4KO2S

Low x-ray dose structure of h2-activated anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
279
structure length
279
Chain Sequence
AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEGEMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFGDNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNGINWCVENAVCIGCVEPDFPDGKSPFYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Periplasmic [NiFeSe] hydrogenase small subunit
publication title Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
pubmed doi rcsb
total genus 82
structure length 279
sequence length 279
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ko2S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ko2S02
4UCWA 3ZEAA 4IUDS 5JSYA 1FRFS 1UBHS 4UPEA 3ZE8A 4KL8S 5A4FS 1E3DA 4UE3S 3MYRA 1H2RS 5A4IS 3ZE7A 3USCS 1WUHS 5JSHA 4TTTS 1WUKS 1YQWA 4UEQA 3AYZB 1WUJS 4IUCS 5JT1A 4KN9S 4GD3Q 3H3XA 2WPNA 1UBOS 1UBTS 3CUSA 1CC1S 4UQPA 4UE2A 3ZE6A 4UQLA 3USES 1UBRS 2FRVA 1WULS 1UBUS 3AYXB 5D51S 5JSUA 5JRDS 4U9IS 1FRVA 4UD2A 4OMFG 4KO3S 4KO2S 3RGWS 4IUBS 4KO4S 1UBMS 4UE6A 5A4MS 4UEWA 4URHA 5ADUS 4UD6A 1UBJS 1YRQA 4CI0B 1WUIS 4UCQA 3CURA 4C3OB 1YQ9A 3UQYS 1UBKS 5JSKA 4UPVA 1H2AS 4U9HS 1UBLS 4KO1S 4UCXA 3ZE9A
chains in the Genus database with same CATH superfamily
5LKRA 2ZJOA 5JBQA 1RJ9A 1NVDA 3UOAB 2H6EA 2QTHA 5BVGB 2EGHA 2AC2A 1BVHA 1O6GA 4QYMA 3ISVA 3E7XA 4MVJA 4XR9A 4EFKA 2XKKA 1G5HA 3OM9A 4NOLA 3DONA 2QAGB 2PANA 2I71A 5E95A 2CLFB 1KL7A 2Z83A 5KYUA 4DZRA 3WNVA 1KP9A 4V3BA 4RSMA 5AJZA 2ZE7A 4BMSA 3G3EA 4UOEA 3AQIA 3L6CA 5IJXA 3CRVA 3EUWA 4CU2A 3QU9A 4G1MB 5LPNA 2YMMA 3N5KA 2X6RA 2G1KA 2WIGA 4EHKA 1G21B 1D8AA 2Z95A 3KB6A 4NOKA 4IOJA 4PLZA 2CXRA 1PJ3A 2CLCX 1V8FA 4K0KB 1PZEA 2B21A 2F3SA 1A4RA 5KQSA 3GL9A 1BDBA 1KIFA 3KPUA 4BVFA 4R4JA 3CJQA 4W63A 5JC8A 1XKLA 1EFRA 2H9YA 2J6BA 3CA8A 3OKFA 1XN1A 4KN9S 1PFUA 2B92A 3NEJA 3H5RA 3L93A 4R83A 3CRNA 3WQSB 3ZU4A 1IBKB 2DMRA 2RG7A 3P4YA 2PLFA 4WFJA 3UENA 4BCBA 5BR7A 4NBSA 2HJSA 3KOZA 2FFRA 4WL0A 3RC1A 4KGZA 4QD3A 3H17A 1XNQB 2RHGB 5C46F 3R7NA 2G9QA 4KOEC 1NG1A 2BEVB 2O1WA 3LUGA 1V1MB 4E0BA 1XT6A 5L4SA 5DGHA 1GRRA 4B7ZA 1JAXA 1RLTA 1B3BA 1BX0A 4YJHA 1G60A 1ZIDA 2QOEA 2ZRMA 3ECSA 4ZDWA 2HFKA 4N9WA 3DC2A 4MS4B 4YCAA 2JGEA 4YONB 2ODNA 5F21A 1JEDA 3AEQB 3AYXB 2AW3A 3C4JA 1V7QA 3C70A 3FTDA 3M6UA 2QTAA 4JP5A 3DVQX 1T2DA 1OGJA 2FW9A 3TQIA 5JRDS 2VSFA 8LDHA 1LNZA 2YN4A 1NUHA 3DAOA 4DR4B 1L6RA 1U7PA 1ZGHA 2QNRA 4X8LA 4BQSA 1RXCA 1RQ7A 3NQ41 3TW0A 5LZ2A 4V0OA 3VR5A 2UV8A 4EZBA 4NCBA 3S8YA 3LDFA 4IUBS 1WXHA 3I8OA 3TW8B 1HSOA 1TJ5A 4OQXA 2ZRKA 4J7XA 2JAUA 1TU3A 4OHBA 3SSNA 3D6FA 3R3WA 1P0QA 4URZR 1QO0D 4EUHA 1OFUX 1J07A 1CIVA 2VSNA 1RHUA 1H42A 2BEKA 5FBHA 3O8QB 4JIGA 2ZUCA 1IOLA 1NBMA 3ENQA 4WFQA 4DUYB 4JI8B 4EELA 1A0OA 4MV1A 4YO7A 1KE1A 5ADUS 5KDOA 5CJJA 2B7CA 2GCOA 1NUPA 3A1DA 1MIHA 1IHPA 3F78A 2YQ4A 3AEUB 1DMRA 1QVWA 3I9NA 1NURA 4FWBA 2BFEA 3IESA 1DFHA 2XUFA 2YHIA 2PUHA 4G97A 3WGGA 5AUOB 3QHPA 3LS2A 3KQTA 3O03A 2D59A 2G0TA 5SV2A 2QRLA 2BH2A 4EPYA 1L1FA 2ZYSA 2W2LD 2XOXA 2I6SA 3G7SA 1CJMA 3BCHA 3OZ7A 2NVBA 1ODLA 4PO1A 5G1NA 3SXUB 3WBFA 2V45A 4JU9A 4X62B 2I54A 4I4TA 4BFWA 1YFJA 1E1QA 1N5MA 1C3LA 3RIXA 3VSAA 3ZY4A 1LC0A 3GDHA 4BGVA 3AKDA 4FFOA 4P08A 3W1VA 3RK1A 4NU0A 4YIKA 4TTJA 4X60A 3WRWA 1EK5A 1ZBDA 2GKSA 4C6TB 2EKQA 1U1CA 4EFDA 2C20A 1JH9A 1E3WB 5F76A 4MGEA 1UJ4A 4BO6A 1L5GB 3ZXYA 3ABZA 5JY1A 4DV1B 1ILWA 3GFTA 5T57A 2MSNA 1L5LA 2TSYB 1MB0A 2ENWA 3Q3EA 4YRPA 1U0FA 2DKOA 2PR2A 4IG9A 2NQ2C 2H7VA 4BNWA 4ZOLF 4J7CA 5TVKA 4M0LA 1ODCA 1GCOA 1PV1A 1M8KA 4MULA 1UC8A 1T2FA 1J5PA 1XRLA 3K9NA 1Z25A 2FK8A 4PXYA 5KSYA 1PK7A 3R0JA 5EJAA 1E5TA 4MIYA 5IT5A 1TZCA 1FU8A 2EJCA 1L7XA 2ID9A 3A32A 2ZP1A 5BWCA 3OX1A 4RV9A 4YFYA 2AOWA 4UBNA 5FX2A 1ZVVA 1D4FA 4YREA 3QU5A 4BHTA 4IF4A 3GW8A 1RJDA 4H4DA 1SCKA 1EYZA 2XI4A 1OXKB 2UZ3A 3W90A 3P2KA 1A9TA 5G0TA 3HYSA 5DXJA 2H4FA 4NE9A 4D0GA 2FHPA 4ZAWA 1EVKA 1K2WA 3IUMA 4JITA 5HK8A 5IP5A 5JMPA 3VXKA 1KIAA 1RAFA 2LTAA 3MJRA 3N3AC 2VG8A 3OKPA 3MTEA 1LH0A 1VBFA 4FYPA 4GP9A 2BUCA 4EYKA 3M5WA 1KPHA 3K2IA 4GKBA 2IDMA 5AI9A 9MHTA 2RBKA 4NEHB 4DBZA 4JEHA 4CLRA 1PV2A 3BD6A 1GLGA 1YR7A 2WT9A 5LA6F 3F3YA 1GZVA 5LYYA 4CIBA 5ADHA 1DHTA 5DMXA 4OLAA 2PWYA 2XHZA 4H35A 2YFQA 3MGGA 4LZNA 4M8SA 3LYLA 4Y2VA 2GCNA 5DNCA 5CH5A 1OIXA 2WMOB 1IHDA 3G5UA 5HUQA 1QGYA 2DFNA 2ZGVA 3V8NA 4FMBB 4F5DA 1VL5A 3ZKAA 3LCUA 4ALNA 1QU2A 1XALA 1JT2A 1KTVA 2XNKA 5B53A 1YDFA 1LK5A 2RC5A 2X1VA 3R23A 2YZKA 2CJWA 3RGWS 2VT7A 4PHHA 1M2HA 3HR8A 1K98A 3RGGA 5BYBA 4QOIA 4ENUA 1JW9B 2JL1A 3NOQA 5KUTA 2WDZA 1G66A 1VRWA 1NRIA 3K5PA 4WTOA 5H16A 3CF4G 3DZHA 3FBTA 3L0IB 4QNRA 5JCJD 2VQDA 3ZWKA 4YRAA 1FDOA 4EOGA 1N2XA 5GIOE 5BR1A 1PJCA 2FCAA 4XUGB 2ZTHA 2O2IA 2YY6A 1KFJB 2R7LA 3KEFA 1DT5A 1GTMA 2JGDA 4RMJA 3K2QA 3EIUA 4IQ8A 5CXUA 1DKPA 2F4NA 1LRLA 4ZO6A 2Q8PA 2VUIB 2Z04A 4OQLA 1XRMA 3UXYA 2VEOA 4C6SA 3UHAA 1JVNA 4OHRA 1QB7A 1DIAA 5KTRA 3R5TA 3VMMA 2X7JA 3VKHA 4XYEA 1P61B 1TYEB 1C7IA 3VR2A 3W04A 1N77A 3DBRA 1P2GA 1E59A 2LIVA 5DNVA 4KQFA 1D8TA 4YRBA 2WZBA 3QHQA 1V7CA 3ZS9A 3VDMA 1XTJA 4HRVA 4DLAA 3TWOA 3HEBA 4DA6A 2X3UA 2B4KA 5IJ9B 4YT2A 5IX8A 4KMMA 4RTMA 4NBLA 4CV0A 5KMGA 1BX3A 1R00A 3WRYA 4O4HF 2XYRA 2EOAA 4ARCA 3N2IA 4Z53A 1NP6A 4JKIA 1A98A 1X19A 3F7NA 5JATA 3K70D 1AKVA 4CEHA 5CBPB 4CDNA 3ZQ6A 4X92A 4L5IA 4HKTA 4K87A 3EGWA 2QN6A 3LFUA 3VNUA 1D0VA 3AILA 1UAAA 4M46A 3QMWA 3KKZA 1ONBA 3JYPA 3B38A 2HIMA 3ICEA 3T3OA 4UE3S 4FFDA 2WYWA 1C1DB 3FMVA 3CC8A 3ZHQA 3D64A 4WJZA 4UDNA 3V42A 2VT2A 3BIWA 4G0OA 1DBSA 3N76A 1PT5A 3O6VA 2XMBA 2H00A 4L8FA 3RVOA 2JI7A 2G7MC 4U2GA 3OPMA 1LZLA 5J47A 1HDEA 3VSEA 1HDRA 1FA9A 1T25A 5FT9A 3CPHA 3CLTC 4FCCA 5AMXA 1HT3A 2LCIA 2ZKLA 4AXXA 3VSDA 1VJ1A 5LP1A 2R84A 3IHWA 4X45A 2KPOA 2QI9C 2VYND 2COEA 1TX4B 2HA7A 3VPHA 1PV4A 3HFRA 3SZUA 3LQ2A 3OIWA 4E09A 4NQRA 4ARIA 1TQ2A 3ZBUA 4EPWA 2C94A 3NKLA 2HQ1A 4FHGA 3RT9A 4XUEA 4CZ2A 4YA6A 4V0RA 1IPEA 4WLFA 3BL5A 4B3BA 1HZJA 3D3EA 3CX4A 4MA4A 4C4XA 1W4LA 5CLIA 3VGPA 2OB1A 4A91A 1GNVA 1REQB 3I09A 2CFRA 1GP2A 2QJWA 5IT0A 4MVJD 1JPVA 4RPLA 4UVDA 3T9BA 4RL6A 4ZK2A 4KNYA 1FFEA 4S04A 4YCCA 1WZ2A 2VHCA 3NYRA 4OOFA 1SQSA 2GNOA 2O07A 5BPFA 1QGDA 4HNUA 2WF7A 4RD3A 5LJLA 4NOJA 3EGCA 3I2IA 1ATZA 1A96A 3D5EA 3OIGA 2HXGA 4ABTA 4ESEA 2PZEA 2OV1A 4C5BA 3NBZC 2WFLB 3PHGA 4DNXA 1OLUB 1SEVA 1C9DB 2C5EA 1S2DA 2ZYIA 4QNMA 4ZYXA 3A0RB 4KBGA 4KSBA 1WIWA 2V96A 4MLZA 3CGWA 1C0PA 4A0HA 2IS6A 4JHXA 4O2RA 1GNPA 4PSAA 1GPUA 2BRUC 1EX9A 3CG0A 3IAM1 3HUTA 1BHQ1 1WKBA 2ATIA 5IDYA 5C18A 1NR7A 1SXJE 2GYVA 2O2JA 5LOVB 1E69A 4R7ZA 4AY5A 4E14A 4CN8A 3STWA 4Q18A 3BG5A 4G4GA 2R2AA 3DE0X 2YVLA 3EG9B 1RRPA 3R0XA 1E8NA 2DFKB 5LDHA 1DPFA 1UK6A 5DNEA 3NC0C 3WTCA 3KZNA 1DAFA 1KYZA 3RYIA 3PFCA 3TVYA 3PQDA 2G9ZA 3EIHA 4FJ1A 3I5UA 1YJCA 2OQ2A 4WZAA 5AVZA 4P54A 4ND4A 4ND8A 4I4LA 4Q9IA 4M1YA 1C9KA 3TLGA 5GVSA 1IM2A 4OHOA 4WY8A 2NZXA 3RIHA 4YO8A 3EXAA 4UBOA 3U3RA 1LRJA 1RWXA 2E4VA 2A9OA 1CJKC 1GXSA 1ZK1A 2OL4A 3W3AD 1JJFA 3RASA 4A23A 1UZNA 1ZRNA 4LOKA 3L1UA 5FOXA 5CB4F 1TYDE 1LLUA 1E1DA 4PZ9A 4QTUB 2DQZA 4LJ8A 5I7AA 3HXTA 1EUCB 2WMYA 3P2MA 1EU1A 3FPAA 3M34A 3OQPA 4OAQA 2G8LA 3UMMA 3AIMA 3KO8A 3RJ9A 3HYLA 2VHVA 4LQLA 2PS0A 2XA2A 3E53A 1JHPA 2MHCA 4JASB 4BNTA 3L77A 3RV4A 1OIWA 4YCMA 2EZ9A 1NBMD 5WRFA 3JPWA 5K5EA 1FX0B 2Y1WA 5JPCA 3ROFA 3IKTA 1UBEA 3LT5A 1GKKA 4L6CA 5I01A 4RAOA 4UMFA 1O97C 5K45A 4OHXA 4JBGA 4KQHA 3F6PA 4P8RA 4CIAA 1K08A 1XFAA 2W2TA 3GNLA 3VGJA 3INTA 4FLMA 3RUFA 1KMQA 2W4MA 5GV8A 5B12A 1V47A 3BTOA 2P2LA 1S2LA 3HYTA 1E0AA 3T4EA 3GBPA 1A9XA 3U16A 1OC4A 1GARA 4X61A 2QY6A 4UATA 1X39A 1W5SA 3V1UA 1UBTS 2CLKB 1VSVA 1KEWA 1XD8A 2BR3A 4JL6A 4RIEA 3NTVA 5CK4A 3CKLA 4WPGA 1E1QD 4AZSA 1KWKA 3WLMA 1UMCA 3OM0A 1GNRA 3CONA 1GZ5A 3AR8A 4WERA 3HGMA 2DWUA 5I9BA 4GLBA 4KAXA 3TG8A 1RJFA 3PNKA 5EJ7A 2GKGA 2WYOA 1SURA 4CF3A 1AG9A 2P41A 3ICCA 1TJ3A 4P7KA 3H05A 3EXIA 4PIPA 3MZ0A 3HN7A 1OLSB 1O96A 2J9RA 4ZQCB 3ZHOA 1DCMA 2DUUA 4WBXC 2DETA 4NNPA 1O4WA 3D4BA 4H6VA 1NOKA 4L4YA 4U7DA 4MUNA 4Z4FA 1QIDA 4YT5A 1M2JA 4CKCA 3DHYA 3DKIA 4BC1A 3DKPA 2Q0HA 3KP1A 1OXBB 2I6XA 4MWEA 5FUMA 1GUYA 3LCVB 4MDYA 4MYRA 2VSQA 3KAPA 2O8VA 1H22A 3ZXSA 4FGSA 2NZVG 4D46A 5BRAA 1LSUA 1W581 2HK7A 3DWGA 2PRIA 1ZWLA 1XK7A 1BA3A 1QF9A 3UK0A 3MJFA 1ZITA 3HLKA 4ER7A 4RTRA 3W8EA 3K70B 2GVDC 2O1SA 1A4XA 2RSLA 3CJTA 3T61A 1ZYUA 2EHJA 2PMCA 1LBQA 1SPXA 4EENA 3HY6A 2CVFA 5ITWA 4RVHA 2BM0A 3CY6A 3EN0A 3IXLA 2O7SA 4IKEA 4URUR 1NVVR 2HA3A 1U8ZA 3U0VA 4B6SA 1YQQA 1Z0DA 5HGJA 1AF4A 1U3DA 2G07A 3FY4A 2QUIA 2WKRA 1SU7A 2IEYA 3KDPA 5F2NA 4LDJA 3UKOA 1IHOA 2RIRA 3N39C 5JWRA 4YROA 1EWYA 3CLTD 5I9NA 2B61A 1QQ5A 1L5MA 3H13A 3VAAA 4L9RA 1E20A 1OGIA 3OJCA 2DFLA 3JQ9A 1T6ZA 1TIKA 4WY2A 4NY1A 4FFBB 2VLBA 4MDFA 1D6JA 1EXWA 1NJ2A 3FDJA 4IJWA 4BO3A 5K7SA 1PSZA 3I9LA 4Z9FA 5AI5A 1WY7A 3QKRA 1MV5A 1XE3A 3L7KA 2YJNA 1Z06A 3NNDA 4Z3DA 1KQGA 1M1NB 4MR9A 2RHDA 1LF0A 5KOYA 1G8JA 4RM3A 1CQPA 3F46A 4TGLA 1GPDG 1R16A 4Z1MA 3ITKA 2GLXA 1E66A 1ZCFA 4UVHA 1UC9A 3QRWA 5EMJA 3SBXA 1JSLA 1BEEA 1VC2A 4FXPA 2ZJ7A 1O6BA 1RJ9B 4YV7A 3DH0A 3BFKA 2JFFA 1OZFA 2QUKA 3D7RA 1RXUA 1KORA 4LDPA 3D6HA 2O57A 3EVFA 1JMYA 4V2IA 3RRMA 3ECCA 3RSLA 2PX3A 5BSHA 2Z8ZA 3U7QA 1L5VA 2V5VA 4O0MA 1FIUA 3TLKA 1M0SA 2GSDA 2TMDA 1XU4A 5DTIA 3R0QA 4IIEA 1UDAA 3WWCA 4AIIA 1K6EA 1ZRSA 2J7PA 2XYQA 4G36A 4XCXA 4Q00A 3SR4A 4CQJA 1G6KA 3ZNNA 2H48A 2JAHA 3AYZB 4B74A 3FUUA 2Q3LA 3EDOA 1VHJA 3GFBA 3K6KA 3TYXA 4DRXB 2O14A 3VR2D 2GXQA 1E0KA 3T7RA 1JQ3A 4AL4A 4LWOA 4AO8A 2V74B 3G8CA 2QTBA 4IJ6A 1N9GA 4OYLA 4L9WA 1SELA 4FYXA 1P0CA 1X87A 2B82A 4IYRA 4PHGA 1OFVA 4JL8A 4KPFC 3W2TA 2VDMB 4H31A 2ZIWB 4BAZA 1W88A 4B09A 1OZAA 5KTSA 3FTCA 1TL7C 3AM3A 3CZRA 1EFHA 1MT0A 3CNOA 1QMPA 1UBRS 4YY3B 4P83A 4RACA 4JVOA 2J3EA 1H1TA 4D0LB 4XXHA 3OOYA 1NW7A 3QVXA 4DQUA 4LE0A 4P33A 2VXCA 3L41A 3PZRA 1CRZA 2R8BA 4XEUA 1FNSA 1RBYA 2F62A 3R09A 5C3MA 5G0SA 3G85A 3QVGA 3KQYA 2Q3JA 3CVVA 1TPYA 3OLZA 3H5WA 2GZ3A 3PJFA 4G4SP 4OLJA 4YRLA 3TQQA 4BQNA 2FMXA 4DUZB 2R2GA 2X2EA 2ZDQA 2OZPA 3QG5A 1Q2XA 1SPBS 1EFTA 5JAHA 1OAOA 4LXGA 5CRIA 3H65A 1SN7A 1FSPA 5C35A 3NVMB 4BQQA 2QN2A 3LCJA 1R4NA 2JCGA 3AEKA 2KHZA 3PXGA 4LMAA 3SM3A 5JH7A 1YZHA 2QP4A 5JS6A 1LPSA 5CLLA 4PTLA 3RU2A 3KV3O 3HWSA 5CFRA 3QPUA 1KYWA 1R4MB 4LIPD 5DN9A 4MUHA 1DBWA 1FS6A 1KC3A 3FFTA 3PFKA 4PAOA 1SA0A 1X0XA 2V0NA 2ZUEA 3GRVA 3Q4GA 1D2MA 3JXEA 4S1NA 4HT3B 1W36D 2IHVA 1JLRA 3V80A 1NYTA 3S2UA 4FQ5A 1PL7A 2P2ZA 3C43A 4IOLA 4IEFB 1U1DA 1UOEA 4Z4QA 1LEHA 3PZBA 5J9FA 3C3BA 2I7VA 3VBEA 2GCOB 3MWLA 2ZQ5A 4HXEB 1XJCA 2BFEB 3RS4A 3VBCA 2YKGA 2O54A 4LVNA 2YHIB 1BN7A 2ZJ1A 1E0DA 3BXOA 4FR2A 4QYIA 2OORC 3OWXA 3RK0A 3MTJA 1HPLA 2WUDA 2WILA 1PVDA 2PTHA 1MIOB 1A9ZA 1Y3FE 2H07A 2YY7A 3D4NA 1K3TA 4KW7A 4L7QA 4N0DA 2FE4A 4JLUA 4PO3X 1P33A 5HJEA 4BMZA 5B3KA 4BO8A 1DG9A 4M55A 4I4TB 2WWHA 3NFRA 1SOVA 4OFWA 4RXMA 4DEYA 4LYYA 4C29A 1RFGE 1WSBA 5G1OA 1LI7A 1GQOA 3MXTA 2YDXA 1HT0A 1JWLA 3MTQA 4KEAA 2AW5A 3EUFA 2AJTA 1DTWA 3HU1A 3OPYA 2IEDA 5DF1A 3OTGA 1P6QA 2ZR0A 1HY3A 4CDMA 3DVSX 1VP9A 3HN2A 3BRCA 5FI0B 2ZRCA 1P60A 2Q5JA 3ZE7A 1ZD9A 2VRBA 3C0KA 2PFSA 4PSCA 4B17A 5BORA 5K4GA 5ED4A 3DGEC 3DR3A 3LQFA 3O3NB 2XMZA 3PUZA 5MDHA 2P5YA 2QENA 4R68A 2GETA 1KDYA 4FEAA 1CF2O 3UAWA 5ADWA 2BF4A 4NH4A 2DFVA 1CB0A 3UQZA 2AEFA 5FOVA 3ZPXA 1YS7A 3L3BA 4CKEA 2V65A 1VYTA 1RWPA 1C9EA 1YB2A 4FDTA 4U2BA 3ZDYB 1OLXA 1U0LA 2CXHA 2FPRA 1GN9A 1T3LA 3EQZA 5U4XA 3RBZA 1K4YA 4B80A 1LB1B 2JHCA 5MGNA 3EIFA 1T9ZA 3PT9A 4CKXA 4OF4A 3FTFA 4R2KA 1NM5A 3ZV3A 1JDBC 3VU8A 2GPAA 4WOKA 3K0AA 4X0EA 2P67A 4C14A 1Z4OA 2C3PA 2XQGA 3F4KA 4RY2A 3LZ6A 2QRNA 4X20A 5H83A 5JR3A 1ZHHA 5C53B 2CK3A 4HQFA 4ZVVA 2OO3A 1VG0B 4BBPA 3IOMA 1YE8A 1VZ2A 4TMYA 3L6BA 3TUJC 2HWWA 3LO5A 4IHJA 4FMDB 1DQRA 1ADJA 3NM4A 3KKNA 4KACA 3C8HA 4ACBA 1MG0A 2FFHA 3ZNPA 3F9RA 4EVQA 3GFFA 3M4NA 1DO0A 2F1RA 4N7BA 2CSUA 2XQIA 3CVXA 1D0IA 4MJ7A 5H02A 3NX4A 1PNOA 1D7OA 4R9RA 5T4FA 2WY2D 2YV4A 4Z2AA 1HKUA 2FZVA 2AYZA 3KZKA 4FQ8A 4G26A 3N0VA 4UEOA 3LGSA 3TCXB 1PIWA 2CNBA 3EZ9A 1CERA 3HJAA 1H4SA 1OASA 1Q19A 3EGIA 4MP8A 4KR7A 5F3DA 3GRKA 1SIWA 5HEKA 4KPGA 3H04A 3EWIA 2CJWB 3WLEA 1J8QA 1AQLA 2J5KA 4MWOA 4RDCA 1AHIA 4WCFC 3STUA 3H1EA 4YRFA 5KYVA 2BJVA 3SIPA 1G17A 1U04A 3M6VA 4M8KA 3WYNA 4EFLA 4RHTA 3H87A 3I01M 5BSGA 5IAGA 3GEDA 1GGNA 3TD9A 3WDMA 4NYJR 4WBNA 5KI6A 2R97A 4BNYA 3L8MA 4EUNA 4Z0TA 3RV3A 1UZMA 3FPHA 2WD7A 3EPPA 4P4NA 8ABPA 4HYEA 2V8OA 3HG7A 2JGJA 4JUFA 2A57A 3KUUA 4E4RA 5C7LO 4EWLA 2FX2A 1V9LA 1GRQA 1E3QA 2H1IA 4CDRA 2HQSA 1VE3A 4RIHA 2XCIA 4AWXA 2QR5A 4JB3A 1QUEA 4TV9F 4WK6A 4AVYA 2BE9A 3DBRB 4DMUB 1U0SY 3FOFC 4IXWA 1C1XB 1JHQA 2YJ5A 3PVCA 4GICA 4AZ0A 3ZNQA 3A28A 5AVVA 3FWPA 4QQ8A 4UM9D 2Q50A 3C97A 2Q3FA 2ET6A 4EO4A 2BIFA 5KMGB 5TSDA 3OC0A 1DI0A 6Q21A 5DW0A 4WA8A 3VTKA 3QLVA 5FLYA 2OZVA 4TN1A 4RA6A 4DQXA 1MH1A 1OTYA 3EAQA 1BMTA 3UHJA 1A5BB 1ODIA 2B8EA 1RS0A 2QMZA 3OLQA 4ND7A 5P21A 3IQHX 1AY0A 2GT1A 2VTKA 1A5TA 4BLSA 1DKQA 3BOSA 1U1FA 3PUHA 2OXCA 3AJDA 1YR1A 1E2JA 2PO5A 4PWYA 3NT5A 2R8XA 2OYSA 4N54A 4MYSA 4I7EA 1V39A 4PLWA 5JI2E 4LNHA 2CLEB 1TO6A 3ONDA 1P4RA 3EXG2 4GI1A 2A5JA 3FRJA 4MGZR 4URYR 2WIJA 5LD2C 4NZOA 1I33A 3CW8X 4JL5A 2O19A 1YQDA 4QIHA 4DE5A 1NXOA 3MTIA 4NRDA 2QM0A 5TQ0A 2FVYA 1Z37A 2R751 4BTEA 1N5IA 5D01A 1Q1BA 2G1UA 2R65A 3ABIA 3CVWA 1D2NA 1OF1A 1PFVA 3MGKA 4W1QA 3D02A 3SEFA 2YJ3A 4JA0A 4CQNA 1S6YA 5B37A 2WM8A 3OZAA 5K03A 3CB4A 4CEIA 2OG2A 4LV6A 3ZY5A 1U94A 1M2FA 4OSEA 2NZYA 1BGWA 2BUBA 4DJFC 4JJZA 2MJLA 5EMMA 3SQMA 4Y2GA 1IVSA 4HBZA 2OXRA 4DC1A 3I1FA 1PT6A 2PL5A 3DEKA 2C03A 4JQCA 3ES9A 1MAWA 4K26A 2HA4A 3G0CA 2IS4A 1Q57A 4HNTA 4RJJA 4LX0A 2VUUA 4MQ6A 5A3QA 2BFFA 2FOIA 2PYZA 1MQAA 3H9QA 3V8BA 3V1LA 3FJOA 3WLKX 3FZYA 4EGAA 2K7ZA 2ZJ5A 3NDBB 3K1TA 4R5HA 4MZDA 2EDCA 4A0QA 5B3LA 2OCPA 2K4MA 3VH2A 4W5NA 1L7AA 2Q3CA 3OMXA 4G4IA 1QBGA 1DC3A 3H8VA 2WU0A 4JQSA 4N82A 4LXXA 3U80A 1M2OB 2O2HA 5KDDA 1CY6A 1THZA 3R3YA 4Y8VA 3T5DA 1I1QB 2J7PD 1DQNA 4J43A 3T5GA 4OYYA 2YWGA 3TN7A 1M0WA 3VJKA 2V5UA 5AKJA 3ROGA 1PJAA 3OCVA 2GGSA 1DXYA 5EXXA 1B1AA 3VPDA 2UYYA 4DJAA 1XX6A 5GONF 3S27A 4GI3A 5KVQA 4XQEA 4EI7A 3GFGA 5JDCC 3ANXA 3R7LA 3PTAA 4GW3A 3REQB 1TEZA 5TT0A 5BV7A 1QHEA 2NQTA 3F5QA 3H9GA 3GROA 3OFSA 1MAHA 4V2UA 5DTMA 2F4VB 2B2CA 2A59A 2W93A 3WLRA 1I7QB 5JD4A 1XZCA 2W4QA 4EW1A 4ZRDA 2QG9A 1T6BY 2AKEA 4ALJA 2CVHA 4RHFA 1O94C 1OT5A 3DTVB 2YV2A 4ADSG 2IP4A 2YUTA 1NW5A 2WQZA 3IJPA 1BROA 4XVHA 3PWTA 5IXJA 4JI0B 1KO5A 3RW9A 1OLOA 1RXSA 5JCZA 1LDEA 1E94E 1GRNA 2PEYA 3QLVC 1GUFA 5A9SA 4YAWA 1TF2A 5HP4A 1DBQA 1H93A 2OQIA 3TMYA 4YP7A 4M87A 3AVYA 4RELA 4QLBA 3RYIB 3OT1A 1G7TA 5BUSA 5KNBH 1W7AA 1EDZA 4C0SA 2ZRQA 2IZ1A 4WZAB 4N0MA 3MWKA 2P1RA 4L0QA 3X1XA 1WX1A 2WAXA 4ND8B 1EVEA 5DHSA 4AJIA 3SF8A 3IILA 4BV3A 1I4WA 4RK4A 1JHRA 5KHAA 5F9HA 2Y9PB 2LR0A 3CZPA 1UL1X 5IKOA 1BU8A 4D02A 1GXSB 3DTYA 3MD0A 4RWEA 4X97A 1LV8A 1CBUA 5ALYA 4CT0A 4UNQA 1W6RA 3BJRA 1LSJA 1NV9A 4GRIA 4AQDA 2ZVDA 1KI4A 3HNOA 4ENRA 2C99A 1WF3A 3AF1A 4KRFA 2SKEA 2YBEA 2DBVO 2QRPA 1E7SA 4I46A 2O0HA 4OG2A 2B9VA 4EF6A 1TIPA 1XDGA 4CF6A 4F97A 1P1FA 1EGMB 4HPWA 4CKWB 3U7FB 1CZLA 3DFIA 4NIMA 2C29D 1YUNA 1I24A 4AYTA 1DG3A 2GF0A 2OKGA 2ZITA 3PENA 4J75A 4CM9A 4H7FA 4EF5A 4E5NA 4PU0A 3UICA 1ZNZA 3B78A 3EB9A 4KLRA 4IDEA 4RD1A 2ODEA 2G17A 4YCDA 1PDOA 1X8KA 3LWZA 1W93A 3DO5A 3GI1A 3OA0A 3QX7A 4ZPXA 1OROA 5KNCA 4IEIA 1CQZA 2JLQA 3AF5A 3FHLA 4Y2XA 3CVUA 2W71A 4CIYA 2ILTA 2FF7A 2F7SA 4G9GA 4NK4A 1A9XB 1VE9A 3A2LA 3NM5A 5DLDA 4XUDA 2IV7A 2G28A 1MO3A 1B6GA 3BD8A 3KQOA 3TLCA 2JLAA 1T91A 2Z56A 3SZ3A 4I19A 3LU1A 1Q0ZA 4GLLA 5MN5A 1UMCB 4TKUA 3M1YA 2EFCB 5H81A 1AQUA 2EU8A 4IIYA 5AM1A 5ESWA 2QORA 4PSVA 5HOQA 3IURA 5B4TA 4CMAA 2ROQA 4FUTA 2QD2A 4FX5A 1UEIA 4F72A 1HNXB 2Z09A 4L51A 2VRNA 4AT1A 2JJYA 2AXEA 4B81A 6ABPA 4KMOA 3TFWA 3ZLVA 1V2HE 3EXIB 3WGQA 3IMFA 3FW1A 4MCJA 4B33A 4EHFA 1N3YA 5HZHA 4ZV7A 2ZIVB 2PV7A 1PTJA 3K2BA 5K1ZA 4D41A 2ZTVA 3QBEA 1OE0A 4FMPA 6YASA 5IH7A 1GGFA 3OETA 1NSYA 1TM5E 2D2IA 4IMIB 4FINA 4CM8A 5GGXA 3UJDA 1DJLA 2ISSD 3HPRA 4EX6A 2XE6A 1J0DA 1JLKA 3FPLA 1ES9A 1UKVY 3RWOA 3WP1B 4AO6A 3M49A 3BTUA 2IYSA 1OOEA 2WKSA 1Z8FA 4R0VA 4C1NA 1E1CB 1J2TA 2H7YA 2QG4A 2ACVA 2W2VA 1TAGA 5BWNA 2J87A 4ZEVA 2YHBA 2EJBA 1YU6A 1ZCAA 5TEWA 1A3CA 1IPFA 1VG1A 3BDAA 3UJAA 3ZHSA 3TGPA 2FDXA 5EJGA 5JPIA 1GFIA 1W73A 5F5NA 4YPVA 1FJXA 3H2IA 2CK3D 3PP8A 3IOCA 3QTLA 1PJSA 4G37A 3C1AA 4Q3LA 1V5FA 1BFDA 3OU2A 1M6HA 1W52X 4U9HS 1ADGA 2JGLA 3WRXA 1Z4JA 4BZQA 1KI1A 2FW0A 4IIHA 2Q4DA 1TFUA 4GYYA 5ALKA 4AFNA 3AHEA 3O8LA 2J32A 2BMWA 2CV2A 1H65A 3GO4A 2JCSA 4I5EA 4IIJB 3LG2A 4W5TA 2CMDA 4UC0A 2RI0A 3J7TA 3BQ9A 4FGLA 4LRTB 3SFVA 4A6EA 3V4PB 1Q0LA 1O8BA 1DZ3A 1FL9A 4BWYA 2QLNA 3EW9A 4C5CA 4UMEA 1YIDA 2LE0A 3LNCA 4H15A 3QKRB 4N4AA 4NYMR 3BPSA 4Z5XA 3KSUA 1L3CA 3IMCA 3P71T 4MR9B 3Q8LA 1O95D 4RX1A 3ZUGA 2V55B 2IWHA 3QWAA 3SDSA 5EWMA 1NU8A 3C7AA 4FLFA 1EVLA 2P9FA 3USCS 1U1GA 1V0JA 3P32A 5SYMA 3A4LA 3SE7A 3U4AA 1YDWA 1VJGA 3ZIAA 3ZUPA 5ETJA 2PZJA 3GJXC 2AZ4A 2HCTA 2ISCA 2W9XA 3NWPA 4DBLC 3MMPA 4B3DA 1W29A 3O8OA 5DOZA 3PEWA 3S1LA 3R3HA 5BSRA 2Q5CA 2YZ2A 5DHTA 2PT5A 4I8XA 3GRAA 5FL3A 4JYBA 1SCAA 1E4YA 2CY0A 3WL7A 3RYFA 4EYOA 1COZA 1L4KA 2Y1DA 3I76A 1XHFA 4LZOA 3C3JA 3TINA 1EFAA 2ZU6A 1PTKA 3I58A 1YUBA 5H7XA 3G88A 2IP1A 2OMKA 3SC4A 2SECE 1S2IA 4DB2A 3VC2A 3QEBZ 4YX9A 4RPIA 1N9GB 4R8SA 4B4VA 3Q0IA 1UFQA 1PE0A 2O9JA 3VOAA 1HDOA 5KZMB 3PUYA 4DNPA 3OMWA 3OJFA 1KY3A 5TE9A 1PTJC 4C76A 1JQ5A 3AK4A 3AHIA 1XTVA 3KLPX 3P20A 4MIOA 1DNPA 3UWPA 4C0KA 5LMZA 1SG0A 2VVTA 1IIBA 3N05A 5C1IA 4QPDA 3MB5A 4JP2A 3TR5A 4E07A 1LF5A 5I8WA 1AK9A 1QTRA 3IXMA 5EXSA 4NCIA 2QXYA 2DUJA 3WNZA 2E37A 2W6NA 1ZGZA 2JI9A 4XLZA 1FUYB 1DIOB 1OT3A 2VDUE 4WADA 4OJYA 2D8MA 3DC7A 2E0IA 5EJ6A 3NHLA 3MGCA 2HDWA 2ZZNA 3HP1A 3AESB 3KKEA 4WFKA 4WCVA 3F0TA 2WRZA 3RVPA 5BW5A 1F2UA 3K9GA 3QVGB 1ZH8A 3WHPA 1RKQA 1WSDA 2FWRA 4FGWA 2J41A 2M1XA 4LJ5A 3K5IA 1GZUA 3F47A 4QTXA 1IZ9A 1T34A 2QWXA 4MW1A 3WG9A 3HKEA 5ELMA 4EG7A 2R4QA 5EIFA 4X5OA 1YVDA 1R4NB 2Y76A 1BW9B 1JG6A 3AEKB 5JH7B 1NW4A 5LQAA 2HN9A 1TECE 5FF9A 2HQOA 4I9NA 2VOJA 3UAZA 4EHIA 1JJBA 4CKZA 5G4KA 1XZQA 3DOOA 1MO2A 5LQJA 3ED5A 4GXNA 1I13A 1Z7WA 3VA7A 3A06A 4AX8A 5CLJA 4KAFA 4BBJA 1DWQA 2YZNA 3E7FA 4UXIA 4PBTA 1HDCA 2ZULA 3TSYA 3Q5DA 3FJ1A 2XCQA 4K9RA 4RTLA 4M1QA 1XTRA 4BKUA 4U0KA 4MGHA 4XRGA 2CYAA 3FHOA 3QY9A 1OVMA 2O4UX 3H6GA 4P22A 3D3WA 3UJBA 1JHXA 3G23A 4QYIB 2FP4A 5CM9C 5FHRA 1NQWA 1V2GA 1OV6A 2CXUA 2ZJYA 3HN6A 4QDXA 3BK2A 5LZ8A 3RJ5A 4B6EA 1SFRA 1V8ZA 5HRUA 4WLUA 5HIJA 3MOSA 4Q1FA 2A6PA 4TSFA 3DE7X 2PM8A 4KQ1A 4LISA 1PFWA 3ONNA 4KO8A 2KS6A 4PWZA 4UUOA 2C3UA 2YS7A 3QFFA 2GM3A 3BSSA 2YWFA 1FW8A 2A8YA 2C92A 4HSEA 5JRJA 1GQQA 4IR7A 2H2DA 4I14A 4D3FA 5BO5A 5B4VA 4KR3A 1LJ8A 3FOCA 2I55A 5BYJA 5CDGA 1QIIA 1DTWB 5DH9A 4ENWA 1SQFA 4CTOA 5CB6A 2QG6A 3CLUC 3WQBA 3AUYA 4FFMA 3G79A 4DQ0A 4R69A 3KFVA 2A14A 4EG6A 1CW2B 1T8WA 1G8PA 2WW8A 3EYWA 1G2PA 1P4GA 1NONA 1T5SA 1Y5IA 3DQZA 3IAEA 4J9UE 4NMHA 4BFYA 1SUEA 3E8SA 1Z0JA 4RK0A 5IJ0A 5CNIA 6GPBA 5IVHA 5AKZA 1VCIA 2Y2UA 1CR1A 2IHTA 1IOZA 1Y1LA 1ZQ1A 4CKEB 1NJ6A 5KOHA 1ZGBA 2G09A 1G5FA 1U99A 1OLXB 1LLQA 3PC7A 3N86A 1TAUA 2OUKA 1P1HA 2HIGA 2QUHA 4FNOA 4POAA 2ZUWA 4G5SA 3RH0A 4DA9A 1SCDA 3PCTA 1UPUA 2XQVA 3K0AB 6NULA 5J2UF 3LHDA 2HZBA 1N4DA 3IIKA 1EWVA 5IM4A 4X20B 1XKQA 3ANYB 4PPFA 2WLSA 1ORVA 3O7WA 1QRAA 1JL3A 3NP9A 3T54A 1AUQA 4TZKA 3WLOA 3EOBI 2GVNA 2JFBA 2LDBA 4Y2QA 5LP6C 2QZ9A 2XE8A 1XHLA 3H0KA 4XR4A 1VKJA 2H2AA 2YDYA 9ABPA 4TKLA 1D5WA 3UYKA 3HFJA 3UWDA 2HK8A 2GI4A 3TKAA 4V39A 3F96A 2HT6A 4RD6A 4MQFA 1F8GA 1E2FA 1T6YA 4KVGA 2DPGA 1E3SA 4MW9A 3KT6A 2K6GA 5F35A 3M5PA 4CM9D 2IXTA 4DCOA 3W2GA 5H4HA 1L5ZA 4GBMA 1NL3A 2OBMA 4MB0A 3D0KA 2JLWA 1EWQA 1XVIA 2CF5A 2OK8A 4TLBA 3KYBA 4A6DA 3FNGA 4F21A 5BW4A 5CVJA 3ADDA 1I80A 3HXMA 2RI6A 3AIIA 2VJMB 2PX2A 3E9QA 3KUKA 2G6TA 4LTDA 4BLUA 1Q91A 5CLHA 3PWSA 3A1SA 3IEVA 2Q21A 1XNGA 1I10A 3H9BA 4WBNB 4RZ2A 4CTJA 1C1YA 1KJNA 1Q7TA 1LSOA 2WD7B 3AL3A 2PS3A 1J1UA 2DBZA 3M3PA 3UG6A 1JQJC 1NMXA 1VJTA 2ICAA 5CFLA 5KOIA 1TRKA 3K8QA 3ND7A 3TAUA 2V58A 2OPHA 3M1AA 5FNZA 5YASA 1GPBA 1SWVA 4CE6A 3DQQA 1NMQA 1OYVA 2VZ0A 1ZIYA 5CP8A 2GKOA 2F9LA 1OSNA 2GYYA 3EARA 4ECEA 1E18A 2FWPA 1IHXA 2AVNA 1QNLA 1KRHA 1ESNA 3TLZA 4AUNA 1SBZA 4DLSA 5I9IA 4LRQA 3OQVA 4F04A 3TGLA 4AZ0B 2VHJA 4GI5A 2X5XA 2DJ5A 3LZDA 3NOVA 5ILQA 2HNKA 1DJOA 2NTVA 3IKLA 2QW0X 2Q28A 5BSEA 1EJBA 1Q95A 3KZOA 2II6A 1A8QA 2IYVA 2ZS8A 4F60A 3ZK9A 4MVJH 1NXXA 3ED1A 1DIGA 2O0KA 3ETLA 4RA6B 4YALA 4J29A 1XKTA 1DU4A 3AW9A 4MNTA 4OKNA 4TTTS 1L7EA 1JUDA 3JY6A 3HCDA 3WYAA 2I2CA 2D0IA 3B51X 1XEXB 4D3SA 4C4OA 3DZBA 1KPIA 4RD2A 3JQFA 1IULA 3OTIA 1CLEA 2FUEA 1CUBA 3ND5A 1Y9AA 3HJCA 5F77A 3ZR4B 2IYQA 3C3EA 3EHDA 1Y48E 4JV5B 3NHZA 2Q49A 4GSLA 2DRIA 3W9UA 4C2AA 2PGNA 5HSGA 5TQ0B 1QGOA 4L8WB 2CVOA 1YAJA 2PVCA 2DSNA 1Y4UA 3WMGA 1Q0SA 1BS1A 3C5WP 3L8ZA 2IVZA 3JD2A 4HGQA 1A8IA 1JLMA 1IZYA 1R0RE 1JYSA 2QUJA 2VATA 3TCNA 1DAOA 4CEIB 2BGGA 4NZNA 4RAQA 1T2VA 4C9BA 1IUNA 1TVEA 2WWTA 2H06A 3H16A 3JQ7A 4M89A 2H1RA 4YMSA 5C3UA 3WFIA 1P7PA 3A1UA 5K4AA 2K87A 2XY4A 4JOSA 3NC4A 3ZD8A 4YXWA 4MWSA 4GPBA 1AO0A 1KMHA 2Q3HA 3KOMA 4UAGA 3RBAA 1X77A 3K5HA 4PSDA 2F8LA 4TWZA 4NBUA 1KKUA 3IQFA 5EP3A 5JD6A 3DDHA 1FUEA 1QKIA 1P74A 4KFCA 3QWFA 3ZIAD 4WINA 2EVWX 3FMPB 2B69A 1GITA 2C7VA 4KQ6A 3D9QX 3CRZA 4XZ3A 1HL7A 5C8XA 3PX7A 1J8MF 5HFJA 3MNFA 2O5VA 4U7PB 4LGMA 2P9TA 3JVEA 3LSTA 2VCHA 2BC9A 3VR5H 4CKCB 5L3ZA 2ID7A 3P2YA 1J42A 3WICA 3MN1A 1MVNA 4GYWA 4K9OA 4P9NA 4TYMA 5G0UA 4MB2A 4N7MA 3NHWA 4MMZB 5LQMA 1E6UA 2V3WA 1T10A 3CURA 3L9XA 3LLUA 3ZCTA 2E49A 2F8MA 1XCOA 2X19A 4B48A 4FMCB 3ZXIA 3ZLJA 2QSYA 4O1MA 3TJRA 5A4DA 1K89A 3FWYA 1WB5A 4C7JA 4F84A 3PFWO 2J30A 3RFXA 1PVOA 1CWUA 3B9PA 2NU8A 2NU6A 1B8NA 5A5EA 5AK5A 4Q02A 2MMCA 1Y33E 3O75A 3OE1A 2AZTA 3OZDA 3JWIA 2N42A 1E0SA 2JA2A 5BN5A 2CE7A 2HBZA 3ZQUA 4UFNA 1QKKA 1GLNA 2I1LA 4U2FA 3QV1A 1XTQA 4DAOA 3RD5A 1CY8A 5ENZA 3BL8A 1MEOA 2AD1A 4GGPA 4GRAA 5JADA 5KJ6A 1TJPB 3GA7A 1DC5A 3BHNA 1JDNA 1N7JA 4KPUA 1V5GA 2C1EA 5A9SB 5CCBA 3LRPA 1GAXA 1PZGA 3FRHA 4LZWA 4DV6B 1IQ0A 2POQX 2YJ4A 4DCUA 1JR4A 5J5VA 2YMQA 3ORYA 1JKFA 4HAIA 3PXXA 3NRCA 1GIAA 2P79A 1BGXT 4QVGA 7MHTA 3FAZA 1I2ZA 1ZJ5A 2D1SA 3PXDA 5AYVA 3SF8B 2HEIA 3V4SA 5DLYA 4A92A 4EKYA 3FNEA 5JXHA 4LZJA 3HP7A 4XAQA 4PRZA 2QSZA 1KFEB 5I3ZA 5JEDA 1HK7A 3OF5A 5FOQA 1FMJA 1SVUA 3DR5A 4BLQA 4EK9A 4ZZ1A 4R2WA 3UHFA 1IDOA 4GM4A 4ZT4A 4AKHA 4HMPA 4HWKA 2FFAA 2VP6A 2YZ7A 1PWEA 3CB2A 4GOND 3UMCA 1X1AA 3DMHA 4GZMA 2XQFA 3KTAA 1IBLB 5FNVA 5BMOA 1TAQA 2QQFA 3AOGA 4FN4A 5D86A 4TV8A 1V5IA 3ESZA 5E2IA 3TZQA 5K3FA 2DTXA 4E5KA 4CL3A 4JJ8A 3ZBTA 4B71A 3CSDA 2AHRA 4K46A 2FEXA 2ZWAA 3P9IA 2E4XA 3DE4X 4U2DA 2RHBA 5LCXA 3W77A 4RD4A 3Q8XB 1E2MA 3QKUA 4RKYA 4C7OA 3SHFA 2N9UA 4WKCA 3BFVA 3PPWA 3ZOKA 2GEBA 3V7UA 1IYZA 1F6DA 2D4HA 4RV5A 4QSHA 4MSUA 3OCJA 3SIRA 1Q0UA 5AFSA 3WAGA 4BQOA 4B73A 4UUAA 4DZTA 1QR6A 2HEGA 3MT8A 3P4XA 2X8LA 3QMMA 4DMKA 4KC0A 1H5QA 4TKVA 3PHIA 1YQGA 1KY2A 4EY8A 4TSFD 4RLFA 2VN8A 5ISMA 1D6MA 1J7KA 1M34E 2C5SA 3ABRB 4NBNA 2I4OA 1BYUA 4UASA 4KYVA 4AY4A 4BATA 2E85A 3IODA 5DTRA 3L5OA 4IGKA 4CT5A 2DTDA 1S4QA 4TKUB 5K8VA 3LKVA 3L05A 3P2EA 3R24A 4E1AA 3U56A 1T36B 1GR0A 1MENA 3ZI7A 1E9FA 2BVNA 5KS2A 3RODA 2YIJA 5F2OA 3UAVA 4JEMA 4ARZA 2OXFA 1IVYA 1E3TA 3K4HA 4BL5A 5I8ZA 1XNHA 4MUGA 3HACA 4DDVA 5E4TA 1OY1A 2R8EA 1EUDA 1QC5A 2JFXA 4X9XA 2XODA 3M6FA 1U0TA 4LI0A 4XH9B 4AAYA 4POOA 5FEUA 5KC9A 4BNHA 2ODWA 4B84A 3GEMA 1XA0A 4CMCA 2V5AA 3DYIA 5J3JA 2HK6A 2D00A 4DM7A 2YHAA 4G09A 2XWJI 4B6PA 1P1RA 1I6LA 3O4IA 5EINA 4BFCA 4NHEA 2FQ1A 4RL4A 4DEVA 4PTYA 1BFKA 1C0EA 2V9ZA 4AG3A 3P0IA 4BNGA 1I3NA 2PZKA 4QUHA 4BQEA 3T7DA 1D09A 1B41A 4KLNA 4OPMA 2JFHA 2BCEA 1PAUA 1ENPA 2NQ8A 3GDGA 5AKGA 1DEXA 2Y4NA 2QT0A 3ZG6A 2FETA 4HAYA 1VQ1A 5K3AA 3OICA 4UUBA 1HBJA 4D9KA 3KUCA 2I2DA 1VG8A 4JVLA 4L07A 5U1PA 2XT9A 4BB0A 4CG3A 16PKA 3NH9A 1QTIA 3PEEA 3QFCA 4OJNA 5KAPA 3G0HA 2AOXA 4OATA 5G3YA 2DUWA 1D1SA 3HR4A 1H1DA 2WF6A 3OKCA 4JJIA 1NZDA 2Y0EA 1QE0A 4IEEA 3JWEA 4UUNA 2GYWA 4EJMA 5IHXA 1OILA 2OV2A 1JN0A 1TF5A 1UIMA 1H2HA 3DUFB 3T12A 2Y92A 5EQJB 1P80A 1PR5A 1UMBB 2E4ZA 3CW9A 4U7JA 5AW9A 3VOBA 4KN6A 4RTKA 4D4IA 2GM4A 1ICIA 3DZIA 3SP1A 2XB4A 1AKWA 3EWAA 3OFNA 5FI1B 3RVSA 1MRSA 4B2PA 1PG2A 4DXDA 3B3AA 3QJGA 4E3ZA 3KSBC 1JQEA 2MSDB 2GBPA 4RF3A 1WMFA 1NW9B 3CCCA 4JLOA 1MRZA 2C42A 3IEPA 1GZ6A 1PDWA 2PK3A 3L0OA 2XITA 3JAKA 2YIVX 3RIYA 1G8KA 4AD8A 2QL7A 5EP4A 3FKQA 1NI5A 3LPNA 3BWVA 4IS3A 9LDBA 1RC1A 2J08A 2EZTA 3IHTA 2VK4A 4E3WA 4XPZA 1NSTA 1V7PC 4FFRA 4GI2A 5K2MA 1RHMA 5BWOA 1H4VB 1P39A 3EGEA 4F86A 2B35A 3RARA 1U3FA 4M1EA 1DIHA 2R44A 3P97A 4V0NA 4W1SA 5CTJA 5CT6A 4YYEA 1P2DA 2DVMA 2XD9A 4M0PA 1ZO8A 4PINA 3ZTWA 3NAGA 4EJFA 1Y1RA 4YP0A 1N2CB 1TEHA 3VPBA 2R8ZA 3LXMA 4IGAA 3WK7A 4HEA1 3RYFB 1Y89A 4PLCA 2JNWA 3GBVA 2R1TA 3LPCA 5KAMA 1H0RA 2Q27A 1WULS 1JDTA 2BGNA 2HPZA 2UZIR 1Y3AA 4OQQA 5EE3A 3UCEA 1P9NA 3ZX5A 2BKLA 3MT9A 5DHRA 1YRHA 1TOAA 5J4HA 4BQRA 5JW6A 2FMFA 1GKYA 1RYHA 4EB0A 2HYIC 4BO7A 3IUPA 1GU0A 3H5OA 2HF7A 4H3KB 2EKPA 1RAHA 4ME6A 1C81A 3ZHRA 5BSKA 3BAFA 3ND8A 4G81A 1KARA 3NHKA 1NUUA 4YPFA 5IAOA 4OP3A 2UUCB 1J8VA 5TC4A 3UCXA 1PWHA 3H9JA 4KSYA 4B46A 5FTLA 4QGBA 2PUGA 2N3ZA 3U44A 1P9LA 4EHBA 1XVAA 3HCFA 4E1VA 3PT5A 3H7AA 1C8BA 1SXIA 2MSKA 3IMGA 5KTKA 1SHUX 2I78A 2R6DA 1CZHA 1L7NA 1F2UB 1N6OA 3ANTA 1TEVA 4ID3A 4Q1DA 1ZMTA 5DLPA 5AKLA 4AJ4A 4GMHA 4BCCA 3AY0A 4X65B 1L4MA 3U9SA 2B20A 4QHTA 5JJIA 3K15A 1PR1A 1XVLA 4D26A 1XTPA 5LP6B 1U98A 5C4GB 4OHZA 4C4TA 1UDXA 1G3RA 5K0CA 1F20A 3HKEB 4ER0A 2VK8A 1CQJA 3HJRA 3SLRA 3WGIA 1WTCA 4GBED 4B2YA 1IE3A 2ODTX 4FYIA 3UC5A 2FPPA 4JZKA 3RU7A 1UBLS 4BU1A 1RLOA 3B3GA 3E6AA 4MH0R 4OJKA 5K0GA 4ZOLA 3QX9A 1DARA 1TU0A 2PJUA 2XVAA 5G4KB 3UB2A 5A62A 3FMIA 2QYSA 3FUWA 2R25B 3IVCA 1U5BA 4KFTA 4PRYA 2YWCA 2PSFA 1U3GA 5KTYA 3MQ2A 1WG8A 3V8QA 2CE2X 4KKXB 1MJFA 1MC1A 1EFPA 2CGEA 5CLQA 4YXWD 5A5FA 4ALIA 4DYHA 3ZHUA 4R7TA 3M4ZA 1UBCA 2IPNA 3OQJA 2WTXA 4EGJA 1W9MA 1SKUA 4FR5A 5CT4A 1M73E 3BF7A 3OM1A 3TOXA 1V35A 4P4LA 1KI7A 4X54A 1HE2A 3RT1A 4LXIA 2FKNA 3D3WB 2FP4B 5HWSA 5IASA 5K6RA 5HM6A 5CXSA 1FFXA 1FP2A 1GWNA 1I3LA 2AR9A 2GYUA 2EGGA 3EQ9A 3M81A 2RJOA 3QPDA 1TA4A 5F3RA 4BCDA 1ECCA 3OCYA 2VEDA 4ZZ3A 3H5LA 4PYRA 2ETXA 5FKJA 1FOEB 3B8HA 4CMEC 5JAPA 4GQBA 4EPXA 3P9NA 1S89A 2C4HA 4F96A 5LA6A 2NPIA 5FV4A 3K8ZA 1IZ7A 1EP2B 3KKQA 2CVQA 3H1BA 3VPSA 4INPA 2ZB4A 4FYJA 4IOKA 3OTHA 4EA9A 4DV2B 2FEWB 1NOJA 4ZJPA 1ZHOA 3OZSA 3AEYA 1ZMOA 3GRPA 4R98A 2GBLA 3KE9A 2EQAA 3O82A 5D1HA 2JK0A 2LBPA 3HA5A 4HAZA 5DJ5A 5E1MA 4PSUA 1R5BA 4ZARA 3ROZA 4BECA 2D3TA 2MR5A 4M9CA 1VLHA 4JB8A 4BYMA 4C1BA 3ZU2A 5FDFA 5EJFA 2TMYA 3JARB 3BCUA 3HWX1 3ZZTA 5BSFA 2XOKA 5IJ0B 3PPYA 2O7QA 4CCWA 1XPUA 3BD7A 1NRXA 5ALUA 1R37A 2Q4TA 3SKXA 4EGCB 5KOHB 4INOA 4PYQA 1BO6A 4J3NA 4ZGGA 5G0VA 4LFAB 5LFAA 1M5TA 4X71A 3ODPA 4CV2A 2ZT6A 4IJUA 5AHXA 4Z6KA 1QH1A 1ISPA 1GJRA 1LZKA 1GU7A 3AUFA 2J0VA 3GR6A 4BKQA 1QYDA 4JK3A 4K1XA 4C7VA 4ISBA 2MSCB 1DPGA 3HZHA 2CFCA 4O25A 1HL3A 3PF8A 4N3CA 5AW7A 3IV7A 1Q44A 3A05A 1G8FA 2QN9A 3I12A 1NNI1 2IIVA 3ORFA 4NPCA 1RYBA 1LPNA 2BH9A 1EZ1A 2NYRA 2WZCA 1TM4E 4TXHA 2QRVA 1NC1A 4HK4A 4F4DA 2IUTA 4OHPA 4X66B 3D6UA 2JAQA 3DAFA 5A4MS 5IUKC 2A0UA 5JCOC 4IVRA 4HZUB 3IR5A 2VBGA 2ZJFA 1ZMRA 3GHHA 2AR0A 2CFSA 3L1VA 3V6LA 2XGOA 2V7QA 4MQFB 4D57A 1J39A 4C3OB 4MV0A 4BMCA 2ID4A 4IP0A 8GPBA 2V7WA 3PIIA 1OJLA 3HCBA 1QFXA 3ITDA 3UQYS 4LVUA 3T8YA 3K92A 3EJWA 1VCMA 1AX9A 3B6JA 4JYCA 1UFKA 4KIFA 3T5TA 1AUXA 5A9RA 3A14A 4PM4A 3NEYA 1E9DA 2DR3A 2HSJA 3HRHA 1JEAA 1GFWA 2YS6A 2O2DA 2I2AA 4K6CA 3TR6A 4F8JA 3PJRA 4DF3A 2F3TA 1TCUA 1G2QA 4ZT7A 3W5JA 3PC4A 4G8BA 2EYQA 3PE3A 3A4YA 5KYXA 2GBFA 1VCNA 1ZGJA 1L7BA 3FTQA 3O84A 3R4VA 2ZWMA 1MGPA 1WL8A 3JS5A 4MCIA 4PONA 5SZKB 1H66A 3VH3A 4X90A 3UKJA 3AP2A 3EWSA 1USVA 4JLDA 4YPOA 3C3YA 2RONA 4A8JA 3HI6A 4BP3A 3AVVA 3LFTA 1B8PA 2BCGY 4KR6A 2OZLB 4QATA 2QNBA 1H8HA 2O0LA 3D8NA 3KZCA 1M1XB 3NETA 4WOBA 1YL6A 3G2JA 4RQAA 5ARCA 4B3HA 4QKQA 1SIOA 4DBVO 5K8UA 3HB7A 1USUA 1B0UA 3EUAA 4DDUA 3HR7A 5FWXA 1A7JA 1JA1A 2KLHA 1Z2OX 3CSSA 1ZK3A 3IAAA 3PE6A 4FYVA 3D8RA 4V38A 3VAZA 3MTBA 5AK3A 2Z4SA 5DMHA 5BN4A 3TOSA 4Z1MD 3KUDA 1QS0A 5T4BA 3ZHBA 4AN0A 3GF4A 4ZXPA 3JV7A 4DABA 3CJRA 2OGZA 2WJAA 3EZGA 4Q4AA 1ZGCA 3M4JA 1N92A 2GF9A 1RTKA 3CEHA 1ZPDA 1K86A 2ZVQX 3N8KA 1DIBA 1E61A 1IJBA 1OYWA 4K05A 2Q6OA 3EULA 3PPXA 4GD3Q 1ZKMA 4AJPA 1UBOS 2CEKA 1Z7BA 1JSZA 1HH4A 5JJKA 1Z15A 3JQBA 3ESQA 3HU2A 5HMLA 4CMJA 1IAQA 3BDIA 3DOIA 3ZE6A 1KR2A 1SVMA 5K0EA 3JR7A 3R9XA 1UAYA 2ZAYA 3BHIA 4EIWA 5A04A 3G0GA 3MPOA 4AYWA 4WXPA 1C8LA 3NNSA 1SQ6A 4N8EA 4TQUS 1CZRA 2OY0A 3SNKA 3EQ8A 2W58A 1FEZA 2A9PA 5F98A 1U7DA 4EHDA 4CCSA 2VQSA 1E63A 3N2ZB 3ZC3A 3TLMA 3RADC 2P2DA 1KQ3A 3TTWA 1GU1A 2QS9A 1C4KA 4B3FX 1B8OA 4ED9A 3UAOA 4AXBA 2V4UA 1DKRA 2IEZA 2R4UA 3I34X 3DPUA 1YI0A 3P96A 2QTZA 5BPHA 2C5GA 1MAAA 3P4UA 3EIQA 3ET4A 1D9ZA 3OFND 3Q15C 2K7FA 4KQWA 3GUHA 3KX2A 5LC1A 2WTMA 4DYVA 2E5FA 1V8PA 4A8TA 4TKZA 2IP2A 2X9GA 4ZAGA 2OV6A 1T1IA 1HV8A 3G5TA 3JQ7B 1W2WB 4LF7B 4HYYA 1RXIA 1M83A 1Z4LA 4HXFB 4KNVA 1U7HA 4P32A 1H3EA 4XGIA 2Z08A 1T8PA 4GS5A 4XVQA 2GNPA 3TR0A 2XUGA 3ZIUA 1KMHB 2QHXA 3ZK7A 5HF6A 5JOQA 4ZCQA 2UVQA 2HR1A 5CGQB 4FM9A 4UU7A 5LDGA 4B7AA 3N74A 4HQKA 1TTHA 3KK0A 3I9JA 4ZC1A 2FW7A 2V54A 4QXMA 2WWFA 3LQKA 3ZYZA 1UDBA 5E8JA 2OQRA 5FQOA 3HHEA 3DDUA 3H1GA 4IIGA 3O2SB 1J1IA 3BEOA 3CSUA 1DAKA 5CNJA 2E1PA 4O1HA 4AP6A 3V1TC 4E21A 4Q9JA 1AQ6A 5CNKA 4HLDA 2H8GA 1BWQA 2WHRA 1DLIA 5FO0A 3BE6A 3TLYA 1EXMA 2AN1A 3MJ4A 2HW8A 3O0TA 2Q4BA 2VXYA 3MG9A 3RTAA 2IYPA 2XZDA 4II2A 5CDHA 1RFLA 1QMGA 1K7SN 1LJLA 3JYOA 2NU8B 2NU6B 1C1HA 5G53C 3PLNA 3ACCA 1KI6A 4I99A 3WOHA 2X3YA 3QWIA 4K6GA 2FRDA 1UT5A 6PFKA 3L7DA 2BMJA 3BE4A 3I28A 1FTGA 1GO2A 4PEVA 3VKFA 4BKMA 2BW0A 3GOQA 3CH5A 1WEHA 3EK2A 1CULC 1CVLA 5BN5B 3HUEA 3HCRA 4L5AA 1YB4A 1DCTA 1FNBA 3HBAA 3VC7A 1CG6A 2X41A 2HU8A 2M6SA 4QXQA 1HA3A 2FB9A 4KPUB 3MYRA 4EM6A 5KJ1A 1AQIA 3GZ4A 2YOHA 1QYXA 3RVQA 1CNEA 1DOAA 1TW3A 3DVAA 3W6NA 1QHXA 3KEGA 4L5YA 1FCJA 1YVEI 5IN5A 1ISMA 1F06A 1NE2A 1QDUA 3L8FA 3QEKA 4US1R 3U3OA 3TH5A 1NUSA 2Y68A 3F3MA 4A4DA 1W6UA 3VVLA 1SKYB 2X4LA 2W22A 2XWPA 1VA4A 4PBSA 3FOWA 4TL7A 4M9QA 1K97A 1Q77A 4H3VA 2OHGA 1XCJA 3NG1A 4GO1A 5D8DA 4TS1A 1OXXK 3ZHCA 5KOJB 2HU5A 3AHHA 4K9NA 4YRMA 4KDRA 4RFLA 4XB2A 4AROA 5JV5A 2XF8A 3KTAB 2NLOA 2G71A 1K7EB 1Z0ZA 2QUBA 2FPWA 3QPAA 3R6TA 5FNVB 1L5KA 3WLFA 1K6JA 4JLJA 3TEFA 4B3CA 4TV8B 5JANA 5K9ZA 1ZAYA 3F6BX 5JS8A 2VF2A 3MUOA 1I5OA 4HMOA 3RSFA 1GTSA 4DQVA 5C5EA 5B58C 1AKTA 4D92A 1B4DA 3V4RA 4X93A 3UUWA 1U9ZA 3TQRA 1P5JA 1HM5A 3HFSA 4ERXA 4C7OB 1N5DA 4HDCA 1DUIA 2H1LA 3E70C 3E9EA 1F5NA 1E9CA 3PTZA 4XOUA 4DM3A 5DCLA 4ZJZA 3IA7A 1HYHA 1X7XA 1SXJA 3RQSA 4K6HA 3SFZA 4EJ0A 5I4KA 2AX3A 1G2IA 1WU8A 3PI6A 4LYFA 1W2HA 1GADO 2XB9A 1X0VA 3K09A 4FI3C 4HX2A 3STYA 3VZQA 2KBFA 2X76A 1AQJA 2D4AA 3F6YA 1J21A 4PYKA 4WN9A 1T3SA 1PJBA 3E15A 3K8OE 4NXNB 1RQXA 4O02B 1YS2X 3KAKA 3OT5A 1L3IA 3H75A 4GR4A 3N8NA 3PDWA 4B43A 4C7MA 5MHTA 1DS6A 5DKFA 3NKVA 1R9MA 1AD2A 4LSZA 5TVGA 2I6QA 3FOEC 1YVRA 2VJYA 4GYKA 3VUFA 1SUBA 1DG1G 4RVDA 4V3CA 3I5XA 4BNJA 3AXSA 1UF9A 5E4FA 1DXHA 2WAYA 1W4CA 2O48X 3HZRA 2JHAA 4OSPA 4UAJA 1MT3A 2B4TO 2PCLA 4ARZB 4CCAA 3QE9Y 2DEUA 4RVOA 2G0NA 4KWCA 5CD9A 3A6KA 4JLMA 1RRMA 2W6MA 3NGLA 4PAMA 2HYDA 4G63A 1VPWA 5JCXA 2HFJA 1EUDB 3KQLA 5PNTA 4LHSA 1L5OA 4BVAA 2FWIA 4I6GA 1X8LA 4DDMA 2G70A 5EIXA 3KSMA 1MC8A 1NXSA 3N7AA 4KH0A 1T2EA 4FD2A 2C1ZA 2CC2A 3M9WA 1ZH2A 5LQSA 1OPXA 3I04A 3OBIA 4RF5A 2VBIA 2YNMC 3ROXA 3LBNA 3V7FA 1MNAA 4EATA 1O2DA 1XOIA 3A9RA 3DFFA 3MJCA 3H83A 2K2WA 1EIZA 1O5TA 2YCBA 1G4HA 1EX6A 1KMMA 2XDAA 3BE5A 1QP7A 1ZFNA 2NSHA 3KVOA 3EDRA 5L6MB 4QUGA 3L0SA 4PCUA 4U7HA 1ST2A 1TI7A 5AXAA 1ZUD1 3ILHA 5AI6A 5TX7A 2REQA 1FRQA 2C9MA 2HOQA 2XR1A 1VSTA 3H97A 4UUQA 1P5FA 3T3IA 3CLRD 2O59A 1ACJA 4X1YA 4F71A 2DAPA 2QA5A 5EIWA 2UUBB 3Q9LA 4KNWA 2FWNA 5HJ5A 2JD1A 2I4LA 4W1PA 5C52B 4M7RA 3ZJYA 1Z2CA 2H63A 1Y7HA 3AR7A 2P6PA 3L7JA 4AZTA 4D8UA 1NMYA 4JBYA 3PYLA 2NM0A 3OSZA 3VPCA 5I7SA 1FVHA 1IG3A 3DE5X 1KEUA 1XCGB 3EWNA 2XMSA 2NYAA 2VHEA 1C7ZA 3ZXXA 1GN8A 4OQYA 1AHPA 3HUUA 2CXXA 2P9JA 3K9BA 3PB3A 4HGOA 4LF5B 4CV3A 4INJA 4LJRA 2R00C 5T41A 1QRSA 2GPJA 3I6IA 2V7QD 4KXXA 4PXAA 1DQYA 3B6EA 1AF7A 2QRZA 1VJRA 3TW4A 1J56A 1NBHA 5C37A 3LT2A 2BM9A 5ALPA 5KTNA 1Z2EA 1PR4A 2UZ0A 3PBKA 2IH5A 4ZDIA 3QM1A 1OBOA 4BWGA 4DNFA 2X86A 4MLPA 2CJXA 1YTLA 3Q5EA 3NJ8A 4OAPA 2IY8A 4KQEA 4Y2TA 5EXEA 2BCJQ 5ARBA 2EWVA 2CWWA 3MUFA 3RSGA 2W0MA 4AJ2A 4UQLA 1SK8A 3TX2A 5KBYA 1J5EB 1U7XA 4LCEA 3AWDA 2JCVA 2IY9A 4Y9RA 4TTPA 4PZDA 2CB9A 3EOZA 3E8XA 2DQYA 3S2YA 4LJ7A 1YD7A 3JD0A 1D7AA 4RKEA 3HNPA 1QP4A 3LPLA 1KP2A 1XKXA 2WSBA 3PKZA 4HQ0A 5BT9A 4RQBA 1VMDA 5TMEA 2XCTB 2Y77A 2G9UA 1C3JA 1H8HD 1RWKA 4ZQIA 3UFXA 4CUZA 1N5OX 2D3WA 1CFZA 3NIGB 1GT91 4P36A 1J7JA 2VNAA 1JSXA 5FFNA 3KJZA 5DYTA 2R1TB 5PGMA 2OA0A 5DK4A 4ZCSA 5HQJA 1XYVA 4F92B 1AMOA 1GPH1 2WTNA 3TPFA 2PGLA 4ZT3A 2I9KA 2CXTA 1DO2A 4CXMA 4LVOA 1W0KA 3VISA 2W8BA 3CZ4A 1KF0A 2J0UA 3AXTA 3VPFA 4M54A 3AUJB 2GPNA 3QVJA 3ZTTA 5DVZA 3I4LA 1RMTA 5AW6A 5AK0A 2ZTMA 1XZMA 2ZBFA 4JYMA 2VH1A 3UGTA 5CFZA 1I7DA 3AR9A 3K53A 4L9SA 5UKDA 2IHNA 3B5JA 2A84A 2D1RA 4GMGA 3LC7O 4OQZA 3D8HA 4US2R 2R6HA 1T2UA 2ZM6B 3L8GA 2W6JA 2D7JA 1YJBA 3U44B 3BXFA 2IBTA 4PICA 1G0NA 2OHHA 4LBZA 5EJ8A 1RYYA 4N49A 1Q6ZA 2C2YA 1R8YA 3DWEX 3HU3A 4FE3A 4NR0A 2Z6QA 2TS1A 3U9LA 1NQVA 1EG7A 1YVUA 4R1UA 2W48A 4PHTA 3IDOA 4XFKA 2PMWB 1F0NA 3KXIA 2AKAB 3B70A 4JQZA 3HFGA 5L51A 4RK6A 2YOGA 1J0BA 2I7TA 5FYDA 4C4YA 3RS7A 1CQJB 3QXGA 4X7RA 5FR2A 5ICGA 1F6WA 4IXDA 4UMDA 5IJAA 1TA9A 3EEQA 5DP1A 3EIXA 1PNTA 3CO5A 3FKSA 3DMTC 2CDNA 2FPPB 4KRYA 1U6IA 1HNNA 1M74A 3CCBA 3OZFA 4MVWA 4NL4H 1Z13A 3WKCA 4NSNA 3PQ3A 2B9EA 4ZOLB 3BMOA 4I1SA 1Q3TA 4DR5B 1G3QA 4EBFA 1JDPA 5CT8A 3MHTA 1U5BB 2GN4A 2Y66A 3GEGA 2O7NA 3NIWA 4GZLA 4TN5A 1DKLA 4QM7A 1K68A 4BP1A 4K03A 1P31A 2X0RA 4EUEA 5KVSA 1JB1A 2BGWA 4JP8A 1EFPB 3O38A 3WK5A 3LFHA 1WW8A 2FP3A 1VB3A 2PT7A 1EK6A 3PHHA 4KYTA 2OHFA 1RBZA 2XYHA 3LX6A 1G5PA 4WUVA 1EJ6A 3X1YA 2D5CA 4H9GA 3V9PA 4ATNA 3G9ZA 4JJ4A 2X0NA 4IFIA 4IDOA 2PIDA 4R1QA 4A2QA 4DMLA 4RHUA 3WO1A 4BBZA 3O4FA 2MYNA 2YXDA 4CL2A 2CLDX 4WLNA 3IVGA 4M22A 4JCCA 4DKJA 1EQ2A 2AC7A 1H2YA 1J8FA 4WKPA 4XQ9A 3FIJA 5IUJC 2IOHA 1RHRA 3A1TA 4O4LA 1BA2A 1EFUA 1Y8QA 1XPJA 4PZ0A 4B9EA 1MZVA 5G41A 4M0MA 3U7JA 2WTUA 5LA6B 2LD4A 3L8EA 2J4CA 2DU8A 4XD7A 4O4JF 4U3JA 1BKDR 4HWRA 3ZQ4A 5I5EA 1VDZA 1WDTA 5REQA 3ISTA 1JQBA 4IVNA 4E7PA 4WJLA 4AIRA 3K1JA 3II6X 2FZEA 4ER6A 1UODA 2R86A 2AMFA 1ZN9A 2ZBEA 2UXDB 1LNSA 1IY9A 3GPBA 2KLBA 4XWGA 1M6WA 3QEOA 5KNCH 4PYNA 4CHTA 2IX3A 1RMQA 1NF2A 2HGZA 3SY8A 2MWMA 2QPAA 1SQ5A 3P94A 1HE8B 1NAIA 1FBNA 2BEUB 3AR6A 3DDOA 4UHEA 4OP2A 1Q3KA 2E7ZA 1OA0A 3C7KA 3VZSA 4FB4A 4B3SB 3DOHA 4Q3OA 5FTKA 2I66A 3BN3A 2Q6IA 3R0VA 1JKMA 2AJCA 2XJ9A 3F2IA 5GGYA 5TEVA 5IMSA 4ZYYA 1A04A 5KTPA 2PUFA 5AVUA 2D5AA 1QH1B 5AUPB 1K3UB 1WV1A 1P1JA 3DEFA 5SICE 3BMNA 2AH5A 3O26A 6AT1A 1E8DA 4QRHA 2AHOA 3OZGA 4PGHA 4A10A 1ABEA 1SVNA 1XRNA 1WABA 2NIPA 3GAMA 2ILVA 2M9MA 3GJZA 4IO1A 4IOMA 5EOVA 2BFDA 5LB4A 2V7UA 3SZLA 2I65A 5SYAA 2UYQA 3FUXA 4H1WA 1LXCA 4JB2A 3WAJA 2Y67A 1G98A 1WLYA 2F48A 2GLTA 5CXXA 4F93B 5JSKA 1EFCA 4XFDA 5EZYF 4DG9A 5HMMA 5COAA 5T4HA 5B1DA 1EHCA 4RGYA 5GWXA 1E7WA 2VHZA 3MS7A 1PN3A 3WYBA 1U63A 4F2HA 1RRFA 2E48A 4DRZA 2ABWA 1YS1X 5F1OA 1WMEA 1JG3A 1WNTA 3DGFC 4LMPA 1AS0A 1F1BA 1RQGA 2Q62A 4KUEA 5EPUA 3D6VA 4LC1A 1GG9A 3FG9A 4F12A 2MCFA 1ID1A 3TTTA 3W1EA 3ZWDA 2B1QA 1OB2A 2OUIA 4EY7A 5KYXB 1N6LA 1SXJD 5LQCA 2LXNA 2O2ZA 4OYRA 2AGVA 3JATA 4TL9A 2WOJA 4XB1A 4E2ZA 4NAVA 2XOEA 5DN6D 1NVGA 4L3OA 5BQFA 4PQEA 3B9RA 4Q19A 5CCDA 3SXJA 3EMDA 3UAYA 5MFZA 2XGMA 3D0OA 5HF8A 4OM8A 3EBLA 3OD1A 4HDNA 2I9PA 3B1XA 3DO6A 1FJ2A 2JZOA 1Y8AA 1VYHA 3CXUA 3NDIA 3ETEA 2BFAA 2GPBA 1GFZA 4FZVA 4RFSA 5JQGF 5FWXB 2JATA 1R88A 1BDJA 1HDGO 1MF7A 5BN4B 5IABA 3TD2A 2VYQA 4R1MA 2PIAA 5J4KA 3RTDA 4X1OA 2P7HA 2YWBA 3NTQA 5HIIA 1OBCA 2UXCB 3BXEA 2C8JA 4Q4AB 4F0JA 1Y4ZA 2Y0BA 2AN9A 2WFMA 4HY3A 1UFOA 2ATVA 4IIDA 3PKIA 5NULA 4P53A 4WI1A 4ENTA 1XZNA 2Q7XA 4TUYF 4P5PA 2GQ0A 1T9GS 1DBPA 3C15C 2PCJA 4YTEA 2FW6A 1XYYA 5TGZA 2WWYA 1OD6A 3HMQA 2BT4A 4MWZA 4G1UC 2RKBA 3NUZA 3ACDA 3MM4A 1W48A 1NJ1A 4Z86A 4EB6A 1VYVA 4LGVA 1FY2A 2HCRA 5DM70 2A5YB 1RP1A 2F3QA 3GLKA 4YRRA 2C77A 4B6FA 4H7JA 3IIMA 1A9OA 3PXAA 2DWOA 2FWJA 4PAWA 4EY3A 5T3UA 2BAGA 2Z9DA 5KPJA 2FUG1 2G3YA 3GLUA 3OY7A 5KSOA 4R1OA 3JYNA 5AVOA 3GJ0A 4E5PA 4QU9A 5NLLA 2IE0A 3K35A 4H7DA 2HREA 2HH9A 4B44A 3I52A 4TXMA 2GZ1A 1QFJA 1ULHA 1JI3A 2CBZA 3DEAA 4KXYA 1S8OA 3D59A 4LDNA 3SOPA 3SSMA 4DCNA 5HJ2A 4HDRB 2JK1A 1KDRA 1TJNA 4N6NA 1MCZA 3H11A 2NU9B 4C21A 2NW6A 5CDUA 3MK31 4A0RA 1V9SA 4DHWA 4G56A 1T2CA 2ZZMA 2E55A 3EZXA 1GPAA 5KYWA 3D7NA 4WVLA 4GVPA 4HQLA 1YR9A 1SRRA 5DTQA 1MABB 2WMNB 1KJWA 4IPTA 3LUBA 2ZT5A 1FFWA 3O1LA 5CYPA 1WCXA 1B6SA 2WNHA 3L7CA 4YN3A 5B3JA 1MU0A 1NXWA 5CB4B 1IBMB 2GBIA 1VSQA 4U63A 2VJAA 3SJBA 4F5WA 4JP3A 4HAUA 2FW1A 3G13A 1XD9A 2FUKA 2O05A 5AJTA 1RW4A 3ZGXA 2W00A 1SEPA 1I3MA 3R5SA 1KH3A 3ZN2A 4WLOA 3WLNA 1ISRA 1ZAKA 1IN8A 2XNDA 4P3PA 2Y2VA 1L5NA 1NDQA 4Q05A 3LQ1A 2ZYVX 3T3DA 1N6HA 1ITZA 1W0KD 1ZUNA 3FR8A 4JVNA 2ZU0C 4RGVA 4RZSA 1RAAA 1KI6B 3W2EA 2FOLA 3C1UA 1Z33A 2C4WA 3FFWA 3BA1A 1VPEA 2COUA 4HDOB 5T67A 4BZZA 3ZZMA 3NHSA 1PLJA 3QXSA 3TZBA 4CMKA 4R7GA 4TT8A 4R1PA 4FUQA 2QSJA 3LUKA 4XUCA 5T3YA 2Y3IA 3FH0A 4LK3A 2P90A 4MW7A 1SXPA 1ZK2A 2QDKA 3Q8KA 1RAGA 4HQOA 4X84A 1HEUA 3C1OA 4K81B 4X3OA 4YGXB 1XO1A 2JGKA 4R01A 5H0IA 2E5LB 3E5HA 2FPUA 4TXLA 1X7HA 4IRMA 1KSGA 5HRAA 1HQCA 1Y7TA 1L1RA 1TUGA 1LVGA 4CQLA 5KNLA 4HVCA 4IZ6A 3DVAB 2WTAA 1LTHR 4EEZA 1GL9B 1RU3A 3WMXA 4MWGA 1CC1S 4KBFA 3R7WA 2X8BA 4N12A 1J2UA 3QWHA 1E9VA 4E15A 3L1IA 4HGNA 4A2CA 2OBBA 4CCYA 4XM0A 1M5UA 1WP4A 2PSJA 2EQBA 4FGJA 3U7EB 4JMLA 3KKMA 4XTRA 3VRHA 4OMCA 1XQXA 5M04A 4G0NA 4DLYA 4NLLA 1SCIA 3QIVA 3FKSD 1A2OA 2JFUA 1B2LA 1NYLA 3FYUA 2A7QA 2OE2A 4P3KA 4R0MA 5M3BA 4YAGA 5JXJA 3TTSA 5I9SA 3DFUA 4EG5A 1VSBA 4YR9A 3W6ZA 3IAS1 1ORWA 4HF7A 4NBVA 3BZUA 2ZIAA 2EWWA 5FTJA 1QRUA 1CUFA 2IXGA 2VAPA 4M0EA 4EUSA 2BFBA 2CKMA 2H57A 5K3SA 4U6QA 1B76A 1Y4SA 4HO1X 4HRYA 1D2RA 4JJGA 4WACA 4XIIA 3FMFA 1Y3HA 3WNDA 1XMXA 2VWGA 2QM7A 4QUKA 1CIPA 2AUMA 5D5PA 3WC4A 4TYPA 2WIBA 1MEEA 1X7XB 1SXJB 4KQJA 4QGHA 3GDWA 2QX9A 4XM1A 5H3CA 1U9YA 4D5GA 4HATA 3H5TA 4W99A 1GVHA 2AZDA 4FYMA 3EX7C 3OJXA 1MQ8B 1WRBA 2WSYB 4WN9B 4KWIA 3V8RA 4RTPA 1FMFA 1L4UA 3LUHA 3RHTA 2C5AA 3CVJA 3HZOA 5JVDF 2GDZA 2Q3BA 5LBUA 3WR5A 1YHYA 3O95A 2PX0A 1T26A 2FEOA 4Z9AA 3LRXA 1OX5A 4EHAA 2R9VA 3E9ZA 1UDRA 3G0OA 5JAOA 1FDVA 1Q84A 1N7HA 4MKRA 4TLAA 3OHMA 1L5FA 3B85A 3GEPA 3O8DA 4HYQA 3NPAA 1T0IA 2KSQA 5A71A 2H2WA 3ZY2A 1DC7A 1KJYA 4UZFA 1RM4A 4R31A 2QEQA 3MTAA 1G20E 3HJTA 5A3SA 3UJPA 2NSJA 1OZ0A 4EMSA 1VBMA 1P72A 2L0XA 1UPTA 2H4YA 3OZCA 4ZAZA 2FY8A 3I2FA 3QVUA 1YVPA 3BTVA 3LCCA 3C6ZA 5JYEA 2FEAA 3ONFA 1XCMA 5IMBA 1Z6QA 4EG4A 5EAIA 3WWPA 4F2GA 3O1IC 4JJ7A 3RS9A 1NUQA 5K05A 2REQB 3CUTA 1M2EA 4Y0VA 5K99A 2C7GA 2ECFA 1T13A 1XXHE 2DHCA 4JSYA 1T4DA 2W11A 2XCUA 4X1YB 4EABA 5I47A 3VVBA 5F1PA 1ZHFA 1I4LD 4Q82A 4HNHA 5A02A 4D3XA 2BFCA 2ST1A 2K2QB 4XGNA 4B8YA 4PR3A 5M2QA 2HF9A 3B1ZA 1GEEA 1RLIA 2CCGA 2Z0MA 3NC1C 1FFAA 4LOLA 4X44A 4BNZA 3KCNA 4UTRA 5JO9A 3FPEA 4JLNA 5K0SA 3PNPA 1AH2A 3PUWA 4PV7A 4Y2JA 3T7AA 3AG5A 2YXPX 2ZXFA 1UQUA 3AH8A 5AXDA 4DA0A 5BOSA 1GPNA 2DH5A 1YH3A 2OHXA 1BCRA 3PRYA 1CRWG 2H16A 2P69A 3KTDA 3KLBA 1PJ2A 1W5AA 2P3LA 4IWNA 3F9CA 4NZPA 1HFWA 3IR7A 4UTZA 4F4JA 4QXOA 1HC7A 5DCWA 1JMKC 4LFBB 1E79A 3L4BC 4UU1A 4ESHA 5CCXA 3H4MA 1W8IA 2NXCA 4C2UA 1VI5A 1SVWA 4BN0A 3ZDXB 1FSGA 2QRKA 3SOZA 3EXHA 4EFNA 4D6YA 3BIJA 3U48A 5IVDA 5K4HA 2GWHA 4KIUA 1KKLA 3AVWA 2OM2A 1Z83A 2OP1A 1XTTA 4LYAA 2OGWA 5C8DA 1Z08A 1BD3A 5GTDA 2YWDA 1RWBA 3CH4B 4KX5A 3WKDA 1GPJA 4FC7A 4BUZA 4ZVLA 2BBTA 3KQMA 1P1KA 4F6RB 1C29B 1GQRA 2D2EA 2W4IA 1BG6A 1H8EA 1ZSVA 1BKYA 3D0RA 4MV6A 4LRUA 2FU5C 1RRKA 5E9QA 5JUWA 3VC3A 1G1AA 1IEQA 1XDBA 2C4MA 1I2MA 4EG3A 1UBMS 4Q7JB 2W5UA 3L02A 4P81A 4QPZA 3EZYA 3HM2A 3UFXB 3F98A 2I3BA 2RD2A 2P9BA 2NYUA 1YZNA 4LFCB 3WHIA 3HYRA 3B3JA 3KS9A 1ORDA 1K6MA 2HA0A 4TQ9A 1XEFA 2ZYUX 3H0CA 3UJ3X 4EP1A 4D8XA 3U4QA 4GP7A 3T9AA 5DE3A 5TLSA 5HNKA 2QTGA 3FSRA 2J59A 1GUBA 1CKEA 2CJPA 4S0XA 4AJHA 4G1FA 3D2BA 3A0UA 4ZA2A 2XF2A 3QOYA 4WZ6A 2J3MA 1KAOA 4V24A 1X80A 2XDWA 5DX0A 1N6NA 1F5SA 3MWYW 5AJXA 4BNNA 1R0BA 5EKDA 1RPJA 1CY4A 1KERA 2JFYA 1G55A 2V1XA 5HDBB 4AJLA 2P4HX 4I1RA 2DC1A 3EDYA 3QXXA 5TARA 3NJ4A 5ECDA 4ZTBA 3KTOA 2GUGA 5CT9A 5K0FA 3L4EA 4L4SA 4A3SA 5HCIA 3AFNA 1JDUA 5DBGA 3Q87B 1U1EA 2NADA 3F7TA 3G9XA 3AVTA 2OCDA 2IPXA 3NHUA 1ZN8A 2BOVA 4O4IA 5AR1A 10MHA 1B3RA 5C1BA 3HKBB 1U1IA 1IB0A 1M2KA 1TU4A 3FDFA 4YV1A 2WM9B 1FFCA 3KPWA 1VTKA 3QA3E 1E58A 3ZE8A 4ZAFA 1MBZA 5FBKA 2IYUA 1WQ4A 1JHVA 1W76A 1U8YA 3KUXA 1YRLA 3PTLA 4R51A 3PJEA 5BR8B 1NNEA 1DRVA 1YUMA 2ZUBA 2XGGA 2FK7A 5JWHA 4BKPA 1QIHA