4KO3S

Low x-ray dose structure of anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
279
structure length
279
Chain Sequence
AKKAPVIWVQGQGCTGCSVSLLNAVHPRIKEILLDVISLEFHPTVMASEGEMALAHMYEIAEKFNGNFFLLVEGAIPTAKEGRYCIVGETLDAKGHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPAAEGNVTGSKSVRDFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPLLFFGDNIHENCPYLDKYDNSEFAETFTKPGCKAELGCKGPSTYADCAKRRWNNGINWCVENAVCIGCVEPDFPDGKSPFYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic [NiFeSe] hydrogenase small subunit
publication title Structural foundations for the O2 resistance of Desulfomicrobium baculatum [NiFeSe]-hydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 84
structure length 279
sequence length 279
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ko3S01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ko3S02
4KO4S 4IUBS 4U9IS 4UD6A 2FRVA 4GD3Q 4URHA 4IUDS 4UE2A 4UEQA 5JSKA 3AYXB 4KO1S 1FRFS 3ZE7A 4UQLA 4U9HS 5A4MS 1YQWA 1UBUS 1WULS 3ZE8A 4C3OB 4UE6A 1UBMS 3AYZB 1E3DA 1H2AS 1UBOS 1UBRS 4TTTS 5ADUS 4UCQA 4KO2S 5A4IS 5JRDS 4UCWA 3USCS 1WUIS 4UPVA 4UE3S 1UBKS 3USES 3CURA 4KL8S 4CI0B 4UEWA 3RGWS 5JSUA 1WUJS 4UPEA 1WUHS 1YRQA 1H2RS 4UCXA 1FRVA 1UBHS 1YQ9A 5D51S 3MYRA 1WUKS 2WPNA 4UD2A 3ZE9A 4UQPA 3ZE6A 4OMFG 5JSYA 4IUCS 3CUSA 5JSHA 1UBTS 3H3XA 5JT1A 5A4FS 4KN9S 1CC1S 1UBLS 3ZEAA 4KO3S 3UQYS 1UBJS
chains in the Genus database with same CATH superfamily
1KJJA 2H4WA 2ZSFA 2GM9A 4MUYA 1W87A 1QHNA 4NF2A 4NONA 2H29A 1G7SA 1FX1A 2WAOA 3E23A 1LX7A 4MYSA 4WECA 5LWQA 3H5IA 1PN3A 4HUQB 3ANTA 2V7XA 4GE3A 5KYGA 4O4JB 2CV2A 3HKCA 4OHFA 4UTNA 3AM1A 1BH2A 4LF4B 4HLUC 4EPVA 4ZK2A 5JYCA 2BTQB 4JGIA 3KHKA 5AKIA 3C7TA 2DBZA 2ZG6A 3TAXA 3WL7A 2C00A 3B60A 2HQRA 3ZH2A 5AKXA 1NIJA 5CW2A 2RBEA 5ALEA 1YQGA 3L0DA 4RGQA 3LQ2A 4EEZA 2O8BB 4HQLA 4YFYA 2V7QA 2C57A 2YX1A 3DPIA 3S29A 2QVZX 3BH6A 5E1DA 2OO5A 5TMDA 5BSFA 2C7PA 1UK8A 3MRTA 2RGNA 4D3ZA 3CSSA 1MRZA 1KSFX 2NSHA 3B3GA 3G49A 4QDUA 1HRKA 4FFOA 4YMTA 1DWQA 4LZAA 1CQWA 3OH8A 2R47A 4NAUA 3FAZA 4CRWB 5I7RA 1VL0A 3KLNA 5KYYA 4EY4A 1GZ3A 3NEPX 2XB9A 4FFBB 2OQ2A 4RLHA 1UBRS 3SJUA 4CUZA 2ZUEA 5ESWA 2PZLA 2ASVA 2RCYA 1OVMA 4BO6A 2PX2A 1DQNA 3PRYA 3FBWA 1N5JA 5E6UA 2GJSA 2IK8A 1SKYE 1JHXA 1JFLA 4QFCA 4RFVA 3N0WA 2W0MA 3EZ6A 2V96A 4OLHA 4ALNA 4JQCA 1EK0A 1W85A 3EIOA 5BV0A 1PK7A 1NRXA 2PU7A 1CZLA 2XEDA 4NEHB 1L5GB 6LDHA 2OORC 1NF2A 1MLDA 3AHHA 3D4NA 4FYVA 3JAMA 2J0EA 3Q87B 1RJ9A 3F8TA 2JAOA 3DMFA 4K6KA 1RJDA 5FBRB 4IHJA 5HE8A 4BP3A 5HKKD 1ABBA 3BKXA 1QO7A 5J4VA 4PHTA 5KHOC 2N3ZA 3GW8A 3IELA 1P7PA 2J5KA 2IH5A 2IX9A 4U2KA 4P7FA 3RGWS 2JJ8A 3U6BA 2IPOA 3GFTA 4N5HX 1EJ0A 5DHTA 4N5DA 1GTSA 5D3MB 1ADGA 3GZNB 2PRIA 4GX0A 3PYMA 3HI6A 3DO6A 2R8EA 2H3HA 2MDTA 1TQHA 1KMIY 2GH1A 4ZQCB 1V43A 4LJSA 3WLSA 4QHSA 3GLFB 3O8QA 4CG0A 2QX4A 1VCMA 4Q00A 4CM5A 1TEZA 4BJ1A 4NJEA 3CSDA 3LXXA 3RS2A 1DPGA 1KARA 2QV0A 4DUYB 1RI4A 3JYLA 2CMFA 4AZTA 1V71A 1EZ4A 2C2BA 3OU6A 4X7BA 3EY4A 4DZZA 4MSUA 3CQ9A 5HEKA 2Z6VA 4J0IA 1WBBA 2REQA 3BK1A 2PANA 4GC9A 3IOEA 5DNUA 1ZHOA 2QZ4A 4I50B 1R6TA 5JBIA 2GBLC 2IYTA 4OQDA 3PA8A 4PPNA 3BAFA 5C8YA 4Z54A 5KX5F 3JTMA 3NOXA 2D1SA 5J2TB 5CEFA 3LHKA 3GEBA 5K4HA 2LRHA 2Q2VA 4N6OA 1Q74A 5FUYA 3CR7A 1Y81A 1AUVA 2JFHA 3K8OE 3ZXUB 2FKAA 2WDZA 3OT4A 4KBFA 4Y1RA 4PSKA 3QQ5A 1PD1A 3TRIA 1U7DA 4DC9A 1W8DA 5BYKA 5U4QA 2WQ7A 2WE8A 4NARA 4BRSA 4HL6A 4ZEVA 5CLIA 3GVXA 3ETHA 4I4NA 3FFAA 1FP6A 1HQCA 5ES4B 4NNPA 3O93A 1GO2A 4GLLA 1BWQA 4DLKA 4Z4QA 5LD2C 2O05A 2DHEA 1H8HA 3LQ1A 4EG0A 1DG1G 2ATIA 2WNHA 1E7WA 1ULBA 1UKZA 2BFMA 2BMFA 2C4MA 2XB6A 3JYHA 4IRUB 4NH4A 4WH0A 1SXPA 3DL0A 2WM9B 4QUAA 1YS1X 4K86A 4KGDA 2HPHA 2PT5A 3VNAA 1LQUA 4DCMA 5KB3A 2OBFA 4LQCA 2POQX 3EQ6A 4CWAA 5I01A 4W5WA 5FOVA 1THTA 4M1QA 3QY0A 4QAJA 4EUFA 1AZWA 5L40A 3P2MA 2HLHA 1ZJZA 3PRJA 4J4BA 4ZCIA 1HDIA 1SUCA 5F21A 3ZR4B 1RI5A 2CLFB 2Q8NA 3SHQA 1CR2A 4HG2A 4M89A 4BFTA 5LFAA 2MSKA 3RT1A 4A6XA 5FA5A 1EX6A 3INYA 5EUCA 5BQ5A 1E6UA 2O2HA 3GEHA 4PGHA 4TWIA 5H3LA 3IEVA 1VKJA 1SCQA 4HEHA 2IZ0A 2C3UA 2EV9A 1U6KA 2GN9A 2O14A 2XWSA 1L4NA 3ZTTA 4MCIA 6Q21A 1OASA 2E0IA 4PXAA 2VT2A 4TV8F 4L51A 3WK9A 4YCLA 5JJCA 5JU6A 1RHKA 3PYLA 3U9SA 2Q50A 3IJ5A 4J0HA 3DB2A 5F35A 4B43A 4RESA 1ZGGA 2NLOA 4MRMB 2P2YA 2O23A 1SCUA 1I4TD 2PA3A 4JLSA 4MKFA 1UUFA 2K7FA 3MJTA 4NS4A 1XZQA 1AH2A 2IYZA 1DKLA 1MUUA 2B1GA 4Q6BA 2QY6A 5ICFA 2ZTUA 3VXKA 4C14A 2PLFA 1GPAA 1R37A 2Y6VA 5JAUA 4XDGA 5F7ZA 2G76A 5CFNA 1TC1A 1R8XA 2HO4A 3PUHA 1GXSB 4GI2A 2Z58A 4INJA 3KWMA 4PAGA 4PLWA 3ZDDA 1NZFA 1P4JA 2NZJA 1WY5A 4Q39A 1K98A 4XYMA 2ACVA 1C2YA 2EFDB 3STXA 1U8EA 2AR0A 2VAMA 4HI0E 3FDXA 2GGSA 2PJRA 5KSYA 3VO8A 2IH2A 3COVA 4FYMA 4MYDA 1KAOA 2Y9PB 4DLYA 1CR0A 2FDXA 1KZ9A 1I6WA 2F3PA 1YZLA 2TMKA 3QENA 4HUTA 3C5HA 5THQA 2LV8A 3STVA 1RWBA 1XSEA 1KPGA 4R2XA 5B3JA 3V97A 2H2WA 5HX7A 2Q3EA 3THYB 1E2UA 4BLQA 3IB6A 1W93A 5BNWA 5B7QA 1MD9A 2H2AA 1KIFA 3L4JA 2X6QA 1BQ3A 1M1ZA 3RVKA 2H1FA 3C3JA 4BGDA 5DX8A 1VBNA 1TUGA 4CMIB 5BSHA 1M10A 5JSFA 1VMAA 1FE8A 1GNTA 1HDCA 2XD4A 5KS2A 3FYDA 1UFRA 4M54A 3ZGZA 4E4RA 4M36A 5CJPA 2R1UA 3MBKA 2UUPA 2VNJA 3KM0A 3E27A 3J81A 4DWWA 4Q3DA 2QW1A 2P27A 5BWMA 1CF9A 3Q7SA 3FCEA 5FT9A 1Y3FE 4MUJA 3GJZA 4JMLA 2CMHA 1VCIA 4Y7CA 2ZYVX 6ABPA 1OH8A 2UUAB 3F5QA 3GOHA 1H42A 1CNEA 2B8WA 1I4OA 1IJEA 2Z95A 1T8RA 3W8FA 2FRVA 1YNOA 5DN6D 3WMGA 4GPTA 5ALPA 5AK6A 3VGJA 2Z57A 4ZAZA 3Q8XB 4TKUA 4U3JB 1PUXA 3E03A 1JBQA 3OQVA 3R7WB 2W93A 3GF4A 4FN5A 1N6PA 4CMAA 1KEWA 4RAQA 4ZCRA 3FCAA 3U37A 1OLSA 3UATA 4QXRA 5JD4A 2GN6A 2JRCA 1X7XA 2QPAA 3Q9SA 1RJEA 1YE8A 5F5XA 3WYFA 1ONPA 1YA4A 4RZ2A 3R3JA 1JEJA 3W04A 4AMBA 1V45E 2ZJ8A 2AOVA 1T5TA 4Z86A 4EA9A 2UYCA 1AQYA 1FJHA 1SWVA 1PJQA 4OFZA 1PK9A 3R3UA 3DT6A 1E3JA 5H4HA 4DNXA 5E7QA 4G65A 4JXJA 2P9CA 2D3TA 4DA8A 2JVJA 5C46F 3X2SA 4RM3A 1BMFA 5IANA 3VR6A 1RTTA 3DXYA 1JDPA 3GJXC 1WU7A 5KYNA 4ZCQA 2GD2A 2WJHA 3AUYA 3FZQA 5EKSA 1SG0A 3RS4A 4ADSG 4DIEA 1PV2A 2ZM6B 2V6GA 1BDMA 2A0KA 3MRVA 2Z83A 1MIOA 4OFWA 2W98A 3WLJA 2I2XB 4URFA 2C0PA 3OOJA 5E1OA 4EP1A 8ADHA 3G02A 1E3SA 2JGDA 3KV3O 1UDRA 3ZDFA 5IYZB 3D6JA 4CLOA 2ZSUA 3OHPA 1MJFA 4TTPA 2A4MA 1NJGA 4LI3X 1W30A 2HSGA 3KJXA 3S2ZA 5ICEA 2TECE 2WVHA 1FU4A 1IN8A 1E9EA 1EBUA 1IHUA 1ZA1A 5CURA 4EJ6A 3I5YA 3ZE0B 4M9UA 2JDIA 2VCYA 4OKIA 3COZA 1G20A 2CBZA 3BK7A 3ETNA 4DMMA 5JVDF 1DL5A 1PDOA 2XMQA 4LE0A 1FVHA 4A6EA 5DNCA 5AVYA 5A7HA 2QRHA 5JCPA 1JPVA 1M6WA 2ZZMA 4KKVA 3PX7A 2PZMA 1I1NA 3STWA 3U3XA 3V4PB 2R8YA 2ZRIA 3DXXA 2FMIA 4MDYA 4Z9YA 5H70A 4MP8A 5DLDA 3B51X 5JNSA 1V6AA 2I3AA 2R5WA 3EGIA 4P81A 1A1VA 4B33A 3N2EA 1W1UA 4HQ0A 1UDBA 1WUTA 3HO8A 4JLKA 2IXBA 4V0OA 3DE6X 2BFEB 3D81A 4OJMX 3VOBA 5A1JA 1EUDA 1F2TB 1D9ZA 1XMVA 3O3NB 3ZQKA 5B7NA 4MR9B 2P2GA 3MAAC 3RBXA 3WIOA 4BNZA 3DHEA 5LP6F 5CPFA 2J31A 4EMBA 4MP6A 2WSBA 1EMDA 4CM3A 3V32A 3ILXA 3IQGX 1URPA 2Y1LA 2ZKLA 2ZTLA 5ED0A 1YB4A 2AFHE 2NTVA 2EKQA 3VVLA 1VBKA 2OCDA 1RZRA 1D7AA 2H92A 1QB8A 4UVEA 4EKEA 3ICQB 3ZI4A 1DGQA 3A9VA 3EFBA 1M34B 3QEOA 4H6PA 3K0AA 4GVXA 1JX6A 3DDWA 3W2TA 4BXOB 4CM4A 1R8QA 2QPOA 2BMAA 5AM3A 2QX9A 4U8HA 2Q7XA 3KUCA 4LSWA 3HDTA 4GXQA 3T9DA 1YCDA 1EP3B 4W5NA 3K9GA 2CDNA 1EDEA 2X9GA 1PBTA 3FPBA 1VLMA 2QENA 4CMHA 4E2FA 3UPTA 2IRWA 1Y5MA 5BOSB 3UMBA 4BQFA 2A9JA 1NXTA 1UBLS 1ULUA 2WABA 2ZRQA 2X8LA 3IAHA 2H11A 3UK1A 1V7ZA 1M8PA 1OHHA 2I6QA 4WOKA 5CUQA 1KYYA 5IVDA 4MQEA 4N0EA 4U9IS 1HLDA 4GSYA 5JQGB 1TU0A 1ZM7A 3CJQA 1ODCA 2J9FB 4YY3B 1U6JA 1XLTA 4NXMB 2G25A 3LZCA 3H5AA 1LPPA 3OZTA 5FLKA 2X19A 1II9A 1S8OA 2ZUVA 4N12A 5A6SB 3PGA1 5J5AA 3ZUGA 2EP7A 1O1YA 3QKRA 1RLJA 3QMWA 3X1WA 3QEAZ 2NMVA 1F38A 3UMJA 3LUGA 1ZVJA 2C4TA 5GJCA 3FJ1A 4ZJUA 3X1KA 1BKYA 1FPMA 3QLJA 4TMKA 3TZEA 3VBEA 2NTYC 5JDIA 3PPYA 3RADC 3EVDA 2OG2A 3WB1A 5BQOA 1AURA 1Z88A 1ZC3A 1F48A 2H4YA 4TYPA 2CSUA 2DFPA 1SBQA 3B6JA 4K2AA 2X8AA 1CR6A 4V1CB 1EWVA 3DHNA 2HZBA 4JB0A 5CVDA 3TR6A 5L3SB 2JH3A 3ZIUA 1GA4A 3PPVA 2Q1YA 1E8DA 1FQWA 3OU7A 3RWMB 4QICA 4AIIA 4Y98A 3EIEA 4H7HA 1J8DA 1KEPA 3K5IA 3M5WA 4NCNA 4YJHA 5FHQA 1ZSNA 5ULLA 4M49A 3BXXA 5I9SA 2FUG1 4JI4B 1KGDA 3W5CA 1JSZA 1Q0SA 3DEZA 2JFVA 1LBIA 1M2OA 1GQSA 2BKUA 1BS1A 1KU6A 1CE8A 1VE6A 4P35A 3UMRA 4CF4A 5A9SB 5JD3A 1OC2A 3O3MB 1E1NA 3BGVA 1PEAA 2JLQA 4PO9A 5IT4A 3T1OA 4Z49A 4UM7A 2AJCA 3D5EA 1QIFA 1WO8A 2ZJBA 3PP8A 1UQTA 3EXIA 4AF8A 1Z0DA 4FCCA 4TKZA 2X1VA 5FPKA 4TT8A 4DRZA 2R0QC 3P9ZA 4RVOA 3DMTA 4B79A 3QJ5A 3EG9B 2CXOA 4DNPA 3AI2A 5KUTA 3RRFA 4YIKA 1NJ2A 3HLTA 4JI2B 4WBNA 1RRKA 4WFIA 4DKJA 2IYLD 2JLAA 2PUCA 5FB3A 2YXNA 3PGKA 3QFCA 1J9GA 3NC1C 3R5SA 1NZJA 1Q0PA 4KHPB 3NR2A 3IQDB 3EGWA 4F2HA 2P41A 4ZYUA 1TZBA 4LI0A 4KYTA 5TQ2B 4LKRA 1WSBA 4P3NA 1N8TA 4KQ2A 1CSEE 3TZKA 2FEMA 5D51S 3V33A 3WL5A 2MU1A 3OZWA 1O03A 2WUEA 3KLMX 5DM2A 4XD2A 4LOLA 4FONA 4UMDA 3GLHA 3VTZA 4MKRA 2KSQA 2GVNA 1XZEA 5FYQA 2E5WA 1CP3A 3KXKA 4WA8A 1ZH6A 5HE9A 1KEUA 3IGFA 1XRRA 2C29D 2J0UA 4J0KA 2YV5A 1B93A 4FYJA 4D3DA 2C54A 3H3XA 1KDYA 5A7FA 4R5MA 4HSGA 1A88A 3EXAA 2OO7A 3EXEB 4HN2A 1RJWA 1DOZA 2ANCA 1OBHA 1AKUA 2GOYA 3SAJA 4RMJA 4DDTA 4MIOA 5BN4A 2C8VA 1AQUA 4C04A 2Z3WA 3WWZA 3NDIA 5PNTA 5DP2A 4UD6A 4UQOA 2OT3B 2BRUC 1YR9A 4IDOA 2QLFA 3TIIA 2D8MA 3AR8A 4QNNA 1G3RA 4RZIA 3E1GA 4BU1A 2P6UA 2D7CA 2GFHA 2WWVD 3ABIA 2AMLA 1K8YB 3N59A 4DLVA 4FGSA 2KX7A 5CD9A 1PGNA 1P61B 2QLBA 1P7YA 3E22A 4EFLA 4UVGA 4B6GA 3TECE 2HDOA 5LD2B 4LJ7A 1GY8A 4CLEA 4Z9AA 3SQWA 2Y99A 3W5AA 3MQFA 3BZUA 1EVLA 4NPCA 1Z2EA 3PE3A 1FLNA 1L1RA 4LF7B 1R5OA 4JC5A 5B12A 1ETHA 5I7SA 5LOVF 1K5DA 1U8TA 2EQ5A 3A6LA 1HOTA 2LP4Y 1BD4A 5C3UA 3GLIA 1NV8A 3P5BA 3R9KA 3WLRA 5BSEA 1XU9A 2NVOA 2J1LA 1ZUD1 4IWXA 3TTTA 2QTNA 2VJKA 2SKDA 10MHA 3CN7A 1XELA 1V5FA 5IUNC 3MUOA 3CIOA 4K9KA 5ITVA 5K0EA 2I3BA 3ZXSA 1S7GA 5DKFA 1Q1BA 4O8ZA 2FZGA 4ZQHA 3CE6A 4MUFA 1VDMA 1KQGA 4QPPA 1M2GA 1COWD 3OIVA 1SOAA 4UCWA 2RI0A 1FU7A 3UPUA 3KLPX 3VPSA 5DK4A 2QU7A 2V4MA 4RVFA 2FGJA 2AQ8A 2C7VA 1NOKA 2JIQA 4G1EB 1ZFNA 1SU4A 3LUPA 1XMOB 5JFTA 1DBSA 5FDFA 1F06A 1WQ4A 4TQGA 1BCRA 3D8SA 4G0QA 5KWIA 2Z1DA 5LUAA 1C14A 5LLTA 3VPDA 2Y6UA 4PLZA 4M1TA 2GR9A 1ZOSA 2A59A 1A77A 1L8LA 3G5AA 1QLHA 5DIFA 1LBEA 2GF0A 2YV1A 3VC2A 3I2IA 3W3AH 4NS1A 4PG8A 3AU8A 4UVDA 3RUPA 4EEKA 2ZYUX 3G1UA 2GCOA 3OE5A 4BLOA 1YRLA 1TF2A 2PBZA 4BFXA 4DLNA 2I4NA 3EVNA 1XDSA 3C5EA 4HCJA 3ZDQA 2UZAA 1N3BA 4QYIA 4MTLA 1CU1A 4G89A 2HBYA 5TT1A 3X0DA 4YDHB 4LSZA 5J4KA 4F71A 1R0LA 2OBNA 4G36A 2H00A 3ZXXA 4EH1A 4LBWA 2OV6A 1AK2A 4JXKA 3SJBA 3T5TA 4C4AA 4CDMA 3CTPA 4CIAA 1OXSC 3HYNA 4FKMA 3WQBA 3NTQA 3KOZA 1HURA 2QS9A 1HT2E 2RJNA 3Q9LA 5FHRA 3GPLA 4H1TA 4KG7A 1JL3A 4H7DA 4IEIA 3OX3A 4D4KA 1XRQA 2BFAA 4DUGA 4K6CA 2VWHA 3E8MA 3K1YA 1W2GA 3ONDA 2AQKA 2B2XA 4OHBA 5AK4A 5FWAA 3V48A 4GL2A 3ZE9A 4I8IA 2JFUA 1Z0KA 4QYMA 4PZ9A 5EWMB 5FWYB 3I5AA 4MR8B 1Y9ZA 4CLDA 5L6LB 4MLDA 1M1YE 4Y3UA 5AUQA 3ZD6A 721PA 5GIPE 1Z0IA 1CRZA 1WR8A 2H2IA 3A6EA 2PEZA 2XZTA 2B4QA 4JBIA 3LWZA 4MRVA 5B5SA 2ZS8A 1TT5A 4IVRA 3CKLA 2A92A 3G2PA 4MVJD 4X85A 4NK5A 3REQB 4LVOA 3UB2A 4D8UA 5JAZA 1JSRA 3NIFB 5A4FS 2KW5A 4BFWA 4MWGA 4OGFA 2Y77A 4QHYA 4E33A 2QGFA 4CDRA 1FJXA 3JWIA 3O74A 4YMLA 3SHOA 1JPJA 4RE5A 4WKBA 1SIWA 2YY7A 3FLAA 4FSHA 1GV0A 1DC7A 4DMUB 2R65A 1EDDA 1FQKA 1SVWA 2AVDA 1RAEA 2WJ6A 4KQKA 3HN2A 5JROA 3K0CC 4IIJF 3SQNA 3BDVA 3UV6A 2QMEA 4R2IA 3DZBA 2XAAA 3UJDA 1TVMA 1OZ0A 3VU1A 4MKGA 3GPIA 4CKYA 1EUQA 4OX9B 2FVYA 4BFCA 4C5CA 3PQ4A 2YWFA 4LTNA 2P7HA 4EYEA 1P81A 2WSMA 1EG2A 2ODPA 3M9XA 1D2AA 5KWEA 3ZZ0A 3F98A 2XCOA 4GEGA 4QOIA 3URMA 4OYRA 1GVHA 3RRNA 3T5AA 2PMWB 4MK4A 2PIDA 3HBAA 4Y2SA 2C4KA 4FHDA 4EHLA 2NAFA 3SC2A 4LVCA 4MITA 3CPHA 4RK0A 4LJ8A 3LUHA 4E94A 1NVAA 5ED4A 3CH7A 2IP1A 2VK4A 4Z8XA 2ZUWA 2PKQO 2EFHB 5BSGA 1AZSC 1T4BA 1HL3A 2OYSA 3HA5A 3GCZA 5AUNB 4JI3B 4TTTS 3F74A 2PA0A 3AY6A 3IQEA 4IJUA 1EFPA 2HQBA 3V80A 4EO4A 1LC3A 2HUNA 1LX6A 3K31A 3MTIA 3ONNA 4TV9F 2IXFA 4NICA 1G2IA 1XL0A 5GADl 3BT7A 1ZOPA 2JEZA 3SXUA 3VR4H 1L7XA 1T5BA 1CUWA 3CRRA 4RXTA 3SIRA 1J90A 5DTJA 5DYYA 1T4CB 2YZ7A 3KYDA 4HDOB 4ZD6A 2WTMA 4KQ1A 4BGEA 5CYGA 3A4IA 3CVUA 4JP5A 3RV3A 3R8FA 2EC5A 2HHLA 5F3RA 3FRJA 1D4ZA 1W5SA 2VQ3A 1WVGA 4TMVA 4B5KA 3LVQE 4IV5A 3UN1A 1JEQA 1W1WA 3HR4A 5CLHA 1UT8A 5BVGA 4PNPA 3A11A 1JQJC 1B0AA 2I80A 3PC7A 1P91A 3HVIA 1FPQA 1PJ8A 2UZ1A 1KE1A 1NMYA 5GAJA 2EKBA 2WP0A 3W5SA 4EGFA 5FUQA 4B40A 2CNWD 2IPMA 4DGQA 4BX0A 5JTTA 2HU2A 2ZYSA 4K1LA 3ONWA 4MWZA 1C4XA 3SOPA 1VPEA 4BQQA 5H3CA 2PO5A 2IHZA 3PGXA 4QBTA 3SZGA 3EDQA 1A7JA 4OA8A 2NSLA 4RK4A 3OZUA 1DX9A 4W6QA 1XALA 1M2EA 3IOBA 1A5AB 3ABZA 5JMPA 3WLMA 5F23A 4PZYA 4UKDA 5K6TA 2WU4A 3WTCA 1CJUC 4EA6A 1QRUA 5BRJA 2QD3A 5INTA 1G8AA 1CBUA 1ZGAA 1MKYA 3B6MA 1EFVB 3EWSA 4KWEA 4OCZA 4W99A 4B75A 4BV3A 1JDZA 4B9EA 4ZXPA 1QVAA 1Q5PA 3A6FA 4P54A 4LXQA 3S28A 1QG0A 5ICSA 4FB4A 2R68A 1JR6A 1N2EA 1THMA 3GCGA 1NNEA 4BEBA 2ZJ0A 1FTGA 3OJWA 2QR5A 1KKUA 5CD1A 1AK1A 2PH3A 3DHYA 3GRVA 2TRSB 3HI4A 1PCXA 1X7ZB 1XEWY 3D8TA 4MEJA 1QOPB 3UJHA 3AOEC 3L1HA 2HMYB 3NGXA 2AXQA 3H4TA 2XMBA 5H02A 4ZFNA 2XCRB 1O94D 3FRHA 4Q3CA 1D04A 4C7OA 4QXQA 1FNNA 2ENWA 3RTAA 1T3SA 3SX2A 2ATXA 2A5LA 1NBIA 1HE1C 4QJBA 4Q82A 5LA6F 1IXYA 4WKPA 5HG0A 2WTXA 3EGXB 4LRUA 2MCFA 4QREA 2I2CA 1H9BA 3K6JA 2N47A 3PXAA 3UKDA 3H04A 1EYZA 4TQUS 3VDRA 4YI3A 3L7AA 3T5MA 1BA2A 3U0VA 4ZARA 1LV7A 3I53A 1SULA 3SZUA 4TOIA 3LCJA 5FV4A 5LYJF 1QS0B 2PUJA 1CUDA 3AVTA 5CTAA 2D54A 2IVZA 3IPRA 1X1TA 2PVSA 3LVFO 4FEAA 5JH7F 3D6VA 4DEXA 4IM7A 4GMXA 1W5FA 1MQAA 4N3BA 1XWWA 4OUKX 4QQFA 4KMRA 5ECDA 1ND5A 1IY0A 2FSVC 4HNAA 4G9BA 3CE9A 4RO0A 1NU8A 2VXCA 2IV3A 1M75A 4E1BA 3AZPA 2X8JB 3KL4A 4WXRA 3ZD8A 4NATA 1E6EA 1VKRA 4IDNA 1JKJB 4EB0A 1PFKA 4KV9A 3AHIA 1EAYA 4FOPA 3KOYA 3N8GA 2OC4A 3H9GA 2IPAB 3L2OB 1KJZA 1YBHA 3OQIA 1U2GA 2IHBA 1BOOA 4ID9A 3NAZA 3OKCA 3GLRA 2B3TA 4TUYF 2WUWE 3HJTA 4N5LA 1ZK1A 1YKGA 4U2CA 2Q4DA 4ZYWA 3LHSA 4G26A 2HJVA 3VSDA 1ZNXA 4DYVA 2ETXA 3PKJA 4GPEA 3SCZA 3TFQA 4EF4A 2WILA 4GKVA 2NZXA 2MWMA 1DKMA 2PK3A 1TFRA 3LL7A 3INTA 4DQ0A 4M0KA 1AUXA 2GM5A 4HX2A 2CE7A 2LR0A 1DJLA 4P4SB 4EATA 3GJ3A 3RFFA 1CWUA 1JHRA 1NXXA 1OE0A 1SN7A 2I4MA 3AJAA 3H2JA 3PWSA 2ZYGA 2WK1A 3TW8A 3D43A 1RAFA 1IEWA 1Y8RB 4FHGA 4JC4A 1GSHA 2N0SA 1AY0A 3B9RA 4N18A 1GSOA 3SR4A 4YAUA 2CLEB 1EP1B 2WYOA 2B25A 1M0TA 1ESDA 4N7JA 2PQ6A 2I2AA 2DPMA 4TLDA 3HZHA 1V9SA 3BCUA 1JKMA 3EQ2A 4LY3A 3I30X 3OKAA 3KQNA 3KB6A 2NYAA 4P7KA 1N9GA 1JFFB 1NASA 5JY1A 5BSMA 3GJ6A 4ARUA 1OW3B 2ZYDA 2W2KA 4FI3F 3T7RA 1X1CA 3EPPA 2NYUA 1FRVA 3SS7X 5KOJA 2CVQA 5KNCD 1H5QA 3D5QA 2E5LB 1FVXA 3VDMA 2ONYA 4FDTA 2FN4A 4BFVA 2ZRMA 4AUEA 4OV6B 4MTCA 1NI3A 3KB1A 1NT2A 1R0ZA 3KLOA 2YHAA 4S1OA 2H1HA 4L2IA 4DAOA 1YWGO 4X62B 1JVBA 1NF9A 2J41A 2YY5A 1WP4A 1A0OA 1JJBA 2Q5CA 1DIGA 3F1KA 5HRCA 2IUFA 2X77A 1GRNA 3LCCA 3VPBA 2ZI3A 4HH1A 5JISA 1ZKDA 5ALRA 3FYUA 3WLKX 4GX5A 4P0TA 3TBFA 3PNKA 2FFAA 1QQ5A 4MGKR 1F9AA 3IAAA 4E0BA 1SHZA 4NHEA 1CF4A 4O4IA 5T5QA 1NR5A 4HKTA 4YRPA 1BE0A 1JR3E 2IYEA 2VPYA 1Y4SA 3LXMA 2NXWA 4YAOA 5AK5A 2IEYA 2WYIA 2PS1A 1U0FA 1Z68A 2GZRA 1CXZA 1T3TA 3NTOA 4IUYA 2YKGA 4DQVA 2Z8ZA 3JAWA 3QYFA 1B2LA 1G64A 4XJXA 3BSFA 3OQ1A 3GAAA 5EAIA 3C0KA 3WLOA 3MUNA 1D4FA 4CQLB 2FWAA 1N75A 1RQGA 3BRSA 4G4SP 3W34A 1OBFO 3T7SA 4NPAA 3DS8A 1K86A 4TVBA 5GVSA 1X38A 2BSXA 3NZEA 4KQJA 2P9GA 4KXXA 3P4XA 3SYLA 2OCYC 2VP0A 4CMEC 5KTNA 1NTOA 4M8IA 3SC3A 5D3QA 3U7RA 1LC0A 4KQMA 1L7AA 3COWA 5I8PA 2YYAA 1GWNA 3R6LA 4NZMA 3QH4A 2WIJA 3OZGA 3C5WP 1S96A 4KRFA 5IDVA 3Q41A 1V11A 3KWFA 4S2EA 3W2FA 3GDWA 3E9DA 1V37A 4LHXA 1FUKA 4E14A 1ARZA 1QGYA 3A0RB 3TZ6A 3HU2A 1O54A 4PLYA 4XPZA 4MIYA 4E5YA 3C97A 3GUCA 4U7TB 4WSOA 2HRZA 2VHXA 3IX7A 1FRNA 3R7AA 3RC1A 1EZ1A 3BWMA 4U39A 3W4IA 3ZPXA 3HDJA 1PJTA 1PEYA 3CX3A 3VVCA 5LN1A 1ATZA 1CT9A 4Y9TA 3IIKA 3NM6B 1VE9A 1NXVA 2XV1A 4GPAA 4U4AA 1DJNA 3T4EA 4TLCA 1UJ2A 4X1KB 1H2WA 1U7HA 2MHCA 1X7GA 5JFGA 3QBJA 2CKMA 1X1SA 1PDVA 1E92A 2DT8A 4IV8A 3UO8B 3KT6A 4DV6B 2SNIE 3NASA 5TY0A 3X2EA 1Z5PA 4EA8A 4CYMA 2VLBA 3O8RA 2FPGB 3DYVA 3NBQA 4HVAA 2XE8A 1MENA 1YI0A 3BRCA 2FZVA 5DB4A 4WZAE 2V0CA 1RWVA 4IJWA 4JJIA 2Q8QA 1E0DA 1V7QA 2GXQA 3DUFA 2ID8A 1G1MA 1M7GA 4Q9AA 2HSJA 4RKWA 5BV8A 2OFOA 2HHCA 1S7CA 1VDZA 3HNRA 3LRXA 2C78A 4U0JA 2FSFA 4MO2A 2E2WA 1DP4A 2Z04A 3D0OA 2YZNA 3DNPA 1ZD1A 2DWOA 3RVDA 2O0JA 4F4CA 2Y0DA 2FPSA 3HR8A 2YJZA 1QIIA 4GOMD 4GP7A 4HNSA 5GONA 4KXYA 1PWZA 1RYZA 2OGTA 5K6AA 3JD4A 3EEQA 3UG7A 2NO0A 2EDCA 1ZLYA 5JYBA 3EF3A 1A7KA 3VNBA 2G7ZA 3CGWA 5IM4F 5DIZA 3EODA 4MVJI 4AZ0A 2HCTA 3AGPA 2PCLA 2AG6A 3P0JA 1SJ9A 3G8CA 3HU3A 4NY1A 4ETNA 3PEVA 4F38A 3SSNA 2W7TA 5KDOA 3I9V6 2CXTA 1WNFA 2QM0A 4R40A 5T8KC 3WBBA 3TMKA 4KTVE 2XAUA 1L8XA 2C3YA 3MCUA 2FCAA 2BGMA 3JQ9C 1E3LA 4P92A 5F51A 1KRWA 2I34A 4B0PA 3AJ9A 5AVKA 5IBPA 4RXUA 3SKXA 4DPMA 1CQJA 1RBMA 4FYWA 2UU9B 1AGRA 4WGGA 1HLGA 2A1UA 2V5VA 1L4EA 3G89A 4AQDA 1I36A 4FZ3A 2FPLA 4C4PA 1V35A 2X0FA 4DQLA 5REQA 2NU6B 1U1CA 1KORA 1ZC4A 4X1YB 5J1TB 3GNSA 5DI3A 3K7EA 5A4MS 4D42A 3BS4A 1M3SA 4CL8A 3NG1A 4NBUA 4AMUA 4E2XA 2RBGA 4RU1A 5HKOA 2FWNA 3T7TA 4FVTA 4XVRA 1C1YA 2CL7X 1GITA 3D5TA 3WG9A 5CFRA 1FNCA 5K0NA 1T4MA 3NEJA 2AJBA 3OG9A 1ANKA 4LOKA 4V1CI 2YWDA 4LS3A 1VXOA 1II8B 1S3IA 3AUXA 4G5RA 4YRIA 1U8ZA 4MVYA 4BB5A 2G1UA 1P4AA 3DTVA 4BO7A 2A58A 1OXTA 2BGGA 1DIHA 4G4JA 1S2MA 3D8NA 4GYJA 1LDEA 2VA9A 3TIXB 2JA1A 4EF5A 4NCAA 2QMQA 1BXKA 1Z12A 4UXHA 3DHVA 3D7SA 3FBTA 4EKDA 3C39A 1XMSA 3GRCA 2GZMA 3R3XA 3LQQA 1I2DA 1C9KA 3DOCA 3DWFA 3GBSA 4KRYA 4YJ2F 5GJWC 1E2MA 2ZAGA 1J4AA 1OT5A 1D8TA 3NCTA 1JAXA 1V2GA 4KXLA 1WUYA 4WN9B 4AP9A 3JVVA 4F9EA 4ILEA 4OJTA 1VLZA 2W11A 1Q22A 4I1VA 2H85A 4IO1A 3T1QA 2HHAA 1IN6A 4BV2A 3OQOA 1X42A 4H6VA 2ZI5A 3JWGA 3OCJA 4ZIRB 4BNYA 3BMQB 2PKYX 3EGOA 3WZMA 1TYZA 4OQNA 2YJGA 4XVCA 5JC1A 3BMNB 5KNBH 1OXVA 1PLLA 3PUYA 2AJ8A 2Q46A 3OQNA 2A35A 3E15A 1JRLA 5TQVA 3JWPA 4EELA 1NULA 1HA3A 3CMMA 4KN8A 3SQOA 3BYZA 4U02A 5C53B 3UJNA 2FW1A 4YQFA 3OZVA 4UEJA 5IZCC 2QR3A 1IH8A 3IDSA 1GQQA 1FS4A 4ZV4A 5HQTA 4OX9Y 3HVJA 3E3NA 3EA0A 1NBAA 1ZX1A 1VXRA 3WWDA 4UU0A 3LY7A 5FNVF 1R50A 4X1IA 2WF9A 1N2CB 2V4ZA 1OTHA 3WV5A 4HRVA 5ADHA 3QV1A 1V3TA 1OB5A 2ZJFA 1PR6A 4RZ3A 1LK7A 1JQAA 1NBMA 3MTGA 5JXHA 3HHPA 5TC4A 2H1WA 1C9EA 1NXPA 1V9CA 2HSDA 2IZ7A 2DFLA 2IITA 2B9VA 2VWPA 2XF8A 1OBVA 1WCIA 3PEFA 4PQGA 4NP6A 4QDKA 3I0ZA 1ZY2A 2EBWA 3H16A 4R31A 5CRIA 3IVXA 3C8ZA 2Z4TA 3R1IA 4K6GA 4NYJR 3SP1A 2ZXUA 3EUFA 2FDCA 4URUR 8LDHA 2ZCUA 1EFCA 4DJ5X 1K89A 4D46A 5ALYA 1TYEB 5AKGA 1HZZA 3VKFA 1THZA 3L6EA 2HJ9A 1Z07A 2A5JA 2PGLA 3NKFA 3AJRA 3WZ2A 3TQQA 2G5CA 1M73E 3GGCA 1KFBB 1IZ0A 5B53A 4N7RA 3EW9A 3BXFA 4Q7JB 1FC0A 4JLBA 4TKMA 3VR5H 4EQ6B 1SOUA 4OL0A 1EGHA 1YMVA 3KCNA 3C1TA 3E7PA 4FMBB 4IW3B 4OLBA 4ZDKA 3AHEA 3VGPA 3H2BA 5HMLA 1FDUA 3IP1A 1TO2E 1TKCA 4D92A 3SEZA 1XRPA 1BQEA 2ZR9A 1NW5A 2F4VB 4P5DA 2CLSA 3H5VA 3M4XA 2ZXFA 1ZPDA 3ZE7A 1EDZA 2ATVA 2IP4A 4PVCA 4RVGA 4BX8A 5FX2A 1KVSA 3W5DA 3IVMA 3QE9Y 2NO1A 1I6LA 1A27A 1TA4A 4HBZA 3M6IA 4P4GA 1XVLA 1FYEA 5D3MA 5ALLA 1YU9A 5DGTA 3GZNA 1O9BA 3VR1A 4JJ4A 4TL6A 1GU7A 4AUMA 3GLFA 2YWCA 2GAJA 4EY7A 1GZ4A 1JS1X 1Z7GA 4CR7A 3DPUA 1EPUA 2ID7A 3PUVA 4FPXA 4WADA 1EJBA 2BEUA 5DGHA 5I9BA 3UKOA 4EKNB 2HREA 5FPHA 4ZWNA 4MI9A 3KOOA 1DWUA 2B5VA 4M7OA 4ER0A 2O3TA 2OSBA 2G4VA 3U5ZB 1UPBA 2G3YA 1A5ZA 2P68A 1YS7A 2ZJ4A 3NBFA 5ECGC 1K75A 4Z7JA 2WA1A 3KYBA 1PQPA 4I50A 1BXRB 1PS8A 4OA5A 5LNK1 1L4BA 2IBMA 3VC1A 3T15A 1SHUX 1ZYUA 1P45A 1E1DA 4QPDA 3GGOA 3F9RA 4GOOD 4W8HA 3TVYA 4E5PA 1J5PA 2Y8EA 5DXFA 5HDBB 4BNMA 3OAAD 3A1DA 4C0WA 2F1RA 3L8YA 2PKCA 3SM9A 2X4LA 3IJPA 4YXFA 3GZJA 3P2EA 2OZLB 1DFGA 1OKKA 4Y9RA 4RJ2A 2VNSA 2X6TA 3M83A 3DBRA 5DYWA 5GV8A 3WB9A 4LRTB 2V1XA 4WZZA 4F97A 3WB2A 1TEHA 3BB4A 1C2TA 3GUVA 4EAAA 4AKHA 3EG5A 2FZWA 2XCUA 1GZ7A 4IINA 3HDGA 1G9XA 3DM5A 3PNPA 1PGQA 1IDN1 2W90A 2OKGA 3MMZA 3OD1A 3QPVA 4CEJA 3EAFA 3LIIA 3Q0IA 5IVIA 4Q48A 3U7IA 1WA5A 4S0ZA 4P22A 3H9UA 1JE0A 5B1HA 4AYXA 1GAWA 3OFSA 1JN0A 3HWX1 1SC3A 3OOEA 1SUAA 3UC5A 3LBYA 1SQFA 4UFNA 3ADCA 2CVHA 2R8BA 3DT9A 2B98A 4F5WA 3FMFA 3G8DA 4LF8B 4X61A 5AM1A 1ZD4A 3RODA 3VH2A 2XMGA 4JX9A 2IV7A 4R7ZA 4II7A 2GBPA 1OTYA 1Z73A 1NMXA 3EEBA 2OCBA 1SU7A 5KEIA 4R1QA 1DBRA 1LQTA 3VU8A 3F96A 3T0IA 4LW8A 2XGOA 4WFJA 4AM8A 2EFJA 1H8ED 3NUZA 1WMSA 3PQDA 2Z5LA 2FE4A 3RUCA 1WZCA 2WZDA 4DY4A 2FV8A 3GEGA 1YKFA 1ZUHA 3I64A 3QVUA 5ALNA 5IYZA 3P45A 4W9NA 1AV7A 2B1QA 1JBEA 2VHWA 2W43A 3HV2A 4DV4B 4EPYA 3VDXA 3EFOA 2XE4A 3VNVA 1BKSB 3EARA 3F5MA 3OEYA 4YHBA 3KSAC 5A5GA 3UHFA 3VO9A 3ZGNA 4CQNA 4FC7A 3TQSA 2ZYAA 1JU4A 5F4ZA 3S2GA 4WXHA 5HIIA 1OZAA 2G9VA 2J9GA 3CW9A 4ZQFA 2BY4A 4G1CA 1C0KA 3A7EA 4TRRA 1X0XA 3DMGA 3VSCA 4DB2A 1PZFA 2ZUTA 3MMNA 3I39X 5DGXA 1C7JA 1Z37A 5KYWA 5JJIA 3C70A 2D5IA 2QTTA 3TQCA 1ZCAA 3QEJA 2NW6A 4IYRA 2H5IA 3GJQA 7GPBA 2QWXA 1WLSA 2R87A 1Y1RA 4WKOA 1R3DA 2UXBB 1K8RA 1Z35A 1GTG1 2Y0EA 4NYMR 3H2GA 3NHUA 5KYTA 3CUTA 4XEUA 3ZDAA 2V8BA 1H6CA 1C7ZA 1VHLA 1YZYA 3AEYA 4HEQA 3DVSX 2VNHA 3QU4A 3QY9A 1IVNA 4K9QA 4MAAA 4WN3A 5JLJA 4Z7QB 2QAIA 4PO1A 2C4NA 1KY3A 1U04A 1NMQA 1X6VA 1NW7A 1YQQA 1F60A 1IWOA 2I5PO 3KUKA 3MGKA 3O4FA 1GADO 3MHPA 4A0FA 3W5JA 1KRHA 4BBPA 4DSNA 4HNVA 4DA4A 4R1PA 3EB9A 2D00A 3MWGA 3RROA 3FUCA 2BEVA 4F11A 3V1YA 1C5KA 3NHSA 1RXWA 1GRQA 2IKQA 2VT7A 2CJWB 3CPJB 4F3KA 4CMIA 1BXGA 4F6RB 4LY9A 4G85A 5AKHA 3WHLA 5H81A 1IATA 2IODA 1QXSA 4WK0B 4O4JF 1G8KA 1VC2A 3GQBA 3KDSE 3SFVA 3USZA 2C8KA 5FL3A 3ODPA 3JQ7A 5EZSA 3CJTA 1VQ1A 1XDUA 3V7FA 1VLQA 4LDPA 4AYWA 5B7GA 1R15A 3HXQA 1CS0B 3WMRA 1HDOA 4MGYR 4OHOA 4R3NA 4FX2A 3S44A 5BVHB 3SBDA 2EBFX 2GM3A 3W2GA 4IDBA 1DJMA 2CNKA 1GTVA 5DRTA 1LRJA 3T1YB 1GGMA 2XVXA 3PEEA 2PKEA 3NIGB 4FYPA 1LJUA 3LUDA 1UAGA 2JAHA 4LV6A 4MP3A 1E6KA 2A5GA 4QUBA 1W29A 1KMHA 2WMOB 2PFKA 2X2PA 3O4VA 4K9SA 1KF0A 4WCFC 4XB1A 4WXYB 1O9HA 3FF1A 4M8KA 5ARBA 5BUZA 4ZT5A 4AWBA 4JP2A 2FLKA 4G5QA 3F6SA 2PZEA 3WZLA 3CCFA 3IBFA 3L8EA 5HRAA 4P58A 1TKRA 1U9CA 5LC1A 2D59A 1Q3HA 5DBHX 2ILTA 5G02A 3A6PC 1ZUNB 4K40A 1CUBA 1LDMA 1QPGA 3M5PA 4D8YA 1LV8A 1KJYA 1SBTA 4FR0A 5IVHA 3IAM1 2YMMA 3HKDB 1ATIA 2GF2A 1Q7BA 3ORSA 4XWOA 5ALHA 5JWHA 3IIJA 1OR8A 4NESA 4QYWA 2O8FA 4AL4A 5JV5A 2YN4A 3MWFA 5FTKA 2DERA 1RXSA 1SKUA 3RU9A 5B4UA 1KMQA 1R18A 2JCVA 3NFYA 3N7AA 4HZUB 3RIEA 4U5XA 4EPXA 5F9HA 3PA6A 1RWKA 2PH1A 3AO0B 3BREA 1A2BA 2ZUBA 5JCOC 2QUHA 2X86A 1IQUA 3KYIB 1V25A 3H2KA 1Y3IA 2PMKA 3O91A 1MAHA 4A26A 5E4JA 5B1EA 3OUTA 1LW6E 3TO5A 4RPHA 3ZXYA 3I2KA 2PHZA 1MA3A 4M88A 1ID1A 4F45A 3L4BC 3LY9A 1VMDA 4UM8B 3H0CA 4R16A 4U00A 1PW7A 1N1EA 1QE3A 4O5AA 3OBBA 2OUKA 2VHTA 4TM7A 4EYOA 1H6BA 1GPWB 2Q9BA 4C05A 2BBTA 1QTQA 4JV5B 1EM8B 3OP4A 3E81A 5F5LA 3BFKA 1B76A 1P4HA 3PWKA 4MA5A 4CNQA 1Z6XA 3ABOB 2R96A 4Y2HA 4GLOA 1KJ9A 4TTQA 1Z0FA 2ZSBA 2LBPA 3Q3GE 3VPAA 5I7HA 1XE3A 1LI5A 1U28A 3OCVA 2QZZA 2PGDA 1JKXA 3F0TA 2CVOA 4EZEA 3PIDA 5A7GA 3SZOA 3ROPA 3FPAA 2UAGA 5L3VA 4LMPA 4MR9A 5ESXA 4ODIA 1A7AA 5BR1A 4WA7A 5J2TF 3BKWA 3H9CA 3TJZA 4XGQA 2Z30A 5CB0A 1P39A 3SEAA 3I0NA 1D2HA 3AY0A 1VLVA 2VRNA 4GI5A 1ZBQA 4JQZA 3EHDA 3IUQA 4TS9A 1NAHA 2H1IA 5DOVA 4OGWA 3QIAA 2RH9B 3NRBA 4I4TB 3USCS 4ED9A 2J3LA 1I24A 1B15A 1OJLA 4KSBA 2HN9A 3WGJA 3D4OA 3E3OA 4MV8A 4HDAA 4BNWA 2Q28A 2QXUA 4S2UA 5EFZA 1QE0A 4FWTA 4ZOEA 3BWCA 3ZW8A 1TZCA 3C14C 4RMHA 3MAJA 4PC1A 1SZJG 5DZSA 2C9ZA 1ZMBA 1BH6A 1CJVC 1JHAA 1QFSA 3V8VA 4BMOB 3QKWA 3IVCA 1UJ4A 1EDOA 5JATA 4KHZA 4ECAA 4QFMA 2Q5EA 2R6AA 3G0HA 5CAEB 1AHHA 2RDMA 2WLTA 5I47A 2ANBA 2QLMA 3OJFA 3QE4A 1G20E 2OFFA 4Z4HA 5B2EA 1ZITA 4J29A 1F6WA 1Y1PA 3RFVA 1M72A 2VHUA 5G0WA 1OGIA 4PG6A 2L17A 1YDGA 3X44A 2G6TA 4CMKA 2DCUA 3U9LA 2HF8A 2Y0PA 1DC6A 2I0FA 2ZBEA 2JRLA 3M6WA 1FQJA 3ESXA 3F6BX 3KSUA 3OCZA 2F1OA 3ZDBA 3PRHA 3ZK7A 2FUNB 3FHOA 1EG7A 2FHPA 4KAXA 3KLBA 4OSOA 1Y1TA 3VV3A 4A6PA 1AKRA 3ELYA 5EE5B 4IQGA 5FYDA 3JARA 3R0IA 3VPGA 2BJWA 2GAOA 3K20A 3OD5A 4KFRA 5EFOA 5EXTA 3SBEA 4F91B 3KQYA 3A6JA 3IUNA 2F1IA 3COPA 2OM6A 4K88A 4KIWA 1LF5A 1RWQA 1ZM3A 1N0VC 2FN9A 1E1RA 1OWOA 4HLUA 4XIGS 3V1UA 2NUPA 1PNTA 4AJLA 4BWYA 1E1CB 2PR7A 3OX2A 4RFSA 4BZZA 4OK6A 3T7IA 2DHDA 2OBXA 2GTHA 2ONKA 1OFIA 3NTXA 4MW5A 4A5OA 3FOAA 4QOJA 2QKYA 2O2CA 3CZAA 5C1IA 3U56A 3RUHA 1KH2A 3N2YA 3B1ZA 1E7MA 5CGZA 2J6IA 3L07A 1V4VA 2OXCA 1Z2CA 1IOLA 3OEEA 1JMYA 3WJ7A 4F93B 2D1YA 1MT3A 1KQOA 2GZDA 4PQEA 1L7DA 3O4IA 5DCWA 3W3AD 2O3UA 3WICA 4LHSA 2CLLB 4YAIA 1BJKA 2VC2B 2HJGA 3PVZA 4TYMA 3RFCA 3F97A 4JITA 5DHUA 4FU0A 3WI7A 1KQ3A 2HXGA 1GDHA 1L1EA 1ZSYA 3DAGA 5A9SA 3ZIAA 1RFGE 4M9CA 1F1BA 4NZOA 4BECA 3G1TA 3OJEA 4IFIA 2IYUA 5LSAA 2ZB7A 1F0KA 1UZMA 3AONB 4I99A 1DS6A 2R1TA 2JCBA 1HYBA 2C5SA 3DKRA 5FOXA 3SSMA 5JZBA 1ZD2P 3QA9A 3HKBB 4GGOA 2EERA 3Q5GA 7ADHA 1B1CA 4UVHA 3A3NA 4BLPA 1FY2A 3GLSA 1TTQB 3HEBA 4QTUB 4EB6B 1ZVKA 1KDZA 2HDWA 1N7IA 1M1NB 4KGXA 5AJXA 3EG9A 3HCEA 3NC4A 4WK4B 4TTIA 4ZI7A 2DHCA 2P3OA 1NMZA 4YRCA 4MHSA 3MWDB 3ECCA 3JQRA 4IF4A 4MWCA 2P9FA 3MS7A 4U7JA 1SPBS 1Z6QA 3LY5A 1QKIA 1T8PA 4NKRA 5TEWA 2Y3IA 2J45A 5J2UA 3DKPA 5TQ2A 2ZIAA 1Y6RA 1RTKA 2XUDA 1NOJA 3E4DA 3TOSA 1HH4A 3WBFA 4KQWA 2C4VA 2HWKA 1L5VA 4ZVQA 4V2UA 4F1WA 4DV3B 2AC2A 2EX1A 1ISIA 1RPAA 3NWJA 3RNOA 3ZUPA 3RRMA 4X65B 4HNTA 2PSJA 4YMWA 1RCUA 3KQUA 2AKEA 3EIQA 1P1HA 3ZDXB 2DFNA 3P4YA 4XX0B 1VMKA 2Y71A 3PNLA 3RRJA 2BTOA 3VMMA 4AB1A 4HEA1 4YJDA 2WJJA 5JR3A 2G4CA 2FPOA 1JQBA 4MS1B 4I9FA 5LQSA 1HNXB 2HM7A 1U1EA 2R60A 5TNXA 4MGZR 4YUZA 3KTAB 3ZNPA 5I4KA 2ODBA 2ZK7A 1Z8NA 1TA9A 2VSQA 4KYIB 4CF6A 1N5OX 3JZFA 4H4CA 1AN9A 2WHQA 2RC6A 3KOMA 4LF5B 1D9XA 2BFWA 1DAIA 2I7CA 4IFTA 4JLDA 4Z9XA 5JSZA 2VDWA 2GD6A 1E20A 2IHKA 2ZJ2A 4ACBA 3NGLA 2XE6A 5JS2A 1CQIB 4WNAB 2H2GA 2HLDA 1KYWA 2Z0MA 5F12A 3T3DA 1GPKA 2J33A 5KQRA 3RVMA 1AN0A 1A5BB 1SPXA 2ZCVA 3P0RA 3PNVA 2XH8A 5KTKA 2ZWIA 4UDYX 5AW2A 4OQZA 3SBOA 3PJGA 4EO9A 2OCAA 2CXNA 1XTRA 1JDNA 3DVRX 3H4IA 3QUBA 4H7JA 1K8QA 1KZ6A 2YWHA 1UMBB 2JJMA 2PGIA 5IYZF 5G4KB 3L7YA 4UBMA 2HUPA 1C30A 1U7WA 3L40A 1J97A 3INGA 3LS2A 1BGXT 4YGYA 4Z6KA 3EPJA 1VP9A 3PC2A 3X43A 4A8JC 2VSYA 3A27A 4WE3A 1VG0B 1QDLB 1X1DA 2C2ZA 2NU7A 2WWHA 3FWHA 3PICA 4QGAA 3H2IA 3PD1A 2NPFA 3VR4D 3O2SB 3OLVA 1G8JA 1RMQA 2YS6A 4Q4HB 3FB4A 2AR9A 5KO2A 1V5WA 2RFLA 4P80A 2YFHA 3K9NA 4DABA 5CLQA 1ZXXA 4DMGA 2ZLBA 2O8CB 2IIPA 4D0NA 3DEKA 1U2QA 2H54A 3EVZA 2QW0X 4M0MA 4XGKA 3GLHE 4R8MA 1Y9AA 3KUDA 4XVHA 5HF9A 2OXIA 4RAOA 4KXUA 4N4AA 4UM5A 4GWKA 4Y2YA 2XNDD 2QGZA 3OECA 4XVUA 4AMYA 1N77A 4R1OA 1E3MA 2QX6A 1ZRMA 2ZYTX 4D4GA 4F3TA 2IGTA 3K9WA 3OICA 4EZIA 2V3CC 1GDDA 2RGXA 3PT5A 4URYR 4MWBA 3RKRA 5FQNA 3ZWDA 1P2FA 5HCUA 4F6LA 4ML3A 2AFIB 2RGCA 2VP6A 5C8YF 5J58A 5TMPA 3ADBA 3L0SA 1YZ3A 3R20A 2QUBA 4E70A 3V4SA 4GQAA 1JEEA 1QK3A 2FSSA 2IUUA 4WBSA 5LQJA 2DVMA 4AP6A 3F6CA 3PX2A 3IQIX 4DDUA 2BZSA 1YCHA 1D1PA 2O4UX 1P9OA 1ZXLA 2FMFA 5B1DA 4X7MA 3IMGA 1TJ4A 3KC2A 3PQCA 4MLCA 4ENSA 2WT4A 3OA0A 4L5BA 5BQ3A 2DBYA 4D99A 3R3WA 4RSRA 1AX9A 1GVNB 4QJ5A 5EXSA 3VV2A 3MLAA 3WKCA 3D7LA 2VF4X 3L7OA 4Z7NB 1G4UR 1QFMA 1LF0A 1ND6A 1NLUA 2GHIA 2V6BA 4MVJF 2O5CA 4G25A 3KHSA 3FPHA 3H5TA 1DIBA 1KY4A 3FTQA 4NDZA 4OK3A 3HJFA 5J9FA 5KYXA 4I55A 5GM2A 4E09A 1T5LA 2EKZA 4XCVA 5EIBC 2P0YA 4FP9A 3C24A 4HLNA 3GJ5A 5EMJA 2HDHA 1TZJA 1G7CA 5ELLA 1USVA 4MUEA 3V8RA 3EZFA 4O02B 1DSSG 2XVYA 3IUSA 1VJCA 2H5EA 4YCBA 3ENVA 4HWSA 1GD1O 3IUEA 4AT1A 2AEFA 2ZRPA 1QP4A 4P98A 1EGMB 1T3GA 1PX0A 3TQRA 5JQGF 2BBWA 2NG1A 2GK7A 4DR3B 3TSCA 4XZ3A 2EGGA 4PZUA 3HWSA 5ETJA 2R6FA 1DAEA 3E7WA 2O8EA 1W88A 1XLWA 1YUNA 2XTMA 2LTAA 4HDKA 3LVBA 3REQA 2AUTA 2Q99A 3A4YA 2YFQA 2VJMB 4CFSA 4F56A 3WRXC 4J6EA 1PTKA 3JQ6A 4J1TC 4Q19A 1ZSVA 4BUZA 5JG7A 4A10A 3MQ2A 1C1XB 1LDGA 2H4FA 5CJJA 1LJLA 5CHYA 1W5EA 4DR5B 2JVIA 5GINE 5EE1A 3FNHA 3QLVC 3W1VA 3L8GA 2BKXA 3DXFA 1U0EA 4LMBA 1YL5A 5EIOA 4G0XA 4GSKA 1RLTA 1E96A 1CVLA 5FBKA 2IOQA 2IT1A 2OMKA 1U3CA 4X90A 5U4XA 3JQBA 2JG3A 2OXTA 3Q88A 1JIVA 3MTBA 1YI1A 1ZU4A 2EIHA 2R4QA 3M1IA 3GXBA 1GTMA 3UEOA 1RVDA 4WCFB 2J08A 2GTIA 2PYIA 3PTLA 1WV1A 3HBLA 1ISSA 4FXOA 1B8NA 3FOZA 1XCMA 3GBPA 1VSQA 3KJNA 2V98A 1WW8A 7REQB 5K05A 3BXEA 3WSTA 4D82A 4RPIA 2VR1A 4E5VA 1BHO1 3AETA 2H0QA 4GZ3A 3PQ6A 5IHXA 4B3MB 4IH9A 3AUKA 3TD2A 2BSQA 3I12A 1YQXA 1MC1A 2ZEJA 3G2QA 4YH1A 4RULA 1U2DA 3GT0A 2QTHA 2W42A 4ENRA 2O54A 3VZQA 2O2XA 3IP3A 3OQ6A 3LOUA 4Q66C 3UA3A 5BR7A 5LIPA 1ITZA 1RSZA 1TAQA 2F59A 5AM4A 3ANSA 3OJCA 1RQRA 3IMKA 1N32B 3PFFA 1ESCA 4OU4A 1SZDA 2FQQA 4WVLA 5GM1A 3IAS1 2YFYA 3SLKA 3ZLBA 4ZZ0A 1D2CA 2VJDA 2UYGA 5EIAA 2O50A 2IIBA 1FJGB 1JVSA 3U7HB 2ZYIA 4X7RA 3RYFA 4X97A 3CLSD 3ORRA 4Q9NA 5HM6A 1V5EA 1OPRA 1PRYA 4OO3A 1TADA 1UADA 1V8OA 1QCDA 1NPTO 5C1BA 3TCXB 2G9ZA 3B9PA 2IS2A 1F2VA 1XEFA 4QBFA 3L8ZA 3KRTA 4IGIA 4LWPA 4WLEA 4B3FX 5FAXA 3S81A 2Q6IA 3LKDA 3QI2A 1LVHA 4I1YA 2D5BA 1YONA 3ZQJA 4RTMA 1TE2A 5LQMA 3C7AA 3NHFA 3CF4G 3W9SA 3UOGA 2TMGA 3JZAA 2GUGA 2UVDA 3V7UA 1ONBA 2VK1A 1L5LA 3UC9A 1W44A 3LUCA 1PWEA 4RLQA 1VKOA 2WU8A 4OKSA 5G2OA 1V6CA 1PFWA 1Q15A 1OA0A 3QLUC 5IW8A 5IKEA 3AEKB 3PQ8A 2BH9A 1R6UA 4X6YA 3LGAA 5K09A 1ZH0A 3QFFA 4IYJA 2DFTA 4PEVA 2ST1A 2DKOA 4Q12A 4YRKA 3MELA 1VYHA 3ZKAA 4EW2A 4QVIA 1XCLA 3L4SO 3Q98A 1XUOA 1HO3A 4UPVA 2XXAB 2OBMA 1MX5A 1DQYA 2Y1XA 5P8WA 3UY4A 4FGKA 2P1DA 3BMOB 3D6HA 3ANYB 2HI0A 4LC0A 1NFQA 2NO7A 3C7DB 4NFYA 5U9CA 2JCYA 4IZIA 3R74A 3RU2A 2B8TA 3EIXA 2AMJA 2DCMA 3SC4A 1HX7A 2GN1A 2WTNA 5KKCA 3O83A 4EA7A 1X7ZA 5A0TA 1EVYA 2YIJA 3AH8A 2AL7A 4P93A 4RWZA 3UTCA 4A2CA 3C74A 4B8YA 2OD9A 3DLPX 4QM7A 3C6QA 1NBWB 3BHIA 3H84A 5C5CA 4Q47A 3T7EA 3SVLA 1HLFA 2I1LA 3O8BA 3T95A 2ZM5A 5A2GA 2EX4A 3D3WB 1G98A 1VFNA 1Z6GA 3G0DA 4C3UA 1CVIA 4FJ2A 1QLJA 1QCYA 3PSHA 4EBFA 5KQMA 4HAYA 4MI1A 3A8TA 2YCBA 4EGQA 3VOAA 1JQEA 1PQYA 2R6JA 3QPUA 4Y9SA 4I9HA 3MLBA 4GWLA 4P3YA 4DLAA 4ZTUB 1RI2A 2H65A 1ODLA 1YQEA 2A33A 1DX6A 2C77A 2O7RA 1CJKC 1GHTA 3HEAA 1KDPA 3QFRA 4ZOLB 2A9KA 5I8ZA 3LU1A 5E8JA 2IS1A 1NX6A 3E18A 3FFXA 5EJ2A 2AHRA 3LECA 3MS2A 1FYFA 1HT0A 5AIBA 1Z63A 5FQOA 1Z47A 2PD4A 5KVVA 2HMTA 3HFSA 3W5BA 1PT6A 2Q1TA 3IODA 4D9NA 2KQUA 1G21A 1KVUA 4EDHA 1SCKA 1UMKA 2IEIA 2XNHA 3I4CA 5FLXA 1A4XA 5FBZA 3PEWA 3GCXA 2IZZA 2QAGC 3O8CA 5K0GA 3TIFA 2UDPA 3KYJB 1MC4A 2HQ1A 3V7NA 3RYHA 4M0CA 3JVUA 4TLMB 2HQSA 1CPYA 3FNRA 4KE6A 4L8GA 1E7QA 1CC1S 1K8XB 2GKSA 2X8JA 3WQSB 1IK6A 1UJBA 3PHJA 5IXJA 2XKBA 3DZJA 1P8AA 3KETA 3FPKA 1HWYA 3NP7A 5SYNA 5AWFC 3U39A 4EGSA 4JYBA 4CL2A 4PTYA 1YQTA 4CBVA 2QZSA 4PZCA 3G2KA 3QMVA 4YCNA 1JA1A 2B92A 3I23A 1IM8A 3ZE1B 3OY2A 3EF1A 2HMVA 1QHSA 2B7BA 2F00A 2BELA 4R1NA 4CTKA 2YJ6A 4J3NA 4LJ9A 4RZHA 4BZQA 3Q4GA 4GECA 3L41A 1EFAA 3MTJA 1JV2B 1ZL2A 1WL8A 1VMIA 2AMYA 2JI7A 3BWBA 1VB3A 5ADWA 4ZEWA 2LCIA 4LV8B 5LQKA 1Z0UA 2WYUA 4UCFA 2PL3A 4JD5A 5TQJA 1QOZA 2WHXA 2JIZD 1XZNA 2R25B 3ZDCA 4PVDA 2UYYA 1KOFA 2AA3A 2A57A 3L3BA 5LXTB 3VH4A 1I1OA 5C31A 1L3IA 3RD5A 3ZU6A 3G0OA 3GLGA 3OIYA 3R9XA 3DR5A 4A15A 1CIVA 1TYBE 5EPEA 1JSXA 1LD3A 3AIIA 4PNEA 3MJ4A 2EW1A 1NMEA 1PO7A 3PITA 2R1ZA 4PWZA 4DIFA 1OREA 2FWMX 4ZHQA 2DSNA 1O95C 1MB0A 5HKBA 3CG4A 1EX7A 2CZCA 1L4MA 1JFFA 1WIWA 4BC0A 4ZDJA 3ZCXA 3V2UA 4TS3A 4D79A 3Q5DA 1XAHA 2QTLA 1BWRA 2FPMA 4HRXA 1Z4KA 2ZUFA 3VHXB 3AF5A 4G5FA 1YIAA 1U9JA 3FVTA 2YVKA 1EK6A 1CR1A 1Z13A 4KLNA 4RHXA 5B64A 3ET5A 1DAGA 1QH1B 1ZW6A 3LPAA 3MYYA 5A3VA 3SQMA 3CCCA 1QO0D 4WQMA 5F9MA 4DQKA 5CA0B 3B6KA 5TIIA 3VJLA 1YTLA 3T3MB 3RASA 1U4NA 8AT1A 4LDJA 2D6FA 4ZKDA 2Q4EA 3KB2A 2YWGA 3CLVA 1Y98A 2YJ5A 1F5NA 4N41A 1O0SA 2GYWA 4DRXA 3AKEA 3C85A 2BV3A 3BIJA 2G5PA 3RTCA 4I1RA 1FTNA 1AKQA 2BI4A 3RKUA 5IKMA 5M7EA 1I7DA 4JI8B 2P75A 3AP3A 2Q07A 3GVPA 2AYYA 3Q8MA 3I6IA 2BTEA 3H86A 5KOYA 1T8YA 4V02A 4HXGA 3PWTA 4BBJA 2SKCA 5EZYB 3Q8LA 5H4GA 1QPZA 4GDFA 1AKVA 3A9CA 4HXEB 4QEDA 2HA4A 4B83A 5C1DA 4D25A 1P1JA 2BRUA 1XF1A 5KWSA 4YV1A 3AHCA 1G0NA 3SSOA 3IP6A 3IC5A 4YP5A 2XYPA 4MCAA 5LP6C 3T4PA 4LG1A 2J7PA 4MICA 4XUDA 3R7WA 2QUIA 3AUSA 4PG7A 4TWBA 2DPGA 4JLOA 5HYVA 1J00A 2VF8A 5BQXA 2ODQA 1NN5A 3QOFA 3REGA 1UCFA 1ISGA 1I3KA 3TZLA 2C2MA 1QH8B 3BRWD 5JAHA 3OC6A 4LUCA 3PXGA 4TSFD 4XPIB 2FRXA 4FNOA 1MX9A 1BHQ1 2J67A 4YECA 1FNBA 2KB0A 4BYGA 2FFJA 1TF5A 4M0FA 4XYEA 1QG4A 4A8JB 5JUWA 1NUUA 2B30A 1XD2A 3KD2A 4RF5A 1Q92A 4D6YA 4WBNF 1NJFA 1KHHA 1CNFA 2O0KA 3ADPA 3B5JA 3PLRA 3U7EB 4ZDIA 4YLEA 2PLAA 3I1YA 4ZN6A 4LFBB 1T10A 2IH4A 3Q6MA 3WGOA 1G5RA 4J2HA 4OQMA 4WT7A 3OT1A 5MN4A 1SELA 3RVQA 1MAUA 2LCQA 5KNBD 1NGSA 4UAUA 5BOVA 3FSGA 4EEXA 2CE2X 3BSSA 4JP1A 5HFJA 2JFZA 3DWEX 1G38A 1EA7A 2Q1SA 1JHPA 1YB1A 3D3NA 4X6UA 3T06B 2Y68A 4L6AA 3TI9A 1QZ3A 3T3IA 3E9NA 1BRMA 3E5MA 1D1TA 4BAUA 5KHLB 4RTRA 2H31A 2CLKB 3DQQA 3DNMA 3FR7A 3WRWA 2BKVA 4OI2A 2ZIXB 1YAHA 5AW9A 2X2OA 3E5NA 4G1FA 2FPGA 1HDRA 3D1LA 3MJFA 2NZ2A 4B47A 3CNOA 1FDOA 2QIOA 5AJWA 3QVWA 1V1RB 1T6YA 3N8NA 4EG5A 4C43A 3UCFA 2V6JA 1JFRA 2Q5IA 3ZW7A 1NQOA 1USWA 3U3DA 4D3FA 4BB6A 4JBWA 1OI4A 2HWXA 3IRVA 1E9CA 1YRHA 3QX9A 2A9RA 5AW0A 3W9YA 4TSKA 5KWJA 3CVVA 5BNZA 2VAWA 1JZQA 2IGBA 5FI5A 4RHFA 3S4YA 1E1QD 2AXEA 4YPVA 1SB9A 5G53C 2COKA 2OCXA 4CUKA 5IJ9A 4RHEA 5A5EA 2UUCB 1Y8QA 5SY9A 1Y0BA 5C3MA 2WE7A 4MOWA 3GDGA 1QV9A 2CGEA 5GIOE 2JGKA 2BM8A 3LT5A 1E2DA 1Q14A 3NAGA 4H08A 4JX8A 5KJ6A 1JPNA 3VR5D 2RI6A 2CLHB 5CMLA 4BQPA 1SCAA 4EBBA 1YR7A 2CUKA 3TGPA 2ZTHA 1U7OA 1A8QA 1BYUA 1KFJB 4AJ4A 3DC7A 3IT3A 1EJ6A 1XKTA 2OEPA 2PAAA 4ILKA 2VTKA 3A2KA 2OZVA 2FPIA 4HH0A 1Q17A 3C16C 3JW8A 1G5FA 4H17A 3ZWBA 2C03A 3WVNA 4B82A 2NXJA 3AF6A 2VI5A 1CJBA 3E53A 1FLDA 2XUKA 1PZGA 3QVLA 1JYFA 2OKCA 3BH0A 4JUCA 5CYFA 2G9NA 4CVNA 5A6VA 5KKNB 4CEHA 4NCBA 1FP1D 1CCWA 4M9XA 2OAP1 4PBTA 3PDUA 1XP8A 1ZESA 4ZO8A 4WZBB 1VGVA 3O2JA 1M2FA 4ND5A 2NUAA 4E51A 1Z83A 3DLTA 4L9RA 2C5BA 1XMXA 2C9YA 1UP4A 7MDHA 2PZAA 2FUKA 5C1PA 3BJZA 2NO5A 4JBNA 3LWDA 4O2BA 1Y7IA 4XGNA 5E7JA 4KR3A 4BJ3A 2BGWA 4DCUA 1R0XA 3HCDA 5FP0A 5J47A 2W6IA 1CJTC 4R7TA 3R75A 2VZEA 1A71A 3VU3A 5IFLA 4I66A 1T1SA 2F3QA 2NYRA 1IIRA 3L7DA 4Y1GA 5BW6B 1C3EA 4ZVNA 2W2TA 3QM1A 4J6FA 5E8RA 5CNIA 1JVNA 4YJFB 2YMQA 4G56A 5EWJB 1HDGO 4PSCA 4UHCA 1WQ3A 1XPUA 1M8FA 3D1JA 1E2HA 3E61A 5MF6A 4KTTE 3LC0A 2OD7A 5CBKA 1BIFA 1Q0RA 3J81k 4GBED 1FDTA 1PGOA 1QRRA 2SHKA 3PHCA 4B4DA 1UL1X 4MS4B 4ENTA 2CJXA 4FBGA 5D1HA 2QNIA 1A2KC 1JA9A 1Z4LA 2H0RA 4JVMA 2AG0A 1VHDA 4V0QA 4CKXA 4CF5A 3U4QB 2Z9BA 3NHAA 2XVZA 3HG7A 5CCBA 3K0HA 4DSOA 4UEOA 4CIVA 2HBQA 3UT5A 2CB9A 5F7OA 1WHTB 1M54A 4KVGA 1R6VA 4KQCA 1VB5A 4OBEA 4H27A 4RVHA 2GESA 4S35A 5KX5B 3KYCA 4ZI5A 4RD1A 3V1KA 1GGNA 1L5ZA 3H65A 4HVTA 1DTWB 3NHWA 3TLAA 1TD9A 3ZWNA 3DL2A 2FWRA 2IYRA 1Q3TA 4CT0A 1TRHA 2Y1CA 1TECE 3H18A 3HKEB 1L8AA 1RFLA 1F6DA 1GRCA 3QKSB 5COBA 1U1GA 1L7MA 3LX4A 5GV7A 2UKDA 2J7KA 1C29B 4UBNA 1CJMA 1SUPA 1ZN8A 1H05A 3BMNA 4FLFA 5JNRA 4K0RA 1DO2A 4AJHA 2AOWA 3LYHA 2WIFA 1FMLA 3QNMA 4PAWA 5EJ4A 1H0KA 2FP4A 4YMHA 4R6XA 1BAPA 2RHLA 3U7QA 3FOFC 4OI4A 3AESA 2CCKA 3IEKA 4EW3A 2HJRA 3QPBA 3TS1A 3MOGA 621PA 1V16A 1S2DA 1E3QA 1U9ZA 3D31A 3I8XA 4WMLA 1A1SA 5AJUA 3AERA 2K2WA 3I6MA 2KYRA 1C3XA 4Y6LA 4PPFA 3P0FA 5AESA 3I01A 2Z5VA 3WA6A 2EBUA 1K3UB 2DH5A 2FZLA 4GLBA 2EJVA 3RSCA 3RK4A 1QHXA 2ZJ6A 1L5KA 4TKVB 3GMIA 3RVSA 4CF7A 3ZLJA 5DYNA 2YVUA 3VZPA 4QBGB 1OBOA 1B4DA 1GARA 3B82A 3PUZA 4POOA 2P78A 3G2JA 4YGXB 1DX4A 3L1KA 1GCOA 2FF7A 4JU8A 1OAOA 2PX5A 3GELA 4WKCA 4XKJA 1PJAA 1Z5OA 2UUOA 4UUBA 2JARA 4Y6GB 2QQGA 4JEHA 4TV8B 4ZPXA 3PIRA 1AHIA 1C81A 3TTYA 2YASA 2DTDA 2H59A 1D2MA 3PQ2A 4KQ6A 3SD7A 4P38A 3NBXX 4Z3OA 3KQOA 1UBSB 2Z9CA 3RKSA 4MLZA 1O96B 1PZMA 2Z6QA 1GNSA 1CS4C 1GNLA 3ILHA 2NSYA 1EFDN 2VSNA 2QRPA 4HWPA 3A1EA 3GJRA 1KJIA 3D4BA 4FBMA 4N1AA 4RK1A 3WGUA 4DEYA 2JLWA 4D0LB 2VBGA 2H08A 4M1YA 1VCOA 1EESA 2F48A 2Q1XA 1W0KD 1EM6A 4UTRA 3GJ7A 2E85A 2Q4OA 3LHFA 1E66A 2YCLA 3DBLB 3N2ZB 4C6TA 2O59A 3NYIA 3DKIA 2C31A 1Q7CA 4NZNA 4CKCB 3KQQA 3A10A 4RDIA 2DUWA 1G1AA 4CLRA 2AC4A 5FBLB 4E6PA 1Q0UA 1U9IC 3WMXA 3MB5A 2BGJA 4REQA 1HMYA 4JH0A 1A9YA 2G08A 3AF4A 5GQSA 2ZBVA 3BIXA 5HQ3A 2BGNA 1KEEA 2WVJA 4NZZA 1KPIA 2YL2A 4FR2A 1NBME 1UBJS 2WJGA 1OV6A 4DLTA 4BCBA 2BGTA 5CIYA 4NCIA 1RACA 3C3BA 3R7DA 1KO8A 2XDQB 3N5KA 3SN6A 1EFKA 5D7BA 1P33A 3CLRC 3ZTYA 4JK3A 4UHFA 3ZNNA 3CVJA 3WX0A 1NDHA 5KSWB 3GO4A 4X94A 4EPTA 1UXGA 1D07A 1MX3A 2X0KA 3STYA 3E9YA 4EY6A 1XTSA 3UPDA 3S8EA 1MABA 1PI3A 3DFFA 4B6OA 1K7YA 5DLYA 3AC0A 4DCGA 5D84A 2O8DB 3AU9A 1AUPA 3LBIA 3QELB 2HO5A 1Y7HA 4RANA 4DV7B 2CN1A 2CFTA 1UMDA 4KX5A 4KFTA 2JASA 1K08A 4ZRNA 1TCBA 3LKZA 1AF7A 1J9ZA 4LE1A 1NSFA 3QPWA 2HPZA 3DEJA 3G2NA 2XQFA 2ZVDA 3QU7A 4H7EA 4W5HA 3EDYA 3UANA 1WSDA 2X9NA 4ME6A 3AFMA 2FRDC 2Y4NA 1PVDA 4QNRA 4YUAA 4H3HB 2FWIA 1GPH1 2O7QA 1EBFA 3I09A 3S1LA 1V2HE 1WXGA 1XQ6A 2D8AA 2P2DA 2DKFA 5L3ZA 3KE8A 4UTXA 3WAKA 1AS2A 2C2KA 3I34X 1N6NA 1UXJA 2J8ZA 3EVAA 4S1TA 5GPBA 3H9BA 1OYYA 3DDUA 5EKDA 4ZYXA 1EQAA 2VCHA 1XLVA 4L5JA 4LJ6A 4WLFA 5K2MA 1R9MA 2P2NA 2XECA 1GCGA 4QPJC 2AG8A 1MIHA 4N0DA 4X6XA 1C4WA 3FCUB 2CLIB 4DTCA 1DEOA 3M4JA 5IK2D 3K32A 4PFQA 3C87A 4W7SA 1F14A 2JIOA 2NM0A 1L5QA 2WR8A 2AJLI 4JENA 5ALOA 2A9VA 2XTNA 3SE0A 3ZBPA 1Y42X 2YVLA 4ZHSA 1WZ2A 4DBVO 4DG5A 2WC1A 4YVFA 4C3ZA 4UEWA 3EC7A 1EQ2A 3P9KA 4G8CA 2O5RA 5EMLA 2CNDA 1Z5GA 1FRQA 2O7SA 2RIPA 3DZGA 2QT0A 1I5OA 5G41A 1FFBA 2ZYRA 2IL1A 1RRFA 5LJLA 2GPJA 1P0CA 3V46A 4E30A 1WUJS 1AIPA 1P31A 3IKLA 4CT5A 5ALGA 1L5HB 1WNTA 2BHSA 3DVAB 4PS1A 5K0ZA 1E5TA 1FNDA 3LCRA 5C52B 2PNFA 3O5AA 6REQB 1KI2A 2QSZA 3BF7A 1QV7A 3P9QA 4HWGA 4NYJQ 4S1PA 4ZAWA 2B2NA 2PQ0A 3STUA 4BGVA 1OH6A 3O1JC 3TRHA 4A8TA 4CTOA 3S1SA 2FY8A 3PLAE 3AEQB 4GZMA 5JVDB 2JGRA 1RXEA 2GXSA 1MX1A 3FXAA 3FPLA 4FSDA 3WA7A 1Z33A 2GHRA 2B20A 1SOVA 1ILWA 2QRVA 3NTUA 2OUIA 2XMZA 5JEEA 1JB1A 1NWHA 1CQZA 2I1WA 4COOA 4FHCA 1MDBA 4HJXA 4M53A 1D5WA 5ENDA 4ESHA 1DFHA 2O4CA 4KYUA 3ZEIA 1ZNQO 3JQ8A 3UJPA 4DANA 4YCAA 3VX3A 3IO5A 1H3EA 3AV0B 4R0VA 1HT1E 3RYTC 4ZT4A 1MRNA 2VIIA 4KLCA 1UJCA 2QNBA 1SZCA 2QM3A 3QJYA 4L8WB 4LHEA 4WW0A 3EPKA 1ZQ1A 3NBKA 2PJUA 2JANA 3TINA 3ZI7A 3IE1A 4MW7A 2ZRDA 5LP6B 2DQSA 3MM4A 4AS3A 1YJAA 2WFLB 4FKBA 2GXUA 1JFSA 4I3HA 5CYPA 5F73A 3C6KA 1AKEA 1O4WA 3IA7A 1DADA 4NBWA 4J7UA 1CB7A 1GJRA 3CT4A 5BNFA 3SFZA 3UQYS 4AN4A 5CEJA 1WE2A 1BJRE 1Z16A 5DHQA 1YZHA 1QSGA 2LVBA 4RGYA 1T2AA 1SG9A 3KG2A 2FLWA 3GFFA 4NC9A 4PX2A 3MAGA 2DHQA 3KK0A 4JYPA 1XTIA 2HRDA 1U0BB 4BP9A 3FHTA 2VOJA 2NADA 2D2IA 5JFOA 5FWXA 3L7JA 1VM6A 5JZOA 1MH1A 1RJFA 3WGYA 1T36A 3AL2A 3NDJA 4RQUA 1SD2A 4XOIA 4HOYA 5B2FA 1AC5A 3TLCA 2UVPB 1OZFA 3GGPA 2VYVD 2G80A 4HN4B 2D0PB 3A2MA 1CEQA 1GG8A 3C7KA 5D85A 3SZMA 3WLNA 4UTPA 2R8OA 5F77A 4C0KA 4H4DA 3QVTA 2I6SA 4TLBA 1AGXA 4LFCB 4KR6A 2IE0A 3GQVA 4K46A 1FMTA 5F9FA 5ALZA 1KO7A 1TM2A 3D6AA 3ICCA 3M82A 3UAGA 3QX7A 3AKYA 2G9UA 3F1LA 2WD7B 3OPMA 4EFKA 1N2ZA 2R751 5KOIA 4X8OA 5KBYA 3D0KA 2Y05A 1XWFA 3UNXA 1JJIA 1U81A 1CUAA 1UZAA 2RGYA 1WDWB 3EW7A 2DQZA 5KMGA 2XLCA 1ODSA 2O2DA 3AY7A 3DTNA 4GPBA 2JH9A 2W6ZA 1W36B 5H8WA 1ZI9A 2GYUA 3TAHA 5FUBA 3RVLA 2NVUB 5DHAA 3BVPA 3QPDA 2I1QA 3B2QA 3F3MA 3UJ9A 4BNDA 2WLSA 1EIZA 1WXQA 2O2JA 4MQBA 2WSSA 3GRZA 1ZUNA 4UUQA 4YK7A 5IDXA 4Q3OA 1P6QA 2ZQ5A 3UK6A 1W1IA 4GL4A 2RHGB 1QHHA 3OOSA 1MXFA 4YONB 2CMGA 1T91A 1RAHA 2R9VA 2V9CA 1AKWA 3IDOA 4OI1A 4BMYA 2OOSA 1YZQA 3CLTD 5I3ZA 3RHZA 2ZT7A 5B6JA 3SIWA 2C9MA 2FUCA 1X7YA 4F6RA 1EXNA 2FKNA 3CWQA 4HWRA 3ZI0A 4OSPA 2RE8A 1J2YA 1LWOA 1UEJA 1XMJA 3OWOA 3KHUA 4B09A 2NUBA 4PFSA 2OHOA 4EECA 4R2KA 4FX5A 2FH5B 4UTOA 5IJ0B 5TPZA 3F90A 1U0JA 2ZIZA 4CXMA 3V4ZA 3BE6A 3VZCA 1GGKA 3FYSA 3NNNA 2MR5A 3ND8A 4YWHA 3H1FA 1YUMA 1JHDA 1QCCA 4ZVLA 3DKKA 3UMFA 5JY6A 3LA6A 5PGMA 3KQLA 3THXB 2QRZA 2AOTB 2GEFA 2GPSA 2OK8A 3AP1A 3P1JA 1NMSA 3KDAA 3NEAA 4J8PA 3A2LA 2LIPA 4TTRA 4WK2B 2OPHA 3SEFA 4R9SA 1W0JA 2V5AA 3CO5A 1UK7A 3JQ9A 3UUGA 1WJGA 3LUBA 1B0PA 5FI1B 1SKYB 4DPKA 6GPBA 1T15A 4BVAA 1AG9A 4BO5A 1I5EA 1LPAB 1V95A 1AT1A 4M37A 3NYQA 1E1KA 5D3ZA 2R8RA 5JAMA 3REFA 1O58A 2W58A 4TKLA 1NP3A 4MV4A 3D6TB 2YYSA 3F47A 3CX7A 3OEHD 1Z0JA 2JJ1A 3OJOA 5LYYA 3RIYA 4XIJA 5CYOA 4BBZA 4RVDA 5CFZA 2VO1A 3QLTA 4ARZA 3JR3A 4MUHA 1REQB 3ML1A 4NYMQ 1NJ5A 4C0JA 4E12A 1ST3A 2IHNA 3OTHA 5CVTA 5E6RA 4Q7QA 2ZW9A 3FZEA 3W1WA 2VDNB 5LB4A 2YWXA 3P9NA 2LW7A 4WJKB 4NR0A 4BZWA 1Z2AA 5F52A 4RHYA 1U5BA 2Z98A 1X15A 4JT9A 4UOZA 1L6IA 4ALMA 1D2EA 1UEIA 3WIUA 1NSYA 1VYVA 1JIUA 3Q1LA 1EZZA 4C7MA 2GZ1A 4MW6A 1PQWA 4HAOA 2G83A 5GONF 1SD5A 2JZOA 4OBWA 4PINA 1OU0A 3IAUA 3K8YA 2AK2A 2C83A 4HYQA 4IV0A 4ZALA 1F7UA 1C1HA 3VKWA 1K0FA 1VKZA 3N2LA 3TIVA 3IXQA 1SAYA 1J0BA 4LJRA 3RGGA 2QVYX 5BMOA 1NY5A 2MYPA 4J91A 3IQFA 2OV2A 1R74A 3CN9A 1FRZA 1ESZA 4EHJA 2BT4A 1MW8X 2WVAA 3ASUA 3TSZA 1ECPA 3VHRA 1XJCA 1NX9A 3GIWA 3NAMA 4KH0A 1B8VA 5HTOA 2BFDA 1P2SA 4CKEB 5I7EA 2XCTB 4L4SA 3KZCA 1BC5A 1TIBA 4JELA 4US0R 5EUMA 2N42A 3ZCUA 4C03A 2ZJ7A 2VQEB 1JXOA 3P0EA 2L82A 3MBIA 4J4TA 4BYMA 2NO4A 2PWBA 3LF1A 1OFUX 2WJWA 5H9VA 3K71B 2IUTA 3IQWA 5HDQA 4CCSA 3H3FA 2CK3D 4LRSB 1O95D 1C7IA 2W4QA 2Z8XA 4MPPA 1U4SA 2AFIE 1HDEA 1NW8A 4WBXC 3CKYA 3RK0A 4G0UA 1MV5A 3BBLA 2J3DA 1F4VA 3E82A 4ND8A 2V03A 2BW0A 4NV0A 3GP3A 3WXMA 2YNMC 3U81A 1CUEA 1KZYC 1QV6A 4ALJA 1WABA 3IUMA 1WETA 3DE2X 5IAGA 2A9OA 3OCWA 1Z39A 3AEXA 3Q15C 2NO9A 1YS9A 2NUTB 4XE5A 4WNIA 5D1NA 3JYQA 3SXJA 1FTYA 3NB0A 3OHMA 4B6QA 4Z4CA 4P53A 4OOEA 2V7GA 2ZPUA 3B52X 1C3OA 2GAIA 3UHOA 1YE3A 3L7MA 1G2PA 3DHWC 4YT8A 1VL1A 4NOJA 4YQYA 1ZD9A 3ELDA 4G0MA 2BEJA 1Z4QA 2ID4A 4IHQA 2YW9A 5CH8A 2JIRA 3V5NA 3MJVA 5DV9A 3EOBI 5EE0A 3RYCB 3VU0A 3EXG1 3OMWA 2G4LA 2ZBPA 1U99A 2VTVA 5JZSA 3RC9A 3SU8A 4LK3A