4KOEC

Quinolone(trovafloxacin)-dna cleavage complex of type iv topoisomerase from s. pneumoniae
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
226
structure length
208
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Inhibitor-stabilised cleavage complexes of topoisomerase IIa: structural analysis of drug-dependent inter- and intramolecular interactions
rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna/inhibitor
total genus 54
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4koeC00
3KSBC 3FOFC 2XCQA 3FOEC 3KSAC 4KOEC 1BGWA 2XKJE 4Z4QA 3L4KA 3RAFC 1BJTA 4Z3OA 2RGRA 4G0WA 4G0VA 2XCTB 2XCOA 3RADC 3K9FC 4KPEC 4FM9A 4Z53A 3LTNC 3RAEC 5EIXA 2XKKA 2XCSB 4J3NA 4KPFC 4I3HA 2XCRB 3QX3A 3L4JA 4G0UA
chains in the Genus database with same CATH superfamily
5DFAA 2ZZKA 4YCMA 2CHFA 2NU7A 1CUIA 4ZMBA 4LKRA 3LK6A 2SICE 1KZ7B 4KIFA 2WZDA 3PEYA 1Y1TA 1E3DA 4JVMA 4HNHA 4RA6A 2A67A 4HX5A 4OSOA 1TT7A 4P4NA 1UEJA 4YTEA 3TSAA 3VR4H 1UKYA 2C4MA 3QX8A 2GN4A 4WWHA 1RWXA 4MGEA 1GCAA 1XN1A 5BWBA 4PHHA 1YS7A 3UK1A 1NUSA 3VZRA 5KYVA 4IXDA 4KTVE 1UQUA 5AXAA 3A9TA 4GI3A 4RTPA 1UZNA 3BXFA 4TLBA 3DJYA 4LECA 4C0BA 3K70D 4CMBA 5J5VA 1CHDA 3AOEC 1QHEA 1Z5PA 4TV9B 4WAUA 3IA7A 1SXHA 3G0GA 3L0DA 4BNNA 2VDJA 5DE3A 1A98A 1PJ4A 5K0GA 3MCWA 3NBZC 4I5FA 4CNBA 3VHXA 3FSEA 3NFRA 1VGVA 4NH0A 5EP3A 5A1TA 1OSNA 1S6YA 1R9MA 2AR9A 4ITVA 5JXWA 5CITA 1P1BA 1YMQA 3ZWAA 2BGJA 3IUSA 1LFDB 4LHEA 2I80A 1A2OA 2OCXA 2ZOSA 5KO2A 2E6KA 4M3NA 4JKOA 3GLGA 3V1NA 1EGMB 2H0RA 1TW3A 1JNYA 3J81k 4GLJA 3L7AA 5DZSA 1AXEA 5ALDA 3W6ZA 3PQ7A 4E6EA 2FYTA 1MEOA 2D5LA 4HVTA 3HVUA 1XJ0A 1O94D 1II8A 4Y1FA 3H04A 5IMSA 4QBGB 1LWOA 1EVQA 4QC2A 4EPYA 5NLLA 3TNYA 4RX1A 1N1DA 3OTIA 5BURA 1GTVA 1GGJA 4RO0A 1P81A 2Y1OA 1E6KA 3W0LB 5C7OO 2EIXA 1WUIS 3E9YA 1YV9A 5L4SA 3GLKA 5CCXA 3S55A 3UVEA 3MWEA 4AY3A 1G8FA 3O9MA 4OJMX 5EHQA 3V6LA 2VDRB 3L0BA 2IKQA 3P9KA 2Z3ZA 3SK0A 4WGFA 1R0KA 4XDZA 4JROA 4Y1EA 3I9V1 1S4MA 3UCXA 3ZLTA 2PUVA 2X22A 4AY5A 1E2DA 4TS9A 2OV4A 3V8PA 4BFWA 3KL4A 4CTNA 1GOTA 4TVKA 1K0FA 3DZJA 3E35A 3JTMA 5F78A 3BD8A 1A0OA 2ZSUA 4P5EA 4AP6A 2W42A 4M89A 1UJ5A 5DEOA 1C80A 3Q85A 4DEXA 1NFRA 1NTRA 4MUXA 3QUCA 3HY4A 1GPUA 4MB6A 3PEVA 3B7GA 1HC7A 1XP5A 2NAFA 2Q3MA 3HDJA 1Y1QA 2DY1A 3ONVA 1U8EA 4DLTA 2W0MA 4W5JA 1TLTA 1ACJA 3OZAA 3C3JA 3SMVA 1NG1A 4CBVA 4Z0TA 2VVTA 4GOOD 2Q27A 5B6IA 1ESDA 4D9NA 2BKLA 1CJVC 4OL0A 1WMSA 4YCAA 1TFRA 2QT9A 3DWFA 3PQ6A 3P94A 4E6PA 4ROSA 2R79A 2CL7X 4LRTB 1WU8A 5ECWA 4E88A 2YIVX 3QU5A 3EG5A 1L7OA 4AKGA 4GMGA 2WM3A 1JI3A 2YMPA 2HA6A 3FWNA 4PZEA 1UK6A 2MMGA 1T36B 5DHTA 5FTJA 1GG5A 5ENVA 3SDZA 2DZDA 4M37A 1KDTA 5CM2Z 1SPBS 2QU7A 1N2XA 2QMHA 1RWWA 2HSWA 3O2QB 1QQ7A 4U9HS 2OGWA 2R5FA 3OTQA 3RAGA 4MWDA 5DWQA 4NXMB 4M2LA 2JFVA 1QHYA 1CBUA 2G7MC 2J46A 1DHRA 2QLBA 2PRJA 5IDQA 3VOAA 3ONNA 3ZJYA 3OPYI 2YVKA 2SNIE 3H1AA 4J1TA 1EK2A 1X92A 2GPBA 4LRUA 4RD6A 4M53A 1NL3A 3U4AA 4JJZA 4ZYXA 4FYWA 4JC8A 2PBZA 4Z0HO 3A10A 4ZI7A 4OAQA 1WG8A 4XCXA 5EJGA 1GNQA 2ZYWX 2PJUA 3I9OA 2DULA 3V42A 4QQ8A 2PUCA 2KMLA 5BV8A 1CUZA 2Q4EA 5GVRA 2PTHA 4J0JA 3ECCA 1QUEA 1Z0KA 2RGRA 2ZAOA 1Y9ZA 4KXVA 1FXUA 4GXQA 4GZ6A 3RUPA 4FX2A 1INLA 5JXGA 5DNAA 3I73A 2H9YA 2HSDA 2PD3A 2NO9A 1GCOA 1TYCA 2V3WA 3N39C 1JZQA 3CX6A 1UPTA 4IFBA 3UJPA 1RNLA 4Q3EA 1XZ8A 3ESRA 1J0CA 3AGPA 4CMHA 3H1GA 4F4UA 1P1FA 1OI4A 2VUIB 2J5RA 2Q62A 4YRQA 2E4XA 5DNVA 1IHXA 3I6BA 4DMCA 2G1JA 4WKPA 4ZIRB 2XQIA 4IRXA 4WNAB 1F1JA 1E7YA 2YV3A 1PX0A 3ML1A 4FDUA 3OEED 3PGKA 5ERXA 5AICA 3RNLA 1RRPA 2FEAA 1CJMA 1TPYA 3LUKA 4Q3NA 1OBVA 4MYSA 4TKUA 1K9SA 3ZVMA 3ZDAA 5LN1A 3IVCA 3HVIA 3NJ4A 5KOHB 3K6KA 3L0PA 4IIGA 4NOMA 2QX8A 5JARA 2ECPA 3U4MA 1U2QA 4RBNA 4DC0A 4F5DA 5IZCC 4Z4FA 2H9AA 1I8TA 2I65A 2A0XA 4JT8A 4D4JA 2REQB 4BNVA 3UGJA 1GFSA 3T34A 2ERCA 1XX6A 1UOQA 4YAUA 4BNWA 1I4LD 2TYSB 1T5BA 4E2FA 3VKUA 4EDHA 3ZDDA 4OU4A 1UMBA 4UCXA 1TAGA 4L4XA 2B78A 3GGOA 3FLEA 3UXYA 3ZCTA 1FUYB 5L3QB 2GO7A 2OHFA 1C3OA 4PCVA 4UU1A 3BEDA 4J7XA 1QBKC 5EA2A 3KO8A 1OT5A 1HLPA 4RZXA 3LKBA 2AQHA 1Z4KA 4UBNA 3WKDA 1SZPA 2H6EA 3BMNB 1E9DA 1JQEA 4PO9A 5L3ZA 1F0KA 4D7AA 1UT5A 3D3WB 1PZXA 7YASA 3EPKA 1ILWA 4FVTA 3UH0A 1M7GA 1N9GB 5ARCA 1U8FO 2CVOA 3LBNA 3FWHA 5HDBB 3AHGA 4HAVA 8ATCA 1OBHA 3K32A 1GQQA 2IT1A 3JZIA 3RM3A 3N0RA 5INTA 3N58A 3QOYA 3QX3A 2WSYB 3EZLA 1DAIA 2ZZNA 1WV0A 3FLAA 3HVHA 3ZCUA 4UMFA 2O8EA 1SC9A 4X62B 5PNTA 3G5MA 4JR1A 3VNAA 5JYEA 5MN6A 3U9LA 4G1VA 4HR7A 1LPBB 2ZB2A 1BHJA 1UPFA 3LUFA 1IZ8A 3W5HA 2J5BA 3HH8A 3S1AA 1J7KA 1FJ2A 2PO7A 1AG9A 3E7PA 3I05A 3LQFA 2E55A 4U6SA 4EY5A 3B1WA 3R7SA 5ALQA 1P6QA 2ATVA 2VHQA 4FTWA 5T67A 4NZPA 1U11A 3HP1A 5LQJA 3F6BX 4IINA 4P4UA 5AJHA 1QK5A 2ZE5A 4TL8A 2Z43A 4A1FA 1Y9JA 3GY0A 5LXTF 2E37A 1FP2A 3MSCA 1K7FB 1RAEA 4CMAA 2QOEA 2VJBA 1H0HA 3C5HA 1QE0A 2HIGA 3EEFA 3BMCB 4MW9A 1Z3IX 1WZEA 4OLHA 4LZJA 4S0XA 4I2VA 3V3TA 1OZ0A 2FNAA 3DM9B 5DSXA 2CB9A 3UB2A 3A2KA 4OHFA 1YWGO 5FL7A 5J2TF 1DRKA 3H19A 3OPNA 1X3LA 4CODB 1U02A 2GHQA 4WN3A 3VBEA 3EXFB 2JLQA 4UHBA 2XCTB 1HGXA 1ULAA 2GUGA 2HEIA 2VNAA 4NS1A 4ZQIA 1ID1A 4JLJA 5KTOA 5EHGA 3RS9A 4AXXA 1LLQA 5EMHA 2X8JA 2DFNA 3LRPA 4ER0A 2WZBA 3CE6A 2C7RA 1J0XO 4KE7A 4Q1FA 1WO8A 2VT6A 3CRNA 5JFOA 3B89A 4WLVA 4BFLA 4OHKA 5JAQA 3THRA 5JBQA 2OGUA 2XE8A 3RTGA 5AW6A 3CXUA 5A2GA 1EX7A 4PAMA 4DTIA 1R7RA 4IQ0A 2XE4A 4X8OA 4E7OA 4R1MA 4ZAXA 4EPVA 2MDTA 2MOKA 1FPQA 2WPDA 1U1CA 4JASB 3A9VA 2ZXUA 1XE3A 3CM0A 2Q29A 3EXAA 4IO0A 3WYDA 1EBFA 5B3LA 2BW0A 4Y9SA 4DR1B 2I3ZA 2J9FA 3ANXA 3CJQA 2OXIA 2OBLA 1NVMB 3U7EB 3AHCA 4HGPA 5FH9A 3ZW7A 2R48A 3MTAA 4QBKA 4H1WA 3JARB 4QFBA 1D4FA 1A9QA 2HA5A 3SFZA 1LXCA 5KYUB 5CBPA 2ZR7A 3U17A 3BN3A 1JHYA 3CE9A 4P7BA 1UP6A 1ZESA 1U4OA 1PF7E 4JEUA 4UM8B 1U9JA 2Y3IA 3EHDA 2FMKA 3HMQA 1ZIOA 2ZBFA 3R6TA 4RMNA 4D4KA 4J0GA 4OBWA 4GX1A 4KJXA 4QFMA 4LN1A 4FLFA 5FULA 2XMSA 3MA0A 4RMGA 2PUDA 4BMVA 3QA9A 1OIVA 3ZE2B 4N7RA 1DKUA 3O2JA 4IIHA 1CUHA 1XYYA 2V59A 4JI4B 2BKEA 3BA6A 1FSSA 2BC9A 4L73A 1QR2A 4XUDA 3HXKA 5DB4A 2ZBDA 5A62A 3COJA 3LBHA 2OC4A 1MHPA 1LV8A 3TEFA 1VPEA 3GFVA 4BLVA 3A3YA 3DCNA 3OJWA 3K35A 4NS4A 4RJIA 4B3DA 3DTNA 2WMNB 4X44A 4FGSA 3DZBA 2R8RA 3OD5A 3T1TA 4HXFB 1IM8A 3BXXA 4HS4A 1U04A 3I5MA 5CAEB 1PKEA 1IHYA 4D45A 2BD0A 3EGEA 4W1RA 3GW8A 5U4QA 2B7LA 1G3QA 1P44A 3NEYA 3FNFA 2PQMA 4LJ9A 4J9UE 3H6GA 2EBFX 4BZPA 5L3VA 5IUNC 1H69A 1NR1A 3MMZA 4HZGA 4PX3A 4Q82A 1RM3A 1YBAA 2BKAA 2G40A 2UVQA 3PZBA 4I4CA 4R40A 4WECA 1W49A 1X7GA 4F1JA 4UUAA 4CMEC 2R7AA 1MO5A 3N1UA 1W4BA 3A8TA 2GLUA 3GL9A 4FC7A 1E5XA 5K20A 4KREA 2O07A 1B3BA 3CUVA 5JVDF 1E1LA 2FN7A 2IYRA 4WFKA 3OU7A 1HFKA 2JFOA 4M0PA 1GPMA 2P4EA 2ZPAA 5EP2A 5JV5A 1QYCA 3BJEA 3G85A 1SBIA 4S2UA 4DRZA 3RJ9A 1TUEA 4WBNA 1JQJC 3ZZUA 4UDYX 1W0KA 2QTFA 4MEAA 2CNWA 2HRRA 5FNVB 1LNSA 4XXHA 1DHTA 3ED1A 3N6VA 4G89A 4LZZA 3FYTA 3CGGA 1IJEA 2P9JA 1QP8A 2Z5LA 3HBAA 4MKIA 4MUMA 4J6FA 1CVRA 1JKJA 4PG6A 4ZCPA 3TNLA 4Z49A 5JBIA 2ZZMA 2YXNA 4W8GA 3AI7A 4YJ3F 3W8RA 1PKXA 2PTGA 5COQA 1A8SA 3W5CA 4EG5A 1DWOA 2WUFA 3QI7A 4LJYA 1J8QA 5U4XA 3RC7A 3GZNA 5IYZA 3UEOA 1AC5A 3C3PA 3Q7RA 1T25A 1GLVA 1J5XA 3VI4B 1R9JA 2YIJA 1R5NA 4L74A 3ZI7A 3JD3A 3CIOA 4H6WA 1VG8A 3I01M 5FOWA 4YRAA 5IDVA 1PW5A 3TPCA 1QK3A 2QIPA 2VJCA 4BO7A 5IASA 1V71A 3BQMB 2YZMA 2NZUG 1KYXA 4TKVA 4D74A 2CLOB 3EX7C 3ETGA 2XXAB 1PS8A 3U1BA 1R8QA 2ONYA 3BPSA 3C5CA 3UJDA 1MXHA 1NN3A 2GCIA 3WBKA 1UUFA 4N03A 1MQAA 1P5ZB 1QKKA 3QEMB 1DBWA 2POCA 5FOUA 5I4BA 1EKXA 4XR4A 3LIIA 4EATA 2WDPA 2CHVA 4UNPA 2ECOA 3L7JA 4CG1A 2QN8A 5GINE 3PVCA 1JU9A 5DI9A 1NN1A 3FIUA 3MJFA 1E79A 2B4AA 2DPMA 2PJDA 3DTVB 2QU8A 3R3WA 4V02A 4WRRA 4C4XA 5HNKA 4XB6B 4DA4A 2MWMA 3ZDQA 3HCCA 4JI1B 2QYHA 2OOKA 5CH8A 2WRZA 3VGPA 4O4LA 1DWQA 1Z39A 3D4BA 4PSDA 4YMIA 5HK8A 2YWHA 3RUCA 1PZGA 1V5EA 1S2OA 3GFSA 4JLOA 3AR6A 1M2EA 3SIPA 3WGNA 3TF5A 2A88A 1G2IA 2GBIA 2AFVA 2KI5A 1YDEA 1V3QE 2M1ZA 4GMXA 3VNQA 1YE5A 2OORC 2CLIB 3EZXA 3PYMA 4EH1A 5HRUA 3M6MD 4G1FA 4RJKA 3WWCA 1ZNYA 4RSMA 2O2ZA 4TUYF 3A4TA 1U0OC 1XZBA 4D3SA 3QVSA 3FPJA 2CD7A 4V24A 4DXDA 2WJYA 2GM5A 2PU5A 3GEDA 4G37A 4G5RA 3G0IA 2AG0A 1JMVA 2ORIA 2XZPA 2EIHA 4ZMRA 2HWWA 1Y3DE 4J3FA 1I3OA 5B5SA 2O9JA 3DBIA 4JXZA 4NBLA 3F78A 4KQJA 2IZ5A 4MV3A 3CLTC 4RJJA 4YYZA 4Y0VA 1R0RE 3NNSA 2CLHB 3U7QB 3UAVA 2OAEA 4O8CA 4EI7A 2P9FA 5IJ9B 3GN2A 3KDSE 2CE2X 4EEKA 5F1PA 3TTXA 3T0GA 2QIOA 2Z2ZA 3F46A 2GTPA 3MWLA 2CDBA 4Q66C 5KJCA 1UKVY 2AFHA 5KNBH 1G5QA 4D97A 3VC2A 3LH5A 4OFXA 2AT1A 2G9VA 1Z0ZA 2PG3A 2HYDA 1XTBA 2W6ID 4RU1A 2O2JA 5KCZA 1JL3A 2O5EA 3MK31 4O3FA 2W2NA 3LOQA 3ELYA 1OZHA 1DAGA 4QHTA 1BWQA 3K0HA 5EGSA 5LYYA 4F6CA 2J6BA 2X76A 3ADCA 1ENPA 1VBFA 2IIQA 1PGJA 1ZGHA 4U7PB 4P0TA 3LXMA 4YFYA 4V1CB 1NMQA 1H2BA 2ZSAA 4N39A 4PYQA 4I1VA 5REQA 4G0VA 3ZDBA 1X86B 4ZI5A 2V45A 2WYUA 2QP3A 1RPNA 4Q6WA 1ZBQA 1DXYA 4CEHB 2PYIA 1C50A 5B1DA 3PJEA 4PVCA 1L5SA 1UL1X 2G1KA 2PWBA 2A5YB 3EAFA 3PK0A 1A8QA 1L4UA 5B58T 1Y8QB 1MJGM 2FZVA 4TUYB 4EF4A 1TDJA 3SIRA 3V55A 1Z8DA 4P4TA 2UUCB 4Y30A 2QAIA 1J8VA 1OVGA 1R0BA 2Z8YM 4NONA 5DULA 5ERYA 2JJMA 2HGSA 2GBGA 3EGCA 3DZGA 1II0A 3RJZA 2QL9A 3OLWA 3OU6A 4NYIQ 1T8UA 4JYAB 4HK4A 4AZ3A 4LFAB 5A0TA 3MJRA 1C3EA 1RMTA 2CUTA 2YVLA 3OURA 3RS3A 4I50A 4PR3A 3SYMA 1FRFS 2J87A 1GG9A 4A8HA 3E4CA 4AX8A 1U28A 4EKNB 3R5XA 3L7CA 4OB6A 4IDDA 4ZU1X 1QTNA 3TZHA 5AM2A 2P9ZA 4FHDA 1F51E 3TFWA 1FDUA 4FJ0A 4LY0A 4XTRA 1BKSB 4QM6A 3EAGA 4Q4JA 1DBSA 2O2XA 4MR8A 2J9XB 4QLOA 3UMJA 3JQFC 1X1EA 2VRWA 3EZ7A 5CA0A 5DTIA 2ZIAA 1QNLA 4KQ6A 4R8KA 4MPTA 4R2LA 1K3UB 4D9HA 1YS2X 3TLJA 4MVJI 5EINA 3GRZA 1FL9A 3VV3A 1RI3A 4HSGA 3TIGA 1M75A 5DX0A 2EJUA 1E3WA 3A9SA 3FG9A 2QTTA 4Y1RB 4IGEA 4MR9B 2L2QA 5CW2A 4V0KA 1GCGA 2G8LA 2H65A 5FBHA 4TTSA 1EDEA 2I33A 4BFTA 2WJAA 5IM4A 3GUHA 3ZY3A 5C4MA 3VYUB 5AHRA 1NX6A 2WIJA 1TK2A 3NDPA 3TD6A 3WB1A 2BJVA 4D2IA 4EO9A 1YJBA 4FR5A 1JWLA 4AS3A 4DREA 3DVQX 2RD2A 2R1VA 2FSFA 4GF5A 4ZRMA 3WRXC 1SNYA 4V3CA 1G20B 2EBWA 2OCDA 2XR1A 1SEVA 2VTDA 3OJEA 3IXLA 4FJ1A 4IDNA 1JHRA 1CQJA 2QL5A 4XAQA 5KWEA 1PP4A 3QMVA 2VUTA 4TXNA 1JKIA 1GVNB 4WCFB 3VMMA 3OEYA 4ERXA 2IW3A 3O38A 4PQFA 4DADA 2E9SA 3BJMA 3U4IA 1ZH0A 3TSWA 2I6TA 2WE7A 3DULA 2GN9A 3KZXA 3PR2B 3QH4A 5CK4A 2XQGA 4H6PA 4C9BA 4N5IX 4AI6A 1XZAA 2AUNA 2X9VA 3ROEA 4MV0A 4CLXA 2C7QA 1H42A 1IBCA 3SQLA 2IVFA 2AE1A 2UDPA 3NUQA 4PY2A 3SYTA 4OLFA 1T2FA 2AH5A 3AJEA 4WLOA 4IHAA 2VHVA 2XA9A 4R8SA 1USGA 1LK7A 3LQQA 2Q5OA 2XCRB 1GZ7A 1XFAA 2HBRA 3P2EA 4XD7A 4F5WA 2TMGA 1S9HA 2WKQA 1KO8A 2IFTA 1GL3A 1TQ4A 1ZI9A 1QGUB 2P6OA 3C87A 1ZQ1A 3PXBA 4QGSA 1JE1A 1R4NA 4AJOA 4HX9A 1ZCJA 1JEYA 1J2UA 2J0UA 2PXAA 2YASA 1U8TA 1QO0D 1RMQA 4L7QA 1QGAA 3FAZA 3EVCA 4AUMA 1GG8A 1XLUA 1Z34A 4OU5A 1QBGA 4Q3KA 2AC4A 1S8AA 5K6AC 3GP5A 5BW8A 3R74A 2AZXA 3MTQA 3WDMA 1TVKA 2ZJ6A 4N49A 3G0HA 2X0IA 3UHJA 3TNDA 5LL6P 3EPHA 1P7WA 5CDYA 3KFXA 4OB8A 5SZIA 3S6JA 3VR6D 3MPOA 3PUHA 4EJSC 1OWNA 3KRTA 3WBBA 3U13A 1B6GA 5IAKA 3R6GA 4AMUA 4BVEA 4PONA 4B31A 3ZJVA 2PKWA 4IM7A 1A95A 3K0KA 1EPUA 1Z75A 3EWIA 2XUHA 3IESA 4BV3A 1RWVA 4PTLA 4K0RA 5AFSA 5GIOE 1BD3A 4PG4A 1DMSA 3L4EA 5FTMA 4JL6A 2V7BA 4A3SA 1L3BA 1AKQA 4LBZA 2O2EA 5BN5B 3RV4A 1ADBA 1YDFA 4PZYA 4BNUA 4BU1A 3G7SA 3H3XA 3VU3A 1SVWA 2IXBA 2AX3A 2DPXA 3DEFA 4E51A 1HMPA 2XUKA 4JNKA 4PZAA 4YLGA 3SQNA 1JXOA 4QYTA 3E2MA 3WYNA 4AECA 4HQOA 5BUSA 4ZZ2A 1KQFA 1RHQA 1ZRSA 1QE5A 1NKTA 2AD5A 1G0OA 4UDNA 3EEQA 2YJTD 2UZ0A 3JQ8A 5D3QA 5FF9A 4C7JA 1BCSB 4NCXA 2EWVA 2I7CA 3G7NA 3B12A 4O2RA 2Q2QA 1MX1A 4QFCA 3IGFA 2PZEA 3JU3A 3LKZA 1M0WA 5JATA 4WJLA 3HN7A 2G9ZA 4L5YA 4YGXB 4YAIA 4ZHSA 4UOZA 1MC4A 2FEWB 3EVDA 2OBXA 4CM9D 3KFLA 4AO8A 5A2QA 2PZBA 3DYIA 1U7ZA 2ZI6A 1QXSA 1VE1A 3HBJA 4JI0B 4H3HB 1HLDA 2FRVA 1ONSA 2BFCB 2WUDA 3KYCA 1FK8A 2VZ9A 2XB8A 1BXRA 3LW8A 1Z5UA 3OSUA 4LUCA 4BLSA 4RTSA 1K89A 2O0MA 1AB5A 2ZS9A 3C3DA 4FIZA 4CV1A 2FF7A 2EBUA 3F5MA 5BSVA 3N7AA 5TNXA 4EJFA 3EYWA 3WSWA 4ZCMA 4DDTA 4CIBA 2Q5QA 3DDNA 1JFTA 1TO1E 4EJMA 1XEXB 4YAGA 1IONA 1JT9A 4JBGA 1QGYA 1JAIA 2ZUWA 1T6ZA 1T9GR 2X41A 3UWOA 3VSEA 1HUQA 3QPCA 3Q3IA 3EE6A 4K9QA 1T9ZA 2OOSA 1SC6A 1JLSA 4ND5A 3AHHA 5D84A 3EVZA 3R3SA 4PX2A 3ZLBA 3E3MA 2O1WA 5M04A 4X3OA 3EIWA 1IVSA 3FN4A 4BPBA 4DA9A 5I4CA 2QMEA 1ML3A 5DBGA 1XCPA 5FBRB 1RHRA 4D4HA 1SIUA 2FSGA 2I1QA 1QYWA 2BFEB 3QVKA 2DRIA 4M8KA 4N7JA 1V9SA 4ETMA 2YHIB 3DEJA 1HNXB 2IH4A 5E9AA 3FNHA 3VOBA 1KEEA 4F46A 1OFTA 2O19A 2WT4A 4EEZA 4W1PA 2I71A 2XTZA 1DUVG 4Q9KA 3QBDA 1OAOC 1PQ4A 2B99A 4RLQA 4Q12A 4A27A 4J6EA 4ZT7A 5JCZA 1P9LA 3GGCA 2VZLA 7MHTA 2X42A 2C00A 2YQ5A 3GFQA 4US0R 5HZHA 2K2QB 1JR6A 3ELBA 2X2FA 5FI1B 4AM8A 1ZUNB 2A30A 1JDTA 3P2YA 2EVWX 1UZUA 3OY2A 1Z12A 5KB3A 2R1TB 1W93A 2QLMA 3DEKA 4DIKA 4DDUA 1QP7A 1TIKA 4NAHA 1G4AE 3QXHA 2N1BA 2ZJ2A 4D80A 4DB2A 4PYLA 4C1NA 2J6HA 1YUNA 4E07A 3I42A 5BR8B 2JLRA 721PA 5HZKA 2HHLA 3IDSA 4MTLA 1Q0PA 1PJ8A 2VJNA 2SHKA 4D0RA 5KVCA 5JD5A 3A6PC 3HS3A 1YB2A 1XCJA 2LW7A 5DLQC 5TRTA 4RAQA 1AKMA 4LW8A 2EW2A 3DTVD 4MV6A 5KX5A 3RGGA 1WW8A 3W3AA 1E61A 5DLEA 5JH7B 1UDBA 3R5KA 2I54A 3JX9A 4EFMA 4Q7QA 4UHDA 2I1WA 4CR8A 2ZB4A 1EXMA 1F7UA 2NXJA 2ONKA 2JJ8A 1DTWB 4OJQA 5DM2A 3TLZA 3T4EA 4QL3A 1KZYC 3O4RA 1R8JA 4ZXFA 4LS3A 3LHKA 1Z45A 4CLDA 1FMFA 5CLGA 1JJBA 2ZYSA 4GOLD 3UWKA 1XEWY 1HT2E 3DS8A 1YQDA 4LA4A 4Z0NA 3BULA 5G3YA 4HB0A 5C3MA 2VKTA 5DHSA 1Y80A 4QXQA 4CYMA 4DLXA 5HKAA 1BKDR 2ZYRA 1XMPA 2W2LA 4FU0A 4L6AA 3FKJA 1U2SA 3DA8A 3DXZA 1EI9A 4O4HB 3DZKA 3I83A 3PXCX 4OAPA 4B3GA 3DMGA 1U8AA 4YMTA 1JIVA 2IIPA 4XZ3A 2CXOA 1J6UA 2FEKA 1CF2O 4N12A 4QQNA 4MV7A 2SCUB 1P2SA 4B45A 3DLIA 1WXIA 4M1TA 4I9HA 3LL4A 5AKIA 1AQUA 4EGQA 3C8HA 1R00A 4LZAA 1R18A 2I4LA 2P30A 1YMVA 3RAJA 2OXRA 2A9VA 3WIBA 1G20E 4FB5A 3EEOA 1N0VC 1R6DA 2GHIA 3AUUA 1FFYA 5G1OA 1JTVA 1OFGA 3MAGA 3CLKA 1FNDA 1Z5NA 1W96A 5JWRA 3LLMA 4FMCF 3A0RB 4NPAA 4LF6B 4K5QA 2H08A 3WVNA 1RJ9A 1XWFA 1XJQA 4P54A 2BBOA 1SB9A 4OY3A 3ZD7A 4E70A 1Z5ZA 4HQ6A 1X1SA 3VM6A 1TNDA 3DFZA 4BX0A 1DZ3A 2R11A 2WWWA 3MGBA 5JE8A 3IOEA 5B1HA 3QLJA 3OWXA 1LZLA 5KHAA 1F2UA 1E2HA 1QS0B 3C5VA 3HNOA 4FOPA 4N0PA 3RK0A 4RVSA 2AFIE 3ZZ0A 4RJTA 3VR4D 4EPXA 3TGWA 4EP1A 4JKYA 4DDHA 3OIYA 1VA4A 1BROA 3DWIA 1OBCA 1CERA 4O2BA 1PDWA 4CF3A 5CDUA 2ES4A 4G85A 4CKCB 5J2TA 4QU8A 4JC5A 4OXQA 4FHFA 1CUAA 3PPVA 2I6FA 1KE1A 2UZAA 5M29A 2H48A 2J45A 4ARUA 4FQ7A 2R8XA 3A27A 2EDAA 1KIFA 3EUAA 4XYBA 4JI3B 3D6FA 2V0GA 1KQNA 3I1FA 3G7UA 4RZ2A 4PPFA 5T3UA 1WPGA 3ZE9A 4UULA 4F2GA 2ZPUA 5LQRA 3DONA 1UFOA 5KWJA 1Y1LA 1DPGA 1ZM4A 1EUCA 3OUUA 3HB0A 3PB3A 5DM1A 4BHTA 1T9HA 3IKLA 1G42A 4YIKA 3M7IA 4KSCA 3GLQA 2ZAGA 3ZKWB 5J4LA 4EJ6A 1E3IA 2WQZA 3WBFA 5FAKA 1V5FA 1OAAA 4BO5A 1T24A 3EBLA 5EP1A 5K2OA 4FB4A 4H1HA 4BLPA 4YX9A 3F47A 4AG6A 1BX0A 1AGPA 2NUTB 2QYOA 3K31A 3J7TA 4CM4B 3L7MA 1PJAA 2HRDA 1LK0A 2JEYA 1JZSA 2V0CA 3AX6A 3I58A 5EE0A 3WHLA 2Q3LA 2Z2YA 3QMWA 4QYIB 3K15A 5EE3A 3IODA 1GZ5A 2OMEA 3V4SA 1SCUB 2GLXA 3HADA 3THXA 1BNCA 4H18A 3RSLA 3U9TA 3T5AA 4ARAA 2EXXA 3O73A 2WD8A 4K9SA 1A4XA 3AH8A 2OBYA 3PHCA 3WKAA 5CT9A 1EK0A 4XIGS 1L1RA 1F60A 3MS7A 4OKSA 3O8RA 2OKGA 5E1DA 3TQRA 3ZU3A 1AMOA 3R7AA 1VG0B 2V6JA 3UUWA 4BDTA 2VRCA 3BREA 5KYXA 3VR2A 3HKBA 4E5UA 3SYKA 4FFDA 5HW0A 4BFCA 2H2WA 4MVWA 5EJ2A 3LY9A 4PNZA 1SKBA 5B4VA 5CXQA 4DR5B 4RTJA 3ZVLA 2LCIA 4URFA 5LXTB 4WX2B 3N6XA 3KWLA 3LF1A 3DP9A 3B38A 3JYHA 3P45A 4ES6A 2OHXA 1G66A 3BE5A 4JJ6A 4DIFA 3NI2A 4UCWA 5EIWA 3BDIA 4CUZA 3H0KA 5BMVA 2CHUA 3PXAA 5L7WA 3ZHCA 2X1MA 2PUHA 3OCZA 4YV7A 1QCDA 2UXDB 1Z47A 3QU7A 4JQOA 3BGVA 5ALXA 2C83A 5FYDA 5J1SB 4AKHA 4KODA 2PZ8A 2VP5A 3OTHA 4L2IA 4D79A 1LLUA 1USWA 3IHTA 3ZS8A 4MMYB 4YFVA 1QDUA 2OO5C 3NDIA 3QFTA 4UW9A 1Q83A 4AULA 3ABZA 5EIXA 4XVRA 4R6XA 2IGTA 2PX2A 1F6BA 3EIXA 4EHBA 2RE8A 1NLFA 1Z4LA 1HDCA 3E22A 3W78A 3D8TA 1VG9B 1T4MA 1M0TA 2V65A 3UHOA 3IUQA 3LIPA 2IZ0A 2XDAA 4BOYA 5H5JA 2O8BB 3LX4A 4NP6A 1LC3A 1PZHA 1SZCA 4FS8A 4MQUA 1QTQA 3NP9A 4WNCA 5ALOA 4JQSA 2VJMA 4DV7B 3DT8A 2I22A 4CLRA 3H3FA 3P27A 1W5TA 1AQ6A 4IGKA 1EFRD 4X20B 3RS2A 5TQ0B 4DG5A 1BDHA 1E1CA 1KC1A 1O95C 3EARA 3L0OA 2YXPX 2XY4A 4DGQA 4ETIA 1OFUA 3FM9A 3WGYA 2EGGA 1OIWA 3D2BA 4UVEA 1W25A 5AJWA 3HCWA 1IBKB 3C3YA 3VUFA 1UDRA 3PX2A 1SCNE 4MIKA 3CZPA 2H1FA 1NVVR 1FQKA 2Q5IA 2WNIA 3GDFA 4O2LA 3SE7A 4MIOA 4ZU3A 1ZS9A 5C1OA 5TPWA 1N25A 2YW2A 4AYXA 1FIUA 2VH5R 5HOEA 3UXMA 5BRAA 2UAGA 3DZDA 2Y9PB 1M8PA 4KPYA 2QMUA 1GTL1 2QY6A 2R4UA 1BJKA 1T1IA 3CR7A 2AZTA 2QGZA 5CPFA 1A9TA 3RS0A 1IFXA 1Z6PA 2RI1A 4X6YA 1JILA 4DLLA 1E62A 1O9BA 5KNDD 1A4UA 5BV1A 2O8VA 4WOBA 4DJFC 5B3KA 1XTVA 3G6WA 3S3TA 3VH3A 3FYUB 1Y3IA 1U5BB 2E3JA 2H51A 2NYUA 3GJTA 1G8YA 3KBOA 1YIOA 4P58A 4X84A 3THYA 4C78A 5AXDA 5EIBD 2GA9A 2DJIA 1WZUA 2Q99A 4RVHA 1RS0A 1HFWA 1TL7C 3GBSA 1NBMD 1DX6A 1ZGGA 4JBLA 4QU0A 4RA9B 4TPKA 1TF7A 5BT8A 1G6KA 2FVYA 4P0QB 3TLCA 4XJXA 3WTBA 2FQ1A 1S7GA 3ITDA 3T99A 3JZMA 2HW8A 2R00C 3ZX4A 1J56A 3BICA 5AI5A 5F1YA 2H85A 2LD4A 2W8ZA 4R1TA 2PX4A 2P78A 3K3PA 4BIMA 3KT8A 5EQJB 5F7JA 2JFHA 4HYYA 1P7CA 4TMTA 3ZNOA 4IJUA 1TEXA 2BISA 4EB6A 3MWFA 1E6MA 1Y81A 1WHSB 5J5AA 3ILHA 3MMXA 4P6VF 2YZNA 2G09A 1L5KA 3GLFE 4IXMA 3PJFA 1KDZA 3KAPA 3SJ7A 3I2HA 4DLVA 4Y6RA 1IY1A 1I2DA 2COUA 3L0CA 1FC0A 1RBZA 1VPLA 2QRMA 3G8CA 2CMFA 3IBTA 2JF0A 1VJCA 4TMWA 1OZFA 4UD6A 3OQOA 2CMDA 4G0OA 4ZVOA 4HH0A 2GFQA 1W9MA 1CY2A 3AJ8A 1EHIA 1BMQA 1PG2A 3EDQA 4FFVA 2QSYA 5FPHA 1L7DA 4H4EA 3ZNPA 1I3CA 3P0JA 1KEWA 3SQDA 4C04A 3LUGA 1V4BA 4E32A 1UKAA 4YC7A 3H6KA 4C7OB 4ENWA 1RLOA 1UBHS 5L6MB 3I23A 3NM5A 1KOJA 3MJTA 4PVDA 5CLHA 4ALLA 1Y9DA 4HQ0A 4B82A 5CB4A 2JVJA 1V6CA 2XYVA 3H18A 2IXTA 4P2GA 4Q9DA 1C7QA 3TQIA 2P62A 5H16A 8OHMA 4JT4A 4F9EA 4ZTZB 2Y99A 1E1DA 1TQDA 1GRCA 2I87A 4A8TA 4PSAA 3EVTA 2DWQA 2ZBGA 1YL5A 4R1QA 2KBEA 2XAAA 4V0OA 2HNBA 3R41A 3FMOB 3RBZA 5T4HA 2MINB 5BQ3A 5AJUA 4JX9A 4TQGA 4K8RB 3ZBPA 1O5OA 1NW5A 5A3QA 4UD2A 1UBKS 4DFDA 2UYQA 3JQ9C 1U2RA 5ABPA 3WIVA 1M54A 2RHRA 3QXCA 4RYDA 3UIEA 5BNIA 2OGSA 5TMBA 2R84A 3EGXB 4BQIA 4WUVA 2CVFA 2OO7A 4G1BA 4N1AA 1XNHA 4YB8A 3NHWA 2BV3A 4RQAA 4G25A 4BCCA 4EHIA 4H16A 1P80A 4TL9A 1I7NA 2B9EA 1LDBA 4CMCA 4Y6SA 3BWYA 5LQUA 4C08A 5ICFA 1Z83A 3WJ1A 4A4DA 3GU3A 3ONWA 4M46A 5K8UA 2ZIWB 2O1XA 5IF3A 1OASA 2Y1GA 3IAM6 1NUHA 3NASA 3NRBA 1XVVA 4ZAWA 2NUBA 1DOZA 4M7PA 1S2GA 2XJ4A 1QH9A 3OP1A 5A0VA 3V1UA 2NLOA 3RB8A 4E4TA 1O57A 2Y93A 4UU8A 1FJHA 4ZO4A 4BMOB 1TCBA 1QIGA 1D8TA 2HHJA 4HN9A 5KJ6A 1CUJA 4ZCSA 3BFKA 2QTZA 3IE0A 1UBGA 5FR2A 3TSYA 3G3EA 1ZK3A 5BUQA 3FTEA 1OFVA 2FPSA 5D87A 1K5PA 2HA7A 1BU8A 3ISTA 1ENZA 1T15A 3ET4A 3GFRA 2GVDC 3B7PA 2X5KO 2KS6A 2QTMA 3EXG2 4ZO9A 3TX6A 3O6VA 4JMPA 2G4CA 5EG5A 2OEPA 2X7XA 4ZEOA 2XWBF 5HRAA 3PGXA 3EXIA 4G86A 4C01A 2OYRA 4YP7A 2MJLA 2MT9A 2BHTA 2H4XA 2VF2A 2VEOA 1L7EA 4ETNA 4GM4A 1K2WA 3ULKA 2K2WA 3CYFA 4LDNA 1YNSA 3BYZA 2GXSA 3HB1A 2HI0A 3A4VA 2VPQA 5DTMA 5HJEA 5FTLA 1JKFA 1JDUA 2OBNA 2ZBVA 2CNDA 1JIUA 2J4DA 4KV7A 4MRMB 3NAQA 1IK6A 3V2IA 4C06A 3C7AA 4ETWA 4PC2A 2C5FA 4AAYA 1AKVA 3NHRA 1Z74A 1OA1A 1PEAA 5IKEA 1YB4A 1U98A 2GJ8A 3D6NB 3EFOA 4EY8A 3GYBA 3BF8A 4KGVA 2UYOA 2CBXA 5AVTA 1U7HA 1Z8NA 3ZVRA 4M1YA 2QSUA 3C97A 1CB0A 2P9BA 4U7HA 3ICQB 1NV8A 3EF1A 2A35A 3ORYA 1P1JA 3CWQA 2C7PA 1Z22A 3BL6A 3MWDA 2JK1A 5JIBA 3TCKA 4CUKA 1IPFA 1H22A 3UUEA 4HLQB 1MC1A 1DJMA 5EPEA 3FJOA 1SKYE 2A58A 4HN4B 4N0DA 3RI3A 1PL7A 4Y2TA 4ENUA 2F1RA 1XUOA 4GXNA 2VEDA 4RPCA 3WJAA 1UDWA 1IEQA 2C5LA 1EWQA 2ZI5A 4J7AA 4D57A 3EOZA 3O8OA 2D8AA 4UUPA 2YY7A 4LZWA 1YRBA 1EUDB 1A9XB 1FUUA 3I8XA 5JCJA 2HLNA 4D43A 3HFRA 3AUJB 2OE2A 2C58A 4U02A 2WNHA 1YKSA 3L49A 3D3JA 4A0SA 1GGVA 1ST2A 1WCXA 2D59A 2WHQA 3M6UA 4MW5A 2WFMA 2FGKA 4TTVA 1M66A 5D8DA 2GFHA 3AL2A 4FYYA 3RRBA 2HJGA 1VJ5A 4ZCLA 4BWYA 1E98A 3H8JA 3K0EA 4XOUA 1I1HA 2FR8A 3GP8A 4K6OA 4LCJA 4ZEMA 4TQ9A 3WOVA 5A7FA 2IF2A 4GDFA 1BFDA 5IJZA 2HDHA 2GPAA 2VDWA 2R7NA 3A2LA 3NTUA 4IUDS 3MHTA 4Z4GA 2OM2A 3AVYA 4B0PA 4PHFA 4K87A 1VHJA 1WSAA 1XD2A 2X40A 2E18A 2MU1A 2C2GA 5HE9A 5DMXA 1LV7A 2FKNA 4B83A 2C3OA 4EW1A 5LQMA 4B73A 1XD8A 3OEHA 3Q8XB 2HA2A 1XEWX 2WV9A 1RU3A 3O4HA 3ICPA 3LE8A 1QGDA 4ND7A 4YH1A 1KSGA 3ZHZA 5IABA 2AV6A 5K8JB 1VIDA 4GVXA 3AHEA 2GAOA 3KOOA 1EH5A 4DJDC 4XUGB 4JYCA 1NNEA 3PDIB 3DNFA 2VG8A 5GZ1A 2P5YA 4MCAA 1KK3A 1TGYA 2DFVA 4B9EA 3H9CA 3QEKA 1KBQA 3TKAA 4J0CA 5G3ZA 1M1YA 2IS6A 2UUBB 1PT9A 1IZZA 1O3YA 2HM7A 2IXGA 2BEUA 1G9TA 3QTTA 4BGDA 1RJDA 2XB6A 2UZ1B 3FDIA 1MAAA 2XV1A 4V0RA 4DCVA 5JQGF 3D0QA 3GPLA 3NO4A 4NPHA 3VKFA 3K9FC 2JFQA 3O84A 1PWEA 3KOWA 3UPDA 1E2LA 1Y89A 4YV1A 2FW0A 5FWAA 1WSBA 5L8VA 3ROPA 3BCSA 1E0KA 3EMKA 3NHLA 2Y05A 3KEOA 3FIJA 3ONEA 4UJ3A 5IDYA 5LYJA 4DCUA 2RHWA 3H5RA 3VPCA 4D98A 3D6UA 2GBFA 2PUBA 3UAYA 1W2HA 3MBIA 2WHXA 3WKEA 5BQPA 4D8XA 4I1OA 3PEWA 4J90A 1UEIA 5AKJA 3E1GA 1H6CA 3UYKA 2HGZA 4REQA 3M4ZA 4Z9AA 1RZ3A 2NZ2A 3KC2A 1ADGA 4B1FA 2V7QD 4MAFA 3VNSA 3O8CA 2BCEA 2HBZA 3RRZA 3IAEA 3SHQA 3WHKA 1NU8A 3WK6A 5IK2D 1V5GA 4H4CA 3U9SA 1SXJD 3KB8A 2VHUA 2WMOB 3JQBA 4HTFA 4R6WA 4I81A 1T10A 1UKEA 4LCBA 5IHPA 3LRTA 3LP5A 2XMDA 4JSYA 3WYCA 4J16C 5TPZA 3H1FA 3OEWA 3C8UA 4P9NA 1Z88A 2L69A 1HE2A 3MXTA 2RAFA 3HN6A 1A9ZA 4A7PA 3EZ6A 1W8DA 4RULA 4YAJA 2YBDA 3FDJA 1YRWA 3PC8A 3UAXA 1KYVA 3DB1A 3EXHC 4BMDA 4PLZA 1NRIA 3BDAA 3O03A 5AKEA 5A06A 4WBXC 4MVJM 5BVHA 2LNDA 1L7PA 3NC0C 4UVHA 3T3HA 1RVV1 3SYNA 2WQ6A 1RLMA 2QVYX 3BGDA 1X1CA 2H4FA 3MBOA 1CFJA 3CC8A 4I4LA 5LP6A 2EG9A 5TT1A 4UXHA 4CDGA 5MGBA 4BBJA 4YQFA 7ABPA 1ZUIA 3KSZO 1P2DA 4IDAA 4RYLA 4CM6A 1QRRA 2AB0A 1KKMA 4FW9A 4YP5A 3JATB 1K7XB 1SVNA 5G02A 4OAOA 2Q45A 3ZWNA 4MYUA 3B5JA 2ET6A 1QG0A 4Z4EA 2FPPB 1NUTA 4RKRA 5HGJA 3AXSA 3JPWA 4TSFD 3HEMA 3BWXA 3GUZA 2NZYA 1BU5A 3DZIA 4EVIA 2LUOA 4UEQA 2PLFA 5CW1A 5LQDA 4Q1EA 1PTJC 2ZRNA 2QQ5A 4GZLA 1W5AA 4LHWA 4Q48A 1JMYA 1FNNA 1KDRA 1XVAA 5EQTA 3VX4A 3TRKA 1XOIA 3H4MA 5KNBD 4DDKA 4YI3A 2GSWA 3EVEA 4S05A 3Q6IA 1G8KA 1FVHA 3NHBA 2MCFA 4OXKA 3ZLUA 4E1BA 4MICA 3H05A 1OXTA 3W06A 2ON6A 2GCNA 1MEEA 1QWSA 4MTCA 3EEBA 3RC2A 1H0RA 1M6WA 1U9CA 1B2RA 1X9HA 2WDZA 2VAXA 3QRWA 3QOWA 5EJ8A 3KKZA 3ELUA 5ER9A 1OU0A 5HQ3A 2BKUA 2VYVA 1MP0A 1YK1A 1HT3A 2AJDA 3QLTA 1HOXA 2VRNA 5BWMA 3OKPA 1IPEA 1NLYA 1YZGA 2Q7XA 3DOFA 5ADHA 1HQDA 1MDFA 2WJWA 3PE4A 4FGLA 2ATIA 16PKA 1G1MA 2CJXA 1PG0A 2IITA 5FA5A 4A2QA 2FR0A 3MINA 2JLWA 4X1OA 1Y63A 3X44A 2FDXA 2GH1A 2IQ5A 3DV2A 4D41A 3QEJA 1XZFA 3M33A 3BIXA 3JRXA 2AMLA 2H06A 2VAPA 4LOAA 4HGQA 3TCXB 1A7UA 1W1IA 2P4UA 1B8NA 2XRYA 3CY6A 3B2NA 5AKYA 2A94A 4FJ2A 4Q4AB 4S0ZA 5K3SA 2CNBA 4EGAA 4P92A 1UXJA 3LP8A 3DUFA 4CFSA 4P0PB 4EYEA 2C2WA 2CJWA 5LA6A 4CKEB 1N0IA 2I03A 3W5SA 5TY0A 3OPMA 4HN2A 3E0QA 3HUFA 3OUTA 1RM5A 4RCVA 4ZEWA 3D7NA 3SGLA 1XJWA 1D6MA 3CVVA 1U4SA 1GPWB 4Q4CA 3K92A 4MWGA 2CGEA 3D31A 3GZTB 2ZIUB 3DAFA 2XTNA 2D6FA 1A5TA 4OQEA 1UJ6A 1SAYA 3WGJA 1WW2A 1Z08A 3DBHB 3CQ9A 4QPJC 3TECE 4RF5A 4G5GA 1F2VA 3QVOA 1K27A 1CJCA 1YQEA 3F97A 4J76A 3FDXA 5L95A 4M0MA 4CT0A 1RT9A 1KTIA 4IRMA 1CUFA 1F8XA 1Z18A 2WPNA 3Q2KA 5JDCC 3RIYA 5U1PA 1PYOA 1X7XA 3SEQA 3S2YA 3TTSA 4HUQA 4CL3A 3U56A 1IAQA 3AIIA 1NMXA 3EGDB 2Q8NA 3WGLA 2VDMB 5AHKA 4O4IB 1EJ0A 4UHJA 3VZPA 4IIJB 1Y1SA 1H2WA 2HLDD 3R0VA 3RFFA 1W4LA 4AZVA 1ESMA 3JZFA 3CR3C 2E49A 2JZOA 1YR9A 3WIOA 4C0KA 3OZDA 5FUMA 4YBRA 3T9AA 4MMXB 3NXKA 4DEYA 1E2PA 2JFFA 2OLEA 2I7VA 4LF9B 3V1TC 2Y9MB 4MCJA 4PNEA 3UFXB 1UJMA 2HU5A 4LQLA 5AM4A 5BYBA 1AZLA 1VMAA 2PLAA 2BY4A 2CLEB 1Z4QA 2PZAA 2UV8A 3LUJA 3FA2A 2IYOA 1U3VA 1T9AA 2YRFA 3ETDA 2PA0A 4XVHA 4CEIB 4ABYA 1ODJA 1JDZA 1AGYA 1OZGA 4TTTS 3S5UA 4ML3A 2XITA 3GP3A 5JXHA 4K0KB 4MUIA 2CL0X 2B8WA 2MSEB 1HPLA 4JJ4A 1IJKA 2BFFB 3NBQA 4BNIA 3LGAA 3LV8A 3H1TA 3PXDA 3M6LA 4QPDA 5JWHA 3P0HA 4B8WA 4QPCA 3OY7A 3AEXA 4B2YA 4AY6A 2XCSB 3NTLA 4RHXA 1I3LA 2ODQA 4A2WA 5TGDA 4BO9A 1H85A 1GAJA 2JANA 1XTQA 3IJRA 3QGMA 2CWDA 4BEBA 1NSTA 4I1PA 4MQ5A 1WCIB 1PT8A 3C15C 4U5XA 2WBLC 2NU7B 3KJEA 3QU2A 4IJQA 3W4JA 4BNZA 5DX1A 4LYJA 4C4RA 5IXSA 1T5IA 1L4NA 3ZDFA 4BFUA 3N7UA 1BQ4A 1QAQA 1TEHA 3AB7A 4G97A 2XHEA 3WL5A 4KYIB 4RA6B 4KQ1A 1JHPA 1OV4A 1Z5WA 2CEAA 2Z4TA 3IUYA 4PPNA 1C0PA 2H9IA 3NDRA 4H3KB 4F11A 2V3VA 1NNSA 3T9FA 3EWSA 2BELA 1FBTA 4NU0A 1FLVA 1RBYA 1SUIA 3KZCA 4NTZA 1R5JA 5LNK6 1T4CA 3GLIB 1SBNE 3K05A 2ILTA 4LOJA 2E82A 1LLCA 3CBGA 2B7CA 3ETHA 4NL4H 2XIJA 5AP9A 4QHYA 4B5LA 4CM1A 2C59A 4D1YA 1P5JA 3L18A 2C31A 1WVMA 3W5BA 1CLEA 3WLAA 3I34X 2R47A 3LHFA 1AMNA 1XELA 2CZQA 4JQYA 4CQLA 2Q50A 4L85A 5JMTA 4MQ4A 1X3SA 1RLIA 3TINA 4ARBA 3PUJA 3DKIA 1SKUA 5P8WA 5H68A 5JNRA 2VP3A 1F3OA 2VIIA 4XQ9A 5HM8A 1K08A 1SIBE 1TU0A 2C2BA 1IN4A 3CZ9A 5M34A 4GGMX 1MABB 4RD0A 4LRQA 3GLGB 3ZJUA 1C9EA 1K4YA 3NV9A 4H6XA 3EODA 4I6GA 4Q3CA 2H5IA 3QJYA 2QTLA 1JPVA 4EFKA 2ZRIA 2OFOA 1W8IA 3QSGA 4AZWA 3R09A 3WK7A 4JYPA 1DKLA 1Q5PA 1K92A 2JLSA 3I72A 3LFHA 5B4TA 1IQ0A 1ZEJA 3I3OA 5DBIA 5BUZA 1U1GA 3UANA 3UWDA 4CHTA 5C80A 2J31A 2ZFUA 2ZBUA 2ZJ4A 4HEHA 4Q7LA 5FD8A 3MRXA 1JF8A 1J25A 2XD4A 4YV0A 3NC1C 3TGLA 4Q16A 4GM1A 3CVOA 4U5QA 3GCXA 3IVAA 1SHUX 2A1TS 1ZI6A 2GERA 4Q1BA 1RXWA 1MDBA 3KPYA 5CT6A 3FH0A 3DVRX 3K5HA 4RTMA 5LJLA 2ODNA 3D81A 1BZYA 4BU0A 1MJNA 1SD2A 1D2EA 2BRUA 4E7PA 5ADUS 2Q6IA 3OJCA 2C9YA 2PL3A 3IMGA 1IZ7A 1WM1A 4MQEA 3FUWA 5FLYA 2F67A 2YN4A 1AKNA 3U0VA 2QENA 2VSXA 3A4MA 1PR6A 3KPWA 4HB3A 2BT4A 3QJGA 1EFCA 1MR3F 4KPEC 3BMOA 3LOPA 4WVFA 2BLNA 3JAWA 1UOPA 5COAA 2H1LA 3SBOA 5ITZA 2JD0A 1YS4A 1GUDA 2Q6KA 4PG7A 3PQ2A 4NBTA 3KHKA 2NO6A 3H11A 4IS3A 3KJHA 5JBNA 5JMWA 1BGVA 3SN6A 4DNPA 2HHHB 5A4IS 3VJRA 4OH1A 4LY9A 4PE5B 3B2EA 1DIRA 1T2CA 4OKIA 2X2PA 4F12A 1M76A 1GTSA 3PVSA 3C45A 4JJ7A 3WWEA 3X1KA 1QQ5A 2HF7A 2WYVA 3UBTA 4LOHA 1LPPA 3ENNA 4QFDA 4DUZB 2WWFA 5B37A 4KQWA 3IKVA 1YCFA 2O7VA 3OETA 3FFXA 2FXIA 4BFXA 1HFEL 4ZV7A 4MLCA 1RM0A 3GK3A 3AIOA 1KVQA 4BO2A 3Q5DA 1YFKA 2AOWA 3EASA 3M6AA 1ZOIA 1E89A 2JFYA 3NJ8A 3KQWA 1HTTA 1TI7A 5IHXA 5HJ7A 4Y2RA 4ZVTA 4JI8B 1TMGE 3LYUA 1JR4A 3OEEA 4MS4A 4X1YA 1K6XA 3VO2A 3GFTA 2I7TA 4K6MA 1OQAA 1KAGA 5KNLA 2V9ZA 3CT6A 2F1HA 3U5TA 1ND5A 3M9LA 4TS1A 1E18A 3LQ2A 1LW6E 1DTEA 4LNHA 4TN1A 3BDVA 2JGJA 2R6GA 2AMJA 4P3XA 3EZNA 2ZUBA 3ZGOA 4A0QA 1EZ4A 4IHJB 1FFWA 4F5YA 4NF2A 1P6UA 2JKZA 2JLYA 1FA9A 3HYRA 4AVYA 1K63A 1USIA 3NVMB 1VOTA 2GEVA 3EEIA 2J32A 4HFNA 3WSVA 1BCRB 3MUOA 4M8IA 2Z9CA 4N82A 3VH4A 5DISB 5IJAA 3ZZ1A 1S3FA 2FN9A 4XKJA 3RCBA 3L8FA 4US2R 5DH9A 4PAGA 3E9MA 2QUHA 1QPBA 1SO8A 1YRHA 4BTVA 3DLCA 4CR6A 3SR4A 3CONA 1XF9A 3ZLJA 3LLUA 1P91A 3V5NA 4B3CA 3LLSA 3D2AA 2H2IA 2AJLI 3ENVA 3RSZA 4PC1A 2JGDA 2X4GA 2RCNA 4ON9A 1MT0A 1SVUA 1ZA1A 4TLCA 5EMJA 4RK6A 3PHLA 1E2MA 5DP2A 3DBOB 5EOVA 4OXXA 3RSOA 5KMGB 1OH6A 4WXRA 4KAJA 1VMDA 2CL6X 3GA7A 4KX5A 1N7GA 2QS9A 4L08A 3WNQA 8ADHA 2ZJ0A 4LYDA 4WA7A 1JHDA 3TS1A 1Y6JA 2Q28A 1XTSA 4UMEA 4BFVA 1CIJA 4FGJA 1ZD8A 4Y1GA 4BCDA 3RHTA 3GXOA 4PZ0A 3DMTC 1E4EB 3W2TA 4I1YA 3EIUA 4DLWA 2KWIA 4V03A 4FZ3A 4GNRA 1I2MA 3MOGA 1IWBB 1V8PA 4NCJA 4Q9NA 3GUCA 5B7QA 4U0KA 4CMGA 1DS6A 3FBGA 1Q84A 4NMHA 1ISFA 1VJ0A 2JFWA 1XIVA 3H75A 3HSKA 3LPCA 3OLZA 4UQPA 3A1TA 4EF6A 3OQBA 4P86A 2AOTB 1X7WA 1N2CE 1WX1A 2O7QA 1QYRA 3L2OB 3PZRA 2CYCA 3ESYA 4LI0A 3URMA 1DEHA 4RC9A 2VXYA 3MD0A 3X1JA 2CUZA 1ZDMA 2FPGB 3UBMA 5EVCA 2P79A 4UNNA 5SY4A 1E8DA 2PSDA 4FE3A 5C81A 2O14A 4XASA 4FIDA 1QANA 1A7AA 4Q19A 4XGIA 3B6JA 3T5MA 3OE4A 4R0MA 4DZZA 2QZPA 4UM9B 1D0IA 1BYUA 1MZVA 2JGRA 4P34A 5DN6D 3O1IC 3Q3VA 3KWJA 3QHPA 2C29D 3KAKA 5CA1A 3OQMA 1H5QA 1XHLA 4KXNA 1MIHA 3E9QA 2QBYA 1CYDA 2QSJA 3I2YX 4IDEA 3W6UA 1TO2E 2LWIA 1L5OA 1ECFA 3JVDA 2RB4A 2AOXA 4HDOB 2ODBA 1KZ4A 2VS1A 2VHWA 1L5ZA 3CUUA 4RHUA 1YDHA 2N0SA 2G28A 4AQ7A 5ESXA 1MENA 3D5TA 4TKMA 2PX3A 2VWGA 4JP8A 3NBXX 3NX4A 1T8PA 1Z2OX 1VI2A 3WK9A 4AZ0A 4IEEA 2QPOA 5C8YB 1A5BB 1DNPA 1KMIY 4QYSA 2CZCA 5BP7A 1AS0A 3PUYA 4NHEA 4UEJA 4JL5A 4IICA 2DUWA 2WVGA 3ZDCA 1NI4B 3HB4X 3HDGA 3ER9A 3K4HA 4HGYA 4AMYA 1XJ5A 4RW0A 5JR3A 4Q01A 1R6TA 4FP9A 5GY7A 3AVTA 2Y68A 3SJBA 4IGAA 4BGUA 2ZBEA 3Q8WA 3BTUA 1P72A 4YRZA 1RI1A 2MR5A 4ENQA 3GLGE 4ZAZA 5EWMA 1ICEA 5HZGA 1YAJA 1IEVA 3IP9A 2OYCA 4B3BA 4Z1MD 1BE1A 1PAUA 4KKXB 3W3AH 3L6OO 4B9AA 5EKUA 4EAQA 2RGGA 5IAOA 5B30A 5KDLA 1M1ZA 1QNFA 4CLOB 1V3UA 1HT0A 2WKSA 1EGHA 1FRQA 3H5WA 3NOQA 1VKNA 5LKAA 3KOXA 3L84A 5A3VA 2I66A 4FYPA 1D4AA 1EM6A 4INOA 4WKOA 2WSMA 3TPFA 1DOHA 4XGRA 4V2IA 3TB6A 4EFLA 2QDKA 5JZVA 1XRQA 3R6LA 5BV2P 1UBJS 4Q1AA 2QMYA 4O8ZA 2Z8ZA 2XMRA 1SD5A 3A6ZA 3CPJB 1KVSA 2H4ZA 3TIXB 1TTHA 2V5VA 3DPSA 2LKDA 2W6MA 3PR1A 4N9QA 4WXEA 5CLIA 4D8YA 3UW1A 4DQDA 1QM5A 2PFKA 2C92A 3S2UA 4HC4A 4CKWB 4OCZA 4PR0A 5AVYA 4I3FA 1IHDA 4ILKA 3VSBA 5DGXA 1HE5A 2GYWA 2PH5A 2XOEA 3NHUA 4TV9A 1FRNA 5EUCA 5HJ5A 2YQ4A 1EFTA 1OY1A 4B7ZA 4WBNF 1T6NA 3U4QA 1VI5A 4RF3A 5F3DA 2J9FB 3MAJA 3DZCA 2BLLA 1ZKMA 1G98A 5KJFA 4RY8A 4H27A 1B0UA 1YA4A 3AFGA 3E70C 1Q7GA 3ASZA 4NNPA 3T7DA 1LB1B 1SU4A 4TMYA 2HH9A 5FTWA 2JIMA 1E66A 2RHGB 4C05A 4DRXA 3OQIA 3WAGA 5HF8A 1XTZA 5JS1A 4RH3A 2ZRQA 3LZ6A 5L45A 2X8WA 2FAXA 4GEGA 5E7QA 5IYZF 2OQ2A 1FYVA 2XT0A 2XCIA 4RAOA 2AE2A 4I0WB 4EDFA 3K1ZA 4AO7A 2X14A 3ND8A 4QBTA 1Z7WA 2C7VA 2H4HA 2RGWA 4HMPA 4JLPA 421PA 2RKOA 4C43A 5AVSA 1C81A 3BHMA 2K87A 2AQKA 3QKSB 1HDRA 4Z7JA 2B94A 1ZAKA 4DKJA 1CJBA 3L6RA 2Q5LA 1T1JA 4XFDA 3G9XA 3Q1KA 5DHPA 1P3DA 1BDBA 1JKXA 3ND7A 1VE5A 3I9KA 1A8PA 5KREA 4HRYA 2OBFA 4LC0A 1UBTS 1SVLA 4DQLA 121PA 1Q77A 2IX9A 2CE7A 2BFDA 1L6IA 2PFGA 1ZMBA 3IIIA 4Y6PA 5J40A 3SF0A 1OGIA 1P9WA 2IPNA 2JLBA 1QCCA 4UQOA 3WL8A 1SB8A 3AKEA 3ORSA 4LQCA 1XVUA 3W4KA 3AJRA 2KLHA 3BKXA 1FYWA 4BVGA 2IP1A 4J9VA 1YAHA 3FB4A 4IWYA 3L43A 3FGZA 2G08A 1ADCA 1Y5RA 3WLSA 2D1RA 4IOMA 2YZ2A 4TYMA 1POWA 1YL7A 2VK2A 4O4LF 4X6LA 3F3MA 4JJAA 3HA3A 3IT2A 4MV8A 1M8FA 5D85A 1XXHB 3UGTA 4AZSA 3DBVO 4C4OA 5C7LO 2OZVA 4X97A 1OGYA 3CRVA 5K3BA 4WBNB 3FLBA 3MNFA 2OQIA 1SG9A 1H1LB 4LI3X 5CLFA 2PBRA 2GWHA 2Z4RA 2AX4A 4M8LA 1OV6A 3C6BA 2GN6A 2UVPA 1YOVB 2X23A 3E6AA 4HS9A 1RYMA 3R6WA 5IRCD 1TF5A 1XU4A 3TZCA 3JQ7B 3SX0A 2EKQA 5EFZA 3MEQA 1RXUA 3TZBA 4C1BA 2ZJOA 3TDKA 1MC5A 5EUBA 2J9GA 5AW1A 5IJXA 3CKKA 4OHYA 4RPKA 3IR6A 2X0DA 3Q7EA 1T36A 3HJGA 3GJ5A 5IYZB 2WT9A 1EGQA 1SMKA 3BFPA 1ZLYA 3NPMA 1DT5A 3SYLA 1C3XA 2HU2A 4OHZA 2P6NA 4XWYA 3IDAA 5GPBA 5FPPA 2NPIA 2VJDA 3FGPA 4MRNA 3STVA 2A0YA 4R1OA 1CZKA 1GZDA 2I8LA 4IGFA 4D0LB 3RFVA 3RS8A 4DJ5X 3COZA 4P7GA 3CU5A 3GFBA 5JD6A 3I52A 3D3QA 5DLYA 3G2OA 1PX2A 4ISCA 9ATCA 1XTUA 3IULA 5LUBA 3TIFA 3D3EA 1SQSA 1JTEA 2FFAA 3PHHA 3PNQA 4G8BA 4P3KA 5I8WA 3NTXA 4OH7A 3EGVA 2PRZA 1EESA 2B8TA 3DFUA 1ZA2A 2XQKA 5J3JA 2RIPA 2BI8A 1H9CA 4G67A 1PVOA 2CF5A 1JAZA 2WA2A 3WE7A 3TQSA 1HORA 1GGKA 1SBYA 4OG2A 2R86A 4P4SA 3S7TA 1CUBA 2W6IA 4J1SA 1ONPA 1XHFA 1NASA 1GGHA 1XAGA 2OHOA 3HLYA 4YRKA 1V7PC 1WA5A 2BWJA 1CK4A 2J7PD 2ZRLA 1KFCB 3E9NA 3OCWA 4U00A 4UE6A 4BVKA 4JP1A 2WJHA 1QSGA 1CUCA 4FI3C 5CLLA 1DC7A 4OXYA 2QAJA 1IBLB 1UC8A 1KXJA 1VB3A 2FEPA 1KJNA 2V7PA 1TZCA 1CE8B 3LQKA 4HDRA 1USVA 3RF7A 4ZIRA 3H17A 2ZANA 3EIQA 4LRXA 4RDHA 3MGAA 2J3QA 4YASA 1E0AA 1K5GA 3DOOA 1PJZA 1N6PA 3ESAA 3KQMA 2IA5A 4FYMA 4HJXA 1JTFA 3T3IA 3DL0A 2KBFA 2FFRA 4DN6A 3KQUA 1SCIA 2VK1A 4YP6A 1OWLA 3QLEA 3DE0X 2FWBA 2XQJA 1WDWB 2V6BA 1ZN8A 1NJ1A 2WFAA 4H9GA 4FM9A 5KOHA 5MN4A 4NXNB 1B74A 5KTRA 2UYYA 1OPXA 2BUBA 1HA3A 1U8UA 2FR8C 1H3NA 1G64A 3MCUA 4KLCA 4DXAA 4MGIR 2NZWA 3HI6A 2BGNA 5AOVA 1TQHA 2RG7A 3MT9A 4S24A 3NWBA 2O23A 2G67A 2REQA 3DQZA 4K1XA 4OQ4A 3WLOA 5B2FA 1WCV1 1CUWA 3F1LA 4I50F 2WTXA 3FNEA 4LMBA 5AI8A 3LFUA 1UBNA 2FWMX 5GOZA 1VJ1A 3UMGA 2AIRA 3PR3A 2JW5A 4L50A 3OKCA 1C7JA 1M2NA 3QF4B 4U1RA 3ZD9A 5L3QA 1ZOSA 1T1EA 4L75A 1E5QA 1DEKA 3GEGA 1BAPA 4FHCA 1AE1A 3RRJA 4DY4A 5CA0F 5I9NA 4KR6A 3BMNA 1B4DA 4BB0A 2NVOA 2OAGA 1GDDA 2B0CA 2W4MA 2BPOA 3D3WA 2R96A 4NCIA 1VLQA 2IOYA 3I92A 5A4FS 2XMQA 3UPUA 5CRIA 4E30A 4B4KA 1Q20A 1C7IA 3CZ5A 4ZEVA 4HAXA 4DCTA 1QGOA 3K2EA 4EO7A 2A0FA 3EEYA 4XUCA 5FTKA 4M8SA 2JH3A 3DTTA 3ON5A 4IR7A 3RFXA 5JO0A 1NMEA 4RPIA 5KKNB 2JHCA 1Z25A 1QRDA 3SM3A 5IM4F 2WJ3A 3H2IA 5EUMA 5FJJA 4BBPA 1DWUA 3ICWA 3VR0A 1KU6A 2H92A 1OLUA 1EP1B 4X63A 3BFVA 3WLIA 1P9RA 1P9OA 4BLQA 3VI3B 3TDMA 3AM4A 1XDSA 4F5ZA 3O4JA 4JLNA 4KGXA 4ZYYA 2B98A 1FNSA 2GR9A 3GDOA 3H8WA 4K9DA 1D8AA 1TLLA 5K8TA 5FBQB 2OV3A 1KVRA 4C88A 1ZUD1 2ZW9A 1C4KA 2FP4B 2H5JA 3HZOA 2VPPA 1A04A 1YR1A 2ACWA 2QTWB 2OUKA 3DL4A 1FTSA 3ZWOA 1Z8FA 4LHXA 4X6XA 1YJCA 3BMCA 3T54A 2WWGA 2FMIA 1P77A 3K09C 3EFHA 3L8HA 3OZIA 3VX3A 1GILA 1U0NA 3CZQA 1G2PA 3C5EA 5FYQA 3WX0A 4YXWD 4HRXA 4Y9RA 4CCSA 5JTTA 3NOOA 3PI6A 1XRSB 1YE8A 1IPHA 1PJRA 2GNOA 4JIGA 4JX8A 4YT5A 4BNHA 2X1VA 3EXFA 1I2ZA 2HJWA 2O4CA 3CLUD 2ETXA 4WEQA 4F4JA 3ZVNA 3N05A 4MK4A 1G3MA 4WZBB 4BUZA 3MGKA 1ES9A 2A4MA 5CT5A 2ATCA 3GIWA 1ZM7A 3B1JA 3N8IA 3ORRA 3DTYA 4WIAA 4I1UA 1FSPA 1PQPA 5HIAA 1TZJA 4UM9D 4OK3A 2Y4NA 1Y98A 4LWZA 1CUDA 1XALA 1C5KA 4OQDA 3TTVA 1GKLA 5LKRA 2BONA 1XZQA 4WZAB 3UQYS 1RYHA 3AJDA 3ILVA 1A50B 5CMLA 3PSHA 1QO0A 5D6OA 4A91A 1A8IA 3FRJA 1N5KA 2BM1A 1A5ZA 1Y8RB 1DKMA 1JHVA 1AN0A 2GQ0A 2P35A 2QMOA 4GUDA 2PX8A 4KYVA 4BE9A 3UMYA 2BAGA 2BFPA 1VFPA 1APBA 4JDPA 4XFJA 3SS8A 3ZY4A 1OFUX 1DKRA 5LZ8A 4R5HA 3BRWD 1CKEA 1PV1A 1KYZA 1Q2XA 3KQSA 3NQ41 4KQKA 5AQ1A 1IH8A 1O8BA 1LPMA 2Y1LA 1RKQA 4LJ7A 5TGTA 2VK4A 3GCWA 3H2GA 4MUFA 5B1YA 2E7ZA 3JARA 3VR6A 3H4IA 4C0QC 1M73E 1E92A 2JBHA 2R1VB 1NXPA 3ADOA 3DOUA 1DC4A 5E0KB 5KYUA 4LXGA 1XPOA 1GNSA 1NXWA 2C4WA 4ZCTA 3ER8A 3KEMA 2IYWA 3X43A 3PQDA 2JIRA 1MB3A 3INRA 1PL0A 1VP9A 5C5IA 4F2PA 3V2UA 5I45A 3ADKA 1W6RA 3AZQA 3F3KA 1NW9B 4UEOA 1IZ9A 3SSNA 4ZJUA 1CUSA 5K0FA 2BFBA 2XNKA 3T3DA 1X1TA 2BE7A 4LDQA 3ZD8A 5JMOA 2GVZC 1Z62A 3D6HA 3RABA 1IY2A 2ECKA 2O4UX 2BFNA 2XOKD 3F1KA 5K7SA 5KQSA 1EUYA 1OXUA 1GU7A 3HA7A 1CV2A 2CDNA 3OZ7A 4KO1S 4I9NA 3V8VA 4CE6A 3GNQA 3RIHA 3EXEB 1M33A 3GR6A 3GQVA 2VA8A 1XMIA 1KOFA 4XSHA 1U0JA 9LDTA 1C1YA 5KTPA 1E63A 3HDYA 4D5GA 1VHTA 4Y2YA 5DKFA 5FA8A 3O2NA 2JBAA 5HYVA 4AF7A 4EI2A 4YQZA 4ZT5A 5ITSA 2EX4A 1JP7A 4Q9HA 1JAYA 1FMLA 1F4LA 1JQ3A 1PVVA 4B6QA 4CFYA 5CAEA 5EJEA 1XR3A 5LLTA 4JLVA 3VMFA 2ADOA 3K1JA 2J0UB 3K5PA 3DM5A 5DGHA 3R75A 3RFUA 2R44A 4LQ4A 3SMQA 4CM9A 3UTCA 2FPXA 2INGX 3OMXA 4D25A 1V4NA 3BZBA 3T1HB 5A5FA 1QIIA 3FSGD 1EQUA 3HR7A 4N54A 1W19A 4OHXA 4AF6A 3G1WA 3PCRB 5LZ9A 1CY8A 3I39X 3ZDEA 8ABPA 3GZJA 3JALA 4P32A 3BERA 3N2ZB 4OHVA 3SQOA 5ALVA 3TWOA 4HPJB 1I5OA 2NG1A 3PC3A 5HWSA 2CV1A 2NV6A 3EISA 3MW8A 4QOIA 1VLLA 3GMSA 5CT8A 4CG0A 4D82A 1JH9A 1WLSA 3KZMA 5DHUA 4LFBB 2O8BA 3ROQA 1WEKA 3CRQA 4JBHA 4YCJA 3ZJ4A 1JMKC 3ZTYA 3HRHA 2QM8A 1G291 3QKTA 4PIMA 5B3JA 1NU6A 3EJ6A 1JFFB 3JD4A 5FNVA 4QJBA 3KJXA 4RK7A 1NVBA 3B53X 3KLNA 3LGSA 4PLFA 4ALNA 3WYEA 3N8KA 1XRPA 1BWPA 4P84A 1AK1A 5T5QA 1T0IA 3CV3A 3GQBA 2GTHA 1ODIA 2P4QA 2N47A 3HU3A 4M6WB 1RI2A 2QYSA 3Q9LA 3ZHRA 3HO8A 2GBLA 3Q15C 4AMZA 4BMZA 3J7AC 1NJ2A 1SIWA 5FEUA 5CHEA 3FPLA 3GEMA 2O2YA 4LAFA 5F12A 2G9RA 4ZANA 5ULLA 2IWHA 3VDQA 4AJPA 4C89A 2VT2A 1CJKC 3NETA 4RZUA 3WICA 3COWA 2V7UA 5AVJA 4IY1A 1KJQA 4R1LA 4R1PA 1PNOA 1X15A 1DQPA 2DQ4A 5I5EA 4RVOA 3N07A 2QTHA 1C1DB 1E9FA 1U2EA 1W85B 2JGEA 4ZVLA 1FRVA 2XXAA 3PA6A 1PZMA 1CZOA 1WUHS 1U1EA 1RXEA 3HCPA 2JPDA 3L8CA 2XB4A 2XKJE 4ZQBA 2O7SA 3BBLA 1GSHA 2NO4A 3KYCB 4MS1B 5FOQA 5KX5F 1BXRB 3NYIA 5IN5A 3D2LA 3DNPA 3BJZA 3G8AA 4QPZA 3DUWA 3AUKA 4B3IA 2ZKIA 1J00A 2EKDA 4G0YA 2GXAA 1Q12A 2ZWIA 2NYRA 3DTVA 3GX1A 4ZWNA 4YT2A 4WESB 1B0ZA 1JHXA 4KB5A 1TXGA 2BIFA 2HUPA 4TZKA 2K4MA 3KHTA 1W1WA 3STWA 3H9EO 4Y9TA 4FMDF 3UM9A 5DYNA 1OX4B 1N0UA 3VBCA 2AFHE 1DEOA 3LZDA 4CN8A 3OBIA 3OJLA 3NRJA 4A0FA 3Q87B 4JUIA 2PMKA 3KSAC 2UYHA 3Q6NA 1LY1A 2KM1A 1O94C 2FV8A 5H81A 4I5DA 2OZKA 5JRZA 3BXHA 4QDUA 3COVA 1ZCAA 2Y1DA 1AB6A 5E1MA 1EG2A 1ODKA 1GTZA 1PVDA 2WU1A 3HP4A 3IAXA 1CSEE 1N8NA 1L3CA 3VTAA 7REQB 4P3NA 2HK6A 2ZYTX 1YR6A 4AL4A 5KSWB 3OOWA 5JASA 5IANA 1YQWA 4RQBA 1N9KA 2V96A 3GNTA 5DYIA 4AMGA 2PNJA 2XVMA 4K26A 4QTTB 5DEIA 1FU8A 1T8YA 4BE7B 3KAJA 2QN7A 3AI3A 1X8JA 2XIQA 3AEZA 5DXJA 5KJEA 1CF9A 2RIRA 3SP1A 3TAUA 2VXBA 4NBWA 2QRNA 3N2GB 2FQYA 2ZTLA 1I4DD 1KAOA 1DIOB 3L6BA 4WH0A 3I5XA 1D0VA 4H0NA 1UMKA 5FBVB 5E7JA 3BAFA 3ANNA 3OOSA 2PMEA 3W5VA 1RCUA 2QP9X 1NF2A 3PUZA 4ZVKA 3RODA 5J43A 3AVPA 1ADFA 1CUXA 1X14A 1L4HA 2DSTA 1OYWA 4MQMA 2FE1A 4IOKA 4MWSA 2C7OA 3VYWA 3V8BA 4NKRA 5CURA 1AXRA 4J3NA 2PJRA 2X2OA 4MGKR 2CLKB 4GLBA 1E79D 1F6DA 2WWHA 3BTVA 4QJ5A 4DR2B 3BEOA 3U44B 5IJ0B 2P2YA 4O2BF 5A9RA 1KEZA 4EZIA 1UF9A 4XI9A 1RACA 2FZCA 1CVIA 2HCJB 5AUOB 4F72A 4CEJB 2OSVA 3VR4A 3UXEA 1L5YA 1K8RA 3EQ6A 1N77A 2D5AA 5FQOA 1PSWA 2GBCA 4V1CA 4M7WA 2DHRA 1E2NA 3AV0B 3LY8A 4EYSA 1U8YA 1QMPA 1Z7YA 2Q1TA 2ZIEA 3KOMA 3QW4B 2HY7A 4GYWA 5JLJA 1XKLA 5JNVA 4CEHA 1NHWA 4M9UA 3A4NA 3EAQA 3H99A 4B3RB 3BIOA 3EW9A 1GN8A 2WSLA 3QV1A 3CBQA 4DC1A 4QKQA 3FYHA 2BKXA 3ZEAA 2PMDA 2CJPA 4R54A 4ACAA 2Q0QA 3DT9A 4R2WA 1EVKA 2PXCA 5HE8A 4MI1A 2JFBA 3CNHA 1DJLA 4MYRA 1PBNA 1RWPA 2IHYA 1UBSB 4J7UA 1N3LA 1Z2AA 1PFYA 1I7LA 1KMQA 1AQYA 2CCGA 3KVVA 4MP6A 4PRLA 4BC1A 1DAKA 1CDEA 2I76A 4IP0A 4KH1A 5ALYA 3ZYCA 4F4HA 1KK2A 4ZK2A 2BF7A 3WMXA 1VJRA 2KHZA 2R68A 4MIEA 1WHTB 2FG5A 4UTXA 4YAFA 4GPD1 1RJ9B 4IQFA 4UBLA 1KAHA 4MINA 1NDHA 4RH0A 5IH7A 4Q00A 3DFMA 3B6KA 3Q7SA 3VDRA 5EPOA 2VUHB 1A77A 3GMIA 1NZFA 3W1WA 5IT5A 2NXCA 3HA2A 3JRWA 1MTZA 4L8WB 5KNDH 4KN5A 4MUKA 1E2KA 3TQHA 5MFZA 4LY3A 5JO9A 3MB8A 1N3YA 4X92A 2P65A 3WDLA 3AVWA 5CEEA 4U9UA 2R8OA 4O2BB 1S3IA 3SM9A 4KR2A 4B4UA 1QC5B 2A2ZA 5FOTA 3GCDA 5JHHB 1KTVA 2HOQA 2DUMA 3B3JA 4Y1RA 2H17A 2XADA 4MR9A 4A16A 4BX9A 5BMVF 3Q3GE 5LM3A 4KU4A 5H80A 1HM5A 2E87A 2M6LA 4BVBA 4JYZA 4IKEA 5DK4A 3ZBUA 3L07A 1XO1A 2WF9A 1L4BA 4TMZA 5ITVA 1NHGA 1X8XA 3AR2A 1T1RA 3A1FA 1IOVA 4PQRA 5TMPA 3NAGA 4FDMA 3E05A 2JCVA 3L46A 1Q19A 4MLZA 3IBFA 5FI5A 221PA 2OGTA 2V98A 5JMPA 2CHGA 1H3EA 3WQRA 2IHKA 3OZWA 3MRTA 4FX5A 2GD2A 1KC3A 4JJFA 3RVJA 4Q18A 1VIAA 5HQJA 1G3UA 3JVEA 1C9JA 2CLSA 2FLVA 4L1KA 3LWDA 5DCUA 1GUZA 4PINA 4MIYA 1G5PA 1TKRA 2OECA 5K3AA 2IWRA 3RRYA 3UO8B 3X2SA 4BNXA 1E9EA 2X58A 1OI3A 5JPDA 5LBTA 3C1TA 4OEHA 2QUBA 1SXIA 1CUEA 3BWDD 3OF2A 4QTYA 4PN7A 4DXHA 1E9CA 4UXJA 5T8KC 4ZOQI 1TCCA 4JUAA 1Y4ZA 3A4IA 5I7FA 4HLUA 1JU3A 1G5HA 3HI4A 3IKTA 3AI2A 2R6DA 3PCXA 3PX3A 4YONB 3WZMA 1EXVA 1MO6A 2PKXA 3WFJA 1LTHR 1QGUA 2CUKA 3CN9A 3R76A 2EJBA 1EFRA 2PZFA 5DHQA 4RQUA 5TSDA 3L7LA 4A9AA 3C85A 1GY8A 2D1YA 2ZRPA 4X5OA 3JAMA 4B4VA 3T0IA 3V9PA 4EHFA 3ABIA 4HNGA 4DYDA 1CLUA 3KQTA 4PBSA 1NT4A 5KYXB 3E7XA 3RPEA 4MI3A 1F38A 2QTNA 1WNFA 2P75A 3HCBA 3M89A 3OZEA 3SFTA 1KO5A 1ORVA 1QHHA 1CU1A 3OMLA 4C21A 3QE9Y 1BO6A 1E7RA 2GSDA 4B34A 1QFZA 1KARA 2DH5A 4CTMA 2F1OA 3C7CB 4FD2A 1E9VA 1ZRHA 5HKKD 1NGSA 3M6VA 1NVEA 3Q7PA 3DVAB 4RIHA 1VL5A 4KBYA 3L7NA 5BXYA 5JNTA 4MPRA 2QZZA 3H65A 4DUGD 1CR6A 1O0SA 4HEQA 1JA0A 1USUA 3FOFC 2F7SA 5KNDA 2QN3A 5HQTA 4DV6B 2YCBA 4BO1A 2H8GA 4ENTA 2NTJA 4UZFA 4C5BA 1D4ZA 3EY9A 3BZWA 4DAEA 1NLMA 2ISQA 1E0DA 1TGVA 4MA4A 2JS7A 4YDSA 2IS4A 4L2IB 1FFHA 2P9GA 5BN5A 5HX7A 1MMFB 4LJ6A 4I6EA 4XYMA 3JYPA 3TFOA 1S3SA 1CY1A 6REQA 4GBGA 4BY9E 1YE3A 3KALA 1NBMA 3D8SA 4RWEA 3WMRA 3EQ2A 1B16A 1E8MA 1K8QA 1WZIA 4NJEB 1X7ZB 3JZDA 4PEVA 1HRDA 3GPDG 3WLEA 5K01A 3PTAA 2OLKA 2OSBA 2N46A 5F1KA 1ZWLA 2ASVA 1DBPA 2CNNA 3GRVA 5AW5A 1HL7A 3ZY5A 1VKOA 1T4GA 2Q4BA 2RI0A 3I6MA 3PFBA 2GDZA 4L15A 1AUOA 4LRWA 1Q50A 1G5TA 5T6MA 3KJZA 4COKA 2FY8A 3O94A 3VKGA 2ZETA 4M9XA 3H86A 5ALPA 4L9AA 3O82A 3Q12A 2DWCA 1MRZA 3C6MA 4J2TA 1AO3A 2BFCA 5T7BA 4FR0A 4I5GA 3KYDB 4HVAA 4FGZA 1HQYE 3KQPA 2A0WA 5E4FA 1UOOA 4OMUA 4W4TA 1A76A 1E3TA 1IVNA 2PLWA 3VYVA 3IP3A 2HYIC 2HIMA 4EG7A 4FEEA 3TVDA 4R41A 3VGJA 4BVLA 1P3JA 4ERNA 5FUQA 4E12A 1XEXA 4M1SA 1V26A 3PWZA 3GC6A 5GWXA 5EE1A 4DVJA 4EG1A 5CB4F 4N3AA 1P7VA 2NZVG 1M0SA 2QQGA 4GLFA 2BEJA 4TVBA 2ZSJA 4IX1A 1H6BA 3HSSA 1KYWA 3R5FA 4IO1A 3SVTA 3V00A 3PWKA 5L4NA 3SWWA 1OXSC 2PUFA 1SHTX 2XBUA 4UMVA 4KMSA 3RVSA 2L42A 3CVXA 2PH7A 2V55B 4MNTA 5EXTA 3S2GA 4DR3B 1PHPA 3KQLA 4R8MA 2DLCX 1HE3A 4FOTA 1XDDA 3QW2A 2QL6A 4G0NA 3VO8A 4WK6A 2YHIA 5I9TA 1H8ED 1NYRA 1L5VA 1QH0A 1SEPA 2F6RA 3M4NA 5EZQA 3E48A 1P2UA 3DDZX 1Z8HA 3K0FB 4J03A 1D2AA 3FHLA 3IUJA 3OI7A 4R98A 3TUJC 3K0CA 3PUXA 1EVIA 3ZV3A 3LPMA 3QOFA 3GDGA 4J43A 2IZZA 4URUR 3NWOA 1V9CA 2O5CA 4D8TA 1ZUNA 2J30A 4OX9Y 4V1CI 3OM0A 2DMRA 2NSLA 1I36A 2R1TA 1BN6A 1FCJA 2NZ8A 2WP0A 3E2IA 2JAUA 2ZJ7A 3HLKA 4FSXA 4IG4A 3LY7A 4BV2A 3TLEA 4ZICA 4JEIA 3VVCA 2FF5A 2DR3A 2VXOA 4EUSA 2FSSA 4LMAA 3HJAA 3AKZA 4M0FA 2WF7A 1ZHOA 2HCBA 1P2BA 4J29A 1P1IA 2DFLA 3TOZA 1QQAA 4G23A 2HPHA 2LR0A 3H5LA 4HAIA 3R20A 4PSCA 3ZCSA 4LF4B 3T3OA 4Y6LA 3WLRA 4BQSA 1X0VA 4FKMA 4OXRA 4HO1X 4X7MA 2BGMA 2PPLA 1H1DA 4RLFA 4TX1A 4YREA 3U3OA 3TW6A 3VYRB 5JH7A 1PIWA 5G41A 3T7JA 3BE8A 1YNOA 2VWQA 3SZ3A 1DTWA 1K8XB 2C7BA 3PIDA 2POQX 2NNLD 3MPUA 2QQ0A 2XODA 3BFJA 4NFHA 4Q05A 1GARA 4TTRA 4X6UA 5DTRA 4P5DA 1CDOA 3ANMA 5CB4B 3KJNA 1L7BA 1SCDA 1VZ3A 3MTGA 4QUKA 5LIPA 2ZJ3A 3OG9A 2AG1A 1RZVA 1RE0A 3NS7A 5A3RA 3G2KA 5AVVA 1KP2A 3LC0A 3O9VA 4BNKA 1Q0QA 5DYTA 5B2EA 1K7YA 1ZCFA 4PLTA 4O4HA 2B1IA 2Q6LA 3ISVA 4RIEA 1LRJA 1P5HA 2G8NA 1T2NA 3ZUPA 4GBMA 4CN9A 2J59A 3PGMA 2PUWA 3BGSA 1X8KA 3B78A 5C18A 3L6CA 2SCUA 1EDBA 4X85A 4DIEA 1RJGA 3OZVA 1S96A 4XM2A 3AF0A 5EWLB 2RBEA 2P9TA 2OG2A 2X2EA 3P20A 2VN8A 3PF9A 1Q3TA 4N41A 4MYTA 2JZCA 3WMGA 1UKCA 3SHWA 2A7QA