4KO5A

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/w48l/v95i/y108f)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNLVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/W48L/V95I/Y108F)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ko5A00
1URIA 3WG7B 1MG3C 3FS9A 3WKPA 4A68A 2IDFA 1JZIA 3IEAA 1A4CA 4YL4A 1PLBA 1JZGA 2BP0B 4A2FA 2WSDA 2UXVA 1OF0A 4E9VA 1RCYA 3JTBA 3FSZA 3UACA 2UX6A 1CYWA 5FC9A 1DZ0A 3FU7B 5B1BB 4DP6X 5B3SB 1AG0A 1PZAA 4DP2X 1L9RA 2BP0A 4YSQA 1GS7A 4BXVA 3X2QB 5AZUA 2FQGA 4JKNA 1E65A 2JXMA 2VW4A 2YAOA 4AKPA 4BWUA 3S8GB 1B3IA 1JXFA 2FNWA 1E67A 2YAFA 2J5WA 2EINB 4PAZA 5I5MA 2IDSA 3FU7A 4YSCA 2VM3A 2XXGA 2XU9A 3ABMB 1N70A 1NZRA 5B7FA 1A3ZA 3PAVA 5AFAA 4KOBA 1MDAA 7PCYA 1GS6X 3EH3B 3EH4B 4W9ZA 1WS8A 4YVNA 1OCRB 2HX8A 2PPAA 5D4IA 5I5JA 1WS7A 2VM4A 3AG2B 1MZZA 3NP4A 1AIZA 1JVLA 4QKTA 3ZIYA 1SFDA 3AW5A 2H3XC 4HALA 1MG2C 3QPKA 3EHBB 2Y69B 4HCFA 2IH9A 4YSDA 1PNCA 2GBAA 2ZOOA 3UABA 2DYRB 2BZ7A 2IWEA 2AVFA 3CVDA 1DYZA 1EHKB 4E9YA 1ET7A 2IAAC 2J56A 1JOIA 2Q5BA 4G7RB 2CJ3A 3ZDWA 6PCYA 1OE3A 1SF5A 1J9TA 3FSAA 4BDVB 3X1NA 2PCFA 1L9OA 4F2EA 3U25A 3X1EA 5TK4A 2VW7A 4TXVB 4M4RB 2B3IA 4YSOA 2FT7A 2HXAA 3WNJA 3X1GA 1M9WA 2GI0A 3AG1B 4BDVA 1BQ5A 1AZBA 3FT0A 1OE2A 2DV6A 1BXVA 2FWLB 1GS8A 2H5UA 4JHVA 1PLAA 2I85A 2DY2A 1J9RA 1CUOA 1AS6A 2BW4A 3DKHA 2YXVA 2OJ1A 4G72B 4L0PB 2FQEA 3WNIA 2YXWA 1JVOA 1ASPA 2MRYA 1SHXA 1NPNA 2XX1A 1WA0X 1JZHA 3NYKA 4EF3A 2EIJB 4KO5A 1BYOA 2CALA 2BHFA 1UATA 3OD3A 2AANA 5I6OA 1PMYA 2VW6A 1L9QA 4YSUA 1CYXA 1NIBA 1R1CA 1I53A 4M3HA 5F7BA 3PAZA 4RH4A 1BXUA 1PF3A 1ILUA 2MTAA 2X87A 2EIMB 3X1FA 1SJMA 1A65A 3IN0A 3GDCA 3T6WA 2EIKB 5I6LA 4F2FA 4GYBA 3NJIA 1JERA 2PPDA 1NIFA 1X9UA 1ETJA 3S3BB 4AKOA 2Q9OA 3NJHA 1J5DA 5I6PA 3G5WA 4GXFA 1JXDA 5EHFA 4DP7X 3EF4A 4K9JA 4DP8X 3V9EA 1JZEA 2FT6A 4PCYA 2AZUA 1OCOB 4GP4B 4DPBX 3FQYA 4X4KA 3QJQB 3IN2A 1PZCA 2FQFA 1KV7A 3FPXA 4DPCX 1W6WA 5D4JA 1GY1A 5ANHA 3FYIB 1ASQA 1FWXA 1SNRA 5E9NA 1GR7A 1IUZA 2GHZA 3S3DB 4AZUA 1A8ZA 5TK2A 1AACA 3WKQA 3AY2A 4DP1X 2VSMB 4NB7A 2WO2B 2BWIA 2XYBA 1KCWA 2QPDB 4A66A 2TSAA 2XUWA 3DIVA 3SBPA 4YSRA 2AZAA 1NDTA 1WA1X 1NTDA 5B1JA 1PCSA 3NT0A 1QLEB 2OCCB 1KDIA 1HFUA 1FA4A 2IDTA 2OV0A 3H4FA 3PPSA 1F56A 4F7KA 3UAAA 3JT2A 4AI7A 5I6MA 2IH8A 1BQRA 5PAZA 1SDDA 2YAQA 5I6KA 3NJLA 4N4YB 1ET5A 1QNIA 4YSEA 3ABLB 2YAPA 2HZHA 3FU9A 2GIMA 2XV0A 5I28A 4DPAX 3NJFA 3CVBA 2CUAA 1RKRA 2R7EA 3QJTB 2ZONA 4P5RA 1GY2A 3CG8A 3CVCA 2N0MA 1ZDSA 4W1TA 1NWPA 3D12B 1YLBB 1PLCA 3QJVB 2BO0A 1ID2A 2NRDA 3ERXA 3QQXA 4YVUA 3T6VA 1M57B 3QJUB 4YSSA 4DP5X 1AZUA 5F7AA 5B7MA 1IC0A 3OMIB 4A2EA 2XWZA 1XMEB 1XB8A 3OM3B 2TSBA 1HAUA 3WIAA 5A7EA 2UX7A 3FPYA 3V9CA 2XVBA 3OQRA 1JZFA 2VN3A 1AQ8A 4QLWA 3CDZA 2HX9A 3GXUB 3ABKB 1TU2A 3H56A 1A4BA 2PPFA 2IWKA 1AANA 3ZX1A 1KYAA 4MFHA 3L45A 1OE1A 4E9QA 2Y1AA 1BYPA 3NJMA 3KW7A 4Q89A 2QDVA 1J5CA 1NINA 2IWFA 3C75A 1M56B 2H47C 3SBRA 2W8CA 4KNTA 1XB6A 1AOZA 1HAWA 5I26A 2BP8A 3QJRB 3FYEB 1GSKA 4HHWA 3UADA 2IDQA 4KO6A 1WAEA 4G7QB 2QDWA 1SFHA 2PPEA 3FSVA 2YARA 4KO7A 4FAAB 3NJNA 2BWDA 3ABGA 4GP5B 1AZRA 1PY0A 1N68A 4P5SA 4UANA 3NJGA 1V54B 2XX0A 4DP9X 1AG6A 4HCIA 2UXTA 1RZQA 2P80D 3HEIB 1EZLA 1ADWA 3NSYA 1NIAA 4ZK8A 3UGEA 4BWTA 1KGYE 4E9XA 1XB3A 3HB3B 2CBPA 3MBWB 3QJSB 5B7EA 2GC7C 1NWOA 3KW8A 1PNDA 3FSWA 3OMAB 4HIPA 2XXFA 2QPEB 3N55A 4G7SB 1BEXA 4KNSA 1BQKA 3ASOB 4YSAA 3PCYA 4YSTA 4KNUA 2RACA 2PCYA 4AKQA 3N2JA 3CZUB 2XV2A 2DWSA 5AKRA 5I6NA 3BQVA 1SF3A 4AX3A 2GC4C 4ENZA 2J55A 2CCWA 4BWWA 3FQ1A 2YAMA 2FQDA 5I5IA 1BAWA 4FA7B 4E9WA 2HRHA 3PLYA 3S8FB 1ET8A 4WKXA 4N8UA 2BW5A 2I7OA 3BVDB 1IBZA 1ZV2A 1L9SA 1SDDB 3GYRA 3ASNB 6PAZA 2IDUA 4BK5C 1OOWA 1AAJA 3AG3B 3S3CB 1ZIAA 4HAKA 1TEGA 2DWTA 2ZXWB 2JFCA 2GSMB 1W6LA 1ZIBA 5PCYA 2PP7A 2R7EB 4A2HA 1NIDA 2E86A 3AG4B 4KOCA 4A67A 4E9TA 3TBBA 2PPCA 4Q8BA 1L9PA 1X9RA 3IE9A 2HX7A 3SBQA 1GYCA 2X88A 3WI9A 3OMNB 3T6XA 1TEFA 1VLXA 4KO9A 2W88A 1L9TA 4NERA 3ZBMA 2HLEB 5IY5B 1ZPUA 3NP3A 3MX0B 4DP4X 4HCGA 1CC3A 2PP9A 3NJKA 2FTAA 4CSZA 1AS8A 2WO3B 1AS7A 2FT8A 4G70B 2I7SA 1E5ZA 1OV8A 3PXLA 2XLLA 2BZCA 3PAUA 3CDZB 1PZBA 2VMJA 2FJSA 2LLNA 3EH5B 1J9QA 2YAEA 8PAZA 3NJJA 1SHWA 3RYMA 1FFTB 2UXFA 5LDUA 1BXAA 4CSPA 1V55B 1E5YA 1QHQA 1AR1B 5D4HA 1KBWA 2B08A 1JZJA 3T6ZA 4HZ1A 2PP8A 1E30A 1RZPA 3H4HA 4YSPA 1KDJA 2BP8B 4JHUA 2P80A 3T9WA 5B1KA 4GP8B 1IKOP 1KBVA 1ZDQA 4G71B 2PLTA 1A4AA 3UAEA 3X1BA 4DP0X 3FQ2A 1KCBA 2AFNA 3TA4D 2JKWA 3NSDA 4A2GA 3IBOA 2HRGA 4A2DA 1T5KA 4BXSV 3AZUA 5B1JC 4HHGA 1NIEA 1OCZB 2CAKA 2XV3A 5B1AB 3TU6A 9PCYA 2A3TA 2DYSB 4GY4A 4WTQA 1WA2X 2EILB 1JXGA 1AZNA 3FU8A 7PAZA 3NSFA 2GB2A 1NPJA 4E9SA 1IBYA 1AZCA 2UXGA 1GW0A 3DTUB 1ILSA 2VSKB 2YAHA 4E9RA 1CURA 1PAZA 1J9SA 2QT6A 1V10A 3T71A 3TASA 3TBCA 3SQRA 1ASOA 2J57A 1NICA 2ZWNA 1TKWA 4UF7C 1OCCB 4NAJA 3NSCA 1W8EA 4UAHA 2YQBA 1MZYA
chains in the Genus database with same CATH superfamily
3PWPB 4Z7NF 1KBGH 1UGKA 8FABB 1J7VR 3ARDD 2IDFA 4M48L 3BW9B 2VN6A 2WWKO 1P7QA 1PYWA 1WFTA 4N8VG 4AGPA 1DUYB 2N01B 3SSGA 1YNTB 5CBEA 1DE4A 1CL7H 5DUJA 3QNXB 5L2KA 2XWJA 4KRPD 4JFWA 4C4UA 4YDVA 5L2KE 2AAAA 3NCCB 4DP6X 3QDGB 3DETD 1AG0A 3FOLB 2Y06L 2WTRB 4DP2X 4D2NA 5IGXH 4JGNA 3SDXB 4NQCA 3F7YB 2O4EA 2WQVA 4BXVA 2VRQA 3AJ7A 3VM7A 4NQCE 5EOTB 4WEUD 1C7TA 3BLKA 4XNUL 3AWFA 3PY9A 4BSVB 3SKNA 4OCWL 2Z65C 4EPSA 4DN4H 1IAOB 5I5MA 2V3DA 2XXGA 1I3GL 3GSWB 1UM6H 4DKEL 3IMWA 4B9CA 5IFHL 1KGXA 2LU5A 1A3ZA 4G1EB 4WWKC 3RZCD 4GAGL 1UJTA 4YLCA 3GXMA 4XN2A 4PG9A 4TSAH 3W2DH 3ZLQC 4N6RA 4N90D 4YVNA 5IK3B 3B37A 4KKCD 4Y4HA 1IM3A 3OTTA 4Y7OC 3SOBH 2VLKA 1AIZA 5ID0B 5KUKA 2FH8A 3KVQA 1S9XA 1R5VB 2VLKE 2NY7H 2PCFB 4K3EH 3MU3A 1UB6A 1UD3A 3HI5H 3JV4A 4XE5B 2G4GA 2Q10A 2BZ7A 2IO5A 3HHSA 2Z31C 4FA6A 4ONHB 5FUZL 1EHKB 1ET7A 1HH9B 2YSTA 3BAYA 1A25A 1NGQL 1FAIL 2YGNA 1OE3A 2HH0L 4XNDA 2Z4TA 4KROC 3BJ91 3X1NA 3SQOL 3CVIL 1NPUA 2JCCA 5J6GA 4RMSA 1AGFA 3BZDA 2SEBB 1AFVL 3UTPE 4LSUL 1GXEA 4G7YL 3X1EA 4GW1A 5CD3A 4YHNA 2YOAA 2ZP8A 1GVIA 2R0ZL 5EH1A 4J3UA 3GF8A 3M86A 1F13A 1FIGL 4YSOA 4XXWA 3ZRCC 2OCFD 4HGKC 1RIHL 4MAUL 1X5FA 4XHQA 4PMFA 3QUMH 5IOKA 5CNHA 1WFJA 2FGWH 5F6IC 3ULVE 4JPSA 2D8KA 4F7TA 1CTOA 3MJGX 3IGKA 4W93A 1FGNL 5DJ2B 3V7AE 3QORA 3GGWB 5K9KB 1C9SA 2Z92B 4M6ML 1W0VB 3UDWA 2R56L 3MGTB 4O02B 4MCZA 4E68A 4L4VA 5FECA 1JVOA 4TS6A 1JFQL 3EJUA 3OLIA 4EMZA 1U95B 2RH0A 4L4VE 1UOKA 3LEVL 3KYKH 4U4BA 2P44B 5IVOA 3MJ8A 3AXLA 3MCG1 1AOHA 3OD3A 2ICWJ 4QRUA 1P6FA 2CD0A 4NO5B 1P7QB 4WHYG 4UILH 2ZG3A 2P45B 4K7PH 1LO0H 5TF1L 1CFQA 4HULB 3Q6GH 4Q74A 4NJ9H 4ISVA 4OAWA 4FFYA 1MI5B 1Z9LA 5F7DB 5C8JB 3CDYA 3E38A 3EJZC 5L8JB 2XWJB 1MCRA 4YDVB 4GKLA 3D39D 1A65A 4JZNB 3O4OC 2P43B 5FHAL 1ETB1 2ZIDA 5FDWA 2OSYA 4F1SA 3CSYA 4FG2A 4NQCB 4A7QA 3FQXA 3I3DA 4LLQA 3GEFA 3PGDA 1U33A 5DEFB 3FQUB 3GKWH 3L4ZA 4JFFD 5HHVH 4XVJH 1FG2B 3SKNB 1DBAL 2WB1A 1YRKA 2FYVA 4OU3A 4QWWD 5AYTA 2LLLA 1FP5A 3ASWA 5IB5A 1ZHBA 4PJAA 2DQJH 4FNUA 3QI9A 2CO3A 3LXAA 4XNMB 4M93B 2YPVL 1Q72H 1I4FB 5ABAA 4PJAE 1QOKA 1NBVH 2HTLD 4PG9B 4XPHL 1OZUA 1BREA 5DFWH 2YD2A 2FLRT 3O2DH 5TK2A 4AE0A 1UD2A 4Z7IA 1GAFL 2BP5M 2CQVA 2UUDK 4H0GA 4WKZB 1KXVA 2CMRH 5E0QA 4LRNL 1BW8A 1F5WA 1MJ7H 4A66A 3QP3A 1UB6B 2WYHA 4HBCL 1CDYA 2AZAA 4DK5A 3GO1H 2Y7QB 4UNTA 5DC9B 2A6KB 5G2NA 3HHSB 2BRRL 1PZ3A 3DVGA 4X9BA 1HTYA 1ROCA 1S3KH 5HI5D 4BQ6A 12E8L 3APFA 1F56A 3DGCR 4O58H 3S4SA 1EFXA 3Q44A 1EAJA 2GJ6D 4KKAC 5HDRA 3MYJA 2MCPL 2IH3A 2X4TA 4AYEC 4Z3HA 2JCCB 4IRSC 3VFRA 3RA7H 1UFUA 5LJYH 3ABLB 3QWRA 4GAAA 3V0IA 5CD3B 5IHBA 3UG5A 4YHNB 3OHXC 1UADC 4DPAX 3SDAA 3MRGB 1I3VA 2CDEA 3CG8A 4CSSA 3LZOA 5ILTH 1WZLA 3SODB 5E2VL 2VDNH 3EAKA 4PJ8A 5EV7A 4ELDA 1UM4L 1EUTA 4OLEA 3VA2C 4GINA 3AFLA 5MI0C 4F7TB 2OYLA 3Q6FA 1LD9A 5GSVB 4Z7AA 4QRBA 5DHYA 3CHQA 3PDOA 5T5FL 3SKJH 1BMWA 3QORB 4P3WA 1GYVA 4Z77A 4NNPH 2F5AH 4EXPX 4TVPD 2PNDA 3QCUL 4MCZB 1NFIA 4ALAH 1FNSL 1MH5A 2CRZA 3S35X 4P5TC 3T65A 2C26A 4XVTL 1E4WH 3DI3B 3MJ8B 1HSAB 4PRBB 5IJDC 2G4EA 1MEXH 5TGBB 4QRUB 3DARA 5T33L 2G0LA 2CPUA 2AJYH 1S7RA 4FX5A 2IWKA 2ZWZA 2C9VA 2V37A 1DBKL 5CEYA 1WEJH 1CFQB 4ELKA 5DYOA 1ADQL 2EDXA 2PMZA 5JW4R 4ISVB 1H3PL 5EOQH 1S9KC 4LAQL 1GCFA 2FJHB 2XHNA 3IRPX 5DMGC 1GZPA 2DJ4A 2H32A 4MMYA 2E27L 2ZSVB 1AE6H 4B9PA 2AJXH 4FFWD 1HILB 3ZT6A 1MIEL 3QBTB 5FDWB 2YD1A 5I1HL 5K9JL 3GD1C 4C47A 3QFJA 2LW3A 3UZEA 1EXGA 2Z35A 4EI5D 1KTLA 2ZG2A 5K59F 3QFJE 4GI9A 1U8KA 2XV6B 4KKLC 3QNZB 4OZHB 4ZMVA 4HJJL 1BX2A 2GABA 3ARPA 4PP2A 5J3HC 1KN4H 4MB1A 4UANA 4WWNA 2MCMA 3DSFL 2X6AA 2ZPKL 3BRDA 2EE6A 3F84A 1ZHBB 2P42B 3W82A 3DX9A 4PJAB 4HF5L 2P80D 4ZS6D 4KY1H 5BPPA 1MJJB 3BT2L 5JPMC 1WWCA 3BPOB 3MBWB 3UJIH 4ZXBB 1MJUL 4JCWA 4IKIA 2HAZA 3QPQC 1CXIA 3E1F1 3OAUL 3BQUB 2X0UA 1ZVSA 3D48R 1RJLA 3KL3A 5DMIL 4WO4D 1TDQA 3ETTA 4IU3A 4J3TA 2ADFH 1VFUA 3MRFA 3WJMB 3UMTA 5I6NA 1UYWH 2GC4C 4KVCH 4LLMB 3C9NA 4A7SA 1THAA 1TSRA 4K8RD 3DHMA 4LOFA 2XZCH 3S4SB 4MMXA 4Y88A 2CJTA 3ATBA 1Z9PA 2X4TB 1TTAA 2LV4A 4D0BB 4YX2H 1P84K 4Z5RA 1OOWA 1AAJA 4ZOCA 1JE6A 2E9JA 2V5YA 2P9RA 3FW6A 3CCHB 1FL6A 4WWOA 3VX0A 3AAZA 2PP7A 1YY9D 3MBXL 5CUSL 2CDEB 4HPYH 1GJWA 5KVEH 1RUQL 2X6CA 2VZTA 5C92A 1EIBA 3TWCL 2WCGA 3VD2A 4UOZA 3FQ4A 1D7BA 1OAZH 1UEMA 4Z76A 3MJ9L 5D7KE 3ZKMD 4ACPA 4XP4L 1OSZA 5GHWL 3CPLB 4XVUD 5DHYB 3PDOB 3VFNA 1DVZA 1K2DA 1MCQA 1JNNL 3QRGL 4MA1C 2VLJA 1NFIB 1V3KA 3BFWA 4MGXA 2FSDA 1MH5B 3TH2T 1Q38A 4Y4FB 3MLYH 3RPIB 4YXLL 1F4XH 2VLJE 3T65B 2MOGA 4R8WL 5B1CA 5IQMA 2X3CA 2V8MA 3C08L 4WUKL 1XCWA 1JSYA 1S78C 1UUSA 3C09B 3RIAF 1S7RB 3SPGA 3TNNA 2XZQL 3AREA 1PTZA 1QEWA 4YZFF 3PNWA 5CZVL 4AYDC 4ELKB 3GHBH 4GMSL 3CV5A 4OFYD 2YPVA 2DJUA 3GM8A 1GZPB 1WC7A 2H32B 4FQHA 4RDQF 4YSPA 5A3IC 4MMYB 5GIRA 1J5OH 1AP2B 4ONOA 1G5GA 4B6ZA 5IB2A 1RIVL 2R1WB 2GVYA 4UQ3A 4G6KH 3L48A 3QFJB 1MFAL 5GISH 3QUXD 1KBVA 2Z35B 1U8KB 2PXYD 5LXGH 3UAEA 3UPAA 1XTMA 4PP2B 3SDDD 4ONGL 3LQZA 4UIMA 3IMBA 1S7XA 4M7JL 2YMXL 3RWDA 5BW7C 1MFUA 3AZUA 5LGJA 3NN8B 4JG0H 4OF6A 4XZ4A 3RVVD 3WIHH 2HT4C 2JCWA 2Y7LA 4DHLA 2FX8H 3BVVA 5DD5H 1JXGA 2OXHA 2X9XA 1ZVSB 2A9AA 2Q2LA 2WY3B 3ARFC 3FJTA 3N1FC 1ZLVH 4XNZC 3LXUX 3T0XA 1UH2A 2WXMA 3FCGA 1IQWH 3F7VB 4IU3B 3H9ZA 4JDTH 4MQ7A 4OCLC 4V1DA 4X0KA 3MRFB 3DTUB 3AABA 2AHIA 2BVOB 1AJ7L 1EGJH 1FL5B 3LNEA 4OJFL 1J1PL 4EI0A 1U3HD 1D5BA 2YWZA 5T5FA 3P2TA 4PJEA 4KMQA 5ITBH 4ZX5A 1L7IL 2ZWNA 1TQUA 4UF7C 4XO3A 5D8JH 3VE0A 3IDGB 4PWKA 4PJEE 2HWZL 3ZZLA 1FRGH 5IIEA 4WSKA 2WXRA 4Z5RB 1E9OA 4YLBA 1GJUA 3I84A 4D9RE 1OOAA 1FL6B 3L13A 4K71B 4L05A 4Z7VF 5HJ3A 4JUSA 4PTUA 1XSIA 3AAZB 2B16A 5JMRA 3MROA 1KC5H 5FCUL 1E6JH 3V0JA 2X38A 3F8UB 4HKXB 3QHZL 5ESQB 5KTEH 5DRZB 4DW2H 2VSDA 3VI3A 1ZT7A 3K4ZA 5F6HJ 5T3XL 2QELA 4ZG1A 1EAPA 4MXWL 1E4XI 3VI3E 2GK0A 2OQJA 5ABDE 4Z76B 4X5LA 5IB1B 4I85A 5ID1A 3HNVH 1OSZB 3P73A 4M3KB 3HAEG 3QEHA 3Q1SH 4PLJD 5TDPA 5DHMC 1BF2A 3VFNB 2XKNA 3MRIA 1GOGA 5E1AA 2W9DL 1K2DB 5L7XH 1SHSA 4OGYL 4MXVF 4J7RA 3CFBB 3M8OH 1K5WA 2BSDA 3FB7B 1MCPH 4QXTA 2MFNA 1X9QA 1D5IH 5IT2H 2PWGA 2JMRA 1HX0A 2IQAA 3ABMB 3GSOB 5L4IA 5J11B 1MNNA 1DQLL 1OD7A 1XXFC 4KQ4H 4Y1AA 5KSAC 1XR8A 2R15A 3AREB 3TNNB 5JOPD 1WWAX 1QEWB 3GHEL 1GS6X 4OCSL 4Y1AE 5CO1A 1L0XA 4Y0GA 1OSEA 2Q8AL 1JPFB 5B38A 2G60H 4B3EA 4JFUA 1UWEH 1WC7B 4LNRB 5E0FA 3WLWC 1INEH 4QOKB 4PV1C 3G6AA 1XBRA 5IB2B 4E0RA 1J05B 1Z2KA 3ESMA 2QGEA 4UQ3B 1WD9A 3UABA 2FEDD 3SO3B 5HDLA 1KXTB 4R0LC 3CVDA 3HFML 1KBKA 4M7ZC 1QEXA 2CIIB 2ZTBA 4GAJH 1SDAB 5CHNA 6PCYA 4RNRB 2ZOKA 1A1OA 4NKQB 1MHHB 3LQZB 4K9EL 2LU7A 1O6TA 1S7XB 4X4XA 1WRFA 2PF6A 2DKMA 3EJYC 4WV1A 4Y1TA 5GRUH 3RKDC 1NCWH 5DK2B 1NUGA 1VA9A 5CSZB 4DVRH 3NSJA 4IKLA 5C9KA 1DEEA 5IQ9A 1HU8A 1G87A 4FQXB 2OXHB 4LSSH 3KJ4C 3X1GA 4YGVA 5D5MF 2V3FA 5D72H 4ODWB 4V1DB 4X0KB 2Z7ZA 2GJPA 3WOVA 5C0BD 2JKRM 4I9XA 1EZVY 1MWAL 3QRBA 4MDRA 1RXLA 2GG1A 3MJ9A 3GLAA 3MI6A 3NPSB 2HFTA 2NW2A 1L6PA 3D2TA 1D5BB 3D4CA 3Q8EA 4JO1L 1ZKAA 2GBUA 3MOQA 3U1SH 1KMGA 2JIXB 1UC6A 2OP4H 4L0PB 4YHKH 4DGVH 4QO1A 1E9OB 1I1YA 2A0LD 3HLAA 4QXGL 2P1YA 3VTMA 3RWEA 1J12A 4OV5A 1FZKA 4W70A 2V9RA 3MA9H 5HJ3B 4PTUB 1B2WH 4UTBL 3RI5F 4HK0B 4M1CC 2JE8A 4DKDC 4S1RL 3ESUF 4HJ0D 2D73A 2QSCH 3VI3B 1ZT7B 4BV1A 1CF1A 1EAPB 1RVFH 2AKRA 2MQCA 4Q9CA 2EABA 2BFVH 2GK0B 1CPUA 4NOBA 3IPEA 5C2UB 3X1FA 2DTSA 1MFBH 3HR6A 4OGXH 3EO9H 4TQIA 3P4OA 4JMXA 5E7BA 2AK1H 3P73B 4GYBA 2QVFB 1FV1B 2VO5A 5DT1H 2XKNB 3D33A 4L37A 3RZCA 2LABA 3CXHJ 5E1AB 1AR1D 3PDGA 3PE9A 5JO5A 3D0VB 1ZVNA 4IBQA 4M7LT 4K9JA 5AB0A 3BSHA 4I2XB 5HTSA 3QQNA 2JKSA 4U7KA 1QACA 3EFDL 1U93B 4OF3A 1RUKH 5DS8A 4Z95L 2A9ML 4G8IA 4KI5F 2IQAB 5ICUA 4JDEB 4ZJ9A 3P0YH 4HIEA 4X4MA 2XQYK 5IB4A 4JRLA 3L3GB 1GHFH 2F54D 4P23D 3RE0A 3UYPA 2A2QT 3VTAA 4KJPD 3BWAA 5B38B 3KL0A 4X6CA 2GHZA 4XC3H 4FI6A 2PCXA 2OI9C 5HHMD 2VISB 3MRNB 3MXWL 5CIPH 4X6CE 4Q2ZA 2R69L 4WU5A 1UT1A 4E0RB 4U6VL 5FO8A 1T7YA 4BK4A 3SBPA 4ZW5A 1N0XH 4LHUA 1WA1X 2ZX7A 1OTTC 4B60A 5FUOL 1CGYA 1YPZA 2DLFH 4XNYL 4NQDD 1XH0A 2HT3D 4RSYA 2IDTA 4TOYH 3D08A 2D9CA 2YZ8A 2ICEA 4GXVH 4KBPA 5CHNB 1SBSH 5HHOA 3RVXC 1A1OB 4NZFA 4XGZB 4BGLA 4X4XB 1XD0A 4PB0H 5HHOE 4WV1B 3NJLA 1LK3H 1QNIA 1NM9A 3C8KA 2KZ1B 3S2CA 4G82A 1E4XH 4U1IB 3VXRA 6FABH 5LDSA 4MYPA 1DEEB 1FH5H 1Z5LB 4OGAC 1AGEB 5IQ9B 1BFVH 4IHOA 4PVMA 4PN6A 5AVYB 3VXRE 4HWEH 5FUCE 1KULA 4OZFG 3ESPA 4OZGF 1CB4A 3AM8A 4L2YA 4ZUTA 3KYOA 3QJVB 2JB5H 4WNQA 5KVFH 4R7LA 3L5XH 2Y6SC 3SDCA 5DJ8B 3KVDD 1JN6A 3ARDB 3QXUA 5IMKA 5T3XE 3TYFA 1OGTA 3B3BA 2NW2B 1WF5A 3L4WA 3OSVA 4JFHE 5E1HB 1NCHA 1NUDA 2H0JA 4AQ8C 2UX7A 4JY5H 5IESL 1LQSR 3OGCB 1OQXA 4QO1B 1I1YB 2ENYA 3HLAB 1HN1A 4KRPB 1S7QA 1XGUA 2HX9A 3QHFH 3RWEB 4OV5B 1CBJA 3D39A 3JSSA 4F9LC 4GSUA 5D7SH 3JUYA 3D39E 1TLMA 3VD4A 2BOBA 2ZX8A 3GRWL 3GI9L 3DK2A 3IDIB 2M2DA 4HK3N 3UTOA 1NINA 2AKRB 1HL4A 3LZLA 1ZLUK 1YMMA 2VLRA 3P02A 3OQ3B 1CLZH 4EDWH 1ANUA 3TBWA 3WFBL 1I8IA 1N2RA 3VW3H 3GINA 3CFEA 1YMME 2VLRE 1BWWA 1IMHC 3D4ZA 4OQTL 1OTSD 1TJIL 2V5RA 1FFRA 2IDQA 3RZCB 5F9OH 8CGTA 5JOFA 4KKRA 5JO5B 4MBRA 3S34H 4NO3A 3WEOA 4GP5B 2ZYHA 1UXLA 2CO2A 2QVTA 4HSQA 1V54B 2NTFB 5DS8B 4G8IB 2XICA 4NCC2 3UBXA 4TLUA 4KTDH 4QXUL 4L8BA 5IB4B 3IS1X 4XCEB 1Z3RA 3FQWB 3CVHL 3QJSB 4IMKC 5BVJB 4D9QE 2GC7C 5D1XD 1UT2A 5GS1C 1RZKH 1T5WA 3BWAB 4X6CB 5KS9F 2BXYA 4APQD 3B9DA 1CT8B 2C9PA 3ASOB 1A22B 1PQZA 2GJ6A 4YSAA 4Q2ZB 3OKDB 4FERA 1N64L 1NANI 5FO8B 3BWUF 2GJ6E 1CICD 1IVLA 3AUVA 3QNYA 4WTZG 2X9YA 1N6UA 1PLGL 1YPZB 1AGBA 1T1XA 1XGYL 1UJ3C 2P26A 3P4MB 5L6YL 2DLIA 3QQ9D 3DHPA 1MWAA 1ET8A 1T2XA 4M8QB 3SPIA 3CAFA 4AGOA 2I7OA 2IG2L 1F58L 4I3SL 5AALA 2VXUH 2JJWA 2WQAA 2XQBH 3CFUA 3ENEA 2IPUG 4ZPVA 2W91A 4UT9H 3HZMB 3N3EA 3S3CB 3RY6C 1JI1A 3C8KB 3RWCA 1H8NA 3SYOA 2JFCA 3FHQA 3BPCB 2X70A 1KELL 3A23A 1I85A 1N5AA 5JA9A 2RHEA 1NMBL 2E86A 4IHOB 4GH7B 4LSVL 5T1KD 3SGKC 3EDKA 5I8KL 2CWRA 3KYOB 1IZKA 1S4IA 4XC1H 5E4EC 5LO7A 3SBQA 1J0ZA 1IGJB 1KCUH 5B8CC 4JPIA 2GW5A 1I1AD 3TNMA 2IGLA 5IMKB 1JN6B 2PR4H 4R3SA 1AKJD 4X7EC 3TYFB 2BH0A 3OPZL 3QXDA 4LLDA 1YQVL 1DVFC 4GQ9H 4OIBA 2XPYA 2M83A 4D9LL 3NJKA 1BQLL 3QAZC 2HP4A 2ZCHL 5EPMB 3VGHA 2L04A 4FKEA 2VDLB 4Y2LA 2Y72A 5KUMA 3ULUF 2WKOF 1EERB 1S7QB 3HMXH 4Q52A 3D39B 4YBLC 4FXKB 4Z3GA 1J5HA 1LXMA 4KU1A 4NQXB 4QYOB 4ORGB 4JZJC 3GI8L 2BOBB 2Y07H 4AGMA 2E7LA 2NY5L 1HOEA 1KB5H 1VESA 4HU8A 1J1OH 3DVNA 2EXYC 1YMMB 2CHNA 3TBWB 1I8IB 1J0YA 2E7MA 3CFEB 4CVZA 2W65A 2NW3B 4G83A 2MKWA 5HDBB 5ACZA 3LDBB 3BP5B 2P80A 2R69A 1WT5A 5JOFB 3ECQA 3VJ6A 4GP8B 4R9HA 3ZGHA 1IKOP 2K6ZA 1SY6A 4TL5A 2XPGA 4NO3B 1RU9L 3LS4L 5DEGA 4Z7QF 4F7KA 3V95A 4HPHA 3EFOA 1SLXA 4JHAH 2BVQA 2HRGA 4FXGA 2ZZUT 4DGIH 2WZ6A 3UBXB 3BZFA 4CA4A 5BQ7A 3P3SA 4L8BB 1CIUA 2Q7YA 4H8QA 1MJ8H 2QZ5A 2DI7A 4POZD 3TU6A 3U9UA 5C0ND 2IMMA 2VXSL 3JV6A 2BNRE 4DK6A 3AT8A 1JS4A 1R5WB 3VWKC 2AQSA 2O5XL 1HK6A 2QSVA 5MERB 1Q9OA 2B3RA 1PQZB 2GJ6B 3QS2A 2HJLB 2YZ1A 4R2GD 3U0WL 4D8PA 4MQTB 1MW3A 3FCSA 3T3PF 5FLUA 3U9PH 5GGVH 1IC4H 5CEZH 2FWOB 3HA0A 3OXRA 4WFGE 3QNYB 5FHBH 1TVBA 5BOZG 4XMPL 5FA3B 2DIAA 1T1XB 4LDLB 5C3LD 3P0GB 4IK6A 3EO0A 5IUSA 3L3OC 1MWAB 3TASA 4Z6AT 1CR9L 2B1HH 1QUNA 4GW5B 2D0FA 4A1RA 3E3QE 4W9JC 4DFHA 2A74C 4ZPVB 1F4YH 3GXDA 1QLEL 5AVXB 1MHCA 4LSPH 4EN3D 2GUYA 3ORJA 3IK2A 4MB3A 3RWCB 3D51A 3MZTA 1PZDA 2X70B 3G6JA 5AOMA 4A7GF 4WHTB 4LVHB 1JZIA 2IBZX 3QARA 4D0DB 4NZRL 4H1LG 3G6JE 4GFTB 3CZSA 4KXAA 4E41A 3B7RL 3EO1A 4U49A 3RJOA 1P7HL 4Y89A 2K6YA 4E41E 4P57A 1QFWI 5J89A 3WTSA 4GPVA 4TVUA 1CFVL 1P6WA 3H9SD 3DA0A 3MOBL 3CHRA 2D7QA 2VM9A 1U9KA 2NYZA 3FU7B 1TMCB 4UNUA 5B1BB 1W72L 3TNMB 4IOFC 2JTDA 4LU5H 4WWKD 3BD3A 3WFZA 4LLDB 1I7UA 4RMUA 4OQTA 3QWQB 3T8XA 3NCFB 3S8GB 1DQKA 3TV3L 3WXWL 1DQDH 3MREA 4KDTA 5K5YA 1OXYA 3EJRA 2IDSA 4FFVC 4NM4H 2OPCA 1HI6A 2XN9D 4JGJA 5DI8A 2KH2B 2DQHL 3BAXA 4QTFA 5AZEL 5C6PB 3T2NL 2DQUH 5F7EH 1JPTH 3L2LA 1KBPA 1NCIA 1NANH 3QUXA 4UQIM 4JG5A 4LQFL 3S5ZA 4FQIL 4FULA 3SHSA 3V5KA 1RUPL 3VDCA 5GZOA 2E9BA 5DWUH 2AJSH 3CVHA 3IGUA 1HKLL 3TLRA 1SHMA 3DVNB 2VQ4A 3QUKA 1MZZA 2AXFA 3A6BH 4GQPH 3WFHA 3RFRA 1DLFH 4J27A 4KROD 3EGXA 5I8EA 3NDYE 2Z91A 1U8NA 5JA8B 4M8VA 2IALA 3VJ6B 4YQXH 2FO4B 2D2CC 2XPGB 4R7DB 3DSNA 3G5YA 2R83A 2VL4A 5EZOL 3HZYA 4E9YA 4ZMZA 1JHKH 4G7RB 1BQHA 1E6OL 2EYRA 2JJTC 3EFOB 3NZHH 4IEFB 3U4EA 1BLNA 2BVQB 3GXTA 4FXGB 3NESA 4FZ8H 4J12A 4GKOA 3F64A 4WO4B 3BZFB 2CU9A 5IUCA 2Q7YB 3KG5A 4U1GB 1U4FA 4JPKL 2KZBA 3DX6B 3VNZA 3U9UB 4XX1G 3FCBA 3CFJB 3FTUA 1G9MC 1RZ7L 5FX3A 1YC7A 1U3HA 4HVBA 3ARQA 3B9VA 3APDA 4GRLC 1Q9OB 3S37L 2HXAA 3FRUB 2AV7B 4FZEL 4D8PB 1ZVHA 3FCSB 1KACB 5ICXA 4M7LH 1AZBA 2N7AA 1REIA 4PRHE 2DV6A 4EZKA 3TZVA 1Q9WA 3CSFA 4PJFF 1TVDA 1KY7A 3DROA 1QSFD 3KL5A 2Q87A 2H5UA 4K23L 4JHVA 1UXMA 4BRJA 3SKMA 3Q05A 4NN6C 3NK4A 4M5SA 3U46A 5E2WH 3K6FA 5GJSL 4JQVA 2HCZX 1E4KC 1G4MA 2MRYA 3LRKA 2VDRB 4TSBH 4U3SA 4XOCA 5A2LH 4XPAH 4I87A 4L1TA 2MQ3A 1S9WA 3U0TB 2VCOA 3FONB 5J12B 4JQXA 1BA9A 2XBDA 3QJFA 3L1OH 2HRPH 5HI4D 4F58L 4KJQD 1IAMA 3EO1B 4K94C 3OMZA 4XOEA 1SVZA 5JW4N 2LLGA 3MUGA 3ZTDC 1NCDL 5JPNB 1BVOA 4XP5L 4PWJA 3RIAK 4XOBA 3H2QA 4F9PA 1NGYA 4AQ1A 1NFDF 4X7SL 4AY0A 1MDTA 2WLYA 3OF6A 2VYRE 4Y16C 4AKOA 1I7UB 2JI1A 3IJYA 5IBUG 1X5JA 4G8EA 5AVWB 3T8XB 3BP6B 5CR1A 2DQTL 1C12A 1S7VB 4PY7B 3MREB 4NUGH 1A3LL 1HXMB 3D85D 2AZUA 3ZL4L 1NCCH 2H9GB 1W8NA 3BXNB 2WTOA 3MLZL 4GP4B 5DI8B 1BVLA 4B3VA 5L4JA 3UEZA 2XN1A 4NKDB 4XBMA 2ADGA 1IGYA 5AZ2H 1JBJA 5C2BL 2K45A 2PETA 3T2LA 2YN3A 3MUHL 4S1QH 3AT9A 4ZFQA 4YHOL 4S1SL 3QUXB 3V5KB 4JPWH 5ECGA 4NXSA 1VSCA 2DIJA 1IUZA 4AZUA 3BAEL 3QUKB 3RHWF 2AXFB 3SDDB 3WFHB 4FP8L 4FA8A 4DP1X 5I1EH 2J8OA 2MNUA 4M02A 3RRQA 2K7QA 3RILA 5J8OA 4RESB 1EDHA 2GUOA 3LX9A 1V7NH 2IALB 1RZGA 2Q3AA 4OJYA 3DSNB 1XD1A 3G5YB 4A7TA 5BVPL 1BBDL 3JWNH 3PPSA 3HZYB 3II3A 4TM9A 2UYLB 3OBAA 1GRWA 3IB4A 4JREB 3SOTA 5JHDA 1BQHB 3ULUC 1T1ZA 2IOMA 5HGAB 2IH8A 5EO0A 3U4EB 3ZUCA 2IBGA 1BLNB 3NFSH 5JHDE 3TA3A 4YSEA 3ZRFC 3O3DA 3TT1H 1QFWH 1A6ZA 1MFCL 5IEKB 2YD7A 1GMIA 2ZUSA 4FMKA 1FORL 4RAUA 4XAWH 4MSWA 1U3HB 1L9NA 2ZUUA 3EYUL 1PLCA 3EYFA 3S5LA 2OSLA 4ZUUA 1T83A 3HC2A 3TJEL 4P5TD 2YLKA 1BAFL 4PD4J 1D5MA 4KITB 3T0EA 4OZIB 2MH4A 4YDKH 3QQXA 1CG9A 3A47A 5DD1H 3ARYA 4C56D 5EF1A 3DROB 3T0EE 1TTCA 1BVZA 1WICA 2B5IC 3SKMB 3INUH 1RZJL 1W72A 3VH8A 3RL2B 1JG9A 3ZTNL 3TVMA 5DMGD 2OYKA 2BDNH 1U58A 5C0EA 4CNIB 1N18A 2VR6A 1PCXA 4OR1A 4X80L 3LNHA 1S9WB 1LWJA 3ZR5A 1AQDB 5C86A 4LMQI 1W0WA 3MLRL 1YEHH 1T0NB 3GJEB 4R7NA 3V2AR 1IFHL 2MKLC 2OR7A 3MRJA 4NGHL 4J8QA 3WNMA 2VWEE 4KKLD 1UD6A 3FKUS 1WFMA 4NENB 4C4KO 1BZEA 2Y1YA 3F7KA 3MUGB 4PJDF 3T4AB 2IWFA 4FNQA 2OMBA 4WI0A 4NXKA 2PWDA 3LSOB 1PZ5A 1NGYB 3RWGB 5TF0A 2Q76B 1CLCA 4OM1L 3JTTA 1EBAA 2OZ4L 5CMAB 3UJTL 3OG4B 4AQAB 2F54A 3IJYB 3HCVA 5INCB 4FKKA 2E7DA 3QPQD 1QBAA 2MSPA 2BWDA 3ARTA 3U4BH 5DK3A 3F04A 2FRGP 1YNTF 3V52L 2EEBA 4OFKA 2NZIA 2VLLA 4F5CA 1BVLB 2GTQA 2BIQA 3WO3B 4L8SC 2ADGB 1IGYB 1RZQA 2YMTA 3HEIB 3ELAT 3NSYA 4F5CE 1NIAA 3FO2A 4I4WA 5I1DA 1IU1A 5B7EA 2ZKYA 1XGPB 43CAA 4NQDA 2Y1VA 1D6EA 1NOAA 5TE7H 4P49A 4FYSA 1AKPA 1XXDC 4I0KA 5CCHE 2QPEB 4R5XA 1JZ8A 3T3ME 1SJVA 4YSTA 2RMNA 4ZTPL 3RTLA 5FOJA 2DI9A 4B9IA 3FZUC 3BQVA 2ITFA 4ENZA 1DL7L 2Q1EA 2FQDA 5I1KL 5I5IA 4X4ZA 1ZSDA 1Q8MA 5JHAA 2JTYA 3LRLA 1T1ZB 4F3FA 1RURH 5GGSY 5EO0B 3FO1B 3C6LD 3A6CL 1NMCC 5D4QA 5B3NA 1L9SA 4WSJA 3GDBA 2A9BA 5CINL 4OY9A 2IDCA 5CD5C 1TEGA 3NQIA 5C0BB 1A6ZB 1JP5A 3FN0L 1GZHC 4ODUA 5BCAA 5IQ7L 1UCBH 3C5ZC 3CN2A 4KHTH 2H8PB 2BVTA 2K9UA 5T1MA 3FT2B 3WL9A 4BZ1H 1J9CT 1KTBA 4XBEH 1AHWC 1KUMA 4RAUB 1JRHI 4QHMA 4M9PA 4MSWB 2BSTA 1GGIH 2JKNA 1JGUH 3EYFB 4IIQB 1TENA 3S5LB 2OSLB 1I8AA 4H8UA 3QH3A 5CEZD 1D5MB 2X88A 3RI5K 3T0EB 1CG9B 1WTGT 4M1DL 1E8YA 2WOBA 4XWGL 1IL1A 4LT7A 4ODVH 1QR1A 1JPST 1NEPA 2YS4A 4JRXE 4AK2A 2EDNA 4XMXA 3VH8B 4XXDA 2VDNB 4JVPA 5CN3A 1P2CA 2XXMB 3G5VB 2LT9A 3VXUD 4NWTH 1U58B 1LGVA 4X5RA 4ONFL 4ZMXA 3LPPA 3L9EA 1KTJA 2WLJA 2YK1H 1W0WB 4MAZA 3U2IA 3L3IA 1DANT 1IE4A 2UXFA 3PWLA 2V8LA 4R7NB 4LRIC 1AR1B 2B08A 5C0RL 3IMTA 2MNJB 2YGQA 1AZZC 1CXLA 4XCCH 2ESVA 3WO4C 1BBJA 4OI9A 4BHUA 2JKLA 1EQWA 1PZ5B 2ESVE 2ZX5A 3N42B 2I26N 4N3UA 3VD0A 3JTTB 2YGOA 1XVSA 1OHZA 3MXVH 3UZVA 1MRCH 4ZFZA 4F8LA 3UEQA 4QIRA 2F54B 4P23B 3HCVB 4I0CC 3JWOC 2HT4D 3KCWA 1J11A 2OFQA 3HS9A 3QK0A 4TTDC 3RURA 2GK2A 4BUQA 4YIQA 1MN4A 1N3NB 3FUNA 4APQA 5HHMB 2AP2A 4HIXH 1JTPA 3HC3H 1JTOA 1F42A 2VLLB 1E2VA 4A2DA 5LCVH 3MO1A 2DWDA 4BQ8A 1KCVH 4KUCD 4X98B 3KEDA 1YNKH 1CICA 3CZKA 5CJOH 3FO2B 4J3BA 1A7RL 2XTJE 4I4WB 4Y2DD 5TD4A 5I1DB 1DVQA 2OL3H 2E0PA 4X6BA 43CAB 3VO0A 3T3MB 1H15A 4NQDB 4HXBL 4GY4A 1BEYL 4CW1A 3DYOA 1FIEA 3O6KL 1BFSA 4U6HA 1U8QA 5AOLA 4L8CB 3S36H 3ZE2E 3QZWA 1QKZH 2ZKHL 4TNVF 1YEIL 1G6RL 1AZCA 2DRUA 4PGEB 4QRQB 3WY1A 1LQBC 5AVZB 5HPMB 3OC8A 3E2HB 3L5HA 1T2JA 1KZYA 3QWOB 1FYTA 3IU3A 5C3IA 3HC4H 3WIHA 4MNGE 1UQSA 2HKAA 4XCFL 2NY1C 1FYTE 2P49B 2C7FA 4LPVA 1ZSDB 4RX4D 4NHUA 5L88L 5G5DB 5AKTA 2QVIA 1C8QA 3E8VA 5DD3H 5D1ZA 3A67L 5T1KA 3W9DA 2RIKA 4F3FB 4XMWA 2KPNA 2WBJC 2ZT9C 1QBMH 1FLRL 3CHOA 3H42L 3HE7C 4KX7A 4OGQC 4RMWA 1V3LA 5KOVC 2PO6C 5I15H 4A6YH 5A7BA 3IXAA 1S5HB 4PUBL 4ODUB 1I1AA 2XJLA 3WL9B 4LPXA 2QV4A 3DURA 1JZ7A 5JXAH 5CJQL 5I8OL 4QHMB 3F6IA 3CE1A 2EH8L 2WLNA 2BSTB 3OKOA 3B2DC 4GT0A 5FFOA 3GSVA 5AAWC 5AYQA 3VRIB 1NDMA 3MR9A 3QH3B 1BHGA 3H7BA 1ZA3A 3MRBA 2Y22A 2R4SH 3B9AA 3IAPA 4FQCL 5B3SB 1IL1B 2JCCF 3T04D 2XA3A 1WHPA 5H35A 3L4YA 2P46B 1OARL 3WJLC 4HDIB 4U1JA 3HBGA 1JWMB 1P2CB 5DDHA 2OZ4A 2VDQH 2NY4C 2Z0BA 2FNWA 4LCIH 1NLBH 3SKOA 4MA8H 4CJ1A 1ES0A 5IJBC 2FEEI 3WLWD 1YECL 2WAQA 5D96C 1UACL 5DQJA 3FCTA 3H9HA 2WXPA 4DKAA 5J5EA 3LOWA 1HL5A 4NNYA 4GBXD 1F3RB 1Q9KB 3CHPA 3PAVA 3L3IB 4K3GA 5DGRA 1MDAA 5ALCH 3JV0A 7PCYA 2VQTA 3IRZA 4HU2A 5D7JD 3QDJD 3BFOA 3UROR 5IMLA 3BRGC 1OD9A 1A4JA 3LD8C 1BBJB 2OTUB 1BPLB 1FE8H 2C4XA 3BP7A 3EJYD 4UWQB 5E6RB 2WCPA 4CC4A 1NOFA 4HALA 3E8UL 3DBSA 1CBVL 4ZFZB 3HHMA 3I6GB 1MCBA 1ZLSL 3KPLA 1S9VA 3CN0A 5D1XB 1SJXA 2V5SA 1QZ1A 3K2UH 2R2BB 4JRYD 3KYMB 3MNVA 3TPKA 4APQB 3PJNA 1TYRA 3I50H 3WEAA 3LZFL 1BYNA 1U92A 2FCBA 4BDVB 1JRHH 4JG1H 2I27N 3SKUD 1WFNA 3KYNB 4H0LC 3RNKA 2FUQA 1CICB 3UC2A 3I9AA 2FJGA 1KIRB 2DQIL 2CCLA 2X89D 3QB7C 1TFHA 4JFXA 1H15B 1D9KC 1MVUB 2L4OA 2XVKA 3JV5A 4NJAH 1S3RA 3QJZA 3P4LA 3HUJF 4CW1B 3ZYOA 4OZHF 4U6HB 2WV3A 1T6VN 3QZWB 3U6XS 1KTKE 3V0EA 1F2QA 4EN3A 1H6UA 1M1XA 3BPNB 4PW4A 4FFTA 3MLWH 1XH2A 2OTPA 1RAMA 3O6ML 5BZWB 3QPXL 3ROOB 1PFCA 1QQDA 1P4BH 3L6FA 5EZIH 5T1KB 2PR9A 3W9DB 1T89C 1MFVA 1OAKH 3TM6A 1ASPA 3UAJC 4FL4B 3H9SA 3U83A 4YDMA 4HEPG 5KBMA 3MRRA 3R8QA 2CALA 3HAEA 1DBJL 1A14H 1UATA 4LSRL 1I1AB 3VX1A 2VH5L 2OTWA 1AKJB 1AMYA 1N26A 3DURB 4BUGA 5GZND 4KGJA 4Z0BL 3ML8A 3GSVB 4LVOB 1NDMB 2ZUYA 3KGRA 1RIUL 3VQMA 1EO8H 2EDMA 2AQ1A 3H7BB 2VXTL 3MRBB 3CDCA 5F6HI 4B53A 3NJIA 4R26H 3L54A 2PYEA 2WVSA 3GRGA 2A9DA 3CFCL 4N85A 3RL1A 5C0FA 1IC7H 2PYEE 3E7JA 4DKFH 3ARGD 5DDHB 4HH8A 4DP8X 3HMWL 1ES0B 1G9MH 4ZQKA 1EX0A 2YQGA 1C5DA 4HFWB 2G9HB 3V6OA 5DQJB 43C9A 3FCTB 1NSNL 3V6OE 1HNGA 1YHPA 3D30A 1OTTD 1VGEL 3ZDZB 1TTFA 1W6WA 2X9ZA 3R4RA 4KAQH 3BH8A 4FI7A 5IMLB 1A1MA 2VJXA 4QTIL 4UU9B 4XPFH 1A4JB 3SE3A 3HZVA 3RVXD 4JFYA 3G5XA 4QI3A 2E75C 5I76A 1N6VA 5EC2A 3BP7B 5FGSA 4UM8A 4JKPH 5KJ7E 5CCJA 2A77L 3GPEA 3LH2H 3O9WA 4BFEA 1NDTA 5C0IA 4FEIA 4DUXA 3T0AA 1G6RA 4JY6A 4AM0A 1CD0A 1TSHA 1S9VB 2CIKA 2OCCB 4OGAD 4XB7A 1FA4A 3H4FA 3REVA 3UIZA 3EF7A 3JT0A 4K94H 1WAPA 4BSWB 4QDGA 4LHQB 4R90L 4LB8A 4R2GB 2ZCLH 2HLFC 4XVSH 3RNKB 2FJGB 4ORZC 1N0LA 4XMLL 2V6HA 5I82A 2BCMA 1JTTA 3DOSA 2A99A 1ZT4B 4JFXB 3I02A 5GGTL 4CUCA 3QG7L 2AJVL 3D3VE 4FMVA 2O72A 4AK1A 3QFDA 5FYLD 1DZBA 1JVKA 4JUTA 3KPRD 2G75A 4XI5C 3U7YL 1G1CA 4PJGB 3N9GH 5KYYB 1I31A 1OAJA 4EN3B 1FZOA 3BGAA 4E5XG 1M1XB 4UI2A 2W9EH 2WXLA 1KB9K 1KZQA 1SOQA 4OUOA 1TFPA 2QQKL 3L6FB 1IGMH 3M46A 1W0YT 2ETWA 4OJCA 4G9DA 4MWFA 2NNCA 3H9SB 2W07B 1G1YA 5EUOA 1HHGA 1AQ8A 2HJFA 3SY0A 4QLWA 3HAEB 4GSQA 1NKOA 1UXSA 3ECUA 3H56A 1GGCH 2HVKB 4WWKB 4OQ1A 2OTWB 3S7GA 1ZXQA 1MY7A 3JXAA 1C5CH 1KYAA 4DFIA 2V9QA 3LNGA 3QW9A 1FO0H 2CBOA 2QDVA 4RGMB 5ISZD 3K5RA 3X3FL 2W8CA 1RZFL 3SPVA 3WELA 2FHBA 4OD1L 3IJ8A 3ULUH 2YUVA 4QJ4B 4R4NC 1BPVA 5I26A 2XN9B 1JGEB 2FATL 3GT6A 3Q2CA 4M93C 1WBYA 4KO6A 2WXHA 4MMZA 4Z9KB 1HHHB 1M2VA 4G7QB 3RL1B 4AW7A 5C0FB 4HCRL 1HZHL 4XP6H 5EU3A 1U8IA 2MCG1 4Y4HC 3LKPA 4Q56A 1XF3B 3PP3K 2V2TA 43C9B 2OJZH 1AG6A 1O0VA 3LMJL 4KK5D 4NCDA 1TUPA 1JHLL 2E74C 3DYMA 1YUHB 1KGYE 1TO4A 3N1MC 1U3YA 4DF9A 4FYTA 1A1MB 1HCFX 1PNDA 5IR1B 1WHOA 2IJ0C 2YFOA 3TO4A 4RIRB 2ODHA 3GUTA 3G5XB 3D6GA 4GW4A 5EC2B 3GC3A 3HN8A 5EBWB 3S88L 3NCYP 4Y19D 5F6IB 5HDOA 3EHBC 4EQ3A 5AKRA 1TJMA 3QQ4B 4P3CH 5C0IB 4W9IC 4XPGL 3QR0A 4AM0B 1RULH 1NDGA 1B88A 4X7TB 5F7WC 5HY9A 2KLTA 4DQOH 3UO8B 3REVB 4I9WD 4IBTA 4NIKB 1NGZA 2HRHA 1HEZA 2VR4A 5I18H 4WKXA 3FT4A 2R8SL 4OT1H 5T5NG 4N8UA 4XXWC 2BW5A 4DO6A 3ULVC 4NP9A 1I7ZA 1NCBL 2Q2EB 2CA4A 2VDKL 2XWXA 1T04A 3ASNB 3V6FB 3VSQA 4Y5YA 5ITFA 2HN7B 3FUHA 4TRPL 2N1TE 1N0LB 1KGWA 1OM3L 4C56A 3GMRA 5I23A 1QSFB 3B7YA 2AEWA 5GRYA 2Q6WA 3QORC 4NFDA 1I75A 1DVFD 3I02B 2OMYA 3UDWC 2BVPA 4M6OH 1RK1B 4CL7A 3NZSA 4HGMA 4NN7B 1OEZW 3QFDB 3H3PH 2G75B 3P9LB 4UT9A 2G2PA 5BUPA 4CC1A 2H2SD 1FZOB 1VZGA 3O4OB 3KWWA 5EZLA 3ZQWA 5KVDH 1J1XL 4AZ8A 2V9UA 1SUJA 3RWJA 4LNVA 4Z7WB 3LKNA 5LAXA 1JAEA 2XWBA 1VJSA 2F53A 3GSQA 2DJMA 1T2QL 2NNXA 3WSQL 1B0WA 1ACCA 1UA7A 2DTMH 2D7OA 3QEUA 2R59A 3H2PA 5E4AA 3NCXA 2VERA 2F53E 5K1JA 4MWFB 2EXYD 1XGQA 1DQIA 2DQGL 1OM9A 3Q7JA 4G70B 4NKOA 2CJUL 4LSTH 4NC0B 4PG2A 5EUOB 2NSXA 1HHGB 2BZCA 1PZBA 4MNHA 4AEHL 1UXSB 4DCQB 4NP4H 4TNGA 3FO0H 4PRAA 3PHQA 1HKFA 4JL1A 1KCSH 2G2RA 1QASA 3FH5A 4PBVC 1YN7A 4L9LA 2UV3A 1KFAH 3KAAA 1E30A 3BP4A 1GW6A 4BFRA 4HIHA 3OGOE 1S5IH 1N67A 4E2OA 5BXFB 4WJG3 1LDPL 4ZO9A 4L8DA 2FL5A 2W9LA 3QI9C 4JHUA 4EOWL 1WBYB 2AEIT 2X7LB 4MD0A 3MLVL 3WTTA 1OGAD 4HUKB 1M2VB 4OLVH 1RJYB 2Z64C 1XEDA 3KWVA 1KB5A 5EU3B 1SOXA 1U8IB 3VWKD 2IEPA 3EFFA 1OT1A 5BO0D 1J5IA 4N2BA 1KXVC 1SLVA 5CP3A 1YQ2A 3ZDYE 4XT1C 3QHTC 7TAAA 3WHXA 4L1HA 1RZIA 3K8KA 4WTZA 2BXZA 4NI3A 3HVDA 2ZWSA 1CO1A 4WI8A 1OCZB 1PY9A 2CAKA 4BH7B 1MLCA 3QC5X 1ED3B 3UIYA 5IOPA 3B8SA 1GGUA 1SBBA 4WTQA 2FBRA 3MCYA 2N56A 1HQRA 3GUTB 3N04A 5GGTA 3KLHC 1G7JA 1XGRA 2C34A 3C6LA 3QDMD 4FQ2L 3ARZA 4EBQL 3TL5A 1YO4A 1GW0A 1ILSA 1ZVYA 3V5DB 3WFDH 3FH7A 3SDAC 5HY9B 5IBLC 4F7CB 1VFAB 1H9VA 4UOJA 5DMYA 1DQVA 1NGZB 1TVHA 1HEZB 1V10A 3WKNA 4KZEL 4PJ8C 3SQBA 2HKFH 3DGGA 5FR3A 4MCYA 4AEIL 3O3BB 3L4CA 4P5TB 4S1DC 5ITFB 1KPVB 4NBZB 3WG7B 4N2EA 3FS9A 5JDJA 4IOFD 4A39A 3US9A 4C56B 1TQWA 3GMRB 4MQXD 4DPRA 5I1GL 3L1FA 5TE6H 2Q6WB 1AXSA 4BQCA 1AQMA 2OMYB 4WWPA 4E42A 2OJEB 2BVPB 3OV6A 3A21A 3JWOH 4H44C 5F44A 5ACLA 2XZAL 3GLDA 3WFEH 4HMEA 2QQLH 3CLEH 3K91A 2IPKA 1L3NA 4YHZH 4JCLA 3GMQA 2DWEA 2XT1B 5EZLB 3C09C 1PZAA 5JIDA 4TUOB 5LAXB 4ODSL 4AQOA 4P4KA 5I0DA 3N06B 2P4AB 4N0YL 2ENJA 4GG6A 1L7TL 1PG7H 4K3JH 2YAOA 4AIOA 3QEUB 5JHMA 4JFPA 4GG6E 1XGQB 4HCRA 3C5JA 4PAZA 1AGCB 1IGFL 3M1CA 5BO1L 3ULSA 3MMEB 4GO8A 4MNHB 3CX2A 1DVUA 2DIBA 5DO2D 4OI7A 1N70A 1NA8A 1C1EL 3IDMB 5DRNA 1Y1DA 4PRAB 4PJ7A 3UZEC 3PHQB 4GKSA 2R0KL 4YHLH 5FGBA 2Q3ZA 3V4VH 1P4IL 4PJ7E 2IADA 2BOLA 1YN7B 4DUWA 4L9LB 3VFOA 3L4UA 1UA6L 4G1MB 4GSXA 3BP4B 2EDBA 1JVLA 1OZTG 4GG8B 4B27A 3OX8B 4I7ZC 2V9TA 4HOZA 4ZAKD 3QEQA 2F08A 1KLFA 3UBFA 5F3BA 4PV8A 4MD0B 3EGSA 4RGNE 4MZRA 3QEQE 4Y2DA 1XF4A 4JS7A 1Y07A 1KB5B 2C9UA 3EJQA 1Q0YL 3PGFL 5FF6B 1X44A 1HNFA 3B1TA 1EHLH 1P4LA 4TUKH 3K4AA 3MLXL 3WDJA 4JMNA 4Z7UB 3WEMA 3I6LD 3VXTA 1SF5A 3NEEA 4X6EA 4PYHA 3FSAA 3VCLA 2ODIA 3DTDA 3WHXB 1RZIB 3HPLA 3IDJA 2J43A 3ET9F 2DDQH 4PB9L 3HNSL 1C5BL 3N50A 4QY8A 2BP3A 4CVUA 1MLCB 3MLSL 5IOPB 4M4RB 3L1EA 2YEZA 1R3IH 3R7QA 3BAWA 1MPAL 4O9HL 2GSIA 3PIQA 4RX4A 4MMXC 2R9HC 5CILL 2I25N 1XGRB 4OF8A 3AG1B 3C6LB 2CK0H 3K8MA 4JRWA 4R4BB 1QFPA 5EOCL 3FT0A 2AEQH 2WQXA 4PLOB 2X4PB 2HFEA 2ZCKH 4K71C 3T08A 3PXJA 1MCOH 3WY4A 1NGWA 4FQ1L 1KJ3L 4UQ2B 3ZKSD 5I5RA 1CLYL 3LKQA 3EBHA 2AI0H 1TVHB 1OLZA 4XAKD 4NNXA 4MA1B 2NY3D 1CE6A 3IFNL 2ZYIA 1HDMA 1WUNT 3EYOB 3SQBB 3MQIA 3LEXA 1F0LA 4X6CF 3LRSA 5LUMA 1FPTL 1NPNA 2P3YA 3ATDA 4PMEA 4Q4IA 3UC0L 1MCIA 4KDWA 3OKYA 4OUUA 1NAML 4Q6IA 3NTCL 2IOOA 1AXSB 1M6OA 2K1MA 3PP4H 3OB0H 2WXOA 1ZHKA 1JK9A 5I1JH 5L2JB 4DNLA 1YPZF 4FFZL 2J88H 1KYFA 5IW1A 2DYPD 5SX4I 3VXUB 2P8PA 3LXBA 4GEJA 3VXPA 1G0YR 2P8MA 4RETB 4TSAL 1VACA 4JN1L 1CU4H 3GMQB 2DWEB 1PZSA 5J11C 1R24A 3I2CL 4GBXA 2ZX6A 3AREC 4PVBA 2CDFA 1LEKB 1LYQA 4P4KB 1BXXA 2JSFA 5A2BA 5EU6A 1JXDA 4LP8A 5D7JA 3QDJA 3V0WH 2ITCA 3HI5L 4JFPB 5EU6E 3V9EA 4ABQA 4AIZA 1OK0A 1QSED 2DL2A 5MEPB 1RFDH 4QXVA 5FW8A 4PHZA 5IM7B 4PBXA 3ULSB 3TN0A 4OCYH 4L18A 5KZCD 2H3KA 3FPXA 1VKXB 4GKSB 5CZRA 2FHFA 2QMKA 2X2UA 3R1GL 3G08A 1IGIL 1ZD6A 4S0TD 5J57B 4AMKL 5KN5A 4EE2A 5MHSE 2VDOH 1TYEB 1A6VL 3AROA 4MVBC 3L9BA 4RGNB 3UBGA 4HS6A 4MJIA 1MSPA 4FE9A 5JORB 4KV5E 4PV8B 3EGSB 3J8F7 5MENA 4MJIE 3WE1A 4Y2DB 2ZUWA 2AVGA 5IQNA 4WEEA 5MENE 5EEWA 2BMKA 2G5RA 3T6QC 4XX1E 4JVWA 4TNVK 1P4LB 3HNTH 2CKBL 3JT2A 4MRBA 3VXTB 2HPTA 3RUGF 3SYAA 4AM0Q 3FBKA 4X6EB 1CMOA 1OAUH 2TRYA 5GS2H 3PDDA 4QRPD 3VG0H 1JNJA 4NC1E 2H1LM 3HPLB 4L5FL 3GJFA 2DLGA 4GMTH 3EJPA 5EU7E 1EVUA 2VDKB 4H2CA 4QY8B 3PU7A 2GFBA 2XV0A 5HDBF 2V2XA 5ERWB 1XSOA 4TNWF 4P5RA 2O6FA 1GY2A 5F1IA 2GSIB 2VUKA 2AF2A 3VB9A 2IFGA 1LK2B 2AJUL 4J2QA 1J18A 3DX0A 4RMVA 5JIPA 5JIMA 2K8MA 2ADIA 2BO0A 4ESKA 4MB5A 1KIPB 4KXZI 4KHXH 2VZOA 2HFEB 4YSSA 1MELA 1NGWB 4IU2A 1IFGA 5F9JA 3LKQB 3RDTA 1G6VK 4NNXB 3FTSA 4N5EC 5GZNA 1MY5A 1CE6B 5GS0L 3LHPL 1HDMB 1H8LA 2F8XC 4PS4L 5E1QA 3ZE1F 1FHNA 2IGTA 5HSFA 2X1PA 1N9PA 1OALA 4Q6IB 3AQDA 2RR3A 1M6OB 5JR1H 1IBDA 1I7TA 2L0DA 1XEUA 1ZHKB 2P5WD 3KXFD 3CSGA 3ARGA 3KW7A 5IW1B 2H47C 1ZRUA 2P8MB 2GQHA 5DVLA 3VXPB 2ZE0A 3V4PL 1OLLA 1VACB 2FJFB 4Q6KA 3B6SA 3F2LA 1R24B 3FB8A 3FYEB 4G8GD 2YD8A 1IC1A 4GBXB 5ICZA 4MD4B 5AL8A 3QG6A 2EEFA 4X5WA 2CDFB 3ZL2A 3QEGL 2R27A 5D7JB 3S48A 3QDJB 5AVSB 1CVSC 1HHIA 4FN0A 5H4YA 4MNQD 4CN4A 4AIZB 4X99B 4B5ZA 3NIFF 1N68A 4NDMA 3BJLA 1ODAA 2OXGB 1MQ8A 4X5PA 3STBA 3VNYA 4K7PX 1KIUA 3O2VH 5F0JB 2ZP0T 2DBLH 1GCYA 4LFHD 4OLYL 3G08B 5BJTA 1IV8A 2YFNA 3EDDA 2FGZA 3HG1D 4BINA 4GAFB 5KN5B 4JRYB 1F02I 4KNSA 1Q1JL 3VU2A 3NJVA 3IPBA 4C59B 4LP5A 2Z8RA 4YE4L 2LAAA 4WV1C 4HS6B 3SZKC 5CD5D 2KYIA 1KN2H 3X12A 4H26A 2LR4A 4AYFA 5EIIG 1YJDL 5HGBB 1HL8A 1CK0H 4MD5A 3FHEA 3RVTC 2R29L 3SE4A 2IV9A 3BD4A 4MHHG 3SKJL 1TMQA 3D25A 5DUPL 1KWGA 3ZUNC 1WIPA 2WVUA 5HXMA 1DDHA 3GJFB 1ZIAA 1YEGL 1D6VH 4HAKA 4HLJA 5FYLE 5C0AD 1LO5A 2AQNA 1FC2D 2XXCB 2ZXWB 1J8SA 5SX4H 3V8OA 2GFBB 3MV7E 2V2XB 4XN4A 5GGSA 3N1GC 3FTZA 1NAMA 1VRSA 4I89A 1OAQH 3TBBA 1L9PA 1QTPA 5JW4Q 4R97C 2ADIB 4FFZA 2FB4H 3TT3H 1JZ5A 1ND0A 1XF1A 1KENL 1TEFA 5EEYA 4KRPC 2I9TA 2D3VA 2XN2A 3DETC 4IU2B 5F9JB 1MUJA 3ATEA 4K5LA 4ZTOH 3NFNA 4CSZA 4FOMA 4JY4A 1ONQA 1EUUA 4LKCA 5DHXB 3PAUA 4W9HC 2VR5A 2Q0ZX 3II1A 3LN4A 4CVXB 2XWEA 2F74A 2DAVA 2WKLA 3RZCC 5BOJA 1XSJA 4ABUA 2F1AA 4BGDA 4TTDD 2B0SH 3ARGB 3DO3A 2FX9L 4LGPB 1FSKB 3OAZK 3BH9B 4I3GA 1RZPA 3TV8A 3ULVH 1SZNA 1QYGH 3BKJH 4OJAA 4MA7L 1FGVL 4X6DA 5D7IA 4RGOH 1I9IL 4NPKA 3B6SB 1INQA 2OMZA 3DECA 4DTGH 4X6DE 5D7IE 1E90A 2R0WH 3W11D 4X5WB 4W81A 3FB6A 4HJTA 4IRZH 3GBML 3QUYD 4EN2A 5A16A 4ZO6A 3QUZD 1HHIB 2AEPH 4MYWB 5E4IA 1K9TA 4ZOBA 2IGFL 3BGMB 4ZMNA 3K6SA 4PW3A 3TA4D 2WANA 4JFVA 4QD2E 3O41B 5CGTA 1K8IA 1EMTL 1QHOA 4JAMA 2HPOA 1KJ2H 2CKBA 4ZMOA 4L3CB 2J73A 3PS6A 4OIFA 4KXCA 2WNWA 2NY1D 4WGVB 3THMH 5KYXA 5BJTB 4BA0A 2EXTA 4L5FE 3F7QA 2A3TA 2ICEC 3RGVA 3N1PC 1KV3A 4UOW0 1ZLDA 3TH3T 1XWVA 2YKLH 3FU8A 4PTTA 4HK3J 3V0DA 1AVAA 4FFYH 4PV9A 1BQUA 2CM5A 5D93B 4M56A 3FFCA 4ZW7A 3MRKA 3H3KA 3KLKA 2X1XR 4K2UL 1O75A 3FTGB 4WW2A 3FFCE 5LHDA 4TNEA 1FNGA 2LHAA 2IF7A 1EHAA 2YUZA 4KUZH 2XFXA 5FUCC 5FYKU 4MD5B 3B2VL 2ZKXA 3WCYA 4ZFGH 3D52A 3D4YA 4ZMTA 1OAXL 3PQYD 4NQVB 3CC5B 1BSIA 1M05B 3AM8C 3D25B 2ZXAA 3NSCA 3LZRA 4ZS7H 3KPRB 4ZMLA 2RCSH 3Q5OA 1LO5B 1WJ3A 3SDCC 4NM8H 2OR9L 4XVOA 1M9SA 3LHAA 4DOHE 3BOVA 4HFUL 2BP0B 5HHPB 4E9VA 4E9LA 4JFOB 1ETZA 1IGCH 3ZYIA 4YXKL 1CIDA 1NMAL 2HSIA 2XVGA 4LARH 4FGMA 2NY4D 5DHEA 2ZXQA 1JF5A 4JR9L 2XTLA 1XQ4A 5FC9A 4HQQH 4H13C 3FUMA 3WNNA 1DJHA 4IOIA 5BMFL 1ND0B 2LU4A 4Q9BA 3WBDA 2I9TB 4FNLH 2V0AA 3U36A 4CADB 5I6XB 1TETH 4O5LH 3QYMA 1M71A 3IETA 3V4PA 1G7HA 4JO8A 3OKNA 1AR2A 1O5PA 2H7WA 4U2YA 3IMRA 3NFNB 2VXQL 4ZW6A 2O1AA 4G6KL 4IBSA 1M53A 2EC9T 5GISL 1E67A 4JY4B 1DJWA 5H4ZA 3CBJB 5ISZB 1ONQB 2J5LB 1NAKL 1RUAL 4HIIA 2MNWA 3DI2B 5JW4M 3WTXA 2EDLA 2OULB 2NT0A 3EW3B 1NZRA 3VFPA 4OZIF 2F74B 5F7FA 3CC1A 4DN3H 1UWXH 1OGAA 2HJKA 4M1GL 3BAKA 2HTLC 2YQ2A 5CLZA 4N6QA 5LG1A 4L3EA 4MBOA 5GS1B 1JWUA 2AV1B 4W4OA 1OCRB 5LGKA 3AG2B 3N43F 4M48H 3KYAA 4L3EE 1ULVA 3D2UD 3K6DA 1WAAE 1CGUA 3NZUA 3R18A 3PJSB 4L29A 3MGOA 4FTVD 4FADA 4X0NA 1O6SA 1INQB 2WVVA 3NIGB 4K9EC 3X14B 3DV6B 3P1VA 4AQEA 1XF2A 1D7CA 5A16B 1D9KD 4JDTL 4HJGB 1DYZA 5HI5C 3U1PA 2J56A 2Y06H 1EGJL 4N5UA 2MPAL 3D9AL 4ADGA 1K8IB 1LP9A 3BPLB 2R29A 1FNEA 2NYYC 2YEQA 4Y19B 5T1DL 2ZUTA 4XNUH 4W68A 1LP9E 3QIUD 3KWTA 1P0SE 1T4KB 2F19L 4OCWH 4W9CC 4BKSC 1FRGL 3O0LA 4KDVA 2E6QA 1Z7JA 3ALWA 5KYXB 2XZZA 3CLFL 4LDCA 1I3GH 5KSUA 3DO7A 4DKEH 2IQ9L 3V6ZA 5IFHH 1PZUB 4WFHD 4N8CL 4XP9L 5IQOA 4PTTB 4PV9B 3LVEA 4U1HA 2VDML 2H32H 5F3HA 5KTEL 3ZKXB 3MRKB 2Y1ZA 1Z3GL 2FWLB 3K0YA 2OL3B 4LVHC 3X17A 4TULL 5CCKL 1I85C 4TF4A 1J9RA 1CUOA 1DVFB 5F8QC 1HJBC 1P7KA 2KPWA 4KMTL 3M17A 1FVEA 1YDPA 1R0AL 5GS2D 4N2LA 4IYKA 3FTYA 3HZ3A 4MX7B 1JMZA 3V7MA 3WTVA 3NYKA 2EIJB 2QL1A 1FJ1A 1KG0B 4KKNA 5J6HA 5FUZH 3JTSB 4DOHB 2AANA 3WN5A 1NGQH 1K4DA 3QE5A 3K4DA 1ZEAL 3VWJA 1D5IL 3GBNL 2FZ3B 5IT2L 2HFGH 3SQOH 3CVIH 3B5HA 1PX8A 3NEOA 5IFAL 4M3HA 4AXWB 4KQ4L 1AFVH 4LSUH 4RH4A 4G7YH 3PG2A 2XN0A 4N86A 2R0ZH 1EV2E 3K6OA 4HPOL 1T7VA 4IOIB 3W3BA 3U36B 2JQZA 4F2FA 1UENA 4MAUH 2HB0A 3V4PB 1INEL 3OKNB 4YBQC 1G7IA 3C5SB 5D7LD 3W9EA 5KSBA 2FJUB 4NEHB 2DM2A 5I1LA 2E7LC 5A43C 5DJ6B 2QFRA 1FGNH 4JFZH 2EDFA 3K71A 1F3DJ 2DMGA 4J3OD 3O3EA 4M61A 4M6MH 3AQYA 2R56H 2D4FA 3VFPB 4ZAKA 5LBSA 2HG0A 1WT5C 4TKWA 4LL4A 3GFUA 3MSPA 2HJKB 1OGAB 1JFQH 4RBPK 5GRUL 3LEVH 3HBQA 2VDQB 2VT0A 3FN3A 1JWUB 3VWKB 4YJZL 2UVFA 4Y9GA 4KZDL 4L29B 3MGOB 3AB0B 2ERJC 1V7ML 4FXGC 2HLFD 1A0QL 2OMNA 3QXTA 1O6SB 5TF1H 2WVVB 2Z8SA 3OKLB 5CSBA 1BECA 4JFSA 4LSSL 1NC4A 3EUUA 4UNIA 1F1DA 3GTNA 3NG5A 4NQEA 4AQEB 3B9KD 4JFED 4U1GC 1XF2B 3EDEA 4X7CC 4NQEE 1DP0A 2DOCA 4K8RC 4PGCB 3L3OB 5E94A 5KVGL 5EWIL 2ITDA 3DYPA 4LASL 2R23B 5DQ9A 5FHAH 1OP5K 2W0PA 5BS0E 4ICXA 3FQNA 2ZOLA 5I2IA 4XI5D 3QDMB 1FNEB 4TVSa 1UH3A 4J2XA 4CMHC 2N4IA 3NZ8A 1QD0A 2EEXA 1DBAH 4WGWB 4EUPG 3BH4A 3GSRA 4MAYA 1VEPA 2EJ1A 3E3QC 3QA3B 1DO5A 3T5WA 4FLQA 4PJBA 2YPVH 5L2KD 4XAKE 1VCAA 4HEPA 4DZBA 1G9HA 4PJBE 4XPHH 5TFSL 2AW2A 4BZYA 2ITEA 2ZYSA 2BHUA 3Q5YA 1E4JA 1HH6A 1RVFL 3RNQA 1GAFH 4XVUC 1EXHA 3LKSA 3MJ7B 4LRNH 4KZ0A 3EO9L 1JV2A 1P7KB 2ADJA 4I88A 3M17B 4HBCH 2I07B 2TSBA 2MOQA 2VR8A 4RWHA 2DYPA 5DJXA 4I1RA 1G7QA 3DX2A 2BRRH 4R4ND 3ETBJ 1FJ1B 1JYVA 2WK2A 12E8H 1BVNT 3GXUB 4NKIL 1A4BA 4ELMA 3GSUA 1K4DB 1XV8A 3VB8A 2MCPH 1U2CA 1AANA 2EEAA 1CXFA 4P2CG 5IW6A 2B9AA 2YJLA 4MFHA 4OCMC 4ELME 1IKFL 4KTEL 5ES4B 3GRBA 4Y4HD 1IM3D 2VLKD 4N2GA 3LPOA 4P5MB 3V5HB 3VXNA 4MLSA 3KPMB 3GSNA 2E7BA 4QHPA 5I0XA 5E2VH 3N85L 4HHWA 4Q58C 2GAZA 3CUPA 1UM4H 1KFGA 3W9EB 5KSBB 3QUXC 2FIRT 5L8LB 2Z9TA 4BFGA 5GZOC 4EIZC 4JZOA 2GKIA 2BIPA 1AZRA 1PY0A 3NFPA 4KKBD 3K71B 5T5FH 3C87A 3NVQA 4P46A 5FM5M 3UTPD 2AXGB 2YA2A 4JANB 4KNQA 3O3EB 3EHBD 4ERSL 4ZAKB 4H25A 1EZLA 3QCUH 3VXSD 1AXIB 1JF1A 3TBTA 4BWTA 4POYA 3WUWG 1FNSH 1XB3A 4FXTA 5LBGA 3NABL 5KYNA 4XVTH 4ANVA 1F8TH 1YEKL 4U1MA 4JREC 1Z9NA 2DQCL 3DMMD 4QUOA 5T33H 5IB3A 3ULVD 2IPUK 3BDYL 5LWYL 4WHCA 4LPUA 3QJHB 2KS0A 3BUQA 6FABL 2BM3A 2QTVA 4HUXB 1DBKH 4LLVA 1KB3A 4QRPA 4XPBL 2XIIA 3GSXA 1H3PH 5HHNA 3IMUA 1DFXA 1LLAA 2VXVL 4LAQH 4QRPE 4RA0C 3VUAA 4DO5A 3WS6A 3UO1L 1MFNA 4J3WA 2E27H 2YGPA 2N0KA 5E94B 4FA7B 3Q5TA 4L4JA 4OB5L 1MIEH 2ITDB 1U3HC 5DQ9B 2F1BA 5I1HH 4L4VD 3PWVA 3KS0J 4W4NA 5K9JH 1P5UA 4OF5A 5I2IB 2IMNA 3OZ9L 1ZV2A 6PAZA 4WI6A 1AHKA 4OZ4A 3GXIA 1TJHL 4Y4KA 3TZVC 1KIQA 3N6YA 4NWUH 1NLDL 1R3HA 3BHBB 3DXAD 3NZ8B 4HJJH 5CEXB 2D31A 3DDFA 5DFVC 5DHVA 2Y23A 2ZPKH 3QDAA 4G5ZL 4A2HA 1UM5H 2GY7B 1WCBA 4KOCA 4QTHA 4HF5H 2NY3B 4JQVC 3RFZA 3BT2H 4PJBB 1S7SB 4JX0A 1GGBL 4DESA 4DZBB 3INOA 3HS0A 1MJUH 3IGAA 5E6YA 3ZKQD 4FLRA 4HKBA 3OMNB 4WK2B 3OAUH 4JQXC 3VXMD 2FVNA 1QSVA 2YHGA 3QO1B 5IWLA 3LKSB 1G84A 5DMIH 2K78A 1JV2B 2PP9A 5I9QB 3KXFA 1UZ6E 2UWEA 3GZKA 1QNZL 5A1AA 2CDGA 3BVNA 3FO9A 2DYPB 3KXFE 3RX5A 5DJXB 4XH2A 1G7QB 1OSPL 2UWEE 2NY5C 4N2KA 4OLUL 2JJUA 1ML0A 4F9PC 4AQ1C 1HYSC 1ZMYA 2FJSA 3EH5B 1NBZA 3G6DL 3QI9D 4GI8A 5HJGA 4IS6A 3GSUB 3GNML 4G8GA 4URKA 1JDDA 5IW6B 5FEBA 2CRYA 1HEHC 4G8GE 2H1PL 3LIZL 4UDTB 1K8DB 5LXVA 4HZ1A 3UBXI 1QSEB 1JPGB 1HVXA 3MBXH 5CUSH 3B7SA 3GSNB 1BFOB 1F86A 1KDJA 1RUQH 3AUWB 3F3HA 5CKGA 4GRWE 5EDSA 4NQSB 2GAZB 5KZCB 3FBQA 2Z8VC 3TWCH 4G71B 2FEDC 1JUFB 3MJ9H 1RHFA 3ZT5A 2BSSA 3IAGC 1EFXD 4XP4H 5GHWH 3NFPB 1A7NL 5KAQF 1IX2A 4GLRI 4P46B 4B5EA 3MRQA 3P3YA 1U8JB 2ORBL 4K3HA 4PJ6A 3TIDB 2WNKA 3QRGH 5BZDA 4H25B 3QWRD 5JDSA 4WGKA 5KVGE 3TBTB 1V3MA 1YEFL 3UYRL 4HHGA 4YXLH 2DL9A 3SDAD 3QUGA 5DMJB 5IBLD 4R8WH 2R2EA 3TGXA 1AHWA 3C08H 5E03A 4WUKH 3OHMB 1R17A 4ZBJA 1F4HA 3X13A 2WUCH 5IB3B 4PJ8D 4BFIA 4YDJA 3FB5B 2XZQH 3V79C 4MKMA 5LKNA 5CZVH 4X42A 4S1DD 4QRPB 5ALBL 4GMSH 3TA3C 3HE6C 4TNWK 3GSXB 5HHNB 3KBHE 1TITA 4P48A 1K72A 3NIDB 2EDYA 5I0VA 2NSQA 4UT7L 1ECZA 4ZUWA 3O2WL 3ZDZF 4APXA 3UFIA 1RIVH 1E8ZA 2E6PA 3VI4A 1PKQB 1IGTB 1W80A 3PWVB 2VMDA 1P5UB 1XF5A 4MTMA 4ZMYA 2FEJA 3T0EC 3DV4B 4OZ4B 5IVXA 2A0LC 4Y4KB 1KIQB 1C7SA 3H6JA 1R3HB 2YO3A 2D31B 4OIIL 5IVXE 1GPOL 2V3EA 4ONGH 3IEAA 1A4CA 2P8LA 4D0CA 2VMCA 2WXJA 4A2FA 1WIOA 2FBJL 3IDXL 1OCWL 2YMXH 4QTHB 5EU5A 4IBZA 4HJ0C 1HHKB 4HS3B 5TQ0L 1CQKA 3TVMC 3UACA 2UX6A 2ZOUA 3ZZSA 1E3XA 3RQ3A 4K3DL 4N1HB 1ZE3C 4HKBB 3ZTJG 4QHNB 1QRND 3KNBA 4UV7L 2ZNXA 2VWEC 2EDEA 5D2LF 5K9OA 1AR1C 2P5WB 5BQDA 2FQGA 9CGTA 4EVNA 3HG4A 1MCFA 3KXFB 2OYPA 4AKPA 2UWEB 2Z0UA 1B3IA 2PYFA 2A83B 2CDGB 3CFNA 1A7QL 4J3SA 1AJ7H 1MAJA 4XH2B 4UTAL 3TO2B 3LCYA 3N40F 1EK3A 1BGXL 4N28A 4OJFH 5GGRB 1J1PH 1NBZB 2KL6A 4L8SB 1X5KA 4IS6B 5AVQB 2VABA 4G8GB 4PJGF 1E9QB 5FM8A 5B7FA 1L7IH 2X5PA 1S2EA 1PW3A 1Y18A 3QCVL 2HWZH 4LAJH 1WH0A 3QUYA 4W9LC 3FT9A 1EEZA 3OR7A 3QUZA 2HX8A 3B1UA 4MNQB 5FCUH 2D7MA 4KI1A 3W0WA 5H2BB 1RY7B 2WHVA 3QHZH 3QIBA 1P6AB 1ERNA 2GY5A 4PJCA 3W0WE 4P06A 3KLDA 2WW8A 2IH9A 5T3XH 3ZY7A 5ICYA 4MXWH 4PJCE 2R39A 3VRLE 2NY0C 4PJXF 5AW2B 4PQXA 3S0PA 4ODXA 2NSMA 1N59B 4G9FD 4GUCA 2R9HD 3A3YB 3MDJA 2Q5BA 2J71A 4G6JL 3O11A 3VA6A 4AV4A 1NGXB 2W9DH 1J0HA 4OGYH 1SGKA 3MLUL 5BZDB 3SB3A 2ENSA 4JDVB 3TP4A 5JDSB 4F37F 2ZSWB 3E2HC 5DFAA 3K8LA 1NCAH 4C55A 5CJXA 1U6AL 4MZ3A 1KWKA 4J1UA 2GI7A 2R2EB 1AHWB 1BVNP 2F8OA 1B4LA 1DQLH 4BFIB 4YDJB 4ANKA 3IFLL 5C1MB 1O9VA 5IJVA 2XRAL 3PQYA 5D7KD 3GHEH 3L2MA 4OCSH 5KBLA 4XB8A 4LEOA 2Q8AH 5C0AB 3GTVA 3WEXA 3NH7L 3FQTB 4W6XB 4APXB 1V27A 5GGQL 2F58L 1KLUB 2VLJD 3VI4B 3IWVA 3L7FA 1XF5B 2J72A 3FXIC 1DSWA 3CD4A 5FA4A 3GMMA 3MTXA 4LCVA 5IVXB 5AVRB 5BOPA 1SXAA 1UCTA 3HFMH 4K07A 4H20L 3WEBA 1XCQB 3EBIA 4Y8DC 3ARED 2P8LB 1D5RA 5E5MA 4N9GA 2G3ZA 1FLTX 4K9EH 1QLRA 4Z0XA 3G5ZA 1AC6A 5E6IA 2OMUB 2O30A 5EU5B 1SXNA 3SBWA 5F9DC 3ZO0A 2X4RB 4ZNEA 2EQDA 3WO4B 1HQ4B 2K8QA 3O6LL 3SEPA 4ZNEE 1IQDA 3ULAB 1XH1A 2YD9A 5A2AA 4P0DA 1UXWA 5I30L 5DEZA 2XQYA 3KNBB 4GLRH 4JM2D 2FR4A 4LKXA 2KZKA 4ZUSB 5AEAA 5AG8A 5K9OB 4B96A 1EJOL 4EVNB 1A6AA 4GSRA 2QLYA 3DUSB 4OIAA 3WIIL 4Y5VA 1MWAH 3EYQC 4GRMB 2FECI 2EVHA 2ZKMX 3D2UA 4MVBD 3T0BA 3AS3A 5FYJL 3TBSB 1H5BA 4FTVA 1ZANL 1CD1A 2OMVB 2NNRA 2J2ZA 3GIZL 4JO1H 1NEZA 2VABB 2ZQKA 5K1NA 2F18A 1Y18B 4XWOC 5D4JA 3QUYB 3CFDA 3FYIB 4QXGH 1FWXA