4KO5A

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/w48l/v95i/y108f)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNLVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/W48L/V95I/Y108F)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ko5A00
5B1BB 3X1EA 4G7SB 4P5SA 1NIFA 2BHFA 4X4KA 1PZAA 4YSAA 2FT6A 1ET7A 1OOWA 1A65A 1JVLA 4Q8BA 1ZV2A 3S3CB 1WS7A 4YSUA 3G5WA 3UABA 2N0MA 2GC7C 4NB7A 4F2FA 4A2FA 2IWKA 2ZONA 1DYZA 3CVBA 3PAVA 5I6LA 1ZDSA 4BXSV 2CCWA 1RCYA 3BVDB 3NSYA 4G7QB 1OCCB 2CJ3A 3OQRA 1AQ8A 1PZBA 4JHUA 1GY2A 1DZ0A 2H5UA 3CVDA 4YSSA 3IBOA 3QJSB 4F7KA 2AFNA 1NINA 1E5ZA 3OM3B 4HCIA 2EILB 4G7RB 3UGEA 3AG2B 1MG3C 1KCWA 2UXTA 1KYAA 2YARA 1AG0A 1AZRA 2GIMA 4DP5X 5TK4A 4GY4A 4GP8B 4DP7X 1BEXA 2GHZA 1E65A 2VMJA 2HX7A 4RH4A 3DTUB 1W6LA 2PPFA 4N8UA 2PP8A 4GP5B 1XB3A 1ET8A 2PP7A 2HRGA 2VW4A 4BDVB 3C75A 2B08A 2FWLB 2VSKB 1BYOA 6PCYA 3S8GB 2PP9A 1RZPA 4N4YB 4YVNA 2VW7A 3AZUA 1NIBA 2AZAA 1V55B 2TSBA 3ABMB 4GYBA 2W88A 1OE1A 3IEAA 1V10A 4DP0X 3ABKB 1A4AA 2QT6A 5AKRA 4YSOA 2DY2A 1JZJA 1FFTB 1OV8A 2DV6A 3EHBB 2YAFA 4KOCA 3ZBMA 3AW5A 3FU8A 3S3DB 3X2QB 1HAUA 3X1FA 1BXAA 2H47C 4KO9A 3PCYA 2EIMB 2VM3A 2FT8A 1OCOB 1SDDA 3JT2A 2XX0A 3S3BB 1JZEA 3WKQA 3IN2A 1NWOA 2FNWA 2R7EB 4A68A 2HRHA 1YLBB 1N68A 1WA0X 2WO2B 3DIVA 4HCFA 5PCYA 4A2DA 2W8CA 3FU9A 3QJVB 5I5MA 4AKOA 5I5IA 2JFCA 3H4HA 5D4HA 1F56A 4YSQA 4A2EA 5D4JA 3NSDA 1XB8A 3NJJA 2CUAA 2FJSA 2AZUA 3JTBA 2IH8A 1J9RA 3PLYA 2BP8B 1ADWA 2PPCA 2GB2A 2ZOOA 4NERA 4GXFA 3X1GA 4DPAX 1ZDQA 3FQYA 1WA2X 2DYRB 1A4CA 1FA4A 1SHXA 1ID2A 3T6VA 2Y69B 4YSPA 3WNIA 1QHQA 2EIKB 3NJMA 3X1NA 1N70A 2X87A 2FQFA 3WI9A 2BP8A 4KOBA 4E9QA 4DP1X 1NWPA 3ZDWA 4UAHA 3AG1B 2DYSB 2BP0B 1URIA 3AG4B 1CUOA 1PAZA 4BXVA 3EH3B 3SQRA 1GS8A 4YL4A 5B7FA 1L9PA 3WIAA 3WNJA 4AI7A 1MZYA 2QDWA 3CDZB 1QNIA 1KBVA 1AZNA 3GXUB 2PCYA 2YAQA 2IDSA 5LDUA 4E9TA 2BP0A 1IC0A 3OMAB 1J9TA 3QJQB 5TK2A 1KV7A 4BWWA 1BYPA 3FPXA 2GBAA 2E86A 5ANHA 1X9UA 3EH5B 3X1BA 1CYWA 1AAJA 3RYMA 1GSKA 4YSCA 2HX8A 2J55A 1PCSA 3IN0A 1EZLA 4KNSA 5FC9A 2FQEA 4HHGA 3CZUB 3T71A 3PXLA 4AKQA 5B1AB 4G71B 4A66A 3FU7B 3HB3B 1NPJA 2ZXWB 1JZGA 4JHVA 2XV3A 2PLTA 3QJUB 4HHWA 4UANA 1OCZB 2AVFA 2CALA 4WTQA 3FSWA 4Q89A 2WO3B 1W8EA 1PF3A 2ZWNA 1IBYA 1R1CA 1V54B 3FU7A 3NJHA 1AZCA 2P80A 1BQ5A 3CG8A 1L9OA 1GY1A 1PNDA 2IDFA 4QLWA 5B7MA 1A4BA 1FWXA 1CC3A 1A3ZA 2JKWA 1AIZA 1NZRA 3OMIB 4NAJA 2JXMA 5PAZA 4E9XA 1SHWA 4E9VA 3KW8A 4F2EA 1JERA 4AZUA 2XYBA 4BDVA 2FQDA 2J5WA 3OMNB 3NYKA 1XMEB 4M4RB 1PLCA 4E9SA 1EHKB 1ASQA 1BAWA 1WS8A 2PCFA 3V9CA 9PCYA 4TXVB 4CSPA 5I28A 1UATA 5I6OA 4GP4B 2QPEB 4G72B 1WA1X 2IDUA 3ABLB 5EHFA 1L9QA 2CBPA 4WKXA 2VW6A 3NSCA 3T9WA 5B7EA 3FPYA 1E30A 6PAZA 1BXUA 3NJIA 3NP4A 2BWIA 2HX9A 2OV0A 2YAHA 3NJFA 2YXWA 3PPSA 3SBPA 2IWFA 4BK5C 1ZPUA 2UX6A 2BZ7A 1A8ZA 4DP9X 3NJKA 3L45A 4YSDA 1PNCA 1AS6A 3FS9A 1WAEA 3UACA 2J56A 3TBBA 1JXFA 2YAPA 1NIDA 3N55A 2YQBA 4E9YA 4A2HA 4E9RA 5AFAA 4E9WA 2R7EA 7PAZA 3FYEB 3NJNA 3T6WA 1AS8A 4M3HA 3ASNB 2QPDB 3BQVA 2YAEA 4HAKA 3V9EA 1PZCA 4DP8X 1JXDA 1NDTA 3GYRA 2HXAA 2FT7A 3TA4D 1NTDA 2IH9A 3UAEA 3D12B 1ILUA 2H3XC 4AX3A 2Y1AA 2EINB 1M9WA 4HIPA 2I7SA 1GS6X 4ZK8A 4BWUA 4HCGA 1ASPA 1NIEA 4L0PB 4AKPA 1SF5A 5I6KA 1J9SA 2CAKA 4P5RA 3WG7B 4PCYA 3HEIB 3H4FA 2YAOA 2GI0A 4G70B 2A3TA 2XUWA 1BQRA 1X9RA 1NPNA 1MG2C 3FSVA 2PPEA 3IE9A 5I6MA 1BXVA 3H56A 1JOIA 5F7AA 5A7EA 1KBWA 1JVOA 1SF3A 2PPDA 1J5CA 1NIAA 2OCCB 1NICA 2YAMA 4W1TA 5B3SB 3CVCA 3GDCA 3TU6A 2PPAA 1OCRB 1RZQA 1MDAA 3CDZA 4ENZA 3QQXA 3SBQA 4W9ZA 2UX7A 1PMYA 3U25A 2FTAA 3ZX1A 4KO6A 1BQKA 2I85A 2B3IA 4DPBX 2RACA 2XXGA 3ERXA 2VSMB 1PLBA 4QKTA 3AG3B 2UXGA 1AR1B 2NRDA 4YVUA 3OD3A 4FAAB 4HZ1A 4YSTA 2XWZA 3NSFA 1CURA 4BWTA 5I6PA 3FSAA 1OE2A 2Q5BA 2QDVA 5F7BA 2XVBA 1AANA 5B1JC 2XU9A 2XV0A 2IAAC 4CSZA 4DPCX 2BW4A 3NJLA 2MRYA 4EF3A 2EIJB 5I26A 3FYIB 1SNRA 5I6NA 1CYXA 5D4IA 2XV2A 2WSDA 1KDJA 2BZCA 1SJMA 2UXVA 1GW0A 4K9JA 1XB6A 3ASOB 1OF0A 2J57A 4PAZA 1KCBA 3UAAA 1JXGA 3MX0B 1JZFA 2X88A 1AZUA 4KNUA 3UADA 2VM4A 2LLNA 1GR7A 3NP3A 3NJGA 5IY5B 4YSEA 2BWDA 2MTAA 2IDTA 2VN3A 1AZBA 7PCYA 3TBCA 2FQGA 1L9TA 3T6ZA 1AS7A 1W6WA 3NT0A 3FT0A 1GS7A 1B3IA 4UF7C 1GYCA 1QLEB 2UXFA 1PY0A 1ZIBA 3DKHA 3S8FB 2OJ1A 3T6XA 1SDDB 1TU2A 1L9SA 1IBZA 4DP2X 1KDIA 5B1KA 3WKPA 1SFDA 2YXVA 3AY2A 2GSMB 1M56B 4KO7A 5E9NA 1L9RA 3FSZA 1AACA 3FQ2A 1JZIA 2Q9OA 1KGYE 4A2GA 1AG6A 1IKOP 3MBWB 3EH4B 3TASA 3KW7A 4MFHA 1TKWA 1E5YA 1VLXA 2GC4C 1TEGA 3N2JA 2AANA 3QJRB 8PAZA 5AZUA 2IDQA 1J5DA 1IUZA 4YSRA 2I7OA 1T5KA 1ASOA 5B1JA 3EF4A 3FQ1A 1J9QA 1OE3A 1PLAA 2HLEB 2XLLA 2XXFA 3PAUA 1AOZA 1HAWA 1RKRA 1TEFA 3QPKA 3PAZA 4HALA 1ILSA 1JZHA 1E67A 2DWSA 1ET5A 4FA7B 4A67A 4DP6X 2P80D 1SFHA 1ETJA 3QJTB 4JKNA 3ABGA 1ZIAA 5I5JA 2BO0A 1HFUA 2HZHA 2DWTA 2IWEA 2BW5A 2TSAA 4DP4X 2XX1A 3ZIYA 1M57B 3SBRA 4KO5A 1MZZA 4KNTA 1I53A
chains in the Genus database with same CATH superfamily
3FTXA 4JO1H 2LAGB 1OT4A 1DVFA 5ISZD 3I9GH 2W65B 2XKSA 3KPNA 3WUWB 5MEND 4MSWB 4HD9A 3SDCA 4WY7H 1IEAB 1UM6L 3MOQA 2VLRB 1JVLA 4O2CA 4XOCA 2F5BL 3MYJB 5CEZH 2GC7C 3O4OB 3PQYB 5KS9E 4DEPB 1OAKL 3A6BL 4MMZC 1ZVSA 2Q3XA 2WUCL 2MWCA 5I1HH 1YYCA 3ECVA 5FUOH 1SLXA 3UZVA 1J1OL 2CJ3A 4NM8H 1OW0C 5IB2A 2WQVA 1HNGA 4APQC 2H5UA 1VFAB 4UT9A 2BNRA 4YSSA 5IKCB 1JF6A 1KT2A 1KPRB 1AGDA 1ZLDA 1NCJA 4YQXL 1EZVX 4OZHB 2RHEA 4WWKB 2J4WL 4QRPA 3SEPA 2MMXA 4MLIA 4G6JL 4Y5YB 1U3JA 4MASA 5E8DH 3K3QA 1CIUA 1FVDB 1AQDA 1TQVA 1NQBA 1AHKA 4O2FB 4X6EB 2A83A 3LXBA 1BEXA 4U3SB 3KYNA 4QDGA 2GSIA 3RFZC 3PNRB 1OTSC 3QWOB 3BD3A 1TCRB 2ZT9C 2FZ3A 1EUTA 2OL3B 4IBLT 1AGFA 2ZXGA 3R4RA 4KQ3L 4WHCA 5KVEH 4HX1B 1MCJA 3FT1A 2GTQA 3OZLA 2F7QA 1B0GA 3Q2CA 2D3NA 4QRUB 5C6PB 1BYOA 3DOHA 3VVWA 1KYOJ 1SEQH 5JXEA 1JNNH 4AVIA 3LNHA 3BQUC 2CDEA 1DHKA 1B0RA 1CXHA 4FJ6A 4OCRL 2GUOB 1OK0A 5D1ZC 1ZVNA 2UZIL 3CH8A 4HDIB 5E6SB 5HD8C 2IAMC 4D0CA 2PTTA 1NOAA 3OLDA 1FBIH 3ZGHA 3KLHD 3U30C 5EBLA 3MI6A 2BH0A 1SYVA 3TIDA 1MFEH 4LSPH 5EIIG 5ICZA 1KJ2B 4I89A 4HS8L 3WXVL 3TEYA 1JHKH 4ODVL 5DJ6B 2FO4B 4J5VA 1EEZB 1JVKA 3NA4A 3JV4B 4YX2L 4BELD 3FFCD 2CGRH 3CPLA 3BUPA 3P77A 4NZTH 5GS3A 4K94L 4OI7A 2ZWSA 1N8ZA 1GGYA 3V0VA 4F8QA 2QSTA 5J6GA 4ISVB 3K4ZA 1A6ZB 3C5ZB 2EO7A 3CHOA 3SPCA 3Q2NA 2JI1A 3RPIB 5KSBB 5ABDE 2WO2B 5TE6L 3OKNB 2VDQL 2JFCA 3IDXL 1ORSB 3PP4H 4H2AA 3GLDA 4JN2A 2GVYA 3KHQA 1T0OA 3LZFH 4M7LH 5DJ8B 3PJSA 2ZUQB 1FPTH 1PKQB 1W0VB 4Y1AE 5EWIL 2DQDH 1N8OE 2XYCA 4YR6B 5SWSB 5E8EB 2FJSA 1KULA 2NW2B 1I8UA 4I0PB 4S2SA 4WNQB 4UTBA 1FAKT 1UA3A 3KPQA 2QVMA 1B88A 1YYMH 2OMVA 3C09B 4YUEL 2WQXA 2FYYA 5IEKB 2GHWB 3NCBB 4GXFA 5SX5H 3W39B 3FQYA 2WYTA 3CFEB 35C8L 4DN4L 1BZ7A 1DVUA 3V8CA 4M62H 2YPVA 3CLFL 5EBMA 1RIHL 5DDHB 1P1ZB 3WTTA 4WKZB 5MENE 1Q72L 2NLJA 2VRQA 2ZOLA 3QDMB 2AXJA 3AXIA 3RKDC 3WIIH 1QWHA 2CO6B 3BWZA 1K85A 3IAGC 3AG4B 2K6WA 3DBSA 5AD0A 2O6CA 3T4YA 3WIAA 1MZYA 1MELA 2KZ1B 4UQCA 4QYAA 1E27A 3VYPA 3O6KH 4G3YL 4ZDHA 4YHPA 3WSQH 5DZ9A 2E0PA 2AF2A 4FKEA 1QFOA 1SLVA 4NBYB 2Y5TA 3FO1B 3IKCB 3VGAC 3SYOA 5DHMC 1EAJA 3OB8A 2F8OA 1MCWW 2YD8A 1PCSA 4KNSA 4R2GB 4IKKA 3V4VH 3C6LD 3VYOA 1P7QD 2H0EA 3VWJD 5GRJH 2R4RH 4N6QA 1VRSA 4JFZL 3WIHA 2B7DT 1JGLH 3T77B 5LGJB 4G82A 4Y5XC 1ZSDB 3KLAA 4MDJA 1OCZB 4UANA 3BO8B 4PJ9A 1D7DA 3KZ8A 3C87A 1RIVL 3EGSA 1QVOA 5DGQA 1MLBA 4LSSH 3TJEL 1PF3A 3GMLA 3TN0A 1IQDB 3ZDYF 4NZDA 3GRWL 4XP9H 4UAOB 1W72A 4BQ6A 2GJ6B 2G75A 2VOTA 3ARFD 2V2TB 4HH9B 2W95A 3HI6L 2R1YA 4P48A 4RGMC 1L9OA 4PGCA 4UQIM 4Y2DA 3NSXA 1HQ4B 5KZCB 5GJSH 2FX9H 4HF5L 1NFAA 4AMKL 1V7NH 3WN5C 5PAZA 3DECA 1SY6H 5IF0A 4CVWA 4AL8L 2J43A 2WZPD 4JPSA 3MRLA 4JFYB 1XF4B 3L3JB 4J28A 4WTXA 5C86A 2HFEB 3U0WL 3TOPA 4J3VA 1B0WA 1F4YH 2FIRT 2RQEA 2UZYB 4HXAH 4YLCA 5L7XH 1I75A 5KVFL 4PJDB 4U1JB 3FQTA 4NJ9H 2OMNA 3OPZH 1BWMA 3PGFL 3CZEA 1E0OB 4MMZA 1JZ4A 1R24B 4Z7WF 5JORA 4LPUA 5DJZA 3FFCE 2Z7ZA 4LSVH 2H6PB 4PJIF 5IV2B 4KDVA 3UTQA 3F6LA 1X9LA 2O6PA 1OW0A 2ITEA 5FHAH 1ZS8B 3EUDA 3T2QA 2EKSA 3EO1B 1HXKA 5F9OL 1EDQA 4N2LA 4K7FA 4QOKA 2ZUYA 2VLJD 4KMLB 4JM2C 2ZXCA 1DO5A 3UTTE 2CIIB 5E2TH 3KPRA 4U1SA 2IBZX 2PNDA 3ARRA 1S3KH 5IG7B 4AG4H 1CQYA 4GT7A 1NUFA 1UXLA 1CK0L 1NIDA 2FJUB 3QPQC 2H8PB 3LPOA 4UOQA 5FDWA 5D7IE 5F7EH 3RFZA 3O4OC 5IP4A 4G1EB 1KGIA 1G5GA 4KROB 1O7SA 2DF3A 3MBED 1NAKH 2DW5A 2DDQL 3MV01 1FLRL 3VD5A 1KY6A 1HHKB 2MCPL 2YLHA 3KLDA 3DXAD 5D2LB 2PABA 4YNYA 4PV1C 3QWNA 3VI4F 1NGWA 2EE3A 1K6QH 2ZXAA 4UNUA 2XN0A 2AEPH 3BQUA 5ERWB 1VKXB 2VXQH 5D1ZA 1RZ7H 4P5MA 4Z7NB 5FF6A 3RVUC 1WBYB 2IAMA 4ONHB 4QRQA 1N59B 1WG3A 3FUIA 5IBUB 5FO2A 3VRIA 5ADOH 3GHBH 1GYAA 3DGGA 4ZRGA 1LE5A 2LFGA 4U6TA 4IU3B 3VNZA 1CFTB 4W9EC 1RD6A 4OBRA 1CZ8L 1JUFB 2X9WA 1F1AA 4ERSH 1SZNA 1FUNA 3OSKA 3RJQB 3IRZA 5LGHL 3MLXH 3MV7E 4ZT1A 4F2ME 2DBLL 4NFBA 3Q6GL 1ZGLB 1BZDA 1GOGA 2PPAA 3L9RB 1R0AL 2WM0A 2UZXB 3QRFM 4W9ZA 1E2WA 3WFCH 4YDKH 4WW2A 1JPEA 4FFVD 4BSVA 4OVUA 4G42A 3K7UA 4HKXA 4LKXB 1G7IA 3OGCB 2WXOA 2NNFA 3OBAA 5DZAA 1KXVC 1PDKA 3G6JB 3MRGA 1RHHB 5TQ2L 2J8UA 5D7LA 5DSCB 2JNZA 1YQVL 3EBAA 1XGZA 4Q6YA 1O6VA 4JFHD 3OD3A 3CSGA 3B2PA 1PIGA 3L1FA 1TSHA 2Z7YA 2A38A 1YC7A 3TBTB 1O6SB 2VDNH 3AT8A 3BPNC 4IEFB 4PJHB 4RNRB 4CVUA 1NBCA 3PWPD 3PIQB 5DUPL 4X4YA 1THAA 3O11B 1XF3B 2JTDA 4AENB 1JP5A 1TDQA 5CKGA 3OKKB 4XBEH 2XV2A 3CFBB 1UOVA 3C5ZC 3VG0H 3U1SL 3M17B 4PY8J 5HXMA 4Q0XL 1XT5A 2COVD 4KMQA 3T0EC 1PG7W 3EYSH 3FCGA 3CH1B 1AZUA 4KNUA 3Q5TA 2PW1A 4UM8B 3VFWA 4N26A 1MJJB 3ROOA 3NP3A 4NQCB 5IY5B 1UD3A 2BWDA 3C2AL 4CW1B 3MTRA 5D1XE 5DJDB 3TLRA 4HOZA 3MRKA 4R96A 4N3TA 2APBA 3FRUB 5DFVD 1A7QL 1NUNB 3LHPH 4ZMOA 2YRZA 2V3FA 4BQBA 5KBKA 5IHWA 1ZIBA 4IRZH 3VXTB 3D33A 3VJ6A 4ALAC 1L9MA 2W60A 2Y2YA 1G7QA 3DRQA 1I7ZA 2O61B 1F58L 1HSAA 3L17A 5CFAA 5HDBE 4G8AC 4OY9A 3V5HB 1D7CA 2N4IA 4U3CA 2V9UA 4XMLL 1TZGH 5HHOE 4UT6L 3R8QA 5FOBB 3G08A 4IRSB 2D0HA 4FQXD 3MBWB 2EYSA 5AW7B 2OTUB 3EO9L 5CJ8A 2LE9A 2OM5A 1FI8C 3QC5X 5CJOH 3O41A 5EO0B 2M8XA 3QWRA 2Y72A 1QASA 3CDCA 3IXTB 4JFQB 1UXWA 2AGJH 2XOTA 3FL7A 4FFZH 4N0FB 1B6UA 4KXZH 2CIKA 4MTMA 4UIMA 5J1TC 4Z7AA 1T5KA 5B1JA 3EF4A 5DK0B 2EDYA 4XVJL 2D4FA 1PLAA 1JDDA 1MW0A 5DMKB 4GS7B 1LK3L 5AUMA 1RMFH 1U0QA 2WP3T 3FUEA 4UV7L 3VVVA 2NZIA 5MP6L 4RX4A 3CFKB 3BPCA 2RQ8A 3LZNA 4IIQC 4LB8A 1H15A 1RSFA 2WTRB 3F2LA 4R2GC 2ZNWA 3V4PB 4PUBH 3WN5A 1BM7A 5B38B 2AEOA 3LSOA 5GGUB 5CSBA 1GL4B 4PS8A 4FABL 4DP4X 4BZ2H 3D87B 3FN9A 4R90L 3WLWD 2YRPA 1P5UB 1UADC 3CFIC 3OJDA 3SE3C 4D9RE 3LRSB 2EYRA 2WYIA 4JRFA 4G9FB 4YSUA 1HE8A 4G7SB 4E36A 1N6VA 1R46A 1OLZA 2NY6C 2JCCF 4UAOC 3ZT7A 5HI3D 1AFVL 3N41B 1G6RH 1G4RA 1I1CA 1Z3GL 1G0YR 1NDMB 3D18B 4N2KA 3HRZB 2AJVL 4Z7VF 1PD6A 1KIRB 3IYLW 4I4WA 5DURB 1P9MC 1U8LB 5B8CC 4WTZG 3QORC 4XNUL 1CE1L 5JOFA 3VNYA 1BBJA 4C8XA 1UCBH 3HRPA 3CVBA 1NMCC 4HUUB 4PIBA 5CBEA 1ZDSA 2P8PB 1LO2H 2CCWA 2X09A 5IBTL 5C0CA 4NGHH 1M1SA 2XZZA 2AQ2A 3MYJA 3BISA 1GW6A 3PQYA 3SYQA 5C92A 2BSRA 3DX7A 3MRCA 4OF6A 3C60D 4V1DD 5C07D 2I9TA 4XC3L 4AMXA 3QHZH 2EEFA 1DSFH 2Z8WC 2BZDA 1WQVT 3O9WB 1H6TA 4WW2F 1GGCL 4I48A 5GJTL 5DYOB 4G5AA 4PVNA 2ZG1A 1GRWA 1XIWB 2EE9A 4HULB 4JFFA 1VFAA 3QRGL 4NKIL 1SPDA 4IK6A 5IKCA 4JDEB 3LPGA 3QZWB 4OLYH 5I1AB 4NS0A 3DTUB 1BF5A 1CGVA 4OZHA 4TN9A 4TVPL 2DIBA 5CJ5A 1TG8A 3VH8A 2DICA 1NCOA 2VW4A 1FVDA 4JFTA 4ZJ9A 4WIQA 1L7TL 4EIUA 1DQDL 2FWLB 2Y22A 3KLLA 3S8GB 4A6YH 4EOWL 4FHJA 4KROC 3AWGA 5E5UB 2H2PD 4KKNA 4RDBA 2OL3A 2XKUA 2Y2TA 3MFFA 5JIKA 2VH5H 4HX1A 5E1GA 4PW9A 4LOFA 4FFYL 4JN1L 2VXTL 4QRUA 4C83A 3OWEA 5E4AA 3WOVA 4F7MB 2EADA 3D07A 2HFGH 1FIGL 3S2AA 2Q10A 4L1TA 4F33B 1UYWH 4TUKL 4BSWB 1A7OH 2P8MA 2A9AA 1XV8A 2GUOA 1D9KD 4Q6IB 3Q48A 4HDIA 1RFDH 1KXVA 2ZOTA 4RMVA 2FAUA 2VYRE 2WWMD 2XRAL 1NFIA 3ESOA 4ZFOB 1OCOB 3C5SA 3S3BB 3CK0H 3L5HA 2EEAA 2DYPB 1XXFC 3PWNB 1OSPL 3CHPA 4NN6C 3T09A 3MLPA 3N3EA 1Z5LB 5DJ6A 2YPLB 4X7CC 3HG1B 1GMEA 2VXVL 4MD0B 4AKOA 4GAJL 2ODHA 5D8JH 3LKPB 4KZCA 5D4HA 1GKOA 3O3AB 4OQTA 3RDTC 4Y9GA 4NEHB 3NPZB 5INDA 4KMTL 3C5ZA 4RWYH 4P99A 5ACLA 1JXKA 3HJ0A 4V2CB 4XP1L 2BVYA 4M7JH 4Y7OC 3RPIA 5KSBA 5AW0B 4I85A 3O8XC 1I1FB 4I88A 1Y6KR 4HVBA 1OP4A 1HWWA 3B37A 4F58H 4DPAX 3ISRA 3SE8L 5F71A 4KHXL 3W81A 1DBAL 1XGPA 5DJ8A 1ZXKA 4JRLA 1WCQA 3K6DA 4KAQL 2P5EB 5E8EA 4ZSOB 3WKYA 1TYJA 1VFBB 4FFWD 2NW2A 4I0PA 3WI9A 1KIPB 2R2EB 2R8SH 2L8AA 5FGRA 3ES6B 5GSRB 4ZW6A 5IEKA 3TV8A 4XGZB 3EDDA 2XI9A 3DURB 3W39A 3CFEA 1F6LL 3A4DA 3M7OA 2V9QA 1DEEA 3QDGD 1EZSA 1DVXA 1IIKA 3GTTA 3CUPB 2FBJH 3KM1A 5CP3H 1INEL 2ATKB 1BQHB 1CCZA 1QNIA 3BZ4A 4QXUH 3QDMA 5AW5B 2HAZA 3B34A 4Z7QB 4XXDB 4TPRL 4RGND 2CO6A 3BLBA 3KYKH 3LB6D 3CHRA 4MS8C 1BM3H 1CLYH 4WI0A 2ZUTA 5KW9L 1ZHKA 2E7CA 3DX3A 4BH7B 3QJFB 4HH8A 1BYPA 3R1GL 4F7PB 3P4LA 1QFHA 1QSED 2J8OA 5C8JA 5BRZD 3LYRA 1LDSA 2V6HA 5TDPB 3RYMA 4L5FE 4QRRD 3TH3T 3GJEB 1QR1A 1JWSB 4K73A 4S1DC 4HHGA 2YXFA 3QIBB 3PXLA 4PJAE 5AW3B 3V4VB 3UEQA 4LLYB 1Y07A 1JZGA 4P2RD 4L4JA 3CU1A 3UJJL 4ELKB 3IKCA 5CINH 5LBGA 2XV3A 1Z5HA 3ZSSA 4EDXA 1H6FA 1Q9WB 4IIQA 1R4XA 2B4CC 4PJBE 4PMFA 1WFMA 5C0AD 2FSEA 4Q9RH 3BUYB 2Y2WA 4PLJC 3VCLB 4N2GA 2F7RA 2FWUA 4IRSC 4K2UL 3QAZC 4KGJA 3NPSC 2O5YH 5E03A 3N9GH 4HSCX 5DO2D 3UO1L 1A1NA 3FMGL 3RVWD 1WFTA 2BVQB 1PNDA 4OD2B 5B7MA 2MPAL 3TWYA 3MJ8B 2AJZB 2XY2A 1A3ZA 4N5UA 1CS6A 1IQDA 4FHBD 1FO0H 3HMXL 4IOSD 1OALA 5I75B 3B9DA 2V2TA 4HH9A 5JMRA 3IMWA 2PYEB 4GSDH 4OZHF 3V0WH 3BX7C 2KZBA 3GSRA 1O7DE 3UCRA 1P9MA 1EHKB 1HQ4A 5B8CA 3QORA 4OH2A 3NK3A 1CU4L 4FYRA 1CDGA 3OPUA 3TO2A 1BAGA 4J3WA 3FO0L 3UL4A 1JZ7A 4RQQB 3CFDA 4PYGA 1ZLSL 2DTMH 1LO3H 1XF4A 3L3JA 4JFYA 4ZUVB 4S11A 4J3OF 2UZYA 4GAGL 2QFRA 4R5TA 5F3BB 1YNKL 1ZMYA 3CN2A 3FB5B 3S2CA 1C5DB 2BIHA 4U1JA 1P5UC 3BP5B 3IETB 2HX9A 3BP4B 5GRUH 3I74A 3HR5A 2Y36L 4FS0A 2QR0B 3QCTL 4NRYA 4DQAA 2IPKB 1A3LH 5KS9B 2EDDA 3QZNA 4NPJA 4GG6A 3J7HA 2Y1YA 2NX5A 1ZS8A 3GSQB 4MHHI 4OB5L 5LN8A 3BFQG 3NCEB 4FJYA 1KCRL 3W11D 1XGRB 3CFCL 2CXKA 4C54A 4DGUA 1WF5A 2W81C 2O5ZL 5E1QA 2J71A 1KTLB 4LLMB 5JO5A 5IROD 2CIIA 2QPDB 4JFSA 5IG7A 3S88L 2WJ7A 1MFMA 5HHMD 3WFEH 1FNAA 1MLCA 4EBQL 3TA4D 1YEDB 2CKNA 2H8PA 4N8CL 4ZUWB 4OBSA 4KKCC 1KENH 3US9A 5LGKA 4NUQA 2EINB 1YC8A 5DS1A 1ODUA 1GS6X 4X6CA 5EUKB 1E4XI 4M93B 1WT5C 1S9VB 4PJ8B 5D5MA 2HT4C 4LLVB 4OCNC 5IQLA 4AKPA 1NC4D 4H8WC 4NZRH 3O3EB 1CFVH 1CLZH 2X4RB 3W38A 4JM4L 4HIHB 1KLGB 1JPSL 1ZE3C 5TFSL 1ECZA 1QBML 4JJOA 5ID1A 1Z3RA 4MNQD 4WUUD 3B7YA 1OPGH 3JWOL 4DUWA 3L6FA 1WBYA 2HT3C 1QSEE 3MUZ1 4EQ3A 2C3VB 1JNJA 1JPGB 2UUDK 3K6FA 2EZ0C 1PX8A 4AJYV 2PWEA 2EAEA 4EUPH 1XDTT 4QRRE 3EJZD 4S1SH 3SGKC 1CL7L 3OAUH 2X4OB 3DX6B 4DKFL 4P5TC 2CRYA 3FOLB 2G5BB 1AKPA 1N26A 2F7OA 2I85A 1AQHA 1A6PA 3FAXA 1ZGLA 1U6AH 5KSVB 2VDPH 3L9RA 3RWFB 1JRHH 4WY7L 5JW4Q 2UZXA 3EFDH 5C0AE 4BFFA 2Z3FA 1TQBC 1PS3A 4N2DA 5T5NF 3KLQA 3H3PL 2CO7B 4HZ1A 5TDOB 3O8XA 3UTSE 4N2OA 2Q3AA 2YIHA 2H2SC 3OGCA 4DJMA 1FNSH 4ELME 2XVBA 4E42B 4Q6IC 3ZSTA 5LWYL 1NEPA 2FB4L 2WSPA 3FHEA 1KBBA 3F6JA 3MDJA 2Z6FA 3EYOA 3QRLA 4CSZA 3CDGB 4TLTA 4Y1AB 3QDHA 5FUOL 5I6NA 4L18A 4PREB 1NKGA 3KGUA 5H35B 4NM8L 5J12B 3O4LA 5AVVB 1FFOA 1C12A 3TBTA 1GW0A 1A9BB 2AMGA 2BP5M 3NCWA 4IEFA 4RNRA 1TZIB 3OF6A 5JOEA 3UAAA 3UP1A 1A3RH 3PIQA 1JZFA 3O11A 4NQED 5IUSA 2VM4A 2K4WA 3VB9A 4BFEA 5IMOB 3OKKA 1BG1A 1MVUA 2M83A 5DQ9B 4Z78A 4NXSA 1JNHB 3CFBA 5F7LB 2Z8SA 4DW2H 1TTUA 3M17A 2ZSVB 5MENB 1FNEA 1ZT1A 1K5NB 3LN4B 4LLDB 1BZ9B 4MWFA 4HETA 5BQ7B 4M4RA 3TO4D 2YUWA 3DO4A 5IMKB 1FN4B 1MJJA 2WPGA 5E4OA 1JAEA 3I9PA 5IFJB 3W2DL 5IHUH 2Z1KA 4CW1A 5DJDA 5KVEL 1SXBA 5FCUH 4GO9A 5KTEL 4L0ZA 4AQOA 5E9NA 4H1LG 1ZHBB 1SEQL 1X4XA 2APXA 1CFSB 1DE4B 4ADJA 2Q9OA 1NBYB 5GRXG 2YGPA 2B1HL 4L8SC 3SE4C 5IZ7A 2J44A 3K8MA 3NA9H 1H0DB 1RZJH 2O61A 1Y6NR 4O02H 4N68A 3GBEA 3MKKA 3V5HA 2XIIA 4OVVA 1KGCD 4PJDF 4EO5A 3U6RB 1GPOH 4LSPL 3H9SA 1PU0A 5FOBA 4WK4B 4IRSA 1OB1B 2DM7A 2XPZA 3GI9H 5CJXA 4OV5B 4K71B 4PH8A 1WZKA 4NAQA 3VSTA 1OE3A 3C9NB 4JDTH 3F7KA 3OKOA 4F80A 4F7TB 4LCUA 5EO0A 4RGOL 3VH8G 5GHWH 2LVEA 4N0FA 1YY8B 1FAIH 3CFQA 5HYSB 2I27N 5HPOA 3ATAA 4M6AA 1SMDA 4UMSA 3ABGA 2V8MA 5CZXC 4XVTH 2IWEA 5DMKA 1VCAA 4PJXE 4K9EH 3QXTA 1M57B 3CFKA 1RK7A 3HR6A 4M7LL 4I18B 3OHXC 4KO5A 5TPWL 3FOMB 5D70L 1WCBA 5B38A 1OD7A 3DMMD 3ESPA 3BKYL 4GKZA 5GGUA 3N1MC 4HJUA 2ZUUA 1HYSC 4N8VB 4QHMB 2FT6A 3WTUA 2FJHB 4PW4A 2WW8A 1T7XA 2GJPA 2OYPA 3SQOH 3V10A 3S3CB 3BZEA 4TNWK 1P5UA 5E8OB 1BVKA 4XHJC 2Z92B 3GHEH 3BT2L 3PDOA 4M62L 4TS6A 4UQ9A 1U33A 3V55A 3VXSE 4HEPA 3FF7A 1LVEA 5D2LF 5IFHL 4U05A 1CL7I 3GTNA 2IWKA 4QJ3B 5I6LA 3FFCB 2Z64C 1F3RB 4BXSV 4HWBL 1PG7H 4AYSA 4YH6A 3WIIL 4QRSA 1WBZB 3QUXD 4G7QB 4H44C 4HJSA 4QXTA 4KKZA 1KIRA 4JHUA 3VFPB 1U8LA 3RPBA 5AWNL 5FUCE 3EW3B 3ME0B 3D30A 5FM5M 4HUUA 4CAGA 4TRPL 4YHYB 1MUJA 2DM2A 2P8PA 1EPFA 3A24A 3OM3B 3O6KL 4KKLD 1E6JL 2PR4H 3WTSA 3UTTB 3ARTA 3WS6C 2EE2A 2R69A 2E27L 2OMBA 4BM7A 3L3KB 4TSAH 1DJGA 1NBVH 2WAQA 2C1PB 4M5YH 4XBGA 4IKLA 3N85L 1AXTH 2VMJA 4HIEB 4ANXA 2XKNB 4AIEA 4ZW5A 4E41D 2HKHL 4OFYD 1U8KA 4JRXE 4PRHD 4IBQA 3IGAA 5AW8B 2R4RL 5GRJL 4AEHH 5E4IA 3NDZE 5DRXA 3SGEH 4BDVB 4MJID 2X1QA 4UDUB 2R15A 3UYRH 3NBNA 3G6JF 4JDEA 3QZWA 4JE4B 1RZFH 1X5MA 3BDXA 2PP9A 2H26A 2VDQB 3HPJA 2O6EA 2G0LA 2XETA 3QO1B 4R7DB 2WXJA 5KJ4A 5DZPA 3HPLB 3QUMB 4MXWL 3VGDA 3DUSB 1A25A 3MTXA 1RZKC 4PGDA 3SGKA 1V55B 4K3EH 4TSCL 5CUSL 1JGDB 1HS6A 4PJHF 3M88A 1AHMA 3IEAA 1FYTD 1Z6JT 3ABKB 4WU5A 4OF0A 3CFJB 1KACB 3S3PA 1VAHA 2Z93B 3OZKA 2VDLB 4P5TA 5D7KD 3TTYA 5F1OB 3NACH 3SIKA 12E8L 2MEJB 4WV1B 1TOXA 4PJ8C 4O5LL 1S46A 3PXHA 5GJSL 2FX9L 1I7TB 5K59E 3P4OA 4P5KB 2VM3A 3V5KB 3QFJE 1EBAA 1BW8A 1OY3B 4JCMA 5JDJA 3MV7B 4KK9C 1JV5B 3Q7JA 3UGXA 4AYFB 4F2MB 5AZ2L 4F7MA 4RZCB 2K3TA 3QWQB 3SPHA 2FWSA 2M2DA 2LTQB 1ZY9A 4HXAL 4POYA 1U8HA 5L7XL 1MI5A 5E2WL 4F33A 4BSWA 3ULVC 4RMQA 2WLKA 4X7TA 1G9NH 4Q6IA 3NABH 4UTAL 1ZTXL 1ZA6A 1BREA 5BV7H 3H4HA 1QSZA 4LSVL 4ZFOA 2VSDA 2DYPA 4Z3EA 3PWNA 2VZ3A 2YD3A 2CUAA 2QKSA 3VFUB 3IWUA 5MHSD 4PI2A 3P4MB 1HKLH 4NNXA 2XPGB 5DD0L 3LEYH 2VLKE 3D6GA 2RAMA 1XF2A 4EZKA 2ZOOA 3QAQA 2XG5A 3BHBA 3L95B 3BZFA 3O3AA 4C4BA 3AADB 4XAWL 2XFXA 3ZYIA 1G9MH 1UQSB 2AV7B 2CSPA 2Y4SA 2ZIDA 2JJSC 2NQDA 2DPKA 3DGCR 4UDTB 4NUJB 5J9PB 4AG4L 2O93L 2QLVB 3MGAA 5FB8B 2WCPA 5FA3A 1UZ8B 2V7NB 1RZIB 2WVUA 2EXSA 3LTVA 2ZCZA 2ZSWA 3QXAB 1T66D 4P8QA 4DGVH 3SKJH 4GSQA 2FD6H 3MRJB 1QSFE 4GW1B 1V7MH 1N19A 4FMVA 1AXIB 4ZSOA 5MERB 4A7GA 1OOAA 4U2YA 1KIPA 5J12C 2A77H 4CUCA 3ES6A 3AC0A 5GSRA 1JZ3A 1KXQA 4XGZA 3FB6B 3EGDB 3FQ4A 5D1XB 5DI8B 2AJ3B 2VITB 1KB5A 4J4PC 3WJJC 3ZL2A 4F3FA 2AEPL 4L8SA 3IKKA 3LEXA 1J05B 3SE4A 4CL7A 2I07B 1MCQA 1WBXB 3CUPA 3I3DA 4XX5A 1RZ7L 3QDAA 4R8WL 5CS7A 1F4HA 2E86A 2DJUA 4M6ML 1UH4A 1C9SA 3LQAH 4KI1A 4ZNCD 2ATKA 3VRJB 3II2A 4HU2A 1E9QA 4XXDA 3MRBA 1A64A 3CU7A 3GXDA 4WHDA 5HDBB 4CGTA 1ZJBA 3E1F1 5JW3H 4BH7A 3M46A 5TH2A 5HHOB 2A6KB 2DKMA 1BF8A 1ECYA 2ROXA 3AQXA 2ZPKH 3APCA 3MFGB 3OC5A 4TMPA 2HKFH 3GTVA 3GZOA 4HCRA 4WDIB 3N41F 3T2OA 5G4OA 1XSKA 5TDPA 3IFLL 2ZE0A 3GJEA 1DFXA 1JWSA 3WFCL 2MQ0A 4CMHB 3ZTCC 2QVTA 5E7FA 4LLYA 3UG3A 3QARA 1LILA 3D0AA 4JHWH 9CGTA 1MPAH 4R4FH 4ABUA 3GHPA 4NWTL 1G7PB 3GIZL 3F3HA 3SYPA 1JHLL 3FCUB 5FYKL 3W9EB 3HN5A 4H8QA 4LMQI 2V3DA 3VCLA 5IQ7L 1ZA3B 3BYTA 1HH9B 3W5NA 3OAYK 1NCBL 1FO0B 2EUVA 5LXGH 1IM9D 1YEKH 1F3JB 4K71C 4B9CA 2FQDA 4BFOA 4J1UA 2VDNL 3ZRSA 2BVQA 4OD2A 2F5AH 5D7KE 1VDGA 1XF5B 1IC4H 2AJZA 2EECA 3MJ8A 4JAMA 4NQXB 1EFQA 1WS8A 2RD0A 2J1KA 5IBUG 2OMYB 2X89A 3FFDB 3ML8A 5E2UL 3BGFB 4HUVB 2QGCA 5I28A 5AEAA 3VG0L 4FTVD 2WB1A 3CZSA 3QYNA 2XN9E 2XICA 5JHMA 1INDH 5F0MB 3BVTA 1E6OL 4CU8A 5I8EB 1JZ2A 1CD8A 3FUKA 4NRZA 4KTEL 2EH8H 2TAAA 3NSCA 4CSSA 1RPKA 3PPSA 3ORJA 2YAHA 3KBEA 4A37A 3S8WA 1J0KA 2Y7SA 5GRVL 1ZPUA 3TL5A 2YMOA 3U6XA 2D2OA 1UA7A 4ZUVA 4F20A 4OR1A 3WS6A 2VLME 4OUUA 3FQRB 4PVBA 1XEUA 2DQCH 2HRLA 3BYYA 4TLSA 3UACA 1WITA 1XSOA 2J56A 1C5DA 3D85D 3HZMB 1X5IA 4E9RA 3IETA 3M07A 3ZHDA 3HHRB 2RFXB 4JFWA 7PAZA 3I3EA 2QR0A 1HHJB 4L48A 4W4OA 4TUJA 3MCLL 5KS9A 3OC8A 5E8PB 1PD1A 3QQ9D 1VJSA 2YRBA 4XN8A 1TZGL 2EIZB 5F1NA 1CVRA 3E2HB 4M5TA 4M56A 3BIKB 1TCMA 1H9DA 1DQLH 4M6OH 5DJCB 4AX3A 5CEXA 2Y1VA 4LLMA 5J3HD 3FCBA 4XP4H 2E47A 5JXAH 1DJXA 4HCGA 4IMLA 5F7WC 1TEYA 2W92A 4FFZL 1G1OA 4Q9QH 1VHPA 1GZQA 3OKMB 1YEJL 4MS6A 3D69B 4JFPB 5HHVL 2BVPB 3GMNB 5C9JB 4N2AA 3UPRA 1ZLVK 3CSYB 3L1GA 4XTRD 4PGBB 4WFFD 1RMFL 5EUKA 3S0PA 3US0A 1S9VA 4PJ8A 3H56A 1AKJA 3A67H 3DUUB 4LHUD 4LLVA 1MCOH 5I16B 3QXUA 1HDMB 4K94C 1EMTH 2J21A 1H8LA 1A4JB 1JMXA 3FNKA 4UNTA 1UD6A 1Q9OB 1SEBA 1YEGH 2YAMA 4W1TA 5HPMB 4HIHA 1KLGA 2X05A 2CU9A 4EUPB 4JZJB 2UX7A 5A2IH 2G3XA 1I1RA 5EU5B 2XJLA 5IK3B 3IDGA 4A7GF 4P46B 3RVTD 1ZKAA 3ZX1A 5DVPA 1K4CA 2HT2D 3ARGD 2ADGB 5GRZA 1AXSB 1O5DT 5JW5A 1IGJB 5KVGL 5TE7L 1X7TA 3MV8A 2VDPB 2I69A 1G6RL 2VNCA 2X4OA 2Z4TA 1UJ3B 4D9LH 4FQIH 3RL2A 3B9KC 1ZVYA 3NSFA 3QYCA 3N1QC 4J6RH 3FOLA 2CXGA 4WV1C 2G5BA 4IBSA 4GRLD 5EZIH 4HOMA 2FEEL 1EWHA 2NUTB 3QHTC 4GT0A 4IRJB 4JKPH 4C59B 3HVDA 3P2BA 4PP1C 4DPCX 1LO2L 4TQPA 5F0LB 2CBMA 2ZUVA 2XZCH 5T5FA 3DSFH 2H3NB 4OZGF 5TDOA 3W3BA 2LTQC 1NCWL 2BERA 2A73B 4E42A 5EDXA 5IMLB 2NT0A 3SCMD 5IQ9A 1UACH 2YD4A 3C2SA 3CDGA 3G5YA 1DSFL 1ML0A 2X88A 3NQIA 5H2BB 2F15A 4A63A 2AJYL 2FHBA 1PG7X 1HX0A 4PREA 5E2JA 2SEBB 3D39A 4YSEA 4AEIL 3OQ3B 2VN3A 3O6FD 1FZKA 3ZTEA 4S1QH 4J4PA 3TYGH 1A9BA 4NKMA 4G6AD 1BMGA 4JGUA 1JZ8A 4HEPG 3VACA 5IOPB 3PU7A 3WFDH 4Z7OF 1IC7L 5AVZB 5IVZB 4AGLA 2Q7YB 5C7ZA 2FNBA 5IVOA 5ALCL 3X14B 1I8KB 1K3IA 1KB9K 1F11A 3WTWA 3C8HA 4OU3A 2ZSVA 2KL6A 1MHHB 1RK1B 3F62A 3UBXB 3WKPA 2J6EA 1K5NA 2CK2A 4LLDA 1KELH 1S5IH 1BZ9A 2OTPA 4A6YL 4PWKA 3WMSA 1CD0A 5DXWA 1AG6A 1FN4A 2PN5A 3EH4B 2OK0L 3KW7A 5INCA 5IFJA 1NFKA 2WNXA 2NDFA 3CFNA 4K23H 4LGPB 4EN2A 2VH5L 2O1AA 3C08L 4N9GB 1S7TA 3C60B 3NG5A 4NQVB 5FW8A 2ATAA 2BMKA 3B9AA 3X3FH 1U8NB 4HMCA 3V2AR 3CWGA 4C57C 1ZHBA 5D1XC 2IDQA 3B5HA 1CFSA 1D5ZB 5CCJA 1NBYA 3I6SA 2ADFL 3V0EA 4U0RB 3BAXA 1TO5A 5I1CH 4PJAB 1A7OL 5I9QC 5JZ7D 1JYVA 1H0DA 2EVJA 4BCYA 4AVHA 2HPTA 3UTZB 3UJIL 4ZS7L 3QPKA 3LKRB 2HVJB 3JV6A 1P6FA 3T2LA 2I5YH 2BRRH 4Q9BA 2C9RA 2GT9B 1F18A 2WGNB 5B4MD 3U6RA 2BC4B 2WKOA 3FCSA 4K3DL 1EK3A 4AL8C 4KPHH 1OB1A 3QZWG 1O6TA 1E8YA 2GJZB 3KD4A 5DD6B 4MB3A 2OMWB 3C9NA 5J06A 1A3QA 5EOQH 5I5JA 2BO0A 5KS9F 3IDMB 5D8JL 3U7WH 2BX5A 4WFFE 1UXSB 5DVNA 2YR3A 3TCXA 2HMIC 2V8LA 2FGWH 4LEBA 4G9DB 4CJ1A 1YY8A 4DKAA 1D5IH 5C3IA 3TESA 1Y0LB 4LOVA 4OKVB 3S35L 3T2PA 4EZLA 2KKQA 3E6HB 4GUPB 4Y4HD 4HT1L 3FAWA 5HYIA 2K6ZA 4PB0L 3EYVB 1SM3L 5J11B 2W80C 3FOMA 4WQOA 4P4KB 4NENA 2I24N 1Z9NA 2WXQA 4DGYH 2ZONA 4JQIH 4ANVA 2FJHA 4JVWA 2ZKHH 3FN0L 5F7HA 1X5ZA 2GI7A 3BVDB 1LTXA 3HE6D 1NAMB 3K4AA 3BFWA 2FBJL 1NCTA 3PABA 1W0WA 3EO0B 4QHNB 4CN6A 3CVDA 3BGFC 1KTRL 3H7BB 3LIZH 3MLTB 3HLAB 3O2DL 1WBZA 1CLYL 3CVIH 4ECNA 1KCWA 1M71A 1EXHA 3DETD 1IJNA 3QZLA 4TF4A 1AP2A 1CTOA 2C7FA 2FEEI 1OXYA 2XWDA 3G3LA 5DS8B 4C47A 4HWUA 3D06A 3WIFB 4KI5E 1E65A 2DQGL 4RH4A 2IADA 2J5LB 3N42B 2XTJC 4PP2B 3UTTA 3P73B 1AGCA 1X7SA 4QCIB 1IZKA 1LEGB 1NCCH 2FEDC 4DH2A 1MCKA 3L3KA 4EQ2A 3QPXH 1U3HD 4GIPD 4HU8A 1MJUH 4N2IA 1U4EA 1DUYB 3GKZA 5I18L 3TA3D 1E4KC 6PCYA 1URLA 2X3AA 2OZ4A 4ZAKB 1CQKA 1UZGA 1YPZA 2VW7A 4UM9D 2AK4D 4AUJA 4TNGA 2DIEA 4PD4K 4PMEA 1S9KC 1UTDA 1MCDA 1PZSA 4X6DE 4UDUA 1DANT 3N9GL 4UQ2B 1LK2A 4RMUA 4MXQD 1CD1B 4YHOL 5E0FA 5D6CB 3HI1A 4LSUH 1EFXD 1FSKC 3HPLA 3QUMA 4PLKD 4PS4H 3VDCA 3X1FA 2G3NA 4PJCE 4KHTH 1QSEB 3L54A 3F8UB 4DCQA 1NCHA 5DZJA 2JKIS 4B9YA 3CFJA 4S1RL 2Z93A 4QRRB 3CN4A 1MH5A 4WV1A 5AZEL 5JLZA 1C5CL 1QZ1A 1NDGA 1BFVL 1SN5A 2E6PA 4MQ7B 3V7AG 4ZX6A 4HCFA 4F37F 7CGTA 4P5KA 3QJVB 1O5PA 1X7QB 4LVHC 5FHBH 5E9DD 3V5KA 1GGIL 1HVXA 1F3DJ 1UM5H 2E9WA 3MV7A 3OB0K 1JV5A 2DTSA 4I77H 1OCWH 4TOYL 4AYFA 1NM9A 5BV7B 3FTZA 4PV9B 4FXKC 4PWJA 2F54D 4JFVA 5L4JA 5C0AB 2AZUA 3JTBA 3OG4B 3AUWB 3UTSB 1KN4H 4P46C 2B0SH 3MRRB 1OGAA 3D08A 4KXDA 4OUOA 4UILL 1E43A 3ROLA 2Y07L 4HJGA 3UH8A 4ELMB 1A3LL 1K8IB 2FUQA 1WDAA 3GS0A 3WNIA 5I8KH 4KJYB 4YPGB 2QQLH 3SDAD 2OJEB 3VFUA 4UWQB 1UEYA 1UJ3C 2X87A 3P4MA 3FCTA 4B6ZA 2DJMA 5D2NC 4ZMTA 3L3DB 2R56L 4XMVA 2FRGP 4ANKA 2J2ZB 2NYYC 1MHCA 2F9BT 4XVSL 3TH2T 5J9PA 3FH5A 3MACH 5T1KD 3EH3B 1AO7A 2V7NA 1RZIA 3TEWA 4FLHA 4LPWA 4XCCL 1DL7H 3QXAA 2QDWA 4NUGL 3KR3H 3EYUH 3RGVD 1AZNA 1GJUA 4GMSH 3GXUB 4QWWC 5DZVA 4A2MA 3MOBH 3BJ91 1ADQH 5GZND 3R18A 3MLUL 5TK2A 1KV7A 3JT0A 4BWWA 4GG8B 3W56A 5C0RH 4X9IA 4PJEE 4XB8A 5ANHA 4X5PA 3RY6C 5A6MA 3X1BA 4HJ0C 5FUZL 1BFOB 1JPFB 3KBFA 3FB6A 3LNFA 5D1XA 2CDGB 4A2LA 1CICC 1C16B 2AJ3A 2VITA 1OAYH 3IN0A 4FNQA 4M3KB 5DI8A 5FC9A 1OQOA 5JIMA 1WBXA 3QVAA 1OPGL 4G71B 2BY0A 3QT2A 4LOUD 1UVQA 1QI3A 4X7FC 2FR4B 4UI2A 2PLTA 4MQXD 4PCSA 5F6IB 4ONOA 2E4TA 3T3ME 1HJCA 1R3JB 1HZHL 4S1SL 5C3LD 5J13B 1IBFA 4MMYA 5HHOA 2I9LA 2WXGA 3GKWL 4KRPD 1RH8A 3L2NA 2DMKA 2NW3B 2KH2B 5IWLA 4GXUN 5LCVL 4DNLA 2ZQKA 1C08B 1LE9B 4N3UA 2IDFA 4F15C 4ZQKA 1JGIA 4BZ1A 3UTOA 2AK4E 1OTTD 1NGXB 3HNSH 1WHOA 3ZRCC 1H3PH 3VTTA 4U0RC 2X4TA 4CA4A 2XYBA 1FNSL 4YDLB 2IAND 4X7EC 1KUMA 1M4KA 1OL0A 4F9LC 2P24B 4PJXB 3OKEA 2JJTC 1TYEB 2QFPA 2E3VA 3I6LD 4YBQC 4TXVB 1HH9A 4CSPA 9PCYA 5EU6D 2NY7H 1IAOB 3NH7H 3US1A 3QCUH 2CMRH 5D7IF 2ADYA 2OXHB 4CU7A 3CXDH 3AT9A 1XF5A 4NQXA 1HOCB 4O9HL 2OMYA 4HUVA 4AT6A 1JGEB 2BWIA 2FE0A 3VXSB 4Y0GA 5F70A 2ICEB 4NIKB 5CF3A 1DR9A 1UT2A 2ADIB 1N67A 3HE7B 5C0DB 1F8TL 2ZP0T 4RRPG 2F54E 3HAEA 2YBRB 3LPWA 3WHE1 2OMXA 4ONGH 2R7EA 3CHQA 1O7DC 1I3VA 4P4KC 1WUZA 3K8KA 2HLFD 5FCUL 4OCLC 2DWEB 3ARPA 1KIQB 3FQRA 4HAKA 4L8CB 3OLEA 5FCSH 5EF1A 2EDTA 3HZMA 5EH1A 4MBOA 4P04A 1YYLH 4NP4L 1LD9B 3EDEA 3RWJB 3UAEA 3TBVB 2RFXA 4BH8B 1E4KA 3NA9L 1E3XA 2H41A 5D4QA 2B2XH 5EEXA 5E8PA 5KVDE 1FG9C 2ZWKA 4O02L 3THML 1ASPA 2C9QA 3GBML 1F2XK 2DKUA 1GPOL 3AREB 3BH9B 1OAXH 3NEXA 4FQJL 4JRXB 1YNLH 2XY1A 2EIZA 3GI9L 4J3XA 3BIKA 4PCKA 5KYXA 4DGIH 1DLFH 1VFMA 2YAOA 2GI0A 5DVKA 3FU3A 5DJCA 5KEZA 1A4KB 2XUWA 5LDSA 4AQAA 1RI8A 1FJ1A 1NPNA 4Y4FD 4ORGB 3ETTA 4LFHG 2X7LB 2J5LC 2JB6B 2XWTB 3RWHB 5GHWL 1KBWA 3TO4B 5ELIA 1CF1A 2PPDA 3OKMA 3ZO0A 1TTBA 3D69A 3GMNA 2E59A 2OMUB 5C9JA 4JQVC 3CDZA 3CSYA 1K8DB 2H9GB 1OQXA 2Y0SA 4JVUA 3SO3B 4K9EL 4RVBA 4MX7A 4OF7A 3DUUA 5EG6C 2UVEA 4IDJL 2EXYD 4ZAKC 5I16A 5MEOB 1HDMA 4HPOH 3RI5F 4AM0Q 5CCHE 1A4JA 3ZMRA 5F0JB 2GAZA 1Q9OA 2DQUL 3QRBA 1S9WB 4DPBX 2R27A 1MF2H 1OF2B 3SPGA 3QFJB 5CGYC 4XVOA 3MJ9H 3VFVB 4ZZKA 1A02N 4ZOAA 2NRDA 2C7UB 1UD4A 2A9ML 4LEEA 5IK3A 1UHVA 3QIWD 4LASH 5DHDA 1JDCA 4P46A 3WJMA 2NXZD 1OE2A 1NMBH 4ZD3H 1AXSA 1IGJA 1E42A 1HXYB 3EJYD 4P3CL 4KTGA 2XU9A 1F97A 3E9UA 1JPTL 1PZ5B 4I1RA 1UJ3A 4H0GA 2Q20A 5I26A 5D7SL 1DQTA 1FE8L 1S7VB 1MJ7L 4HUXB 4MB5A 4N24A 1XH1A 2MFNA 2WSDA 5D2NA 4QTHB 2CM5A 4HFWB 1E50A 4R7NA 2EDWA 4ZBJA 4XMTA 2VLKB 2NUTA 3GGWB 5DMJB 1CDCA 1JCVA 1TQWA 1X5XA 5HDBF 4KRMB 3MX0B 5I0YA 2BSCA 4PHZA 3JBG7 1EO8H 4XCEB 2H3NA 2XC8A 4JDZB 3I6LE 3SDCD 1IVLA 1JE6A 1GIGL 3U0PB 4TSAL 4PCTA 2A73A 3L3OB 1L9TA 5IMLA 1IE4A 4OZFB 3SKUD 4MZ2A 3BZ5A 2QV2A 4HJJL 4BFRA 5DTFB 5EDSA 2QMKA 1MNUH 1ZXQA 2G60H 3HBPA 4N5EC 5H2BA 3S6CA 1QSFB 4XPGH 3RY6A 4OLVL 3S8FB 3UZEC 4ENEC 1L9SA 1E8ZA 2YXVA 4M7KL 1N0XL 5IOPA 4UINL 5IEHB 2RCSH 5IVZA 1D5BA 2Q7YA 2H45A 3A47A 3O6MH 4GIOA 4LCYA 4X8CA 2BNRD 4KNQA 1O7VA 4WI7A 4HYTB 1JIBA 3TONA 1D2OA 3X14A 2Z35A 1I8KA 2QBWA 4YBHA 7FABL 2DD8L 3QJRB 4K3EL 3K6OA 5ESQB 2C3GA 4QRPD 5C0FA 1I1YB 1S9YB 5AAMA 3SE6A 4RCAA 3K2IA 1N5AA 3MKGA 3KVQA 4U4BA 3KGRA 3NACL 3OXSA 1KEML 3CD4A 5K9QI 3WTXA 5GGQL 1UWFA 1ZOXA 2D8KA 3GRGA 4HFUH 5CIPH 2NNAB 3IMTA 1BJMA 4MRBA 5IW3A 5KSAC 3V6FB 3FBQA 1U8NA 1JZHA 3NFPA 1M1XA 1D5ZA 3GNML 1D5RA 1ETJA 4PJAA 2H0JA 1SOSA 5JXED 4Z7UA 6FABH 3Q2WA 4CILA 1P1VA 2R9HC 4F9LA 1MEXH 1JD9A 2EDMA 3LKRA 3SDXF 2HVJA 2JJTA 1RURL 3HW7A 4BKLB 3OVUB 2GT9A 5FOJA 1KTDB 2AXGB 4NQUA 2WXFA 2IG2L 2NQCA 3QQNA 4XN5A 4FQLH 3R4DA 3LEYL 4X9HA 1HN1A 5JHAA 3IDMA 5DD1L 1KG0B 1UXSA 1SHSA 2J1YA 1V05A 1F4XL 1DCEA 1G9ML 4G9DA 5KBPA 3NQKA 4QXGL 3V4LA 2AI0L 3GC3A 2RH0A 3OZ9L 5AKTA 3GDBA 4M1DH 1Y0LA 4JO2L 4OKVA 4ZUUB 5BVJB 1JZ5A 4YIQA 4PJ5E 3E6HA 4GUPA 4DGVL 1GGTA 3B2XA 2XN9B 1JS4A 4P06A 1HYRC 4QF1B 1UUSA 3I50L 2HFFB 4UV4H 1DBML 4ADGA 1A47A 1PZBA 4MMXC 5CAYB 4CVXB 1AGBB 4P4KA 1TXKA 1WAPA 4JZOA 3T3PE 3GEFA 4FEIA 2AJUL 4XMKH 4M1GH 4F57H 3L5XH 4FG6C 4H88H 3P40A 1YNTB 1KJMA 2GBUA 1NAMA 4MJ5B 5JTWA 4B3VA 4QHNA 3EO0A 5BCAA 2ZKMX 3RNKB 3MA9H 1TMCB 2EE0A 5IHBA 2HJFB 5IVNA 3MLTA 3HLAA 4J23A 4N8UA 2W94A 3CFTA 3WFBH 3O45A 4FFYA 5FYLE 2VDMH 3HE7C 3WEOA 1EBPA 4X83A 4WW1B 5JW3L 2OSXA 4JGNA 5IR1B 5ALBL 4FLRA 4APXA 2ZPKL 3OSVA 1U95B 2VSKB 2LGNA 3BN9C 2VDOL 4MYWB 1O9WA 2YPKA 4M02A 5CR8A 3IMBA 4PP2A 2GFBB 1BBDH 2WHVA 2XZAH 4UUJA 1RHFA 4N4YB 4U1IA 2XA8H 4QCIA 3KWTA 4NDMB 2CJSA 3MRPB 4AXWA 2CJUL 4QTIL 4JQVA 5E24E 4JHWL 1S7SB 2NY1D 4FYSA 5F44A 2QT6A 2C3HA 2VRAA 1OV8A 4ZAKA 1U21A 1A21A 2BNRE 5J57B 1T04B 1NKRA 1DVTA 2W07B 3TZVC 2H47C 4J3SA 3AREC 2OLDA 4X2UA 4YO0A 5FYJE 3HZVB 1KJVB 1O75A 1YEKL 2Q1EA 3JT2A 4QRPE 4U6HB 3VW3H 4I87A 1U92A 1CD1A 1IC4L 4U1LB 5D6CA 5ITFB 1T03L 3FU9A 4PJ9D 3VQ1C 2X6VA 5A16B 3QJOA 4MA3B 1J1XH 3TN0D 1U8PB 2P5PA 3SQBB 3P11H 4XMPL 1CI5A 4PVLA 5T1JA 4FQ2L 4KK5D 3SO3C 2EH8L 1MQKL 3KPTA 4ZS6C 2YO3A 1UOKA 3WE6B 1X7QA 5CILL 3QZBA 2FLBT 3ZKND 4Y2DD 3VGGA 3NK4A 2B20A 3HB3C 1ZLUK 1TQCB 3HS0C 3V0GA 5C6TL 3UEZA 3K2UL 1QHQA 2AXFB 3K4DA 3NJMA 1YEFL 4ZW7A 4CN1A 2FQFA 1A0QH 3UTSA 5AYUH 4N0YH 3MRRA 3CQFA 4NHCL 5JQ6H 2N01B 1T2XA 2VZTA 4EN3D 2WKGA 4G8EA 1K8IA 4O51A 2VABB 3IJHB 4X5WA 3KL0A 4BYHA 1Z1WA 4KJYA 4BXVA 4YPGA 1IGTB 2OJEA 4N0RA 3SQRA 3UZEA 3EDJA 4UZSA 1M9SA 3KCPB 3H2WA 3HZYA 5T33H 1U58B 4M6OL 4PJBF 5D93B 2V3EA 4QOKD 4XP4L 2YD6A 5T1DH 5GGTA 3MA7B 2XWJA 2QADB 3KPRD 3TFKC 3TNNB 3HAEG 5B39B 1IJ9A 3L3OC 1JI1A 1NCUA 5ILTH 2NY2D 3MUY1 3WAJA 3ECQA 2OQJA 2P49B 1BEYL 1KGXA 3QUZC 3PNWA 3TVMB 1NPJA 1NEUA 5KAQF 1FH2A 4EE2A 3NZHH 3L9EA 1BFOA 5DEJA 3QFDB 3KPMB 2R2CA 2VO5A 3HMXA 3U36B 1C16A 3B43A 4WTQA 1VEPA 1DDHB 2Q87A 5A2BA 1IM3B 3NFNB 2E7DA 2UV3A 3L7EB 3TEUA 3GLZA 2OSLB 3BQUD 3N0AA 4HZLA 3V95A 2FR4A 4R0LB 4H5SB 4OGYH 2A74C 3NEOA 4LSTL 3MRIB 1R3JA 1ACCA 5HD8D 2IAMD 1A4BA 4H20H 4F91B 3F5WB 2VTFA 5BMFL 4EI6B 3PAYA 3EBHA 2EP6A 4MAUH 5EOCJ 2HFTA 4AZUA 2CRMA 2CUHA 3OMNB 2ETWA 1ZTMA 2OAAA 1XMEB 2XFGB 4JKPL 3BC9A 1JGUH 3MLSL 4QNPE 1IBGH 3IPFA 4XZUB 1IILE 1NCAH 3DSFL 4LHUB 4NZUL 3BSZL 2R29A 3DROA 1UATA 4Q4IA 3RGHA 2BY2A 1IO4C 2NY4C 4DTGH 1J8SA 2ZCLH 4EI0A 3N42F 2L3BA 3PHQB 3DJTA 3PREA 1WIPA 3AU0A 3AT0A 1OVZA 3PWUA 1UACL 2CBPA 2GK0B 2P24A 4N2MA 2K8MA 3FPYA 1EHXA 3WS3B 2VERN 1Q9KA 2YMXH 1IAOA 2B77A 2VN6A 1Q94B 5D7LD 3ARGB 1O9VA 5GS1C 2YMTA 3TYGL 3LH2H 3IDUA 4I9WE 5K39B 3JV5A 2VR4A 3VYNA 5DJ0B 3FS9A 2ZUXA 4KZ0A 1HOCA 2X44D 1C7SA 3VXSA 3RU8H 2AXHA 1P5VA 4XHQA 2ADIA 3LS5H 5D1QB 1AHWC 3O81A 3GZPA 3HE7A 4QI3A 1MFBH 3LS4H 4QHKJ 3MLRL 5C0DA 4YDVB 1KELL 4PGEB 1S5IL 5DQJB 3B6SB 3GYRA 4G7YH 2YBRA 4MQTB 3RKDD 2WXNA 3QQDB 4FMFA 4U6YB 1T6BX 1HSBB 3ZHNA 3VXNA 5DJXB 4L1HA 4JMNA 3PJLA 3LNGA 4KUZL 1UA6H 3UC0H 5FYLH 1HHHB 4JCWA 3RWJA 4WCYH 3HEIB 4BH8A 1EEYA 2WVTA 1FQ9C 2WIIB 3NTCL 3DVGA 4B7IA 3JVGC 2G5UA 4B5EA 1IARB 4R5VA 2VJXA 3L81A 3TZVA 2V7HB 3AREA 3BH9A 4M8RA 5ICUA 2O5XH 4JRXA 2OMZB 3ZT5A 4KPHL 5GGSY 1P7BA 3KPRE 5CZVH 4NKOA 1MIEH 3CBRA 3MZGB 2G9HB 2GG1A 4WHTB 4ELMF 1M7XA 2OPCA 5EOQL 1RZQA 4X6DB 2KDGA 4TQIA 4ORGA 2CNZA 5CU9A 2X7LA 1RK0B 5DWUL 2GY7B 2XWTA 4UT9H 1S7WB 1WAAF 4JJ5A 5D1ZI 1OP9A 2OSWA 4YDIL 1BZ8A 3QWRD 3KLSA 2J25A 3DV4B 4PJCB 2CO2A 4OM1L 2H9GA 3IFNH 3HVNA 3MCYA 1B0IA 4HQQH 2XIDA 1AY1H 1TF4A 2UXGA 4L3AA 5EORL 3V0AC 1AR1B 4WUKL 1T0MB 3BAYA 4G80A 2WSKA 2YFOA 4JHAH 4NXKA 4MA8L 2Q76B 3A23A 4RX4D 1YQ2A 1S9WA 1W15A 3HS0A 4EDWH 3KXFA 3QFJA 4XI5C 1YAIA 4NZFA 2C7UA 1U41A 2OFQA 4QAWA 1HIML 4LO9A 5E6UB 2GYSA 3U1QA 2RR3A 5DD5H 1IGCH 5EN3A 4NBZB 2X2HA 3HUJA 1HXYA 5CZRA 4MGXA 3LPFA 3L3HB 4D9QD 5F1KC 2HVKB 4XCFL 5TF1H 1MY5A 1SYSB 3RWDB 3IJEB 1X5HA 1OAQH 4HUXA 4N28A 3II3A 1ZANL 3SSGA 5I74C 1LMIA 1OO2A 1AZBA 5FV1L 3RQ3A 2F1BA 2IVFC 1DN0A 2VLKA 4P4RB 4FADA 2YGNA 3GGWA 3PUUA 3HS8A 2OR9L 2XBTA 4Y4HB 1NGYB 2W59A 3MNZA 3KCWA 4EZMA 1MCSA 1HL8A 1TQCC 5H4YA 4U1HB 5GISL 5KJRH 1LHZA 1Q0XH 3NAAH 4IHOB 5C0CD 5EC1A 3L3OA 1WZ1H 3DSNA 1MJUL 3QPQD 1KDIA 4OZFA 4NZ8A 3FUDA 4FQCH 5DTFA 1QFWM 4LEOB 4YE4L 3QUZA 3TV3H 3PQYD 1QSFA 4RMTA 5C0EA 3ZTJG 3CMGA 2XA3A 3UJTH 3GPSA 2X41A 1HH6B 3C5JA 3I02A 4PJEB 1M05B 5IJDC 2H6OA 1U93B 3T4AB 3GMPB 1BQLL 4FCAA 4PJXF 5AZUA 2JLPA 4UTBH 4JFFD 1S7RB 2MQGA 4WHYG 5L0QC 5D93C 5FAAA 5I30L 1IAIH 4YHKL 2FATL 5IGXH 5HJDA 2XVGA 2A74A 3MPCA 4KHTL 2BFVL 1RKRA 3RVUD 2QADC 5DT1L 2WLLA 2YPVH 5CIPB 5ESQA 1EJ6A 3ZT6A 3EJPA 3PE9A 1S9YA 3U4BL 1WFJA 3ZLQC 2ZKXA 1Z66A 2W9DH 1ET5A 1B9ZA 3E0GA 5JR1L 4N2HA 2P80D 4OV6F 2VC2L 3QDJE 4JL2A 4QTFA 3FFOA 1G43A 3T8VA 3TVMC 1QUNB 2NNAA 1DQQA 1HFUA 1B4RA 2D7QA 2BW5A 1TFHA 3V6FA 5F8RC 2HA1A 4OF5A 4I77L 4ZO8A 1OCWL 3NGBB 1JFQL 4MCMA 3SBRA 2EDLA 3EFOA 4NKQB 4HP5A 4R7VA 1YEIH 2QQKL 3L4UA 2DMBA 4HWBA 4KV5F 4PTUB 4PWFA 5SX5K 5T3XE 4KU1A 2AK4B 1RULH 1IKFH 1KN4L 5JQIB 4ES9A 5J7CC 2YK1H 1ZK9A 3K0YA 1ET7A 3AS2A 4R0LC 2WXIA 4BKLA 2ZOUA 4OLWL 1U8OB 1WTGT 4TM9A 2AABL 1KTDA 5DZOA 1U8MB 1T0NA 3UAJC 5F7UA 5EIIB 4Z3IA 4AM0B 3KBPA 5I76B 5E23A 2G5RA 5GQBA 2VN5A 5CJQH 1YVLA 4L8BB 1TJGL 3PDGA 1KG0A 4OGAD 4NC0B 1BECA 3WIHH 4M7ZB 4C4KT 3MODL 1T89C 1AQ8A 3MACL 1JV2A 3II1A 1SHMA 2CA4A 1VSCA 4JLRA 4ZUUA 3V8OA 4IBYA 1AHWA 1DL7L 1PCXA 3VFTA 3U9UB 2Q2EB 3EYUL 3C5ZD 2UYLA 3IF1B 1NUDA 1W72H 4G7RB 1ADQL 3PPEA 4QF1A 2HFFA 3IDIA 1KCKA 5AL8A 3CVHB 1QYGL 2D7TH 4CVXA 1AGBA 3AGVA 3O3BB 3MRHB 3A6CH 4L2YA 2EQDA 2AQRA 3I6KB 4HIXL 1KFGA 3KJ4C 1UB5B 1IFRA 4D9QE 2YQ2A 3TCLA 2C4FT 1TZHB 2C9PA 1JXJA 4I0PD 1OGSA 3G5VB 5AVQB 1Y1UA 5DMYA 3VFMB 4G83A 4MJ5A 3SDAB 2VDMB 2C4FU 1WLHA 3RNKA 5K59F 3Q44A 2G2RB 3JVGA 1W91A 2HJFA 4OAWA 1GA2A 3GSXB 3IJYA 2WUBH 5D1QC 4DUVA 2R1XB 3JWNE 4NC1E 1THCA 2VJ8A 4Q74A 3NFSH 5HGDA 3QDMD 5IR1A 2AZAA 2D31B 2APWA 3SGDI 5C0CE 5K1NA 2N7SA 1GKEA 2ZNXA 3U2JA 2YOCA 4W6XB 4UTAA 3HG0A 3S5YA 3KPSE 4G5ZH 1YMME 2BVOB 4KI5C 4ZO9A 4DSYA 2CGZA 5EEUA 3VXRA 3F01A 4YXKH 4NDMA 3AXLB 3BRDA 1BXAA 1GH7A 3KLHC 5DJYB 3PCYA 5EA0H 1U8CB 1AQKL 3FHQA 3DHJA 1FL3B 2VDKL 4JG1L 2P7TB 1S7SA 4ZO6A 3DO3A 1KNOB 1OAUL 4JFFE 1L9NA 4Y88A 5FO7B 3TT1H 1NJ9A 1N5YL 2XQBH 1T04A 2ZTBA 1TTRA 4UOW0 3IJ7A 4R2GD 3MLWL 2NY7L 4JFOB 1J1PH 3P9MB 2CMRL 1JF1A 5HYFA 4YSQA 3MAWA 1PX4A 4ZW3A 2VZSA 3O6LL 5JMOC 1D5MA 1ED3B 4M29A 4U1LA 5ITFA 4FQHA 5AKVA 3ZE0F 5JW4N 2BP8B 1UH3A 2HH0H 2XWBA 3RY4A 1N7ML 4JPQA 4MA3A 1SHXA 2CCLA 3SQBA 1KZYA 1DUZB 5LNGA 2EIKB 43C9B 3VXUA 1IGIH 3DJSA 2NNXA 3D1MC 5CSGA 1J87A 3FSOA 4ONGL 1AZZC 2B9AA 1T5WB 2IALB 5EZPA 1RAMA 3EXJA 3QORD 2F53A 3QEGL 4LAQH 4CKVX 2BDNH 3D8MA 1PAZA 2WBXA 3AS3A 5EO1B 4JANA 4ZI8A 2HTKC 1UASA 2VAAB 2O5NA 1VPOH 1TTGA 1MIML 3MLZL 2DQEH 3NCJL 4QHUB 1QI5A 5SWQB 5C09E 3OMAB 5I1LA 1U8JB 3IJHA 1DLHB 1WWAX 3PGDB 4OCXL 3APMA 3CZGA 4DHLA 1NBQA 1KN2H 1QR4A 2MNWA 1YNLL 1Q8MA 1S6NA 3KCPA 4Q52A 1C8QA 3ZDZF 1CG9B 1NFDA 1DLFL 4MAYB 2BS8A 5BO0D 2NX5D 2VDRL 3GXPA 1SVCP 5JIHA 2FQEA 3RA7H 4KH9A 5LNDA 3CZUB 3T0EE 4F7CB 5B1AB 4KRLB 2YC1B 3VGHA 1PZUB 3ULUE 3P4NB 3TNNA 3ECUA 2AVFA 4I5BB 3VWJC 3SD5A 2BNUB 1J48A 2VL4A 4P2OB 2VXUH 1LLAA 1DBKL 1R1CA 2MNUA 3TVMA 15C8H 3B5GA 4KROD 4MB1A 3MLYH 3QFDA 3EKCA 3KPMA 2A9BA 3R0MA 5I23A 1MCHA 4FTDA 5L2KE 3KH4A 3U36A 4PTTA 3WLBB 5IIEB 1MF2L 1CF8L 4QLWA 3T4AC 3TGXA 3OAZK 1DDHA 5D7EA 1ZLEA 5J8OA 1SOXA 5DHVA 3ARFC 2X5PA 1MWOA 3P2TA 5CLXA 3KJ6H 3QJHB 5DK2A 4R9HA 2BSBA 2CKBB 2X4NB 5HYQA 1I85C 2ZX8A 1JERA 1UURA 4F2EA 4R0LA 1QEXA 3IFPB 4H5SA 1CFNA 3P9LA 3D2TA 3AU1A 1B4LA 3MRIA 4KKBD 4XP5H 2A5UA 3UAJA 1YNTF 2O4EA 4GJTB 4EI6A 3BAEH 2VR5A 4DUXA 5KUKA 1ACYL 4HUWB 2F6AA 4NO0B 1U30A 1YJDC 3L4VA 5BXFA 3Q5OA 1T80A 2HRPH 4GUQA 1S7QB 1JK8A 3T9WA 3NGBC 3HOGA 4QHKI 3NJFA 2EVIA 4NKDB 2YXWA 5A7BA 4R97B 1OANA 2ICWI 5HHNA 2BZ7A 4GI8A 4LU5H 3PHQA 2LQRA 4PJ5B 1AS6A 1ZPLA 3CN1A 3O8XD 3UYOD 4U7MA 4DK5A 5E08L 2QQNL 3ETBF 1MNUL 3N55A 4E9YA 3RZCC 2IV9A 5HGGS 5DC0A 4Y19A 4HLEA 3WS3A 3OJ2C 3GXFA 3KPPB 2VKWA 3T3PB 4M3HA 3TXAA 4OLZH 4OSUL 2YAEA 5J1SC 2NUPB 2WNKA 2OZNA 3O4LD 4GBXB 4MCZB 5DJ0A 3ZDXF 1CBVL 2ARWA 4FL4B 3H8NA 2HXAA 2QQQA 4FCHA 3G04B 4OM0L 4PBXA 3S36H 5BUPA 3ECBB 3OF6D 3IE4A 4GINA 2AJSL 1ILUA 2V2XB 1A7NL 3MBEC 3DVFA 2LVCA 2I7SA 1HTYA 5D1QA 2Z4QA 4EVNB 3O2VL 2AERT 4PGEA 4UQ3B 2VXSL 1MRFH 3SZKC 4RBPH 1WFUA 1DVFB 2JELH 3FULA 4MS8D 4U0QB 1M53A 3KPNB 3QQDA 1OARH 4PN6A 5SWZE 2IMNA 2WXHA 3V0HA 5CN3A 4GMTL 3MGOB 3ABZA 3DPBA 4B27A 5I6MA 1G7MB 4TNEA 5E51A 5A7EA 4XNBA 5EIQA 1BGXH 5J6HA 2RB8A 2Y06H 4OZFG 1NIAA 4S1DD 4J7RA 3LNDA 4BFKA 1EDHA 4J8QA 4PWHA 1ZVSB 1XQ4A 5J4MA 1OM3H 4GG6E 1R19A 2NX5E 3GDCA 2C9UA 4JHBA 3TU6A 5JIPA 3WXWL 1MEXL 1LO4H 2AJXH 3UZVB 1PMYA 3IJSB 4WWOA 1IU1A 8CGTA 4B3EA 1TMQA 4YAQA 4TTGA 2BNRB 4IDLA 3BVXA 1GTFA 1KT2B 1KLFA 3PWJB 4ZMZA 3EOBA 4PLJD 4PRNA 4Y4KB 1J11A 2VQ4A 2GSGA 3H9SD 4X6DA 4IRSD 3ERXA 3QQ4A 4IJ3C 4FFVC 4QRPB 1S7WA 3AACA 3D5OF 2CK0H 3ILDA 1AQDB 1IGFL 2R23B 3KWVA 4O58H 3OR6B 5I6PA 5LN4A 3L13A 4X6CE 3KG5A 3P30L 2DQTH 3ZTNH 4P9HC 4B95C 3KH3A 3DV4A 5D5ME 4PJCA 4GAAA 4HBQA 5LBSH 4F8LA 2WMPB 5CD3B 2WWOA 2FZ3B 2X70B 2ID5A 3FYIB 1AI1H 2Z8RA 3MJ9A 4DK6A 5EEYA 4L9LC 1T0MA 4UV4L 4J39A 2A9NL 5TD4A 5DYFA 4K8RL 1HHIA 2KQMA 3LKNA 1J86A 2IPTL 2UZPA 2Q76A 2X4UB 5AAPA 1JWUA 3AB0B 3FK3A 2OL3H 4M1GL 3HG2A 1AE6L 4F57L 3Q5YA 1PEWA 4S0TD 5L8JB 3NJGA 4AJVA 3SJVA 4ZOBA 4D0CB 4GQ9L 2WXPA 4CADB 2BJMH 1QW8A 2HLAA 4JY5H 1ORQA 3IFOB 1QI4A 2X6MA 4MZRA 3ZKQD 2EDBA 3TIDB 3HC3H 3IU4H 3L3HA 3NCCB 2ALAA 3JWDL 4RZKA 1GS7A 4CJ0A 1SYSA 4LPVA 3WFBL 3IJEA 2OS7A 3RUGF 3MO1B 1V3KA 5HHQA 2HWZH 5DFVC 2F1EA 2X2YA 2G30A 3MNDA 4P4RA 3V0VB 5B1KA 2ERJB 4Z0BH 1HOEA 2JWYA 5IB1B 1CR9H 2I60L 5DURD 4RSVA 1C8PA 1NGYA 2QHRH 1BBDL 5HVHC 4YMPA 5LNEA 1IKOP 1A7RL 1EHLH 2XA8L 4OQTH 4PY7A 4IHOA 4J3BA 5C1MB 1VLXA 4GKNB 1TEGA 3VWJA 2V9TA 4NM4L 4Q4EA 3T5WA 5DVOA 3LNEA 1AD0A 4KKCD 3O4LE 4LEOA 4LKCB 5D7JC 2BPBA 4S2SB 3S3SA 2A6IA 3TJPA 2FYYB 4G43A 2XG4B 4PI0A 2MOGA 2HT4D 3WHXA 4PJEA 4LE8A 4UU9A 1M05A 4ODSH 4NWUL 3T4AA 1FFNB 3GSOA 2NSMA 4WI6A 5I15H 4MAYC 3VW3L 3ZYZA 3ARFA 5JHDA 4UQEA 1LYQA 3NOIA 4R7LA 3A0OA 1I85A 4LOEA 2Y7QB 3L48A 2ZOLB 3T8MA 1J5OH 4ZFZB 3IMVA 4IU2B 1AD9A 4W9HC 2HT3D 4MJ2A 4YZFE 5CIPA 3QZOA 5BZXA 1CXIA 1RIUL 2ZUSA 2EZ0D 3AM8C 3FZUD 5AD0B 3FTSA 3ZYJA 2JKSA 1MRCL 2CO3A 5D71H 3I2CH 5EOCH 1NIFA 3GXMA 4ZPTB 3WLWC 4P5TD 4BE5A 5GZOC 1QUNA 3MRNA 4EAEA 4KVNH 4DVRH 4YHPB 4Q8BA 1ZHNA 5DZLA 1PLGH 3GSUB 3RI5K 4JREB 5ESAA 3L3GB 4PTUA 1Q9LB 5CD5C 5E1AA 3O2DA 5HI3C 4ZQTA 1Z9MA 4F2FA 3U0TB 2JKTM 3GMMB 1DYZA 3H9SE 1MI5D 1DVYA 2H2SD 4AC2A 3RZCA 4ZMPA 2VMCA 1FFRA 1U8MA 3JSSA 4OGXL 2D7MA 4K07A 4WI5A 4W9FC 3SOBH 4MDJB 4PLOB 2DYPD 4PJ9B 2AFNA 5T33L 1MLBB 3CZNA 4L8BA 2EILB 3STBA 4Z8FL 1BAFL 3UGEA 4AQZA 4JGJA 1W72B 1USQA 2P1YA 1AG0A 3DX9A 5ITBH 2G75B 5L6YL 1T6WA 3MXVH 2YHGA 3BKJH 4GAFB 5I1JH 2R1YB 4GY4A 4XNYL 2V5YA 5KG9B 1DEDA 4PGCB 3U9UA 3IF1A 1IAMA 2XQYA 3DXAA 4XRCA 1ET8A 2WD0A 3LMJH 2APTA 4ZOEA 5IF0B 4A7QA 2XTLA 3CVHA 4WFHD 3VFNA 4FLOA 3O3BA 1MWAL 3BSGA 4PJCF 3ULSB 4KK6C 3I6KA 3NZHL 4K7PH 3DNKA 1H3GA 5FW6A 4Y16C 1UB5A 1ITCA 2P5ED 3CCHA 1CDHA 3FQTB 1Q0YL 5I73C 1Q38A 2JH2A 2FUTA 3U83A 3VFMA 4DAGL 4MMZB 5I71B 4B9GA 5F7YC 2IBBA 2OW6A 4QRTB 3NIDE 1YECH 4Y9FA 4GYBA 1ZHLA 1FGNL 5AKRA 1QFWL 3G6AA 4OJEH 4APQB 2F08A 3AY4C 4MNGA 3EHBB 2B1AH 2RMNA 4BUHA 3LVTA 4AYBA 3AABA 3M1BB 2GBVA 1MCIA 2D31A 3IJ9A 2N7BA 4LNRB 2F2HA 4MAUL 1OAJA 3KPRB 3LJ3A 5KOMC 1SDDA 4P9MH 4L0YA 3MJ7A 5CR1A 4JO3H 3WKQA 1FF5A 1AGEB 1WZLA 1S7UA 2JSFA 1N68A 5E2VH 3RFZB 1NCGA 5F1SA 2D03L 1CDYA 4FA6A 1IL1A 1JNLL 3O0RH 2IH1B 2CUMA 1QLEL 3GSWB 4I3SH 4OIIH 5CZXD 4L9LA 1GVIA 5FO7A 2F58L 1CD9B 5JPNB 1U8QB 4YNYB 2GBTA 4X8JA 3KPLB 3LAFA 1UKTA 2PPCA 4BQ8A 3BQUB 1EXUB 3P9MA 3ARQA 4GSRA 3TFBA 4IBUA 4Y4KC 1UOWA 5D1ZB 4OKDA 1HYSD 2YFNA 2IAMB 4LZKA 3GI8L 4QD2E 3X1NA 4UIKH 3R7QA 1I1AC 3U30B 2MNJB 1ERNA 2BP8A 1RP8A 3FUHA 4BUGA 3RU8L 4PGJA 4UAHA 5GGVY 4NQDE 2ESVE 1RSYA 4KY1H 1IQWH 4FFWC 3LS4L 5GGSA 3V52H 3MSPA 2Q8BL 4WFGD 43C9A 2YUVA 3ZTDC 2PYED 1RV6X 3RWGB 5T3ZD 5C0JB 3HKZA 1KBVA 2IALA 3ISYA 1IGMH 4WI9A 4CMMB 1MI5E 5E0QA 3CTTA 4R4BB 5J1AA 2VE6B 3T3MF 5KUMA 4TQ8A 4BSVB 5AB0A 4G42B 4HKXB 1UA6L 5EO1A 1F6AA 1DDTA 4WEUD 1OAZH 3FPXA 4LARH 4ZZFA 1KYOK 3EYQD 1L7IH 4KK8C 2VAAA 1P0SE 1PDKB 3MRGB 3VQ2C 2ED9A 5EFIB 3LB6C 3CV5A 2KBGA 3S36X 1AJ7L 2J55A 4KXCA 1BVNT 3LOWA 5D7JA 5JOPE 1KWGA 4G6FB 1U8JA 5F7KC 1Z7JA 3PGDA 5LCVA 5CNHA 3ZVVA 1RZ8A 5LQBH 1GHFL 3B1TA 4HKZA 2CQVA 2DQJL 3DHPA 4MAYA 3QJUB 4X4YB 5B3JE 5EOTA 1R5WB 3FSWA 4Q89A 2FJFA 3DO7A 3H6JA 1QWUA 2WGXA 2ZWNA 5E56A 2YC1A 1UT1A 3FB8B 1SDYA 4OIFA 3SE9H 1PSKL 1XGTA 3LV3B 1J8RA 4Z95H 5KYYA 3NJHA 1GZHC 3K5SA 2DAVA 2YSTA 2AK1H 3AM8A 1OSYA 1FWXA 1BJ8A 2BNUA 1F4WH 2NY3B 3A6OA 1DN2A 3ROOB 4WU7B 5FPIA 3K2KA 3QS3A 4KZDH