J0QD 5LY3A 1RTHB 5CCMA 2QL9B 2F9WA 3CJSA 3MWPA 2X3GA 2HVEA 4CLFA 3KWMA 1XMOF 3W5YA 2BM1A 4EAHD 4M3RA 2WSFC 4ED4A 1GLBG 3O5TB 4W92B 1RA7A 2P6SA 4LFBF 3THYA 2QK9A 3DOKA 2IIRA 1K73O 4F4YA 2KM8C 2QLWA 3EM1A 2A6MA 3CQYA 3O6WA 4ZTFA 4HACA 2IC3A 1XHZA 4MKBA 1K0TA 5SWMA 2BX6A 4I0WA 4CZJA 3G82B 1JLCB 4X4SA 3EL2A 2PYJA 3BQ2A 2YNHB 2VBXA 5B0GA 6AT1B 2XHBA 4ED3A 3IBFB 3FBCA 3MCAB 1UEVA 2CXEA 5AQZA 4I9QA 1SV5A 1TV6A 2ZBIA 5B0DA 3SAGA 4YB7A 4MJKA 1WSGA 1NZAA 1VQMS 4BRGA 5T7LA 3KDOA 3OXLA 3PM9A 1VR6A 1JCFA 2NLWA 4RBTA 4K0KK 1IG8A 2UV8A 4XH1A 4HLBA 2DR5A 1HWJA 2XMJA 1GOCA 2KT3A 3LM9A 4O4GB 2FUG9 2O4GA 2CQ2A 2GVZB 4CEOA 4GKKK 3QICA 1ZC6A 4CI6A 2OPSA 2KZMA 4BC3A 1TZ0A 3KUHA 3PX6A 3TARA 3QT8A 3AA4A 4CEBA 3R7SB 3K0JA 2BJ3A 4NCAA 3NMAA 2I5JA 4ZCMA 4AD6A 1T95A 2GV9A 1IBLJ 3VQ9A 3BZCA 2SXLA 2FZCB 1W26A 4DR7K 2DXDA 3HD1A 4BDPA 1N34J 2ASJA 3V6HA 4CGGA 2V94A 4MIBA 3R2DJ 4DCJB 4J2EA 3CFPA 4PCQA 2DXEA 1U47A 5IT4A 2DNHA 4DZ6A 4KREA 2FJDB 4M45A 1NDPA 4U8VA 3MF5A 4WQ4C 2N7YA 3HVTA 2O01C 1VSKA 2CADA 1RTJB 5JS1A 3FZHA 3KLFB 2R7VA 2CQ1A 4DL3A 2EW9A 4DTNA 1B92A 2CQHA 1U24A 3PIOQ 1WC3A 1FJCA 4G1QB 3QIPB 3OR2A 3L2VA 1G4CA 3IGVA 1HBMB 3W5XA 4BRPA 4CM0A 2OJ3A 4JK9A 4FNHA 4CDIA 2MY8A 1VQ6S 4RLEA 5AQNA 3BN4A 2D1KA 4RU9A 5CYJA 3BUZB 2ZH5A 2XBPA 3GL1A 3A5OC 2C2RA 1C0FA 1IKWA 2Z30B 3ZFVA 2VQFJ 3WXLA 4ILHA 1BOTO 4CJQA 1VC5A 3KMQA 2BRLA 1YJRA 1IQTA 2JX2A 2EWHA 4CHPA 5T41A 3OJUA 5KAKA 4DV0J 3NNAA 2C2OB 1YWXA 4KRFA 3BEGB 3CERA 2JRSA 3IG1A 4FS2A 5JXSA 2M5YA 3VAFA 2LQ9A 2Y3YA 5I3QA 5DLFA 1JLBB 5F8GA 2XMMA 4C0OC 4U95A 5GAGP 4RW4B 3R5BA 5IT9Y 2PIIA 4AHVA 4PHTX 4H5RA 2GX8A 4BE1A 2DRBA 4MLHA 1NG9A 3KJVB 1QAXA 2ZDPA 3CJ3A 3BREA 2A2DA 2OZMA 1XR5A 3I4PA 2C1EB 3Q0AA 1T3OA 4L76A 2C3PA 2OTJS 1TKXB 3HCXA 3HULA 2RD5C 1YKWA 2RU9A 4TY8B 1NKBA 4LF9F 1N32F 3KLIB 1N6QA 2BW2A 3IBCB 1D8ZA 2EFGA 3H5UA 3VAHA 4F4KA 4WK3A 3OVNA 1TUGB 4I9LA 2F8SA 2A41A 2BEFA 4FYWB 3MUMP 4CP5A 2I7PA 4UUXA 1QS4A 3HD2A 1HI0P 1OWXA 3AD7C 4LFCF 3SSRA 1WUAA 1S10A 4IOXA 3OR1A 1AA1B 2G1DA 1Q95G 4I6YA 4EU0A 3H59A 3SQGB 4U8YA 3CD0A 2AT1B 4YY3K 5H1SV 4BQLA 3A8JA 2WSCC 3MM9A 3MAAA 4OJGA 3UKRB 3W8PA 1Q78A 4DQ8A 1JCEA 1E6VB 2PFUA 2CWXA 2FVSA 3PZPA 4I2PA 4WK1A 4HUEA 4CJPA 1RGIA 7AT1B 1VRQC 1K8KA 3L2UA 4ZMMA 1CS4A 2W9BA 2HK3A 5A8RB 3RVCA 4DFMA 4H54A 2PE8A 4NASA 2GUPA 4J9UE 1WELA 4LF6J 1OSDA 2W2MP 2WAQD 3CDWA 1CJVB 2QA4G 2PA3A 1W2BR 4KH4A 5DLGA 2XCAA 1WG4A 3I33A 3KHRA 2QN6B 3MHYA 4YNQA 4DV1J 2LEAA 1F3VA 3CDUA 3AA8A 1BQMA 2A0FB 2BKOA 2XM3A 3QIDA 3ITHA 4GVLA 3QFHA 2CDQA 2CQCA 2MMYA 1WG1A 4X65J 2KLAA 1FTRA 4NYPA 4EK2A 5F0XA 4XH4A 2BE9B 4NZ0A 2W41A 1NGAA 2UU9J 1Q8LA 1WLJA 3GIRA 4H4MB 4EBCA 2HYIB 2OMLA 1WKLA 4HUFA 2LP4A 2IVNA 3D0HE 4QIVA 1TL4A 1NSPA 3K2PA 1N5YA 1YJNN 3M8SA 1B99A 2R8IA 3C94A 2ZWPA 1FERA 2QWQA 1FJGK 2HMIB 5DM7L 3FZMA 1S7HA 4PL7A 1RJJA 2QL5B 3E3XA 2D5RA 4CO4A 1FJEB 4PL8A 3GE9A 3CJAA 2MZSA 5GAEU 5CZXA 3CYMA 1OIAA 3R6GB 2HGMA 2M7SA 5AZJA 4M95A 2FY1A 3R1XA 2NXEA 5L1KA 2ZBRA 9ATCB 2AIRB 2VF3A 2XMKA 3IRWP 1GQEA 5LSLA 3L4QA 4LF5K 4LC9B 2ZKUA 4ECYA 1IN0A