4KO0A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with an anilinylpyrimidine derivative (jlj-135)
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
556
structure length
555
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 159
structure length 555
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4ko0A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ko0A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ko0A05
2BANB 2P5GA 4Z4FA 3RRHA 1QSSA 1WSJA 4N47A 4FW2A 4ED0A 4CFCA 2B5JB 3OHAA 4N76A 3KK1B 2UVVA 4Y1DA 1RDAA 1RT5A 1N5YA 4ED8A 5FRNA 3V9WA 3OYHA 2W42A 1RT3A 4CEZA 4M3XA 3PR5B 4EP5A 3DRPB 4IG3B 3M8QB 1KHVA 3VQ6A 1G15A 2Z1GA 2RKIA 3LDSA 3MEGA 2ASDA 1YTUA 2WONA 3CJ0A 2C22A 4CJ5A 2OPRA 2PZSA 4Z4GA 4MK8A 5KT3A 4KHQA 2AGOA 3SUQA 3T1AA 3EZUA 3NGDA 4E89A 3UQSA 3I0RA 3KK1A 1C1BB 1WSEA 4J2BA 3NAEA 3DOLB 3N6MA 4FJ8A 5KT6A 1WNEA 1FKPA 2W7PA 2R2RA 4CE9A 3O3HA 2FC0A 3AO2A 3OJUA 1VK0A 2FJVA 4ZPBA 5C42B 2C2EA 1T05A 3V1RA 4TXSA 4URGA 4BWMA 1T94A 3MXJA 2W8KA 3KLIA 4YNQA 2FBTA 4EBCA 1D9FA 4ICLB 4LSNB 1S10A 1QUVA 3RBEA 3QETA 4GC6A 3KLEA 4GC7A 1XWLA 3F73A 3VQ7A 4DTPA 3M9MB 4JRPA 4DF8A 5EWFA 4OJRA 3SQ4A 1QTMA 3QNNA 1FKOB 3TQ1A 2XRIA 2PYLA 2HHXA 1JXBA 3BQ2A 3ZT0A 1LWEB 4CCHA 4FJGA 3VQPA 3ZT3A 4YMEA 3TAFA 4DSEA 4LSNA 3GQCA 2BQUA 5HROA 2AQ4A 3C94A 4PWDA 4KV8B 4ID1A 4TQSA 2ASLA 4LSLA 4URQU 4FJIA 3TI0A 4MH8A 3DMJB 1T03A 3VQ5A 4FLWA 3HO1A 4MKBA 3ICLA 2IAJA 4F4YA 5J2PA 5C25A 2D3UA 2HNDB 3IG1A 1IKYA 3OL6A 1HJRA 3MXMA 3OYIA 3H59A 3O3GA 4M42A 4PWDB 4KHMA 1D1UA 1HPZB 2RKIB 1S5JA 4TSXA 1UA0A 2KZZA 3G86A 5T14A 3SUOA 4CJWA 5D3GA 2FBVA 3IS9A 3BSCA 4IH6A 2E6LA 3DI6B 4RW6B 3IGNA 3MF5A 1W9HA 4DLGA 1REVB 4YR0A 1RTDA 1I39A 4MKAA 3L8BA 5L1JA 3Q8QB 4DTSA 3AVFA 1Z26A 4JLHA 2AU0A 5KFNA 3QERA 4M94A 1K1SA 3OS2A 4F2RA 3I5BA 1TKXA 1IKVB 1QAJA 3EY1A 1T05B 3ZSWA 4NZ0A 5KFWA 3AA2A 3LP1B 3TABA 4WFXA 1NKEA 3NF6A 1QE1B 4EYHB 1Z25A 3CVKA 1S48A 4BDYA 2GBZA 4Q5VA 2AGQA 1S4FA 2XI2A 3KK2B 1S6QA 2YNFA 2CJQA 1GX5A 5DGBA 2UUWA 4JUZA 2IDOA 1TVRB 4H4OA 4Q0BA 4RUAA 2HMIA 4NCBA 3Q8RB 4QW8A 4CJRA 3AA3A 3OVNA 1RBVA 4Y34A 1RTJB 5J2NB 2HW3A 1NJZA 1UWBA 3DOKA 1GX6A 3AVLA 3NBPB 1RBRA 1XR6A 4E7KA 3BREA 3D5MA 5EU7A 2FLPA 2A1RA 4CHYA 3JYTB 5DG7A 1DTTA 4FLTA 3K5OA 4WFYA 2ZD1B 5KFJA 3AVAA 4NYFA 4HUGA 3MR2A 3HP9A 3B6PA 3H5YA 5HP1B 4U7CA 3HK2A 1KSPA 3NF9A 1RT1A 2V0NA 2HNZB 3CJ4A 2XY7A 3QLHB 4DQQA 4H8KA 4MK9A 4EBEA 3C6TA 4K4UA 2XGQA 3RTVA 2Y1JA 4B3OA 5KFOA 3DYAB 4PUOB 2IMWP 4CK3A 2YHAA 2BE2A 1JLFA 4QAGA 4MIBA 2HMIB 4ZP9A 5KT5A 3SCXA 4FM0A 3FQLA 4HKQA 1WSFA 1S1UA 4DG1B 5EWEA 4KBIA 2BDPA 3V4IB 1SL1A 3KLIB 3OY9A 3C6UB 1N48A 4XPCA 4ICLA 4PQUA 3IRXB 4KKOA 1QS4A 3TAMB 4EBDA 1HQUB 1U09A 4CK2A 4F50A 4IFYA 1W25A 2BE2B 1CXUA 4PUOA 1BQMA 2P1JA 3OYDA 2R8JA 1S9GA 2XY6A 4IFVA 3RB6A 4O4RA 4J9NA 2IA6A 3FSIA 3OLAA 2WK4A 2DFEA 4U6PA 3V1OA 4TYBA 5KFIA 1TK8A 2R8GA 4CK1A 4DSFA 1KVCA 3VN5A 2OPRB 4BDZA 4CJFA 4PQUB 3G6YA 3H5UA 2VWKA 4E3SA 3KLGA 3SFUA 1LW2A 4E19A 3QEIA 1JX4A 1X1PA 2FBXA 5J2NA 1JLEB 3AVIA 2LSNA 2YKMA 2NUBA 4IH7A 4NYNA 1U49A 4B08A 2F96A 1SKSA 2VG7A 3DI6A 4CJEA 4QOZB 1HQEB 4K4XA 1N6QB 2HAIA 3EPGA 3VQEA 4E1NA 1S97A 1RDDA 4O3NA 1FK9A 4WXWA 3G10A 4WZMA 2AJQA 5HRRA 1KFSA 4I2QB 5CZ1A 4DL2A 2V4RA 1JLCA 2IS3A 1O1WA 2Z1IA 3IN5A 3KHRA 2D5RA 3UDLA 4EO6A 2YNGA 1FXXA 3ISNC 2RF2B 1C6VA 3CFRA 4K50A 4DFKA 4CF2A 3PW4A 3AO3A 3QO9A 3ZSVA 1HNIA 3K57A 4CGDA 3IAYA 4EP4A 3Q8SB 1NK6A 4C8KA 4NLXA 2HWHA 3VQAA 4CEAA 3AA4A 3VQ4A 1J53A 3DDKA 2OPSB 3DLGA 3ZSQA 5KGXA 2VG5A 1KFDA 3QIPB 3SI8A 5I3UB 4R8UB 1BI4B 2Z1JA 4Z4CA 3MEDB 4Y2CA 1SKRA 2XC9A 2OH2A 4LH4A 1JXLA 3PW0A 1NK8A 1A5VA 3OL9A 4GVMA 1S1VB 2HHWA 5KFUA 5KG7A 5KI6A 1T3NA 2XHBA 1RT6B 4HUFA 5F9LA 4Q45A 5KFQA 1UOCA 1TK0A 1ASWA 3JSMA 3H98A 1IKYB 5F8MA 2DPIA 1IKXB 3FRZA 3GIKA 4ED3A 1MMLA 1HYZA 4I9LA 4NLTA 4ECYA 4ZTJA 3LALA 5EWGA 3V6KA 4DQPA 4OPKA 2W9CB 2D0BA 4ZP7A 1Y97A 1C1CB 1S1VA 3ZSXA 1DTTB 3QEXA 4F4ZA 1X9SA 2W7OA 3OYLA 1JLQA 2XY5A 5HLFB 1TL1A 3H5XA 2OZMA 2OPSA 5CY4A 4CIGA 2UVRA 3NH0A 4CGFA 5J2MA 2OPPB 3TARA 3F9KA 3MEDA 5KGWA 4NCGB 2B43A 4CECA 4Y3CA 2DPJA 3HL8A 4ZHRA 1RYSA 1YVUA 4K8XA 2W8LA 1NK0A 4OKKA 2YNFB 3L3VA 3UR0A 4DEZA 3T5HA 1KLMB 4IG0B 1RTIA 4RNMA 2W9CA 1SV5B 1TKXB 4FM2A 2VA3A 4RUCA 1LAVA 5DGAA 4OPJA 3M9OB 5DG9A 4K4YA 4URSA 3HPGA 3L2WA 3TAQA 3TANA 2E9ZA 4W5QA 1K6YA 1KLNA 1CXQA 4F3OA 4ECTA 3KKSA 3SV4A 5C42A 3ZT2A 1S9GB 1QHTA 1N56A 5HBMB 1Q9XA 4FM1A 3OYEA 2ILYA 1S49A 4ZPAA 2KQ2A 4DTMA 1KHWA 3KLHA 3DM2A 1BL3A 1UAXA 1L3TA 4ELVA 4LQ9A 4O3OA 4K4WA 3QGHA 5KT2A 3DOKB 4KE5A 1LWFA 4CGHA 2HNYB 5L9XA 3CJ5A 4MIAA 3MECB 1REVA 4J9OA 3OYBA 2JEJA 1RTIB 2ZE2B 2E9TA 4K4TA 4QWDA 4RW7B 2I5JB 1Z4UA 1D0EA 1XHXA 1ZBFA 3GILA 2FVQA 5KTQA 3KNAA 1C0MA 4R5PA 4AHRA 1BCOA 1NJXA 3KLGB 5I42A 1JLFB 4WE1B 4DLEA 3TAGA 3AVGA 2ILZA 5KFAA 1S0OA 2VA2A 1SL2A 3PY8A 3MEEA 2ITGA 3ZSRA 1TV6A 3CJ3A 3K5MA 1EETB 3C95A 4QPXA 4O44B 1QSYA 3KK3B 4AHCA 3H5SA 4CJVA 3RMCA 2YNHB 4DSJA 2IJNA 5F9NA 4B8CA 5C25B 4J9KA 1TGOA 5J2PB 3AO1A 4Y1CA 2KW4A 3AO4A 4QCLA 2A1SA 3V9ZA 1TK5A 1KVBA 5KFEA 4LY7A 4JRQA 4NLQA 3PO4A 1JKHB 1HQUA 3KIOA 4DL4A 2GIQA 3QGIA 4MFBA 5J2QB 5T7BA 4R5PB 2ZQBA 3QEWA 2UUTA 1TKZB 4DTNA 3NGYA 3PUFA 1NKBA 5FRMA 3HVTB 3S3MA 3NL0A 3NH2A 5KFKA 1S9EA 4DTJA 4LD0A 4ZPDA 4FK2A 5KFFA 1L5UA 1NKCA 1ASUA 3P83D 4Z0UA 4R0EA 3QZ8A 4J9QA 3O4NA 1EX4A 4DTUA 1SH0A 3KLHB 1I3AA 4RZRA 3HXMA 1RDBA 2IM1A 1S1XA 2RDIA 4NLRA 1ZBIA 4FJHA 5E41A 4ED1A 3AVJA 3PW7A 4M41A 3HP6A 3GV8B 3U3GA 1RT6A 1C0TA 4HCCA 3VQDA 5F8LA 5KFLA 2QV6A 4J2AA 3M8PB 3MR6A 4H4OB 4TYAA 3E01B 4Q0BB 3V6DA 2WOMB 1EKEA 4B9SA 1LWCB 3MR3A 1LV5A 3NGZA 3KTQA 4IOBA 4QWCA 4KRFA 3PX6A 3IG1B 5HRPA 1HNVA 4QW9A 2IC3B 1S6PA 1RAJA 1RT1B 5KG0A 2YNIA 3HPHA 3HSTB 4DS4A 4ELUA 4YR3A 5F8JA 3OYNA 1U45A 4G1QA 2BQRA 3N6LA 3WNHA 4IG0A 1RT7A 3ISND 3PW2A 2C28A 4OKEA 1S1WA 2BANA 3OYGA 3V81B 2D3ZA 5SWMA 1HNVB 3I5AA 3BGRB 3CYMA 1RT2A 1LWCA 2YV0X 4FJ5A 3AVMA 2GC8A 4C8NA 3AV9A 3GYNA 2FVPA 2X6NA 2EX3A 4ZTFA 1BI4A 3VQBA 1VSKA 4OLAA 3MFHA 4YP3A 3RBDA 3NF7A 3MECA 2D41A 1SH2A 4CHOA 2HNYA 1S1UB 3S3NA 1HYSA 1ZBHA 4FK4A 1B92A 3KLVA 2O4GA 5K14B 4TY9A 4TQRA 1SUQA 4KTZA 1BQMB 4OLBA 3VQCA 1C1CA 4E1MA 1JLAA 3OYMA 4RNHA 4L8RB 3ZCMA 4O44A 1U4BA 2R8HA 1BQNB 1EP4B 3PJXA 3K5NA 3MEEB 1RT4B 1KTQA 5F8IA 3DLKA 3RB3A 4ZVEA 2JEGA 1L3SA 4F8RA 5HP1A 3NHGA 4KHSA 1CZ9A 5K14A 3ASMA 4O4GA 3OYKA 3LP2A 2BRLA 2G8KA 1RNHA 1ITGA 3V6DB 2KFZA 1LW0A 4ZHRB 1WAFA 3SQ1A 3P1GA 3KLFB 3SJJA 3CWJA 4O55A 2Y1IA 4WZQA 1JXEA 2O4IA 3SFGA 3AVCA 2B5JA 2HHSA 4FXDA 4N56A 3SPZA 1CZBA 3RAXA 1TAUA 1JLAB 3GIIA 3DRSB 2DFFA 3Q8PB 5DG8A 5KT7A 3BSOA 2HHUA 4KV8A 1NOZA 3CM6A 4K4SA 1IKWB 5KFYA 4BWJA 1U47A 5CYMA 4Q43A 3LWLA 3VA0A 1IM4A 2V9WA 3CDEA 4NCAA 3IRXA 4ECRA 4OKJA 3OL8A 2FBYA 5L1LA 1C1BA 1MU2B 4DQSA 4RW4B 4AHUA 4Y2AA 4FBUA 4DFPA 1VRTA 4FYDA 4M95A 2IM0A 3FFIB 3OHBA 4CGGA 4KB0A 2IJFA 4YFUA 1L3UA 3P5JA 4I2PA 1KCFA 3I0RB 3IGVA 2J6TA 3M8RA 2C2DA 4CFAA 4M3UA 4BDPA 2KFNA 1W0HA 3BSNA 4ZVGA 4DTOA 4FZXC 4NRTA 4J9RA 3KOAA 4CEQA 4IR9A 3NCIA 4FS2A 3VA3A 2B6AA 3THVA 4ECUA 2XWYA 3H08A 4ECSA 3KMQA 2W9BB 3CJ2A 3AVKA 1YVFA 1IKWA 2YNHA 5KFRA 1L3VA 4M3RA 3RR7A 3ITHB 3LZJA 1YT3A 2YKNB 4OGEA 1NHUA 1LWEA 5FDLB 2X78A 2VWJA 1VRUA 4XPEA 3HVRA 5CZ2A 5KFZA 4X2BA 2AWZA 4FCYA 1VSHA 3ZT4A 3HVTA 3KLFA 1C2PA 3TVKA 3RRGA 3BSAA 3RMAA 1XR7A 5DQHA 3AA5X 1UWBB 3L2UA 2OPQA 1RT2B 2I1RA 3U6FA 3KJVB 1B9FA 1WSGA 3RMDA 5KFDA 1C0TB 2UVUA 1JLQB 4Z4HA 5HRNA 1JLCB 3VQSA 5DQGA 1EETA 2IOCA 2JLEA 4HCBA 3LP0A 3KKRA 3H2LA 4CJ4A 2RF2A 4C8MA 3CO9A 1NHVA 4CESA 1GOAA 4O5BA 3K59A 4Z4IA 3SV3A 4DQRA 3UIQA 1VSFA 2FVCA 5J1EB 3RAQA 1J5OA 4KTQA 4RNNA 4F3TA 1HYSB 2OYQA 3LAMA 4CF1A 4H4MB 4IQXA 3KJVA 4TY8B 3OSNA 1X9WA 4EZ9A 1TKDA 1RTDB 3HJFA 4B9UA 3DRRA 2HHQA 2E9RX 3I0SB 3MEGB 4DWIA 4NYZA 2QXFA 1BHLA 4ED7A 2F8SA 3OSPA 4CEOA 3GIMA 3DLRA 1RT3B 1S6QB 4FLVA 3LP2B 3PW5A 4W5TA 5DLFA 1WN7A 3RMBA 4AH9A 3CM5A 4WE1A 4H4MA 4B9NA 2RPIA 4KO0A 4FW1A 2E4LA 2WONB 3NGIA 2O5DA 4M3WA 3M8SA 4B9TA 5KFBA 3HKWA 4O3RA 2HNDA 5D3GB 3O4QA 1Q9YA 1DLOA 3OLBA 1D5AA 5KFGA 3BQ0A 1RT7B 4CFBA 2ZE2A 4WFZA 4IFVB 5DMRA 4ZP8A 3ITHA 3DRRB 4CHNA 1TL3B 2XY8A 4RG8A 3BGRA 2DFHA 2FVRA 4CJTA 3DOLA 4WYLA 4PA1A 4NLOA 4RW4A 3QYYA 2XCPA 3SUPA 3V6JA 5C5JA 3I8DA 1HRHA 3GV7B 3OS0A 3E51A 1JL1A 4IBNA 1ZBLA 3V6HA 3BDPA 1OS5A 2J6UA 2RN2A 3LAKA 5J2MB 4EYIB 2OZSA 1NOYA 1ASVA 4J9LA 2IGIA 3DRSA 3L2RA 4J9PA 4O3PA 2W9AA 5F8NA 5SZTA 2AX1A 4C8LA 4K4VA 2R2SA 5EUHA 4NLPA 1RYRA 1RCHA 3L3UA 1SV5A 1SL0A 1FKOA 5KFPA 4KO0B 4WYWA 3LPTA 4IKFA 2IBKA 3L2VA 2BQ3A 4IR1A 3EZ5A 3NAIA 1WNSA 3PO5A 3KLEB 1GOBA 1ZTWA 4Q8FA 1TKZA 3PR4A 4DS5A 2HHTA 4I2PB 4I7FA 2BRKA 2AGPA 3TAEA 4O4GB 3JSMB 2JC1A 3DM2B 4EO8A 1S1XB 1GOCA 5KFVA 2EC0A 4FLXA 1VRUB 1EP4A 1NK5A 5HROB 2FJWA 4QWAA 1VSJA 4IRCA 3T5KA 3I5CA 4DF4A 1T03B 5KT4A 4FZZA 3ZSOA 3H4BA 2ZD1A 4GW6A 1XI1A 1RBUA 3MXIA 2UVWA 1ZETA 3QGGA 3FQKA 5KG1A 1WLJA 1B9DA 2OA8A 3NBPA 1RDCA 3KD1E 1TKTA 2D7SA 4NCGA 2DY4A 5KG2A 4CJPA 1UA1A 1XR5A 5DLGA 4N41A 4CJQA 4KPYA 3D28A 4DU3A 1HMVA 4DL3A 1N5YB 3OL7A 3HM9A 2X74A 1QSLA 3GIJA 4ECVA 4KREA 4AHVA 4B8AB 1TQLA 1YTAA 4RNOA 1S0NA 4ECZA 3ULDA 3S9HA 1U48A 4FBTA 1XHZA 3LWMA 1VRTB 4FLUA 1NNDA 3U3YA 4ZPCA 3PVXA 3WNFA 4QWBA 5C24A 3VQQA 2Z1HA 1S1WB 1VSIA 3EYZA 2FLNA 1IKVA 1BIZA 4G1QB 4ID5A 3RR8A 4Q44A 3HHKA 2WHOA 3V1QA 3QZ7A 1BIUA 4W5NA 3SPYA 2IC3A 2W9BA 4IRDA 1DTQA 2YNIB 4DTXA 1HQEA 1BISA 2OPPA 4GMJB 5KFXA 4O3SA 4YQWA 3H40A 4HHTA 4CJSA 3WNEA 1TL1B 2C2RA 4YR2A 3G6VA 4TLRA 5JS1A 1RTHB 3ZSYA 1T8EA 3QINA 2XI3A 4CGIA 4CEDA 1QAIA 4K8ZA 4F4KA 3V9SA 4CIFA 4DL5A 1RDRA 1RBTA 1RT5B 1JIHA 5L1KA 3C6TB 2R8IA 2V4QA 4DQIA 3BJYA 3CG7A 1IO2A 3NF8A 4ECXA 2ASJA 4IKAA 2FJXA 2EHGA 2R2TA 3KMSA 5HBMA 3V4IA 3QIOA 3T5JA 3LP0B 2WB4A 4CHPA 4KI6A 3SNNA 5I3UA 4R8UA 1N6QA 4DL7A 5KG6A 1LW0B 5HRSA 2QKBA 4CF9A 4C8OA 2OPQB 3DLHA 1VSLA 4KFBA 4BE2A 4KKOB 3HVWA 5HLFA 4G3IA 2E6MA 3V81A 3KHHA 3TAPA 3M8QA 4RNFA 2XGPA 3NH1A 3I0SA 2VG6A 5KFHA 3OYFA 1ZBUA 1SKWA 4TY8A 2P5OA 3MFIA 2ZKUA 5CYQB 3JYTA 2QK9A 3T19A 3O3FA 3HVAA 4DMNA 1TV6B 4M3ZA 4CJKA 2HWIA 3LZIA 5EDWA 1TAQA 4ZVFA 4KHUA 2IM3A 4ED6A 4W5OA 3EPIA 4CJUA 2VG6B 3QEPA 3QESA 1KRPA 2RDJA 4FJKA 2IM2A 2KTQA 2HHVA 3SUNA 3QIDA 1WAJA 3TWHA 4FJNA 1LAWA 3T5LA 3OYCA 3RB4A 3PJWA 3N6NA 3G0ZA 3NFAA 3ZT1A 1HMVB 1NK4A 2FVSA 3L2QA 4FJJA 3CFOA 4CFDA 4KI4A 5KFCA 4NLUA 3ALYA 1HYVA 1X9MA 4MFBB 5J2QA 3FFIA 3MAQA 1HARA 1A5XA 2BGGA 4CJ3A 4NLSA 3ZSZA 3KHGA 3AVBA 4B3OB 4OVLA 3NDKA 3K58A 1S0MA 4N5SA 3AO5A 2IAJB 5FDLA 2YKNA 1Q8IA 2G8HA 4KTWA 3VQ9A 1XC9A 4DSLA 1S1TA 3MTKA 4OGCA 1VSEA 2YNGB 1JLBB 3DLEB 1J54A 1KLMA 2QKKA 2J6SA 4PY5A 1A5WA 1JLGA 1WSHA 3CDWA 3D0PA 4KB1A 5KFMA 4ECQA 3GV5B 3C6UA 4EEYA 4MK7A 3OYJA 3AVHA 4E0DA 3SQ0A 4EZ6A 3RWUA 4I9QA 3MR5A 3CQ8A 4CERA 1LW2B 1MU2A 2BR0A 3IS9B 3DLKB 4OL8A 4IG3A 3BQ1A 4XO0A 4KB7A 4DTRA 1DTQB 4FVMA 3NAHA 3M8PA 4FS1A 4JV0A 2QE5A 3NKYA 4FZYA 4E7IA 4IH5A 3T3FA 5KFTA 4NLGA 1QE1A 3CDUA 1N4LA 3V9UA 2JGUA 1RILA 4MQ3A 3LPUA 1IKXA 4CHQA 4DU1A 4CEBA 1BQNA 5KG4A 1RA7A 4KAIA 5DQIA 4E7HA 1EXQA 1JL2A 1FK9B 1C1AA 1FKPB 4Z4EA 1NJYA 4LH5A 4RW8B 3DMJA 2D0AA 3PV8A 4HYKA 1S9EB 1U04A 4HUEA 3K2PA 4JS4A 3FDSA 4FJXA 4CF0A 2B6AB 4TN2A 4NLYA 2PY5A 1ZTTA 4M3YA 2JEIA 4B9VA 4J9MA 3SZ2A 4JV2A 4KFBB 2XO7A 2FLLA 3K5LA 3OYAA 4CGJA 3PX4A 3RB0A 4B9MA 2HVHA 4AHSA 4KHNA 4ZVHA 4CF8A 3CIZA 1RTJA 5KG3A 4RW8A 4JV1A 4K4ZA 2D0CA 2X6SA 3DYAA 2HB5A 4KHYA 2G8VA 1VSMA 2GUIA 2R8KA 3QLHA 4KSEB 4CIEA 2G8WA 3CFPA 5F8GA 2B4JA 1NK7A 4B9LA 4NLWA 4BACA 1TL3A 4UQGA 2PYJA 1SUQB 4DSIA 4FJMA 3S3OA 2HNZA 1CLQA 4ZP6A 1F21A 5CYQA 2VG5B 1CSJA 4CHZA 1NJWA 4E7JA 3OJSA 2F8TA 4KHWA 4RW7A 4O0IA 3H4DA 4KAZA 4WXOA 3SI6A 1LWFB 1SH3A 4FLZA 5I42B 4KHRA 1J9AA 2F8EX 1TVRA 4BE0A 1C0UA 4NRUA 2WTFA 1HPZA 2I5JA 3UPFA 1IH7A 3PZPA 4M3TA 3PHEA 5L1IA 3M9NB 2XCAA 4ECWA 4JS5A 3BR9A 2ALZA 1S9FA 3QO9B 4LQ3A 1D8YA 3OS1A 3G6XA 3SYZA 5CYMB 1JLGB 3NE6A 3VQ8A 2Q3SA 4ID5B 3DLBA 4IFYB 4FJLA 2ATLA 3NMAA 3KHLA 3KK3A 4O3QA 1S1TB 4HTUA 4I7FB 3V9XA 1QQCA 2G8FA 3E01A 2KZMA 1R0AB 1D9DA 1S6PB 1IG9A 3QIPA 4J2DA 1VSDA 4F4WA 2VG7B 4CEEA 2YHBA 4O0JA 4M45A 2R2UA 1JLEA 2G8UA 1WSIA 1DLOB 3HT3A 2ATQA 5F8HA 1NK9A 4W5RA 4QWEA 3HPOA 1TKTB 2AX0A 1RT4A 1T7PA 4ZMMA 4HVJA 2JC0A 3KK2A 4DFMA 5JS2A 4Q8EA 4DG1A 2WRMA 4FLYA 5JXSA 4RW9A 3LANA 3B6OA 4BE1A 4AHTA 4AILC 4I2QA 4FJ7A 5C24B 1J5OB 2P51A 3PX0A 4LSLB 4DL6A 4ED2A 5KFSA 3HYFA 3LP3A 4DSKA 4IDKB 4XIUA 3DLGB 1BGXT 5KRTA 2HVIA 1TP7A 4F4XA 2G8IA 4RW9B 3A2FA 4NLVA 4CEFA 5DK5A 4E7LA 4RW6A 3KD5E 2ETJA 2WOMA 1C0UB 1RBSA 2DTUA 1HNIB 1RTHA 1I6JA 3AVNA 3TR8A 3DRPA 3WNGA 3D45A 4J2EA 1JKHA 2GIRA 2YKMB 4NLDA 5KG5A 4FK0A 2GV9A 5FROA 1ZYQA 4CJLA 1JLBA 3DLEA 3LP1A 4H54A 1BCMA 5JUMA 4IRKA 4RU9A 2JEFA 1KVAA 4IDKA 4FJ9A 4J9SA 4F2SA 5J1EA 4DFJA 4ELTA 2WCXA 2CKWA 3QNOA 3QEVA 3SQ2A 1RA6A 1K1QA 4DU4A 5KRSA 2R7YA 1R0AA 3TAMA
chains in the Genus database with same CATH superfamily
5FLXO 1CC7A 1WSJA 2W1BA 3JSBA 1YF5L 4CJ7A 4FW2A 1ZZNA 3W9JA 4JI1F 4E98A 3KK1B 4ZDNA 2P5VA 1FDAA 2HQ3A 1N5QA 4JI8K 1CVJA 1RDAA 4Y1DA 3EE8A 2ASPA 3MHYA 3VGMA 2ITMA 3RJMB 1YTYA 3V9WA 3T9NA 1RT3A 2QYCA 4CEZA 4EP5A 3HBTA 3D67A 4EAHD 3M8QB 2Y8YA 3NS6A 1G15A 2Z1GA 1FXLA 3MEGA 3UVJA 2BJDA 3CJKB 2C3MA 3CJ0A 1N34K 4CJ5A 2IDEA 1S0VA 3D6HB 2MKJA 2NPFA 5C15A 2ZGZA 5LM7E 2EWHA 2YQ3A 2AGOA 3SUQA 3EZUA 5IOLA 3Q0AA 2WSFC 1H74A 3DOLB 2KHOA 6FDRA 2R2RA 1VYAA 3CO0P 4JK9A 3AO2A 5B7WA 2FJVA 2K1RA 1G2EA 3H42A 2C1EB 1UFKA 1YHQN 5RUBA 4YNQA 3FBEA 1T9YA 1TUYA 3J7AN 2RRBA 4EBCA 1D9FA 4WKYA 3W61A 2GJFA 2V69A 4GC6A 3M9MB 3AH6A 1NGGA 2RU3A 5AFUA 1HPMA 5EWFA 4OJRA 3SQ4A 1FKOB 2QMUB 5LL6d 1JXBA 4YOEA 2GFFA 2DNMA 2MZRA 3D1OA 2MZQA 5CYJA 1LWEB 4F25A 2IVPA 1IUJA 1WG5A 5BR8F 4LSNA 4B17A 2AQ4A 4ISFA 1W2IA 2ASLA 4FJIA 3DMJB 1X8DA 1T03A 2VU5A 4FLWA 2HURA 4X65F 2Z58B 5J2PA 5C25A 2D3UA 2HNDB 3IG1A 1B0VA 3OL6A 1FJEB 4IOCL 4OYOA 4BCAA 4OHXA 2HS0A 2EK1A 2KJWA 4PYAA 3OR2A 3O3GA 4DV5J 1D1UA 3KVGA 2HOEA 5BPMA 2VPWB 4K41A 3M32A 3MPYA 2OP5A 2LEPA 3IS9A 2A3ZA 4IH6A 1PBAA 3EL2A 2EG1A 3HHDA 1W9HA 4LF5K 1NG9A 4YR0A 1RTDA 2XMKA 1B99A 3Q8QB 4NPOA 2HMPA 2HYIB 4WYBA 4JLHA 4E8UA 2DNPA 3UWTA 4WTYA 3DNCA 3GWCA 1K1SA 4FXWA 4F2RA 3W8GA 5IWAJ 4JKDA 2HFOA 1T05B 2QC3A 1WC0A 3LP1B 3TABA 4KT0C 3NF6A 1O5JA 4ZJQA 4AL7A 1S48A 3AAQA 4BDYA 4JYAF 1R27B 2XTJP 4F4AA 1P8GA 4BS2A 2CJQA 2NSCA 5M2UA 1ZC6A 2HZAA 2FZCB 5CE3A 1TVRB 1UZDA 3O5BA 3AD7C 4JN4A 2RQCA 4QW8A 3GL1A 1QQNA 2HIYA 5J2NB 1UWBA 3O1WA 3K9KA 1HBNA 3D5MA 2FLPA 4I69A 5DG7A 2L48A 3K5OA 5KFJA 3AVAA 1SB6A 2FYXA 3B6PA 4LF4K 3CIPA 1U2RA 1N32F 1OQ3A 2XY7A 2C2OB 3QLHB 1HNWK 2G1DA 3ZZTA 1V3ZA 2Y1JA 2D0PA 2IMWP 3NVKA 2YHAA 2FC8A 3ZTRA 4QAGA 3C3LA 2BVZA 3CMAN 2GO9A 3FQLA 1BE4A 4BRNA 4QS9A 1GEHA 4KHPF 1WG1A 3GU0A 1KQSM 4KBIA 1XNQF 1Y64A 5KPTA 3V4IB 3C0BA 3R2DJ 4X4RA 1XTZA 1T9VA 2QO3A 1JXVA 4EWTA 4KKOA 3PXGa 4AXIA 2E1YA 2HVEA 4EBDA 1HQUB 4JK7A 4F50A 1NDLA 5DM7Q 4IFYA 1CXUA 3HD2A 1ZS6A 4O4RA 5B0AA 1PAUB 4AF1A 4RWXA 2O8EB 3FSIA 2W2OP 2WK4A 2CPEA 2DFEA 1VK3A 3CCRN 4KY3A 5KFIA 2GHVC 1TK8A 4CK1A 1OIAA 4AL6A 2AHOB 1MN7A 4CJFA 4BR0A 4PQUB 4ZN1A 3SFUA 3BYRA 2ZH7A 1VQPN 4DUYJ 2KYXA 5IXUA 4ZLNA 4IOCQ 3AVIA 2LSNA 2NUBA 2HSEB 1U49A 2HFUA 1SKSA 4CJEA 1TFWA 2Y0BB 2IYIA 3E66A 3HJVA 2CYYA 5G0RB 1S97A 2FHJA 2OO4A 1KTVA 1Q53A 1FK9A 3G10A 2L9NA 1NMDA 2AW0A 2KVQE 3UN5A 2C3OA 2OTLN 5CZ1A 2V4RA 1JLCA 1YJNN 2IS3A 4X4PA 3ENHA 1HNXF 3KHRA 2OTLS 1C4CA 2JSXA 1NO8A 4EO6A 2OI2A 4CF2A 2H3EB 3ADAC 3ZSVA 1HNIA 3A13A 5TKWA 2ZH5A 4CEAA 4ZS6A 3AA4A 4AFFA 1UAWA 4YB7A 2VG5A 2G2OA 2GHPA 2Z1JA 2YJFA 3MEDB 2VBXA 2E1ZA 4PXEA 2HHWA 4MLEA 1S57A 3M6XA 1YX2A 5KI6A 1RT6B 2RIJA 1VC6A 4Q45A 5KFQA 3H98A 3MM7A 2KT2A 2F5GA 3NY0A 1R3NA 1IKXB 1W7WA 4I9LA 1N88A 4F0HA 2LFVA 1HD0A 3V6KA 3CC4N 4OPKA 2V2QA 3A12A 4ZP7A 2A2DA 5AQVA 1R8BA 3BM7A 1UFLA 3QEXA 4DCOB 4UY8T 3DLLQ 3D66A 5BREA 5GAHI 2HG4A 1X0PA 2OPSA 5CHCB 3TWZA 5CY4A 4CIGA 1FTRA 1VQNN 1BHNA 2B43A 3BO3A 1XNRJ 4V19J 3IWXA 4ES1A 2W8LA 1X9JA 5C2DA 2YNFB 1K0TA 1YQHA 2ZJRL 2W9CA 1G1XA 2CQ2A 5AE3A 5DGAA 3MPDA 1YI2S 4OPJA 3M9OB 5GMEA 3TAQA 3L2WA 2OEKA 1RWPB 1GLDG 1CXQA 4H0YB 5HJYA 1S9GB 2X1FA 4FM1A 2ILYA 3VCDA 1S49A 1YDLA 2KQ2A 4DTMA 1H2VZ 4CYUA 1ZM3A 2H65B 3HCXA 4DOZA 3DOKB 5HN0A 1LWFA 4FWLA 5LT5A 1H6KX 3MECB 2ZBRA 4TKTA 1REVA 2KVIA 2DY9A 2JEJA 1MNEA 2ZE2B 4F0KA 3ULHA 3C16A 5FPMA 2I5JB 2V67A 2YX4A 1QHAA 5D0GA 2HF3A 1MLAA 1RDUA 2PEBA 4R5PA 1BCOA 5SUHA 4ZCKA 3HD1A 5I42A 2QZ8A 2A3JA 2GV1A 3DXMA 4QYRA 2VA2A 1VQ9S 3K5MA 1XMQJ 3U1MA 2O8CA 3PSIA 3CXCM 2QWQA 2YKAA 4ZCIA 3R7SB 1HLUA 2R7OA 5U47A 5F9NA 4J9KA 4USJC 3AO1A 1HL6A 3ZZZA 1NCLA 4WTOB 2FSNA 3J8AA 3QT7A 4M8LA 2KH9A 4BVOA 5KFEA 3EGWB 4NLQA 2CQPA 3PO4A 1JKHB 1HQUA 3EGZA 3QGIA 4MFBA 1F9EB 3QEWA 4OX9F 1TKZB 5FRMA 1NJIO 4EI2A 3J80U 3CMQA 3CCVN 1J2VA 2QA1A 3EX7B 1S9EA 5MLCV 4JI8F 3GCXP 4C8ZA 5KFFA 3LDPA 2CPDA 4NZ7A 3P83D 4RJVA 4Z0UA 2GMLA 4J9QA 4DTUA 1YJUA 1R0BG 1UVLA 3KLHB 1I3AA 3J80O 5KPRA 2ZH2A 1N52B 4A8WA 2RDIA 2ZBPA 2LMIA 2NYIA 3TEHB 4X62J 4FJHA 2X3GA 2PI4A 1C0FA 2GTDA 4X64K 4MAKA 4M41A 3A8YA 5D4LA 2WVCA 4OHZA 3SSSA 1M5KC 4J2AA 2XHCA 4K25A 1FCAA 1F2HA 3W7BA 3IBCB 5JMVA 2VC0A 2RHSB 2JRSA 1VGYA 1JCEA 1FX2A 3VALA 1ESVA 3P49B 1FERA 3MR3A 3NGZA 3KTQA 4QWCA 3I8BA 1F2GA 1RGIA 2IC3B 1S6PA 2NUUG 5KG0A 3LGNA 3IR6B 3VF0B 3PNIA 5H9EJ 3B78A 1FHTA 4YR3A 3OYNA 2NYHA 3WNHA 4IG0A 1RT7A 3ISND 3PW2A 4WK1A 4OKEA 4HT7A 5SWMA 2D3ZA 1HNVB 1O51A 3NLCA 1RWVB 3TYTA 2F9WA 5A2QY 4BG9A 3CETA 1YZ7A 1W2BR 3NCRA 4DUYK 1BI4A 3VQBA 1VSKA 1DQ8A 2ZZNA 3UB5A 4OLAA 3LA0A 1NGDA 2D41A 1S72N 1FWKA 4IDHA 2P9GA 3GSIA 1H73A 2DO4A 1SJ3P 4FK4A 2ZH8A 3J7YP 2O4GA 1H1VA 5K14B 4CLUA 2PMZD 4KTZA 3MCMA 2P9PB 2BXJA 2VQEJ 3OYMA 3EVOA 4Z37A 3IKMA 3UR3C 3J81Y 4ZPTR 2W2NP 2O66A 1KTQA 3DLKA 5BXIA 2VZ9A 1ITPA 1L3SA 4F8RA 2E1AA 4KHSA 4DX7A 3ASMA 4OIXA 1RNHA 5EGYA 1CZAN 2KFZA 4QJVA 2XQCA 3MM9B 1WAFA 4JKCA 3P1GA 2PE8A 3SJJA 1T9WA 1N54B 1PG5B 1VMBA 2F9JA 3HHLD 4X4VA 4LF7J 1BXNA 4K43A 2O4IA 3MCNA 1M5OC 3VAFA 2ZNYA 2B5JA 1HUXA 4F36A 3NMRA 3KWGA 3EKUA 4CH7A 2DFFA 3UNYA 2QMWA 5HI7A 5KT7A 2U2FA 1IBCB 5KFYA 1U47A 4Q43A 4NCAA 5HSPA 2E29A 2FBYA 1MU2B 4AHUA 4DFPA 1UKUA 1KNZA 4AYBD 4GKKJ 2G9OA 1NAQA 3ZETB 1FWPA 1H3DA 5K8OA 3VF6A 1VBXA 4KYZA 3VEZA 3B8HA 2MKKA 4AQYJ 3I0RB 2J6TA 2BUNA 2C2DA 3VGVA 5JICA 2E7XA 4E2FB 2KFNA 2VV5A 1WF2A 3W60A 4FZXC 3MWTA 3VTHA 5A8RA 4FWMA 3NCIA 5F3TA 1NJIT 4FS2A 1NMNA 3CCVS 4CZJA 3ENBA 2F3JA 3R3TA 1VJWA 5KFRA 3HFVA 1L3VA 3O3LA 1RLCL 4BR4A 1RLDA 4QR0A 1HKAA 4DR1K 2HRUA 1LWEA 4I67A 2VWJA 4XPEA 5AXMA 1ATSA 3BY5A 3G8SA 3HI9A 1FD2A 4FCYA 3HVTA 2YQ0A 1JCGA 4CLTA 3GMGA 1N5SA 4WU2A 4CO4A 5GAGP 1C2PA 3TVKA 1ZM2A 3O44A 5JLFA 3RMAA 1BC6A 2QA4G 3AA5X 3M5RA 3RVCA 2A6MA 4A46A 2GWKA 4DR6F 2MQMA 1H98A 5E3PA 2UVUA 5M1FA 4ILRA 5HRNA 3GBTA 5DQGA 3Q22A 4HCBA 3LP0A 1YJRA 2D1KA 3BBCA 4OO1J 3L6QA 1GOAA 4Z4IA 2EVZA 3UIQA 1N0UA 2DIVA 2FVCA 2QLJB 5J1EB 4KGXB 1N8RO 3VGLA 4X62F 4IWVA 3Q7CA 4DV2K 4CLSA 5BN9A 1FWLA 1F5BA 4Y00A 5J1PA 3QPIA 4PKHA 4GV6A 4NXMF 3OSNA 2WUSA 1X9WA 3AXMA 3R5CA 3DRRA 2ZH1A 5AXKA 2HHQA 4JI7J 3I0SB 4DWIA 3NVMA 4NYZA 3I4PA 2QXFA 1WEZA 1RTZA 1IQTA 3WC0A 3GIMA 1RT3B 1S6QB 1N5VA 4Z2XA 4FLVA 3DU6A 3RMBA 3JAMO 3MR7A 3J81O 2GAHC 5JVHL 4H4MA 2RPIA 2BJ1A 3MM6B 2E4LA 1GNKA 2O5DA 5KFBA 3HKWA 4IQMA 4CO1A 3O4QA 1P9YA 1ZZFA 5KFGA 3MN6A 4V19S 1TUGB 2ZE2A 2XSFA 3PRVA 3DRRB 3ZYYX 2DFHA 3I96A 4CJTA 1Q95G 3G6EN 3DOLA 5GVQA 5FPEA 3W5ZA 1XMOF 3PFOA 3O9QA 5C5JA 3JS9A 1JL1A 1PC4A 9ATCB 1SPBP 2CGJA 3CC7S 2BOAA 2OZSA 1ZBSA 4O3PA 2W9AA 4WFNL 5SZTA 4K4VA 1Z6RA 1RYRA 4AQYK 3HKZD 1ZBTA 4M5LA 2CG4A 1IR1A 2IBKA 5E2QA 4WFNQ 4IR1A 4RTFD 4X66K 1CJUB 2DHHA 3FEZA 3BGUA 3VAKA 2GEMA 2BKPA 4CBXA 2JC1A 3NGTA 2WC9A 3NGUA 3NGRA 4L74A 2HAFA 2B4UA 1VLYA 2B8QA 5GAGU 3QJLA 2DNHA 2SXLA 1S1XB 1HHQA 1KVIA 3WXIA 3G82A 4FWOA 2FJWA 4P2FA 4QWAA 4UY85 1YKWA 4FWPA 2W4CA 2ZEJA 2O3DA 4NB4A 4FZZA 3IA0A 4NA3A 4C1NI 3MXIA 1NWKA 2LP4A 2Q97A 2H5JB 1IBLK 4BC4A 3QGGA 3FQKA 1WLJA 2OA8A 3NBPA 3AOCA 5AQMA 1HD1A 3AA8A 1TKTA 2D7SA 4NCGA 2BJ3A 3FSXA 3HHLA 2HZVA 2LEBA 3NS5A 1YHQS 3SBTA 1GLEG 2X74A 3A8EA 1KQSR 3D6RA 4AHVA 2CJBA 1YTAA 1KOOA 2K1RB 4YB6A 3W2VA 3S9HA 1OKJA 4FBTA 2CVEA 2E1MC 3WQUA 2R4FA 2QA4S 3U3YA 1T3VA 2J4RA 4QWBA 1NEEA 2J7UA 2GHWA 1VSIA 2NCKL 1TL7B 2ASYA 4DR4K 4PL8A 4QYZJ 3N4WA 2WHOA 3BYPA 1J5EK 4IRDA 2PA8D 3QRQA 4C8YA 3R3LA 3SMSA 2HQCA 3H40A 4DMZA 1KWMA 3Q2TC 4YUDA 2V7ZA 1S6UA 1RXOB 4WK3A 2L9WA 3T69A 3ETMA 3QINA 4M7YA 4DV0J 3DJCA 3BPSP 4CIFA 2V94A 3DAWA 1RT5B 2HHPA 4TU9A 1XNQJ 3FE1A 4ENOA 2W2QP 2VGMA 1IO2A 4DZDA 4ECXA 2ASJA 2CWKA 2H5EA 4JV5K 4JI3F 1AUSL 1K9MT 1UETA 5HBMA 3V4IA 2DITA 5DDQC 3D2WA 3LP0B 3JAMU 2RS8A 2XSJB 4DR4J 1AUDA 3WXLA 1N33K 3RGIA 2QKBA 2Y1LB 2F4VK 2NZCA 1R59O 3R6GB 5HLFA 2Z2LA 4A8FA 3LM2A 2JOQA 2M9KA 3KHHA 3DGPB 1RAOA 3NH1A 1DARA 5KFHA 3QB0A 4ZJOA 1T95A 2GW8A 3ZZYA 1SKWA 4GKJF 2CFXA 5AZIB 1RCXB 3N0VA 2ZBCA 3T19A 1QAXA 1YBUA 1Q82O 4CJKA 1K8KB 1LNQA 2HWIA 3LZIA 2GVDA 2VQFJ 1IBLJ 5AQQA 3EPIA 4FF3A 4XH1A 1X0FA 5DETA 4B3RJ 2OTJN 2B9EA 2RDJA 4FJKA 1KOHA 4FWQA 2HHVA 2CZ4A 4A8SA 3MOJB 4GKKK 2HSTA 3T5LA 3K7RA 2LA6A 3PJWA 2KLAA 5GAEI 1NK4A 4IJNA 3UD3P 3L2QA 4FJJA 2EK6A 3HHNB 3ALYA 3MEKA 4O8KA 1X9MA 4MFBB 2HZCA 4NLSA 2E20A 3OTOK 2XYPB 4P9SA 2E1CA 4CRJA 4N5SA 3SCJE 3L7PA 1Q8IA 3VQTA 1FA0A 3VQ9A 1XC9A 4DSLA 3OTEA 3T1HF 3MTKA 1U7LA 3PDNA 1GQEA 5C10A 1KLMA 4D3HA 2HKEA 3M3ZA 3LDOA 3HZGA 1CJKA 3MAAB 2IHR1 4KRWA 5KFMA 2Q6BA 2XYHB 3BH6B 4X84A 3ZTOA 2FZGB 4I9QA 1LW2B 2ZF5O 2BR0A 2BX6A 2O8DA 4IG3A 2AYEA 3BQ1A 3I55S 4XO0A 4FVMA 3NAHA 4UOCA 4X64F 4NLCA 4JV0A 2QE5A 1IWAA 2DYAA 4FL9A 3T1YF 4NLGA 3CDUA 1YJ9S 1RILA 2V68A 4MQ3A 3THYB 4Y6IA 3LM9A 3LPUA 4CEBA 3G96A 4CT9A 4KAIA 2YX6A 2A40A 4E7HA 2VONA 3CC2S 4CP5A 1FKPB 1T0TV 1S9EB 3K2PA 5AE1A 1WSVA 3FDSA 4CF0A 2B6AB 4A4JA 4TN2A 4RBUA 4M3YA 1N0VC 2JEIA 4JAXA 5KPZA 2Q1NA 1NM2A 4KFBB 3KUHA 3PKMA 4P52A 2KDOA 3K5LA 2FLLA 3D6FB 4X65K 2MGZA 3VGUA 3PCOB 3MURP 1KKHA 4LF2A 4C3KA 3JB9k 1NSPA 5B08A 1RTJA 1KDNA 3L9ZA 3CMAS 4M5IA 2X6SA 3UNGC 5AXLA 1ACMB 1BO5O 1U6FA 2HRTA 4KHYA 2G8VA 2VOOA 2DXDA 4CO2A 3OFGA 2AYBA 4QIFA 4UQGA 1X3MA 1T9TA 1SUQB 4CO3A 2RUGA 4I56A 1T6DA 3UFCX 2HNZA 3E8OA 3OUYA 1SJ1A 2QL5B 2HHHK 3UKUB 4CHZA 4LBPA 5LMUJ 4E7JA 2ABYA 1U0HA 2E44A 3V5RA 3HT0A 4L6V3 2QTDA 4RBVA 2J9CA 2R42A 3SI6A 1LWFB 2OANA 2C3UA 3TR5A 5GMKa 4LRDA 1C0UA 4PKGA 1AZSA 2LXFA 1PJ6A 1O8BA 2DGXA 3UPFA 1M90O 4WQ4C 1VS3A 3KWMA 4ECWA 3BR9A 4HTJA 5GADI 2OFGX 4CLLA 1GLAG 4X66J 2JVRA 3B8AX 5CYMB 1JLGB 3JTOA 4MDBA 3VQ8A 2DXFA 3DOMB 4ID5B 3ZNJ1 5DM7L 5FIIA 3QQCD 3MX5A 2EPIA 2G8FA 3E01A 2M88A 1R0AB 1D9DA 4V1Ak 1TELA 3AQOA 3K89A 1OWXA 3G71S 5M1PA 4F4WA 2VG7B 1SQFA 6FD1A 5EXWA 3TNVA 2RDDA 3R1LA 3MMJA 3HT3A 2W4PA 2GVZA 3HPOA 3VEVA 2F4FA 1M1HA 4BC5A 4ZMMA 4P71A 4MJKA 4DG1A 2WRMA 1W7AA 3B4DA 4J9UE 4LF1A 1AB8A 3EZOA 5A0YB 1F9HA 4OZ3A 3MD3A 4ZJLA 4FJ7A 2VPZB 4M63C 2PA3A 2EFOA 2W4DA 2CQBA 2W41A 3TZZA 1HNZF 4LSLB 2EW9A 4MIWA 1JJ4A 3LP3A 3GDQA 3THYA 4DSKA 2Q0UA 1TYQB 1G3OA 5KRTA 2G8IA 4QZVB 1DHMA 2NS1B 5DK5A 5BR8K 1P1TA 3G9CA 1YXQA 4LF6F 4Q2LA 1HNIB 3LUYA 1I6JA 5B0FA 3AVNA 3TR8A 1F60B 2BW7A 3DRPA 3C14B 2V7YA 2AP1A 5D77A 3CD5A 2GA7A 2DT9A 4OX8A 1HNXJ 5JUMA 3TX0A 4IDKA 1UVIA 1GXTA 4OLOA 5J1EA 1FT8A 3CJ1A 2YX1A 3QEVA 1OYEA 1CC8A 1RKIA 4AQYF 3LGMA 1VK8A 3OPKA 2AMCB 2P5GA 3X3UA 1QSSA 5E3QA 2B5JB 4YOWA 4ZA1A 2ACMA 2BABA 2KT3A 2QWMA 2UVVA 1EQMA 1QQMA 5THWA 4CLWA 2DVIA 4LR8A 5FRNA 3BGFA 3OYHA 3I32A 1Y0HA 5FPDA 4QIEA 4M3XA 3PR5B 3H90A 1FJCA 2GIFA 4IG3B 3AT1B 3A5MC 1KHVA 3VQ6A 3QFHA 3B82A 2M2BA 2WONA 3PRBA 4DR7J 3OTBA 2OPRA 3PEHA 4U8VA 2GX9A 4MK8A 1MA9B 3NEKA 3T1AA 3US5A 3NGDA 4E89A 4Y28C 3UQSA 3I0RA 3IWLA 3S6EA 3NAEA 3BKUA 2PEHA 1YJWS 2NREA 1WNEA 3OFFA 1FKPA 1SQGA 2X1GA 4JI2F 3O3HA 3GPAA 3T6JA 2DH9A 5JMNA 2QL9B 4ZPBA 4ISGA 1S12A 3GG0A 1T05A 1MW7A 3GSDA 1T94A 2KKHA 2ZOGA 3SAGA 2VFUA 3EJMA 4R0JA 3UDEA 2FBTA 4ICLB 1Y4ZB 2JLGA 4LSNB 2M8HA 1KN6A 3QETA 2OCEA 4ZPWR 2P9CA 3F73A 4JRPA 4TLQA 1QTMA 2GX8A 3H46O 1I94J 2ZOFA 2RRAA 3ULEB 2CADA 3BQ2A 4FKXA 1Q5YA 4CCHA 3VQPA 1K47A 4YMEA 3GQCA 2HF4A 3C94A 1KR4A 3KJNB 4LSLA 2NRXA 2BM0A 3HO1A 1ILYA 3G8TA 3A3OB 2HEKA 1DGKN 2I8EA 2QJ3A 3PM9A 3T6BA 1IKYA 1U2VA 1VQNS 4N8OA 4J90A 3QWUA 4DPWA 4DV3K 2MXYA 2EG2A 3DXKA 2RKIB 1S5JA 4B3MJ 4BY9C 1HI1A 2ADCA 4JHDA 3SUOA 2IVOA 4CJWA 5D3GA 4DV4K 3DI6B 1YI2N 3VVUA 2GUPA 1YRTA 2GWJA 3L8BA 5L1JA 4P73A 4BRQA 4L73A 1PYOB 1U2VB 1Z26A 5KFNA 3HSCA 2B7CB 2CPZA 3F5TA 3MUVP 1N33F 3PLAA 3FBFA 3ZC4A 1QTNB 4LVOP 5HANA 4AD6A 4DB3A 4OZLA 4EYHB 2CJAA 2KM8C 4Q5VA 1S4FA 2H51B 2XI2A 1VQPS 4M5KA 5H1SQ 4PG7A 2IDOA 2L41A 4RUAA 2KJVA 4CJRA 4XDCA 2LU1A 2MKSA 2EKNA 1RBVA 2W7AA 1RTJB 1NJZA 2DNRA 2XS5A 4JI8J 2ZJPQ 2CGKA 3NBPB 1KAXA 4E7KA 4DN0A 1UMJA 5EU7A 4DQ8A 2A1RA 3CXCR 2H1YA 5GAHU 2ZD1B 5GAGI 4NYFA 3MR2A 1VQLS 3H5YA 5HP1B 4U7CA 3HSGA 2O67A 1IBMF 1D3WA 1RT1A 1HHTP 4N77A 4NXNJ 4V19X 4EBEA 1Y11A 3RTVA 3THXB 4B3OA 3Q7BA 3G8QA 2X1BA 4PUOB 2DCLA 4TU7A 4DR3J 5EN1A 1JLFA 1URRA 4OYMA 3E9PA 3EVWA 3SCXA 4FM0A 4HKQA 1MWKA 3HFKA 2WB1D 5ETLA 5D4OA 2QSFA 4DG1B 4AL5A 2BDPA 4DR7K 1UVJA 5BRFA 2ZH9A 1D8ZA 2FJAB 3OTCA 5M2PA 3C6UB 1N48A 1CPZA 1KBRA 3TA0A 3B6BA 3IRXB 2WAQD 3R5BA 5A76A 2KFYA 1W25A 1EWRA 1HKGA 3OYDA 2R8JA 3C46A 1NGAA 4OX9J 3TUJC 1P6TA 2HFNA 4CZGA 2QA2A 1KS2A 3G6ES 4A59A 1ROFA 4U6PA 4OPAA 4TYBA 5JVGL 4EGLA 2R8GA 1OY6A 1E6VA 4DSFA 1KVCA 3CJKA 4B1VA 4BDZA 3LPEA 1WDDA 3R8YA 3H5UA 2ZWPA 3KLGA 3BKFA 1JX4A 2K8GA 2UUAF 1X1PA 3GFHA 1JLEB 3MMAA 2YKMA 4IH7A 1IWGA 3ILJA 4IXCA 2FJEB 3G71N 2DY1A 4K4XA 2N7YA 3EPGA 3VQEA 2IRUA 2FLOA 2CWXA 1SI9A 3UO0A 1VFJA 1RDDA 3IFEA 2R7RA 3PG9A 5D0HA 1SC4B 2AJQA 1O1WA 2H4YB 3IN5A 1NZAA 3VF2A 4AXJA 2CH5A 2D5RA 2NXUA 2DH7A 2RF2B 3CFRA 2EXUA 3UDVA 3QO9A 4BC9A 2V34A 2YX7A 3HHLB 4USMA 4CTAA 3W2WB 4CGDA 4CZHA 5M2RA 3IAYA 2ZM6F 4NLXA 1QVGR 2NLXA 3VQ4A 2OPSB 5HL7L 3ZEUA 3M7VA 1KFDA 3QIPB 5ETPA 2O8FB 4ZCMA 4Z4CA 1SKRA 1JXLA 3ILOA 4I68A 3OL9A 1LKZA 2BZ2A 3P5TL 5KFUA 2QLWA 5A8WA 1WOOA 1J6ZA 2VD3A 3BS9A 4HUFA 2HPUA 2V2ZA 1TK0A 5FJ4A 1IKYB 2DPIA 3J7YU 3GIKA 5EWGA 3LALA 2F9DA 1TL5A 3O1LA 3T1YJ 3GIRA 3PRDA 5CD4H 4CLPA 2W9CB 1Y97A 1RGVA 3T1YK 1TR0A 2YHWA 3ZSXA 4LSZB 2WSCC 1NBWA 1JLQA 2XY5A 3IUCA 4BRLA 1RQ0A 1E6YB 2K3KA 3I33A 2PDAA 5IV3A 2J0QD 5K9FA 4A61A 2OLWA 1RAAB 3MEDA 4DX5A 3FGVA 2MLXA 4ZHRA 5AQGA 2LYVA 2RE1A 3ZX0A 4K8XA 2P9UB 4OKKA 4DEZA 3T5HA 1RJJA 4M5JA 5T7LB 1EIYB 1RTIA 2QFJA 1SV5B 4P10A 5IC4B 3PIPQ 4RUCA 3Q2SC 3WQPA 3FZHA 1S7HA 5DG9A 4K4YA 4URSA 4LFAF 4W5QA 3BEGB 3V2UC 3P4UB 1GLFO 4F3OA 1VQ5S 5HBMB 3PIPL 5LMNF 2ZUAA 1KHWA 2CNKB 3VR1A 8RUCA 4K4WA 2M52A 4CGHA 5L9XA 5AJ3J 3CJ5A 2AJ0A 2E5GA 2OAUA 2E9TA 4K4TA 1WEXA 1VHXA 1Z4UA 4OJ3A 1XHXA 1ZBFA 3OW2M 3KNAA 5HVFA 4OLPA 3BUZB 1JLFB 2ALYB 3TAGA 1R0CB 1ULRA 5LL6Z 1NHKL 2UXDF 4ITSA 1S0OA 3PHTA 1U2CA 4DR3F 2KL8A 1XUPO 4FWKA 4MYUA 4LF6K 1CJKB 4AHCA 1VR6A 1NGBA 1UP1A 3H5SA 3RMCA 2YNHB 1V6HA 4DUYF 4FVUA 4DSJA 3W5XA 1H7XA 1IBMJ 1EQYA 1K8KA 3DLLL 3K8VA 2VIHA 4JI2J 4WF9Q 5C25B 1J5EJ 2IIHA 2R7SA 4QCLA 3GFXA 4YHHJ 2QEXN 3CTRA 5BRDA 1VQSA 3O9TA 4NE9C 2GIQA 5J2QB 1AT1B 1DQAA 3N4QA 1U8WA 2ZVSA 1NKBA 4XK8C 1TFYA 4H0TB 5F2RA 2UXCJ 3JQKA 2QGFB 4ZPDA 4FK2A 1SS6A 2FTRA 3CD6N 3GYXB 3UKRB 1DQ9A 3O4NA 3PACA 5HAOA 1EX4A 3TSUA 1RI7A 3L0QA 4GVEA 1U6ZA 2QXLA 4A47A 4XH4A 1S1XA 5AQWA 3UE2A 1VBZA 1K9MO 1HBOA 2V4JA 1KD1T 3HP6A 3WC2A 5L46A 4X64J 1NB7A 4K5SA 4RUBA 1HNWJ 2XNQA 2QV6A 4BGAA 3TSPA 2UUBK 3M8PB 4I6MB 4JEPA 5B09A 4PXCA 2QW9A 4OYZA 4TYAA 4B3MF 3AB4B 1F3FA 4W4MA 1RWKB 4C98A 3R5DA 4W92B 1U6BA 3R97A 3OBIA 4B9SA 2GQQA 2EC2A 1BQXA 4FYYB 4IOBA 1V3SA 1J5EF 3PX6A 4KRFA 2Z2YB 4Y0FA 2P9IB 4I1TA 1S7IA 1RAJA 2PT0A 1E4GT 3CPWR 3MPWA 4DS4A 4ELUA 1Q8KA 4JI4F 1U45A 4X66F 3CIMA 3FCHA 1HA1A 1NSAA 4QPTA 2NPIA 5HO4A 2C28A 5LJ3Y 3FBBA 2A6OA 4GNIA 3CYMA 1RT2A 1NM1A 4HHHA 3Q23A 3MM5A 4FJ5A 4CLFA 3O9UA 2PSZA 1FX4A 3AV9A 1NGIA 2XZTB 1EKRA 3R6MA 1KQKA 3U1LA 4ERDA 2NXCA 1T44A 2VQEK 4P72A 3U1NA 1R7IA 3MFHA 2QTWA 4JI3K 1UVKA 1PYSB 2A6AA 3RBDA 1X5OA 1S1UB 3WXMB 3S3NA 1HYSA 2A1BA 4TU8A 4WPAA 1KC8O 2V8VA 2KI2A 3L4BC 8ATCB 4K8RA 3BB5A 4TY9A 1NH7A 1BQMB 4DV4F 4JKGA 2BTFA 4OLBA 4DI6A 4U67Q 1JJ2M 5CZXA 5K8PA 2YCHA 1BQNB 1EP4B 1LK5A 4H5RA 3PJXA 1RT4B 2H54B 2MPUA 3BBBA 5F3ZA 4P2XA 1M0SA 3DLJA 2Z56B 3LP2A 2MTLA 4DV0K 4ZITA 4LVNP 2UXDJ 4ZHRB 2WVFA 3FLCO 3SQ1A 5ELZA 4O55A 4N7TA 2DB1A 3K9JA 1JXEA 3W64A 1XN9A 4DV7K 2CZVC 2MKYA 2KM8B 3CF5L 1WKJA 3LPYA 3AVCA 2HHSA 4DV7J 4N56A 1WOPA 1JLAB 3GIIA 2MHEA 4LT6A 2I2YA 3Q8PB 3BSOA 2HHUA 4EUVA 4A2BA 1JK9B 5C2CA 3CM6A 2B56A 2CNNB 2NRVA 5CYMA 3VAHA 3VA0A 3ZX2A 4ETXA 4CZKA 3CDEA 4PCQA 4ZVPB 4PR6A 1BU6O 2FF6A 2MB0B 2I7NA 2P6SA 1HLWA 1RDWX 5L1LA 3DGVA 3W62A 2I6WA 3PEJA 3OHBA 1C0GA 3MM8A 4IOAQ 3C14A 3PKYA 1L3UA 3P5JA 3SJHA 5BPLA 2PGCA 2KYZA 2D9OA 4CFAA 4DCJB 1S59A 4BDPA 4UF4A 1W0HA 2YI1A 1WUAA 1NRKA 4NRTA 2VOPA 2CAJA 1HWLA 2G2YA 4L3QA 1WWHA 1K73T 2N3OA 5BYSA 2B6AA 4ECUA 2XWYA 3BKTA 3OUYB 3KMQA 1YVFA 1WI8A 4GO7X 1U0HB 2HQFA 4NXNK 2ZJQQ 1YT3A 4RL1A 1LFPA 2AJ1A 4IO8A 4UUWA 3OVAA 2DGSA 3U9DA 1MWQA 5EX3A 1RWWB 3UE5A 4NA1A 3KDOA 4ZLPA 5BYRA 1VSHA 2ACYA 2BW2A 2LECA 1HWKA 1XR7A 2XS2A 4ZPVR 3U6FA 3KJVB 5CQGA 3RMDA 5KFDA 1XEZA 4Z4HA 2DCUB 2A5XA 2NZTA 1EETA 3C19A 3NNCA 3R6LB 3W5YA 2UU9F 4CJ4A 3M30A 4OYBA 3CO9A 1EX8A 4CESA 4OQJA 5GADU 5DZ7A 2OELA 2F7TA 1N36K 3H45C 4HT5A 2FGCA 1W97L 2QWRA 1J5OA 4KTQA 4DR2F 4HWIA 5FPNA 4F3TA 3S7RA 1HYSB 1BDGA 3LAMA 2IFXA 3MI7X 3ETOA 4H4MB 3KJVA 3HJFA 1RADB 5C2GA 2E9RX 3MEGB 1APSA 4LUBA 1SC6A 4OJHA 3JAMY 1BHLA 2I7PA 3OSPA 4ES2A 4P75A 1VQLN 3LP2B 4B1ZA 1WN7A 3FUYA 4MO5A 3EM1A 3G4SS 2CQHA 3BR8A 2ZBQA 2D0OA 2PBDA 4FZVA 4DV4J 2WONB 3M8SA 1M5VC 4O3RA 5D3GB 1Q9YA 3GONA 1ZAVA 4PHTX 1RWUA 1D5AA 3BQ0A 4NYOA 1F5AA 2ATCB 5DMRA 4ZP8A 4CHNA 2ZH3A 4BRIA 4RG8A 3HI0A 4WYLA 4PA1A 3VZHA 4RW4A 1H7WA 3V6JA 1Q86T 1KXPA 4WQ5C 3GV7B 1NDCA 4DV6K 1FRKA 4IBNA 2PI5A 3V6HA 2RN2A 5J2MB 1YGYA 3QFWA 4EYIB 1QUPA 1NOYA 1U1MA 2IGIA 4LFBJ 1XIQA 4QR1A 4J9PA 2OD4A 1H38A 4BLGA 2GAGC 1K73O 2R2SA 2K7KA 3ZXWA 3JQJA 2LA4A 1T3OA 2ASOA 2CQ4A 4KO0B 2M4MA 3LPTA 4IKFA 2BQ3A 3EZ5A 5IQ6A 3VGTA 2YH0A 1WNSA 2DR5A 4Q8FA 1TKZA 1EKSA 3PR4A 4DS5A 2L9DA 2HHTA 5E7OB 3OV7A 2BRKA 3TAEA 2MDAA 3D2FA 2GZOA 1Q8LA 4JKGB 1GOCA 1VQ7N 3V4MA 3R1XA 3W8PA 5LMUK 1VRUB 3A3PB 1GXLA 3U8XA 1EP4A 5HROB 2EKYA 3CJ9A 3QT6A 5EVZA 3T5KA 4KH6A 4DF4A 2XMWA 3RRKA 5KT4A 1HW8A 3H4BA 2ZD1A 2OFHX 3B54A 3TEGA 2C2MB 3ENWA 1RBUA 2RHKA 3QJJA 2M3DA 2AZ3A 5AQYA 2P9SA 4N8NA 1B9DA 1SCJB 3W65A 2HK3A 4FNIA 1BG3A 2PIIA 4JKBA 1OMSA 4X4NA 4CIOA 2HGNA 1N5YB 4ZVOB 1WBBA 1QSLA 1TQLA 2DR6A 1FD8A 2B9YA 3F0NA 2G0CA 2RD5C 2MKHA 4ECZA 1FW6A 2LDIA 3NGSA 3MAAA 4LF7F 2DNYA 4GKKF 1VRTB 3VQQA 2P6TA 2XM3A 2KXFA 3AFGA 2FDNA 2FLNA 2J8AA 4ILMA 5TKYA 1BIZA 1QVGM 4ZCLA 4QR2A 4ETZA 2VQFF 3V1QA 3SMZA 4H0XB 3VEYA 4B9QA 3QZ7A 3CC4S 1BIUA 1H0HB 2ZGYA 1DTQA 1K0VA 1LCUA 4DTXA 4M5DA 4USUA 2B51A 1BISA 2V8GA 3KDNA 1PC5A 2OPPA 2E2PA 4GMJB 4O3SA 5I4MA 3MMBA 2AF6A 4HHTA 2AV5A 1CJUA 3H3NO 1XMQK 3BGOP 1TL1B 1IQZA 2VICA 4GRSA 2VDHA 2UUCJ 3ZSYA 3TUIC 2KG0A 2BE7D 2XI3A 3P6YC 4F4KA 3Q86A 1HBOB 1RDRA 1IJEB 1JIHA 5L1KA 4CLYA 2Z57B 3HM8A 4WP3A 1LK7A 3ENOA 3MUMP 5GMDA 4DV3J 3BJYA 3GFZA 3CG7A 1OH7A 3VERA 3M6WA 2FJXA 3NS7B 2EHGA 1OYDA 1YIJN 2R2TA 3KMSA 1V5IB 2BEFA 4KI6A 3DGPA 3SNNA 4OPHA 1V5VA 5I3UA 4R8UA 3A8KA 1N6QA 4LF4F 2CPJA 4KH0B 4C8OA 3IAM9 2OPQB 4FYXB 1E3MA 2YHYA 2N4CA 4IUFA 3DRYA 3AOAA 4CNZA 3HVWA 4LFAJ 4G3IA 3D1QA 2DGQA 2XSJA 4CLKA 4ZVSB 2VFVA 4K2XA 5L39A 3QRRA 2VB6A 4C9DA 2D69A 3H1VX 2X51A 4M7XA 3CULA 3OYFA 1SJQA 3D1HA 1ZBUA 3MFIA 1FE0A 5CYQB 3O3FA 3HVAA 5LJWA 2VBWA 3GTYX 3A4TA 1FNXH 5T7LA 3DXMB 5H9EK 3QEPA 1NDPA 4JI0K 3J81j 5CD4A 2IM2A 3AD9C 4DHYA 2DHXA 2PAVA 2VH7A 3P39A 4GO5X 1WAJA 1GH8A 3TWHA 4FJNA 1BA1A 5C7PA 3M2UB 2UP1A 1GK8A 1HMVB 1R6YA 2YKQA 1Y10A 4JI7F 1FXDA 4FWNA 2CGLA 5G0RA 1TMJA 1DZ5A 4OYWA 2BGGA 4YDDB 4DUZJ 4OVLA 3NDKA 2HHHJ 3K58A 5AQTA 5M1KA 5AQZA 1UVMA 2YKOA 3AO5A 4FPBA 5ETSA 1XC3A 4JKFA 1TZ0A 4KTWA 1S1TA 1XNRF 1JLBB 3DLEB 2J0SD 1J54A 2J6SA 1J27A 1WSHA 4DJBA 3QMQA 4HACB 4ILJA 3C6UA 2E1PA 3IXQA 2MZJA 2W6KA 1T9UA 2VKZG 3BF1A 3RWUA 1PAEX 3MR5A 3CQ8A 4CERA 1ZOTA 4FKYA 1HBUA 4DTRA 3NOCA 4DDFA 3P96A 4FS1A 3C15B 4FP9A 4FZYA 2ZZMA 4JI5K 1S6OA 4QBUA 4IH5A 3DWLA 1P27B 1FDBA 5KFTA 1QE1A 3CQYA 4M63A 4F0MA 4DPOA 3CB4A 2JDJA 4CHQA 1OY9A 2W01A 4KR0B 4OYPA 5DQIA 1CULA 1LQ9A 1EXQA 5AQXA 1M5HA 4Z4EA 3PV8A 4HYKA 1U04A 2RQKA 5AT1B 1F5CA 4BROA 1P90A 3H25A 1WD6A 4DU8A 1WKLA 4C11B 3JXOA 1HWIA 5GAEU 4U7BA 1OH5A 4FO0A 1REGX 4BR5A 5E84A 2WVBA 4PZVA 5ETOA 1OVYA 2GJ2A 2J9EA 3PX4A 4NMLA 2QEXS 4M5MA 2AD9A 1HBNB 1OSDA 4B9MA 4BRAA 1S4EA 4ZVHA 4CF8A 4DV3F 1FE4A 4HTIA 2DRAA 2AYGA 1WORA 4G65A 5HL7Q 4G9ZA 4OZJA 5AXNA 2D0CA 1RP5A 2HB5A 1FI4A 1U1OA 2EWSA 4FXVA 3QLHA 4KSEB 3CFPA 2B0GA 2HFZA 3ENAA 2B4JA 3HHEA 4X4TA 1TL3A 1ZH5A 3H6EA 4NWBA 4YY3K 2PYJA 4K59A 3HZEA 1Q4RA 5CYQA 1VQ4N 1NJWA 1WOSA 1BMQB 3OTOJ 2M0GB 1KQGB 3AXKA 3A1YG 4O0IA 1V4TA 3H4DA 3HZ6A 4DZ6A 1WOQA 3EMTA 5D8HB 2B4OA 1IBKJ 1J9AA 2F8EX 2MY8A 1TVRA 1UL3A 2IVFB 4NYPA 2WTFA 1YITS 1VIXA 3VOVA 5IZHA 2ZH4A 4B3TF 2LXIA 3S1TA 2ROEA 4OZNA 4A62A 3AGRA 2ALZA 3AB2B 1Q81T 2D74B 4LF8F 3FZKA 3T41A 2Q3SA 3DLBA 4FJLA 2WBNA 3L09A 1HKBA 2DEIA 4O3QA 2EFPA 2CQ1A 4I7FB 4CZMA 3GR1A 4CZFA 4DV7F 2J5AA 2KZMA 5E0OA 2N82B 1WC5A 4PQAA 3AAWB 4CEEA 2DBBA 1G4CA 4O0JA 3MCAB 2KO1A 2JWKA 2R2UA 3BF3A 1JLEA 2G8UA 4EU0A 1WSIA 3MN7A 5CH7B 3AGKA 2ATQA 2L08A 1GXUA 1YIJS 1RT4A 4WP8A 4DV1F 3I4HX 2YWEA 3ZETA 1OQ6A 5JXSA 3D3CJ 4FLYA 3LANA 2RHQB 1VDHA 4ILHA 4A8YA 4GVBB 1AW0A 4BE1A 1D09B 4BRHA 1N32J 1NSKL 3FC9A 5CA5A 3PYFA 4DR7F 3PX0A 1QDUB 3QRPA 1RKJA 1SZ2A 4B3RF 5KFSA 2VUGA 4DV5K 3DN9A 4P7VA 5KQDA 3DLGB 2XG8A 1BGXT 4NLVA 2V8DA 3G25A 3CCZA 3EVMA 4E7LA 2FC9A 2F9TA 1WI6A 4RW6A 2ETJA 3QSIA 1FRJA 2ZC3A 4LFCJ 4ZKAA 3P5BP 4J37A 4NXNF 1RBSA 2DTUA 4M1KA 2I38A 1S99A 1B0TA 5L8RC 5E3RA 3RG6A 2CQDA 2LXUA 1UEKA 2DR9A 2IRXA 1SAZA 4NLDA 5KG5A 4A8KA 1ZYQA 4CJLA 2RB7A 1O6XA 4QIVA 1U1KA 2M7SA 4OZ0A 2R7WA 4J9SA 4F2SA 3SDEA 2EFQA 1B64A 4P6QA 4DBQA 4PXBA 3SQ2A 2MJNA 4DU4A 2R7YA 3RRHA 4YOVA 4CFCA 5BYQA 2OJ3A 3OHAA 4JK8A 5BR8J 4USKA 2DRDA 1N5YA 2D3O1 4ED8A 4YN3B 4DR5K 1XK8A 2CQCA 4C2MA 5KOXA 3DRPB 4IOXA 2RKIA 3LDSA 2ASDA 4DR2K 1X4GA 1YTUA 2C22A 2PZSA 1YRXA 4Z4GA 1RCOB 4KHQA 2GELA 4C0HA 4ANEA 3KK1A 3ILLA 1V3RA 1C1BB 2OMLA 2KU7A 4J2BA 2E1RA 1RE1B 3N6MA 4FJ8A 2HQGA 5AQOA 4PYDA 4L3KA 2W7PA 2WW8A 4PPZA 4CE9A 1HR0K 5IWAF 2FC0A 5HATA 1YJVA 2J7KA 1VK0A 1GLBG 2LU2A 3V1RA 4URGA 5F0UA 4BWMA 2OIHA 1LXJA 4H5NA 3KLIA 4EFHA 3WXJA 1ICEB 3EO3A 1B7FA 1KVJA 3R9PA 2ZHBA 1QUVA 3OBWA 3CD0A 2IJRA 3AJDA 4LF9K 3RBEA 1XWLA 3JTNA 4GC7A 1HR0J 4DTPA 3MM5B 1RSCA 3OR1B 3DXSX 3TQ1A 4BC3A 4DHVA 1HWJA 2HHXA 4YOTA 4ILLA 3UW1A 3FMBA 5LMNJ 2VQFK 3Q24A 4IO9Q 1NGJA 1S77D 3ZT3A 1JJHA 5HROA 5JJBA 4KV8B 4ID1A 4TQSA 4OZ1A 4MH8A 3JQMA 1CQMA 1EARA 4DR2J 1MDUB 4MKBA 3ICLA 3UCGA 2E2OA 2IAJA 1D9AA 1GMVA 4PEOA 1HJRA 1DFDA 3MXMA 1O13A 3KHYA 4U67L 4KBOA 3NRBA 5AJ3F 4M42A 4PWDB 3QBCA 1JQGA 2ZHAA 3G86A 3AA9A 4QIGA 5EX5A 4HI1A 2FBVA 5K5MA 5HJXA 3EEQA 4RW6B 4FF2A 1QD1A 1SKUB 3IGNA 1UW9A 2UV8G 5D4NA 4DLGA 1REVB 2YTCA 4BRCA 3CT9A 1I39A 3CJQA 2QN6B 4MKAA 4LRCA 2O1PA 1Q79A 5AFUH 4DTSA 2K7JA 4CH0S 2VBYA 1PIEA 3TU5A 3R9LA 3TJ8A 2E2NA 5IFMA 2GCFA 4WKRA 1S72S 3IAS9 5IT4A 4M94A 3I5BA 3FJ2A 2E5LF 2RILA 4U7UK 1B3TA 4HDGA 3RSEB 4DPXA 3ZSWA 4NZ0A 3QT5A 4LFCK 2CH6A 3G82B 1QE1B 1Z25A 2UXDK 1B0PA 2GBZA 1S79A 2AGQA 3VAGA 2YNFA 1GX5A 5DGBA 2EFGA 2UUWA 1RBAA 4JUZA 5DM6Q 4Q0BA 2HMIA 4NCBA 4Z94A 3QBWA 3MX2A 3TJAA 2MKIA 3AQPA 3OVNA 5D78A 2HW3A 3AJ1A 3DOKA 1GX6A 2WSEC 2J9DE 2PN6A 1RBRA 3BREA 1SJ4P 2HQIA 4CHYA 3JYTB 5BJRA 4MKVA 2D1CA 1DTTA 4FLTA 4WFYA 3HP9A 4O8UA 1ZPVA 3HK2A 2BKOA 1KSPA 3M30B 2D4WA 2V0NA 2HNZB 2Q6CA 4DQQA 4H8KA 3C6TA 5AZJB 3FVYA 2XGQA 3LOUA 1G6BA 5ADZA 4R79A 3VEOA 4CK3A 1BWEA 3N01A 4MIBA 5M1NA 5KT5A 3KKFA 3NCQA 3UDCA 1BOTO 1OH6A 1S1UA 2E5LJ 3ENVA 3POTB 5EWEA 2Z4PA 1YJ7A 1SL1A 1OO0B 4IEIA 1CS4A 1QVFR 3L4IA 4XPCA 2CDQA 2EFNA 4PQUA 2B4PA 3TAMB 3MCOA 1DAXA 2DGTA 2FY1A 3JXUA 3ISZA 3LH2S 3FZ2A 4CK2A 2B4VA 4PUOA 2MQQA 2CZ9A 1BQMA 2K2PA 2UUBF 2P1JA 1S9GA 3RB6A 4J9NA 3WUHA 3WIVA 4K0KJ 3EN9A 1HWUA 3FCWA 2XMJA 2B3TB 3EKSA 2C3YA 5FD1A 3VN5A 1XQSC 2CQ0A 1DURA 4DCHA 3G6YA 4E3SA 2VWKA 1JWWA 2GVZB 1LW2A 4H5VA 3QEIA 1E4FT 4P2MA 2O8DB 3WHIA 2CJXB 4JI4K 1VQYA 4CW7B 2LQBA 2RAQA 2F96A 5FLXY 2VG7A 4BRPA 3WDOA 1WSRA 4JI0F 2DHGA 2V5HG 3UKUA 4H0OA 5B0EA 1N6QB 1JJCB 1KVKA 5E33A 2MQ8A 4E1NA 1QVFM 5I9EB 4I6MA 4M5HA 2YBVA 4O3NA 2VFRA 3PYEA 2GNKA 2JL9A 1CJVB 3K0SA 4WZMA 3FGUA 2XO6A 1KFSA 1TUUA 2V8HA 4BR2A 3CJ7A 4Q7AA 4DL2A 2G4BA 5AZIA 3NNHA 3R27A 1XNQK 4A48A 1P9QC 4C1NK 3TZXA 4LC9B 2P9PA 2VPYB 4MMOA 3ISNC 2JWLA 4L72B 2K06A 4DFKA 1N33J 4YHHK 3AO3A 1YK9A 2A2CA 3AY0A 5C2FA 3TO8A 2NSBA 3ULEA 4EP4A 4C8KA 2YWWA 1X4EA 3VQAA 2CG8A 1J53A 3A5NC 3DDKA 3ZSQA 3AY9A 3ZX3A 3WBZA 3DC2A 3OFEA 5I3UB 4R8UB 2HK2A 2MQLA 1BI4B 3U9ZA 5GIOA 3FK4A 3SQGB 1IBLF 4HVZA 4GVMA 3MXHP 3RU0A 3WZ0A 3VENA 1NGHA 5KG7A 4FF1A 1T3NA 4LFBK 3K8WA 5HQMA 3K5PA 4NZ6A 4H5WA 1HBMA 5HMXA 3FRZA 1HYZA 4NLTA 4ECYA 2CNLB 4C3LA 3VPZA 2V6AA 1MMDA 2B8PA 3CD7A 1S1VA 4F4ZA 4F02A 4B3TK 1X9SA 4ANCA 1U0SA 3O9RA 3OYLA 3VAMA 1TL1A 3H5XA 2OZMA 2KHDA 4J9VA 1N32K 3D2FB 3OA9A 4C7QA 1F3VA 4CGFA 3TARA 1HNWF 3F9KA 5KGWA 3UN3A 4MLHA 4Y3CA 3TUPA 2DPJA 1YVUA 4FDFA 4KGZB 2CIMA 4ZOSA 1NK0A 3TTCA 3L3VA 4LRAA 1KLMB 1X4AA 4IG0B 5HVGA 4RNMA 1UEVA 4Y65A 4FM2A 1B7YB 1QZ5A 2HFSA 1VAZA 3OXGA 3TANA 3HPGA 2VL1A 1KLNA 1K6YA 2XZWA 1QHTA 1N56A 1EJ7L 3CSKA 3D2EA 2IIRA 4OZ2A 3DM2A 4WCEQ 2NQPA 4ELVA 5LSRA 2G1HA 5KT2A 3U4LA 1X4CA 3P38A 4PWWA 3CCTA 4J9OA 1CQNA 4CH1A 1SQKA 1RTIB 1RBLA 2DTJA 4QWDA 4RW7B 2LQ5A 4FVCA 3DKDA 2WVDA 4ZLJA 1BA0A 4MKYA 2P9UA 4LIRA 3QWPA 2H5IB 2FVQA 4CO5A 5DDPC 4AHRA 4WE1B 4DV5F 4DLEA 3GP9A 1V9OA 3MK6A 5EHHA 4WU3A 3AVGA 1PILA 3ZZRA 5KFAA 1SL2A 2F4VF 1HNZJ 5AQRA 1TV6A 1OY8A 3O4WA 4NX9A 1C4AA 3C95A 4QPXA 4O44B 1QSYA 3EICA 4KHPJ 4CJVA 4I0WA 1X7VA 4S0MA 1Y5NB 2O8BB 1CG2A 2VQEF 1TGOA 5J2PB 4TVAB 1FEEA 4Y1CA 1WB9A 4O0NA 4B1WB 2A1SA 4GKJK 2MSTA 1TK5A 6AT1B 3IC1A 4JRQA 2AP6A 3KIOA 1ZM4A 2QT7A 4DL4A 5IM0B 2UUTA 1CS4B 3UI3A 1QLNA 4LF8J 3M8ZA 4DTNA 2RVJA 2XZDB 3NXZA 1AA1B 4CVNE 3RBXA 4P7TA 2DNNA 2UU9J 1K8AT 3NH2A 4DTJA 2VFSA 1L5UA 3D0HE 1NKCA 1F1BB 1B4SA 2MKCA 1UEUA 3KG4A 2QIFA 4L75A 3NMUA 4BQZA 3D7EO 1SH0A 2JH3A 2ZH6A 3W63A 3IO1A 4RZRA 1RDBA 2IM1A 4RBTA 1JJ2R 4NLRA 4ZVUB 1ZBIA 3MMCB 3CCUN 4FOEA 4ED1A 2QWLA 3OTOF 3PW7A 3O6WA 4Z7YA 3FSYA 3W66A 3GV8B 1C0TA 4HCCA 3CERA 2V2VA 3VQDA 5F8LA 5KFLA 2OUGA 3J7A1 5F0XA 2VDIA 4JOUA 3MR6A 5ETTA 4H4OB 2QSWA 1KAZA 5M1OA 4Q0BB 3UCUP 2N7CA 3HX9A 3V6DA 2P9NA 1Y3JA 4QIWD 1Q16B 2MLZA 2D9PA 2QFIA 2NLWA 4ED5A 1NU4A 3CJSA 4ID8A 4NOHA 2KRBA 2KKZA 3IG1B 5B0DA 3LGHA 3RZAA 2YJEA 4F9OA 2YNIA 3HPHA 3HSTB 4DR1J 1YUWA 5H9FK 5JVHQ 2NRTA 3MOZA 3N4PA 2YXLA 1WACA 2BMBA 4KQZA 2QWPA 2IY5B 3N6LA 1X4BA 2C2ZB 1CULB 4ZIWA 2FZKB 3QJPA 2QX0A 5AQPA 3BP8A 2BANA 3OYGA 4B3SK 5CHIA 1YSJA 4M5GA 4USTA 3I5AA 3BGRB 4NEYA 4CQ1A 2YWGA 1FRHA 1LWCA 2YV0X 4YORA 2G2ZA 3POTA 2W25A 4C8NA 4BRFA 3GYNA 2FVPA 1G99A 2PD1A 4ZTFA 4Q2MA 3Q8YA 1S3XA 4X62K 2BJEA 4YP3A 1WHYA 4F26A 4HL9A 4A8OA 3MECA 4PAAA 1SH2A 4CHOA 3U02A 1FEHA 2HNYA 4LF9J 4NXMK 1Y5IB 4IZ9A 3ID6A 2DIUA 3KLVA 3LTOA 1SUQA 3VQCA 3P31A 4E1MA 1JLAA 4RNHA 3ZCMA 4O44A 1U4BA 2AA4A 1WHWA 3R8EA 3K5NA 2F1FA 4JKHA 2JEGA 4LF7K 5HP1A 4OI2A 3C15A 2CPYA 3OYKA 2UV8A 2OEJA 4FPRA 2ZJRQ 3OVBA 2E5LK 4C4WA 4C11A 1LW0A 4DR1F 1FF2A 1N36F 4DL0C 3CWJA 2RE2A 3F2KA 4C97A 4B02A 4WZQA 1XMOJ 2HHHF 2EFVA 4IJAA 4QS7A 4QU7A 4OMFG 5AQKA 1PBUA 1VISA 2E8AA 3DRSB 5DG8A 1UJ4A 2RQ4A 2F7VA 3A3NB 3ZO7A 2VHGA 1NOZA 4MDAA 5ETNA 4BWJA 3TOQA 3LWLA 2V9WA 3IRXA 1C1BA 2O01C 4FBUA 1AYEA 3CCES 2DHSA 1KAYA 1VRTA 5A6WA 4FYDA 1RAEB 3MAHA 1VQ6N 3FFIB 1U24A 4KB0A 2IJFA 4A5AA 3W3SA 1VQ5N 1WELA 4I2PA 5DO2A 2VF3A 3IMXA 1I51B 1EWQA 1GMUA 3ENQA 4DV2F 2CRLA 4DX8H 2UUAJ 1X3NA 1XNRK 3ZTPA 1I5OB 3IM9A 3E3XA 3U27A 4NL5A 2P9NB 4DTOA 4FWSA 4J9RA 5B0GA 3KOAA 4IR9A 3VA3A 4AT1B 4ECSA 4CZLA 2ZWHA 1HW9A 3NOGA 2VJUA 1Q78A 1IKWA 3D4JA 3QICA 2BA9A 3NWRA 4M3RA 3G87A 3THXA 4RPFA 3RR7A 2FHJD 3LZJA 4ILGB 3AAPA 4OYXA 3F56A 4OGEA 1NHUA 1X5PA 7FD1A 3DRXA 3HVRA 5CZ2A 2OMOA 4LF4J 1YJ9N 2Z2ZA 2KT5A 4X2BA 1U25A 4NI2B 4OI1A 1HHSA 3N79A 5BR9A 4QYZK 4UOHA 3KLFA 2E2QA 5DQHA 3ILIA 2PFUA 2FJDB 5AQHA 3DDIA 3CCEN 3MDQA 3CF5Q 4DR4F 1WSGA 1C0TB 5HQ8A 1JLCB 2COLA 2A10A 3MUTP 4JP8A 3HDSA 1SIWB 1X31C 1ZA2B 2MLYA 3IDHA 2PMHA 3C65A 3H2LA 4B3SJ 1NHVA 3T1HJ 3HSDA 4O5BA 4DQRA 2Y0SD 2BACA 3CJCA 4RNNA 3TQEA 4WWSA 4H03B 1QJHA 4KGKA 4FPAA 4CF1A 4LREA 1XMBA 1WHXA 1K44A 4EZ9A 1TKDA 2VASA 2UYTA 3VVTA 1SVDA 2DHAA 3KFWX 3MWPA 3MM9A 4UQTA 4ED7A 1VQ8S 2F8SA 3S41A 3DLRA 3PW5A 4W5TA 5DLFA 4HTLA 2LCWA 4AH9A 3CM5A 4WE1A 2XEXA