4KO2S

Low x-ray dose structure of h2-activated anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
279
structure length
279
Chain Sequence
b'AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEGEMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFGDNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNGINWCVENAVCIGCVEPDFPDGKSPFYVAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFeSe] hydrogenase small subunit
molecule tags Oxidoreductase
publication title Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
pubmed doi rcsb
total genus 82
structure length 279
sequence length 279
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ko2S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ko2S02
3USCS 4UD6A 3ZE6A 1E3DA 4UEWA 4UPEA 4U9IS 5JSKA 3USES 1UBOS 1YQWA 4C3OB 1CC1S 1WUIS 4IUBS 4U9HS 1H2RS 5ADUS 1UBJS 4UD2A 3ZEAA 4KL8S 4UE6A 5D51S 3ZE8A 4UEQA 1UBMS 4UPVA 5JSUA 3ZE7A 4KO2S 4UCQA 4CI0B 4UQLA 1FRVA 1YRQA 2WPNA 4KO4S 3ZE9A 4KO1S 3AYZB 1UBHS 4OMFG 5JSYA 3UQYS 1WUHS 3AYXB 4TTTS 4URHA 4UE2A 5A4IS 3MYRA 4KO3S 4UE3S 3CUSA 5JSHA 1UBKS 1WULS 4IUCS 2FRVA 4UCWA 4UCXA 3RGWS 1WUKS 4GD3Q 5A4MS 4UQPA 1YQ9A 5JRDS 1H2AS 5JT1A 1FRFS 1UBRS 1UBUS 3CURA 3H3XA 5A4FS 1WUJS 4KN9S 1UBTS 1UBLS 4IUDS
chains in the Genus database with same CATH superfamily
4NS1A 1ESNA 1UCFA 2O1WA 4IINA 3DWIA 4IUYA 5LYJA 2WE8A 1E2JA 3ZYCA 3ETNA 2IH4A 1WZIA 3SR3A 2HPAA 3T3PB 1VHDA 1MO4A 3EGXA 3KVOA 3TVYA 1QFJA 3YASA 9LDTA 5IJ0B 1SCJA 1NDUA 9MHTA 3BE5A 1TJ3A 4ZI7F 2HJHA 5LBUA 1BH6A 4QJ5A 4MKZA 3RTGA 2B94A 4YMWA 2OHOA 2AN4A 2NPIA 4ECEA 3QLUA 3V7YA 4Q7KA 3PQ6A 4H16A 3LH5A 3C3EA 4OYRA 2OHIA 4MDFA 4HAUA 4L7VA 2WAXA 4PWZA 3Q8MA 4WKPA 3PWZA 3FNGA 5EZQA 2B9EA 2ZG6A 1PEKE 3FSJX 2VPQA 2ACWA 5A03A 3JWGA 2XUFA 4OPMA 3H4VA 1G8FA 3HZOA 2I3GA 4AK9A 3BHMA 1QZ3A 4QICA 2ZB4A 1IONA 5KTKA 4KB5A 2NZVG 4B7XA 1NRJB 3JQ9A 4H77A 2X4IA 2Z43A 2AJBA 3Q3GE 1OIWA 3R7LA 1BWPA 2PS3A 2WAAA 5BQ5A 3M83A 2D1FA 1KAHA 1YVDA 2DX7A 3WLOA 4N1AA 4KNYA 4L3VA 1RSZA 3ABIA 5KQRA 1G60A 1RLJA 5LM3A 1BX0A 4P3OA 5C7IO 4C4RA 2G3YA 3SMVA 1J0DA 1TCVA 5HZGA 2EATA 3UQYS 2O2JA 3BHJA 1CB7A 2WICA 2X86A 3RSSA 1HQCA 4MV7A 1SG0A 4D3YA 2NU9B 3SBXA 1UPUA 3AR5A 5L6MB 1CUCA 5MDHA 3GH1A 1WZCA 4M22A 3RUCA 5CD9A 1OLXA 5CFMA 2XDWA 2WSMA 3WP0A 1NY5A 2MJLA 4D0SA 1XZKA 1OBOA 1PSWA 1YB1A 2XYQA 4DUZB 1V7QA 2RONA 3JU3A 2XB9A 2RCYA 4MUMA 2VSQA 4KVGA 1Z5NA 2Q3EA 2AI2A 2Q8QA 4PTLA 1FSSA 5CG1A 2DSNA 1RD4A 3AM4A 3JVEA 1QF9A 3HDQA 3DMTA 4UJ5A 5HUHA 3O83A 2GO1A 4TM7A 1KI1A 4HH3C 2CCJA 1RXCA 5AXAA 1NP3A 4PEVA 2ZOSA 4YRDA 3TEMA 5L3ZA 3HVHA 3GC6A 1U1DA 1CR4A 1WCYA 3I9FA 4BQRA 2WPDA 4I1UA 2CFIA 3K1JA 1CFZA 1UT6A 4AFNA 3DMHA 2GPAA 1OB5A 4X1KB 1MH9A 4PZZA 3B9QA 1I3NA 1K66A 1CUDA 4DABA 2RB5A 1AZTA 3DXYA 4HD8A 4M99A 1KYYA 4C0KA 3SQWA 3UWPA 2AMYA 2E55A 2EC5A 3C7KA 3S70A 4B8ZA 1H4QA 2VQ6A 1GG5A 3KKEA 3IP1A 4B2PA 4FW9A 3ROXA 4WN9B 5KAPA 1EA7A 4AZ3B 4DVJA 4IIGA 3WS7A 4C6RA 3VU3A 4QNNA 3T4XA 2LKDA 2X8BA 1M7GA 2GM3A 2GZAA 1CRQA 1FMJA 4J07A 4QM7A 4LOJA 3LBHA 5KTPA 3TPCA 1DT5A 1RFGE 3E82A 2AMLA 1BVUA 1RZUA 1Z07A 3EGVA 4NFLA 4W7IA 2H11A 5G41A 3QSGA 3SMQA 4D9KA 1IEVA 2WFZA 2VPPA 1N32B 3INGA 1C50A 2QIPA 3VM6A 3BIWA 4D4KA 1XPOA 1IPHA 4UBNA 1VJ1A 2BISA 3NXKA 2F2TA 1WOMA 2NTNA 2H5LA 3KHKA 2OGSA 3MLBA 3N1UA 5D1NA 4OGFA 3P9PA 1GCAA 1R64A 3IDZA 4ZICA 1PG5A 4YP9A 1SIWA 2JJ1D 1K27A 2Z58A 3GLIA 5HJ7A 4E6EA 4FFNA 3K0CA 5BPFA 1YU6A 4DEVA 2FX5A 2XRYA 2G0AA 2ZJ1A 4C0BA 1G3QA 1QH1A 1KPHA 2AQIA 3T34A 4IKPA 4Y2UA 1U0SY 4C7XA 2QQEA 1RT9A 1DC5A 3EC7A 1C0LA 2ZYUX 3PFGA 3UGQA 3KCNA 3VNBA 2ZRMA 4PLCA 4NCXA 1LSJA 4QOEA 5EVJA 1TM5E 2IZ7A 1U3VA 1V25A 3N2ZB 3PGXA 2WILA 1CZRA 2HEIA 3B8HA 4PGAA 5AHKA 3C4JA 4QKQA 3AWIA 1CK4A 4BBAA 5JCPA 2BDUA 1U6IA 2FFBA 3WKBA 3VV2A 2DFPA 3DLIA 1EPUA 1F6BA 3GNSA 4Q4JA 1XNJA 2JAWA 4ROTA 5DMHA 4W5NA 3EWNA 1Q1GA 3MN1A 3UT0A 3M34A 5DLQC 5KUTA 3NMUF 1LTKA 5IULC 1ZKDA 1F5NA 2VEOA 5B30A 3GJ5A 2D2XA 4PPYA 1JT9A 4IYJA 4Y1RA 1AS0A 1U2RA 2FWAA 4IEIA 5DASA 1HT0A 4AF6A 5CFQA 1H4SA 1GA4A 1QE3A 2Y6VA 4MIOA 4PC6A 2ZIGA 4CM8B 5EHGA 1HT3A 2O5VA 1SOVA 3RDPA 4EVSA 1RVV1 1FX1A 1SPXA 4QBIA 4MWZA 2GBPA 4DEXA 3DEAA 1C3OA 2XVXA 2PTHA 2QX4A 3G9QA 3UF0A 4LJ6A 3BZWA 3ZE6A 4D74A 1FDTA 2IGTA 3IUBA 3TRFA 4JUDX 2WHXA 1NXWA 3SS7X 3G0CA 3MWLA 1FJXA 2CKDA 4E13A 4M38A 3IE2A 1B16A 1M1YE 1WO8A 1YNSA 4IRMA 3TMKA 1FNCA 4ZT2A 4E2XA 3LBAA 2H85A 2AR0A 5TE9A 5BW5A 4IXDA 4OHXA 1X70A 2MMCA 2PKXA 1P7YA 4M1TA 5JECA 1PD0A 2FP4A 4C0LA 4WASA 1ELOA 4JC4A 1RCUA 1HLPA 1TA9A 1ISPA 1Z2CA 4EHLA 2GEVA 2PQMA 5BNIA 2IYQA 4KQWA 1ZMTA 2OA0A 2P5TB 4MYCA 3W9BA 3GFOA 4KACA 1RI1A 3DNMA 1NC1A 1M1NA 4ZCMA 1NW5A 3DPIA 5CW1A 2O20A 2B5VA 3W0LB 2VJOA 4OYYA 2BR4A 2A7QA 4MDHA 5ALJA 1NATA 2QE6A 2VBGA 2IYFA 4TTQA 4PYLA 1EAYA 1WL8A 2BHTA 2W0MA 4RFSA 1NQOA 1S9HA 2HMYB 2J3HA 2XVZA 3I6ZA 3HXOA 1T0UA 1Z0ZA 1JP7A 3D8UA 4QVGA 2GZDA 4K87A 3IP8A 4B3SB 1US8B 2B2CA 1GFSA 4L6AA 3FCEA 3BDAA 3S2UA 1CERA 1M1YB 3EXHA 3K0SA 2V3VA 4P3YA 3OWHA 1CDOA 4M1SA 2YWGA 4IM7A 2ODNA 2HLNA 4PVDA 3P0RA 4ZHSA 1G7CA 2V1XA 3SEZA 2F3PA 2BFFB 2G8LA 4X3PA 2ZQ5A 1OILA 4RDHA 1U1FA 2LIVA 1O08A 1W29A 2BGKA 4PX5A 4UDNA 5E1MA 4CFYA 4D56A 1NF9A 3ICVA 2VP5A 3LX4A 3NJ8A 2ATXA 3DYIA 2IH2A 1FRQA 2V6GA 1TYZA 4DBZA 4W8OA 2HWXA 3IUNA 4E3ZA 4JC5A 1IN1A 3TKAA 5JTTA 1TKAA 3FR8A 2EJVA 1LS1A 1G9TA 2PZGA 2XY4A 4XSGA 4C3VA 5TQ2B 1XRLA 1AV7A 5T4HA 1IN5A 3ABQB 1LVGA 3DZFA 1N7IA 3EA4A 3WB9A 3DKIA 3L5KA 4OSPA 1A9RA 5FUXA 4A92A 5K1ZA 4BGUA 1VHQA 4KYUA 1YUBA 4OL9A 4TYQA 3SZLA 2B4RO 2GFQA 2J7PA 3UKDA 2IH5A 3H1FA 1Y6GA 1NSYA 3HSYA 1YZKA 4RZUA 2QG4A 1IZ8A 1Z73A 5G1OA 1MGOA 3DE0X 4KDEA 2AOUA 3NQ41 4RVOA 4P34A 2OTCA 4F2DA 3ILYA 1YQUA 1NVFA 3ZWDA 3TZKA 4CUZA 1FLVA 1L3BA 2JIDA 1WJGA 3GG2A 1D9ZA 3KZCA 3RBAA 1QONA 1NUUA 3FWHA 1HMYA 4FYVA 1CNMA 2H59A 2XSZA 5A05A 3NHFA 5DYTA 4E2WA 5DWVA 5I3CA 3TDNA 1BU5A 2UU9B 3R5SA 4ZZ1A 3PSHA 5LJIA 5CMLA 1W9HA 2VDLB 3G0OA 1E89A 1YBVA 1ZH0A 3TIXB 4ETNA 3GLGA 4NE2A 3SLKA 2IS2A 1P6XA 2JFPA 1PHPA 1UBUS 3PCTA 3A2KA 4HDOB 5T41A 1K88A 1QGOA 3UICA 2J6HA 3PUZA 3WWCA 4GMDA 3I45A 4EHBA 3A1CA 1JSCA 1U9ZA 3OM0A 2VDRB 4Q1FA 5EYPA 2QMYA 2W43A 2DFTA 2X2EA 3EVBA 2D0OB 3HJCA 3I09A 5K51A 1RXWA 1FQWA 4K03A 4PYKA 2QN6A 2CL5A 4LHYA 4E30A 2Z08A 1NWCA 3NIGB 4I1VA 2QKYA 1M6YA 1P1JA 2FPWA 4TQAA 1VG1A 1EJ0A 5AWFC 3RRNA 2G76A 2TS1A 1KAMA 1NHGA 4PRZA 1I32A 1Y6RA 2PZKA 1X1DA 2WUDA 3UMCA 1A1SA 2J6IA 1RM4A 1A8HA 3G17A 8ADHA 4YIHA 1B8UA 3ESRA 3VU9A 4U00A 2XHEA 4E4YA 3T06B 2NUTA 4AQ7A 4QEDA 1L8LA 1UODA 2O5CA 3VTZA 4CKEB 3QKTA 4FOTA 2I03A 2JJ2D 5FBKA 4FE7A 1B8PA 2WV9A 3AIKA 4IQ0A 4HOYA 5CJPA 5E6RA 4IFEA 3UPTA 1LGYA 2W90A 4I4NA 4BJHB 4KITB 2XQJA 2CF6A 2J0EA 4KLZA 5BWBA 5IHXA 3TOVA 2W6PA 2XJ4A 2PU7A 4DRZA 3F5FA 5AVTA 1P4AA 4RDXA 4R5MA 3L5OA 3DDUA 2SKEA 2WD9A 3PTZA 3GLTA 1QH9A 1JJVA 1TMYA 3P5SA 5ALIA 3HRKA 4AULA 1IY9A 3GUCA 3AUJB 3KKZA 4FT4A 3DOOA 3HCOA 4PG6A 1GQSA 4KGDA 1E2LA 5CP8A 4WACA 3QU5A 3UK2A 4CTOA 2YKGA 3JR3A 3AP2A 1KC1A 2VUHB 1UDRA 3NB0A 1E1RD 1HOXA 4R0NA 2G36A 3USCS 5FUBA 5HKBA 3PT5A 2O2YA 3NT2A 5CA0B 1GSAA 1I7DA 4X20A 4GZ3A 1YSCA 4EBBA 1QCZA 2ZRLA 4GZ6A 4BMDA 1PT8A 1XFAA 3AZQA 3ADCA 1YE8A 2VJAA 1M2VB 3WGNA 1ZD5A 4NJMB 5KU7A 3PXUA 4K8OA 1VJGA 2XITA 3DJFA 5BV0A 3KJGA 4PQEA 4R2WA 3WIEA 5AW7A 1J1UA 2J5RA 3RU2A 4E7OA 3A6DA 4N0MA 3KAPA 1A4XA 3INRA 5CNKA 3UJ7A 2P77A 4CIVA 4CF7A 5CDTA 1YHYA 2BMJA 2B8JA 2VUUA 3HBNA 4G24A 1SRQA 4B83A 3RW9A 4EARA 4CLRA 3W2IA 1FS4A 2VJKA 3WYGA 3TIIA 4OU4A 1M5RA 4M54A 3IC5A 2OO5C 3LYAA 1JL3A 3PDWA 4MULA 4X1OA 5D3MA 2GXUA 2GK4A 3RTDA 3ZBUA 4ZOLB 4K9RA 3GEIA 3DQQA 1P7WA 1Y8QA 2A0YA 4GYWA 3QOFA 5TX7A 3ONFA 2CXXA 4UHDA 1QIMA 5DTMA 3I83A 4DIKA 4W7SA 2Y1CA 5H70A 3PS9A 4JI1B 1Z2PX 3BKWA 3CB2A 2ZETA 1XMQB 2NVWA 4XPZA 4Q7MB 3P4YA 3QHPA 1BXRB 4MV3A 3BS4A 5E3JA 4FJ1A 1BX3A 4YQYA 3MUOA 2YMLA 4R2XA 2RHHA 1NVVR 5KC8A 3WK6A 3K0FB 4DJAA 4RMNA 4WD3A 2ERCA 2HT6A 5EP3A 2J3EA 4IICA 5IBPA 2EL9A 4BMNA 4L74A 3KYJB 3CZQA 3RYIA 5KYNA 3FNQA 3AESB 2DPMA 1NLZA 1II9A 1HZZA 5B5SA 4PO1A 1KSJA 3O93A 3BG5A 2IZOA 3M1AA 2PD6A 2X58A 1YE5A 2AVDA 3KVNA 4YRLA 2OD7A 4IDHA 5DBFA 3KC2A 3C7DB 4OBWA 1R8QA 1B93A 1O94C 2XYVA 4IS3A 1ADJA 1UZNA 2IX9A 3IQFA 1SRRA 2JCBA 1YRHA 4BCBA 4LYAA 3T1HB 6ADHA 2ECKA 3EFOA 1UWVA 3HCAA 3LLCA 1GU1A 1QQAA 4TLMB 1AN0A 3G9TA 1MFPA 5D5HA 3E3OA 3W1WA 1T4MA 1HG1A 2I7DA 4UBLA 1XVAA 2FNAA 1E6UA 1VLVA 3MCTA 3WKCA 5JU6A 1DBPA 5JY6A 1P5ZB 2VOJA 1KQFA 4WHMA 2FX3A 1EFVA 3GPBA 4DMRA 1GTVA 4HB4A 1RXEA 2C96A 4TSKA 1C3OB 2YWJA 2Q3DA 3QZUA 2IUFA 5IW8A 3FZEA 5A3SA 4Q4AA 5T8KA 3UK6A 3X1XA 2PRJA 3A6LA 1RC0A 3MCWA 3GLFA 4FCTA 2UXCB 3PDIB 4ALJA 3GN2A 2ORED 2QM3A 2R1UA 2WUGA 3OO0A 1MFZA 1DFIA 1MPXA 2BONA 1JDBB 2I62A 3HHPA 3NORA 2HRRA 3KJIA 1PQPA 5G3YA 4O4IF 4YRSA 3HCFA 4IRXA 3PLAE 1QIGA 1XTKA 4UMEA 3Q8LA 2WHQA 1YJCA 2AZ4A 1L1FA 2Y9PB 3KXPA 1H22A 3LL4A 2RGXA 1IIRA 3ANTA 3PI6A 1P2SA 4FNOA 4WEOA 3Q5EA 3VPFA 3FLAA 4MQ4A 4AIRA 2GASA 4LJAA 2BFAA 4FSHA 1MMFB 4CMIB 1VKJA 3L18A 2RG7A 5FV4A 2XYRA 1ZICA 2YY6A 2OAGA 4QTXA 1HA3A 1E1NA 5EMJA 5A3JA 1V3VA 3FCAA 3IAS6 4U2BA 4TLBA 1SUSA 5TB5A 4CT0A 4YCCA 5LQUA 3ETEA 1QYVA 1KZGB 4IVRA 2J3LA 4AQDA 2ZIXB 2EDCA 3AB3A 2P6MA 4I3GA 4XRGA 1W94A 4D3SA 4QUDA 3LX6A 3T5AA 2F8SA 1LW6E 4HDMB 3QVMA 4YUXA 3OETA 4OI1A 2PUDA 2ASEA 2XRMA 3FOEC 2DFVA 2IEBA 2QQGA 5BRJA 4YT2A 3IQGX 1E3WA 4Q66C 1G5QA 4MQMA 3HFRA 3NRJA 4J8PA 3L2OB 5HOQA 2JAXA 1GKIA 1LQTA 1P4JA 4LNHA 4NTZA 5KSPA 2E3JA 4GOJA 4F3RA 5I7UA 4FJ2A 2MSWA 2R1TA 4HGPA 1VJCA 4ZVKA 3PXGA 4WY2A 3LFUA 1SUAA 3E58A 4PS1A 1GTRA 4O5AA 4IJ6A 1VA5A 4FDTA 4L22A 1U3GA 4QXQA 2I33A 2HU7A 5AKXA 1R0XA 3AUAA 4EFNA 2BM8A 2X1VA 4KH1A 4RU1A 3NWBA 3IT1A 2OB2A 4M88A 4UVDA 2QZSA 2CLLB 3DBRA 4JY7A 4X3CA 3D6HA 4LXGA 2VK2A 3LV8A 4KPUA 5FTKA 2Z3VA 1LLCA 9GPBA 3O7WA 1WOYA 4HB0A 4RZQA 1B8NA 1FS6A 1KBQA 3UWSA 2IVFA 3QJ5A 3OA2A 1CFJA 4PZCA 5HA5A 5IFLA 3COSA 3Q9LA 2JANA 3EXEB 3KKKA 4O0MA 4QGFA 3CNQS 3ZDRA 4ALMA 4EMBA 5BWMA 3W77A 1N9GB 2BMVA 2I76A 3CCCA 1IXKA 3X1YA 1OZAA 1W44A 3OZTA 3I04M 4IS2A 2AOUB 5HGXA 3ZIUA 3PZRA 1RLOA 3RIEA 1IAVA 1A8SA 3HNOA 4X8MA 3VVLA 4OU5A 4QOSA 3JAWB 2QXTA 2PD4A 1RQGA 4DE5A 5DM2A 1KL7A 1PS0A 2C29D 2OZVA 3A1UA 3AOGA 4J0HA 5REQA 1HQDA 3RYIB 4RTOA 5C53B 1MCZA 2JI9A 2P35A 4KDFA 5TY0A 4MS4B 5LZ8A 3RI3A 5E9JA 2A1UA 4WESA 2DBVO 1OH6A 2XDAA 4US2R 1QE0A 1U9IA 1JEDA 1TUBB 2HCBA 3FYUC 3U60B 4FMBB 3CC8A 4B34A 3QUSA 2CZGA 4B2YA 1U8XX 3DE4X 4L50A 4XW2A 5IP5A 3GCDA 3HWRA 4UBIA 3EEFA 4JDPA 4CKBA 2KYRA 2XE8A 2WHPA 1MJ5A 3D4OA 5EXXA 2EKLA 5JDCC 3AR9A 3BCSA 4P93A 4AS2A 4EYOA 2OAQ1 4OXYA 2COKA 3UG7A 5DNVA 4HNHA 4HFJA 2GPYA 3HB5X 1Q83A 2PKQO 1EVIA 1JJAA 4MV0A 1NVBA 4I50B 5BW6B 4P80A 4OL0A 4OP3A 1LJ8A 2EZ8A 2ZYAA 4I4TF 3WWZA 3AF1A 3D3EA 1O5OA 2WJ3A 4BN0A 1Z06A 1D04A 5B58C 4JFRA 4MR8B 3I5YA 1FFYA 1JA9A 1FP2A 2PKRA 3IALA 4ZO7A 5EHNA 1OH8A 1PYGA 3WY9A 1UM9B 3C14C 4W5QA 1SVLA 4GP9A 2AXPA 2GI4A 1C4XA 1LPNA 1MC1A 1DV2A 1CE8A 3KFLA 4LEIA 4FQ7A 4R68A 4LHSA 3PJGA 4ZAYA 5EA2A 1MA0A 2Y1KA 2D2EA 4IIJA 2NUAB 3LLSA 3UK0A 5LWHA 4UBKA 1DJLA 1E7SA 3B8EA 3SS9X 2R1ZA 4O1MA 4LHWA 2WJHA 3RQSA 4V0MA 4PLTA 2NXNA 3UTCA 3N6XA 3QLTA 4AICA 1VGVA 2V9PA 2AT1A 3GDHA 2FPUA 2ZTSA 3KJXA 1SUCA 2MSKA 2CXHA 5FOWA 3OQNA 2TECE 5IPFA 4L4SA 2Q5OA 1E9BA 1T4GA 3ENWA 2QD5A 3RS3A 4P0TA 3RS5A 1E60A 3JR7A 1C9KA 2A9PA 3I1IA 3PE3A 4I55A 4NFHA 3C97A 1VLQA 2W2XA 1GRRA 2IHJA 2XKBA 3GBSA 4W63A 2QRPA 3TI9A 5G2OA 1CQZA 1VJTA 3RRXA 4JXZA 1JYSA 3UM9A 4EF4A 1G20E 1IATA 3GT4A 4RY9A 3Q7PA 4CKBB 4IDDA 5AJVB 1K97A 1KJIA 4YYEA 1R6XA 3WYFA 3CZ4A 1E2GA 1W5FA 1ZS9A 3PR3A 5CX1B 1YBFA 4C2BA 2WYVA 4R8KA 4TUYF 5FWYB 2IOYA 2O2EA 2WABA 4JD5A 1Q2UA 1TQ8A 2YBEA 3VC2A 2Z1MA 5LKAA 4XUDA 4MS4A 4EKYA 1UXOA 5MN4A 3DULA 3PNLA 1RAGA 1U63A 3FDJA 2ZWIA 2VJQA 2EAUA 4GM0A 4RTSA 2AKAB 3FDIA 2MDTA 1Z88A 4DXHA 2HFJA 3RAGA 3SVLA 3PKIA 4P92A 4RM3A 2OKGA 4NYMR 3CPHA 1CUGA 1DAHA 1YH3A 1MH1A 2Y4OA 3EEIA 1EUCA 5BMVA 3B7PA 1CUFA 1NYQA 4II7A 1QP4A 4MVJA 4INZA 4C7JA 1RMTA 1VIYA 2MYPA 3OC6A 5EJAA 4MQEA 2V9CA 5B7PA 3R3VA 4YQZA 3R4VA 1RTKA 1DINA 1EFKA 4JXKA 3L4JA 5KYYA 5BQFA 3AG6A 2HRCA 3OEYA 4JNCA 3QPCA 2ZTVA 2QN7A 1S1CA 1HQKA 1QQTA 2JGDA 3FR7A 3O8LA 2GZHA 5H1YA 4UFPA 4JOQA 1YR7A 2XUZA 4JODA 4WECA 1XLTC 2WWYA 4KPUB 1LVUA 3Q2OA 3FWZA 4TTIA 4ZEWA 4DWVA 7REQB 1Y3BE 1JXMA 3KT8A 1E8NA 1EUDB 2O8BB 2XIQA 2I1WA 3EH1A 5EAIA 3HVRA 3EQZA 3BH7A 4PCUA 4YRJA 4YCSA 4N7BA 4HDNB 3HY4A 3UKOA 1S8OA 1NUPA 1KU6A 3GFPA 4MGYR 4MRSA 4AMZA 3SBOA 4BKPA 1V71A 1ZITA 4OI4A 1VJ0A 2ZYRA 4O4JB 1DEXA 2O9JA 2JCXA 3V8PA 3B7WA 4JIMA 1POXA 2DUJA 3PXCX 5AFSA 1BWSA 3GH3A 3DOUA 3U39A 3C5VA 3VHQA 5FBVB 3ODGA 1FP7A 1PUJA 4GYYA 1RCTE 2ZJ4A 3C0KA 4WINA 3QJGA 3OURA 4B35A 3V46A 3FDFA 4Q6WA 2DJ5A 4HZIA 2E1RA 3W3AA 1WLSA 3D7SA 2PMDA 3F98A 1N1DA 3JQ7B 3L8EA 1AUPA 2AZDA 3R3SA 2DC1A 4DQUA 4CEHB 2A0XA 3SGLA 2NYUA 3I05A 4HL6A 5JWOA 3B1FA 1U9YA 1TF2A 2ZU0C 2QF7A 3HJBA 1KHTA 1IQRA 1GNQA 2AUNA 1P81A 1RXYA 1QHNA 2PVCA 2YJ6A 5ALSA 3W78A 4CCWA 1R16A 2IELA 2JLRA 2ZRBA 3TH5A 3VTKA 5KOHA 1YAJA 3AEZA 4PGMA 1S6YA 1C3EA 1HYEA 1FYEA 1ZHFA 1YRBA 1L1EA 2OWEA 4N5NA 4EJSA 5LXTB 2WQ6A 4ZTBA 2EZ9A 1PDOA 1N8NA 2PL1A 2WEKA 5EUQB 5K2MA 5BORA 2JCYA 2PX5A 1WBDA 3T9BA 4F6RA 4IIJB 2ZRPA 5LIPA 3FNFA 4H08A 4M0FA 2ADMA 1BGVA 4FONA 4MVYA 4X63A 1U8FO 1KF0A 1R27A 5CUQA 2MCFA 4DLVA 2QBYA 5IKEA 2M98A 3JS5A 3BA1A 3O26A 5H5JA 3QW2A 3BCRA 3RS4A 1N7GA 1NUTA 2PIAA 3P2OA 2ZIWB 5LNK1 4TLEA 4FZ3A 3BRWD 5CU7A 5GONF 4UNNA 3EFBA 5F4ZA 2DKFA 3S44A 1RRCA 1MEEA 3T7AA 1DS6A 4CNBA 3UAWA 2ISSD 4MIYA 4N01A 1IN8A 5TS3A 1HT1E 1BJTA 4YAIA 1RYFA 1ZGHA 3GZTB 1LD3A 2IY9A 5E6SA 3WNQA 4LFBB 2MSLA 4NZNA 3DEHA 2K5UA 3DNPA 3MWFA 3IIMA 4N8EA 5B1YA 3RBVA 5KNBA 4G5FA 1XNGA 1GXSA 1NXOA 4G07A 3ZLTA 1WY5A 1FY2A 4R3WA 3KCQA 1GA1A 1E0DA 3X2SA 1EGHA 4D5EA 4F3NA 4E07A 3QX3A 3W5AA 4GE0A 2CKMA 1SUEA 1N6PA 1A4IA 4GBED 2VJMB 3GGSA 3IVGA 1U8UA 3KOZA 3OE1A 1JG7A 2ZXFA 4R01A 5A4DA 1EIZA 5BSEA 2DRIA 3Q88A 2X9QA 4HDAA 3SE0A 2D5AA 3H5TA 5LD2B 1OAOA 2GBGA 2I4RA 1NMZA 3EWIA 2IPOA 1MJHA 3JQDA 2Q49A 1JWAB 3QA9A 4JVMA 5HPYB 2LCQA 5SY4A 1NLUA 5EMLA 2I54A 2EGUA 2P9HA 3B3GA 3CLUD 1BFDA 1TKCA 1W75A 4IZHA 5T5QA 3BTUA 2BGJA 5A4MS 3M5CA 3I2HA 3DMDA 3KTAA 4YRCA 3RIYA 3WMFA 5ICSA 1BXRA 3WDKA 1OB2A 5CVEA 3ZHVA 3ONEA 2HBZA 3BIFA 4G84A 4QQ8A 1KDVA 4IYRA 4QUAA 2VP4A 4KBFA 3FG9A 3MRVA 1RI4A 2J9XB 2PEZA 2V7WA 3I2JA 1M1XB 5EIBD 3AI3A 3D7MA 3R09A 4CF5A 3LT0A 4KL8S 5HUQA 3BBPA 521PA 3AUUA 3KJFA 5B1DA 3BT7A 4K6KA 1H6AA 4PG5A 4X1IA 3IDOA 4F4DA 2HUPA 3L1KA 5A4KA 2D5CA 1ZO8A 2TMKA 5H16A 4KCGA 1F12A 4QYWA 1I1QB 3QA3E 1C0IA 4F38A 2QSYA 5DNDA 1ZEMA 3U6KA 2IYNA 1UBKS 3DAFA 1AGRA 3KQHA 2Q4EA 1PD1A 1OZFA 4NJOA 5AKZA 5JQGB 1BVHA 4NYIQ 4RBNA 2REXB 1L6RA 1U4OA 1XZFA 3M9LA 4NSNA 4JOSA 4UAUA 1OI7A 2WF5A 4ZANA 3IB6A 1AHIA 1BA2A 4JEIA 2C5SA 3GUUA 3PGLA 2O3SA 3GWGA 4BNDB 4BRUA 1DKOA 4O4HA 4ESVA 2V59A 2DFDA 5IX8A 3BL5A 2YNMC 4PC3A 2I2DA 3K0EA 1LQ2A 1V11B 4JZYA 4X44A 5J2TB 5CA0A 1EEHA 2EG9A 2PS1A 3D43A 5K4HA 1AQLA 4KZKA 3I4CA 3ESBA 4DDUA 3OO1A 4ZVMA 3UNXA 4J6FA 4TYWA 3IUPA 3SVZA 5FCDA 3U9TA 3AYZB 1M8FA 2IU6A 1U9IC 2OCYC 2WHEA 4DV2B 2CNKA 1T24A 4NHOA 5EI5A 2ZI9A 2HWKA 5FLYA 4C2AA 1L5MA 4RKYA 4F4HA 2FE1A 1KAQA 1E9AA 4EY3A 4YY3B 4EP1A 4MZXA 3E7DA 4M36A 3LHKA 1JA1A 4L51A 3SX4A 3K71B 2RHGB 5KOYA 5CB4B 2QTFA 1PHRA 2QWXA 3MWDB 2OV8A 4G8DA 2WAYA 2H92A 3ICQB 2QXYA 2P6RA 2ZJBA 3NU1A 4K6GA 4L8LA 3REGA 3NC4A 1VRCA 4EEXA 3ZXIA 3HI4A 3GGCA 1AQUA 3QHQA 1U2PA 3ETJA 1R5JA 4EB6A 1ISJA 1M83A 3RFTA 3REFA 1K5GA 2AB0A 3HFGA 2ZPTX 3D4PA 3V00A 3RSFA 3FAKA 3Q3EA 2GSWA 1DC3A 2XKAA 3BGIA 4ZPXA 1PJZA 2L2QA 5EXEA 3EF0A 3PP8A 4NCBA 3WRWA 3FB4A 1SFRA 4FBGA 3RRFA 3NOXA 3NZEA 1JDTA 3HCDA 4IW3B 1YS9A 3ES9A 3ZWXA 4WK4B 3CX8A 1MEJA 2A5GA 3S4YA 2GK7A 1GWNA 3E1SA 4MCJA 3A4VA 1JIXA 3UKJA 1YTLA 1KH2A 1XL1A 3QI2A 5FPHA 4PW0A 4DMUB 5BV2P 1I2DA 3S1SA 2X13A 2ZRGA 3ETGA 3IXLA 2PUAA 1O58A 1RI5A 2ZEJA 2VPZA 5JZOA 2DFKB 1DDGA 4J3JA 4HVCA 4IWXA 2BEKA 3LCCA 4L4UA 4M83A 4RH0A 2WKPA 4X1IB 5JXHA 3GELA 4PO3X 4RIEA 4PLHA 2OZPA 1MHTA 1XMXA 5JLAA 4AJOA 1XF9A 1OBHA 2WFAA 4YP1A 1YB6A 4RNCA 3ZPXA 2BBOA 3JQAA 3KOYA 3EJ6A 1DMRA 1NN3A 5EQJB 5BOSB 5HE8A 4YUVA 4I1SA 2HTEA 2V97A 4F5DA 1CQPA 2NZXA 4BV8A 1ACJA 3L4EA 4ZO4A 3LCJA 2VHXA 2YFQA 5CH5A 3EHEA 1WB9A 1LV7A 3CH5A 3EK2A 2VZ9A 3R3ZA 3RYFB 4GEGA 4QHYA 4YQFA 4MWBA 1ISFA 3A0RB 4B71A 3VPGA 4C3UA 3WHKA 2GNOA 3OY2A 3U9SA 3VZRA 4OEHA 4FOPA 1U8CB 3CSUA 1QG2A 3QEKA 1E2IA 1KFCB 2HMAA 2HIHA 4UFNA 2G71A 4I4TA 1DQSA 1HDRA 3CKKA 3U81A 5LB2A 1WZNA 3RWBA 5AM0A 4K1XA 2VNIA 4B3IA 2BM9A 3T7KA 4LX8A 3EXG2 1BX1A 2KJQA 2QK4A 1KFEB 3AC0A 4FFVA 5BMVF 1KWKA 3EEOA 1XTZA 4ZOLA 3F6CA 4QYSA 2PJZA 2O7QA 4KQ6A 4B17A 1C1DB 4Z1MD 3H04A 3E1KA 1D1QA 1TF7A 4WZAB 2VOEA 3EOAI 2CXNA 3VQTA 4PWYA 4LTNA 1ZVMA 4LSGA 5KQMA 2HBQA 3E9QA 3KXIA 3N2YA 4E4TA 2XMBA 3P26A 5AH0A 5GZ3A 4HSEA 2ZJFA 3VR1A 4DJDC 3F7TA 3FIJA 3NRBA 1SXJA 4CIWA 4XAQA 2B92A 4ZDWA 3DT6A 4CHTA 1N6OA 2OZLB 4YNBA 3GRFA 1ULBA 5KINB 2BKEA 1FRFS 3TNLA 4H0NA 3ISVA 1IZ7A 1PQYA 3I9LA 5AP9A 1F4LA 3PT9A 3MXTA 4D8WA 2C0CA 2JI6A 1KI9A 1KTVA 1R4NA 3FYCA 1SB9A 3DDNA 3KHUA 4C4XA 1QRUA 1DKMA 2PWBA 3TLGB 2BGTA 4XWKA 3N0WA 1OGYA 3OQBA 5JCJA 1L5FA 3AI2A 1IHOA 1UEXC 1VC2A 1GGNA 4DIEA 1K0FA 1TUGA 1JECA 2W00A 3KE8A 3N3AC 4WRRA 1I4TD 1ZIPA 2I65A 2CMKA 2GK6A 1I2CA 2IEAA 2YHSA 1CWUA 5EERA 1NUQA 4GI2A 5A6SB 3WB1A 3B78A 4XKJA 1PUXA 2R7MA 1H2EA 5JATA 4C0WA 3L8FA 4EM6A 4MS1A 2VWQA 4BVFA 1QDUA 2PAAA 1GUBA 2FP4B 4NQZA 1L7OA 2RAVA 3AY7A 3RC7A 1EDDA 2PLRA 3Q7EA 1U3DA 2M32A 3GI1A 4YI3A 5ALVA 3BXPA 3CR8A 3O4VA 3DZCA 4DQXA 1L4GA 2GD6A 2QM8A 4OBEA 1GTZA 1XELA 4G37A 2D7CA 4L9SA 4TV8A 4B6EA 1JDVA 1UAGA 1I4LD 4HG2A 4PV7A 5FQNA 1BKYA 4PAGA 3E84A 2AC4A 1O95A 2DWPA 1J42A 2RC6A 2X7HA 1VI6A 3BGDA 3GLUA 4L6CA 4NOMA 4JI8B 1H3NA 1ZMBA 4UNQA 4AURA 2BTQB 4RFLA 5A0TA 2OYSA 4B4UA 4CV0A 2HSZA 1G8KA 2ENUA 3SDBA 1BCRB 3C3XA 5P8WA 5KTTA 4QWMA 3KEMA 4A1OA 3T3DA 1JFFB 1IBSA 3E0QA 3EZLA 1N2OA 5GJCA 4YJ2A 2WSYB 4P1ZA 3V3TA 1DC6A 3LX8A 4A2PA 5I6DA 2FSIA 3A9WA 5IYZB 2FTKE 2GWHA 5F12A 1R4MA 3IKJA 1GTSA 1EP9A 2FMXA 5AR1A 1M6EX 3RD5A 2NADA 3UMVA 3W3ZB 3AEQA 4YV2A 2JH3A 2VLIA 4MVJH 3T7TA 2BKVA 2IPLA 1CYEA 4TRRA 3UUWA 1VLZA 4J0KA 1RMQA 3VZQA 2RBEA 3F5SA 4M9XA 2PXAA 5F9MA 1JG2A 3RVNA 1NFFA 1F2TA 1SKYB 3GAMA 5TPWB 3CEMA 3KJHA 1Y3DE 2ZWAA 4QBHA 2JIZA 3V6MA 1RDFA 3ZU5A 3BFPA 3UOGA 3CJRA 3CMMA 3VR4A 3MSXA 1QV7A 4G5XA 4RSMA 2YTZA 3D6JA 2IQIA 3GDFA 2P91A 5C1IA 4D96A 1V47A 2XW6A 5EGSA 3TVDA 4ENSA 2LTAA 1XXHB 2XYPA 3PCXA 1ISHA 2HAEA 4KV7A 2ZSEA 4L8GA 4ZVOA 2IUYA 2YHBA 2PBFA 1V39A 2B3DA 3RFXA 5F64A 3TSCA 1QK4A 4MUNA 3SIPA 1M5TA 2AI3A 5H81A 3VU8A 1WV1A 3KFVA 2H1IA 7AT1A 1G0NA 2BE9A 4UZSA 3FOBA 4NDAA 1A2BA 1DJOA 3T9EA 2V4MA 1NKSA 4ZODA 4YRKA 5CFPA 1Z6PA 4GKBA 1NJ1A 4KO1S 4Q48A 4CTKA 1IPEA 4F96A 1JUDA 4QE3A 5J40A 1UKYA 4JH0A 3DBVO 3OCUA 2A86A 3DWEX 2HK9A 3AIMA 4J4TA 4LZAA 5YASA 1ZEJA 3ZN2A 4PO8A 4WQMA 3JPYA 4DDVA 2AUTA 1FSZA 3BEDA 1SHKA 1VHLA 4L5IA 1JG1A 2VEDA 5TSDA 3N3BC 3QNMA 3WV4A 1VLJA 1KSHA 1D7AA 2YWFA 3O84A 1A7UA 3TJMA 1E2DA 2NOAA 3BRSA 4PXYA 2IEZA 9ABPA 5BSUA 4XYGA 4BNXA 2AN3A 4YK7A 3H9BA 3C7CB 3QIVA 1JEAA 4EL0A 3HL4A 5EJ2A 4WH0A 2AA3A 1N2XA 3DEZA 1SXHA 2HJWA 1MDBA 4N3BA 1ZNQO 2PBLA 5GP1A 3DUFA 5CEFA 4MUAA 5EMHA 5ENDA 5JT1A 3JRNA 1UM9A 2QLMA 3VOTA 1VB5A 3OE7A 3GDOA 2VH5R 4KQJA 4IDCA 3ZKWA 3EG9B 3PF8A 4WKNA 3T5TA 5BXQC 2X7XA 3MQ2A 2PJDA 4Q9DA 3WLPA 3ZHYA 1GGHA 3EZNA 4JI0B 3FYHA 4R2JA 4A7PA 2HB6A 3GLFE 1CQIA 3KM0A 1VM6A 4M53A 5B37A 3DAGA 2NU6B 3UMFA 4A2CA 4LDAA 5JC8A 3MJSA 1O8CA 3A31A 4G4GA 1R0KA 1S1MA 5IAKA 2H3EA 2JS7A 1QF7A 2V6BA 3C6KA 5L45A 1BO6A 1P6UA 4OB8A 4XQ0A 4L28A 4XWOA 3T5MA 1TJ4A 1Z5WA 2RHWA 2AZTA 2P75A 2Y1DA 1THZA 3B6MA 4GVPA 4MJ7A 1KS2A 2PFKA 1NI4B 1GNVA 1WVGA 2D5LA 4P54A 4BNIA 5C1DA 2W8BB 4YGXB 5EKTA 5IZ4A 2NIPA 3M8KA 4PFJA 1VG8A 4U8GA 1M34E 2VRCA 3BMOA 3U3JA 5L51A 2WMOB 4GBGA 3MOGA 4AKGA 3ZXXA 2ZI7A 2I2BA 2QLBA 3LHFA 3OOWA 3RKRA 1NMEA 3K5IA 2HNKA 4RWZA 3KQLA 5EUBA 1PU2A 1ZUNB 4W4TA 1T1EA 5U4XA 2VKQA 4LYDA 3HKCB 1ESDA 2VDWB 1X7YB 1MOPA 3E9CA 1WMEA 1XP5A 5ICCA 4OHUA 4LOHA 4PR0A 5THXA 2UAGA 5GOTA 3G0GA 5AW5A 4N0QA 4X00A 4C05A 2AI1A 4HEHA 2WUEA 4NFSA 2VHVA 4XM0A 5J3JA 2OV1A 1IMJA 5BN4A 4GKAA 3E23A 3OG9A 1EVJA 1LTHR 3DBOB 4YUWA 4MLPA 2YXPX 3LYHA 4AMBA 3RYHB 1OHHA 5HBGA 3S29A 4BLVA 1SJ9A 4GNRA 5A0VA 3NV7A 1PQWA 1C30A 4UU8A 4US1R 4JJFA 3GUVA 4JKOA 4KE6A 1N2CA 4QDZA 2NZYA 3L7CA 3QFSA 3NYIA 4MWEA 3SPXA 3VR2A 2JLVA 1Z26A 2P9QA 1P9LA 1NU8A 1MIHA 3NTRA 3CZCA 4DLYA 4WMLA 5KJCA 1M9NA 4YJ3B 5KDDA 2I4LA 4R4JA 5EZ5A 3JW8A 2AWNA 5IDWA 2DB3A 3IP9A 1KBOA 2WYWA 4LXQA 1S8FA 3KPYA 1F9AA 4E4RA 1R9NA 4IFBA 2YWRA 1DAOA 2HWWA 5KS2A 5F9FA 4IMJB 2W11A 5JJCA 3T94A 2PZ8A 4FINA 4RXUA 2OBYA 4BFXA 5ELXA 4OQFA 4DANA 1VL2A 2GTIA 2NPFA 2CUZA 2LKCA 2Q5JA 1VYUA 2EV9A 2Z30A 3A0UA 3DH0A 1I51A 4KHZA 3ZUGA 4E5SA 1OMOA 3TLJA 5EE1A 1YGPA 4Q1BA 4CE6A 2VA8A 3NVAA 4GUAA 5TQVA 4AJLA 4EQ6B 5C8YB 3OU7A 5T57A 3T3EA 1JVBA 3LY8A 5KOJA 2HUNA 2XQVA 3VH2A 4QVKA 3SE7A 4ITVA 1L8AA 2R79A 4IY1A 2X19A 1E1QD 1Q91A 1T26A 4LUCA 3GLGE 3AEKA 3D9QX 3I28A 3B1WA 4FM9A 2PX8A 3AHGA 5DVZA 1NF3A 1H2RS 2GUGA 2J31A 3QU9A 1KSFX 4NX2A 3DDSA 4AAYA 4CM4A 4N0PA 5H9VA 2ZS9A 1LPSA 2JD2A 4UDYX 1T29A 1CVRA 4AYTA 3OT5A 4BEVA 2P78A 2ZIZA 1EKXA 4QULA 2RK3A 2EBFX 2ESRA 1W59A 3UB3A 4UMFA 3DMPA 2P2LA 2C2ZA 3G2PA 4L07A 4NMWA 4DDHA 5CYGA 3HKCA 2NWQA 2FXIA 3JZDA 4K28A 2BTQA 4V38A 5JD6A 2E5FA 2JLZA 3NCHA 3Q72A 4YIKA 3N0VA 3TOSA 3HB0A 1ZH8A 1T9CA 1Z28A 1Z8DA 3DM9B 3QPAA 3VA7A 4ZCTA 1T0IA 3LPNA 4LMBA 3UT6A 2JZNA 3CQ9A 4HN9A 3PU6A 3E7WA 4UZEA 2QJOA 1GUZA 3I6QA 3G9UA 4LGCA 5BNFA 4EJMA 3SK0A 4C5BA 3RIHA 2R6GA 4GWLA 4QNMA 2W6MA 1W1IA 4QT0A 1K3UB 3WLFA 3LQRA 4KYVA 2FEXA 4NU8X 1MG5A 1ODCA 4D9BA 4H4EA 4H3SA 1F20A 4YCLA 5M7EA 5DP1A 2VTEA 4BNWA 2XLBA 1DAEA 1QYCA 2CXPA 1G8AA 3IV6A 1N5LA 1Z62A 1H2YA 3RYHA 3HB1A 4GD3Q 1VZ3A 4MZDA 2XZLA 1WXQA 2NO9A 1FU4A 3PIIA 5FWAA 4BNUA 2FSPA 5IN4A 2IZZA 1CZUA 2I78A 2X8AA 3FTEA 1CY4A 2NO6A 2OT3B 5JJBA 5JSZA 1IB6A 3Q5GA 5CFZA 5JBNA 2NUAA 2J9RA 3GVIA 3HDJA 1ZGCA 1L4KA 1OBCA 3QXCA 2CD9A 1BKDR 2H0QA 3NDIA 4IGAA 3FYTA 3C16C 4PX9A 3L0IB 1KDPA 1GL9B 2GN6A 3GPDG 5BN3A 4CBVA 3P0IA 3KR1A 5D87A 1YQDA 2J9ZB 4RPHA 1ORTA 3EGDB 4LVUA 1I4OA 1WXHA 4P32A 1GGVA 1NKTA 2QZJA 4NK4A 4F7DA 5TMPA 5EE9A 5H3LA 1II8B 1YZHA 2CJYA 2QTAA 3ICOA 3GBVA 2HPHA 4MA4A 4ZJUA 4ZTUB 1KJJA 3T9CA 5AVVA 3G88A 3HP7A 2DPHA 3V48A 2EL7A 1J6UA 3AVXA 3RSCA 2Z98A 3AJRA 5B1SA 3HU1A 1UBLS 2BFFA 5TRTA 4ZJZA 5T4EA 1YA8A 2VJDA 4KFUA 1KYZA 4TVBA 5C4GB 4E08A 1IRIA 3OKFA 2VZLA 3EMDA 2WSLA 3LDUA 1M1YA 4NG5A 5SZKB 4B2IA 2PUVA 1Q1BA 3HUTA 2R8XA 4ZOLF 4MP3A 4UPVA 3AGPA 4I4TB 1JH8A 5EOVA 1RWMA 2ONCA 2ZBUA 1DBRA 1N6RA 4N47A 3D81A 1KR5A 2JGKA 3F90A 3H9EO 4Q9HA 2HWUA 2JA1A 2C8JA 4OFXA 1KETA 2F48A 3E3AA 3AKCA 3K6RA 1XVTA 3O8QA 2X2PA 4OQEA 2XD4A 1Z0JA 1SXIA 4DJEC 4G81A 5K3FB 4DJTA 3FSGD 3IIJA 1RNLA 2JFGA 1GYPA 2OKCA 4ILEA 3K4QA 4K9DA 4QDUA 3RIGA 2L0XA 1ZG3A 3LC1O 3DL2A 1TI7A 2LV8A 1M76A 3AZOA 3O94A 3HXTA 1JEEA 4GEKA 4WOJA 3TUIC 3U31A 1EQ2A 3SHVA 3W1VA 1U9CA 1OYVA 3CMCO 2ZI6A 2Q3CA 2FPSA 1PWYE 3R8XA 4K46A 1Y7LA 2BCEA 2QORA 2IE0A 2NO1A 1DC7A 3FHCB 4FUQA 3VOAA 2GNAA 5C51B 2QYOA 1ATZA 2K4MA 3PNOA 5FXMA 4D6XA 3N5CA 3ND7A 3D3KA 3CN9A 3ZU2A 1DEKA 1VPVA 3KDAA 5BSGA 1QWOA 2F90A 3RYCA 2WU1A 2FPKA 5FOTA 3IAEA 3DBRB 4LFCB 4IZOA 2C0PA 2FPOA 3R3WA 4P9NA 3RODA 3T3HA 1G2OA 2FWIA 2Y0DA 3OIVA 3GRCA 4ME6A 2W6QA 5E4YA 3OOYA 1ZD2P 3C1OA 2R6CA 1L5LA 4BOYA 1KOFA 2JIMA 1AKEA 1DL5A 4K9QA 4Y98A 4RK7A 2I4NA 2J9GA 4MPPA 5FL7A 5IVPA 2IYAA 3TZQA 1EBFA 3ZZ1A 2I7XA 5KKAA 4FQ5A 4B7UA 2Q3JA 4FZJA 1L4HA 1D4ZA 2B1JA 3EIQA 2NACA 2X6RA 4NEQA 1E2NA 5CX4A 2J09A 3WNBA 4H1WA 5IKXA 3ZBTA 4OUKX 5KWSA 8MHTA 1AH2A 3N59A 2CDRA 3EDMA 3RYTC 3CCBA 3O8RA 4MTCA 1V16A 3KZXA 4OVKA 4OHKA 4C0AC 1GPUA 3Q7IA 3GB9A 3W6ZA 5CCXA 1T5DX 3HN2A 3B1XA 3ILHA 3JQFC 5DHTA 4MYDA 3D1JA 5HILA 4XOIA 3G2JA 2ZZMA 3OWOA 5ALGA 3TQIA 1WCXA 2TRSB 3STXA 1NPYA 2Z8YM 2I6SA 1PK8A 4MQLA 3OUZA 4UVEA 1DAFA 1V2GA 3USES 2WP0A 1TCUA 1L3CA 5EZYF 3VKGA 4ZZ3A 3R75A 4GW3A 3CKMA 2EQBA 5ADUS 1EGAA 4X7RA 2GO7A 3QVGA 4M8SA 3SQLA 1VIAA 1QFSA 2C95A 2X0RA 2PFGA 3AEUB 4M0MA 4OQ4A 3V1KA 2WJJA 3NBZC 4OP1A 4IO1A 3RS2A 3OCWA 3CCFA 3V8QA 1SVIA 2WI8A 3F9RA 1MAUA 1U2GA 2OG1A 2WBLC 1QPBA 4NV3A 1TNDA 3JCZA 4E5NA 4TV9A 1ETUA 4OUDB 2FEAA 4WZ6A 2GAOA 2W2VA 1XQ9A 1VIVA 1Y1TA 3IBFA 4NP6A 4DMGA 3U3RA 5ESXA 1GT91 2ZJ7A 4O4HB 2D4HA 4WGFA 2P30A 3UAOA 1GFIA 1K7SN 1QTRA 2ZJAA 3UFXA 2AOVA 4RHYA 4NBNA 3CISA 4H7HA 4HN4B 4MDYA 2DKNA 1YQWA 2PO5A 2NTEA 3C85A 2L42A 4U9HS 1SMKA 3LOUA 3B6KA 4I14A 1P91A 2ORWA 3NBQA 5JAHA 1RM5A 3RSGA 2GESA 1J20A 2WVAA 2YCLA 4K1LA 4PZDA 1P77A 5K6AC 2VG8A 1QS0B 1SM4A 2X5NA 4I9GA 3QF7A 1EVEA 1K8YB 4E5UA 5GADl 5AKIA 4H59A 1ECBA 1M34B 2H1WA 2NXEA 5BMOA 1SELA 3WLSA 5BNTA 5FBRB 1DCFA 4CN9A 2CYBA 5FI5A 4DYHA 4QUJA 4G8JA 1RC1A 2AFRA 5BYBA 2X42A 1NPTO 1P61B 4GC5A 1N34B 1KTIA 2VRWA 3E6AA 3BK1A 4UQOA 4B6JA 1L5VA 3PYXA 4TSRA 3KT0A 3I0NA 1NQXA 4QJBA 3JQ9C 1A69A 4HJXA 4QARA 1W9MA 1JZSA 1QAMA 2J67A 1Z8HA 2ZT6A 3K9BA 2XQIA 5JVDF 1Q1QA 3CZMA 4C5AA 2R96A 4NDNE 5HFAA 1BMTA 2AEEA 5FPSA 1XRPA 5AYVA 4BE4A 4PLGA 2W0SA 3PZBA 5HCUA 1GPYA 3KOXA 3KRTA 2ZR0A 3JQPA 4LDQA 4QATA 4IH4A 2FWBA 3D8RA 3HXLA 3IE0A 4TRNA 5DMXA 3LWDA 1U5AA 2Z4SA 4FDVA 1JI0A 4UCXA 5AKYA 1K6EA 4D98A 5HF6A 1E8DA 2JGRA 4OIFA 2MINA 3VGJA 5FI1B 2OCPA 1V7PC 3RH0A 1P44A 5IN5A 1RAIA 3W8RA 2VP0A 5AW4A 3PTAA 2EGHA 3OH8A 3V42A 5KTMA 1HE8B 4EGFA 2E4WA 2CNDA 4PQRA 5CEJA 5KPJA 4GP6A 3B5IA 2PD3A 1I80A 2Q21A 3W8DA 2L69A 2H06A 3HVKA 2OC4A 1DXOA 2Q6TA 3IEKA 4Z51A 1T10A 3OIWA 5DP2A 1QAOA 3CF4G 5FP0A 5E2IA 1TC2A 1YJXA 2W2KA 1G9XA 3DYVA 3BULA 3WZMA 4RH1A 1DQNA 1WUHS 3T9AA 2J5QA 2H1VA 4DCOA 2AF4C 1TEZA 1VMAA 3V7WA 3INNA 3OSUA 5I5EA 3OBBA 1D2CA 1MQ8B 1TPZA 2BFEB 3UIEA 4TRMA 1DSSG 1PGPA 1R6VA 5FUYA 5K9ZA 4B84A 2HZBA 4FMCB 4MVCA 1AQNA 4F2WA 2VZEA 1QMPA 2QA5A 1IOZA 3MWKA 4L85A 4NBRA 1FZQA 2MR6A 4Q3DA 1RAEA 2C3YA 4QBFA 4WEQA 3ETLA 4MUBA 4BU0A 1F8UA 4LDJA 3QEOA 5DGDA 1XNRB 2VDOB 2P79A 1KP9A 3SZRA 4YRQA 3PTLA 4U5QA 3IAXA 4GYJA 3W6NA 3J80A 1POWA 5COBA 3OOJA 1A8UA 2X8JA 4G4SP 2ZVDA 3T5GA 3TLCA 3QE2A 1V48A 3IJRA 3VBCA 2XQGA 4UTOA 2P2CA 3O73A 4KXUA 4E2YA 2V0GA 3PC8C 1SC3A 4LMPA 4ZVPA 5B1EA 2A30A 2FQXA 3S2EA 2HIMA 3QKRA 4A5OA 4MW6A 3I8XA 3BWEA 4LN1A 1PZGA 1F9EA 4LQCA 1JMYA 4QZVA 4RAOA 1R37A 4R5HA 4Z53A 2BMWA 3K53A 1E2MA 2H4HA 3MTEA 4IF6A 3A06A 2IJGX 1K2VN 1RPZA 4P53A 4DYDA 4TTAA 1RWOA 4W82A 4ZT7A 1JEQB 3HRIA 4FHGA 1P4SA 2MWMA 2HXSA 3EXFA 2BDTA 4G1FA 1N2HA 1OFIA 1Y1SA 2ZTMA 2B0CA 3T5PA 3B3FA 1DHRA 2XZDA 3WWEA 1KZYC 1BQEA 1PWXA 2C5HA 4JGIA 1FLAA 1QKKA 1U5CA 1Q0LA 4HNSA 2BF7A 2QNIA 4M1QA 5CXSA 5LDGA 5COAA 4J03A 4DUGA 1LVHA 3IT0A 2O06A 4XIJA 3S55A 3TTYA 1FFSA 3QMWA 1UP4A 5K8IA 1U3CA 2QGFA 4KAFA 1K9SA 4GQIA 2YNMD 3NBMA 3MTJA 3PWTA 1KFKB 1KY3A 4ZDJA 5BN1A 2FEOA 2ZIFA 1KDRA 3WICA 5F4BA 4MKRA 2DEUA 4KDRA 3ABSB 5BP7A 2RGWA 3QVSA 4UXIA 4EFKA 3F96A 3CY6A 4IKEA 3N0XA 4HZGA 4NF2A 1I3KA 2XUHA 2C2HA 2OAEA 2CBZA 3B60A 4NH4A 3FPCA 5CVUA 3DVLA 4DG8A 1LPAB 1QX3A 3IUMA 4F85A 2R84A 2R47A 5KNCA 1SXPA 1G2PA 4Y6GB 1APBA 5L4SA 1QTQA 5I7RA 4MGZR 2O0HA 3LDGA 1SU6A 4HEA6 2ES4A 4RIFA 4OY3A 1W76A 3P0JA 3V1TC 1Y3IA 5J23A 5D7BA 1NVUQ 4S35A 4E21A 1OPXA 3D6AA 1R4ZA 2B37A 1LBIA 1E5DA 1V26A 1VL5A 1X9HA 2HH9A 2LDXA 2YV2A 3DZBA 4Q05A 4D99A 5KEIA 1N6NA 2QNBA 1WUIS 4Q01A 1TMKA 2XUPA 2A0WA 7ADHA 3MMXA 1ZK1A 4EO9A 4PS0A 5EXDA 4DM4A 2XBLA 4HNAB 2PMBA 2PBRA 4LJKA 4G0UA 3AJAA 2RH4A 5ERXA 2HY7A 4INPA 3C6QA 3DMFA 4I1RA 1XLWA 5TF4A 3DO8A 4Z1MA 2PK3A 5D7NA 3SXUB 1B1CA 4OA5A 5J4HA 2HSGA 5BXYA 3PIRA 4H3VA 5ALPA 4CMKA 3FETA 2VYCA 4J90A 3SC2B 2ONJA 4CQJA 1N1MA 1W5TA 5EQFA 2FPIA 1M66A 5L40A 2P6UA 1FK8A 2HYDA 1VHJA 4QGHA 4J2TA 4D45A 1RKXA 1XK6A 3OD1A 1BGXT 2IZ5A 1AVTA 4N7MA 5EKXA 4DHEA 1W36C 3PNKA 3VNSA 5EP1A 3WHPA 3HYLA 5SZHB 4PLFA 4ZT3A 1N6HA 3JQBC 2W2PA 5TV2A 5JWRA 2UXDB 1ZJYA 1E5QA 1ZVQA 4H6XA 3GEMA 2EZTA 1PFUA 4LPSA 4NZZA 3W3AH 2CHQA 2GOYA 2FWRA 2N1BA 3AR3A 3Q7SA 4HX9A 5DTIA 1EFPB 1Y3AA 3N9IA 1U7UA 3QFCA 1X7WA 4H31A 4HSGA 4KLNA 1T91A 4ZVLA 1JBEA 16PKA 2X3FA 3DW1X 4KODA 1I3CA 1ISSA 1TRKA 4UAVA 2P68A 4DCJA 2AEJA 4OAPA 3CLHA 3K9LA 5E1BA 4CN8A 2F64A 3ZCVA 4BIIA 4P3KA 4DMHA 5HRCA 2IYTA 1Y7PA 3ZTWA 1J39A 5LJLA 3RJ9A 3UV3A 2OYRA 1BN7A 5BSFA 2PKEA 3IRVA 3ZVNA 2Q4RA 4R8LA 3KALA 4N82A 5LB4A 1T5TA 2CXUA 2ZUSA 3CLRC 2NT3A 1W1WA 1W2GA 4LWPA 1YDMA 3NONA 1U28A 4MKIA 3ZE8A 3IPRA 1SKMA 2Q5HA 4LAFA 2PYDA 4DR7B 5TT0A 3RC3A 4RH3A 3I58A 3AM1A 3EXG1 1GUYA 1SKUA 1TYDE 1GQOA 4GZLA 1Q21A 3KB2A 3TGWA 3D59A 1JSRA 2C9CA 2E85A 2P2SA 4RACA 4KYTA 4ZC8A 5B4VA 3NBKA 3RVRA 3UA3A 1W4ZA 3TMYA 2Z8XA 2YZGA 2DP4E 3GFQA 4FFDA 2X4GA 1BZYA 2FZGA 4XWTA 1L7PA 1D6MA 5M2QA 1YJ5A 3W1EA 4KAXA 3KSUA 4XR9A 3RVBA 4E33A 3PRJA 1I1HA 3LPDA 3SC2A 3W5VA 4DAEA 2YZ7A 2ZSFA 4BS9A 4DV3B 4G63A 4G0VA 3IHTA 4HLQB 1X3LA 2G09A 2N42A 3AR8A 4OK6A 2EFYA 3WK8A 1IBMB 3LPLA 1EI9A 3AP1A 3PQ4A 1QP8A 1YQQA 4OGKA 1FNMA 1XVUA 1UBCA 1FFXA 1CRWG 1YHNA 3FLBA 5LDHA 5D85A 3CKYA 3VAYA 2OCDA 2CV1A 4F5WA 4DVGA 4C4AA 4RENA 2C7VA 1GGEA 1HYGA 1CUJA 1K6XA 3OPMA 4M37A 5A7FA 5DI3A 3ACBA 1W88A 2BFOA 3GL9A 1VKNA 1U81A 2DULA 2P2NA 4I1IA 4RIGA 5DE3A 3ZWBA 1MIOB 4GECA 1W36D 3FPJA 2JFHA 5JD3A 4AY5A 2VTBB 1ZL2A 3CEAA 1MG0A 3LRTA 3QHAA 1W0CA 1SWWA 4ROSA 3O8OA 3R74A 3EF3A 4BNNA 4NPCA 3NBXX 1E2FA 1PK7A 3W3AD 4CG2A 2A4MA 5JQGF 2P9GA 1GAEO 5E6UA 3TQFA 3HJFA 2HRZA 3JQGA 2JJ1A 2I4IA 3H6HA 3U9LA 1O6CA 1ZAKA 1SCIA 3QFRA 4AB1A 1V5EA 3KQNA 3PFBA 4RPJA 3KVRA 4D8XA 3W5BA 4B6GA 2QV7A 5M04A 4AWBA 4GR5A 4DMLA 3H2ZA 1O6GA 3ZY3A 1DOHA 2V7GA 4PONA 4G0NA 1PI3A 1G3UA 1SVUA 1QH1B 4X0EA 4EY5A 2IK8A 4ND4A 2IOFA 5DCLA 1OH5A 1Y9EA 5FNVA 3ZY5A 4HC4A 1OVGA 3HV2A 4FKBA 4I08A 3ROZA 2QQ0A 5AMXA 3AL0C 1GZ4A 4RJLA 3TOZA 2C4UA 2G5GX 3ML1A 3DLAA 3X1WA 4CU5A 2O8DB 1RYNA 2WP8J 4TLAA 4RLHA 3DONA 4FDLA 3RF6A 3KUKA 4KSCA 3QMMA 4GRIA 2PRZA 4FFLA 2PX4A 5K45A 1BMFD 4GKVA 3CEHA 1BDMA 1IB0A 4EGSA 5A5VA 1SCAA 1EXMA 3BMXA 3ZNOA 3U4QB 3EIWA 1T3LA 1JDUA 2JDIA 3MB5A 1VG0B 2J8ZA 4FYJA 4A91A 2RGNC 4YPOA 4ZI7A 1OD6A 2L82A 2GPNA 1ZRMA 1XD2A 2G7ZA 1U94A 2R1VA 3Q1LA 1NW6A 3MTGA 4BTEA 3GZNA 1SQ6A 4Z0NA 1N6KA 1RXUA 3C3AA 2G83A 3LT5A 2F62A 4TT8A 4S0XA 3TJZA 4PZYA 4EB0A 4M87A 3IEUA 3COPA 5HTKA 3HXMA 1O94D 1DPGA 4EELA 3U4MA 1DWOA 1LBQA 3NXSA 4PZAA 5CIYA 1EUQA 1V9SA 1FNDA 1NBME 2XXBA 4IOMA 5FPKA 1UZLA 1XTVA 2YFHA 3OLZA 1NNEA 2RGUA 1T8PA 3W9YA 3H9JA 1F0KA 3IHKA 5I8ZA 4I46A 2ZUCA 3SIWA 3EQ9A 4WDRA 1AXEA 1SKYE 1ST3A 1T2VA 2JKYA 4WNCA 4NS4A 5JBQA 3QELA 3OQOA 3CLKA 5FL3A 1VXOA 1X7ZA 2W4IA 3P2MA 3TW4A 4B3MB 4PNZA 2XT6A 1KC3A 1RAAA 4M6WB 3Q7TA 1AMOA 2XDQB 2PRIA 1E99A 2AN5A 3RROA 3SQXA 4LYFA 3ZHOA 2JBAB 1JDPA 4U3JA 3ZZNA 4IMPA 3AQ4A 2CSUA 3FYUB 4CQLA 4Z49A 1XHFA 2LDBA 2H1SA 5K3AA 1W1UA 3FVVA 4EA9A 3CFYA 4NXNB 4F4FA 3DCIA 2OD9A 2NAFA 2I67A 4A3SA 1V6CA 4DA0A 1EFAA 3DDOA 1CUAA 4K05A 5KJEA 1MO3A 4FFBB 5EJ6A 1OA1A 4WLVA 2QVLA 2LIPA 3RPEA 1JHXA 2F9MA 3L0ZA 1FBNA 4H6VA 3BCHA 4Y6SA 3HU2A 3HMQA 3CWQA 3I52A 4GICA 5JSHA 4U4AA 3SQMA 2Z0MA 2UV8A 1XU4A 4LNUA 4GRDA 5DCUA 5KC9A 1XZGA 2YOGA 5I9SA 1N2JA 4ZMSA 3H1GA 3EC1A 2R00A 3P9XA 2BFNA 4RJKA 4CJXA 2H2AA 2OCXA 3IJEB 3KOUA 3MYYA 5KX5F 1G5IA 2AKYA 3MHPA 2DPXA 3ZDFA 2J3IA 1YVEI 3UW1A 4E12A 5AVYA 5C5CA 1EA5A 3R6WA 2PH3A 2AFIE 1H8HD 3OLXA 1IIBA 1UAYA 2BSAA 4CLXA 1DRKA 2AE1A 3C48A 1G4UR 4L3OA 4OLHA 4HN2A 5AI8A 3AF4A 2P67A 2B8EA 5H3CA 5CG2A 3EGOA 1TVKB 2C5FA 4Z9FA 2I91A 4B4KA 1T3TA 3TDMA 3U40A 4J76A 3W6OA 3BMQA 1CLUA 3TCXB 3EIHA 4JJAA 3AF6A 4A2QA 1ODKA 3AMVA 3FTQA 4GE3A 2NUPA 4FFRA 4J29A 5DM0A 1XFDA 1N57A 3OMXA 4FLMA 3CTPA 1AZWA 4IVNA 2GM4A 3AJEA 3O3CA 5K8UA 1K4YA 3LP8A 3U7GA 3GHHA 4WK6A 4DLPA 5KVCA 3R5XA 5LYJB 2VTBA 3ADDA 2FWNA 4G4IA 3I3SR 1E98A 1Y80A 1Z5GA 3E22B 1CY6A 2XOKD 4UM8B 4U6QA 4DR1B 1JEOA 1FMLA 1Y7TA 1HDGO 1E1KA 1SVSA 5IYZA 1IAQA 3QKWA 1SHJA 4J9UE 4BC1A 3REQA 3JTMA 4NKRA 3B7GA 2DUMA 3H83A 1NJFA 1QGAA 5B6IA 2H7VA 2QV0A 3D6FA 3CPEA 5HIAA 4G86A 1SG9A 2DBRA 4NBTA 3ZI7A 4AYXA 4F2PA 4BLQA 4DJJA 1NXXA 1Z0SA 1EVYA 1VG9B 4J1NA 1NNI1 3HWX1 4AKTA 1ZW1A 4CTJA 5DHFA 3N74A 2HDNB 1JR4A 3E7XA 2G9UA 5TIIA 2H4XA 4RJIA 3LVRE 2Y1LA 4YP0A 1QRRA 1FXSA 2JF0A 3WI7A 1KP2A 2OP1A 4NBLA 3EYAA 5JO9A 1A3CA 3WIBA 2A5YB 3BXHA 1SU4A 4PPGA 2IHKA 1C14A 1WW2A 2P11A 3PQCA 1ADGA 2HQOA 1W87A 4LYEA 3STTA 2BH2A 5GM1A 1N1GA 4YAKA 1UANA 1WQ4A 3N8DA 3ZH9B 3PI7A 3ZHSA 2XRFA 3JZAA 1WHTA 4UE3S 4BXOB 1DTWA 1BRMA 2WWWA 3KLOA 5LNK6 3D0QA 4L0CA 1LBHA 4LV6A 2OOKA 1TZKA 3WYEA 4I1YA 3U09A 3ZD7A 4CMIA 2PQ6A 3NHUA 3A6KA 4GOLD 2OCKA 4TKVB 4X9XA 4R1QA 3ICPA 1ZJZA 3HNRA 1ISIA 5F9HA 1CQJB 4K9PA 1KZHA 1VB3A 2Q29A 1GPAA 1XDSA 5JPDA 4UBJA 4EH1A 4WBSA 3P4XA 4WVFA 2FFAA 5KVVA 1ZCAA 2A57A 3L8ZA 2ZE8A 1QYWA 2WSIA 4CEIA 1U90A 1EK2A 2XB6A 4MK4A 4B3RB 1B6TA 1NLMA 4XIIA 4H9GA 5AI6A 3TKLA 4L9AA 1X1BA 3KJNA 4LY9A 3GF4A 5K0GA 2JJYA 3NO4A 4TV9F 2ADOA 3A70A 5HKKD 3VH3A 1GQRA 3JY6A 1Z7GA 4BN5A 1D09A 2XOKA 6GPBA 3PEYA 2F1OA 4MUEA 3REQB 5H9WA 1M6NA 4PBRA 5K01A 2WDPA 4OATA 4BNMA 1U98A 3TRKA 2Y8EA 5LN1A 2GGSA 4J0FA 3TLXA 4CFSA 4QQRA 2W2NA 3AUYA 1ES9A 1ORWA 4HQLA 4MV8A 4AU1A 4MQBA 1E6WA 4YJDA 5JAZA 4HAWA 1W4RA 1OSNA 1VDZA 4HNVA 2O6HA 1J2TA 2J87A 2ODQA 3GFVA 4PHFA 5B58T 3RUIA 4HEA1 4EX7A 5IH3A 3FWKA 4LVCA 1VSQA 2HJGA 2M1ZA 1B2RA 3A11A 3O75A 4UHJA 1X9GA 2EKBA 4OO3A 2GA9A 1CUHA 2P6OA 2RHMA 4ZAZA 2ZIEA 1QYXA 3OEWA 1NJ5A 3PGVA 5B6PA 1A97A 1RHRA 1TVKA 5ES3A 5BMVB 5LQCA 3HXPA 1L2TA 4MRMB 4R40A 4BVAA 3PGMA 4UTNA 3H3XA 2A33A 4F3KA 4YJFA 3SS8A 3NM4A 3G0BA 3OZCA 2I9PA 4BWFB 5KQPA 5MHTA 2HK8A 1PL0A 1SCQA 1XT6A 2VXBA 2WWGA 1J0AA 1J21A 5HXAA 4U7WA 3QU7A 2J3QA 4BE7B 2EYUA 3ILSA 5JTUA 2EWVA 1GU0A 2BRUC 1PFGA 2DTEA 5TQ2A 1XTTA 2VXCA 3UK1A 2GS9A 3BD8A 5A9SA 1PTJC 3K3PA 4F9TA 4L6IA 5JI2E 2OR3A 3IPAA 4V0KA 1E7MA 4OLBA 5JJIA 1QV9A 1M10A 1XAGA 2PCLA 1YR1A 3HPRA 1WY7A 1HFEL 4J0CA 2QPTA 1KI3A 2Q3BA 3ADBA 5AVOA 4MHTA 1Z2NX 4G1EB 4H4DA 3R44A 1KDTA 4PIMA 1ABBA 4KLCA 4LQ4A 3VDRA 4C6TB 2JEZA 2RFLA 1QHSA 2E89A 2CWWA 4H7PA 4YRZA 2GYVA 2X5OA 2QROA 3W7BA 4V2IA 2BMDA 5IH7A 1AB6A 4IR7A 1W48A 1W96A 3QBJA 1EFTA 2JBWA 4JGGA 3FHJA 3PITA 1JFVA 4CMEA 1PGJA 1AHNA 4MJXA 5T64A 4K0RA 2CBXA 1A8PA 4M8KA 1UZMA 3AL3A 1C3LA 3VUEA 1DUVG 1Q12A 1SO8A 2OV2A 2NXJA 2I3BA 3A1WA 3F4LA 4MCAA 2RCNA 4PFQA 3DNFA 1N77A 1PRYA 3OE5A 3VHRA 1F1JA 1WG8A 2XVAA 3EEQA 4F1WA 1TJNA 3L04A 4GL4A 4YLEA 5J58A 3MHTA 2J4DA 5AI0A 3WLHA 4AWXA 3JARB 1IXRC 2PS0A 4HNGA 2Z8ZA 2V7UA 4I7EA 4ACAA 5JCOC 1UFRA 2X4DA 2AOTA 2JJ8A 3QPWA 4H1VA 4D8TA 4O3MA 3MWDA 1O5TA 5K5EA 4G01B 1ZD9A 1R1DA 3OM1A 3TXAA 1V6AA 3Q9UA 4HMPA 1R50A 2QUHA 1YB4A 1Y6ZA 4ZEMA 1WETA 4BXOA 5CB4F 3ZLUA 1JFLA 2AR7A 4ERNA 2BFCA 4J6EA 5A3RA 4B4VA 4OHVA 2YS7A 3ZK8A 2VT3A 3QGMA 4M9RA 2FR1A 1RI3A 2HSDA 4MRPA 5A0FA 3NH9A 1KWGA 1L4BA 3OEHA 4MGEA 1U31A 4HADA 5HCIA 1KR2A 1IVNA 2GRAA 3DE5X 2O8CB 2DTDA 1RACA 1WF3A 2IPNA 4JMLA 4MB2A 5EHXA 5KTYA 2PL9A 1TZMA 4EOGA 1WB4A 3FD8A 3FVQA 3K9HA 1YBAA 4MYRA 4YAOA 1CY0A 1C4KA 1PW7A 2W7TA 3OF5A 3WLMA 2VSXA 4PLZA 3LDFA 2BEWA 5L4LA 3EEBA 4NCKA 4ZT4A 2GA8A 4QU8A 4Y1RB 1JKFA 1Z0DA 3W4KA 4Z86A 4A73A 2O50A 1G42A 3STUA 2REQB 4IPTA 2UVDA 4CETA 1CUYA 1K3FA 1Q77A 3E0XA 4FI3F 1KORA 2BGMA 2CW5A 4QECA 4W6ZA 3SP1A 3M6MD 3WGYA 1WXDA 2BTEA 4Z3DA 1GAXA 1E2HA 4FHCA 4GPIB 2Z9DA 3GAFA 4N65A 3NBUA 2OBFA 4XYMA 1F0YA 3EY4A 3GDWA 2ABWA 4FWIB 5B3JA 5JALA 4IDFA 4UBOA 2C0QA 2HSWA 3CVYA 1JR3A 1ECFA 2NV0A 2BE7A 1QRAA 3HJHA 3RJ5A 4NPAA 1IL0A 2H7CA 2DQKA 2QOEA 2YOHA 3G8AA 3NI2A 3CZ9A 1DOZA 1Z5ZA 4UUMA 4ZQFA 1KDYA 4B75A 3S1AB 3IELA 5IJWA 1E7WA 1HL7A 2VO1A 3BF8A 4QXMA 1H2XA 3WLEA 4B40A 4DLTA 2HMVA 3R76A 4I3FA 1E3SA 3WIOA 1OFGA 1DWPA 1KJQA 3GFTA 2X0DA 3IP7A 3SC6A 4HUQB 4M4SA 2DAPA 4R3NA 5AM5A 4D02A 1E6MA 1KPGA 1J9EA 1CR2A 2SKDA 2WDZA 4IF4A 2ALJA 1GFWA 5K03A 1F60A 4A8JA 4ISCA 5KYXA 4QYMA 4DR4B 3VZSA 2HGZA 1ESEA 2ZP1A 3QQPA 4Q82A 4DW8A 3SIRA 4X8LA 4L0DA 1D03A 2B3TA 5FWXB 2OLKA 2D1SA 1ITZA 3LUHA 4RA6B 5CLFA 1AQYA 4HF7A 4QELA 1AD2A 2WD8A 5DLYA 1L5KA 1ADYA 1P6QA 3G8CA 4B6OA 1CY8A 4UTPA 4V1CI 3PFKA 3N7TA 4KXFB 4Q12A 4BY9E 2EOAA 4C7KA 3ESAA 1PJTA 3U13A 1N2CB 3ASVA 3F7OA 3OMWA 3FDZB 3C3JA 2QMQA 4BKUA 4NC9A 4C01A 2Q2OA 2VTVA 3C45A 3GQBA 4WNAA 5AUQA 3W5DA 3THWA 2EFJA 3AHHA 5DSTA 3TX6A 4L27A 4LYHA 2C83A 1BH2A 3DPSA 3GT3A 4URZR 2FPMA 3IDFA 1U2DC 5DH9A 4CQLB 1U1IA 2Q3FA 1EDEA 1MF7A 3WXMA 3NJRA 4ZRDA 4QFBA 1ECCA 3ZI4A 3ZV3A 3MS7A 3G2IA 1KO1A 5J43A 2PUHA 2ZSKA 4P7BA 3BH6A 5KYWA 5I45A 3RSLA 1J8FA 1JAZA 3P9ZA 1GT6A 5GJWC 3WL8A 4F93B 1V1RB 1C7QA 2ORYA 1SHZA 1NV9A 3PNSA 1ZR4A 4M0CA 1C0PA 5H82A 3UUFA 1G6HA 1RWWA 1JR3D 1T2DA 4Y1EA 5EE5B 4CTNA 5FI3A 5I9BA 2B4AA 5HQ3A 2BVNA 2QAIA 4M0UA 5G0SA 1C0KA 2HA4A 3HBAA 5ILQA 2YH2A 4O29A 4JB3A 2ET6A 4FX2A 3HUUA 5DNCA 4XLLA 5B53A 1OBFO 4L5BA 1O96B 1RRPA 1NI4A 2JKZA 1UPTA 4E2FA 3ANMA 2ZBDA 1ECLA 1P74A 2E5WA 1ARZA 1PS8A 2BFPA 4TRJA 4TMYA 5DFAA 2QLTA 1G55A 5IJXA 2ZYSA 1FRZA 1KKUA 1SKBA 3UCFA 4BNLA 1YK0A 1BSVA 3B9PA 3CVUA 5F2NA 5T67A 4JUCA 1PG2A 3H5RA 4KXYA 4TN1A 2ZE7A 4S1TA 3CB4A 4BBPA 3ZGOA 4JHLA 5F23A 4C89A 3ANSA 2CVFA 2J41A 3I04A 3SXUA 721PA 3R2JA 3QF4B 1JDNA 4F2HA 1T8UA 5C8VA 3O47A 4YCJA 1NU6A 5KJ1A 3GVHA 4HB3A 3TNDA 3OX2A 3U1TA 3NHMA 3MLEA 3LPMA 4R6XA 3VYTB 2H17A 1KEKA 4GX5A 2DT5A 2WJGA 1KNXA 3MINB 1Z2DA 3F5QA 4HLCA 4IIFA 4LK2A 5TDHA 2Z9CA 4GQAA 4Y7DA 2GBLA 1UPBA 1JLRA 3D3QA 3QWIA 1C1HA 1PJLA 3P32A 5J4VA 1XQYA 3IMGA 1QRDA 2C42A 3JWHA 1B6SA 1XJCA 2PWAA 2YV3A 4I81A 4H3HB 4QAJA 4EYGA 3QBEA 4GSYA 4ZVSA 3O90A 3OQ6A 1DJMA 2EKZA 2ZFUA 1U80A 1RJ9B 1RQ7A 2D1QA 4HZUB 2PRKA 2AJCA 2PT5A 2QSUA 3QVVA 2QLNA 4YONB 3LQYA 2I2CA 3O9VA 1J49A 1CY1A 1MT0A 1H9BA 2F43B 5B7QA 5ALQA 1CUBA 1KAGA 2LVBA 1UL1X 2PTGA 2V6MA 4ENTA 2CVQA 3HK2A 4XEUA 2EWWA 1J00A 3L0SA 3LF2A 3KJZA 3N76A 4OH7A 5DRTA 4A26A 5C80A 5JADA 1B3RA 1OXXK 1G21A 3RUHA 3RT9A 4QOHA 4WWHA 3ZWYA 1VTKA 4OLJA 4H15A 1Z4MA 4KO2S 4WXMA 4L02A 1U1CA 3AF5A 1W30A 1XPUA 5GIPE 3LT4A 4ZVTA 2EZUA 2VR1A 3VBEA 4JGBA 4JFAA 3WJ7A 2DR2A 3K5WA 3CZPA 3RAJA 4JA2A 4ALLA 4H35A 1J97A 2JD1A 2A84A 1CF4A 4Z0HO 1I6KA 2LPMA 5HHTA 3FUCA 2CVZA 2GCOA 2VRNA 3I12A 1Q14A 3UZUA 4IUBS 4QRHA 3GGGA 5DM60 3ZHUA 4U7FA 2EU8A 2W6ID 3AERA 5EXSA 2BP7B 4RMIA 4FT2A 3THOA 2PZMA 3K30A 1OUMA 2XKJE 4LBVA 1EFHA 3HJRA 4MPTA 3R9XA 3C1UA 1YZUA 2X5KO 1M8JA 4WFJA 1FTYA 2HA6A 1T1GA 1U2SA 2ODAA 1LF0A 2VHYA 1CF9A 3GUHA 3OQIB 4HZUA 4RVHA 3RFVA 3OJLA 5LL6P 1BIFA 1AKVA 1MB0A 2G9RA 3MM4A 5IYZF 4NI5A 3RAFC 4OQNA 3AEYA 5A5DA 4FBMA 4MI3A 4BB6A 1ZESA 2AG5A 3RVPA 2YWDA 3IUJA 2CYAA 1T43A 2ID7A 3FKSD 3PX3A 2D2IA 1R3UA 4XGRA 1MC8A 5EEHA 1N2EA 4GPTA 3SN6A 3UHFA 4QUGA 2Q0XA 1M74A 2QLFA 2FQQA 3I53A 4CF3A 2HSEA 4IFTA 3TMAA 3H0KA 5CAEB 1Y8RA 5HQTA 3ZZMA 1H8HA 4Y67A 1NAHA 2P9YA 2VPIA 1WXFA 3IO3A 3AFIA 3WDMA 2POCA 4UNPA 1XKLA 5EP2A 1WHSA 2UVPA 3A6GA 5DBOA 1Q7EA 3C39A 4P2GA 1V45E 2B2XA 2FRVA 2P62A 1Q19A 2XPCA 1J23A 2A78A 2EX0A 3CKLA 4Y8VA 2FZEA 3PFIA 4GMKA 3HY3A 3LCRA 4U2EA 1ZN2A 4LWQA 5EMNA 2ZRCA 5A04A 3B5EA 1M67A 3G5MA 3JATA 4FEEA 2CNBA 1OFUX 3QUQA 4HFRA 4PRLA 3Q40A 1NNLA 2OYCA 2NG1A 1MABB 2H4YA 4B09A 2K87A 3QE3A 3K4PA 3VR4D 3CBGA 4D8UA 1J9GA 4YA6A 3GWZA 2GZ1A 3OIFA 1O0BA 3LYUA 3A6EA 3RJTA 2GZMA 2F3TA 4FMDB 2WFLB 5ALFA 3HA7A 3UWOA 2BC9A 3T1TA 4E46A 2GAIA 4BVLA 3B89A 2D74A 3FI9A 4AJ1A 4HLUC 2PZJA 5DX1A 4ZTZB 2C31A 3Q4GA 3E27A 1DRWA 2WKRA 3LA8A 5EUMA 3OCXA 3NAGA 3OAAD 5CLJA 6LDHA 5FBQB 1UMDA 4CM5A 4JI4B 1IWOA 2ZSJA 3IV9A 3KYDA 3OIGA 1E3EA 3C8ZA 4PNHA 5EP4A 3VC1A 3CXUA 4H1UA 5BR7A 1TC1A 1Q15A 3O0TA 1VKOA 2X76A 4MX8A 3DE7X 3TXYA 1GKYA 1IHDA 3D2CA 4GRAA 3F7MA 4HLDA 5CDSA 5KHOC 3WGGA 5B2FA 4HYTA 3KQOA 3LZ6A 4AY2A 2ATCA 2I8LA 1N7HA 1FNBA 4BGVA 4JLNA 2OM6A 3TBKA 2BLNA 1WBBA 1Y4SA 2WC1A 4F6CA 2VHWA 2B4QA 1AXRA 2Q1SA 1JXOA 3T8YA 4QPJC 2X22A 4B45A 1N0IA 4M9ZA 1SXJC 3RU9A 3TDKA 3H05A 3H4MA 1RLMA 3RCBA 3WLLA 5HVNA 4Z4GA 1GGJA 1D1TA 2GF2A 4EUKA 1OWLA 3SYRA 4WLOA 5CT5A 5ICFA 4CQNA 1FVFA 3OLQA 1GNPA 1CD5A 2ZVJA 5GIOE 3DGEC 4WFQA 2VYVD 3Q85A 3TFOA 2QP3A 3A4NA 3L7BA 3WQHA 4FC6A 2E6KA 3BE4A 1TTPB 5D3ZA 6REQB 3EW7A 1D2AA 1E3MA 3UC9A 2F59A 4UD2A 3IR6A 4AJPA 1XZPA 3ZDZB 3JALB 3T7CA 2J0SA 1XTRA 4EKIA 1L4UA 4G26A 2M9MA 3UAZA 3KQMA 2NU8A 4F3YA 4RHTA 2JLAA 4I9UA 5ENZA 1FJ2A 1QJ4A 3H5AA 2RGEA 3IQHX 5BT9A 2R8ZA 5TVGA 4A8JB 4DLSA 3L4KA 1E3WB 3KL2A 3ZJ4A 1ZM4A 4D9GA 4ZGWA 5JPCA 1G18A 2J6CA 3R6GA 4K26A 2C78A 4XB6B 2V98A 4XDHA 4RA9B 5L9AA 4DRXB 3PXXA 1E2QA 1FDSA 1NOIA 3CUVA 3OZXA 4MA0A 4MQFA 2M2IA 5JYEA 2HZ7A 1JEQA 2Z2IA 5DHRA 4PE5B 3L1UA 4QUBA 2ECPA 3EIFA 3W34A 5SY9A 4P7JA 5AM3A 3C8HA 3H0EA 3R3UA 1X7GA 1KO5A 3LMKA 2GZ3A 3V3KA 5IJ9B 1PZXA 2QSJA 3FLMA 5C31A 4UASA 2EFHB 5E95A 2Q45A 3F3MA 1U1EA 4QGAA 2I7TA 1CCWA 2PS9A 1YVPA 2P1RA 1CP3A 3AHCA 1C9JA 3L6BA 5J5AA 3FUUA 2PLFA 4IVQA 3H4IA 3AW8A 2HA3A 1OU0A 2PEYA 3AU8A 4ENPA 3K70D 4LMAA 4QJ3A 1CVLA 1CYDA 5DWDA 5BVGB 3P2EA 3TTXA 2VZ0A 2VBCA 4QPZA 2PNJA 2BJVA 2JAOA 4HBGA 4WCFC 5J47A 1QCDA 4DG9A 3VO2A 1NTRA 4UDOA 2VAWA 3ZDBA 3BK2A 1X1CA 3WLAA 2FPGB 2FQYA 1E6CA 2QX6A 3HJTA 5JZMA 1MX3A 4C7OA 2O8CA 1NYLA 3MPOA 4LDRA 2D3TA 3D6NB 4QTTB 4Y6OA 4AJHA 4DGQA 1Y0BA 3P9NA 1ZOIA 1RZRD 4DWWA 1YOBA 2HQ1A 2QX9A 2D2FA 2W8BA 1BEUB