4KO1S

High x-ray dose structure of h2-activated anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
279
structure length
279
Chain Sequence
AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEGEMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFGDNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNGINWCVENAVCIGCVEPDFPDGKSPFYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Periplasmic [NiFeSe] hydrogenase small subunit
total genus 82
structure length 279
sequence length 279
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ko1S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ko1S02
4CI0B 5JSHA 1YQ9A 4UCXA 4UEWA 3USES 3UQYS 4IUCS 3ZE9A 4KO1S 2WPNA 1UBKS 2FRVA 4UCWA 1WULS 1YQWA 1CC1S 3ZE6A 3AYZB 4U9HS 4UE2A 4KO3S 4UEQA 5JSKA 5JRDS 5D51S 3ZEAA 1H2AS 4UE6A 1UBJS 4KL8S 4URHA 4UQLA 3CUSA 1WUHS 4UD6A 5A4IS 4IUBS 5JT1A 1H2RS 1FRFS 1UBUS 1YRQA 4TTTS 4U9IS 3H3XA 1UBRS 4KO2S 3USCS 5ADUS 3MYRA 4IUDS 5A4FS 4C3OB 1E3DA 1UBTS 4UD2A 4GD3Q 1UBLS 3ZE7A 5JSUA 3ZE8A 5JSYA 4UPVA 3CURA 4OMFG 5A4MS 4UQPA 4UCQA 1FRVA 1WUIS 4KO4S 4UPEA 1UBHS 3AYXB 4UE3S 3RGWS 1WUJS 1UBMS 4KN9S 1WUKS 1UBOS
chains in the Genus database with same CATH superfamily
4FOPA 2RHLA 3FKSD 2XXBA 5EXDA 1EHCA 1SURA 4H3SA 1XUOA 2IHVA 4MS3B 1R4NA 1EUZA 4WZ6A 3UUWA 4L57A 3A1FA 1O9HA 2IXBA 3DO8A 3HEMA 3E2IA 3O2SB 1P81A 5LUAA 4D4IA 1EVYA 2IPXA 2A30A 3K0CC 2XUHA 5JT1A 1P44A 4ZVSA 1DEAA 4AZWA 3P2OA 5DHRA 4FU0A 5JAUA 3MYRA 4X95A 3LV8A 3PNSA 4HBZA 5D6NA 1BS2A 4MUFA 2FU5C 2WUWE 1R50A 2VDMB 2XIQA 4W9RA 5JSYA 4RVGA 3OZCA 4TQAA 3IPRA 3OM9A 3RVDA 3UAWA 3C5VA 1CJKC 2HLPA 3QX9A 4PS1A 3UHOA 3LRPA 3RGWS 4KWEA 3IR5A 1XZMA 2QLMA 3IT2A 3KQTA 4F6LA 4X66B 1UR5A 5IDWA 3KSRA 1JIIA 2BFFA 3STTA 3MS2A 2FUG1 1LLFA 4KIWA 5DXFA 4H6WA 1L6IA 3SIRA 2ZZNA 1LSSA 1ZY2A 2E5WA 4RC9A 1FUUA 1OI7A 4J0HA 1EUDB 2K2QB 5JHHB 1GNSA 2EC5A 2Z58A 4XLTA 3DXFA 5KYGA 4Q9LA 2I9PA 4PC1A 2J1LA 2JHFA 1R0LA 4PO3X 2ZBRA 3CO5A 3GT7A 1M6WA 3GK3A 2WU0A 3PJEA 2FP3A 3P45A 3LBYA 4RLFA 3VM6A 3QIAA 4B76A 5IWCA 3JS5A 2Z8XA 1OFVA 2OK7A 4Q00A 5C8YA 4CN8A 4P81A 4RZSA 4AO8A 2NUPB 3BE8A 1E20A 3AP3A 2Y9PB 3N3BC 3O4FA 3OTHA 4IIGA 4DXDA 4ESVA 2R9VA 4V2UA 3UB2A 4EVQA 1OYVA 3UAZA 5J59A 4J90A 1GD1O 4K9DA 3WA7A 4JUIA 1DUIA 1CS0A 4LWZA 4NZPA 4Y2RA 3RUIA 1GAWA 2DYKA 4RXTA 2GHRA 4MV3A 3NYQA 3FOWA 1SBYA 2HK8A 3RBAA 1M1UA 4C29A 1WVGA 4D3XA 3LDAA 4LI0A 1PI3A 2QPAA 4WVFA 1C30A 2J32A 2FK8A 1HQDA 3G8BA 5FT9A 2YNMA 3F74A 2IV7A 4AJ9A 4F9TA 2AFRA 3FLEA 1BA3A 3A9UA 5C3UA 2OQVA 4BGDA 5DTMA 3PFGA 1NG1A 3CEPB 3KL2A 2UYOA 4HWRA 4IEFB 3V7FA 2WFAA 4BP9A 3HXTA 2ZJFA 2P6UA 5FUBA 2ZRIA 4CQLA 1JIQA 5SV2A 5LLDA 2REOA 4V0SA 4DSNA 1C1YA 1RXYA 4F1WA 4TL8A 5E6RB 4PX3A 2C4NA 3K31A 5C37A 3IV9A 4NYIR 3QA3E 1V3UA 1ECLA 5JVDF 1TMOA 2P3QA 1A9PA 1NXXA 2V9ZA 3EZ6A 3BCRA 1XRJA 3GFGA 2G36A 3OE7A 2NXCA 3EA5A 5JMTA 4MW2A 5NULA 2HV8A 1IM8A 3LK6A 4JIMA 5IM4F 2PUGA 1M8GA 4A6PA 2YQ5A 3AM4A 4O4JA 4TZ0A 5BT9A 5E4YA 3QX3A 1G7CA 3BXFA 3N8NA 2QT9A 3KQMA 1B14A 2JIRA 4BLRA 3MPUA 3VHLB 4G3XA 4MS1B 4QREA 1WXXA 1W47A 5JV5A 3EQ6A 4B73A 2RGNA 4YDSA 2V59A 3C0KA 3KE9A 2VP0A 2C3PA 3PWSA 3QLEA 1ZHHA 4U2GA 4EW2A 1UANA 2W90A 2D2FA 3OA2A 5KC9A 1ZUWA 4AJLA 5JS7A 4RTOA 3PFBA 1HUQA 3KZNA 1F0NA 3VPCA 4UTNA 2M32A 3DKPA 1H6AA 5ECWA 3L7YA 4NNPA 4J6EA 3EXHC 2O7NA 3I09A 1OJ7A 2H0RA 1J9GA 2Y1OA 4MYRA 1J2EA 3M1LA 4KI7A 2OB1A 4R83A 5FQNA 1LW6E 2Z83A 4KOEC 4KQHA 3RHSA 3RBVA 1IEXA 3LWNA 4K7JA 2O2CA 3W7AA 1R8JA 3TLAA 3UMMA 1GPNA 5DP2A 1BOOA 2B1JA 1EFPA 1PK8A 2HRRA 1ZYUA 3KT3A 3T7SA 5CEFA 3GLRA 2D7CA 4BJ6A 3WNDA 1GM5A 4AQDA 2IOFA 2EZ9A 4Q3EA 3KSDO 4DS3A 2UXDB 1RXCA 4RWEA 4R8SA 3TIVA 3ZCSA 3RARA 5FOTA 1GDTA 1R0CA 4F71A 2Q29A 5GMOA 1RE1A 2XBUA 3K16A 4NBVA 4O5AA 1ES9A 1GP2A 1RC0A 1U98A 4X85A 2X2PA 1I3OA 3SIXA 1D2RA 2EYQA 4DJJA 4XYGA 4KRYA 4R1PA 1AM4D 2BMJA 3LC7O 4Y9TA 1ZINA 5GGXA 2BGUA 4QGSA 1QTNA 3TZ6A 1ZJZA 2WJWA 1BX0A 2GJSA 1NVWQ 3N28A 4P93A 3TRHA 3EPJA 4CM3A 5EUMA 5L40A 2HXGA 1DOHA 2ZJ8A 3EFHA 4BX0A 4ZMRA 3OIFA 1CY8A 3GJSA 4BNWA 3Q9UA 2FUKA 3RS9A 4CUKA 3TKLA 1OIXA 1PHPA 2O6LA 4A8JC 3ZJTA 2V6FA 2IUYA 2JGEA 3TGPA 2IEGA 4OQDA 1IY9A 3U4DA 2GM3A 2CBGA 3MHPA 4UBKA 5E6UB 4DAEA 5L3SB 1O9GA 3H16A 3UGTA 1DXOA 1NTRA 1ZD9A 2PGXA 3OX2A 4MVCA 5CDYA 3KVVA 1E2LA 2IHZA 1EUDA 1JHYA 5AMXA 2GRAA 4WLNA 3EFOA 1DJOA 5DLQC 2P7IA 1CUWA 4U2DA 2JJMA 4EW3A 4QG7A 2IH4A 1WXQA 1X2EA 2OZEA 1W4AA 3MUOA 1P7CA 1SBCA 4EG3A 5JWRA 4BECA 3FRIA 1SR8A 2DOKA 4WXYB 4K9MA 3ET4A 4UEWA 2COKA 1U2SA 2ZE6A 3I8SA 3N5KA 5AHKA 3LBAA 3OJLA 3PQ2A 5ALIA 3THSA 4C7OA 5IK2D 2FOIA 2WW8A 1Q1AA 3KFXA 4NE2A 2WD7B 4LGYA 4K6CA 2KPOA 4TMZA 5IWAB 3R5KA 5DBOA 3ORSA 1CUCA 4OQEA 5KSYA 3V6MA 2P1DA 3C1AA 4O33A 2GD6A 3OZUA 4B79A 5CFLA 5DTJA 3I2KA 5JG7A 3GB9A 3G5AA 4Y67A 3VUFA 2I87A 4AJHA 3F3YA 1YS2X 4FQ7A 5D7BA 5EAIA 2ADOA 3QITA 4G1VA 4B8ZA 3IBYA 4NBKA 4QXAA 2WIKA 2PAFA 3H1BA 3VGJA 1PGNA 2UUCB 2CYAA 4A16A 3NW9A 2RBEA 5BYJA 1TM5E 2QRLA 1D1PA 3MRTA 1S8AA 1H5UA 4I5GA 1PVOA 2L2QA 3ROTA 3W5BA 2PKYX 4BKUA 1O54A 2H85A 1VJ1A 1Y1TA 2CMKA 2QY6A 5LCXA 1OX5A 2WG1A 1BJRE 1P5HA 1WD5A 1XLWA 1U6IA 3ZKAA 2K7FA 2OVBA 2JRCA 4JLPA 1V1MA 2WHPA 5JCXA 1QRTA 3AFMA 3N2GA 1DEOA 2AX3A 2YXBA 3O26A 4A6EA 3L40A 1BXRA 1TE2A 1DAPA 3ENQA 1SVMA 1XZEA 2YS6A 3GJXC 1ID1A 2WSSA 3TI9A 3UJBA 4CKBB 2PL3A 4FYXA 2QXYA 5K20A 4TXMA 3U3OA 3VYUB 3K2BA 1PN3A 1V3VA 1YWGO 1ZZGA 5DYIA 4RHUA 4QJ3A 4TWAA 5AVXA 4MPJA 5JSQA 3MW8A 2MMCA 2A2ZA 2ZI9A 3EG9B 3EVTA 1OROA 3P27A 3CZ9A 4Y1RA 1RRPA 1MDFA 4POAA 4IMJB 4NICA 1D6MA 4LDJA 2WIAA 1QSGA 2V5UA 3WHKA 4XSGA 2OP1A 3ANLA 1FFBA 1WDMA 2M6RA 2C2BA 1O8CA 1RD4A 2J46A 3G9QA 3IHWA 3TIIA 4MAMA 2J0UA 4DDVA 1Z2NX 4DDUA 4LCJA 1DHTA 1EFCA 2LW7A 3D6FA 4Q4LA 3TNDA 4A73A 4DV3B 4XWYA 3MRSA 2YWRA 4F5ZA 4OFZA 2GZMA 1P2VA 5F4ZA 1U0RA 3C3DA 3JV7A 3NHYA 3S27A 4OJYA 4RVSA 1YJXA 2I1VB 2FCAA 1SBIA 1XEWX 2Q3MA 2XZTA 2DU8A 2QMHA 3A3KA 2AI3A 2OO5C 4YRQA 4P5DA 1KJIA 4HYQA 3KU4A 4V0KA 5E6SB 3VNSA 3WGGA 5I7RA 4HAWA 3OX3A 3RSZA 3KZKA 3QMMA 1M34E 1VBMA 3UEOA 3KV1A 2O7QA 2ADMA 3A4YA 3KJZA 3REQB 1DKNA 1DQSA 1C4WA 3SYMA 2ZRLA 3RSCA 1L1EA 4CNBA 6AT1A 4N5HX 4Y30A 1MH9A 2Y3IA 4QTXA 4IUDS 4GZ5A 1GY8A 4LECA 2A67A 2QW1A 1XTBA 4XB2A 4D5GA 3KQQA 3L79A 4CL3A 3ASVA 2PH1A 3O31A 3Q98A 4UNQA 1S2NA 2Z4RA 3SCZA 3DNPA 4TROA 4D7AA 4KVAA 1ZIYA 2XW6A 1T4GA 4CFYA 2A6PA 4RACA 4EB6A 3FNFA 4KO1S 3WIBA 5JMWA 1NI5A 1T3GA 1OLUB 3FVRA 4JEUA 5FB3A 2ZJ7A 2QD4A 1KY5A 3PFHA 3UWPA 5F4BA 1DAKA 3VYTB 1B4DA 3T7CA 4HJRA 5IKMA 4KMMA 4PG4A 5JAZA 4RTNA 1SOUA 2A57A 2G07A 2VQFB 5AVOA 4PO1A 4S1VA 2O8DA 2VRBA 4XQCA 3H3XA 2IV3A 2OZLB 3NV7A 2XWJI 4JKYA 4KXYA 1NATA 5BQ5A 1SUDA 1T5HX 2DECA 4NMXB 4B4KA 4WINA 4EX6A 821PA 1ZK0A 3LVRE 4I99A 4ADSG 2XDQB 3C3EA 4US2R 1ECJA 4YUXA 2I3ZA 3KQNA 1AQYA 3WOHA 2B4YA 2NUTB 2X13A 4MIYA 3BICA 3V1MA 1S3FA 3CLTC 3P9IA 3PU6A 1E2GA 2XSZD 5C51B 1P1JA 2QD1A 2BBSA 1RAAA 3AV3A 2FUG6 5F35A 1QIHA 3K9QO 2CNBA 4U5QA 2V3CC 3GL9A 4NONA 3ANNA 2PFSA 1JL3A 2Y1KA 1DXYA 2OV4A 5BR1A 1AHPA 3LTNC 1RQ2A 5LU9A 2XYQA 3PKZA 3VDRA 3NEPX 3IUYA 1GPDG 1YR3A 3GUVA 2W2PA 1JEYA 3R75A 3TUJC 2VYCA 1OY1A 2A7XA 2R47A 1NBMD 4MI3A 3FPLA 4Y6PA 4YCLA 1IDOA 2B30A 2X19A 3L0PA 4XPIB 1SC4A 3HVHA 4QSMA 4QFBA 4S3MA 2HWUA 2FKAA 4MVJM 4TXHA 3EQ7A 3F97A 1O8BA 3H19A 1I7SB 3DBOB 2DUWA 1PW7A 1G20E 2NPIA 2NU7A 1JT9A 3KOOA 2X8BA 3GEDA 4LVCA 3I0NA 3O4IA 1FP4A 1TFRA 2DQ4A 2QLNA 4Y3UA 3ZV4A 3W9SA 6ABPA 1LWOA 4FINA 4X3CA 4PIMA 3LCCA 2UUPA 1UK7A 1P3Y1 3I3OA 3MC1A 3F3MA 3CMMA 1I32A 4RAQA 4FR2A 3OUUA 5IUKC 1OASA 3UMJA 4MDHA 4Q37A 4D4KA 4DUGD 4FR5A 1SVNA 3G59A 3B13B 4KXQA 3OC6A 2DBVO 4HB2A 4DLZA 2IOFK 3H1FA 4QXQA 2F3SA 3I6ZA 2IQIA 3WQBA 5CDUA 4J1SA 4BNIA 4IJ5A 1MFZA 2Y1CA 4I4IA 4EI7A 2Z1DA 1DBSA 2JFZA 1I2MA 3U6BA 5B3KA 1N9ZA 3IP9A 3CH7A 2BFAA 3AB3A 2XODA 4WSOA 3D9QX 1SXGA 4BNFA 1EBUA 3R6WA 3LFHA 3OY2A 2GUWA 5K5EA 1Z6TA 1MX3A 2FX5A 2H31A 5CIQA 4YC7A 2G4LA 5T4FA 1BTOA 5IXYA 1Q2XA 3RAJA 4TN1A 3HACA 4JYZA 1VHQA 3D7KA 4DSZA 2A14A 3JWHA 6Q21A 2QTHA 1EFRA 1U3CA 1R9MA 2GEFA 1CQXA 1SG9A 3T6KA 9LDBA 4QBFA 1ZHOA 1PBTA 1PS9A 3RS2A 4WFQA 4AURA 4LC1A 3RYIB 5E3IA 4WK4B 1KYYA 1XTSA 4J94A 2WT4A 1HFEL 5HDQA 1ONNA 3IESA 4H18A 2P0EA 3LE8A 3MUEA 3KZCA 3UGQA 5DMHA 1Y7LA 4L4ZA 4ZT7A 2R751 3CQ9A 1QJCA 3ICVA 4BNUA 3PRHA 5A1TA 1X9IA 4LZAA 3ZTWA 1K86A 1SUAA 2ZRQA 3BQ9A 3TBKA 4BNTA 4CIVA 4NJMB 1PNQA 5TVKA 4KAJA 3IQIX 4BZZA 2C5AA 1XRPA 2JRLA 2HM7A 3ENZA 3HB7A 2RKWA 4DLWA 2QPLA 1ECGA 2D1YA 1GYRA 2O05A 1SG6A 3E03A 4M86A 3V1YA 2II6A 4BGIA 4PVDA 3MJSA 4QUAA 4Z4CA 4LDAA 1AY0A 2QVCA 3P0EA 1K7EB 3DF7A 4BTLA 4UJ3A 3OOHA 4R01A 5GV8A 3K4QA 1GKIA 3GLKA 4Y0VA 4AJOA 1RM5A 2WJJA 1VCOA 3EW9A 3H9CA 2G9QA 3ISVA 4OB7A 4TOIA 4YCMA 2BP7B 4NFLA 3A1UA 4M76B 4D4GA 5T3YA 2ZBDA 4N76A 3PVCA 1ZDMA 3W5CA 1CC1S 1VP9A 3OPXA 4AF6A 2OECA 4G8CA 2WWFA 1E0KA 1VRWA 3EXEB 1I1NA 5CTJA 2GF0A 1WQ4A 4MKIA 4YRCA 4DLRA 1ZRSA 3EIHA 3X1XA 3ZDAA 2Q50A 2PRYA 5AWFC 5LA6B 3WLAA 1N33B 3PNKA 4C22A 3PCTA 2QVXX 3DR5A 4IH4A 4UFPA 5KHAA 1E1YA 5ALOA 4MI6A 4FC7A 5K0SA 5EWMB 1WHTB 1WU7A 1XTUA 1L5YA 4EYEA 3V1KA 2PSHA 4UU8A 3NVKI 521PA 3RODA 2O8DB 3OETA 1U0GA 4QOIA 4FTWA 3T38A 1W36C 4P7KA 4RKFA 1NT2A 1RWNA 1P4SA 3N74A 1FLVA 2HIAA 2E4AA 1IY8A 1IPHA 4NAHA 4HYTA 4ZVVA 4CU5A 3BGVA 5AVZA 2HHHB 3A6JA 2AR9A 3FF1A 4XKJA 1EX7A 5ARCA 3R7WB 4BMSA 4D9FA 4EFMA 1L4LA 5CB6A 3O8RA 1W5AA 2EQ5A 4UM5A 5FLKA 1YDEA 4RA6A 4JFRA 2GJKA 1THZA 2QAGB 1JECA 1XL1A 1W0KD 2BGLA 2ZWPA 4L8VA 3WLNA 2BLLA 1JDPA 3IDAA 3MTDA 3TVYA 1M1NB 2JARA 5D86A 4KO2S 4GMGA 3DM5A 1C7QA 1NVFA 1LFDB 4NCBA 3Q1KA 3E8XA 4HPJB 1IZZA 2AHRA 4BRWA 4Y9SA 3TM5A 5ECYA 5JSZB 3SF8B 3DLTA 1ADYA 4GT1A 1QHXA 5FUWA 2O3RA 2NVWA 4HZGA 3FWPA 2HBRA 3COYA 4HFJA 1WUJS 5LZ7A 5IVHA 2ZYSA 1DO2A 2IIVA 4TVBA 3NS7A 1Z7YA 3QVWA 1RXEA 4C1BA 2QMUA 2PEYA 4MJXA 1G8AA 3NB0A 3CRQA 2MSDB 4WERA 2WWYA 1C4XA 2VHWA 2VF5X 4ON9A 4LV8B 3UPUA 1CHDA 4R8VA 2PEZA 4TM8A 1YMUA 4CKCA 1NMYA 2W8BB 4HZIA 4XD7D 1EFLA 4FEYA 3KE8A 2LWIA 4QC2A 4XPZA 1KYQA 1VOTA 3HKCA 1P3JA 2HSDA 2RONA 2A9PA 1FU8A 3P2MA 4JFAA 4OHCA 4PYNA 3VSEA 4AC9A 4YMUA 5BNWA 2R6R1 3TWOA 1SQ5A 3B9RA 3USCS 1WKBA 2NO4A 2Z5FA 3JALA 1KA9H 3L6BA 2R8PA 1BW9A 5AP9A 1PLJA 3U7RA 5DLYA 1T9AA 1FW6A 1W88B 2GN4A 1LPOA 3BFJA 4YO8A 2IWHA 2H8GA 1XHEA 1SM4A 2CE7A 1I10A 1JIJA 1LVHA 1X7ZB 4X20A 4XCXA 2FZ4A 2ZIXB 3PQEA 2AE1A 2WTEA 2WWWA 2C8JA 1CEQA 4I9FA 4N65A 5C1IA 1SRRA 4BBZA 4D9HA 1LY1A 3GVXA 3HBMA 1ISHA 3NHPA 3QYPA 5F73A 5I7AA 3U39A 3ZOKA 4NOKA 1XXHB 5HF5A 4IO1A 1LTHR 2VH1A 1NZDA 3FCEA 3OOWA 4L5AA 4YJHA 5AYVA 4E30A 4ERXA 3E3MA 5AKIA 4ZT2A 3L8MA 4PGFA 4AG5A 2P2GA 3IUQA 1O0BA 2HO5A 2HRZA 1TYAE 3FYDA 3GUHA 3SDSA 3KHUA 3KZOA 5HRCA 4B45A 1Q1NA 2E82A 5KCMA 1DWOA 1NWHA 1ZJJA 2HWWA 4B7AA 4MWSA 2GKOA 2X2FA 3DDZX 4QJIA 3SP1A 1T4MA 1OFUX 4PHFA 3MJRA 3IAHA 1UBFA 3G0GA 2ZSFA 2R1TB 1N92A 1XN4A 2HIHA 3H84A 3WY9A 1D2HA 4HDOB 1SCKA 2BM1A 3NNSA 3EEFA 5CAEA 2WUEA 1K66A 1UBKS 2QG6A 3DZJA 3ILHA 4M21A 2WU1A 3BORA 1Q21A 2C4HA 2YJGA 4PSDA 4HDMB 1J39A 4YWHA 4MWTA 1IN7A 5LN1A 4KNYA 3QU7A 4WMLA 3AJ8A 4M9SA 1RYMA 5J5AA 5JARA 1WXHA 1ISGA 2BEVB 3ROZA 4EHHA 4HZUA 2GUGA 2EW8A 2I3GA 3UWSA 3HXKA 3VPFA 4P82A 1GCAA 1NURA 1X2BA 2WD7A 2Q6VA 3LNTA 2EP7A 3NPMA 1I2DA 3OLZA 4NBWA 2RHJA 3O6VA 1SVUA 2AG5A 1U9YA 2GO7A 4JLBA 4N7RA 4YIKA 3ZYZA 3H2ZA 1LK0A 4H7KA 4JJ6A 4XDHA 2FMKA 4IFTA 4WOKA 2FW9A 3FR7A 5IKOA 3F6CA 2XJ9A 4ZEXA 3RYHA 1TMGE 2ZT5A 3D5QA 4MVWA 2PLRA 3E84A 3V7WA 3DUWA 1E64A 1NQXA 5KOJA 4Q16A 5K3AA 4WBNB 1WQ3A 3KL4A 2MMGA 4URHA 3G2OA 2FNAA 5B1HA 2DKOA 3JCZA 4EG4A 1NYRA 5KYWA 3L8DA 3REFA 4MA5A 1XEAA 5D84A 4IIVA 3RSHA 3SXUB 1OA0A 4UNSA 2Q4TA 4L8YA 3GGJA 5CDFA 4DTCA 2G8LA 3N0XA 4ENQA 4LHYA 4MZDA 4EK9A 6ADHA 4LFBB 4D8VA 1P31A 1DKQA 3Q1LA 5B6IA 3F3SA 2G63A 1UM8A 1S7CA 2C5BA 4GYKA 4LYJA 5CGZA 3WGMA 2XGJA 3S2IA 2EU8A 2I1LA 4Y2GA 4ZI5A 4DJAA 4EQ6B 1O3YA 2PZAA 4WEOA 5L4NA 5KYNA 5GIOE 4WOCA 4GX5A 2RGUA 2EEPA 5CDTA 1O5OA 2P9QA 2WD8A 1P0FA 3CWCA 3N2EA 4U9HS 1U9CA 2EOAA 1TAHA 2IPAB 5HE9A 5PNTA 3VZSA 4OO3A 4TRRA 4D3ZA 1Z33A 2ZIFA 3PL1A 3TRJA 4JJ8A 4O25A 4UMFA 1ST3A 4JB3A 5EEGA 1RVV1 5L51A 2PKWA 3B5JA 3EGOA 4JB0A 3AGQA 1JR2A 1VJ5A 1KJ9A 5DI9A 3PIIA 5B3LA 3RI3A 2QW0X 1VE9A 3ASUA 2FZEA 3PUZA 3IV7A 3AHJA 4KIJA 4QDZA 2IEZA 4XM1A 3STUA 4RBNA 3CUWA 4X6LA 2R8OA 4I66A 2IOHA 1Q0LA 1XQ9A 1Z29A 2OBXA 1U80A 2XUAA 4GEGA 4FBGA 3NHSA 3FA2A 1HORA 4HNVA 3MGCA 2RI6A 4QASA 3QFTA 2HRQA 2R1VA 3OEED 2ACKA 2B7LA 5JXJA 3OFVA 1PDOA 3DHNA 2AN9A 5ITWA 4QECA 4BGUA 4K1XA 5KYXA 2V7QA 4M0UA 3U1VA 4DYDA 3HO8A 4EFNA 1B1CA 2EYUA 4KG7A 3FYSA 4RPJA 1P2TA 1XZJA 2AFHE 3NKLA 3WMRA 5C8YF 4KDFA 4PFKA 1YR9A 4E46A 3BHNA 3I2FA 5DX8A 2ZPUA 2E3JA 3AM3A 1JYSA 2HDNB 2YY7A 1HG0A 4EYQA 2FZCA 1QIDA 2ZYWX 3PUVA 3T5BA 2HK6A 2Y1DA 4WLFA 4FP9A 3RC8A 4FZVA 1VHDA 4K28A 5JVDB 2IDJA 2X0DA 4MR9A 1AS0A 5D3MB 3MJVA 5BV8A 1F8YA 4IGFA 1E6EA 1V45E 1B26A 3LX6A 4HYYA 4FGKA 5EZYA 2C4TA 3P9QA 4BMNA 3D8NA 3AM5A 1YRWA 4WHMA 1I1HA 2DBRA 1XQ6A 4FFOA 1QO9A 3TB4A 1ZOLA 3R09A 3V9AA 1FXUA 2FCRA 3T94A 5CB4A 4MQ6A 5HW0A 1IHPA 1MHTA 3L06A 1IY2A 2I6QA 4FT2A 4R0VA 2ZYTX 2OOKA 4B3XA 4N5IX 4MHOA 1R6XA 4QO7A 2G9NA 1EP9A 4UUOA 3V7NA 1Z5OA 1V95A 3BTOA 4F91B 1PBNA 1PJ4A 5DM1A 2BF4A 2WSIA 4CLEA 1L5FA 1RYYA 4B6OA 1DS6A 3D2AA 1R0KA 5BW5A 3C7DB 3IP8A 3NYRA 1AXRA 1W94A 4FXPA 4QU0A 3SR4A 2A58A 2Q62A 3PD0A 4R8KA 3BJEA 1HA3A 2C77A 4GAEA 2DHQA 1M5TA 3EZLA 4GH5A 1HDEA 2C7VA 1W4ZA 1CQIB 1Y63A 1U0NA 2O2HA 5CCEA 1HBJA 5BSHA 4OGLA 1P0QA 1XMQB 3NTXA 3DE1X 3B1JA 3HSKA 4EFDA 1YR6A 4OVKA 1XU7A 3FBGA 4IDHA 4RW0A 4QAQA 3PDIA 4PHCA 5JSUA 2DJIA 2HLDD 4N7BA 3I8XA 2R4UA 2VTVA 3CT6A 2VXBA 3NM5A 5E2BA 5F7OA 3KQLA 4BMYA 4RHCA 2XWBF 2X0EA 3K09C 3WL3A 4Q03A 4ZQIA 3V8QA 2C1ZA 3CX6A 2FA9A 3AJAA 4C7MA 4HQOA 4E5VA 2NMVA 4ND7A 2ZXUA 1XZDA 2HN9A 5FUYA 2ZE7A 3OQIA 4M1OA 3V4RA 3RIXA 5TY0A 3HJNA 4S0XA 5CBPB 3TKYA 2HQRA 4ZIRB 3PSAA 4MRNA 4JI1B 5DZSA 3GEHA 4PYQA 2EBWA 4X92A 2Q9AA 1JHZA 4PC7A 3L4SO 3E7PA 4DCMA 5JCPA 4KLRA 1HLPA 1JKJB 5BNTA 1G1MA 4HB4A 2ZJ1A 4G5SA 2JPDA 2NUAA 4LZJA 3OZEA 3TF5A 3CX4A 2MR6A 5EQTA 3GGOA 4L4XA 1XX6A 1RMQA 2V7UA 3AUJB 1GPYA 4GWKA 1KZ1A 1ZM4A 4JLDA 3ZE1B 4OMFG 4FYWA 2F4NA 2YYYA 3OQ6A 1YB7A 3AZQA 1VG8A 3VU9B 3V3TA 2OCXA 9LDTA 3S0JA 4X60A 3EOAI 2PBRA 3RBXA 1DRVA 2QUIA 2Z30A 4KE9A 4L50A 1TT7A 4BV2A 2ZI5A 3JSXA 4YREA 5B4TA 3USZA 1VA5A 5EMHA 5HE8A 1Z2AA 4LISA 3UT6A 1JBQA 3AQIA 4M55A 5DH9A 5A2GA 3W06A 1MR3F 2GD2A 1RI4A 3DMFA 4I7EA 2PWPA 3P0RA 2XUOA 5ALNA 2P27A 1PLLA 1W35A 4B4WA 1TPYA 1UT8A 1P2GA 2Z98A 3HXMA 3FNGA 1U9ZA 1E5TA 3HYLA 1XDZA 1KFBB 3I5MA 1MIHA 5J63A 5ELLA 1Z4PX 3BL8A 4XRRA 1RHKA 2F59A 2CMGA 1AV6A 4TKVB 3CSUA 5TQVA 2XITA 1XTRA 5FHRA 4ZK2A 4DR4B 1OYWA 2Y66A 4GM4A 5EJ9A 3KD2A 5EKUA 4FB4A 2QUJA 3AF3A 5IG2A 1W49A 3QIVA 3LCUA 2ZRCA 4CPDA 1X92A 1PFWA 2B8NA 2Y76A 3P32A 4RGBA 3FWHA 1JXAA 3IULA 4URVR 4CNQA 3I1JA 2VZEA 1XK6A 4DCVA 4XJVA 2O5CA 2NM0A 7REQB 3FCOA 1XNJA 3SLGA 1U2QA 3C6KA 3PR3A 2BGKA 5EL0A 3V32A 3OMXA 1RAIA 4HNGA 3DPUA 2BE9A 2Z57A 1RXIA 3SBEA 1BVRA 1W2HA 3QJYA 3TVTA 3L0BA 5K0FA 2AG1A 3IEPA 1VYVA 4M9QA 3NT5A 4QICA 2XBMA 4UBOA 4OHXA 4I1VA 2AMFA 2G70A 3EC1A 3N05A 1C41A 2C5SA 2E4YA 3IXQA 1E5VA 3B6KA 1FTSA 4S0ZA 1J22A 5EZSA 1YI0A 5A3VA 1EJ2A 2ZUCA 1P4JA 4PRKA 4DLLA 3GJ7A 2C7BA 4L9RA 2FFQA 5MGBA 4QTTB 1M0WA 1Z4JA 3TIGA 1P80A 1D8AA 3AZPA 3OHSX 3G9UA 4II3A 2SHKA 4QGFA 5F64A 1SUCA 2B9EA 1YASA 4ZFNA 1ENYA 5KSWB 3K4PA 2D1QA 2JFYA 2HMSA 4FYHA 5BNFA 4YONB 5JECA 1WB5A 2BELA 2IZ0A 2QX6A 2VF7A 2O4UX 3DG9A 3FJOA 5A03A 3ZN2A 4R3NA 4QXOA 2JGLA 3EIQA 3ZU6A 3O8BA 3RSQA 1NZFA 1U7ZA 2HYIC 4OTZA 1CRWG 4ANFA 1EM8B 3HU3A 3KHTA 5K6AA 2PO7A 4G25A 3ZIAA 4CQMB 1XTQA 4NWIA 4TS3A 1Q1ZA 2OO7A 5AVSA 1R5JA 3PGVA 4C30A 3A6LA 3FAKA 2PLNA 3UGKA 4ENWA 2IZ6A 4DIEA 5HFAA 1SCUA 3IALA 3G2PA 2FW7A 4J2HA 5K2MA 4CM9A 4EJ6A 3MBKA 5AW3A 1EDZA 4BVHA 5LL6P 3PR1A 3QW2A 4QGGA 4D3YA 2QDKA 3L7CA 3GHHA 1Z5NA 4PAQA 4HNAA 2ZRGA 1IDN1 1Q1EA 1SUBA 3AY6A 1E7YA 2VDQB 3C3CA 3EEBA 3NHBA 4FN5A 4GLJA 4MQEA 4UU0A 3DVRX 4YP0A 1N7IA 3OFJA 1JAXA 4Y2XA 2PTGA 3RU9A 1ECPA 2QN3A 4CCWA 1BH2A 4MPRA 1C2YA 1HMPA 1S2OA 5JD4A 5I6DA 3QU5A 3DXZA 5IAOA 4NV3A 2CMDA 4BX3A 2F17A 1M34B 2OCPA 1C9NA 4GKAA 3WIEA 3U61B 1L5GB 4EDHA 2C2XA 1AS3A 2FN4A 2QNBA 5B3JC 2H07A 3ZHRA 1QR2A 2LRHA 4FD2A 4XW2A 3RTBA 1K9VF 1MJ5A 3KZXA 1Z68A 1HM5A 3I6YA 1FYVA 3GDOA 4R2WA 5HK9A 1A7AA 1TLTA 3NHZA 3TLJA 5JFGA 2F8LA 4Q9NA 1UJMA 2G1AA 4RZXA 5JS6A 4RL4A 2AGVA 2MSWA 3O73A 3DULA 1SHZA 5EMNA 4TSKA 3WWYA 4BCCA 5AVKA 1RWBA 3T61A 3DM9B 3QLUA 4BPRA 3FROA 1V96A 1R4MB 3FGPA 4QEDA 5HWSA 2H06A 2YV5A 5L4SA 1AUPA 2UYQA 2P2NA 3O8NA 1ICEA 5BNZA 1V39A 2W2KB 4O0LA 4TTVA 3HPQA 2JGJA 4KO8A 1GEGA 5DM60 1GUBA 2RKBA 1YNSA 1JLLB 4HAIA 2BKUA 2BEJA 4MQMA 2PD4A 5J40A 2X0FA 3OZXA 3T9FA 3AWDA 1SCAA 4I55F 3NP7A 4MRPA 1US8A 2JI7A 1O03A 2IYXA 2OOSA 2RB4A 3GAAA 4X41A 2ZDGA 4HEJA 5L53A 4I46A 1AH2A 5G53C 1JILA 1K63A 2OCDA 4CG1A 1UBUS 2IRWA 1U0FA 3QQ5A 3DPIA 3STVA 4AJJA 4ABTA 1DC4A 1EEXB 2ZLBA 3WOVA 1MQSA 1G291 4RQAA 3BMQA 4X64B 4PV7A 3DE5X 4C08A 2BFBB 2GPJA 3WLLA 3OJFA 1WHSB 5H80A 1GZDA 1Y5NA 4PEVA 5FEMA 1ZOIA 3RVJA 4XVCA 1DADA 3D0KA 2D1SA 5E95A 4ZU6X 1CW2B 2AOUB 2WT8A 3L93A 1HKUA 3UXEA 3DR3A 4BO4A 2X23A 3I4CA 4HR7A 3QVSA 4KXUA 4ZZ3A 3CNLA 1UXHA 2O0HA 4NPAA 4UREA 2VH5R 4H60A 4X8MA 2RE8A 4Q3CA 2PMBA 1N8NA 4A8PA 4BLUA 3OQOA 1FDTA 5FULA 3SLRA 5JD3A 3QELB 4KMRA 2OHFA 2GPYA 2AFHB 2GAFA 2W43A 2C04A 4HWKA 5AW7A 2YYAA 1HGXA 1RQGA 1K75A 1U0TA 1UWCA 4EKDA 3DH0A 4QVGA 3PC4A 4YDRA 3TZEA 1VGVA 1UM9B 1JH8A 4L9WA 1HDOA 2W2LD 3ZWPA 2JIMA 3DV0B 3LC1O 3RJZA 2JDIA 2OKCA 1EG2A 2HBQA 4MGYR 3O83A 1R3UA 3NEYA 2VP2A 2AEEA 3QYFA 2AEJA 2NQTA 3AOEA 1T4CA 3QHAA 4QDXA 3U3ZA 2DH6A 1RI5A 2YIMA 3OWXA 4RQUA 3C8DA 5LIPA 2ZKLA 5JD6A 4PN7A 2Z8YM 3OJ0A 3A3OA 4PC6A 4PSUA 4Q1BA 1SIWA 3ZR4B 4EEZA 1CETA 2PRZA 4QEKA 3S2UA 2BDEA 5C31A 2V8OA 2CD9A 3O7WA 4FGLA 4CTJA 5JQGB 2DG2A 2HDWA 4D26A 1EEHA 2IC5A 4IWNA 1ZMRA 3AF0A 4YJ3B 3U6KA 5EIHA 2GHTA 3HLKA 2AC2A 2BFEA 2A94A 4TL6A 1N25A 4OUKX 5EA2A 5C7YA 3IDZA 3U0BA 5KJ6A 3HCPA 5JNVA 2VNSA 5FOXA 2NT3A 3QNMA 4EJ2A 2N1MA 2NGRA 5TMPA 1F14A 3IMFA 3BDAA 2XQJA 5LZ5A 3KDAA 4EQ6A 3ESBA 1VI5A 4XR9A 1Z9BA 3A6PC 3FWYA 2R62A 4AJNA 5J2TB 1JXOA 2BFDB 2EGUA 4QAJA 3VR2D 3VPBA 2EJWA 5KNDA 3M6WA 1X3LA 5DGIA 5KB3A 4W5NA 3R23A 1RAGA 1JAYA 4MRAA 3DOIA 1GNTA 4R2HA 2F7SA 2QXTA 3V8BA 2YJTD 3CIFA 1Y4DE 2C00A 1C7JA 3DTTA 4EG7A 1HYEA 1XZGA 4HB0A 3EVAA 1USIA 3KXIA 3O3NB 3A4NA 1AN0A 1VBNA 2JI8A 2XMCA 5EZ6B 4AN1A 1IG3A 5LYYA 4JV5B 3CF4G 4KQFA 3W7BA 3ZXUB 4QM7A 3D7MA 2X4DA 2I29A 4KWCA 4OQFA 7MDHA 3RYHB 5F2EA 3CLKA 4A2QA 4MKGA 2V45A 1Y33E 2EKBA 4LJSA 3ZLBA 2IYLD 3G13A 5TARA 1GRNA 1YE8A 1D6NA 4AP5A 5J4YA 1X86B 2WJAA 1NW7A 3TL2A 1YRQA 2J45A 3BVPA 3ILVA 4MWEA 2UYCA 5KS2A 2NADA 1Z6QA 3UCEA 3FDXA 1KQPA 5KYXB 1J07A 3LK7A 1FMJA 3NNNA 4YWJA 2N9UA 2Q3BA 1SKYE 4LWPA 4JYMA 2PFGA 1OIWA 2Z4SA 3DAHA 3WGYA 5JWOA 3NYIA 3VZRA 4K6MA 4D4JA 5ALHA 3BHIA 2H7CA 1KY3A 3WAJA 4TVOA 4HLNA 3K2EA 4FX2A 2IU0A 4AJ2A 1U9IC 5J5CA 1VE6A 4W63A 2ZEJA 3H42B 1NLZA 4RHTA 7YASA 5K51A 4X65B 1YJCA 4FCWA 4ARIA 4NZMA 3EGDA 2EERA 3Q11A 4P3NA 4YALA 2LKCA 4EMUA 1P39A 4LKRA 4PC2A 4MITA 4XIFA 1NVVQ 1K3FA 3EEIA 4LSGA 3X1JA 1JA9A 5DYNA 3ZNQA 2VJLA 3T3DA 3OCXA 2ZTUA 3Q3EA 3HUUA 4IJMA 4MYTA 5FORA 1RWXA 3WYFA 2ZVDA 4CZ2A 3E70C 2KI5A 3IAFA 1FA9A 2CXSA 4YRSA 3EVCA 1XXHE 1AT1A 4A26A 5J2TF 1ZWLA 1S2GA 3ID6C 2ZAMA 1ISMA 2J9XB 4HLDA 1Y8RB 1ODJA 1O58A 1Q3HA 1U0EA 2VDWA 1DFHA 2QGZA 2QHXA 3DUFA 3JWGA 3LLCA 1JYEA 4G2NA 4V0NA 3TTYA 2R6FA 4KQ9A 1SD2A 4JJ4A 1UPUA 3UUFA 4DQDA 3KTFA 3BL6A 4HVAA 3FBWA 3HFJA 3R7SA 3O4HA 1CJVC 2C3YA 3LGSA 4P5PA 4HAYA 3CNOA 1USUA 3KTDA 3WYGA 3ER9A 1DPFA 1TQ6A 4IDOA 1ECCA 1FJXA 1NUQA 4W5TA 3F6PA 1VIDA 2CL5A 1DXHA 1GFWA 3IT0A 5J4LA 2VZ0A 1P61B 5I8PA 1POXA 2IOYA 3LS2A 4B6FA 3PHCA 2C9ZA 4ARZB 2G1JA 4CDNA 1QGUA 1IUOA 1EVJA 3OZAA 5EUBA 4X24A 3ZOZA 4Q19A 1PK7A 2P9EA 3AEQA 5ADVA 2ZDHA 1JSXA 3SEQA 4JYAB 2D8MA 1YOBA 5CLFA 1U6KA 3IBCA 4JVOA 3LX8A 4FEAA 3DNFA 3H13A 4DLUA 4LZWA 5COBA 1FX0B 4RXMA 4PS0A 4RV9A 2F1JA 4FHEA 4Q4AB 3P26A 3I9V1 3U1TA 2V5AA 5BWOA 3QXXA 1SD5A 5J43A 1Z2PX 2P65A 2ECFA 2TMDA 1NX9A 4TZTA 3L5OA 1E8DA 4HV4A 4ENSA 1IG0A 4MPPA 1AC5A 4WBNF 5DWQA 2AVNA 5BN1A 1Y4UA 3BD6A 3D8RA 3ZNNA 1MF7A 2HTEA 3C43A 3TYXA 3WIVA 3TECE 3U37A 2QL5A 1VSTA 3L4BA 2OXIA 3TTXA 3P8ZA 4I1RA 4LYYA 4D3DA 4RJLA 4HO1X 4B8WA 1XZKA 3GWZA 2FW8A 4K05A 3TEFA 3S44A 4L85A 1Y34E 4LWOA 5HOEA 1HMYA 3ITEA 5CDHA 1CJUC 5E4JA 1JT2A 1Z22A 2YZ7A 5LA6A 2V6JA 3DZKA 2R66A 2H5EA 1XTTA 1NXQA 2DB3A 3U7GA 2D7JA 3EXEA 3CBQA 2XNDD 2OY0A 2ATVA 1CRQA 3DSRA 5JMPA 4DTIA 4CIYA 1ZG3A 4KQEA 4LOJA 3FHCB 1ZI9A 1SZCA 1TGVA 2NG1A 3VSAA 1D04A 4FHCA 1B8OA 4J7AA 2P3OA 4C07A 3GEEA 4DWWA 5FADA 4LTDA 3V2UA 1HZJA 3JZMA 1Y89A 1SHJA 4I1PA 3ODGA 1WNTA 3NGXA 3IMKA 4Q1VA 4YRIA 2IY8A 3Q3CA 4WD3A 4GMKA 3GFOA 4NPHA 3VC3A 3NBUA 1P18A 5EKXA 1NBMA 3MWKA 1I5EA 3LYAA 5FBWB 3HUTA 1XCPA 3V8PA 2I8CA 4Y7DA 7AT1A 4ZAVA 4HPXB 1FLAA 3H9BA 2YWGA 3ND9A 1M6YA 1RYEA 2J4FA 4PLVA 3JQAD 2AN5A 3QBJA 5K99A 1VQ1A 3DWFA 3M8KA 4EIWA 1YI8A 4M87A 3TW4A 4GKKB 1E0AA 2E55A 3ZDXB 3HJBA 2J6BA 1QAOA 2WFLB 4RVUA 3HDVA 4EB0A 4TL7A 3L4KA 1WKCA 3M6VA 4D57A 1FBNA 3WXBA 5TXGA 1FQJA 4GBJA 1WPRA 5B2FA 2PA0A 5DLDA 3JARA 4EYSA 1ZGHA 1OX4B 1Y7IA 1D2NA 1NPDA 3AONB 4OI2A 4DLVA 5BOSA 5TMBA 3KT6A 2ZULA 3HHEA 4WDRA 1AXGA 1OU4A 2D1TA 4W1RA 3FHOA 1CIJA 2HCRA 3G2NA 3V1NA 5C3MA 2B0JA 1DBIA 1HDCA 1JMVA 2QR2A 3PUIA 4U1RA 4KXWA 3ZHXA 1ZVMA 5FBQB 4ASUA 4XIJA 2CZQA 1CULC 4EKYA 1FP1D 4PINA 3MCAA 5EHQA 1XZIA 3EF1A 3KD3A 4AMUA 2KSQA 4PZPA 3EVDA 4I8XA 4YK7A 3CLRD 1J1UA 3AINA 2WD9A 3I6BA 4U7TB 1PEAA 4CIXA 3BE6A 2H16A 4O1IA 4ND1A 4X20B 2YH2A 1Y3DE 1RZ3A 2G09A 1DC8A 2H5JA 3HY4A 3FX2A 2E4XA 4CHTA 5DB4A 5DCWA 1PFQA 2QRUA 3Q8KA 4G5OA 1B74A 2J3DA 4KYVA 1A8QA 1HV8A 1OGIA 2YUTA 5IN5A 4OXXA 3II6X 4UHBA 3ACDA 3WIOA 4YMLA 1M2KA 1XT6A 3QKSB 4C6SA 1QF6A 4ENTA 4D81A 3HCDA 5G40A 2VWHA 3HVIA 2O2XA 3CEHA 3TPCA 1TC1A 4UM9D 3K9FC 4HX5A 3JYHA 1ZJ6A 3JQDA 3QLVA 3BFXA 4E5MA 3S8YA 4KFCA 1WZ2A 1KJYA 1JDUA 4AJ4A 4GRIA 3B1FA 1T36B 2ZBVA 3DWIA 4JLAA 3T1YB 4PYRA 3BRWA 3QFHA 5HKAA 1ZP6A 4AL4A 2J3MA 1E4EA 2ZJ3A 2NU6A 4FFNA 1KI1A 2AE2A 2F48A 2XOKA 4M4SA 2WVGA 3H75A 2ZW9A 1NM5C 1TQ2A 3C4QA 2QRVB 4G5HA 5E6SA 1G8JA 4LNAA 1IB6A 5HIJA 3AR3A 3EVFA 1U0HC 1QK3A 4IKPA 3DAFA 2KB0A 1E7SA 2MYUA 3M1AA 4FE7A 1FVFA 2ZOSA 4KJXA 5GIPE 4GHWA 4Q9HA 4ZV9A 1N6HA 5EYPB 1QCCA 4FPXA 5AUNB 1JHQA 1CV2A 1RYBA 3AHIA 3ZGNA 1E3TA 1NMSA 1D3AA 4XEUA 2CK3D 1QTIA 1TM4E 3ZQ4A 3VO9A 1T2EA 4ZA2A 5G0TA 4CE6A 5CNKA 4C7XA 1A8HA 3VR0A 1ZXBA 4ZCTA 4JOCA 2VA8A 5IF3A 2Q5JA 4ZT6A 3D1JA 4PQYA 4WFJA 2NSHA 4NCJA 3CLRC 1MQ9A 2FEPA 1YBVA 2WJIA 3F7TA 3FLBA 3LQ1A 1M1ZA 2I55A 1P75A 3BE4A 1WTCA 5BV0A 3LUKA 3ONEA 1FPQA 2W4MA 1QVZA 2JGMA 1RJFA 2ZJ6A 3AI7A 1PYDA 3GXOA 3QYAA 4KDRA 4WXRA 3I2JA 3U3JA 1S4MA 1SCQA 1T34A 5AVJA 4CQMD 4ZDKA 1DX6A 4CV0A 3KSMA 2ATCA 3B3JA 2ZB8A 3QBEA 4OBEA 5T3UA 3QY9A 1K7CA 1NFFA 3FCCA 2BMDA 5JQWA 4MW9A 1MORA 3LP6A 1QV7A 2QN1A 1T5DX 4ZC8A 4OI4A 1TCBA 2CJXA 4FNAA 4I6JA 4NK4A 4NZYA 2G17A 2CL6X 4OK5A 4RMGA 1SUPA 3VU8A 4C14A 3R3ZA 4I1OA 3RVOA 1BQ4A 2OYSA 4OU5A 2OFFA 3GLGB 2PUAA 4KPUB 4RKQA 2P5TB 4AJIA 2PTHA 1BDIA 3VDMA 2R6DA 3S4YA 3WV4A 5CA1A 3IE1A 3UK0A 3GLQA 1NRJB 1ML4A 2WNHA 3D8SA 3F8WA 1EFTA 3O94A 1R74A 3O1IC 1LPBB 2CMFA 4K40A 4AF8A 3SZOA 1EX9A 3HDGA 2J33A 3VR5A 1U02A 1X77A 4HGZA 3UYLA 3IS3A 4DCUA 1QH8A 5L45A 2PSDA 4FFDA 4NBSA 3C3WA 4ZOLF 1UBHS 1XJWA 2NXWA 1BE6A 3A05A 3KX2A 3SX4A 1EXMA 2QG4A 1FLNA 4G36A 1G1AA 4ND4A 5DASA 3ME5A 5DN6A 4ZAZA 5HMMA 1J2TA 4D1YA 3AJEA 2XDWA 3ISJA 3SBDA 1N9KA 2AJBA 4O08A 4FOTA 1ZS9A 5GWXA 1FTQA 4MKRA 5LQCA 5F51A 5A7HA 4RHEA 2RC5A 1KL7A 4PNZA 3BS4A 2PCJA 4FR0A 4G0QA 1F6BA 1HLFA 5JO9A 5JBIA 3T4XA 4J3JA 1EBBA 3DVAB 3ONWA 4C2BA 1YZFA 2QD2A 2VQSA 4HN4B 3DT9A 4Q7JB 2Q6LA 3T8YA 2WAAA 4V0MA 2WTAA 3A4VA 3NYWA 1GZ7A 1H4QA 4BLVA 2COEA 4E13A 5HCIA 3PFIA 2VNHA 5ED0A 4B3FX 1GAJA 5ALSA 3SKYA 2CJYA 2XYPA 4PCVA 2RGNC 4PRLA 3WGHA 1PNTA 4I55A 3JVUA 2UYYA 4B35A 1OZ0A 4MRSA 5TR9A 1SBQA 2C2OA 2AXEA 4FFPA 4YXWA 4BUZA 3WK6A 5JZVA 5HP4A 1UJ5A 5TGZA 4KPYA 3ICWA 4U3JA 3WAGA 4Z5XA 1T1SA 3B48A 1VLVA 2PX5A 4BMZA 3ZTYA 1A7UA 1V7CA 2ZYUX 1H42A 4HLUA 5E4TA 1WA5A 4QGBA 3OPYI 4JVNA 3TCXB 5K6RA 4GXTA 1E2NA 4PQRA 5TMEA 4XUDA 4KXNA 4IIHA 4PYKA 4GQIA 4GGMX 3QKSA 1D7AA 2Y0CA 4JA0A 4Q1FA 2YJ5A 5AXBA 1YRHA 4RV4A 1V7ZA 2G6BA 4ARVA 4ZJZA 5C2JB 4B7ZA 5JADA 1P1HA 1ORHA 3IQFA 4KODA 4PG5A 3I5YA 2YIDA 1QPZA 2IODA 3L84A 1U4NA 3UOAB 2ZJOA 1C80A 1E7WA 2ZYHA 2HUPA 3QXGA 1UQUA 4B3DA 2HA6A 1JEAA 1ODTC 4DMCA 4HRVA 5CX1B 2WJGA 1TVMA 3QUBA 1ADJA 1NSYA 3HV2A 3Q0IA 2ILTA 4LDNA 1OKKD 3TS1A 4G24A 5EWLB 1WWKA 4CM9D 4MUIA 4NESA 5EJAA 1E58A 3S2GA 1RAHA 1SEVA 1GR1A 2X5NA 3JQFA 4JWKA 4R3UC 5A3JA 1GGJA 3K8YA 4RABA 1GPBA 1R18A 4K8RB 1QG6A 1G20A 2D0IA 1X39A 3B89A 2YFQA 3QI7A 4XIGS 1XROA 2IELA 2ID9A 3Q7SA 4TZKA 4TV8B 4DIDA 3HYSA 4I0WB 4DE5A 1D03A 4QLBA 2OVFA 3CNNA 3V46A 1COWA 1XMXA 1CF2O 2VSOA 4LDPA 3TJRA 3H5NA 5MFZA 1OFUA 2FTKE 5DEOA 1EZ4A 3TKAA 3OWHA 2P9FA 3W3AA 2ZATA 5LD2B 3INYA 2QQEA 4E4YA 2HMUA 2RJ3A 4BVAA 4EA7A 1I1QB 4JROA 2HU2A 5KTYA 1SQ6A 2PG3A 2VHVA 5EC8A 2MSNA 3IB3A 4BQRA 2A86A 3L1UA 5EPEA 1E6KA 1UJNA 1QH1A 1BHSA 4IJUA 1UBEA 3IMGA 1BN6A 1C9MA 1Q1BA 2FPWA 3HG7A 4HNHA 4BP8A 3V4LA 3LT2A 4JUCA 3DJYA 4OG2A 3OIYA 4GS5A 4PQGA 1S0UA 4OXKA 4D4HA 4TTJA 2RHHA 4QYSA 2DM6A 1M10A 4UAVA 5K3EA 2JJQA 4DADA 3FDFA 3PX2A 2CK3A 4X9XA 5K3FB 4Z4QA 4N5DA 4WA8A 5G2OA 3KQOA 5EGSA 5AVUA 5K3OA 2E37A 4D0SA 1KMCA 4R1QA 1ULHA 5KWSA 4MNTA 4CI9A 3DCNA 2VG8A 3FNBA 5AJTA 5DHSA 2NP6A 4NARA 1QONA 1EE9A 3HXPA 1WDLA 3INGA 4G4IA 4H1UA 1VSBA 1S3GA 3OZTA 5P21A 4POOA 3WGOA 4BVGA 2W2XA 1MOQA 1P9RA 4IINA 1G18A 3ICOA 5KHLB 3WJAA 3GUCA 2WWXA 4ZARA 5CFRA 3D2LA 6YASA 1J2YA 2E9SA 2YJ4A 3BSYA 1CQZA 4KHZA 4UEKA 4DEXA 3HCNA 3QXJA 3D1VA 4GGPA 4GPEA 4F86A 2VSQA 3QBDA 1OHHA 1YAHA 4OM8A 3GP5A 4GNKA 2X6TA 1N2OA 2ZSBA 4R1SA 4P3KA 5GY7A 2RH4A 5F1PA 1W34A 5L3ZA 4Z9AA 5IC6A 1Y9AA 4JA2A 1VPTA 4JJEA 3HJFA 1V6SA 3N8DA 4NENB 5JBNA 4I1YA 4JOBA 5FI0B 3ILSA 1RWKA 4Q82A 3H65A 1DQNA 5LQDA 2DGDA 3QVLA 3R9XB 1IJEA 3K0AB 3T7EA 2ZI7A 1OLXB 4HSEA 3O03A 3JZDA 4XR4A 1UJ6A 1CY1A 3FCAA 1JTEA 3QYJA 5HQ3A 2WDZA 4OP2A 5EFZA 3CLSD 1Z25A 2GM5A 4EG0A 4COKA 1K08A 1FYDA 1AKQA 2GXUA 1E3WB 8ATCA 1T0IA 2PR2A 4R4JA 3TJMA 2GLXA 3WA6A 3NBFA 4RYLA 3BIXA 4IBOA 1P7WA 2EP8A 2GTPA 4M8LA 4UUBA 2OYRA 3FUUA 2O1SA 4OXIA 2XDAA 2CV2A 3GJQA 3QVGB 4RPGA 2G06A 1FLDA 3A4IA 3V8NA 4ARAA 3BJMA 3A1VA 1GA4A 3IPYA 3PDWA 3P9KA 1WULS 3JTMA 3PS9A 4DMHA 1J70A 2GK6A 1TVCA 2QSUA 4NNOA 4QOGA 5BN4A 4I5DA 1AKYA 2CVHA 1A2KC 1UPTA 1VCMA 2WV9A 4REQA 2O2YA 4CFSA 4EAQA 1KRHA 3ZJYA 4CEHB 2XUZA 1XRMA 4GBMA 3WLJA 3I37X 1GNLA 3UJAA 3HEBA 3OURA 1W4BA 2RGWA 4JEIA 5HILA 3K9BA 1P74A 4U3JB 4WY2A 1AK1A 3CUUA 1P3DA 1PSDA 1UBLS 1M9NA 2YMLA 4JLOA 5AM4A 4ESHA 4DUZB 2W4QA 1FRVA 5LPNA 3JAWB 1CJCA 1OKKA 2GCEA 3COPA 4OXYA 1N2HA 3W4KA 5AI6A 2DFVA 3T1NA 1UFVA 3PNOA 4YDQA 3AF1A 4IZOA 1FRZA 1Y3IA 2PGDA 1E8NA 4Q3BA 4CFZA 1I6MA 3OIVA 1W5EA 4LK2A 1E6MA 5HF6A 4BO5A 5CX4A 1A5BB 2HDOA 3AJRA 4L72A 1UMKA 4W6QA 5CX1A 4HP8A 4EUSA 3PPWA 4BTVA 2QN2A 2J0VA 3RT9A 1YJQA 1IXZA 1T9BA 4Y0AA 3ZLUA 3PT9A 4QHYA 4U7JA 1BCSA 3HQ4O 5ERYA 3E2PA 4N0MA 1I6WA 4KKVA 5JASA 5LXTA 1JMYA 4JODA 2O23A 1FF9A 3LGAA 4MO9A 4G1EB 4PE5B 1Y7TA 2E5FA 2VPTA 1PE0A 3S55A 1KAHA 3O4VA 1DRUA 3PWZA 1DDIA 3BCUA 4GG1A 3REQA 5KPDA 3M7IA 1GUZA 5CD1A 1F12A 2RH8A 1LUAA 3PYLA 1T24A 1FBTA 3ZK8A 4M1MA 2YVUA 4CKEA 1E3JA 2PR7A 2SBTA 5CU7A 4D74A 4P4SA 3QWAA 5TMDA 1QHNA 1OX4A 3ZY4A 4GI1A 1V25A 4JUAA 4FX5A 4ZT3A 5IAEA 2OHGA 5KC8A 1VG0B 2FSVC 1NRXA 3DPSA 3EBLA 5GZ3A 3PLRA 3PPVA 2QJFA 4PVCA 1X0VA 3DBVO 4GI2A 4E6EA 3H97A 4RFLA 4XTRA 2NZJA 2QAIA 4KXFB 2CY0A 5I7UA 2Z6AA 2QWXA 2AHOA 4LOIA 4AZ3B 1R4MA 4XASA 4Z7JA 2QS9A 5EHZA 3O8DA 1HT3A 1NC1A 3AF4A 2C95A 1QO0A 1XALA 2X9LA 1KYZA 3IAS6 2DZDA 3NC0C 4FFBB 3OT4A 5H0IA 3M0EA 4RADA 3TLBA 3UMSA 5BQXA 1B3BA 3I9NA 2QTNA 4IOMA 4JIGA 4BO1A 2GFQA 2ZT6A 1P2SA 4ZYWA 1V48A 1W19A 3B60A 2MT9A 1TF2A 2W6NA 4M9RA 3RKRA 2C58A 1RW4A 2QROA 2CSUA 3KHSA 4UHCA 1VLLA 3F4BA 3ZS8A 1QR6A 1B0UA 3MK31 5HM8A 1X42A 2VJOA 3ZBTA 2C3MA 5AUQA 3BUSA 3H2HA 5M2QA 4CR6A 3QSYA 4YAWA 1JJ7A 2O3QA 5GP1A 6PFKA 4ZT4A 1RLMA 3K9CA 2OLKA 1DUSA 3LUAA 3SMQA 5DO9A 4RVNA 2YQZA 4HCJA 4ROSA 2JCGA 4JNKA 4UCQA 2GZSA 1U8ZA 3HDQA 3HR7A 5J47A 2ZRHA 1DCTA 3U40A 1DBRA 3JQGB 1FPMA 1II8B 3IE0A 4NPCA 3UAYA 3L9WA 2OHHA 5B37A 5B6PA 2VYFA 1JLSA 2A1TR 1EYZA 2PCLA 3RTEA 2W83A 2WF9A 5DIZA 4PNEA 5I48A 1CIPA 5EMLA 5KX5B 1GG8A 4TUYA 2OBLA 3ZK7A 1OLXA 1U2EA 1KJZA 3KZVA 2ABWA 2MDTA 2Q4OA 3NPAA 3UXHA 4JBYA 4C9BA 5KNBH 4DMUB 3TMYA 2Q0SA 2V65A 1G5PA 1SHLA 3EW7A 2H6EA 4H0CA 3I12A 1YZYA 2AN4A 4RTMA 3VYVA 2B94A 5BSVA 1MNAA 4BWYA 4DT1B 4I50A 4JP1A 3NP9A 2H63A 4M0LA 4RS4A 4DZRA 5FL3A 5AFSA 1PD0A 4QATA 3P52A 1DFIA 4IFEA 1FDUA 1FNDA 1Q22A 2WINI 3AG5A 3QEJA 4PTLA 3DOJA 3TLCA 3B1KA 1Y9JA 5EZ5A 4MINA 4NHOA 3MS7A 1N7GA 3BIWA 5TQ2B 1NVGA 1X9HA 1EE1A 3TOSA 5CB4B 1XNGA 5JY1A 3Q6IA 2P2ZA 3EPKA 3R8XA 4Z4HA 1NZJA 2WPDD 4MPTA 3JQRA 4CUZA 1KARA 5G41A 1W75A 2D74A 5CM2Z 5A4IS 4LMBA 3RUDA 5E38A 1JTFA 1FXWF 4FSDA 5I4BA 2JLAA 3WLKX 4QODA 1KZ4A 3NBXX 1O6GA 2F3PA 4RU1A 4G4SP 5DNAA 4E7PA 1XVLA 2I2WA 2PGIA 1V16A 3K20A 2OBMA 3STHA 1ZN9A 1YOVA 2FP4A 4RK7A 3DDWA 2A5JA 1G21A 1X7WB 1SUEA 3MIIA 4ITRC 2EW1A 2AZXA 2HRBA 3BN3A 3EY4A 5ALUA 1JDNA 4H59A 4OHOA 3C3AA 1VDZA 3UMRA 5FCDA 3VZBA 4JU9A 3OZWA 5K05A 1FX1A 1N2CA 2JIZD 3LBNA 2GM9A 2ERXA 4MH0R 2BI8A 1PHRA 1BWQA 4Q3AA 1EDEA 1GN8A 2C4KA 2OFXA 4FKMA 1RPJA 2FSPA 4DA4A 1OOEA 3OECA 5ESXA 3FI0A 1NNEA 3DMGA 2B8EA 3SR0A 1Q15A 4ETMA 4MDFA 2HQ1A 2OCGA 3L4BC 1LPSA 2Q2QA 1KPHA 3MTBA 3N07A 1WIWA 4JLVA 4F5EA 3A4LA 2GTIA 3IQZA 3V5NA 1RLTA 4ZC1A 3NOQA 3AIKA 4LK3A 3QKRA 3DMTA 1XKXA 4HQNA 4TXJA 1IULA 3JZFA 4JXJA 5TQ0A 3OM0A 4UHEA 1WY5A 4C5AA 2PVCA 1OFHA 1PFUA 3ZD9A 5C1BA 1YFLA 1YBFA 1XQ1A 3MFYA 4CTMA 1ZBQA 3DAPA 4W8GA 2ZIUB 4IG9A 5LQMA 4LA4A 4X84A 5EZYF 1QGZA 4B8YA 1VKRA 1PJTA 4X8HA 4E21A 1LDGA 1AF7A 3NT4A 5K6TA 3CN9A 3DMTC 1YO6A 1PGOA 3CVXA 5HYVA 1ZXLA 3PX3A 3VU0A 5CB4F 1YDFA 5J3JA 3IJEB 3TRFA 4BCDA 2PH3A 2P11A 1H23A 3IMEA 1EBFA 1WS6A 1YDHA 1M2VA 2F9FA 3K1JA 4HH1A 2IZ7A 4R7GA 3OVMA 3Q88A 1SIOA 3OHPA 3FPEA 4NG4A 2DC1A 2C84A 3BRQA 1DKLA 2YYZA 1LPAB 4QELA 1NTOA 4UATA 4XIYA 4YRFA 1DQZA 5FD8A 3I52A 1CUSA 3F6EX 4V0QA 3LYLA 4PSKA 2FE1A 3L2OB 3GW8A 4I9GA 1FNNA 3M5WA 4G1CA 5TSDA 4REOA 3EGDB 2EBHX 4O8CA 2JFXA 2O54A 3I30X 1RIIA 2DCMA 2XZDA 3RG2A 5IT0A 4RM2A 2GFIA 1W29A 2ACEA 4D92A 1O6ZA 1KI6B 1O95C 3ZD8A 3OPMA 1EFHA 3N59A 3PPYA 4TMVA 3VC1A 3Q3JB 4OUDB 1XWFA 3F2IA 1MMFB 1NXWA 1V7QA 1BXZA 2EARA 4PFQA 2VYNA 2Z43A 4AIIA 3ZE2B 2GD1O 4S1NA 1M83A 2WLSA 3MINB 5G0VA 2O7RA 3NHUA 3M33A 2H65A 5GM2A 4EOGA 2BGGA 2PUHA 1QP4A 1XRLA 4LRYA 1YB1A 1Z38A 4ZQHA 4GI7A 5CA1F 4HDAA 5LA6F 2J41A 1XYVA 2VXCA 4BNZA 1F0KA 4M1ZA 4AYTA 1XDDA 1A2BA 2P9YA 5HKKA 1KH2A 1MH1A 3NRJA 1TW3A 5KTNA 4D9IA 3GAMA 4FDVA 3PGXA 2IV2X 4B6QA 5ITSA 2J0SA 1QK5A 2IYQA 2VFAA 4AKHA 1ENOA 1FP6A 3S40A 1N8TA 3SM9A 1G5QA 3OKCA 2ZSJA 4XTCS 4DGQA 1TUBA 2FX2A 2JDID 2OXEA 4G85A 1BE1A 4YV0A 2EX1A 1T29A 3FPBA 2Q5OA 3N5CA 1PV2A 3R24A 4G6ZA 4LRSB 4UM7A 2Z2JA 4WK2B 2X3UA 2RHOA 3EVEA 2GLTA 4MA0A 2X1VA 3RYFA 4EHBA 2C9YA 3KYDA 4I3FA 2AN1A 4IIYA 1TI7A 3FOAA 3NNDA 4N47A 3OLVA 3N2GB 5DRYA 2XBLA 3QV1A 1I4OA 1W4LA 2GK3A 2WPDA 1JDZA 1U99A 4IF6A 4R1NA 4D46A 2FSSA 4QYTA 4WCDA 1XC7A 1VHTA 2P3LA 3B2QA 2CBXA 3JQ8B 4N03A 4N49A 1TM1E 5L8VA 2OORC 1N4DA 3SAJA 2H54A 1QYRA 2UUBB 2EKZA 2C4VA 5E2IA 1C8KA 3M2PA 1E9RA 2EIXA 2NVUA 5FTMA 3ZJ4A 5B7PA 4EL5A 1VPWA 1XO1A 2JAPA 1JR3D 4CV3A 4OATA 2G9VA 2IUFA 4M6WB 1E1MA 3Q4GA 3R0ZA 4ZMSA 3W8NA 3THWB 3ZV3A 3F73A 3TTTA 1KP2A 3NASA 1F2TB 3A9VA 3AF5A 1U1FA 1RP7A 5EESA 4OFWA 4C3ZA 1SU8A 1DO0A 3NBZC 2OBYA 1OSNA 1K5GA 2FDCA 2BTEA 1K7FB 3BREA 4LNHA 4TKZA 5FBZA 1ONOA 2ZCUA 3TZQA 1NPYA 2UAGA 1MDBA 1VE5A 1EB8A 3SS9X 4EW6A 2A4MA 1U8CB 5ADUS 2BONA 4Z4FA 1TNDA 3QM1A 1PWXA 5LQRA 2C2WA 1HE3A 1I13A 4XAQA 4Q01A 3RC2A 1QLHA 2CUKA 3H0KA 3KKQA 3PKJA 2PMFA 3OTOB 1L5NA 5JTTA 1COZA 1KI6A 1P60A 1Z2CA 2QENA 1NP6A 5FV7A 4E5KA 1CS4C 3EYAA 1QS0B 2PSFA 4YAFA 3AK4A 2A8YA 3PNQA 3A6DA 2BCEA 3M5DA 5DHFA 4A2CA 1ZJWA 1NR5A 1Y8ZA 2X0IA 2EFGA 3D3JA 3GYGA 3N0VA 3UXYA 3PNPA 1IMJA 3QSGA 4HWSA 1ZNYA 2L19A 2O4CA 2QL6A 2VSNA 3QLJA 5DT9A 3WJ2A 5JYBA 2UZ1A 2HA2A 1MD9A 2V7TA 3DZBA 3ORQA 1K8RA 3KTAB 4LJ4A 1EP1B 4BEVA 1WBJB 1XP5A 3VR6H 2CFOA 4PLYA 1TF7A 1PWHA 3RRJA 2FW6A 4L4UA 2BJVA 1F4LA 4R5HA 4HGPA 4DLPA 3VHXB 3FIUA 4KDEA 1J8YF 5A05A 1VKOA 2O3UA 3HE3A 4ZI7B 4KC0A 3EIFA 2ADFA 2CXXA 1A8IA 3AVTA 1CUDA 3DW3X 2GF9A 3F0TA 4Y2VA 5JAMA 1R9GA 1ZGAA 3ZW7A 3HJUA 5IAJA 3CWQA 4PFSA 3R3UA 1LJLA 4EHDA 2JGRA 3DOOA 1QLWA 3DL4A 5EJEA 1C7EA 5BUQA 3F7NA 3UVEA 1A2OA 3C3KA 3QENA 3IBTA 3OESA 1YRBA 5DHUA 1MIOB 5H59A 3E4DA 3GLTA 4JR2A 1WD7A 1J2RA 3LQRA 2OL4A 3RADC 1GSHA 2Q3EA 3L8FA 1T0JB 5GVSA 1SCIA 4FILA 4G1FA 4G0VA 4L76A 2QIPA 1SK9A 2ZSEA 3DEYX 3F9RA 1KO1A 1H9CA 2PMDA 5IDVA 3AF2A 5ICGA 4KREA 2PZGA 1YB6A 1Q7CA 4DV0B 5EPOA 1SCBA 2V7XA 2ZRNA 1EESA 1B2LA 3D7NA 4BZXA 4RE5A 1F9EA 2ET6A 2RG1A 3ECSA 3Q7PA 4WXHA 4DMLA 2PNFA 1G3RA 3ETJA 3PXAA 2YDYA 5AM3A 3V4OA 3LWZA 3CH5A 4XGKA 3TW0A 4GMFA 1PT7A 5A5FA 3PZRA 4Q05A 1LSJA 3H7IA 3WXMA 4R1UA 2N42A 5CFQA 2PMWB 2C83A 5ITZB 1D0IA 5FFMA 2B1QA 4M53A 2CMHA 1KXJA 4PBSA 1YCDA 3BJRA 5GVRA 4CEIB 2Q8NA 4XZ3A 1T36A 3IIEA 4MLPA 1CEYA 1C0IA 3C45A 3LVQE 4Q24A 1FZQA 3DOHA 4RIIA 4ER0A 1A76A 2H11A 3DXXA 3VTFA 3C98A 1A8PA 4INOA 2IH5A 4MI9A 5K03A 2MR5A 3B3FA 1ABFA 3ABRB 3F67A 5L7TA 3HB4X 2XEXA 2ZJZA 5CT4A 4DDHA 3AHHA 1CYDA 4QNRA 5DEIA 5DYTA 2H4YA 2R7NA 1SWVA 3BHMA 4CMGA 3QLUC 2J3EA 3K1ZA 3Q9NA 4TLDA 4MPDA 1EDDA 3W6PA 1C3VA 2D0PB 3S8MA 4R2MA 5BSUA 3ZK9A 2VJBA 1P0IA 1ZVQA 2XUFA 3W6OA 2E87A 1J23A 2WICA 5ALTA 3ZU4A 3ZJVA 5H1YA 3QY0A 2EWVA 3I53A 4EQZA 5E2AA 2F64A 2GCOB 4EHLA 3SHQA 1PQPA 4OPMA 5AIAA 4DC1A 1MT3A 2GBLC 3WNVA 4BKQA 3KZ1E 2YFYA 5B3JA 4QT4A 4Q39A 5H82A 3G8CA 2JI9A 1D4AA 4GYYA 5FEUA 4YMTA 1D0SA 3DEHA 3KAPA 4HQFA 5JJ5A 5D87A 1WDTA 3HBAA 3K0HA 2AH5A 2BGJA 2ZVJA 3RRZA 3S5UA 3V8MA 5ITZA 2ZIAA 3AH8A 3M4YA 3W6NA 3U7HB 2QRZA 1YZHA 3K0KA 2OV2A 4M8KA 1KFKB 3D64A 4YV7A 2FWRA 4P98A 3UPDA 1TDJA 2H00A 2Z2YA 3D4LA 2F3QA 3OQ1A 4OQLA 5EMMA 1OH7A 1DAFA 1IZ9A 3B20A 2OV1A 4JJGA 1YZKA 3O5AA 5I01A 4Z53A 1QWSA 3DC7A 1B16A 2TYSB 3MGKA 1E2QA 4JQCA 4RENA 4RMIA 4ENRA 5J23A 1DKRA 4CMCA 2FXIA 1WXIA 3H11B 3P4UA 4PCAA 2GNAA 4WW0A 4BWGA 1J97A 1YZ3A 2GH1A 4L6IA 1CQJB 1VG9B 1Z0FA 4XLZA 3THRA 3T5TA 3DEKA 4AO6A 2UU9B 4ZXFA 2WYIA 1S2LA 1JU9A 1BA2A 2IDMA 1XZPA 5LR6A 1N1EA 5GTDA 4NMMA 3H2IA 2C92A 4FFLA 1DRWA 3E1GA 3LKVA 4I4TA 5AQ1A 5IZ4A 3EXAA 1DC6A 4DCCA 2CT8A 2W2LA 1GCOA 5BSRA 3H4VA 3D3WA 3LUHA 3EOZA 1TCUA 2POQX 1N8SA 2G67A 2ZJ4A 4IMRA 1PZFA 4YJFA 4ZCSA 3RFVA 4Q9DA 3VTZA 4DVGA 2WSBA 4OAPA 5LYJB 5HKLA 2I9KA 2QTAA 3B6ZA 2VTBA 2JK0A 3SQOA 4M0MA 4NG5A 1WZUA 1XCLA 1HYBA 2CWDA 2OILA 3HJRA 1N2CE 2GPBA 5AH0A 3OQIB 5DP1A 3U1BA 5TPZA 1W85A 2GRJA 5LNK6 2GYUA 3WLSA 4AUMA 3RFCA 4ZYYA 1GPKA 3PUYA 1X7YA 4GFDA 1G9XA 2O1EA 3G7NA 4MMYB 3ZD7A 4IDDA 1W36D 4X63A 3E4CA 4FFBA 1C50A 4MB6A 4TWRA 4D96A 1QC5B 4UCFA 4U7GA 4AP9A 3TPFA 1H6CA 1ACJA 1UZNA 1JLKA 3HRKA 3GT3A 4HRYA 4J16C 4PZAA 2PMCA 5TQJA 4BJ1A 3DZIA 3T3HA 4A03A 1JR4A 1FYWA 1XB2A 3WDMA 4J0JA 5KPJA 2CFSA 1IHXA 4N5LA 2WUFA 1LH0A 4G0OA 3VSDA 1YL5A 2OP0A 3QE3A 4I1SA 4XDYA 4RK5A 2BHTA 2M6SA 5FOVA 1IZ7A 1T0UA 3CW8X 2WSLA 3E58A 4M60A 3F8TA 3KIPA 2XE4A 3MUFA 4EG1A 1M33A 3N0WA 3V1LA 2R7AA 1EQUA 2JAOA 4FJ1A 3DKKA 4F2GA 5KWEA 1T2AA 3A3PA 5BWCA 5MFPA 1WF3A 2IHJA 1PNRA 1AHNA 3LD9A 1YAJA 1USGA 4GIBA 2VAXA 3OM8A 2JFFA 3IVGA 4Y0NA 2FZLA 2GEJA 5IKPA 2CFIA 2JIOA 2PXCA 2PNJA 3UJ3X 1J1IA 2LIVA 5HFNA 5H16A 3FBTA 2RCYA 1II8A 1M66A 3TNLA 3AKCA 1U3TA 3R3WA 4XM2A 1KE2A 4C4RA 2XKKA 4RXUA 2JEOA 3TEMA 3G2LA 4OHYA 4V2IA 2EHJA 3WWZA 5BYKA 2P0AA 2VAPA 4G5RA 4EARA 1YDGA 2GJAA 2QK4A 3IQXA 4RZ2A 3AL0C 3PQ5A 1T2UA 3IOCA 4YP1A 4DNQA 2HK9A 4MJ3A 5TPWA 2QYOA 4LQ4A 5HXAA 1Z62A 3EZXA 3KU1A 5TS2A 4OFBA 1FMTA 2IPMA 1GXSA 1IE3A 2EKLA 5AVQA 2YICA 4S2UA 2X6RA 3HL0A 3HB9A 3NTQA 3NWEA 5HOQA 3AETB 1K27A 3JQEA 1BE8A 2X86A 1JYFA 4WJKB 4O4HA 1E99A 1T5IA 4FFVA 3RIMA 3JALB 1MNQA 1P2FA 1NUUA 4CEJB 2GJ9A 3UO8B 3VH1A 4B0OA 4Z7QB 2W0SA 1XSEA 1CDDA 4BNMA 1KU6A 3TNJA 1UDBA 1J90A 2JFWA 5ALEA 4QQKA 1CZUA 4LXIA 5F21A 3WGVA 2FW0A 3QVMA 1A4IA 4AD8A 1MXHA 3IPXA 2Z2XA 1P1CA 2AZMA 2DY1A 3ON5A 1JQJC 3LWDA 2NTJA 2VYVD 1Z75A 2C3OA 4MZXA 3C6XA 4GRDA 2IE0A 3V6LA 4UMDA 4H6VA 5A9SB 2ZRFA 4K2AA 3LDGA 4KVGA 4NRDA 2M6LA 2I91A 2Y1XA 4FFRA 1HT0A 1RPTA 3COWA 4QDUA 3ZE0B 3C15C 3SQNA 4ALLA 4RTRA 3T5DA 5EFOA 1CR1A 1DBPA 1PZGA 2YXPX 4TQ9A 4LF8B 3AFHA 4N01A 1N2CB 4CGYA 4PXAA 3KR9A 4OOFA 3E9RA 4X8LA 2R1TA 2BM8A 4YMWA 3LHFA 2PQ0A 4M1TA 5EXPA 1B3RA 4BJHB 4JITA 3HWX1 1KETA 3CLSC 2A7QA 3CU5A 5DX0A 5B7GA 2A59A 2NWQA 3T35A 1QB8A 5EWJB 2MJLA 3SC2A 3DCJA 5KTSA 1ZCBA 5ALYA 4YP7A 1RAEA 1XJCA 4KN6A 4F60A 4YUWA 1CZHA 1G8HA 2N3ZA 5FL7D 5E4FA 3SYKA 2ZYAA 1UEJA 1ULUA 3IIMA 4P5EA 4O2LA 3RSLA 4FYMA 1A0OA 1DIOB 3EXFB 3K7EA 3G8DA 1I6LA 4OHPA 3X43A 4B74A 2YVAA 1QP8A 2NTNA 1UL1X 3BTSA 1TAUA 5JATA 3DE7X 5IJ9B 3K70C 2DR3A 4K9SA 4HNTA 5BR8B 1I2AA 3DVSX 3NI2A 2I4RA 5KNCH 3GP3A 3O8QA 2CDCA 2VIIA 1NYTA 1FDVA 2FPPB 3WP1B 2VJKA 4MRRA 2WABA 2HZ7A 4OSOA 4DNPA 4YCNA 1QHSA 3NDPA 4EJSB 1QRDA 2LP4Y 2AS0A 4B3GA 4AK9A 2GHIA 5DGCA 4WN9B 5EMKA 1DZ3A 4W5WA 5EJIA 4QYIA 2VEOA 1PF7E 3WJ7A 1DWPA 1X1TA 1OXSC 5ETJA 2DE0X 2WLTA 3LY9A 3LY7A 4E5NA 1HTBA 1PJ2A 3L1KA 4XA8A 4BU0A 4F4UA 4WKBA 4YGYA 2PGOA 4PRYA 1IAQA 1SVIA 5FAXA 4CMEA 2JIDA 1FYFA 1NVMB 3A7DA 2D59A 2VPIA 1DL5A 1X80A 3TOVA 5LFAA 3AERB 3CLUC 1QGDA 3IB6A 1CR6A 1UPCA 3OT1A 1Q77A 4KIFA 2OE2A 4NDNE 1JIXA 4QWWA 4YRAA 4G9BA 2Z8ZA 3DTVD 3GJ0A 4WI1A 1L5LA 3EEQA 3W8DA 4E33A 4EZIA 3IKTA 4QOFA 4MRMB 2KE5A 1Q2UA 2FJPA 4L6CA 3WP0A 1SIUA 1IY0A 4HRXA 1U3GA 1XU9A 4PHTA 2GBFA 2YN4A 2CB0A 3GLHB 3RW9A 2DXIA 1VI2A 4RCVA 1FUKA 4KQ6A 2A92A 1I7DA 4B2IA 3B6MA 4UFOA 3T3IA 2XPCA 5C5IA 1T4CB 2IYPA 1M5RA 5KTKA 2HCTA 5U4QA 3LLSA 1HNXB 2GZ3A 3OZSA 4EBFA 1EPUA 5IDXA 1ZAKA 3T0GA 3B2EA 1Q5PA 1T5TA 5IARA 2XY4A 2OZKA 4GECA 3THYB 2WF5A 1HZZA 4KAXA 4UU1A 1KEKA 1ZO8A 2EL7A 3QU9A 4RPLA 2AIRA 4DLBA 1FNSA 4Y9UA 4F4DA 4Y18A 5ICSA 2CN1A 1RRCA 4V1CB 5BORA 1Z13A 3KOZA 1MAVA 4BXOA 4I6EA 3CGWA 5DPMA 4DN6A 2FF5A 4D2IA 2QSYA 3OPVA 1QRSA 5J9FA 3GZJA 3A3NA 2VRNA 2NYAA 3BA1A 5A0TA 1PO7A 3M49A 3OLYA 5E3JA 3ESQA 2C2HA 2OAEA 4OGFA 3D0OA 2FJUA 2WVHA 3M6FA 2WKWA 4NNJA 1ONBA 3X1YA 4E2FA 5KX5F 3T41A 1VJGA 1HF3A 1NF9A 1T0HB 3NEAA 3PA8A 2HEGA 2IF0A 2QN8A 3FW1A 2JFVA 4OAQA 3F8SA 2I4OA 4WNIA 2PRIA 4PGHA 4Q3KA 3D4BA 3MT0A 5IAKA 3BWEA 1GQRA 3LCVB 4WZBA 2VBCA 3PHJA 4G1UC 3UWMA 2LV8A 4BC0A 3IP3A 1L5MA 4MW0A 2I76A 1VMIA 4BFCA 3R7BA 1ZRNA 1PW5A 4HYEA 5HBGA 1MRSA 4ZAWA 3D6TB 2B8JA 5A3SA 3PHIA 1ZNWA 3QNWA 5BVGA 1HXHA 1EFKA 1E3LA 1VKNA 4HEQA 4NP6A 5CDFE 1X15A 1NLMA 2CVOA 2OT3B 3RC9A 2EIHA 3F5FA 2YHIA 4DPMA 1UPFA 3F5DA 2E85A 1F6WA 1KS2A 1PL8A 1NN3A 2FMFA 2BFPA 2YJ3A 3SQMA 1RHQA 3EH1A 3BOSA 3O2NA 3QF7A 3ZEAA 3CRVA 3TEJA 3KT0A 4A3SA 4ZRMA 4PBTA 5M04A 1GUAA 1CJBA 4DBVO 1F9AA 5A9SA 1OLSB 4LQCA 3K71B 4RHXA 2BBOA 2RI0A 4KBFA 2BGTA 3A9TA 3CS3A 4N7MA 3ESRA 4DL9A 3PLAE 4JLSA 3CONA 3A6KA 4LBZA 4M37A 5LOVF 2ARKA 2P40A 1DOZA 4IZ6A 3IODA 5ABPA 4YI5A 4XI9A 1YGYA 3ZJUA 3HGQA 5AJVB 5GOZA 5IT4A 4RE6A 5PGMA 1J0AA 5TGDA 2AXPA 4QHSA 5BUZA 1O94A 2BW0A 3FCYA 5JYCA 4YUVA 2C9BA 3O7MA 2ROQA 2ZSUA 1BU5A 1RBYA 2BEUA 2E89A 4HQLA 4QULA 2BISA 4R84A 1UC5B 3Q7IA 5G0UA 5ILOA 1TTHA 1LDEA 1XXLA 2R8ZA 1PJCA 1JEJA 4PZ0A 3SJZA 2PQMA 4DCOA 2DSTA 3GUZA 3ZGLA 2O59A 2IX9A 2Q7DA 4MTCA 1H0HA 5C8DA 1UBRS 1P9LA 3VO2A 3CM0A 4DA9A 3L3BA 2P41A 3JRXA 2YC2C 3V2GA 1SXJC 3FG9A 4D9MA 5BQFA 1IM2A 3A1CA 4F4IA 5EERA 3AUFA 5FYDA 1FJHA 2JIQA 2QRKA 3U26A 2J3IA 3L6RA 1K5PA 4K5QA 3BXXA 3TX6A 3OPYB 1WUTA 5AXCA 3HCFA 5JRJA 1EGMB 3DTNA 2EKPA 1Y8RA 2VDWB 1ZA1A 3HB1A 2P2SA 2GSWA 3IGFA 1VM6A 2P6RA 4XWAA 2V7EA 3MCWA 3R4CA 1OH8A 4W7IA 2JBWA 2XSZA 3A3YA 2VZ8A 3V4SA 1BO6A 2WBLC 3UT5B 4EKIA 3MM4A 4BQFA 5CHYA 4WADA 1LNQA 4U7PB 1IOLA 2VPZA 1KXZA 2HT6A 2EEZA 1CB7A 4JQZA 1W9MA 2JFBA 1USVA 1ZN8A 4UTPA 3J81k 3HVKA 2WM2A 4O2BF 3QTTA 4CLRB 5FI3A 1A82A 5FBHA 4LJAA 1E0JA 1TU0A 2FN7A 4H0NA 2H9YA 2J4CA 2PUCA 1Y8QB 1VSVA 1MOPA 3CH6A 3IIIA 3KKNA 2JFGA 3KXKA 3W9BA 3BQNB 2JLSA 2QRPA 1IBLB 4OQYA 5JSFA 2ZRMA 5BNIA 4HXEB 4MQFB 2XNKA 3DVLA 4MRMA 4NVRA 2RFLA 1OFIA 4C76A 1BDMA 5MN6A 1YE5A 3GCDA 3OWOA 1DC5A 3W05A 1ELOA 1K4MA 1TXGA 3DDUA 2XA9A 3HZZA 2C96A 1XFAA 2ZBEA 5JY6A 1J09A 4PLTA 4YJHB 1P5JA 2R4TA 1M1YE 4EO4A 3NHWA 3GDGA 2Q3CA 4WKCA 3M4JA 5AW8A 3GJTA 4M0CA 3PNLA 4PPFA 3P9PA 3E7FA 5ED4A 3ORFA 4A6DA 4CKWA 4KITB 3DMYA 1C1DA 3RUHA 3DZFA 2DERA 1ISSA 4WAUA 2BFFB 1C7FA 3CPJB 1J5PA 2CCGA 4BEBA 4JOQA 4LDRA 3K5HA 1QFSA 3R44A 4V1CA 4MYDA 1N36B 1IN4A 1GZ5A 1HH4A 3S8EA 4YMHA 4I36A 1GTVA 4A4DA 3DONA 4AXBA 1PT5A 3EPHA 1CZKA 3QU2A 1CZLA 4HDMA 3IDQA 5CFZA 1AKWA 2C9DA 2VR1A 1P2UA 1EQ2A 2Q21A 2DBZA 3PWTA 4LMRA 4C01A 5ERGB 2JH9A 3F6SA 5KDLA 4EDFA 5BN3A 3T