4KO5A

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/w48l/v95i/y108f)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNLVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/W48L/V95I/Y108F)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 34
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ko5A00
3FYEB 2YAMA 2EIMB 1X9UA 1R1CA 1OE3A 3TA4D 1OCOB 4JHVA 3QJUB 2X88A 3UABA 1AZBA 3ABLB 3FT0A 3UADA 2JKWA 7PCYA 2NRDA 2YAPA 2MRYA 2BP0A 4GP8B 4GY4A 2XLLA 2CAKA 1A4CA 3EF4A 3AG3B 2VM4A 5PCYA 3WNJA 1BQKA 1BXAA 1QHQA 1EHKB 1RKRA 4G7QB 3V9EA 3RYMA 3NSFA 3ABGA 3S3DB 2IDFA 2XU9A 3CDZA 1SJMA 5PAZA 3H56A 5F7AA 1MG2C 5A7EA 3DTUB 4BDVA 2PPCA 3PAVA 1BQ5A 2IWFA 2GIMA 3UAAA 3SBQA 1W6WA 3T6ZA 1HAUA 5D4HA 3BVDB 1KDJA 1JOIA 2FNWA 1SFDA 4N8UA 1CC3A 1NWOA 3EH3B 1IKOP 2BHFA 1KBWA 4A68A 4DP1X 3NT0A 2BP8A 1GSKA 1JZFA 1V54B 1RCYA 4A67A 2UXFA 5LDUA 3QJTB 5I6NA 5TK4A 3T6WA 5B1JA 8PAZA 2DWSA 2BZCA 3NSCA 4YSCA 4HCFA 3NJIA 1BXVA 2VMJA 1E30A 4GP4B 2JXMA 1NTDA 2J5WA 2BO0A 1OCCB 3CVCA 3WG7B 4BWUA 2QDWA 1M56B 3G5WA 4UANA 1AR1B 2W88A 4PAZA 1ETJA 1OCRB 4A66A 4G72B 2GC7C 1PAZA 2AZAA 2BP8B 3NP4A 1PNDA 1CUOA 2BW4A 3FU9A 2AZUA 4F2EA 3WIAA 4GP5B 2PPEA 1YLBB 4BXSV 2AFNA 3JTBA 3FQ1A 2YARA 3AY2A 3FQ2A 1OE2A 4HCGA 3T71A 1QNIA 1NDTA 1OV8A 3TASA 1BXUA 4MFHA 4DP7X 1JZHA 4DPCX 1AG6A 1EZLA 3NJJA 2EIKB 1FA4A 4HHWA 5B1KA 4BDVB 4UF7C 4E9SA 2UXGA 1TKWA 4YSSA 2YAEA 1CURA 1PZAA 1WA0X 3NJMA 2VSKB 4GXFA 4BWWA 4KO6A 3CG8A 3AZUA 3DIVA 1N68A 2WSDA 4KO7A 2UX7A 4YSUA 3NSYA 1PZBA 5I6PA 4BWTA 1GS6X 2IDUA 3OMAB 1DYZA 1NIBA 4RH4A 1IC0A 2BP0B 3QJRB 1IBYA 1NPJA 3FSZA 5F7BA 4E9QA 1XB3A 3V9CA 2Q9OA 3KW7A 5I6KA 2B3IA 4M3HA 5I26A 2QPEB 1JERA 3IN2A 3EH4B 2W8CA 1NIAA 2PPAA 1KCWA 3DKHA 2FQGA 4EF3A 1AZUA 2VSMB 1JXGA 5I6OA 1V10A 2ZWNA 4A2HA 1NPNA 2J55A 1AQ8A 1SDDB 3T6VA 2XV2A 3NJFA 4E9XA 3ABKB 2LLNA 4E9VA 2GSMB 4HAKA 2DWTA 3S3BB 2Y1AA 3CVBA 3ZDWA 2YXVA 4G71B 2HRHA 4KOBA 5I5MA 3NYKA 3FSVA 5AZUA 4KO5A 4KO9A 4N4YB 2X87A 3X1GA 1HAWA 2MTAA 4YSQA 1AG0A 1JZJA 1NZRA 1GS7A 2HX7A 2YQBA 2YXWA 4W9ZA 1E65A 2FQDA 1JZGA 2FWLB 2N0MA 1MZYA 2QT6A 2FT7A 4G70B 1PCSA 1SHXA 1JXFA 3X1NA 2Y69B 1ZDQA 2IWKA 2J57A 2ZONA 4AKQA 3NJKA 1PZCA 9PCYA 2HLEB 2E86A 1ET8A 1J5DA 1GS8A 4UAHA 3S8FB 1WS8A 2XWZA 2P80A 2H5UA 5EHFA 2HX8A 2FT8A 4QLWA 1JZIA 1OOWA 2XX1A 2YAQA 3FPYA 4G7RB 2WO3B 5B7EA 2HZHA 2GI0A 2IWEA 2GB2A 2IDTA 2YAOA 2GC4C 1L9QA 1PF3A 1RZPA 3ASOB 4YSPA 2BZ7A 3FU7B 5B1JC 4NB7A 4ENZA 2OJ1A 1ID2A 4TXVB 3JT2A 2B08A 4KNTA 5E9NA 2BWIA 1T5KA 1J5CA 4DP8X 3IBOA 4Q8BA 3TBBA 2IDQA 3N2JA 3PAZA 2ZOOA 3QJQB 4E9WA 1J9TA 5FC9A 5AKRA 4DP0X 2PPFA 2I7OA 2GBAA 1DZ0A 7PAZA 1BYPA 2XV3A 2P80D 1PLBA 1TEFA 3S3CB 3X1EA 1XMEB 2FJSA 2I7SA 2IH8A 3OMNB 1J9QA 2UXVA 1AANA 5I6MA 1CYXA 4X4KA 3OMIB 2FQEA 1AZRA 1ILUA 3SBPA 3WI9A 1GYCA 2XV0A 5B3SB 1A4BA 1W6LA 2PP9A 3SBRA 4E9YA 2RACA 4DP6X 4YSEA 1L9SA 4F7KA 4BXVA 3CVDA 3FQYA 2TSBA 4L0PB 3PPSA 5D4JA 3IEAA 1AS6A 3ASNB 3QQXA 1M9WA 2XYBA 1QLEB 3OQRA 4A2FA 1GR7A 2BWDA 2UX6A 3IN0A 2PLTA 3QPKA 1BQRA 3KW8A 1NICA 4W1TA 1I53A 3ABMB 3FSAA 3U25A 1TEGA 1FWXA 3X2QB 4WTQA 4DP4X 4DP5X 1FFTB 1AOZA 4HCIA 2R7EB 2ZXWB 2TSAA 3WKQA 1JVLA 2EILB 4G7SB 5B1BB 4YSTA 3UGEA 1F56A 4KNUA 1KBVA 2QPDB 3FU7A 3OM3B 4HIPA 4DPAX 1WA2X 1UATA 1IBZA 2R7EA 2CJ3A 1AS8A 1KGYE 1NIEA 1ZIBA 4YSOA 3SQRA 1SNRA 1W8EA 3BQVA 2HRGA 2I85A 3ZBMA 1WS7A 1SFHA 1PY0A 2HXAA 3FPXA 3QJVB 4JKNA 3NJGA 2XX0A 5TK2A 3UACA 3TBCA 5IY5B 5I5JA 1NWPA 5D4IA 4YVNA 2JFCA 4CSPA 1RZQA 4F2FA 4YL4A 3PLYA 1BEXA 1ILSA 1MDAA 2PCFA 4DPBX 3WNIA 3NJLA 1E67A 2XXFA 3NSDA 2CBPA 1JZEA 4K9JA 2Q5BA 1KCBA 4HALA 4BK5C 5B1AB 3T9WA 5I5IA 1JXDA 4NERA 1AZCA 2VN3A 2YAFA 4PCYA 1A3ZA 4A2DA 1VLXA 4HHGA 1GW0A 4P5RA 1AS7A 3FYIB 4KOCA 3PXLA 1NIDA 1BAWA 1NIFA 1B3IA 4AX3A 1L9TA 1OCZB 2VM3A 5ANHA 2FT6A 4DP2X 2IH9A 3QJSB 4AKPA 1J9RA 3AG1B 3H4HA 3HEIB 1AAJA 2AANA 1TU2A 1ZV2A 3ZIYA 2PPDA 1KYAA 4FAAB 2PP8A 4FA7B 5B7MA 2DYSB 1ZDSA 3TU6A 1GY1A 1HFUA 1KV7A 2CALA 2OCCB 2XVBA 2PCYA 1X9RA 2IDSA 1MZZA 3AG4B 4GYBA 2UXTA 1CYWA 6PCYA 4NAJA 2IAAC 4WKXA 2J56A 4E9RA 1AACA 4JHUA 1XB8A 2VW7A 4QKTA 4ZK8A 1E5YA 1ET5A 4AI7A 1E5ZA 1V55B 5I28A 4E9TA 3CZUB 2XUWA 3D12B 1MG3C 3NJNA 1JVOA 4HZ1A 1L9RA 4A2GA 3AG2B 4KNSA 1A4AA 2H47C 3PCYA 3MBWB 1ADWA 3NP3A 2OV0A 3ZX1A 1ASOA 1L9PA 1URIA 1ZPUA 2CUAA 3EHBB 3FS9A 4AZUA 1PLAA 1ASPA 3MX0B 3FSWA 3GYRA 1L9OA 1A65A 3L45A 2DV6A 4YSAA 2PP7A 1OF0A 1PMYA 3OD3A 3UAEA 1J9SA 2QDVA 3ERXA 4CSZA 1AZNA 1KDIA 3GXUB 1ZIAA 2DYRB 2H3XC 4M4RB 5B7FA 3HB3B 3GDCA 2DY2A 3N55A 2WO2B 3WKPA 3X1BA 4AKOA 1BYOA 1NINA 1PLCA 3H4FA 1SHWA 2YAHA 3T6XA 1SF3A 1XB6A 2VW6A 5AFAA 3PAUA 4A2EA 1M57B 3EH5B 1ASQA 2EINB 2GHZA 1N70A 6PAZA 5I6LA 3S8GB 4DP9X 3FU8A 2XXGA 4YSRA 3X1FA 1A8ZA 1SDDA 1AIZA 4YSDA 3NJHA 2HX9A 1IUZA 2FTAA 1OE1A 1PNCA 2BW5A 1WAEA 3C75A 1GY2A 3CDZB 2AVFA 3IE9A 4YVUA 2CCWA 4P5SA 3AW5A 1ET7A 2A3TA 1WA1X 1SF5A 2FQFA 2VW4A 4Q89A 2EIJB
chains in the Genus database with same CATH superfamily
1GHFH 3FYEB 1T21B 3G6JA 4DERA 1R0AL 2CDFA 4UOW0 3IMRA 4CSTA 4OJAA 1QRNA 4RAHA 5TDPA 2GBVA 1JRHI 4OFYD 1C5BL 1JTOA 2YBGA 3HZYA 3E1F1 4AIXA 3QPQD 1D9KB 4KHTH 3KG5A 4HK0B 1KACB 2DQHH 3BT2L 1OF2A 3LAFA 1EJOH 1IKNA 2E46A 2Z31B 1KPVB 1SXBA 5PCYA 1BWMA 3C8KB 2Y22A 5F6HI 1FRGL 2Y1VA 2FK9A 1MHEA 3DJRA 2BHZA 2F58L 2QGBA 1CWVA 1KUMA 4CILA 3KPOA 4NS0A 1E90A 3H54A 4ANWA 1KB3A 1BF5A 3TCLA 4GSRA 2X89A 4PBVC 3VD1A 4HW6A 2EDKA 1XO8A 3T6ZA 4ELMA 1WFMA 2C3VA 1KTJA 2FLBT 4OUOA 4S1QH 3JVFC 2GJZB 1XSKA 2WWKT 1SFDA 5C3TA 1XH3B 3MGTA 3Q2WA 4YXKL 4Y7OC 1SYSA 1UJ3A 4KV5F 4KKNA 3ARBA 3L4YA 1OAYL 4ZW3A 1NM9A 1UKSA 2LFGA 1DSYA 1EMTL 3PQYE 3QJOA 2WXKA 3C5ZD 4ELMB 4FJZA 3DBXA 3LQAC 4YC2C 5GGTL 4LP4A 3VGEA 2WGNB 4MJ6A 2DH2A 1MPAH 1KOAA 5BS0E 4P2QD 1E4JA 1ZGLM 5JLZA 1NKGA 3QDJB 4QXUH 1UM4H 1UWGL 3D25A 4UDUA 3FCTA 2IOOA 4J39A 1GAFL 2ATPA 3C8KA 5EBMA 4OZGF 4IGBC 2OMYA 1THCA 1LK2A 3U0TA 2O5ZH 1CGXA 1DJIA 3CUPA 4ONOA 3QDMD 5EU6A 4HK0A 1OP9A 1D9KA 3HMWL 2J1XA 1YJDH 4G72B 1AR1C 1MCCA 5TDPB 1ETA1 3GS0A 3PABB 4JHWL 5HHXH 2AZUA 1J9CT 4JN2A 4LASH 3WFDH 3G6AB 1DBAH 4G7VH 3KWUA 3BP7A 1IBFA 1OEZW 2N4IA 2DPKA 2FLRT 1DJHA 3RZCA 1OE2A 2J25A 1ZLUK 3CMOH 4CJ1A 4Z7NE 2RQEA 2ZIDA 3DHMA 3IGAB 5DDHA 2EIKB 3B56A 4W4NA 5KSUB 2F7QA 4LFHG 3QIUB 3F12B 3DARA 4AZ8A 4R0LC 1U2HA 1IFRA 1KCUH 2HN7B 2YBRA 3RX5A 3P4LA 3WEXB 1PZAA 4KHXH 3NJMA 4ETYA 4N2LA 4LDEB 1B9ZA 1CS6A 3LKNA 1MVFA 1FG2B 3FULA 4MSWA 1GS6X 3D07A 4HPYL 4XCCH 1FCGA 4L8CB 3EYFB 5E5MB 2L3BA 4X0NA 3TVMB 4ABWA 4PBWD 1I9JL 1YPZA 4MYPA 2IQ9L 2KLTA 3P3YA 1N3NA 5AYUH 5AAWC 3RVTC 4AM0B 5MEPA 1U8HB 4L4TA 4HJJL 1E8YA 4HAFA 4ILDA 1LGVA 3HRZB 4U6HB 4YFEA 3RY5A 5C9KA 2DAVA 1JERA 4RDQG 1QFUL 2YFOA 3D0AA 4FFZL 1X7QA 2PTVA 4ATTA 1L0XA 4NFBA 2WLIB 2K6ZA 1FG9C 3RVWD 1IARB 4HUMB 3DKHA 1AGFA 4QF1B 1IV8A 2EDLA 2ZUUA 5KYWA 1X5YA 2DQIH 4O2EA 3MA9L 3CK0L 5ALBH 1XTMA 2J55A 3JWOL 2XQYK 3K80A 4O4YL 1S7TA 4BFGA 5BV7B 1KCKA 4K3HA 4L8BA 2NNXA 5IWLC 3F7PC 2WQRA 2GSMB 3FT4A 3UAFA 3V0JA 4AL8H 5IESH 2DMBA 2FLMA 2XN9B 2ZX8A 2CLZB 4U0RB 2Y1AA 5D7SH 4D0CB 4FQIH 1EAPA 4ZX3A 1EBPA 3FN0L 4KPHH 4OJDH 5EO1A 2WUCH 2P5WE 3GXMA 1LQSR 4M1DL 1VFBB 4PJ6A 2F15A 1KN4L 5FYKU 4KROD 1H3XA 5KZCB 1MNUH 3TN0B 1A9BB 1JZJA 3WO3B 4DUVA 3W38A 4JPVL 2X1QA 1CFNB 4N28A 4JRXB 4OQTL 4YHMH 3RIFF 3GEFA 4K8RC 4X7CC 5BZZA 4JK0D 3C5JB 2ZG3A 3FKUS 2GJ6E 3MR9B 1KCUL 2ARJQ 4N8CL 1QKZL 2WXQA 1A3RH 2EJ1A 2ICEB 5F96L 4C4UA 4QGTA 3L48A 2O93L 4XMZA 1K9TA 3CSPA 1TTUA 1V8HA 4B9KC 1U8OB 3KWWB 1WUNT 4JO2H 4MQXD 3S37X 4ZOCA 4NDMB 3HJEA 1FVEB 2EXYC 5F1IA 1NDGB 2X6BA 2QQKL 2QSTA 2YGOA 3ZSSA 1QUNB 2W92A 4S0SD 2QHLA 2A4CA 2VR3A 2Y2TA 3ASWA 3DTXA 4PJHE 4CMMA 1FGNL 3UX9B 1IC5L 5DUML 2QQLH 5TFSH 2IBZY 3IMTA 2NY0C 2V7HA 2WP3T 1JDCA 1ZS2A 2R2HA 3CZJA 3MROA 3CFEB 4HC1L 4CDGC 5I76B 4WTZA 3B7YA 4K2UH 5BOPA 4XBGA 5E8OB 4A7UA 5HDQH 1T0NB 2X4QA 2VDOL 4N2BA 3KPNB 3IDXL 5C09E 4X4ME 2NZ9D 4NP4L 1Z0NA 4PB9H 1A7NH 4AMKH 2BVEA 2Y2WA 5AW6B 2R1WA 2OMXA 3QDGD 4YDVB 4LPTA 5C3IA 3MRJA 4XHJC 4O2FA 5GGSB 4MD0A 4UYQA 3VXTA 4D9RD 4W9CC 1QBBA 1UT9A 5GRVK 2HT3D 4HIEA 1MJ7H 4XHJD 5DQJA 3STBA 5DMYA 4UV4L 1H3TA 5L2KA 2EZ0C 4POZD 4P2RE 3WNOA 5DQ9A 1F1DA 2EABA 5DFAA 1G9HA 1AS6A 2GEEA 5AOZA 4XPFL 1DANU 3OZLA 4PJ7B 2P46B 4RFOL 1EEYB 3L7FA 4FKKA 4UT7H 2DDQH 4JPWL 2EDEA 3VYNA 2O6FA 1PX4A 3TIDB 1RPUA 3WOVA 2OXGB 5CZXC 4YLQT 1G1OA 3L4XA 4PLNC 3CPUA 5HDOA 5BUAA 5D6DC 4A63A 3SKJH 5ALCL 1JGLH 3L5XH 3FFCA 3M1CA 5C86A 4GUPB 3CC5B 4L1LA 2A9DA 4YNYA 5E6SB 1EBAA 2W80C 1IC1A 2X6CA 3H3PH 4BEIA 5B3JF 1AFVL 4BUGA 3D06A 4XOAA 3NACL 2ZYSA 4YR6A 3THML 1ZV5A 4XXWC 4PCSA 5F21B 3KPPB 3QE5A 2HG5B 4K9EL 3US9A 1CD8A 3KBFA 2R9HC 1HTYA 5E9DE 2QPDB 1HH9B 1WGOA 4RA0C 4Y4FC 2EAEA 3RTQC 2V5SA 4Y19E 3KAAA 1HSBA 1HVXA 4WENB 4R4BB 4PW4A 3CBKB 3OMZA 4X7SL 1W72L 3LKPB 5DHVH 4L3CA 5KSAD 4CSSA 3F65A 3QORC 2Z92B 3INUH 4DN3L 2UY6A 5AVUB 4F8QA 3UBHA 2VQ1B 5F7NC 3NA4A 2Q1EA 2LTQB 4RBPK 1F0LA 3H2WA 4PVLA 3P4NA 5BZWA 1MCQA 2CNZA 3R19A 3I3DA 3H9SB 5EORL 4CW1B 5I16B 2QADD 2ZZUT 4MX7A 1BQSA 2VDPB 4KMTH 1BZOA 3H3BC 2EEAA 5DZPA 1UACH 1BEXA 5AW5B 1PY9A 2WMPB 3H7LA 3U30C 4DGUA 3OKDB 4YIQA 1SHMA 2OW7A 2J4WH 4WWID 4JPIB 5KG9B 3WO4B 4PGBB 4NYLA 1YNLL 5KJRL 2JK5A 5I5IA 4IIQA 5BS0A 1WBXA 3T3ME 2XG5A 3MGOA 4X8GA 4Y1AD 3TO4A 3U9UB 5AWNL 1A6ZB 3LV3A 4DH2A 3TPUB 3IPBA 4AH2A 3II1A 3EJCA 1IILE 2NXZD 4NNYA 3DWTA 3PQYA 5EWIH 3VI3B 5AAMA 3ARFC 3FQXA 4JHAH 4UIMB 3F7RA 2HVKB 3OC5A 2VE6A 3VFNA 5CIPH 2ATKB 2VM3A 4DVRH 1WAAE 2F74B 1ZLUH 4K5MA 1F97A 1NCIA 3HZVA 1N19A 1F90L 3PDGA 4OZFA 2B20A 2RR3A 2MSPA 1UFGA 1T3FA 3BLBA 3H4HA 5KYUB 4LNRA 4P5MA 2XFXB 3WKMH 4X6DE 3ZY7A 5LNGA 1BX2B 3U79A 4WUKH 3F5WA 1DLHB 3K2KA 1AP2A 2DZEA 1P9MA 1KCVH 1ZDSA 2OR8A 3TU6A 5IQ7H 1KV7A 1AKJD 4QRQA 4LF3B 4P2OC 5EBLA 3ARBC 1FFOB 1OQXA 2XRAH 5D5ME 2IAAC 5FYLH 4GLRI 3WTVA 2XN1A 4F91B 1AO7A 3KNBA 4P3CL 2AQSA 4GG6B 4AW4A 1KXHA 1RZ8A 3O4LD 1Q9OB 5FV2A 4C83B 1CBVL 5BO0D 1V55B 4M7LL 4NQCA 4QXUL 4IMLA 3VXRD 3G04B 4E9TA 4EN3D 1QQDA 4N2DA 2CK0L 4Y89A 3KMDA 3NJNA 2WZPD 3MLVH 4KROC 3V7MA 2OYPA 2ZPKL 3CPLA 4U1LB 5I8KL 4FTVA 5SV4A 5DFVC 2YOAA 3ILQD 1BQHB 4KI5D 4MMYA 3WTYA 3FO1A 3A4DA 4LPXA 3LOWA 4F58L 1U33A 2DQFA 3QEQA 3MLUH 5CU9A 4XZ4A 1U8IA 4X6DB 3IE4A 1UH2A 1DQJB 4AQ1B 4Q0XH 2PW1A 1E27B 2W0KA 1S7XA 4PD4K 5G4MA 4F7PA 1S7SA 4XO3A 3BDYH 4B9CA 4J28A 4Z7QB 2A9CA 3FUJA 3X1BA 4KY1L 3OVUB 3LX9A 4BQ6A 4AQAA 5ERWB 1UXLA 5CWSA 4AENA 4G1MA 4FABL 5FUOH 4Y16B 4EI5D 2VTFA 4QT5B 4WKZA 2FSEB 5D1XA 4TUJB 4V2CB 3O2WL 3PG2A 3GJFA 4ZUWA 1JL8A 3EGSB 1M57B 4HK3J 5D1QB 1FZMB 1ASQA 3RRQA 5E2UH 1QPXA 2D7TH 3IS1X 5I9QC 5KSAA 1A6PA 2CIKA 5C0AB 5DK3A 4OAWB 4A6YB 4B9ZA 1HWGB 4NM4H 1ZLEA 3IKKA 3VFPB 3O6LL 2ADJB 3D2TA 1DP0A 2FHBA 4JRLA 4KX9A 1JZ2A 3V0IA 1ZVYA 3N50A 1WAEA 3TYGL 1N8ZB 3L2MA 3NIFF 4M48H 3RNQA 1N64L 1FNEA 4JFEB 4U3SB 3U36A 4YO0A 5GGVL 1WA1X 4OFVA 4APXB 5CCJA 4TQEL 5K1NA 2ZYIA 3PGFL 2ZF8A 3MLXH 4E42B 1OE3A 2A6DA 1NCBH 4AVIA 4Z7WB 3BSZA 1TITA 1Z66A 2GKIA 2D4FA 3HC3H 3U82B 3U48A 2CU9A 2D2CC 2R0LL 1BXXA 3VXMB 1CF8H 3F62A 4AEFA 2CUMA 5KYYB 2F0CA 2MOGA 1BQKA 3IKCA 3WGVB 4AOFA 4A2LA 4CVZA 1U8LA 4HOWA 5IVXE 4O58L 3NUKA 3JVGC 1TO4A 3MJ9A 4U3SA 3U36B 3U9WA 4J1UA 3RNQB 3RL1B 1I82A 1R3IL 3FW6A 1N8ZA 5JW4N 5F7AA 2FX8H 1K8IA 4DEWA 3IDYC 4WGVB 3W0WA 5A7EA 1HYSC 2NY5C 4YDJB 5IB4B 4K15A 4W9KC 4JZJB 3DVGA 1W6WA 4G3YH 1RMFH 1KCVL 5IQ7L 2J4WL 2HH0L 1BD2A 4ATWA 4N8UA 1OB1A 1QW8A 1FZMA 4DHLA 2VITB 4WY7L 3ZE0E 3RWGB 1XMWA 4NJ9L 2C9VA 3LKRB 3PP3K 3HAEH 3GXDA 3V5DB 2V2TB 5DRZB 4WKZB 3MRIB 4YWGH 1WZ1L 4K8RD 1E9PA 1T0MA 4WNJA 6TAAA 3BGFC 5ERWA 2IANB 4YZFE 1I1AA 2HJFB 3RU8L 1SYVB 4N68A 4LAQL 4G5AA 4KKCD 3F6IA 4KQ4L 3SY0A 3TJHC 5T8IA 1RLBA 3H9SD 4AQ1A 4LHJB 4G6JH 4DEPC 4JPSA 1HNGA 1XCXA 1Q4NX 1TTCA 2DI8A 1L5GA 3DXAD 3G7TA 2G2NA 4K8RH 2JH2A 1R3HB 2FBOJ 3F7VA 4XBPA 3VGBA 4LQFL 4JG1L 1XGYL 2X4NB 4D9QD 4WEMB 2YO3A 4X8XA 1U58A 5J11B 2WQSA 3IRZA 4GBXC 4I5BA 4L2LA 2CQVA 3GZPA 1O0VA 3U9PH 4ZUTB 2V9TA 3T71A 3CFCH 3S6CA 4CC4A 3RIKA 2XWBA 3QEUA 4XMWA 4C83A 3QI9D 5CNHA 2G3MA 3QDGE 5AW9B 1I7RB 3I50L 1AO7B 4N8VA 1JWMB 1WA0X 2Z91B 1J8HA 3A23A 3VJ6A 4BSVB 2C4XA 2X40A 1KYOK 3JV5A 5EUOF 2YMXL 4GINA 5H8DA 3TBSA 1X5AA 3HKZA 2UX7A 4B5EA 1PZBA 5ILTH 4H4NA 2BSTB 3ARED 1BX2A 1A3QA 3JWNG 5MEOB 4HKXB 3ECQA 4HWBA 4WU5A 4P5MB 1ZLVH 2DQUL 1YEJH 3PGDA 1BG9A 4DZBA 3KLLA 5IFHH 2F53A 4NJAL 3WO4C 3DX7B 4EQ2A 3WS6A 1DLFH 2ITCB 4HKBA 3A0OA 4Y4FA 3RTQA 2F74A 2PPAA 2QSVA 1ZA6A 2ATKA 3ZDZF 1UXSA 1YRKA 3OHMB 3F7QA 4GFXA 3ULSB 2ZKHL 2XYCA 2QSCH 1AZZC 4X6FA 1AQ8A 3D9AL 1UOVA 3QQ3A 2Z8RA 4KGJA 4ODTL 1SMOA 3QORA 1P4BL 4YHKL 4FTDA 3TPUA 1JZ5A 4YXHL 5D72L 3D2UB 2UZPA 3ARDC 4QXWA 5ABDE 3ALXA 2DWTA 3QDGB 5BS0B 5HHOB 5F3HB 3VMNA 2FJGA 1DJWA 3L4TA 5FKAA 2G4EA 3BO8B 4IOSD 5ESAB 4PGBA 1G4MA 5AKSA 4YIQB 3QS2A 3DYMA 2YQBA 5DHXB 1P84J 5C6TH 4ZUSB 3VFOA 4CW1A 1HS6A 2KT6A 4PLJC 1S3RA 1YJDC 1DN2A 1P5UA 1RUML 3V0FA 4CBPA 2E7LC 5DVPA 1GZQB 1CL7H 2J2ZB 5F0JB 4ODUB 5C0RL 1P4BH 4YHKH 4IOSA 3HAEG 5AW3B 1KJ2H 3UJJL 2H1LM 5F7HA 1GS8A 4JFPA 4M7ZC 3UJJH 2X7LA 2XG4A 4L3CB 1I4FA 4NZTH 2QV4A 3LHPL 5DJYB 4JB9L 1MLCB 4N90E 4NXSA 2AV7B 2YD5A 5AW0B 3MX0A 4G7RB 4N6QA 1CLYL 4PJXE 5HI3D 1MJUL 2HFTA 2FECL 1MCRA 4CN4A 1RK0A 5IMMA 3ASOB 5SWSA 2XNAA 1EO7A 1MHHB 5TE4H 5HVGB 3B9KD 3E3QE 1BP3B 5CLWA 4JM2F 2BSDA 3WTSA 2B1AL 4LPWA 1CT8A 1TVHA 4UV7L 4HHAB 5FA4A 3O6FC 3TNMB 4YNYB 3VQLA 2B2XL 4NO0A 4DAGL 4XBMA 1PLBA 1TEFA 1U8MA 4GW4A 4MGXA 4WQOA 3HFML 5E1GA 1NC4D 2PUQT 3W2DL 5H4ZA 1Y0LA 4FXGC 4KDTA 4AT6A 3TIDA 4LPVA 1FFNB 4KK8D 4UWQB 1GYCA 4R96A 2X05A 1EEYA 4GXVH 4YAQB 3QEGH 4UYPA 4F3FA 4XMTA 1CLCA 4PJ7A 3N0AA 2VDLB 1RIVL 2YPVL 1N0LA 1UT2A 2WUCL 4XRCB 4AYGA 4Y16C 2O1AA 2ARJA 4NJAH 3NSXA 4JDEA 4DKEL 4HIEB 5DQJB 2I9LA 1JXKA 3DK0A 1WO2A 1KLUA 4O2FB 2QMJA 4KU1A 3DX8A 4O4YH 1A3LH 1VEMA 1CCZA 5E6ID 5KTEL 4FG6D 2JKRM 3ECUA 1F6LL 3KW8A 1ZS8B 3ABMB 4F57H 1HINH 4PS3A 3QSKB 1OT1A 3GMQB 1KLFB 4G8GA 3RWJA 1PPIA 8FABA 2PNDA 5DUJA 5J1AB 4TSCL 4N2CA 1HHGA 3KPRB 3UJIL 2IG2L 2A6JA 3FTSA 3FHQA 3KGSA 1FH5L 3H6JA 4JX0A 4LQ1A 4ZRGA 3RI5F 2CPCA 2X70A 5F9JB 1G0DA 3ZTEA 1CR9H 4OV5A 2OSLB 3G5YA 4LVEA 4XPGH 5ESQB 1CJYA 3U9PL 1Z9LA 1JG9A 2Y5EA 4XC3H 3ML8A 4DGYH 1A3LL 1OM3L 2VIRB 2BNUB 4QHLA 1RPQA 3QUZD 4TVUA 1HHGB 3KPRA 1SEBA 1PJWA 1VGKB 3O6KH 8FABB 2GVYA 4ELDA 3KPTA 3GXPA 5SV3A 4I18A 4JY5L 4WZ9A 1ZKAA 4LVOB 5I82A 4XNMA 4AV5A 5JZ7D 5GGRA 1WAPA 3WMSA 1MFEH 1NAMB 2Y07H 4W9HC 2FO4A 3TURA 4AQOA 3IETA 1V05A 1OIOA 1W0WB 4GXVL 3MR9A 2YPLE 5EOQL 2BC4A 2BOBB 2BZDA 5SX4I 4Z7AA 1K6QH 7FABH 4JRXA 4DGYL 4TTDD 1IC5H 5AZ2L 3PIQB 2FSDA 5DQDH 1A6UL 1RHHB 3EYOA 3GHPA 1UD4A 1TSHA 4NBZB 3LEVH 4A55A 1F6AB 2YRZA 1A1OA 4KZ0A 5E8DH 4KKRA 1JZEA 1P4IH 2JI2A 5H37A 4BK5C 2NY0D 2ED8A 4XP6H 4PW3A 5K1VA 1I8KB 4GAGL 4OZFG 2CO7B 1FAIH 1UGKA 3EJRA 3O41A 3G5XA 3ZO9A 5DEFB 5DD6B 4GW4B 1Q0EA 3O9WD 1GW0A 4U1GC 3P3TA 2FX9H 2CBOA 3JWDH 2ZUWA 5KAQF 2FNBA 1GIGL 1BFVL 2COVD 3GIZH 3O6FD 3TNMA 4DO6A 4NRZB 2JCCF 3BXNB 4J3XA 3VB9A 1CXLA 2V2XA 2LU7A 2XN0A 3P9LA 5EU7E 5IGXH 3KLAA 2AAVA 3FO9A 2IH9A 1H5BB 2GITB 4OGYH 4YQXH 3KXFD 1R3LA 3HRZA 3SGDH 4XNZC 3B6SA 5IMMB 4NENA 2AANA 5HYSG 3IU4H 4E41D 1SZNA 1WJ3A 5DZ9A 4KZDL 4B96A 4R7LA 3MU3A 4MSWB 2ERJC 3GRBA 3RB5A 5K69A 4HF5H 1J5IA 1VDGA 2ZCHL 4RRPA 3DVNA 1CD0A 2Y36L 4WKXA 4XZUB 4QJ5B 2ZG2A 4E9RA 2ZXEB 3W5NA 4OTXH 5J8OA 2D0FA 2NXYD 3OKEB 3KDMB 3LMJL 4PGZA 3SPGA 5DJ8B 4F20A 5F7WC 3RB7A 4JFHD 3UYOD 1O9VA 1IGFL 4FKHA 4IRSB 2F68X 3WIIH 4LMQE 3OAUH 3GBMH 3WKYA 4KNSA 5IJCC 1ACZA 2HKAA 3SDAC 2AABH 3IFNL 1KWGA 5CAYB 4Y88A 3WJJA 3KVDD 3WE1A 3RVXD 3C9NA 4CMHC 3UAJA 1CICA 1FZKA 2EVIA 1B4LA 1C8QA 4FQXC 5CJ5A 3QUZC 3SKOB 5E8PB 4ISVA 5EU4B 1S3KH 4X6FB 4ZOAA 3Q13A 3WAKA 4N87A 2B14A 3UAEA 3RA7H 2XACC 2HWZL 1CTOA 3LPGA 2ATPB 1ZA6B 5AVWB 4KK6C 1RP8A 4OFDA 4YUEH 1F4AA 4PJ5D 3QDJA 4KQ3H 3WKPA 1TQVA 3H3KA 5JLZB 3FRPB 5K9JH 1KGJA 4JO1L 4NQDE 3IDYB 4PB0L 4MJ2A 3IDNA 4HFUL 2VW6A 5ICUA 3UTSD 1WHPA 3WLWD 3OJVC 5LLIC 4QHNB 2Z35B 2XHNA 4GO9A 1UJ3B 2MWCA 3SKNB 4XNYL 1N70A 1OP4A 4LARH 4XMVA 1ZVSB 4P05A 5D7JB 4UUJB 4N8VB 4QAMB 1KENH 3MO1B 3T1WA 3GSWB 1SDDA 1OSEA 3QRGL 4PG2C 3VTMA 5L8LB 5HGDB 2N1KA 2VH5L 1A25A 2WLNA 2NSXA 1MHEB 2OZNA 1JPGA 5KBPA 4FFWD 4Q52A 3RGHA 3HI6L 2R1YA 2Q3AA 5F7UA 5FM5M 1PGRB 1G7QB 1HL4A 1KPUB 4X50A 4KKLD 2NUTB 2EIMB 1LEKA 3T65B 1OF2B 5IHUL 2FR4A 1OAYH 1TQBB 1R3HA 3F7VB 4XBPB 3UABA 4WU7B 3NCMA 2VT0A 2YAPA 1HI6B 5EEZA 1DQIA 1F11B 4Z7OE 4QAWA 4TLUA 4UQDA 3TEUA 1QVOB 2EYSB 2G5BA 3F01A 4TRPL 4G7QB 5D1ZC 1QBMH 2VGLM 4XNAA 5L0QC 2B4CC 4EIZC 1KIRB 3SY0B 5DTFB 1YMHB 3H56A 4EUPG 1QR1B 5FDWB 2NDFA 4XAWH 3DTUB 1J0JA 1UADC 4MNQD 3RKDD 2ADYA 2F54B 3BUQA 4ZYKB 4ZFOL 1EHLH 4PTUA 3KLSA 4UNTA 2YGQA 3BVDB 3LKRA 4OR1A 3BLPX 2LAGB 1E6OL 1I3RA 4MXQD 3LRSA 1XTLA 1B0RB 5GJTH 1KTLB 3VTTA 5GZOD 4LPUA 4TUKH 2OMWB 3RY4A 3WS3B 3SDAD 4BRJA 3VRLF 2C9XA 1SMAA 4MCNA 2YPVA 4NCDA 3FTYA 3BP5A 2Q6WB 1CF8L 4NQTA 3WIIL 5JZ7C 2O72A 4L3FA 3ZO0A 4ZQTA 5IHHA 4KQ4H 4CVUA 1R34A 3HUJF 1QTPA 4NOFA 1OSYA 4J1UB 2Q8AL 3D87B 4HSAC 1NMBH 2JXMB 3IKCB 2AJVH 2XQBL 5C09B 3LD8C 2ZCLL 3TV8A 3QRFM 2AJVL 2XQBH 3HPLB 3O6FA 1M56B 4M5SA 4U0RC 1MCNA 3G5WA 1H6TA 2BY2A 3FXIC 2YK1L 2YC1A 1J10A 5JOEA 3B1TA 3V4PA 1QSFA 2FL5A 3EFOA 1JPSL 4JJOA 3MNZB 3P2BA 1EGJH 3IJ9A 4LCCA 4W6YB 2A6DB 2Z65C 3QQDB 4Y1SA 3WNLA 3BPCB 3FQ1A 4BQCA 3BUIA 5E6ZA 4PJ7E 7FABL 4OD1H 2IAMB 3V9FA 4BKTC 4M43H 2L04A 2HPOA 1AG6A 1DQLH 1BBDH 1LNUA 1NANH 4JMNA 1EZVY 3MRGA 4YSSA 2UXGA 3NABL 3UDWC 3MBEB 1IGIH 3SE3A 2BVOA 3VFPA 4NUGH 3WHE0 4EDXB 1QPKA 4R4ND 3KXFB 4NUQA 4AUJA 1NH6A 2UZYB 5HI4C 4XTRC 5F8RC 5IVXF 4JKPL 1BVLA 4FXGB 4YHLH 1SHSA 2VWEC 3DIVA 1CQKA 2VDNL 1U8JA 1VFUA 2K4AA 1P4UA 2WXMA 1DYZA 2V9RA 4PHXA 5EZPA 2P3YA 1ETZB 1QFOA 4BZ1H 3S48A 5B38A 4Q9CA 4AMWA 5I1GH 3H55A 2XIIA 1DZBA 4IOFC 1D2OA 4G1MB 4NKDB 4JGNA 4NPJA 3V0WH 2DQGH 1C5CH 2GUOA 2NR6A 2Y3AA 4IGBB 2LW3A 5TPWH 1GJIA 5D7JD 1R5VA 3SQBA 1S7SB 2DOCA 1EEUA 3BVNB 2R27A 4X7SH 5C70A 4HV8A 4X5QA 3JWNH 5KANI 4TNFA 4PRBB 4JFDD 5HGHA 3RPBA 1BZ9A 3V0GA 4WK2B 5E2JA 5E1IA 5E5LA 3FT2B 2HKHH 1UWXH 3PFUA 4UT6H 4M1CD 3MFGB 1FBIH 2IPKB 4HLZH 1S9WA 4N3UA 3ROOA 2CGZA 4AUUA 4F27A 3S5YA 2VERN 1OGAA 4S0HA 5CMAB 1WITA 4JUSA 4MD5B 3TJPA 4J23A 4B9FA 4WWOA 2IIJA 4FXKB 4RRPM 4QXTB 3LN5A 1FGNH 1ZT4A 5SX4H 3FB7A 3G04A 4W9ZA 4NRYB 2FUTA 4NQCB 3VYOA 1B0IA 5IF0A 1P7HL 5LAPA 4NNXB 5CILH 5K59E 3MI6A 4OGXL 3S35L 1H0DB 1A7PH 2JJTA 3IDMB 3NJKA 4HWZA 1NOFA 2IANE 4KJPC 1FFOA 4Y2DD 1WVZA 1F4HA 3EO9L 4RWHA 2WIIB 1TQCC 4KX8A 5IHWA 4QRQB 2IVFC 5IQ9B 1QFWI 4Z78A 3B3BA 5MENB 2Y5QA 4EI5C 2W9LA 4IMKA 2ZP8A 3N40F 4XWGH 4XNXH 2IDTA 4LNRB 1M1XA 4PV1C 1FO0L 4ENZA 2R0ZH 1DQDL 4ZUUB 2A6IA 2NY6C 3FUDA 1KB5B 4TXVB 3UPRA 1HJBC 3KGRA 4AL8C 4F5CA 1UT1A 1KTKE 1OAJA 3HG1A 1G7MA 1Y1UA 2OI9C 3VFVA 4ZMOA 5C0IA 2VQTA 2RCSH 2IDQA 4HK3N 4PGCB 5INDB 4PCTA 3HNVH 4ZTPL 3U4BL 1PU0A 1YYLH 2HFGH 3MLWL 4R8WH 1NEZB 3I6LD 2I7SA 2X5PA 5D71H 1VACA 2WXFA 1KGIA 3Q05A 1CYXA 1E40A 4J6RL 2EXWC 3NIDB 4X4KA 4ICXA 3SE9L 3SKUD 4ZNCD 1C1EH 3LMJH 2KS0A 3LRLA 1BLNA 1MWAH 2F18A 2J8UF 3DMMC 1XGTB 4Y5VA 3SDXE 2N01B 1QFHA 4R7VA 4X9GA 1L9SA 3HHMA 4JDVB 5D2NE 1XAKA 4PH8A 1D5BA 2YEVB 4U1NA 3OLGA 1DL7L 4JFDB 4XMLL 4NCC2 3O2DH 4ENED 4OZGB 3BH4A 2IOMA 5EZJA 5DJAA 4LP8A 4N8CH 2YGPA 5D71L 3TN0D 4BUHA 3OQRA 2OMNA 2VQ1A 4OCLC 3QFJD 3UAJC 3QPKA 5H35B 3GO1L 5IR1A 2UWEB 1I53A 4W1TA 3ETBF 5DK2B 5IQMA 3X2QB 4L4VA 1H8OA 4DP5X 3CN2A 5KSVA 4IKLA 4L8DB 5ID1B 1MJ8H 4UT9H 4HCIA 2TSAA 5JIKA 4I88A 3WEBA 4N2AA 5DHYA 3NFSH 4PY8J 1WWBX 3QUYB 1J48A 2P42B 2W9DH 2HVBA 4Y2LA 2IGFH 2VQUA 1DVTA 3T0EB 3PWPA 3LB6C 1QSVA 4XN4A 5E4EC 4JZOA 4JPWH 5FB8A 4YXLH 3S34H 4MNGA 3HE7D 4UBDC 3QXDA 1KXVC 3QIBD 3MYJB 3WDIA 3JUYA 4EO5A 5JNYA 3J27A 1KGYE 2F7PA 1WF5A 3CLEL 3A6CL 1UEMA 2PTTA 2VDKL 4Z5RB 2PN5A 4RX4D 5HHVH 2PETA 3N42B 2Z4QB 2QADB 2CJUH 3K8LA 4LKXA 2J5LC 3FOMA 1NC2D 4JKKA 3SGKA 5C0NC 1HINL 5KVGH 4GAYB 2EEBA 1RURL 3LQAH 1I9JH 3B9DA 4E36A 3LHAA 3K2UH 4C56A 1CD1B 3IDGB 2LFEA 1UHVA 2JFCA 2W9EL 2HLFD 2QBWA 4YL4A 1HN1A 2FEJA 2RAMA 3UC2A 4PP1D 5IGXL 4IRJB 3WNIA 1TZHB 2R4SH 3O3AB 4Z7UF 5E7BA 3NZSA 4BE6A 1PCXA 2YR3A 1EHNA 1AQDB 1ZAGA 1KCBA 5CD3A 3WFBL 2G0LA 2VR5A 3COOA 2BWQA 1U3HC 1I7TB 4F37K 4L3AA 1IM3B 3ZYJA 1UXWA 4MLSA 1K3IA 3BRFA 1XR8A 4KGLA 5L8KB 4R26L 4OUUA 3VXQB 4CAGA 4P5RA 4X2UA 2IMNA 4D3CL 1QLEH 3FUHA 1Z9OA 3EDFA 3AT0A 4I77H 4M6ML 2XA3A 5SWSD 2Y06L 2B7DT 1BZEA 1NIDA 1YY9D 1MQKH 3CFTA 4JFOA 3VXNB 4AX3A 4P23B 4N8VG 3LDBB 2V7HB 4LSSL 3BZ4B 3S7GA 1SVCP 2F8OA 1JYNA 4EQ3A 3PGCA 2DEWX 3KLQA 5C0AE 4N0YH 4XPHH 4AKPA 1HEJC 3HC4H 4U1SB 1QUNA 1B0GB 1LO3H 3FO2A 2QR0A 3L9EA 2VO8A 5ANMA 1VESA 3W11C 1AH1A 2V3EA 4FAAB 4A7VA 2R29H 3D4YA 2GFBA 1UH3A 5CJ8A 2GSIB 2Y7LA 3GB7B 5KBDA 4NP4H 2BY3A 1RI8A 3LPOA 1EZVX 2ZOUA 1GA2A 3NMEA 4GS7C 4LPCA 5FIEA 5JXAL 1HHJA 2R69H 3K74B 5C0EB 5IEHB 1RIVH 4TNWK 3FFDB 2ICWI 1KN2L 5EFIA 1IGYB 3C5JA 4UNVA 4RDQF 3KR3L 4O58H 1AXIB 1H8LA 3KDPB 4S1DC 2OA9A 1IEBA 2DBJA 1MUJB 1VZIA 4BELD 3AY4A 1VFBA 4Y4FD 3IJEB 3O3DB 2G5RA 1UB5A 1XEUA 1ZHKA 2F1BA 3KPMB 4P9MH 5BRZE 3CFKA 5I6XB 4I1RA 3GI9L 4K4KA 1A1MA 4ZSOB 2XN9A 4G80B 2NQCA 1TUPA 4X4XB 5GISL 3IFPB 1KEMH 4NKMA 4P04A 4ZPVA 3BSGA 1KBGL 4L8BB 4O00A 2QVKA 3VTAA 1S7TB 2P5WD 4UNUA 5AW4B 1GYVA 5CEZE 2NY2D 1OF0A 3HJ0A 4H26B 2PWGA 1J9SA 4XCFH 1YPZF 2IV8A 4OBSA 3UPCA 5AAPA 3BPLB 3GDCA 4EVNA 4P5TA 1X5HA 3F7YA 4KH2A 3V8CA 3TEZA 4YHYC 4JN1H 4HJGA 4OD1L 1JCKA 1MCSA 1NDMA 4JBSA 5D5MA 3VXOB 2RTTA 3H4FA 4NWTL 3N44B 3U2JA 1U8HA 1U41A 3GJFH 2EIDA 1YYML 1DVYA 2YPLB 1I8IB 4NQEE 3OR7A 4B97A 2BY1A 1OCWL 3RFZC 4PVMA 3TVMA 1N59B 1A1NA 4BIKA 5I9QB 4A2EA 4AL8L 2BIMA 5IESL 3G08B 3RY6A 4F7TA 5DJCA 3RP1A 4GS7B 1CPUA 1OAZL 4PJ9C 3S8GB 3MUGA 4YSRA 3ZDYF 5FGCB 5TDOA 4LU5L 3UG3A 4OZIA 2YBRB 2HN7A 3P4OA 4A7QA 3C2SA 2VXSH 1E8XA 3JV6A 2E8ZA 4X5XB 4FQLL 2Q8AH 3DROA 1J5HA 1NLDH 3GJEA 1UB6A 2H1PL 4OLZH 2D3VA 1PZ3A 4LSUL 4XNUL 2EDQA 5F0PB 2JWYA 5HVHB 4JEGB 3O3EA 3T4AB 4G9DA 5CP7B 3VXME 3CXDH 2N3JA 4IRSC 3M6DA 3FU6A 4CDHA 1DQMH 3GMPA 3QXVA 4L1DA 2B77A 4X9IA 3L4ZA 5LCVH 2E0PA 3DX6B 1CFSA 1QW9A 3NAAL 3GHBH 3MRHA 4B5ZA 4N0FA 3ECWA 1JPST 4JHVA 3UTSE 2APTA 2GQHA 3KS0H 3RAJH 1W2KT 2V5TA 1HCVA 4PGDA 5FHBH 3P0YH 1WCQA 5EZIL 4ORZC 3RVTD 3CUPB 1I1YB 5D7IA 3QI9A 5C8JA 4G6KH 1QHQA 2YJQA 4LLQA 3FCTB 2IGLA 1INEH 2OKMA 4NC1E 5EA0H 5KN5B 3QNFA 4PRPA 4LEOB 1OTUC 4P9HC 4I8DA 1G9NL 3CFBA 2CIIA 5JHLA 1SBSH 3PYCA 2R0WH 1JF1A 3GM8A 3TF7C 1M7DB 3D39D 3FTWA 3VI3E 4GW1A 3O8XC 5HHNB 5AB0A 3TIEB 3IDIB 2X44D 5I8CA 3ZW3A 1R3KB 3GO1H 5I1AA 2BHFA 1XH3A 3JBG7 2FDBP 1SEQL 2FD6L 5CSGA 4S2SB 4OZFH 2OS7A 1V54B 1J1PH 1LEIB 1DBJH 3V7AG 3DV4A 1HL9A 4HDIA 4AIEA 1DVUA 1O7DC 3NTCL 4GRLA 5D2LB 4ELKB 3AT9A 3NG5A 1T0OA 1Z5HA 3QRGH 4FP8H 3RWFA 3EXLA 1OLZA 1QLFA 3QH3B 4B9JA 5C0JB 3VGAB 5EO9B 1KPVA 2NY7H 2FEEL 4X6CA 5D2NB 2GJJA 2H0JA 3MRMB 5AWNH 2WQXA 4MAUL 2VABB 2FWUA 2VCOA 3WLWC 4PS8A 4S11A 4Y8DC 1ETJA 3ZZSA 1AOHA 3BYYA 3HZYB 2WCSA 1BLIA 3NZ8B 4Z0XA 4DO5A 3P77B 1CUOA 1WQVT 2R0LH 2DJ4A 3T2LA 1SY6A 1SJEA 3WIFB 5B3JE 2YARA 4X8CA 1I85A 2YZ1A 3HZKB 1DSFH 3Q8CA 2YRPA 2AMGA 3AS0A 4HCGA 2PO6A 3VGHA 2CO4A 1CZ8L 1OV8A 4NBXB 4MFHA 5DS2A 1I7UB 3NJJA 1U8CB 2R0ZL 3NFPA 1FA4A 4WFGD 4YUEL 4C8XA 2VN7A 3KYAA 2VDQL 4LBEA 5IQNA 4FMKA 1YNTB 5EU3A 4ZX6A 2XTJC 2VLRA 4YGAB 4QRRE 3EH2A 3K1DA 4U1IB 3SD5A 4UILL 4TUUA 1O6SB 5IB3B 4KK8C 5KW9H 2MPAL 3LKOB 1FNSL 4JFWA 3VM5A 3B9VA 5KJ7E 1C12B 4YLBA 4ZMQA 3LRHA 4WWKC 1O9WA 2Q20A 4X4YA 2EZ0D 2FGWH 1QHPA 3LQZA 4P59L 4HUCA 1HH6A 4AXWB 3PQYD 3N85L 3WKNA 3Q8BA 2K8MA 4FYTA 4WO4B 2EH7L 4HBCL 1LM8V 3VRIB 2QQQA 1JPEA 1WHOA 3MLXL 2VDLH 3FF8A 4OB5H 1G7PA 3VWJA 1GOGA 2EACA 3FCGA 4TQEH 1KEML 3HZMB 4QUOA 5CJOH 3UBFA 4CC1A 3S4SA 4OGAC 1OAQL 1ICTA 2HFEA 2JVUA 3RPIB 1P7KB 1KJMB 3M07A 1CFVL 2ZWYA 4E9XA 4UQ9A 5E9DA 3HG1E 2BRRL 4JO4H 2ZD0A 1F4WH 5LHDA 3MLUL 3L1GA 2AK1H 2A9BA 1N26A 4Z7VF 4XVJH 3TGXA 2W65B 1A6UH 3GXFA 2JQMA 4D0DA 5HYIA 4KO5A 3O8XB 2OK0L 1J1OL 3WDJA 2HFFB 4FQXD 5FUCC 1J1OH 3MN8A 1NAMH 3CLFH 4OD2A 4OZ4A 1JZGA 4R0LB 2B0SH 3BAKA 5D7KE 3TBVA 3QUKA 1ZT1B 2DQGL 2FT7A 4UMGA 5DJXB 4O5LL 3E8VA 1QLRA 3N43F 5H2BB 3BAJA 4L1SA 1VKXA 2VDQH 4PRPD 2CHDA 3Q2LA 1KIPB 4BK8A 3FT3B 3GBDA 3MNWA 1RZJH 3RG1C 2OPCA 1U3HA 1LILA 3DIDA 3GPEA 2XXCB 3V6ZB 1WT5A 2Z31C 2OTPA 4G5ZL 1N5YL 1BIIB 1KIUA 2OXHA 5AG8A 4B60A 5EHFA 3SGDI 1G6RB 1TETL 2OCJA 2FT8A 1U3ZA 4Y4HA 4KVNH 5DYOB 2V8MA 5DC2A 3TEWA 2PCPB 2HRPH 3KYOB 3VG0H 1L9QA 2GC4C 3MCLH 1TCMA 5J12C 4O5LH 3U1QA 2CK2A 5IBLD 4IS6A 4H25A 5DQDL 2KKQA 5ISZD 2JKLA 4IU2B 1I7ZA 4MAUH 4QWWD 1K2DB 5DJ6B 4AE0A 5M7QA 1W15A 5F7FA 3VXRE 4Y4HD 4GQZA 1D6EA 1XGZA 2ORBH 1ZOXA 3LXBA 1FV1A 4GSDL 4PYHA 1EGJL 3DMMB 2GBAA 5C0AD 3VRJB 4ANKA 2GIYA 3IDXH 1A3RL 5I15L 3D18B 1FIGL 4XNQA 5JPMA 1OT2A 1SLUA 3NCCB 3BKCL 3SODB 4X6BB 3MRBA 4XHQA 2MNJB 1ZTXE 3OAZK 4XP4L 2W94A 4DZ8B 3FF7A 2D3NA 3FQ4A 4YDZA 2Y1ZA 1LO0H 1B2WL 1A7BA 3D39A 4QHUA 3HHSB 1OLLA 4ANVA 5I1IH 4Y9GA 1S7QB 3AABA 3N6YA 3TBWB 5D4JA 5K39B 1RK7A 1T4KB 2H8PB 4OLVL 4FG2A 4MJIE 3QNZB 5L88L 3K6FA 5T3XL 4AYBA 2VMCA 3HFMH 3FCSA 3PDOB 4R2GD 1RQ5A 2CRIA 5KW9L 3TX4A 2OX5A 4GT7A 2HTKD 2JI3A 1EH9A 3FQNB 4EE2A 5H37H 1BQRA 1G7JA 4ZZKA 3V4UL 4OCXL 3W39B 1NICA 3UTPD 3U25A 1IQWH 4EUPA 4W6XB 4WTQA 1XDTT 4KJYB 2JI1A 5K59F 3K8KA 5EPMA 2DMCA 2K8QA 2ZXDA 2JLLA 3L3OA 2WIMA 2NY3D 3VWKB 1GYAA 1RUPH 3HC0A 4FTVE 3IJYA 3LSOB 4QTHA 2JKIS 2P8MB 5HJ3B 4MJID 3U7YL 5KVMC 3BZFA 1NUFA 4KUCF 1QA9B 3O4LA 4NGHL 1IAKA 2NX5A 5J57B 4J6IA 4Z76A 2HT4C 2QTEA 3QUMB 4QRUA 2V2WA 1LXMA 1T03L 4NT6B 3TVMC 1CFQA 2Z8VC 3K4ZA 4UQAA 5C2BH 4B3EA 2VLJB 3BQVA 3UC0H 3V10A 1P6FA 3E80A 3EO1B 4AJYV 2APWA 2J6EA 1MELA 2BIOA 3HOGA 3GM0A 2HJLB 3Q8EA 4MS8C 1PY0A 4H1LA 4M8VA 3CX5K 1G9ML 3NJGA 3NQKA 3MOAH 4JR9H 3H53A 1S7VB 1MWOA 4FE9A 3TBCA 1PZSA 3EYSL 2IH3A 2XWTA 3JTSA 3QG7L 4NC2B 5DHEA 2DL9A 4LOEA 3GMMB 1JPTL 1KB9K 2OZ4A 3APNA 2BVQA 3BP4B 1RK1B 4HSCX 1Q94B 5GHWL 5IK3A 2GCYB 2VAJA 3HI5H 3UO8B 3LXCA 3G5ZA 2XPYA 3L3GB 4HMDA 2NCMA 4XO8A 3PWVB 4ES9A 4P5TD 5G5DA 3DX0A 2ENYA 4M5ZL 4Q58C 2WQVA 2IQAA 3H9YA 1CDGA 4LDCA 4APQB 1CVSC 5CSZB 1GIGH 1QO3B 3QI9C 5E8NB 4BH8A 4CKQA 3EBGA 2BP3A 3KBPA 1JV2A 3K8MA 1DEDA 3BH9A 4B3VA 2APBA 4ONFL 4F9PA 1BWWA 5D9SB 4BE5A 4XNXL 4QY8A 2ESVB 5I0YA 4AIZB 3AS3A 3VFRA 3K6IA 1KY6A 3KGTA 3AG1B 3E2HC 1AAJA 3QUXC 2KMWA 4FFTA 1MRFH 1G87A 1SMDA 4WJ5B 2AKRB 4G6AD 3RNKB 1N9PA 2VDMH 4DWHA 1TTRA 4X7TA 1F6FB 5D7JC 1IGTB 1KXTA 2DYSB 4PP2A 4PJXB 3HR5A 3BD4A 2EKJA 4TLSA 3ZRFC 5DC4B 2GAZA 3OXRB 4FNLH 4V33A 3INUL 4BFFA 4DKTA 5E6YA 1FJ1B 2WBJB 4R2GC 2ENJA 2XZAL 5FGBA 4RWYL 3AWGA 1H3PH 4FL4C 4QKTA 1XGRA 4ZNEA 3QZWA 4AMKL 1HIMH 1AKPA 4OVVA 1JMXA 4DEUA 3FJTA 2WTOA 1XCWA 5CLYA 3BUDA 5DLLA 3SDCC 1A9EB 2XZQH 3HS0A 3ZQXA 2GTWB 1L9RA 5IW6B 4MYWB 4U3HA 3OXSB 4LSRL 5C0CE 4ZW7A 4RRPG 1SJVA 1Z9MA 2AK4A 3RHWK 4HF5L 4LOUC 5BRQA 2AI0L 4DW2L 2APVA 4WSKA 2VLKD 4HT1L 4PLKC 3ARFB 1JVKA 2XZAH 3RTQD 1KB5H 3K6OA 3AXIA 4QHPA 2OL3H 1QR4A 3UBXI 1E4KA 1CF1A 2Z34A 3L8QA 2ATAA 5EF1A 4QRTB 1MHCA 3MYZA 4BD4A 1FC1A 4HXBL 5D96B 3RWHA 4PY7A 2YWYA 3I02A 5CLXA 3GGWA 2MCPL 5CBEA 5MI0C 3EH1A 5JOFB 3O45B 5F7DA 2BFGA 1BOYA 4XVTH 1S78D 2VDRL 1VZHA 1DDHA 3FOLA 2OR9H 3DTDA 5G4OA 1RAMA 1WICA 4M3JA 2MCG1 3KLDA 1N5AA 5CSBA 4CKVX 1Z5LA 4XB8A 2XVGA 3QQ9C 4TULH 4LSDA 3DOIA 2NY5L 4Y2DA 4NUGL 2IQ9H 3EYVB 3EH5B 4ZX5A 3MBXL 4Z7UE 3T8XB 3K2UL 3N04A 3VXUB 4TNEA 3KLHC 4IBQA 2FWOA 2G9KA 3BKJL 3GBNH 4JG5A 2ZKWA 4JQIH 4KZEL 4HIHA 4N20A 1I8LA 4B6ZA 4QYOB 3NJHA 1FPTL 4O2CB 1SQ2N 2DYPD 2P5EB 2X0WA 3WXWH 3QS3A 2D03H 4L37A 4P2RA 1T1YB 3H7BA 3ZMEA 5L2KE 2DL2A 4Y1AE 1QAWA 4LLAA 4PG9B 1VA9A 2V7NB 2WXGA 5B21A 5C07A 1S46A 4Q89A 1NOAA 1W91A 1SLVA 1CDJA 1CLZL 3C60D 1ITBB 5SWZB 1BVNP 1IC7L 2CA3A 2WWMD 1IBGH 2I9TB 2G2RB 2CUHA 1R4XA 2NUPB 1OP3K 1IGCH 1BFOB 4QCIB 1MI5A 2QVMA 3L5WB 2XLLA 2LVEA 1I9RL 1S7UA 4WRLA 3QQNA 5C07D 4WNQA 1J1PL 3GXTA 3HIZA 6CGTA 1P7QA 3B8SA 3MV11 5E2VH 5JMOC 3HC4L 1RZGB 1HIML 2HVJB 3ABGA 4HS8H 3MDJA 4AYFB 1HYSD 3LCYA 5T3XD 3HHRB 1P7BA 1JZ3A 4D8PA 2AXGB 3X12A 1DEEB 3O6MH 4M5TA 1AGCA 2NMSA 5IMKB 3EOYG 4MBRA 1YECL 3ECBB 3BEVA 4FFVD 2GJ6A 4NQSB 3OKOA 5DUBA 15C8H 2YXMA 1BV8A 1DN0A 1OPGL 5D93C 5GRYA 2HT2C 2ZOLB 6FABL 1RUKH 4YBHA 2B1OA 1HEZB 1ZV9A 2DRUA 1AE6L 3DV6A 4G8EA 3MFFA 4U1MA 4MCMA 4RNRA 2PMZA 4XWGL 1E42A 3W3BA 3ZUNC 4I85A 1M2VB 1UOKA 4XN8A 4A68A 1TZOA 1U30A 2YPKB 3PP4H 4NN6B 1F13A 2VLJD 4K3EH 2NW3B 4P4RA 32C2B 1ZT7A 1MCJA 1RZFH 3OTTA 2Y7QA 2AS5M 3M8OH 1Q0XL 2CHXA 2BOLA 3NCWA 4ORGA 4NZJA 4TF4A 3WE6B 2UUDH 2W9EH 5GS1A 3HAEA 4I48B 4XI5D 4ZAKD 15C8L 4G8GD 5MEQB 4XMUA 7TAAA 1TQWA 5CILL 1H19A 3AT8A 2WNKA 3X3GL 1JAEA 1VIWA 2BIHA 4UTBA 2C9AA 2VM9A 2BIIA 3UO1L 2APXA 1BD2E 3MXVH 1S7WA 4HXAH 4NQXA 4HPYH 4V1DD 5JIDA 1V7ML 2ZPKH 2JIXA 2R23A 1U95A 2WLLB 4DAGH 4U7MA 4R7NA 3SDXB 4AEHH 1G9MC 4PTTA 1SVZA 1HL5A 4HZAA 4FG4A 4EXKA 1J1XL 3LH2H 4GAFB 3CZSA 1KEGL 3PPEA 3VQ1C 3HVNA 1CBVH 5IHZA 1ACXA 2Y24A 2WN3A 3TFKC 3Q9PA 1XL4A 5HJDA 1QNIA 4OLEA 1NDTA 3SQOL 2VZUA 3PL6B 3WIHH 4C4KT 4G11A 3QEHB 1BYNA 3BAXA 2WXPA 3C60B 1ORSA 3L7EB 2QKIB 1F1GA 4HHWA 4P46B 3LXAA 4Q4IA 3BOVA 5B1KA 4FFWC 1PZ5B 3KYKH 3LYRA 2NXZC 5F3BA 3N44F 5EBWB 4PUBH 4OI7A 2CO6A 3II2A 1USQA 3SJVA 1HCYA 5EIVA 1LL1A 4ZDHA 4OM1L 4X80L 2AGJH 2IDUA 4JQIL 4Z6AT 4XPAH 1YEDA 4LCIL 3LPPA 5ICZB 3QCUL 4ZNEE 1NPJA 4OZHB 5A1AA 4WSGA 1XB3A 1N10A 4WO0A 3V9CA 1KBPA 3QB7C 3KW7A 3PHOB 3KLKA 3SYAA 2WBJD 4M3HA 2QPEB 2AK4D 3DX9A 2J71A 2DMGA 1IC7H 3OB0K 2E9WA 2FRGP 3U30B 5DS8B 4YGVA 1CLZH 2E27L 4MLIA 3D85A 2N7AA 1JTPA 3MV7A 3S3JA 2B0SL 4M1GH 1XT5A 3RKDC 4LLWA 4L9LB 5FKPB 1TJHH 1H9DA 1BF8A 4NKQB 1BEYL 3ABKB 2NR6D 3FHEA 1INQA 2AK1L 2LR4A 3JTTA 3BAYA 4UDTB 5AUMA 3FONB 4K23L 3ZGHA 2HUHA 1IAII 4G71B 1NAKH 4YWGL 4F7EB 1X5LA 1E2VA 5I1IL 3T3MF 4DESA 2X87A 4P2AA 1ECYA 1ML0A 1OAUH 3BESR 3STLB 1CDIA 3IDJA 4AJVA 5DCCA 5KUKA 3ARTA 1TU2B 3PHAA 3ARXA 3CSYA 4G9FD 5TQ2L 2AW2A 1DJGA 3QA3B 2Y69B 1WDAA 2J57A 2BSRB 1IGIL 1QI3A 2V5MA 3I9GL 4N24A 5D1XD 3O11B 1JN6B 3UTTA 4MAYD 5JMRA 4QD2E 1JD9A 3OC8A 3PJSB 5GGQH 3UXFA 3FBKA 3VD9A 1M3IA 3EO9H 4UM9D 1Q9KA 1JUFB 5KVFH 1K4DB 2EDRA 9CGTA 2BSED 3IFOB 3RFZB 3QEQD 2EH8H 1QI4A 1XGPA 1QEWB 2XZZA 3MA7B 3FUFA 4OIFA 5FOBB 2YAOA 3VNZA 1JHLL 1ZGLA 2K70A 5GRUH 3PHQA 4F9PC 3CQFA 3JT2A 3X13A 3H42L 3CFCL 2JCCB 4KNTA 5HHOE 5CLZA 1N4XH 4Z77B 4IBUA 2Y5TB 4GMTH 3M17B 4Q8BA 2HMIC 2PYEE 5ACZB 5HDBB 3VO0A 3WUWG 4UTCA 5J9PB 1INDH 4KJWD 4YHLL 1A7RL 1TSRA 5I17B 1RZJL 3X1EA 4PRDA 5F7LB 2EH8L 5T1MA 1LEGB 2KQMA 3ZMNA 4PJAA 1RHFA 5BJTA 2IBBA 2QLYA 1MFCH 1QFWM 4YDMA 1NFDB 3P3RA 2H26B 4TNGA 1W6LA 2NQDA 1VCBC 5FGBC 3O9WB 3SBRA 4U1JB 1MLBB 1G7IA 1GZPB 1SXSA 1T22B 2HKFL 4LCVA 1U8KB 1Z7JA 5CN2A 1JWSA 1MY5A 2CR0A 3FQWB 5HYQB 4GKNA 1ND0B 3FQYA 3JSSA 3VACA 3BIKB 3HS0C 1M9WA 2CH8A 3APDA 2B3RA 3OKKB 4Y1TA 1ESOA 4FHKA 4BGDA 4N8PA 1SOSA 3DJTA 2ZG1A 4LRIC 4ZXBD 3LIZA 2W1NA 3R06A 3D30A 4RCAA 4XP1H 4JKPH 4F8PA 3ESPA 1OWRM 2W59A 5CZXD 2A6KB 3WHXB 1R6VA 4QRPB 4JZNA 4Q2ZA 4NHUA 3CIQA 1UZ6E 3KYMB 3WKQA 1MJ8L 1YA5A 4G6MH 1F4XL 3QHFH 1QYGH 1KGUA 1M7UA 5TE7H 4G7SB 4KXCA 3SJVE 1Z2KA 2MQ0A 4MMZC 5GRUL 4DGVL 3ELAT 2ZP0T 1VSCA 5K1JA 5J6GB 5FO9A 3N40P 3ZRCC 5CJQL 2ZF9A 4NGHH 5IFAL 1F4YL 1M3JA 2WV3A 3NRFA 4KI5F 1TVBA 2IH1A 3CX5J 2P45B 4LLMA 1CI3M 1WISA 5CM1A 4GG8A 2MKWA 3QJHB 3QO1B 4NCC1 3BKYH 2ZX5A 5F9DC 3B2UD 4D0BB 4JG9A 1SNRA 3ML9A 1PQZA 4LL4A 2MTPA 1VF5C 3HS8A 4WHDA 1BREA 1QD0A 3U0WL 2YUZA 3D4CA 3PWUA 2CXKA 3P0YL 1KENL 2BXZA 3RIFK 5I71C 2OQJB 1HXYB 4IRJD 1I8LC 4Y2OA 2QVFB 4KRPB 2OAAA 4QTIH 3T3PE 12E8L 4HKZA 3VXRB 4EN3B 1KN4H 3Q6FA 3NEXA 2DQEH 4ODSH 3IMBA 2UY7A 1RJLB 5DMKB 2NY6D 3BGMA 3EW3B 3FFCE 1H3GA 1ILSA 2YD1A 3NN8A 3GBML 1XBDA 2X4PA 1FFPB 1KC5L 2EC9U 2XXFA 3DXAB 1YNKH 3NFNA 3IT8D 2JKSA 3PWJA 1B4JL 4XX5A 3JWOH 2D7OA 2VLKB 3OHXA 3QBTB 1JWUB 3E8UH 3PV6B 3V8OA 5ADOH 1P5VA 1T7YA 3UZVA 5I66B 2YD8A 1RD6A 2Q86B 3DA0A 1JBJA 2DICA 4LZKA 1B3IA 1XIWA 2Z8WC 2WXJA 4ZS6C 3WY3A 3FQRB 1L9TA 1SOKA 3R7RA 4KAQH 4FNUA 3C5XA 4ACTA 5BCAA 4R5TA 4N9GB 4FI8A 4M6NL 5IKCB 1X6LA 1MEXL 3C6LB 3HE6C 4PJFE 5ETUA 3MV9B 3ZIYA 2SEBA 2PPDA 1UM5H 5BMFH 4ZMVA 5I19L 5FEBA 4IOFD 3WFZA 1U8QB 1C7SA 1GZHA 1QZNA 3PAYA 2R0WL 1G9NC 1PYWA 5GRXG 1MZZA 2FGZA 3CXFA 4GYBA 3TTYA 4HWBL 4F37F 2H32A 4RFEA 1JGDB 1BFSA 1UA3A 3CMOL 4LL9A 5FWQA 5CCKL 3B9EA 1BVOA 1E5ZA 5GS1C 5DMIL 5JOPE 2E56A 2H2PC 4M62H 3WV0A 5IJVB 2EE6A 1R5IA 4NN5B 2AJ3B 1WBZA 2OMUA 3B8YA 4H8WC 3NCFB 1IKFL 1CBJA 3S36L 2VOTA 3HMWH 3H9ZA 1XWVA 3S3PA 2AJSH 3ZX1A 4OVUA 2AQQA 4M61A 4MXQC 4K94L 4PWGA 3D34A 3BHBA 1D9KC 1NGYA 5CHNA 5DSCA 3UBGA 3OZ9H 1M71A 4LOVA 1FDLL 1XH0A 2AEWA 4PJDE 2YXFA 5JDSA 4Z7NB 1GSMA 1PY4A 1H15B 4DTGH 2AV1A 2QDVA 1ZE3C 3B2UC 2MHAA 3IWVA 4C56E 2ZKMX 1OANA 4R4FH 3SDAB 2DYRB 1P1ZA 5IUCA 5LAXA 5EH1A 3TNNA 5D4QA 1E28A 4HOMA 2BS71 4XR8C 1S9KC 4PCKA 2ZJSL 4H44C 3IU3A 2MPVA 3W9DB 4XN5A 2EDWA 4A6YH 3MUJA 1MXDA 4OI9A 2ADGB 2C1OB 2UZXB 1N6UA 2O5XL 4K0OA 4KY2A 4ZAKA 1ZWIA 4KZDH 1NJ9B 3UOAB 2KZWA 5C9JA 4BH7A 1AD0A 4JFDE 3VFUA 3IAGC 4I77L 2DIBA 1CYGA 4CC0A 1YMME 2WZ5A 2Y6TE 2FIRT 4C56D 1AGEA 1HHKA 3VCLA 4JJ5A 5I18H 3CVIH 5AAWA 1S5IH 2HX9A 1JV5B 3CX2A 1LDSA 5GZND 2BW5A 3MJ8A 3RZWA 3D3VD 4UM8A 2NY0B 2AVFA 3VVWA 3IE9A 1E4XH 3OV6A 4BFNA 1L6XA 4J3OG 1QFWH 1R24B 3F6JA 2XVLA 1PDKA 2V37A 2EXWD 2XBTA 3ESVF 1X5IA 1OOAA 1FZOA 2DWEA 3D85D 4AYMC 5J6HB 4JFFD 3T77A 5D2LF 3QUZB 2AK4E 5F1NB 2EDNA 3T0VA 3DHJA 2X4TB 5AL0A 3MJ9L 1RUKL 3GINA 1KT2A 3ESMA 3MJ9H 5B3NA 3LPFA 4IHOA 5TQ0H 4LSVL 4EDWL 1EO8H 4LVNC 3ULVC 4LLVA 3IVKA 2D03L 3DO4A 4TVPE 4Y4KA 2BNQB 1G84A 2BCKA 4FJ6A 1U3JA 5HD8C 4N5ED 1QFWL 2ETWA 1EGJA 3MRQB 5L2KD 2WNGA 3TZVD 4WNSA 1E8ZA 2XZQL 3FB5A 2H3NB 5E95B 1HSAB 1V27A 5FLUA 4JFQB 5EOTA 2Y25A 4EIGB 3REWB 3T0DA 1I8MA 1D7BA 2BCKB 4Y4KB 3ZKND 4LLVB 3IVKB 2O61B 5J13B 4WCYL 2P7TA 2EADA 3T5WA 1IBGL 3H9HA 3BEWB 1XSIA 1QASA 3VGFA 1UASA 5DD3L 1GSKA 1XGQB 1GKEA 1CU4H 4HUUA 4HLZG 2GSGB 3B7UX 2ZQKA 4D9QE 5HYJB 4MZ2A 5DJZA 3QORD 4JDZB 3MVSA 4MXVF 1PX3A 5TH2B 3MODH 5E00A 5C0GA 4LSSH 3HE7B 2O5YH 3LZOA 1UCBL 1NBYB 4JHZA 1WTLA 5F0LB 1QSED 1NTDA 4IRJC 2JF1A 2CKBB 1ZHNB 2JJSA 4Q6IA 5FK9B 2NY6B 5DC0A 3X11A 2B1HL 2CDEA 4LIQE 4NKOA 4XNBA 2PYEA 4DSYA 5AOIA 1A7NL 1NSNL 3QRBA 1NC2B 4UANA 1HKLL 3MLZL 3TH2T 2DTSA 2PWDA 3BH8A 1PAZA 2HAZA 4Y0GA 1C1EL 4L8SC 1RJZA 1FL6B 3SDYH 4R7DB 5L2JA 4PJ5B 5EN2A 5HHXL 3CHPA 2H9GA 1AD0B 1CXIA 2P52A 4X8JA 2ENSA 4HGWB 1PKQB 2BIQA 4KJWC 4G8IB 1OTSC 5D1QE 2ADGA 4Q9RH 4PJXF 1YUKB 5FW6A 2EVGA 4AVKA 4DGIH 5HPMB 3W9DA 1QI5A 1UEYA 4JLRB 3QT2A 1DUZA 4IJ3C 1G5GA 1T7VA 1NLBH 3RZCD 3E7JA 3MV9D 2X38A 4F57L 3CG8A 2OMZB 3AZUA 1XCTA 1FFQA 4H20H 1H15A 2VXQH 4N1CA 4BWTA 5JDSB 4OCRL 3M1OA 2VJXA 2NCEA 2BP0B 4KKLC 1S6NA 1OAZH 5JA9A 1O7VA 1CGSH 5J1SC 1EVUA 3ZL2A 2GEQA 4P3DA 2DJSA 4ZSOE 2EYRA 4UQCA 2Q9OA 4TL4A 1N2RA 5INCA 3S88H 1BJ1J 3MJWA 2WC7A 4PGEA 3WNKA 5E1AB 3ZE2F 5CN3A 1YEIH 5LCVL 1KCWA 4K3JH 3B2XA 1F58H 4MDIB 3KBEA 4K3JL 3IPFA 3WUZA 5IOKA 4Q74A 3GRGA 3A67H 4OU3A 4ZTOL 5D7IF 1SM3L 4J8RA 4MCZB 1W0VA 4P07A 4PRIB 3O8XD 4M4PA 4YX2L 2H32B 4PJHA 4HAKA 3UTOA 1P6AB 1SUHA 3H6AA 3KPSD 3ZKSD 3U2SB 5HHMD 3ZDWA 2CRZA 5E2TH 3ES6A 3NYKA 3FSVA 1MFNA 1F8TL 3IM1A 4P3WA 4TVPL 1WV7T 5AYQA 3NQIA 4OIIH 2ZXQA 1M7IA 4PRNB 1XF5A 1HAWA 1XXFC 4A7GF 3HUJB 3VFMB 3BQUA 1XGUB 3EJYC 3OKMB 4QRRD 4XVOA 5BOJA 4NSKB 1D5MA 1MVUB 4NZ8A 1G9MH 3OKNA 3C6LA 1URLA 4RZCA 2LAAA 4ODWA 3R0NA 1HHHA 3M7FB 3L3DB 3TZVA 4PJFA 4LKCA 4YHNB 1QZ1A 2E7BA 5FHAL 5KVDH 1DE4A 3PWPD 1JP5A 4OZIF 2RMNA 5C07E 1FN4A 2VLME 3QIBA 1QEXA 4UIKL 2XX1A 4I7ZC 5F1OB 2WBWB 1TOXA 2QELA 2A83B 1ZJBA 4K7PH 1DQDH 2VLKA 5FFGA 3ZSTA 2ZAIA 4YSPA 3T2QA 1SBBA 4H5SA 4PRHA 2YEZA 2DLHA 3MNVB 5HGBB 3MCG1 1N0XL 4M7KL 3NFNB 2EDMA 4HVBA 4I13B 4EOWH 2QL1A 1NCJA 2VZTA 3T4AC 3BSZH 1FC2D 2KZKA 2X9YA 3DGDA 4HIJB 1F00I 5C7XH 2HYMA 1AIFB 3MXWL 3QJQB 5FC9A 3BPNC 4ZMXA 3SD2A 3WMPA 1OTSD 4ODBD 1BOGA 4IEFB 4GQ9L 2XV3A 1BIHA 1HXYA 1XMEB 2IH8A 3CFQA 2X0UA 4CBZA 1I1RA 4Y19B 1EANA 2FJUB 5TF1L 3P3SA 3RWIB 2PP9A 1CU4L 3WD5H 2ZICA 1SXNA 3DSFL 3FU5A 4KXZI 3ULVE 1LO4L 4GG8B 2XWJA 3RE0A 3EOBA 2F8IA 3ZKXB 1WC7A 1FO0H 2P24A 1CFTB 1CGVA 4I0PA 2V5RA 1Y18B 4N2MA 2XYBA 1QLEB 4G2AA 3DURB 5GSVA 4K94H 4LIQH 3TA3B 1F2QA 4UTBL 3ARDB 4PR5B 2D2OA 4WUUE 4IU3A 4OH2A 4KNQA 4R3SA 1U4EA 3CTTA 1MFCL 3J07A 1EEZA 1GGCL 4NBYB 2VMFA 3CQPA 4Z7QE 5T3ZE 5TQ0L 3DJZA 3L9RA 3I2CL 2UWEF 2L7JA 3C2AH 2OL3L 3RU8H 2VLJE 2CWRA 4XPBH 5KJ4A 2NYKA 3FCUB 4RMUA 3H0TB 1KGWA 2NY1B 3IJ7A 3BIKA 4G1EA 2OLDA 2EIBA 3L95B 1XCQB 4QKXB 5DZLA 1KLGB 4X0KB 1JWSB 1TMCB 5D1XC 5E08H 4EIUA 2VLRE 5ITBL 4KHTL 5JDJA 3LZQA 1DQQB 1T2XA 3P9MA 5KSAC 4MWFA 3P9MB 5ICYB 5BJTB 1OK0A 3CVIL 2GBUA 3OR6A 4P2OB 1LEGA 4FYRA 1I1FB 3AUVA 1J5OL 1OGAD 4M43L 3EG9B 3RDTB 5B4MC 4MKTA 3DRTA 3N9GH 2D7TL 3UACA 4QRSB 2IALA 4Z7UA 4CSPA 2J3SA 2XI9A 5DRWA 3LD8B 2YD4A 2VLLB 1OSZA 1O5DT 5EC2B 1MDAA 3CFDA 3UTTD 3NJLA 3ZR5A 5FM5O 3CDGA 2HPTA 1R47A 3L1OL 2JCCA 4CN1A 4N5UA 1MRFL 3KD4A 1UD2A 1R19A 4ELME 2X4SB 1J05B 4JRYB 4PCYA 1XH2A 4N6RA 5IREA 1XGPB 5IVXB 4HHGA 4JFVA 2YD0A 1NCAH 2ROXA 1EEZB 3DVFA 2EECA 2ED6A 1A4JB 5E24E 2PW2A 1AQMA 1QMUA 2YD2A 2YLKA 3FCBA 3BMVA 2D4DA 4P59H 1K3ZA 3R8QA 12E8H 4X9BA 4Z7QF 5HGAB 1KJ3H 2F54D 1TJIL 1VERA 3GNMH 4Z7OF 5B1CA 4UMSA 2ZSWA 2GPZA 2V5YA 1KYFA 2QGCA 4FCAA 3QJSB 2EVFA 3RILA 1MEXH 3HEIB 1YNTF 1CFTA 5DU7A 4F8TA 4UINL 4P4KB 1W80A 3BGFB 3F05A 3K4AA 4MXWH 5JPNA 1E9QA 3MRPB 1VGEL 3SZ6A 1KYAA 3IDJB 1FQ9C 2JJUA 2W60B 1DVZA 2H6UA 2ZP9A 4FFZA 4MJ5A 4HX1B 3MRFB 2XVBA 3AACA 2J7LA 2L7UA 4OFQA 3FONA 2MOVA 3K6DA 1CIDA 1HE7A 3GZKA 3M1BB 4J4PD 2AXFA 2Z0UA 3ARQA 4JHUA 4TSBH 4ZMNA 2F8XC 2VRAA 1ZK9A 4WW1A 4Y7MA 5EULV 3SE9H 1QOKA 4Q9QL 1E5YA 2EEFA 3D4ZA 4PJ5E 3WNPA 1G1YA 4ZO6A 5MERB 5EC1A 2XUWA 4YGVB 1A14L 3KWTA 2H2PD 1ZXKA 4R97B 2WY3B 4AQ1C 3OKYA 4ZTPH 3NEEA 2ZWZA 3MV7E 1A7QL 2JJSC 3BKML 4S1RH 4G9FE 4PRHB 2WKOA 1QBLL 2RB8A 3ZQ9A 3MRDB 2GY5A 3BP6B 1RU9L 4EAEA 4KZCA 4N9OB 4PJ8A 4OZHA 5ICZA 4TVPD 3HB3D 2O5NA 4FOMA 1E6OH 4MDJB 5FM4A 5D8JL 4NEHB 3RQ3A 2GYSA 4XB7A 2ZYRA 3CH1B 3DSNA 4LGRB 2JTDA 3VWJD 3SSGA 3A6BL 2NW2B 4YEEA 4ZDHB 5GIRB 4XCNB 3U4KA 3TEYA 1A4KB 1JNNH 4EBQL 5JHDD 1KDIA 3GXUB 3ELQA 2R2EA 1TMQA 5GZOA 2DWDA 1SPDA 3V55A 3QNYB 5F3BB 4LKCB 3ZE1E 3L3DA 3TZVB 5AVQB 4CNIA 2OJEB 3MZGB 3NCJH 1NBZA 2AEPH 3ARVA 1ORSB 4XCYB 3RPKA 4DFIA 4OGYL 1VADB 1J0ZA 4HIXH 1YNKL 4I2XA 4YQXL 3CWGA 4F8NA 1T6WA 4LSQH 2J1ZA 3KL5A 1ZXQA 1EFXD 4PN6A 4F7MA 3DOSB 2WZAA 3PNWB 2Y7OA 1BFVH 4KI5E 1NMCC 5GGSY 3QR1A 4FXLA 4U33A 4I3RL 2LABA 3P0VL 4RVBA 3DSFH 1T20A 4WIQA 2R23B 2WLLA 3HLAB 3OAZH 1AD9A 2O6EA 1UQSA 1AIZA 1QSFD 4ADJA 2CHZA 4HWEH 1NGPH 5LN8A 4EZLA 1W16A 3AS2A 4HYTB 3RWCA 4AQEA 5HPOA 4NIKB 3WY1A 4JM4H 2A3TA 3W9EA 1OW0A 3GSUB 2A77L 4CVXA 4RAUA 1DCEA 2YAMA 4N3TA 2L0DA 3WE6A 5INCB 2XKNB 4APQC 2EYRB 3KM2A 4GQQA 2CGRH 4LESA 5D7LA 3TO4C 4Z3TA 7PCYA 2EVJA 32C2A 3WELA 1JGIA 2OZ4L 2NXYB 2WN2A 3CVHH 3TO4D 2CDGA 4N0CC 1M2VA 2VRQA 5IV2B 3VFSB 1CE6B 1XF2A 1HEZA 4PFEA 4U1MB 1XSJA 1BXAA 3ZQWA 1EHKB 1KIQB 4EI6A 4V1DE 3NIFE 1DN0B 4NPYB 3QC5X 1KG0B 4MCYB 3HMXL 2A38A 3ZTJH 2DM4A 1MG2C 4UTAH 4HC1H 2KHAA 1AGCB 4YHPB 2ZT9C 1XX9C 3FN3A 5IMKA 1IEAA 1NMBL 1OALA 1B0WA 1QWHA 2IWFA 3QFJB 5LGHH 3EYQD 3DETC 5FHAH 3REVB 3TZVC 3GDBA 2FJHB 1K4CB 3GWJA 4G8IA 1HAUA 1ZA3B 3KS0J 4GAJH 5FX3A 3RHWF 3TN0C 3JXAA 1TJHL 3TH3T 1P7QB 2K7PA 5DJ0B 2XFGB 5CINH 1KN2H 2BVUA 4YDLB 1IKOP 5TD4A 3ATEA 4X6EB 4ZBJA 4PJ5A 5EN2B 5JHDB 4R7DA 2H6PB 3Q2CA 4PJ7F 4U1GB 3DLQR 3M7OA 3L5WA 3SGEI 1WH0A 4UQBA 3JUZA 4U1KA 2NUPA 3MBEC 2UXFA 2Z93B 4A67A 2I9TA 3FTVA 3L3KA 3QJTB 4OJEH 3DOHA 2EUXA 2E6PA 5F9OL 2PYEB 4OFIA 5LGJA 3HTLX 3HNTL 1YAIA 3S37H 5DT1H 3WFCL 4HFWB 2E4TA 1A7RH 3KBHE 1FYTB 3V0EA 3HLKA 4ZODA 2L7QA 4PG9A 2J5WA 1AC6A 4XAWL 4OB5L 1CICD 2WLMA 3GSOA 1KXQE 2J72A 5I2IA 4L37B 5CGMA 1N4XL 1WBYB 4PUBL 2W88A 4HIHB 4PI0A 4H2AA 3QEGL 1UKTA 4M6MH 4K5NA 1IBBA 4B9PA 3FN0H 3GC3A 4K9EC 1DVFB 4KDTC 5FA3A 3BEWA 3AVEA 3ZDZB 4Y5XA 2A73B 4RMBA 2AFNA 2F5BL 4MQ7B 3GMOA 3DRQA 4H0HB 4N22A 3RJOA 5B8CC 3M45A 4DVBA 5EOQH 2BPBA 5I8EB 2WTRA 4OCWL 3WL9B 4DP7X 5I75C 1ORQB 2ZAGA 1VFAB 3FL7A 1BQLL 1E4XL 3JYCA 2HMID 4HGKC 1QKZH 4MNGE 4E41A 2G60H 4N2HA 1QFUH 3ZKMC 3P73B 3ZIMA 5CBEB 4FABH 4HUXA 1CURA 2ZKXA 4TULL 2QPUA 3ARWA 3I02B 5LO7A 1TTFA 3JV4B 4BFKA 3L9YA 1ZSDB 4QRTA 5I6PA 5DZVA 3QUGA 2ILLA 1BVKB 3E38A 2GT9A 1IC0A 3IF1B 4XPAL 2OMTB 2Q76A 1IAOA 3L1FA 3UTQB 3GBLA 2WD0A 2E9JA 3Q1SL 4W9EC 1D6VH 5L7XL 5DURB 2GUYA 4E9QA 4U6YA 1BAGA 2OFQA 1UCTA 3QZBA 1E3XA 3C5SA 2CO1A 3KYKL 1MJ7L 1SXZA 4CU7A 4YXLL 4A6YL 4ERSH 4G7YL 4MMZB 1USZA 4URKA 3HI1A 4OKVB 3FTUA 3BMWA 2FWSA 2CA4A 3QJFB 3F83A 4HT1H 1NLBL 4X99B 5IFJB 5BVJB 1WE5A 4YC2B 4M8QB 2EDBA 3A4EA 4YPGB 4G6KL 3TO2A 3T1FA 2WBJA 2N1TE 3CZFB 4N2KA 1FJ1A 1PEZA 2PYED 5AYUL 3UMNA 4GAAA 2GAZB 4BH7B 4JRXD 2FZ3B 4HS8L 4KO9A 2VZ3A 2LVCA 3K72A 1HCFX 1JK8A 2YPVH 2VC2L 5E2VL 3V4