4KOEC

Quinolone(trovafloxacin)-dna cleavage complex of type iv topoisomerase from s. pneumoniae
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
226
structure length
208
Chain Sequence
b'KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKAYAWTDGELEELRKLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
molecule tags Isomerase/dna/inhibitor
source organism Streptococcus pneumoniae
publication title Inhibitor-stabilised cleavage complexes of topoisomerase IIa: structural analysis of drug-dependent inter- and intramolecular interactions
rcsb
total genus 54
structure length 208
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4koeC00
2XCOA 4Z4QA 3L4JA 2XCTB 4Z3OA 3KSBC 2XKJE 1BGWA 3RADC 5EIXA 3FOFC 4Z53A 3QX3A 2XCRB 4KPEC 2XCSB 4J3NA 3FOEC 1BJTA 2XKKA 3RAFC 3KSAC 3K9FC 4G0WA 3LTNC 4FM9A 3RAEC 4KPFC 4I3HA 4G0UA 3L4KA 2RGRA 4G0VA 4KOEC 2XCQA
chains in the Genus database with same CATH superfamily
1E1QA 1U04A 1FQWA 2KMLA 4GX5A 1R5BA 3G6WA 5KJFA 4A5OA 4BO1A 2H65A 3DD1A 4BUCA 3K53A 4OGKA 3ZV3A 4UAUA 5EIBC 2R8YA 1S8AA 5ADWA 3RRYA 1Z4IA 3IOYA 2WIKA 2ODPA 3ZHTA 3D8RA 4IWNA 4P6VF 4OQNA 5AW7A 3FOFC 3OZUA 1J5PA 2H92A 4BFUA 2A0KA 1YHNA 3DWGA 5EE0A 3VUFA 3V9AA 2QD4A 1TLTA 1A97A 4ARAA 4GXRA 1SCBA 1TM5E 1CDDA 3SKXA 5JH7F 4YUZA 1K9VF 3QU5A 2HX1A 2FU5C 3S0JA 5I4BA 4F3CA 3UGJA 4HDSB 3K2EA 1JYFA 1NOIA 3GJ0A 4IQFA 1CUEA 5MGBA 1DDOA 4GP6A 5KAMA 4UCFA 1HSOA 5EHQA 3RPEA 4TZ6A 4EGSA 4UPDA 5DOVA 1F5SA 5LDGA 1YB1A 4KE7A 2IKQA 1RI4A 3L1VA 4UCWA 3WFIA 4AURA 1NVKA 1LTHR 3EC1A 2C1EA 5T5QA 4DLZA 2ZXUA 3HO1A 2I65A 3H5RA 1ZL2A 2YCLA 4YRMA 1ZGZA 4JJFA 3VTKA 5EFZA 1KAQA 2YC4C 1E2KA 4MVJD 4BGVA 5EMHA 2PUTA 2B20A 1USWA 3FXAA 4NYMR 4XOIA 4DV4B 4TYYA 4H4DA 4C0QC 3MTBA 2C2OA 3PQ6A 4TV9F 5EERA 5EZYB 3DD5A 3SHQA 1T2FA 1AGNA 4QARA 1F8GA 2HHLA 3OM0A 4W9RA 4TYNA 4LVOA 3HKBA 5BV7A 3JWIA 1KC1A 3Q2IA 3HU2A 3JPWA 4IDHA 4KQWA 3ZY2A 5B36A 3WKEA 5BXYA 1FFGA 1VCMA 4P5PA 5KQLA 1RQLA 1U2DA 3V1YA 5ICMA 1FBTA 2HD4A 3CKLA 3K5IA 3UATA 4C0JA 3TF5A 1QP7A 3GUCA 3AUTA 4WNCA 1Y3AA 4HTFA 4UCXA 4BBAA 3DE2X 5FOXA 2JJQA 5F77A 4IHAA 2NXNA 2M98A 2X2FA 4BUJA 1UKVY 2YZGA 3MCTA 3RIGA 3WIUA 4M76B 5D86A 4YIHA 3LCMA 4XVUA 1QZ3A 2WF8A 4PPFA 4C9BA 1NDUA 1KYXA 4HHEA 1Z6YA 4RH1A 4B43A 1WHTA 2IY7A 4J03A 3E7PA 1Q0QA 8ADHA 3HXQA 1OZHA 1QHFA 1QQTA 2Q1UA 3NTQA 3QKWA 3UMBA 4FYHA 3I3SR 4UE3S 1AHHA 2ZR0A 7REQB 2AFVA 4N82A 1ZN9A 1JBEA 1FDUA 1WMBA 2P67A 4AWAA 1TMGE 2PAFA 5EIEA 5AKZA 3EISA 1KBQA 3B2EA 4WDRA 3UV3A 2ZG6A 1UFVA 2QMYA 2I2AA 1OBFO 4RZHA 2APJA 3VR2A 3UWSA 1RZRD 4S1NA 5DK6A 5CHEA 5M34A 3WQBA 3TOVA 1RLJA 4L8LA 3NTRA 3HYSA 3UXMA 1JECA 4LI3X 1E79D 4RVGA 2IYLD 4CIBA 1CB0A 2GUWA 1IEVA 3Q9LA 5IHXA 3DUWA 5ED0A 1YB7A 1ODSA 3DA8A 4YGYA 5J5VA 3T9CA 3GRAA 1U9IC 2ODWA 3R77A 3UJNA 2QPOA 4X20A 3GLFE 3FGOA 4IHKA 2VYVD 5HIJA 2ZSAA 1RAGA 4IF4A 3LWNA 4RMIA 4G84A 5CB0A 4P36A 1T15A 3FB4A 5DBGA 3K0SA 1C9NA 3GVXA 1M2HA 1TW3A 2OAGA 3WJ7A 1KJQA 4FMDB 4ZREA 4GXTA 1R0ZA 3AKDA 3N7UA 2BI7A 4KQFA 1DXQA 2J7PA 1DX4A 3KWMA 4WUVA 4UTRA 1P3DA 1L5SA 2OV3A 4MQBA 1A8SA 5TPWA 2LW7A 5DXFA 2H51A 1L5ZA 4OMUA 3L7DA 2X5NA 3NXKA 3RIXA 2BOVA 1YRBA 4XCQA 1I1HA 4ENTA 2IEYA 4RPGA 1XN1A 1THMA 2VL7A 1K8XB 3L8EA 3FHLA 3VI3B 3U44A 1ECCA 1Y3BE 2WP0A 3D64A 3R0VA 1SBTA 1XTTA 3F73A 2C3YA 4QYIB 1EH5A 3ZGVA 5DHSA 3JSXA 3M6FA 2O5RA 3GJRA 1LFDB 1GEGA 4MR7A 4DV3B 1VL2A 3BGWA 2A5GA 4X1OA 3J81k 1EBFA 1WMEA 1Q17A 2VF2A 3R3XA 4Q3DA 2ISSD 4C06A 3SSMA 3U6BA 4C7OB 5DLEA 3CT4A 1M1XB 3PDWA 1CSEE 1ZGAA 3SJUA 3UPDA 2JGDB 3CINA 4DPKA 3AUJB 3IOMA 3AJAA 4M1EA 2F8TA 2YIVX 2ZJZA 4BVEA 2JHGA 2BR3A 4EHJA 1MZVA 4RE6A 4YR7A 3OQOA 2ZRCA 3K9BA 2JIZA 2XLBA 5BR7A 3D3KA 3RAPR 2D06A 2PO7A 3BUSA 2O2SA 4W8GA 3A27A 4AJ4A 4C4ZA 4OYHA 1FK8A 4DV0B 3HU3A 2G1KA 4RLHA 1XD8A 2IE0A 2V59A 4GVPA 4RXMA 3GFQA 4MR9A 4TS4A 2JGFA 4RE5A 2HQBA 3IC5A 3MRVA 5ARBA 1RQ2A 4X60A 5FH9A 4DCTA 5CB4F 3KSDO 2FE1A 1O2DA 4HEHA 4MI1A 4EYKA 5B6JA 4X7MA 1EJBA 2WUGA 5CXXA 5KX5A 4PU0A 4CM4B 3GGCA 3HY3A 3K9CA 4LX8A 3G2IA 3UK1A 1LWOA 1ISGA 1OI3A 1NV9A 1YR3A 1OHHA 3WNZA 4F3RA 3OJWA 1PD1A 3LF2A 1JVSA 4L4UA 4L4SA 3UG6A 2WUWE 3TZKA 3VC7A 8ATCA 5TS2A 1FXSA 5J47A 1QYIA 1RZRA 1P7CA 5IDQA 1ZCAA 5SY9A 5AD1A 2X5KO 3H5TA 4AJLA 3O1IC 3EF3A 1ZM7A 4PLYA 5FUBA 4HG2A 2A78A 1DCKA 4GVXA 2QN7A 3VI4B 3ZBTA 2RHLA 3LGSA 4N39A 5JVDB 3TQQA 4M1YA 3VR5H 4BX2A 1P0QA 5KX5B 1PT9A 1VHJA 2RSLA 1R6UA 5A5GA 2WPNA 5ANRB 1WCWA 3GLGA 5U4QA 4RQBA 2BGWA 3DT8A 4ZGGA 4YY3B 4U0JA 3T1VA 2FSSA 1KMHA 4JBYA 1WDTA 3ASUA 1BMDA 1NVVR 1TNDA 1V11A 2C2HA 1CLUA 1HDRA 2JJ8A 1DJNA 1Z83A 4OSPA 3ZVLA 4E46A 3LQFA 3DONA 3LY8A 2FZ4A 4LYYA 5TT1A 2X58A 3GW8A 2UUAB 1ORVA 1V4VA 2Y1LA 3DL7A 3HWRA 3EGWA 3KHSA 2C0CA 4J9UE 3VHLB 1UDBA 1VL0A 4D9BA 4ML3A 2C7VA 3I2IA 4YI3A 3UA3A 3BZWA 3F46A 1QHHB 1B76A 1B0PA 1RTTA 1ZP6A 3NDPA 4Q66C 1V71A 4U2DA 3A1UA 1P62B 4WD3A 4RV5A 1C4XA 1OF1A 4DS3A 4RC9A 3CLVA 2G06A 4GUAA 4NAHA 1SVUA 5FXMA 1KO7A 2AVNA 5KCMA 1VLMA 3A4LA 3PPIA 4GMHA 5DYNA 4KUHA 3IQDB 3R8XA 3SSOA 1O87A 2C0QA 3A0UA 3D3WB 3ZD9A 1YZGA 1Y4SA 3AO0B 1K4KA 4ND1A 3VPAA 4H9GA 1WW2A 5DTJA 2MSDB 8ABPA 2R6AA 2PRZA 3OM8A 4OLFA 3SJ7A 1ZXXA 3LP8A 4QNNA 1L9XA 1NATA 2P6RA 4N0DA 2ZT5A 5TC4A 1JEDA 4KR3A 5ALIA 4ALNA 3ASYA 3RFTA 3V4OA 4LYGA 4ZZIA 5KWIA 1L5RA 2WMNB 3BXEA 1HY3A 4JEIA 2W83A 1VIDA 4E5PA 3MTAA 4N6NA 4XGNA 3QWFA 3NYWA 3EEFA 3PGKA 5DX0A 3ISVA 1OLOA 4EGCB 3GC6A 5LVAA 3LE8A 4MV8A 5HZGA 4WE3A 3L7NA 4E5NA 2CJFA 2DAPA 3GZ4A 1UPBA 3ASVA 1Y1PA 1WQ1R 5KMGB 4JDPA 1NUQA 2VNIA 4KIFA 3E05A 4XGQA 4L8GA 2NPFA 3RVBA 3DE1X 4YYZA 1V5GA 1QFSA 1VMDA 3IURA 3MCWA 1G19A 2X7JA 3OJLA 3KB1A 2N42A 4MEAA 2QAGC 4PZAA 4RGYA 5T4EA 4F3YA 1X1CA 4GOXA 2QIOA 4FU0A 2C9OA 5DPMA 2VRCD 1SPXA 3TD6A 3WLHA 2GEUA 1Z35A 1ZIOA 2IKSA 1PG2A 2NQTA 4KYVA 5MFPA 1BXGB 5TNXA 5CDFA 4EDFA 3C7AA 4NYIR 1RADA 1D1SA 3FRIA 3GH1A 4TT3D 2B4TO 2OHHA 1C8BA 1VZ3A 3KSUA 1W581 4QA9A 1XVTA 3PYLA 2Z2YA 1V47A 1RWPA 5KTPA 4W7IA 4KPFC 2NO4A 4IXTA 3B38A 5B58T 1HLFA 4KAXA 5DM4A 2I2DA 3PEYA 4LKOA 1UBSB 3MINA 1ZM9A 4A23A 3SHVA 1KMMA 3Q3VA 4R1QA 1UFRA 5LA6F 5HQTA 1D07A 3PHBE 3FPSA 4ILEA 3OEYA 1B74A 4N12A 4QBHA 4YJ2B 3RG8A 3BSFA 5B7GA 3KZVA 4ZO4A 5EP3A 4AU1A 3IERA 2ZREA 3HO6A 5DI9A 3WX0A 3L92A 2JD1A 3H7AA 2VZLA 4QOEA 5EHIA 4KTVE 2HCFA 4AG6A 4G01B 2HFKA 2WT8A 2HIGA 3D7MA 3GXOA 4UJ5A 1PFGA 4URWR 2BFPA 4FYJA 2WM2A 1E94E 4DPLA 1CEEA 2I5PO 1T4CA 1UKEA 2R8ZA 4OO3A 3SDSA 4AS2A 2BJWA 4FZ5A 4N54A 4ZZ2A 5KAPA 1C3LA 2QN1A 2XV1A 3PQCA 1TA9A 1LDEA 4FX5A 4IX1A 4R2HA 5ALOA 5AFSA 1KNQA 3F6RA 5B7QA 3O1LA 4PZPA 1U9JA 2ZJAA 2DHDA 2IH5A 3FW1A 4RK6A 1JIJA 1M2NA 4D97A 3R3YA 1T8PA 3WWDA 2CK3D 1KJZA 2ID8A 3K0FB 4A8PA 1U99A 1VCOA 2L82A 4LCBA 4IG4A 3HRKA 3S3TA 1E9BA 3ZZ1A 4CTNA 1E62A 3BRQA 4QBGB 5CXQA 1OB5A 5IVPA 1H66A 2PPVA 1W2GA 4JELA 3VR3A 4C7BA 1HG0A 2FLKA 1QCYA 1RKQA 1U31A 2PKWA 3MMPA 3O8OA 5B57C 5IWAB 5E6UA 4EL0A 3E6AA 2QF7A 2XVAA 1XEFA 2FSUA 3I1YA 3KQPA 1KEEB 3NW9A 4UAVA 5CT4A 4D6PA 1VKZA 3NHKA 5J4KA 1DC4A 1RQNA 4Z54A 2NZ2A 1ST3A 1A8QA 421PA 4OHVA 4AP5A 1YQTA 3IPYA 4MEJA 2JGRA 3WADA 3UKOA 3RJ5A 5LR6A 4B4DA 1DS6A 4K9KA 3HRHA 2DPXA 3VDXA 4BKPA 4CHGA 3NHSA 5I9IA 5GMOA 5B1SA 4L5JA 1ZC3A 3UOWA 4HDSA 1W47A 2VHQA 2ZI5A 3A36A 1JF8A 3EH2A 4JFAA 5DCWA 4CKBB 5BSFA 3P5SA 1NFRA 5COQA 4DN6A 4R83A 2A5DA 3MS4A 3L1UA 4JT4A 4RHYA 1DXHA 1L4LA 3PQ2A 3E7WA 4YP1A 3L0YA 3L77A 1EA7A 4QG7A 9ABPA 1ADFA 5K8VA 3DVAA 3KB8A 1R4NB 4QQFA 1YQQA 2Q6LA 5AICA 3UFXB 1UXGA 1WL8A 1DQPA 3FROA 2WAAA 2QEQA 2UZAA 4B6SA 4FFLA 3A28A 4Q4JB 5AHOA 4DLRA 4E13A 1G7SA 1HDCA 2JG3A 3HDYA 4TWBA 4XR4A 1FDOA 5CH3A 4OK3A 4CDRA 2ZFUA 5JTTA 1GCOA 5D3MA 5C5EA 1FIUA 1FFEA 3SZGA 5FFMA 1FRFS 2ACKA 3O2NA 1J97A 5HE9A 1LEHA 1HMYA 3H99A 4HLNA 2PL5A 2X9NA 3BGDA 3MS2A 5G41A 1MTOA 2G9NA 1D6MA 1Y6QA 3TR5A 4RFLA 4TSFD 4ZOLF 3TOXA 2XXAB 4ER6A 2MOKA 1CS0B 1GV0A 4CU5A 1VRWA 2RHOA 4TKLA 2PLFA 3LG2A 4UM9B 5EJ5A 2R6DA 4M8NE 1K6EA 4NEHB 1OWNA 1Z4JA 1E2FA 4YAKA 1D8TA 1ORTA 2QRVB 1W5TA 2VAXA 4JJKA 5F5XA 4Z9BA 4UE2A 5FYDA 1JLLA 3NUGA 2ZDHA 1NW9B 1G6HA 3L2OB 3GCXA 3OC0A 1CY6A 1R64A 3RVRA 2UZ3A 1DG9A 1XD2B 4AFNA 1YVRA 4DJEC 1Y80A 1KOFA 1WWKA 2PZMA 1P5FA 2GPWA 2PSSA 1XRPA 2Q4OA 3T5PA 4XEHA 4IS2A 4QGFA 4YDRA 3UGKA 4E5KA 1T3GA 1T5DX 3R3JA 1D1QA 2H6EA 4TLCA 4UJ3A 1N9ZA 2PLNA 3OMWA 3PFNA 4EFNA 3ER9A 3G5AA 1SHJA 1M66A 2KLHA 2X13A 2XPCA 3U5ZB 5CFNA 1BMQA 4N47A 3AEKA 3OBBA 4D82A 4MKRA 4BO9A 3G2JA 3M9LA 1F2TA 4KLAA 1SXHA 1GZDA 3M4JA 4W5WA 2QJTA 2AJLI 2RBKA 1GNTA 2RGUA 2IOYA 3GX1A 3HK2A 4PQEA 1Y1QA 5JCXA 1J07A 1OIXA 2HBYA 4J4BA 2OQIA 5F5NA 1U28C 5IP5A 3CVUA 1I5OA 3AVTA 1BKSB 3H4IA 5REQA 2QGFA 4R71A 4QE3A 1K6XA 2QUHA 2ZPAA 2AFIB 3E82A 3F3KA 1DJMA 1PEYA 3KKZA 3R7DA 3PDUA 4Y1EA 4JR2A 3RRZA 1R8SA 1IB0A 4KI0A 2Q3FA 3GP5A 4DTIA 1AZWA 2QU7A 2O19A 1HC7A 3CLSD 1LBQA 3G2MA 2ANCA 3KCQA 5CPBA 1JWLA 3SJZA 2HLDD 5JSHA 1JG3A 1BFKA 4JSTA 5FV4A 1BH6A 2I76A 4XUGB 2OY0A 2DWCA 3U9TA 4OFBA 5L7TA 3K0KA 2CBZA 4I4TF 2WIJA 1F0PA 1TKCA 3ITEA 1QGYA 2JCBA 3DQZA 2RE8A 3H19A 3HQ4O 3RFXA 1M8PA 3RLFA 5BY2A 2M6KA 4DV7B 4B76A 2LXNA 5THQA 2PGOA 1MQSA 5KTTA 5HXAA 1Q50A 1UJCA 4JLKA 3PE3A 4Q7MB 4C6SA 1UPCA 2J59A 5EHXA 5JXHA 2G88A 1F6BA 3K9HA 1JVNA 4IDBA 2P9TA 2X3UA 2ZIEA 5LP6A 4LF9B 2VUIB 3FTFA 1JB1A 1SJ9A 1PX0A 3SYLA 1GJRA 2W98A 5T57A 3TWOA 1QYCA 1Z6AA 1M6VB 4C7XA 3NJ8A 4CKZA 4KN6A 5LZ8A 1YZYA 1I4TD 1X1DA 1UZMA 1OZFA 1QCDA 2XMBA 3WMFA 2IHNA 4HZUB 3GFOA 3HCAA 2FOIA 4WY5A 4ES6A 4C0BA 1CJTC 3Q87B 2CE7A 2R1VB 4RX1A 2K2QB 4DCJA 4IW3B 1F48A 3I5XA 3FFWA 3COVA 4QELA 4P4GA 3VRHA 4CMGA 4Y2PA 1YZVA 3QUQA 2OGTA 1AX9A 4L76A 3EZ9A 4WVLA 3UMSA 5JMTA 3LF1A 2D1TA 1R0BA 2O54A 3O26A 2QE7A 3TX2A 1HSZA 4PYQA 2R7NA 2PMDA 2QJFA 3GA5A 3LCCA 4BMNA 1NNEA 2WTXA 1XMVA 4AJEA 3PFWO 1H9BA 5EG5A 5FHQA 3E81A 5FEUA 4BO6A 4OKIA 4DEVA 2IEGA 2WKPA 7MDHA 3A58B 5ALYA 2GN2A 1DZ3A 4UE6A 1ZIXA 2RIRA 1MCZA 2Q8PA 1MR3F 1XD9A 1XGKA 1FJGB 5KTOA 3WRYA 1O97C 1P45A 2EFDB 1TCVA 3IQFA 4GZLA 3WGOA 3MWEB 1NBEA 3QELA 2YYSA 5EWLB 2JNWA 4DV2B 1EAYA 1Z6PA 2PXHA 3AC0A 1I2ZA 3C8ZA 4YRCA 5K0BA 3BFKA 5BSHA 3NTOA 2Q0XA 2QL6A 2AX3A 1ZN8A 2Y0BA 3D6NB 3ZNPA 3ZCTA 3LP6A 1BJTA 5HF6A 3ISTA 4W5QA 4DJDC 3CC8A 1X7XB 1EB8A 1XJ5A 5SICE 3SBEA 5ALRA 2FCAA 2XQKA 2O2HA 2ZR9A 3UUEA 4Z7JA 2IS2A 2AG6A 4KVAA 4B8ZA 1UPXA 4HXEB 1U2GC 1Q7CA 4ZVSA 2Y4NA 4YP5A 3AEQA 3I1IA 4GICA 4JITA 3HLYA 1H2XA 5FV7A 4QEKA 1CKEA 3AX6A 4F4UA 5K20A 1X7ZB 3PLRA 2XLCA 4KITB 1XZLA 2BAGA 4JI5B 4AIRA 1EP3B 5EZ6B 2GPJA 3AJEA 1Q1GA 1OX6A 3GA7A 1GLNA 1L4HA 2CXPA 5HE8A 2QM7A 1JX6A 4F0JA 2PZ8A 4WVFA 1LZLA 4Y3UA 5SYAA 1R3DA 3L7OA 4HXFB 1KI6A 5ALEA 1PJLA 2HTFA 2Y93A 3QKSA 3ZI4A 3RVSA 5C8DA 2AZXA 1X2BA 5KHLB 2WZBA 2AWNA 2OR3A 1DTSA 4L4RA 5TLSA 2DSTA 4NYMQ 1H5UA 3QPAA 1M6YA 4AX4A 2FSIA 2OAP1 5IABA 3PJRA 1PZEA 1R5JA 3DOFA 3RAJA 3U7IA 1AV6A 2REBA 3LSTA 4D46A 1BU5A 3RKSA 4Q3BA 3VH2A 3T3EA 1TZKA 4BQSA 2WG0A 3BTVA 4FYMA 3KELA 2HZBA 1HEYA 3QIVA 4REQA 5DEIA 1SUFA 3BORA 2WICA 4JX9A 2CXRA 4OHOA 4AJKA 3K9GA 1C9YA 2E0IA 1ESDA 2WTAA 3JR3A 4X7PA 3PNMA 4XIYA 3PR3A 3I6QA 1WD7A 3GGJA 3K31A 5I51A 5A9SA 3L0DA 1QVRA 4CV2A 3PHJA 2Y4OA 1CZHA 4DIEA 4WBNF 4YV0A 4Q39A 4IMRA 1MPTA 4IXDA 3FUXA 5ILGA 5TQ0B 2OECA 1G7RA 4BRUA 4HPXB 4A4DA 2H63A 2CUZA 3U39A 3FOWA 4ZOEA 4QVIA 2XAUA 1AK2A 1D1PA 3KC2A 3UW3A 3HR8A 3ZEIA 2EL9A 4PAGA 4UMEA 1TQDA 3GDWA 4ZAXA 1SXJB 3KFXA 3ZQUA 1I01A 2IK8A 4F2WA 2W43A 5JS2A 1PGNA 2VK8A 3I4FA 4FJ0A 1EDBA 1TKAA 1UT6A 4HYQA 4IDAA 2IGBA 3B6ZA 5ALVA 4ZVLA 3D4PA 2QP4A 4LJKA 3EIUA 4ABTA 2IHYA 3Q8MA 4ZVQA 3T4EA 3Q10A 1VA5A 1VIAA 3N53A 3GHHA 4RWEA 2P0EA 5LDDC 4HZIA 4M37A 4DIDA 3W2GA 3I34X 5BW6B 1YI0A 2AR0A 1G8PA 3BF7A 1E1NA 1RQGA 4HRYA 2P7IA 4FE3A 4KUEA 2R5WA 3HXKA 5JDIC 5DXJA 2X5XA 4FMBB 5FPTA 3X2SA 1WUIS 3A04A 1K6JA 3GFBA 2MSCB 4Z4QA 1E9CA 2O8BB 1VJGA 2I4OA 3LY7A 4K6KA 521PA 3W6UA 2W6ZA 1HOTA 1KEUA 2Z6VA 3DBVO 1L0BA 4X45A 3WHIA 4CDMA 3OQIB 4KTTE 1PUJA 3L79A 1V7ZA 2AZMA 3JV7A 5IKMA 4O1HA 1BU8A 1CR4A 2MTBA 2OZPA 3W2FA 5EJ2A 5E4FA 1C1XA 3HNOA 4M1KA 2AGVA 2YUTA 4J6EA 4RKEA 3OFKA 1P0MA 4KIGA 4BX3A 3NC1C 2R44A 3HKEA 5JCZA 1IHPA 1CEYA 2G71A 1LQUA 2VJKA 3UC9A 4EKIA 4UOZA 1ZU5A 1Z12A 5EZYF 4TV9B 4GE0A 3RUAA 2C3PA 5AVSA 5HJEA 5B2EA 2VLIA 3ICEA 5JQGA 4BEWA 3CZMA 3CPSA 1G8GA 2J4FA 2JEZA 3KQNA 1NMXA 4BTEA 2QLNA 3ZQJA 1ZD4A 1QC5A 2MSKA 4BRSA 1M74A 1ND5A 2NTJA 1Q3KA 4DLAA 5M7EA 2V1UA 1TVKB 2PY6A 3KAQA 1JKJA 2LUOA 3L0BA 2YXDA 3GPBA 1TT7A 3JTEA 4KBYA 5AKEA 3KQYA 1LS1A 2A1UB 2PCJA 1PZXA 1YZHA 2GHTA 1RMTA 3E8SA 3KQTA 3KYIB 4TTQA 4X24A 4DNOA 1HDIA 1T4MA 3QKRA 2JGIA 3BJMA 1R4MA 4A2CA 4KBGA 5FTNA 2KQUA 3ERCA 4CT4B 3D2LA 5K09A 3UXHA 2WM8A 2XSZA 4FPXA 1EK2A 2GTIA 2C00A 4C78A 3T61A 3V8BA 5K2OA 4LBWA 5BMVB 1PDOA 3PXXA 1RXUA 1QTIA 4PFQA 1U9CA 1PR2A 3ZDXB 1G8SA 5CG1A 3PL5A 4NJEA 4V0LA 1LVUA 1OWLA 2PIAA 1RHJA 4GM0A 1X14A 3E22A 3OCCA 5EQJB 2QR5A 3PEWA 1EBUA 2CEKA 3OSUA 3VKUA 4OP2A 2XZDA 3N2GB 1I2BA 4CXMA 1Q20A 4RDIA 2E48A 4ONEA 4LEIA 2F62A 4PLHA 1XKQA 3SQDA 4IOLA 4YCNA 1Y0BA 1JHAA 3IT3A 4C88A 1Q1ZA 2FDXA 4RZIA 2CXTA 3DTVD 4CCAA 5E38A 1QNFA 5IUKC 3QLUC 2QSUA 2QX8A 3RUIA 4BNDA 4PHTA 3ZPXA 3OUUA 5I4IA 3JYLA 2HJSA 4NJMB 3K73O 3D1VA 1AURA 4UEOA 2WU0A 2NU6A 4HS4A 3TVYA 4QUAA 4UDXX 2KYRA 1IUKA 2BP7A 3E0QA 2FNAA 3LUBA 2OAEA 3G1TA 2V9PA 1MVNA 3G0DA 3QQPA 4KNWA 4QOSA 1QOPB 2V7XA 5AKJA 2A59A 4EHFA 5JSZB 1DFGA 3IP9A 3OZVA 4TL7A 2NPOA 3MMZA 3B1JA 4UAGA 4N7JA 4DIUA 2VHJA 1GU1A 1XFDA 1VI5A 1SHUX 2FEPA 1M1NB 1P80A 1OY1A 1H6DA 2XB8A 2Q5OA 4KV9A 1PJ3A 5AJVB 3ODGA 3H5LA 1SR8A 1Z13A 1T9HA 4N0EA 3EVFA 3FVRA 4ZQCB 5DWVA 4C7MA 2CNDA 2AD1A 3AKYA 4ZEXA 3R5SA 1XR3A 1AKRA 2WT4A 3IE0A 3EMDA 4XQEA 3TSYA 1HGXA 3DP7A 5A5DA 4RESA 4NXMB 4KQ2A 4BP9A 1E2EA 1PEKE 2VTKA 3FFXA 3R5TA 1B0AA 1JIIA 2FUKA 3FJYA 5EY5B 2BF7A 4O4JF 1IN4A 4MVJM 1JAIA 2HF7A 3EXHC 3NLLA 1REQB 5AOCA 2R1TA 1SXJC 3JU3A 3C8MA 1RPTA 4IFBA 4R16A 4ZO6A 1XJQA 4CM9D 5JTUA 1PSWA 3SSAA 4D44A 5JAHA 1RQPA 1GXSB 3TO5A 2B8EA 1S4MA 4B85A 1WXIA 4G89A 3H9GA 2XMQA 2JARA 4AS1A 1ISPA 3L7BA 4EZEA 2OMKA 1L7VC 2CXHA 2X0JA 1C14A 3LT5A 4NP6A 3H9UA 4BWFB 1BXRA 3GG9A 3U09A 3K3PA 3TGPA 3RI3A 2B92A 2Q3JA 2GN8A 4AAYA 1AXEA 3KVRA 3O5AA 3PUKA 5HKKD 4UM8B 3BE6A 4BNLA 3C8HA 2JGJA 3MB8A 4MRVA 3ZH9B 4LDZA 2IZ7A 3DPSA 4RD1A 1SB8A 3FYUB 1UMDB 2YS7A 3I8XA 3NO4A 1QRAA 2I54A 2OQRA 3GRUA 4GDMA 4H3KB 4J90A 1OC2A 3PA8A 2ZIXB 2X0DA 3TUJC 1XHFA 4EPRA 5ED4A 1URPA 3OWHA 2RH8A 3EPJA 4Y9RA 2PE5A 4JXKA 3TZLA 4FBLA 3SZOA 4J7AA 5IC4A 1Q0TA 2PV0A 2F43B 4Y2TA 1JHZA 1EU1A 3ROZA 1Y63A 3GEPA 4Z86A 5KYYA 1Q19A 2JZCA 5CB4B 1QAQA 4OMCA 1R15A 1YOVA 4KPGA 2BFFB 3WV5A 3UTCA 3QLEA 3TW4A 4RHTA 1LI4A 4WJZA 3UAOA 2GOYA 3U7GA 3ZLJA 2AHOA 1JA9A 1LRKA 4AUKA 1O95D 1SC3A 1WRBA 3QUSA 4I66A 1NQTA 4PPQA 5BOVA 3VNAA 4A6EA 5BVGB 2YJZA 4YBZA 5F2OA 4FKBA 3DMTA 2FGJA 4JLMA 2BH9A 1NW4A 2YNMD 1L4MA 2WINI 1QZTA 2NNLD 5KOHB 4RDHA 4Y2JA 5D00A 4BQRA 3RLIA 1AMUA 1LDBA 2AZTA 3E1KA 5E2BA 3RYCA 1M0WA 1I7DA 1BEZA 2GRAA 4GKAA 1Y42X 3MLBA 1E8NA 3A6JA 1E2DA 1E99A 2HXYA 2IZZA 5JXJA 1C9EA 3NYIA 1HO3A 3V4FA 1PLKA 4DSNA 1F0NA 3V2UA 1JLKA 1ZOSA 2X2EA 3JZFA 4KAJA 4U02A 1QQ6A 2NTNA 3EGDB 4H4EA 4DRZA 5HZKA 1JSCA 5A5EA 1C0LA 3GFGA 4DM4A 1LSJA 3DC2A 4FFDA 4V38A 1I2CA 3C0KA 4ZWNA 3QV1A 3VPXA 4CJXA 2A1TR 3DEJA 2RI1A 1HPLA 4LJ7A 3QKTA 3PZBA 2JFZA 2PJDA 4GDFA 4AF7A 3ZHBA 2JLAA 1KYWA 4YJFB 3P9ZA 3WL5A 3B6JA 4D0GA 3O3CA 3U3JA 3IKTA 1XWWA 1W5SA 1E2LA 2OHGA 3F2VA 5E6SB 1Y98A 4C30A 2LTAA 1X6VA 5CFPA 1PNRA 5AI4A 5DMHA 1NQ5A 3AF1A 4M0KA 4UQOA 4N0PA 5L6LB 4O4IA 3P9KA 1Q14A 2JJ1A 1PDWA 3GLUA 1P17A 4IIFA 1E20A 3HB5X 1U2ZA 1YTLA 3Q0EA 4IYRA 1Q22A 3ZEAA 4AKTA 5AIBA 1ESNA 1WX1A 4ND7A 1NJ1A 3OAAA 3LWBA 3ML1A 3QG1A 1TK3A 2PUGA 1TQ2A 2I91A 3UXYA 1AQUA 4WBSA 3RCBA 4GMFA 2J3JA 1I0LA 4ZT4A 1L4NA 1NL3A 2ZE7A 4WACA 4OI1A 2JIBA 3O84A 4B2IA 1VFNA 4YRRA 3DPUA 4BIIA 3CVXA 3IX7A 1TPZA 3WMXA 3TJRA 2DC1A 2WE8A 5BQXA 3PFIA 4AMGA 5FPHA 5K6TA 4XUCA 2JAQA 1LLQA 3LUJA 3JD3A 5ELLA 1IIRA 2WUVA 3N39C 4NMWA 1Q15A 2PZAA 3V7YA 3GLIE 1JEAA 1KI1A 1ZIYA 1XZPA 3U3DA 5JIBA 3ZDCA 1RM4A 3QPBA 3TIIA 2G77B 4TT3A 3CUTA 1PTJC 4RWZA 4DUPA 3GJZA 1XCGB 3MWLA 3DE0X 2G0NA 4PS1A 1IG0A 4DKJA 5CIWA 4KQ1A 4YMHA 4NK5A 1UMBB 1IZZA 1SUPA 2O2GA 4WADA 4EKNB 2FFJA 4GGPA 2G25A 3CZ5A 2GD2A 3L7KA 4Q9DA 2O1SA 4QOFA 3RTGA 2UUPA 1BJKA 1QH0A 1RWBA 1V1MA 3BMCA 1CQWA 2CL5A 3CZ4A 3D4OA 4Q1EA 4QJIA 5HRAA 1MJFA 1LV8A 4CT0A 4UREA 2CXXA 4LJSA 2JKVA 2X23A 2J7KA 5G1NA 4YREA 4EJSA 5LL6P 3CXRA 4K7JA 2VDLB 4OI2A 4MKHA 1U6KA 4UOQA 5EQDA 1PNQA 1M1ZA 3MNFA 2TSYB 4L3WA 4Q4HB 2VWPA 3FYUC 1U2TA 3RUCA 3S2FA 4KZKA 4G0QA 4PYLA 1I6WA 4GOOD 1VRVA 1Z5NA 3ORFA 1J1IA 2ILVA 1SUSA 3M6IA 2O5CA 1X7YA 2PR2A 4B7CA 2DFPA 4GLBA 3MSCA 3ABIA 5TSDA 1YULA 3A3KA 4UTNA 3B60A 4EGQA 4NY1A 1RYDA 2O3TA 4DLNA 2PGLA 5JCJD 2ZZMA 1UJBA 3NOOA 3VO9A 4BU0A 4P81A 1RXWA 4UZSA 3ITKA 4JLNA 3L8YA 4DE5A 3WZLA 3F97A 1Y89A 1NVEA 2XUIA 3JQ7A 1TRKA 2RC6A 2G4LA 4FWIB 4HVAA 1PVDA 2P2CA 4KFSA 5DOZA 2Q2NA 1KK2A 4EA8A 3LVQE 1FUYB 3BC1A 3HEAA 4L9WA 2ZP1A 3GFSA 2WJWA 4M7WA 4XX0B 4Z4HA 2ZIUB 2BMJA 3W8FA 3PVZA 3DZKA 4ZT5A 4FDAA 2P6MA 4NENB 2NV6A 3LC7O 1IVNA 4RD6A 3AINA 1DV2A 5F2KA 2ZJ5A 1KY3A 3OZAA 3WGYA 3WMWA 3ZR4B 2IYZA 4DDWA 2BEKA 1MW8X 3QX3A 1WHSB 3LUAA 4D96A 3HDGA 3L7JA 3N8KA 3FPLA 1GGMA 3QYPA 1W0CA 1P75A 2PUVA 2WSLA 3JRWA 1IQ0A 2O4UX 3G8YA 3MBIA 2OTCA 1MNQA 3V7NA 2H1VA 4GPIB 4RH0A 5JZOA 4UKDA 1LFAA 3QXHA 3AF5A 5HP4A 3GGDA 3K15A 1F3OA 4RPIA 2WYHA 1GA1A 2ISCA 2JBWA 4Z1OA 1MB3A 1KSJA 4H4CA 3WWYA 1KI4A 4OFZA 4N8EA 4IXNA 1R6VA 5F2EA 4YAOA 4LNAA 2BM1A 3RTBA 5AXCA 4FKMA 1ZOIA 4A6XA 4DLPA 4F71A 2DPYA 2VSXA 1YCFA 4BO0A 3K8YA 3NKVA 3MGCA 4NDNE 1JAXA 1KQPA 3F0TA 1I1QB 1MAUA 1GKYA 1YQDA 3CGWA 3PC6A 2AW5A 3UV7A 3U40A 2EKPA 2IX3A 2XOKD 5ENVA 1TQ6A 2HIMA 2WD7A 2KHZA 3FDZB 3TTTA 4C4SA 5JRDS 1QG0A 2OORC 3GDHA 3GQBA 2BL4A 2F3UA 2UVPB 2ZIVB 4J3JA 2QTMA 1KQNA 2G0TA 2NTYC 2WIAA 5GZ6A 3GD5A 3QXSA 2YOHA 1E5TA 5G3ZA 4NESA 1MQ9A 1T9BA 2EJVA 2LWIA 4WXEA 5HFAA 1EINA 1WQ4A 1KSGA 1SXIA 1KIFA 4RPLA 1Y3DE 3TLAA 4NZOA 4EY6A 1N9GB 4NJOA 1ZUD1 1W94A 1MF7A 1C0KA 2A6PA 3ED5A 4HH1A 1F12A 4M98A 2PX3A 1GRVA 4LZOA 1C7ZA 3SG0A 1UJNA 1E32A 1TJNA 4B3IA 4MI9A 2C92A 1M8FA 1EGVB 1G7CA 1CQIB 4UFNA 4Q48A 2Z1DA 1ESMA 2EYQA 5BSWA 5CA1A 4TTAA 2PS0A 1G55A 4L02A 3O2JA 5K1ZA 2YXNA 2GPTA 2Q7DA 3FTNA 2W11A 3EQ9A 3JX9A 4HDKB 5LZ4A 2JLWA 3N6XA 3IP6A 2VAMA 5EKTA 1NF3A 1NXXA 4B47A 3OSZA 4H1TA 2J6HA 3H97A 1ADYA 1VLJA 4KIWA 3QVWA 3TTXA 2JLVA 3IIMA 4HNAA 3NBZC 1YU6A 2R7MA 3PD1A 4D26A 3T7IA 1CRWG 4O8CA 2GVZC 1W88A 4PGMA 3SAJA 3LQ1A 3SR0A 5BVHA 2FLVA 3BK1A 3OTOB 5F9MA 2AQKA 3DE5X 1I4LD 5GGYA 2GKSA 3N2ZB 4KI7A 5J23A 4BV8A 4XB2A 2GWHA 3RSHA 2R3SA 3CRVA 3CLHA 3FPBA 4DDHA 1ZSVA 4S1OA 1NM5C 4OHBA 3NP9A 4ZRMA 2DPMA 1E3DA 2XYPA 1M5TA 5C9ZA 4AP9A 4KCGA 3I83A 4YAUA 1EX9A 1UJ4A 2XMDA 1E3EA 4ZYVA 2BJHA 1ETHA 4TMXA 3GRFA 5F35A 1XPOA 4PVDA 2GO1A 3GLIB 2OV6A 2DG2A 2I66A 3AZQA 2X0IA 3BX1A 3FCYA 4G41A 3R41A 4KLRA 5K05A 4LY0A 3QF7A 1NZJA 4FWTA 4RHXA 5HWSA 1N1EA 3WYEA 1NZFA 5J4VA 1FQKA 5ESDA 5AM3A 3O83A 2AXPA 1N2XA 4LHXA 1CVLA 4FDMA 1THGA 2ZULA 5TPZA 3D5EA 5CCXA 1O5IA 1ZI9A 4W8HA 1R7RA 1WXEA 3GPLA 3NMUF 2DFKB 2F48A 1ANKA 2JDID 1QBKC 1C8LA 4GI5A 3KJQA 3GCZA 1SWWA 2I55A 3FIJA 2GX6A 1E79A 2OCLA 3GJ3A 5EE3A 4ZC8A 1USIA 2NNWB 2ZAIA 3QSGA 4X1IA 2O2EA 3KOMA 4MIKA 3TSCA 1G5FA 4Z2AA 5KYKA 4HSEA 1XVUA 3CVVA 1ONSA 1T1RA 4Q4DA 1MRZA 1JHDA 3REQA 3L4BC 1QR2A 4M46A 1IPHA 1ZAYA 4IDOA 1KQOA 3C43A 4MRPA 2B1JA 3V6LA 2X0RA 3UJHA 2I8CA 3DAHA 3D43A 4DA9A 5LNK6 4LF6B 1J1UA 4LMPA 1H05A 3FF4A 1DOZA 4IQ0A 1MAHA 5KC9A 2VTBA 5L9AA 3RAEC 3E58A 4Z51A 4LDAA 2CWWA 4PLTA 4UTOA 4LBZA 3BAZA 1CQJA 2CNWD 2P3QA 3EIEA 3CF4G 4WBNA 3CE6A 2O8DA 1PI3A 3FOZA 1MX5A 3FLBA 1EB9A 1XU7A 2LVBA 4RH3A 4X41A 2GAJA 5GJVC 4BQEA 4F12A 1DCTA 1FYVA 5JNWA 1G3QA 2ECOA 4KO3S 5LXTB 1QZUA 1WZIA 3IKMB 2AKAB 1U7OA 2P2LA 2ZT8A 3ECSA 4MIYA 1FYDA 1T6BY 1UDRA 2GDZA 4MROA 2NLOA 1NZDA 2AYZA 2D0DA 2GZ3A 2RKWA 4FE7A 1ZJJA 4DLVA 5KEIA 2HIAA 2OHOA 3HJHA 3WLKX 3EBLA 4WERA 4E32A 1J8DA 2IOFK 4Q1AA 2NZJA 3I8SA 4HQNA 1PP4A 2VJYA 1THZA 2LZ0A 3KRTA 3U3RA 2QV0A 1MIOB 3ZD6A 4NBTA 3BTSA 1HNNA 4GMGA 9MHTA 1S6YA 4J0HA 4MTLA 4F72A 1EDZA 4FGZA 1KGDA 4OA5A 1O6GA 4LG1A 2AOUA 4Y1GA 1WMAA 1ACJA 2JCXA 2WWYA 1WS6A 2I4NA 1P4SA 3JQFC 4NONA 1TUGA 3BPSA 1YDWA 4N8DA 1E7YA 1T8TA 3CX8A 3OFSA 2QPLA 2YXPX 4ZAVA 4HAZA 3FNFA 1ULHA 2OG1A 4URVR 1DBIA 4PN7A 1QKIA 5AVTA 1EFRA 1SKBA 5H9WA 3KOOA 5TIIA 4GPBA 1Z15A 2CGEA 4BKMA 4D8XA 4B3TB 1RT9A 3BBLA 5A02A 5IJ0B 2WPDA 1GNLA 1QMPA 2FK8A 4D3DA 3KLPX 4UVGA 5TXGA 1YH3A 3ITNA 3F90A 1EQ2A 5TJ9A 3WLPA 4E03A 1VFPA 3KU1A 4N3AA 3NQ41 4XQCA 2VIIA 4MCHA 1YS7A 4PHHA 1E3MA 2QVBA 3WO0A 2FPUA 5HW0A 3NWJA 3R5FA 2FTKE 2XUPA 1K06A 4FYKA 5C32A 1LF5A 1EVJA 1XZJA 2F1IA 4H6XA 1VYVA 4EHKA 3PLAE 3KJEA 1R0YA 3IT1A 4HN4B 3OKCA 3H1EA 2EKZA 3TMYA 2ZYRA 1W9HA 4MIOA 3ICOA 2HCTA 4HP8A 1RJFA 3FYTA 4PFJA 2W6JA 5I7UA 2DUUA 3PRYA 3QFHA 1JNYA 1SIOA 2FQXA 4L5CA 1WKCA 1E9VA 3JD4A 3DQQA 1XCMA 1MH1A 3A11A 2YFKA 1U8FO 4G25A 3OMLA 2V7QA 1U5AA 2XTMA 3WAJA 1P2UA 3VKHA 2A5LA 4XJVA 1A7JA 2AVDA 1H23A 3MB5A 1S7GA 1G0NA 1V8ZA 1Z2PX 4GI1A 4E21A 4DXHA 4DREA 1V8OA 4YO7A 2VUUA 3GMDA 4INPA 1E5LA 3O4VA 1RR6A 3PEFA 4GM4A 4NHEA 3SDZA 3FCCA 3T15A 1QAMA 2Q3HA 2DHCA 4KEAA 4XQ9A 4EG6A 2A86A 1MLDA 4P7JA 1C8KA 4IKPA 1ZK3A 4X8MA 1RXSA 3QPVA 1E98A 4H7FA 2Q3EA 2ZUDA 1FSSA 2ATXA 4CL2A 2V0NA 3CMMA 1WAMA 4B7UA 4W6ZA 4F7DA 3QLTA 2R62A 3KZKA 5IJAA 3JRNA 5IXYA 3G0IA 2P7HA 5C8VA 2QTTA 1RKUA 1BKYA 1YC2A 2BIFA 4OBXA 4KSYA 5KNDA 3WIEA 1XL0A 1YJ5A 2EBFX 5LZ2A 1ISJA 4MV5A 4CFZA 3X0DA 4OXQA 2COKA 2GJ9A 3AI2A 3RK4A 4XM0A 1N6HA 2WD9A 4DBLE 5HJ5A 4DLWA 4BU1A 4GFDA 2ZXFA 3R3VA 5JARA 1V6SA 3WGTA 2AK3A 3IHLA 3JSAA 2P4SA 2H8GA 1M2OA 2WYVA 2AMJA 1FLVA 2YASA 2ZYAA 3WB0A 2RMKA 2OHFA 2PRIA 3V4RA 3ZNQA 3FJOA 4C5BA 1C7FA 3AF0A 4U9UA 5JT1A 1GPH1 1I3LA 5DP2A 3E9ZA 1IOLA 5AVOA 4NE9A 5HKOA 4CN9A 5K3EA 4MJ3A 3ZLTA 1M8GA 5E2AA 3C41J 1CEXA 3JQAD 4LY9A 1EFRD 2XWBF 1V43A 3FFBA 3LM8A 4JJ6A 2W6MA 1JQKA 1QF7A 2C2GA 1NJSA 1IOWA 2MMGA 2EGHA 5FBRB 2OWDA 4AQ7A 5C1PA 4MYSA 1AQIA 1CNFA 5B7NA 3OMXA 3JQDA 5EJ4A 1XTBA 3BWVA 2C7PA 4Z7NB 1PZFA 1RXIA 2QM8A 5FX2A 1KF0A 4Y6OA 3ZD7A 5AW9A 2ECPA 2FX3A 1QE5A 1XLTC 3NC4A 3GY0A 3NAQA 1ZLYA 1QMGA 1FVOA 2AV6A 4KE9A 1E0SA 2C5LA 4TKVA 4OA8A 2VPWA 2FR8C 2BZ0A 3C4QA 2FUCA 2V5AA 2V6GA 3DKVA 4MGYR 3TH5A 1MHPA 2HEGA 4A92A 4UNRA 4P34A 3PGLA 2WZCA 4WXMA 1BVHA 2G3YA 3OOSA 4NQZA 4Z0NA 3NWPA 4BZQA 2OHJA 4TMVA 3ZHZA 5JDCC 3SE0A 3K9WA 4U7FA 3TRIA 3E0XA 2CT8A 3ILHA 5CT8A 2XA9A 4BNUA 5LLTA 2B0CA 4CM7A 2G6BA 3L01A 4IH1A 3SJAA 4FJ1A 1JYEA 2YVQA 4RFVA 3ROMA 1EX6A 2H9IA 3H8VA 5F21A 1QGDA 3RABA 4Y6LA 2GBLC 2QD3A 3MPOA 4C5CA 1RLIA 1TL7C 2HJWA 1A1VA 4CBVA 1E9FA 4ZDWA 3FJ1A 4BO3A 1TLFA 2OFOA 4JJ4A 2VJPA 1H5QA 2NO1A 4ZU3A 4E6EA 1NWHA 2AHRA 2I2XB 3BCUA 1II9A 2Y6UA 2R6JA 3DE3X 3B6IA 2ECFA 2QDXA 3I09A 3JAKA 3M1YA 3O1JC 4HK4A 1FTQA 3GEBA 4J3FA 1NNSA 4P86A 4DSTA 1C50A 4L5BA 2IHBA 5AI5A 1BW9B 1DIAA 2YV2A 4U2KA 2Y1WA 1RZVA 4LYDA 1KYQA 2HHJA 4YHHB 3WFJA 1OIWA 2ZATA 4ZAYA 1A0OA 4MA4A 4BBPA 2F6RA 3VYWA 4FYVA 3MCUA 1M34E 1WXDA 1JXOA 2BKAA 3VVMA 1TM2A 1J0CA 2LE0A 3RREA 2QGNA 1LNSA 3ZKWA 4ZYZA 1M75A 3EVGA 1E63A 1O97D 1XQ1A 3BEOA 3CO5A 4FFNA 1ZMOA 3NP7A 4WCDA 1E6WA 1FPQA 3NEPX 4RV4A 2JIDA 5IBPA 3ZK7A 3AW8A 4KV7A 1FNBA 5EIBD 1D5CA 2GM4A 1XTQA 2LR0A 4CR8A 5E95A 1OAOC 1KZYC 4WZZA 3TM4A 1J2JA 1JG7A 3FNRA 3ZXSA 4BLOA 2PUDA 5JWRA 1IWPB 4DA0A 2EQ5A 1CUFA 4QUEA 4DEXA 1KKMA 3HCOA 1TQ8A 3CNEA 4MP6A 2A0FA 4YASA 1EE2A 1MO6A 3TB4A 4CF3A 2PH1A 1EX1A 1L5MA 5GIOE 1W1UA 1WV0A 1USUA 3M1LA 3OECA 3ZU5A 4JLSA 2CUNA 1U0GA 1EXMA 4O2BA 4PO9A 1S1MA 1GRQA 5DASA 3R8FA 4COKA 4MYDA 5J1TB 3DZJA 1HYBA 4JQYA 3CB2A 2ZUBA 4HH4A 1DCMA 4ID9A 5LZ7A 3SQMA 2E9SA 1L5NA 4AZWA 5KS2A 1ZJWA 1KL7A 4Z49A 1V39A 3NM5A 1YE3A 3QFSA 4K8RB 4U4AA 2NYAA 5FBZA 3KQOA 2COEA 2WJ4A 3TQTA 4BNIA 1JQ5A 3G68A 2X2OA 2E5WA 1QONA 2ZB7A 4Q18A 1NRIA 5TEVA 1AHPA 2FPMA 2J0VA 2O0KA 3KJNA 1E5QA 1WMDA 3KYCA 1V1JA 2HHHB 1G3UA 3CEHA 1G291 5HILA 4R8SA 4AT1A 2I8LA 2ERYA 1YUMA 4X54A 1G17A 4YJ3A 5IVIA 4BDSA 4BUZA 3BE4A 3BRSA 1JJ7A 1GA6A 2PU7A 4L9RA 2YR0A 5ALSA 4U9IS 5LQDA 2Q3LA 1CU1A 4YRSA 1HFEL 4YJKA 4KRGA 4EYEA 1GILA 1QDUA 3GIWA 1ZR4A 4B8YA 4I5IA 1SVSA 3MD9A 2FGKA 5K51A 2W58A 3SF8B 1RBQA 4GL2A 2O7RA 3DF7A 4YJHA 1FTWA 3D6JA 1EVQA 1GPMA 2L42A 1RAFA 2O05A 2B98A 1JA0A 4YK7A 3QYFA 1ISMA 4GLFA 4MJXA 5AQ1A 3ZK9A 5DHQA 5F5LA 3B12A 1X7YB 5KWSA 2QA5A 1B8OA 3C1AA 3HDVA 4HYYA 1TF2A 3KR2A 4ITVA 4OVKA 1FTSA 1SBCA 2E89A 2VKQA 4D4GA 3HFGA 4GW3A 1KPIA 1QAOA 4I6EA 1AQLA 2QRPA 1X19A 3DNMA 4Q4HA 4ZAFA 2I80A 4EH1A 1H4SA 3AVWA 4BEBA 2EKDA 1W5FA 2VT6A 2VHUA 3EIFA 3KOZA 4JUFA 3RO7A 3TZQA 3I58A 1TK9A 3EHEA 1GG8A 1GDTA 4L3OA 2HU8A 2FW8A 3IEXA 3QFRA 2GM5A 2RGBA 2QTGA 2D2VA 1CY8A 2Y76A 2CLMB 3I2KA 2CF6A 4Q1FA 2XNJA 1BKDR 4Y9UA 2OGUA 3ZU6A 5AW5A 4HNHA 1ZK2A 3QVKA 4LF7B 2I7XA 4FYYA 3GR6A 4JLBA 4OHUA 1OIVA 5AK5A 3R4VA 3IILA 4XPIA 5KDLA 1UMBA 2GQ0A 1ZK0A 4G63A 3W3AD 3WNBA 5G2OA 1V1RA 5C18A 1YBFA 5A71A 2OBMA 5FNZA 2I6UA 5M3BA 4F1WA 1P5ZB 4KXYA 1JDUA 3RROA 3ZHUA 4CUZA 3T5GA 3RHSA 4PIPA 4UBKA 4OYYA 1EEHA 4LXIA 4Q37A 3WNDA 3D4IA 4AMBA 2PNJA 2ZDQA 2E6KA 4P3PA 3U31A 3D7KA 3B13B 1WP4A 5KQSA 1DPFA 4EA6A 4HJXA 3BH6A 2BFMA 3G88A 4KXWA 1JMKC 4AXBA 4GT1A 2KW5A 3SJBA 4JC5A 3PNQA 4MUJA 1C1DA 4CKWA 2IH4A 1SOAA 4JUDX 2RKBA 3TRDA 3ZDYB 4C7KA 3OPXA 4ANFA 1GZ5A 1X38A 5E9QA 3KHUA 1CUZA 1VBKA 3PX3A 3OCUA 2XT0A 2Z5FA 1O9HA 2YVLA 3IBFA 3S40A 2YZNA 1CV2A 2ZSJA 4C0SA 2H17A 4FD3A 5FT9A 2DPGA 5K2MA 1ZHFA 2FUNB 2ET6A 3UKJA 1XZ8A 1OLXB 3F5QA 1ZVQA 4RMGA 2EIHA 5E6SA 4AJ9A 1XPUA 3ILSA 1VOTA 1LK7A 2Y9PB 4Y6RA 3A6FA 1ZCBA 3LPNA 2AZDA 1E6KA 2Z2JA 3L49A 1TB4A 2OESA 3TMAA 2I62A 4MVXA 4KB5A 2ZUCA 1RMYA 3WLJA 4V1CA 3VKGA 3LK7A 2FY8A 2HBQA 3LQ2A 2AR7A 2DR0A 2PMCA 3FETA 4MMYB 1PYDA 4QPCA 4FTWA 1VP9A 2L69A 5IBQA 1ODIA 2O3JA 2OHVA 1T9KA 2GCNA 2JCYA 1AIPA 3HFRA 3OF3A 1MOQA 3G2OA 4HX2A 1X7DA 4GLOA 1UWLA 1G59A 4J43A 1E2JA 1KU0A 4PE5B 2MSNA 3IIIA 1XL1A 3CUUA 2Q45A 5KYVA 1E2PA 3Q3HA 1XNQB 4L4YA 5DM70 1QRSA 1KH1A 1MOSA 4H7DA 3T41A 4NBUA 1BDJA 4J1QA 3H2JA 5JC1A 1XTZA 1E61A 1SURA 1Y5LA 3LQKA 2AKEA 5FBQB 2I6QA 2F9LA 2ZIZA 2QQ0A 4M0EA 3ZE6A 1RE0A 1TAGA 5JMPA 1QGUA 4P1ZA 3ZHVA 4CUJA 1RRCA 4QDZA 3HUTA 4R8MA 1Q1AA 2HGSA 4OGGA 3UMCA 3HE3A 2QMHA 5ES4B 3VZSA 3UT0A 1G9SA 1SHTX 1HTTA 2JJ1D 2F9FA 2Q6OA 3FHCB 4PAOA 5ICFA 1B3BA 1I9CA 4XKJA 2UXDB 4ZT3A 2NIPA 1IHXA 3DJFA 1C3VA 2R7AA 4PZLA 2WABA 3I39X 6GPBA 4U7WA 2BT4A 4ZJUA 1EWKA 4B3DA 4M0FA 5DP1A 2BFEB 1GFSA 1U65A 3EEBA 3QW4B 3TE6A 1WUKS 3AQIA 3WIOA 3VPBA 2I7VA 4ZCMA 2X7HA 2HU7A 3DG9A 4UPEA 5HMMA 4MDHA 1XOIA 2WWTA 3N3BC 2QTVB 3EIHA 5LMUB 2QUZA 2IYYA 2ZI4A 1EJ2A 2JFQA 3D5QA 1DADA 1XCOA 3DOJA 1D7AA 1T91A 1Z07A 3IV7A 3QUAA 4IIHA 1F1BA 2HQRA 2B21A 1GAXA 2ZUEA 4LZJA 1PHPA 1FNSA 1Z2CA 2ZIXA 4ND8B 1JLHA 2YRXA 1ZM4A 4LXUA 5DKFA 2BFCA 5BUZA 3FYUA 1TVCA 1LW7A 2HZ7A 1G2QA 5EWMB 4CQMB 3M6MD 2UVPA 3EQZA 5AESA 1M73E 5BN3A 4X71A 1N6LA 2W0MA 3KJIA 3FDJA 4QEDA 2F8MA 4W7SA 5AJWA 3U4QB 4EQ6B 1NN1A 4OAPA 4I4CA 1CJCA 1MFPA 2J5BA 1JHYA 2Z30A 3TEMA 1Z7YA 3TQFA 4LVUA 2YQZA 2PUAA 4J0JA 2Z8YM 4TS9A 5EUQB 4WK0B 4ERXA 1VM6A 4A0QA 3AUKA 5D87A 4GLJA 5E6RB 1OGYA 1U8UA 3LHDA 3M89A 4GSLA 4I46A 4PAWA 3VDQA 2R96A 3CX4A 4YAEA 1R5NA 1LB1B 5K0FA 4FINA 3BD9A 1KVTA 4TUYB 3WB2A 3GJYA 4K9NA 5FIUA 1IEWA 5B58C 4B3XA 4NBLA 4O33A 1FU8A 2A9JA 3EPPA 3VBCA 2ZTSA 5DX1A 1JAHA 2W0SA 4J7XA 4B3JA 4PLVA 5DTEA 1SUEA 4W1SA 4B84A 1KP3A 5FWXB 2B1QA 2H1OA 1QU3A 3RT1A 1ZK4A 4L16A 2EV9A 4PBRA 1FVXA 2C58A 5ENDA 1D3AA 1EE9A 4KWCA 1E2NA 1G16A 3FTEA 3B1XA 5EL0A 1RW4A 2VJBA 1FMTA 1LF0A 1GSAA 2B2XA 1WVGA 3OX4A 3Q9UA 4IIYA 2VP4A 5IZCC 1M1NA 2DQSA 4BMZA 3GAAA 2BFBB 4INZA 3X1MA 3FG9A 5ISMA 3CUSA 2JHFA 2BTOA 2N9UA 1EK1A 3BIWA 1M8KA 1M2KA 1WVMA 2OZVA 2JBAB 5JSZA 4BP1A 4YACA 4ZT7A 5CH8A 2ZI9A 4NICA 2E85A 3D1LA 3TNLA 3LT1A 1WU7A 3AJDA 3H6HA 3P4XA 1JRLA 3FCXA 5JNVA 4LV5B 1U8ZA 2GZ1A 4UZEA 1SA0A 2ZI6A 3FFAA 3NEYA 2AXEA 4OAQA 4I4NA 5GIPE 5ICSA 3UJ3X 5DLYA 4LYEA 2HI0A 4Q12A 1PN3A 2B2NA 4EY5A 3F7MA 2PV7A 2UKDA 4B7XA 4MUHA 1WVIA 5AVVA 2IZ5A 1PG0A 4PNHA 2BMVA 2CB0A 5HTKA 3SVLA 2H06A 2XADA 1LJLA 2YWFA 4MGIR 2C97A 4GZ6A 4C0XA 1FFAA 2EFJA 4OB7A 4YV1A 3WMRA 3A1EA 1N0HA 1SBYA 5FAXA 4RK5A 3RVQA 2F55A 3QXCA 2O8CA 3BT7A 1B2RA 2FKAA 3GFPA 4KDCA 4MW0A 1O94C 1DWUA 3QX8A 1RYNA 1D6JA 1IB6A 1OB2A 3OVMA 5EXPA 1D0SA 2XMZA 3SM9A 5FULA 5FI1B 3FPCA 2R6R1 3IFSA 2N46A 2WJAA 4YO8A 4D9GA 4QREA 4V0KA 2XGGA 3EGOA 4PN3A 5JO0A 3FF1A 4FCWA 3SX0A 2GTHA 2IIPA 4D4HA 2J3DA 2AMLA 2CXSA 1P4HA 2XE8A 3NHZA 4AJHA 5CDGA 1C80A 3HM2A 3L7IA 3ZI7A 1Y33E 1EYZA 3A4NA 1TCBA 2ONYA 2IYVA 3O9ZA 3QPUA 4BJHB 1QC5B 1IMJA 1TLLA 1UFQA 1G3IA 2V03A 3QW2A 4R68A 4RVSA 4YAFA 2F8SA 3IQZA 3EK2A 4F9GA 2HFJA 2IELA 4KJZA 2A9KA 3FX2A 4FDVA 4FGUA 3HV0A 4QQRA 4CKYA 4DQVA 1WNTA 1WV1A 1UQTA 2O7VA 1T1JA 3K2IA 4P83A 3VKVA 1PGPA 3IVRA 5HQJA 3Q3CA 4LJ8A 1K7CA 1N1GA 1QHEA 2VDUE 3L6RA 3KYJB 4FK8A 4CEIA 1NHGA 2DGDA 3PJEA 4GQIA 1FP2A 1U0HC 1W30A 2D7CA 2OBBA 4EI8A 5ECYA 3RRBA 3E2MA 3GA0A 3ZJUA 1Y4AE 1XA3A 2XDAA 1UKAA 4CDGA 1WG8A 2CFTA 2VYND 1QQ5A 3KQQA 4NWIA 3DVRX 3TKAA 2JGLA 2O8BA 3A05A 2BKXA 2EF1A 1UUFA 2LIVA 2GPAA 4P7FA 1QUFA 4DLYA 4HC4A 4CKEA 1DT5A 2I34A 4Z7QB 1F51E 1LCIA 1N0WA 1LGYA 1UOEA 3IDOA 4IF6A 4K1XA 3BRCA 1I9GA 1FW8A 3HN7A 1XA0A 3EA4A 4HKTA 3X1WA 3BDVA 4ENSA 1J56A 1LK5A 2NXJA 4NV3A 2PBLA 1G5HA 4U0KA 4EEKA 2JGEA 3TI7A 2VAWA 2CLDX 5P21A 4X61A 4Q7EA 4Y6GB 1E5VA 2D0OB 3EGDA 1YZ3A 4G4SO 2JFNA 1GZUA 1B14A 4CFSA 4ZI7B 4P3YA 4ZZ0A 3M6XA 1GFZA 5JPCA 4I55F 2CKDA 1NJGA 3Q41A 1RWOA 4U00A 4E3WA 4EF4A 1Q1NA 1U7DA 2UUOA 3INTA 5B5SA 1S3GA 1BX1A 4KN8A 5EIWA 5AQEA 5BVGA 1OBHA 2AR9A 1SXJA 2GXSA 2JASA 2QI9C 4E7PA 5A06A 5CD1A 2WWFA 1GZSA 4RORA 2VDVE 3OBIA 4NZYA 3S8EA 1CZRA 4HX5A 1SCIA 4QECA 2HB6A 2ZM6B 2CCKA 1YASA 2J9XB 3GXBA 3HVRA 1N2SA 2ZVPX 3NU1A 1KBZA 4CMIA 4X91A 1NHWA 4RNDB 2GFHA 4LDRA 4NMXB 1P44A 3W9BA 3A6ZA 3KE9A 4YMLA 3MK31 3DKKA 5A9SB 1NT2A 4ZI7A 2R4QA 2FRVA 1XU4A 1RWXA 3OLXA 1H0SA 4ZCIA 4FD2A 4L74A 5MN4A 2A1IA 4D99A 4O3FA 3VISA 2V5VA 4EO9A 1ULTA 1TM1E 5FTJA 3LXRA 2FKNA 3PGVA 2DHRA 4NCKA 5DW3A 3VH4A 3ZHOA 2IYEA 1ZXBA 4KYIB 2JAWA 3PPWA 4TQAA 4YB8A 3UHJA 3IAS1 3INYA 3IVMA 5KYYB 4I1PA 1VLLA 4ZO9A 3PFBA 4BASA 3EDRA 1WCV1 3VM6A 3JQCA 5HZHA 4QVKA 3U1BA 1SHLA 4OHFA 1PT6A 4P9NA 4DYDA 5K3BA 4YLGA 4HUTA 5BYJA 4HNUA 1Q0UA 2WQZA 1HNZB 3LX6A 2PUJA 1JV2B 5K01A 3W5JA 3L8ZA 5U4XA 3UXEA 4O2AB 2F1JA 2RCNA 2YW2A 4F2PA 1R6XA 1JGTA 1WDWB 3OE7A 1KSFX 2D1YA 2GEFA 4IKEA 5ECDA 4ZQFA 5FLEX 4OQXA 5FPPA 3IL2A 3HSSA 2WSYB 3C5WP 4HAVA 4MVJI 2JJMA 3MYYA 4Y7DA 4F92B 2R0QC 5I7SA 4JH0A 4XYMA 3DXFA 3BD8A 4GC5A 3J80A 2MCFA 4JXXA 3MW8A 4PX2A 3P9YA 1TTPB 3H9JA 4QVGA 4WZ6A 4PPGA 2XRFA 5EIFA 1X7ZA 1OTYA 4LXXA 1MB4A 4WLOA 1AKTA 3CX3A 1N5OX 1E4EB 2IFTA 3AHFA 3FMIA 1GTVA 2ZB4A 5DYWA 1XZBA 2AFRA 3WWOA 5DCYA 4GWKA 4BMDA 1L8AA 1M7HA 5IYZB 4E1AA 3TGLA 4IPTA 6REQB 2RGAA 1KRHA 2O7NA 4AM8A 2GRJA 5TB5A 1GEEA 1W2HA 3IRUA 5IKEA 3QVGB 4Y2HA 3HVHA 3ILXA 5EWLA 3V32A 5G53C 1SEPA 4AN1A 1EMDA 4OCZA 1J2TA 4ZCLA 4FFWA 3FCOA 4GOKA 2WB2A 4DIBA 3OCJA 2QMUA 3KLMX 5ITSA 1KWKA 3WL7A 1PT5A 1B73A 4OH7A 1Q57A 2BONA 3M6WA 3MJFA 4YMGA 3WKDA 1SXPA 3L4SO 5IULC 3DLIA 2XT6A 3R5KA 1T0UA 1JDZA 2E2WA 3EN0A 3F5DA 4D3FA 1JDBC 4OLHA 4FC6A 3IE1A 4I5FA 3ADDA 4JYAB 3G7UA 4FI3C 4MQUA 4F5ZA 1XNRB 2X86A 4L0DA 3LGAA 2XNHA 4E51A 3T9BA 1NN0A 3M3PA 4I1OA 1W25A 2BYTA 5DRTA 1IQRA 3WL3A 3VR4H 5CK5A 3D6AA 4DMCA 1NYRA 1YB5A 2RK4A 1KPGA 4HGOA 2HDWA 4BB5A 2DF8A 4CNQA 3R9XB 3R6TA 1ZOLA 1CY7A 2JLBA 4TX1A 3ZWMA 1IJFA 1Q6ZA 3PNLA 3Q8XB 4IIDA 4Y0VA 2CW5A 5K4GA 2QW8A 3IQWA 1M76A 4RD2A 2XTZA 4E08A 3WB1A 4EPYA 4HAUA 4EZIA 3BK2A 1QKJA 1MGPA 2PX2A 4ZV7A 4ZARA 5JNTA 1HFJA 2NO0A 1HORA 2V6JA 2X6RA 3D3NA 2W4IA 2IT1A 1BMTA 2YN4A 3S29A 3V3TA 4F1JA 3R7BA 2EXXA 1YKGA 2PGJA 1QPGA 2BFBA 3ELBA 1B2LA 2CXNA 3GLFB 1D5WA 1QHXA 1R4AA 3VHXB 1FLNA 3ZCUA 3ESQA 1W34A 1XTIA 3QBTA 3I1FA 2HYIC 5HUJA 5B7PA 1IIBA 1WW8A 2X1MA 3HGTA 3KPWA 2VRNA 2FAXA 3CVWA 2RHCA 1I3CA 2DY0A 4BNWA 3PU6A 4BLVA 4IVPA 2JH9A 2I7TA 3HM9A 3VUEA 2JK0A 5A3RA 4IIJA 2V7GA 1E1DA 5DNAA 1I5RA 3NTUA 1Q84A 4E2ZA 1AO3A 1GCAA 2D5IA 2QLTA 2QNBA 3QVGA 5FUXA 2E82A 5TMDA 1MW9X 4RNCA 4GYKA 5FA5A 2EZTA 4NZMA 2HMTA 1NN5A 1STOA 5J43A 2G1PA 1SUDA 3SEQA 5LBTA 1LBHA 4U2FA 1S02A 4Z4IA 3KSAC 1AHNA 1Z36A 4NNJA 4MMZB 4AWBA 1ZA2A 2HWKA 5FPQA 2O9JA 3LPCA 1E4EA 1Z8DA 1T9DA 1V7PC 2VG8A 1A2OA 1BZYA 4TV8B 2OXTA 3CHYA 4TV9A 3K1YA 4U9HS 3FM9A 1NQUA 3RBVA 4CKCA 4ESEA 3JQ9A 1PD0A 4LJRA 3ZGLA 3F8TA 2O2XA 3U7RA 3T7AA 5KYNA 4XWWA 5E9JA 3LBNA 5ERGB 1G0OA 1W75A 2I6XA 1TADA 4J1SA 4MIEA 3R3UA 1SCNE 4F7WA 4YJDA 2FX5A 3WLFA 4TRJA 3WKCA 2PLWA 4ARVA 5A2GA 2VEOA 4X1YB 4KPEC 4ND8A 1YVEI 3I4CA 1QJ4A 3KIPA 5EJ6A 1J09A 1PQUA 2FPRA 3BEDA 3JQ8B 4KJXA 3GJSA 5JISA 5B1HA 1XSEA 4EO4A 1UWVA 4AJJA 1JDVA 3I9V6 2G6TA 1KMQA 3DYVA 1JSRA 3CW9A 2OC9A 4QGAA 2G5GX 2J3EA 3V48A 4LOAA 1NJ8A 2QTCA 4C3OB 2WF7A 3OZ7A 5BXQC 3LUKA 2ZJ3A 3U80A 3LO5A 4P4UA 4I8IA 4WH0A 2NQ8A 3ZVNA 1JLLB 4G5QA 5DNUA 2VPTA 1B41A 4X66B 1JHMA 5TGTA 3PCTA 4UASA 5FP0A 1Z73A 4KIUA 3HCPA 1MJNA 5HM6A 1WZCA 1YA4A 2C77A 2LCFA 3WIBA 5CIYA 1A9PA 4G37A 5AHWA 4ZEWA 5GZ3A 1IBRA 1OJ7A 1OUMA 2OBFA 3EGXB 4QBFA 1PK7A 4YDQA 4HAXA 4R8RA 1E8MA 2B82A 2CYBA 1L7XA 3FNGA 2Q46A 3CNBA 2PUWA 3PICA 2XYGA 4WKOA 4YRPA 2BEJA 1OV6A 2D0IA 4Q7QA 4ZGWA 3KALA 5JWHA 1ECLA 1FE8A 3GT7A 2QYHA 1NTOA 3H2SA 2BCJQ 5EJMA 2O07A 4IVNA 1W7AA 3E9YA 1M2EA 3GNLA 4EGAA 1HXHA 4HNRA 4Q4JA 2XYQA 1O08A 2J9YB 3DAPA 5FI5A 1P3Y1 1JDBB 4JHXA 1KP2A 2GBIA 2Q3BA 3TPZA 2FSGA 3I9V1 3BFXA 2GYVA 4DCCA 4LC0A 1K2VN 3ZWOA 5CNKA 3OA2A 4K46A 4TWRA 1U63A 1XRSB 4FXOA 3AVVA 2XKBA 4B6EA 3DOHA 1Y9DA 4G9BA 4REQB 5DE3A 5C52B 4FQ7A 4H16A 4ZQIA 3AF3A 2BFDA 3DWFA 2GCPA 4CKBA 3AI3A 4R1PA 3GVHA 1COWD 4OV6B 4HQFA 3NVAA 2D74A 4NPHA 3PQ5A 1C8VB 4O2LA 1E4OA 2FQYA 2MT9A 2YYYA 3DO6A 1EX7A 2IODA 4K9DA 3RR2A 3WQHA 3VOBA 4EEXA 5B30A 5H0IA 2CSUA 4IL5A 2D5LA 1UC9A 2BUCA 5LA6B 1NLZA 4NU8X 1KYYA 4OGLA 4TQGA 4XB6B 4JVOA 4PCVA 1KI6B 1Y9JA 4JMLA 5AW1A 4BNFA 1D2CA 1DOAA 1Y7HA 1SNYA 2BGIA 2JL1A 3ZS9A 3ZGZA 5MDHA 3CEJA 4UUAA 2DFDA 2R4TA 2WIBA 3NG1A 2ZGVA 3GFFA 5L4LA 3D7LA 2FQQA 3CEAA 1RCUA 1UXHA 2HCBA 2PFSA 4V03A 1ZONA 1PV4A 3GARA 1SIWA 3RKUA 3S70A 4BNNA 4ZYTA 3OOJA 1WZUA 2ORIA 4PANA 2XGMA 4XVCA 3WNVA 5FUQA 2N3ZA 3TZBA 2YCBA 2VRBA 3KPJA 1AKYA 1S8NA 2O4CA 4PW0A 3EQ2A 5AVWA 4QO7A 4AICA 4NBSA 2P9ZA 3UQYS 2YRFA 1YR8A 1KMNA 5B2FA 1E9AA 3EOAI 3QENA 1XC7A 4NULA 3T0GA 4C22A 2PKEA 1NVMB 1P1FA 2NO5A 4OHXA 4DB4A 2RGYA 5AXAA 1Z33A 2B35A 2G1AA 3AOEA 3CVOA 2VP2A 3HU5A 3LX5A 1FP6A 1V1RB 1EQUA 1QVVA 2VCEA 4RVUA 5F98A 5JV5A 3W04A 2E4WA 4D8YA 3OFVA 4Q9IA 3T4PA 4UEWA 4MRSA 1T6XA 2JGNA 4YRFA 3OQBA 4P5EA 1VZ2A 5AOBA 1ENYA 3H2HA 2I99A 5CM9C 1RKVA 1NI5A 5EWJB 3O21A 3U48A 4MUBA 5DYTA 1QE0A 3UH0A 4JENA 1JU4A 2Y27A 1YBVA 3GGGA 4ODIA 4RANA 2X7XA 3T7EA 4FXPA 2FPGB 3RARA 5CLJA 3IEIA 4HFJA 4NABA 1XALA 2QN6A 5CVCA 1DAGA 1P1IA 1N6OA 3HXLA 1XAIA 2C9MA 3O2QB 1NOKA 4BBJA 3OX2A 1LDYA 2WU3A 4N9QA 2FZLA 4QLOA 1PSDA 1VC2A 2OYSA 1TZCA 3D4LA 4ROTA 3L8GA 2KBFA 3S4YA 3AHDA 1GKIA 4GEGA 3EW7A 1KI7A 4E07A 3EE6A 1C7QA 1HV8A 3QWHA 4XJSA 4UU1A 3KJGA 3TFWA 1TUBA 2QAGA 3GRPA 1SIBE 4IVRA 1NDHA 4F5YA 1MX1A 3EMVA 1ZQ1A 2R87A 1KK1A 1CUUA 3V8NA 3D8BA 4JUAA 2AN3A 5LP6B 4LSGA 4H0NA 2J08A 3GBVA 1Q1QA 1RYEA 3FYCA 4P3XA 4C03A 4DVGA 4E14A 5JD5A 1ACLA 2QNIA 4RS4A 4F3TA 1EZ1A 3RJMA 4QTZA 3AHGA 2ZJ1A 3KYCB 1QTQA 3SIWA 3HJFA 4WRRA 3O9VA 3I52A 1QXSA 3LTEA 1G6Q1 1M1YA 1TA0A 2Q07A 5I9BA 3RTEA 5JASA 3K71B 2MYNA 1Q7EA 4U2GA 3COZA 2Z58A 5BYKA 1KDTA 1Q7RA 2UZ1A 4DDVA 3BF8A 2C29D 1U3VA 3EVTA 1I3OA 3GUVA 1JQBA 1TJ5A 5JC8A 3OG9A 4XB1A 4I9UA 4WNIA 1PCXA 3LDGA 1WSBA 2HMUA 4TUYA 1IY8A 3KG2A 3H5AA 4RF4A 1CZUA 1ZGCA 4Z3DA 4ZTUB 4DIKA 3JARA 4QFDA 1YFZA 1QFJA 4PICA 2MR6A 1JXMA 3DGFC 1OC4A 4MUAA 1TCCA 1V2GA 2EWMA 1K5PA 3KQKA 4U7JA 1GVNB 4G56A 3M6LA 5G0WA 1R37A 4EL5A 4FT2A 5REQB 4KQGA 3UHAA 3UK0A 3OE5A 3A3PA 3TI9A 1UIMA 4I1VA 3ZBQA 4HDRB 5J4HA 2VXCA 3LUHA 3Q7IA 4M87A 3B36A 1JR2A 2AEFA 2VVTA 4ZIRB 3EGCA 4WY8A 4OQ4A 1WXGA 4G0VA 4OXXA 1AG9A 4KRYA 4E5DA 4NZ9A 3K72B 2E37A 1WMSA 1KI9A 3H2IA 4PRYA 4F21A 1JDTA 5TT0A 2JAOA 4QXOA 3RHFA 3AF6A 4AY5A 1LSUA 3KQLA 4WEQA 4NLLA 4MX8A 2YWHA 1PAUA 4N40A 4Q1CA 1BW9A 1XZCA 3WK9A 3C5EA 3IEKA 1ML3A 2HWWA 4X8LA 5DT9A 2YZMA 3CPJB 5EKUA 2XKKA 4YHBA 3S55A 1UBJS 3OQ1A 1E1RD 2IU4A 5JFGA 2BFEA 3OT4A 4C2TA 1DQNA 4DZZA 2EDAA 4YPFA 2F1RA 3SP1A 3VMFA 2JFUA 5K3SA 3LDUA 1L7OA 4NEQA 5T8KA 3ZWBA 1K7YA 2QTFA 1VE7A 2ZWPA 3FTCA 3VTZA 3X2EA 4ER3A 1CS0A 1BAPA 3AIMA 4PLGA 3FKSD 4A2WA 3MFYA 3EVBA 3UO8B 1CZOA 2IYWA 2I1LA 2FZVA 1INLA 2FE4A 2VDOB 2HY7A 3EIWA 3KVVA 4INOA 4K3VA 4RU1A 2CMHA 4Z1MA 1GTSA 1DXYA 4TMTA 1BD4A 1D0IA 1TIPA 1KBOA 4JUCA 1UPTA 1D4AA 3ISJA 4DF3A 4BQFA 4RELA 2OCYC 4LFCB 1J24A 1WUTA 4JGIA 4E7OA 5DGXA 1P4RA 4A2QA 5BNWA 3CRQA 2SNIE 4Q93A 1R88A 4WOKA 4O4IF 2X8WA 2LIPA 1FL9A 3T7KA 5C51B 3OCXA 2ZE6A 5LNK1 5JQGF 2IH2A 3FE2A 3NI2A 3MJSA 2PBRA 4MJLA 5FUYA 2PSDA 2XZPA 4MWGA 4IZHA 2DP4E 4OQYA 2ZUUA 1GQQA 1VGVA 2ICAA 3MQFA 2IYXA 3QVXA 4INJA 1MHTA 3BE5A 1ULZA 3I2JA 4ZQHA 2JH3A 5DHTA 4RQTA 3LC2O 1QZZA 5FNVB 1FLAA 1Y6JA 4LRXA 4U7GA 4N7BA 3UT6A 4M7RA 1YK0A 5HK9A 4JUIA 4CI9A 1DUVG 2A3NA 1CR2A 2CD9A 3T5MA 1ZWLA 3MF4A 4JQSA 1Y9EA 1ZJ6A 3N0WA 1VKRA 2VSYA 3UAYA 1U94A 3W5AA 2XCSB 3AM5A 2XH8A 4DAEA 5FWXA 3UHPA 2E5LB 3OO1A 1MJGM 4AY2A 3BWXA 5CFZA 1MB2A 3F6CA 1NXVA 4EB0A 5IF9A 3TL6A 4CG1A 5KWEA 4DM3A 4GKKB 3Q7RA 3I1JA 4W99A 3D8TA 4ZJPA 2BDUA 3DQPA 3L43A 1UH5A 3Q6MA 4Y30A 4JJ7A 4HV4A 3W8NA 1KDZA 3OCVA 2ZPTX 2FPLA 3L0IB 4GNKA 1UDAA 2Y0EA 1XRJA 2JFOA 1DKMA 5I8PA 4RJKA 4QYIA 3O8OB 3M5WA 1OW3B 4BMXA 1SKYE 3TG2A 2Z6QA 3IA2A 5SV2A 2AE2A 2PH7A 5TVGA 3HLTA 3OY7A 1M33A 3BXZA 3W9SA 5A3SA 3WRXC 2A9PA 2TMDA 1LLDA 3ORQA 1U7ZA 1AKNA 1KK3A 1ZGJA 2ZQYA 1AO0A 1CRPA 2GMWA 4X3PA 3A10A 4YQZA 4UTZA 5DYGA 4CT5A 3NDBB 1LDGA 2YVUA 2W6CX 4Y9TA 3QY9A 2BFNA 4D8WA 3HI6A 2PDAA 2DB3A 5TPWB 4DR6B 4CG3A 1ISFA 2DBYA 3MBOA 3RRMA 2FJ0A 2H07A 1KVQA 2VWHA 4DBZA 1RC1A 1Z0AA 3AR8A 3CURA 5KYXA 1QP0A 3VNRA 1ADCA 4IO1A 4F85A 4BFSA 2W42A 1TAQA 5K8CA 1I36A 2UV8A 1I7SB 1XA4A 1NY6A 1ORWA 1OXSC 2CLFB 2QVYX 4YWJA 1OPXA 4RSGA 1T26A 3VMMA 1JQJC 3WSWA 4CNBA 5JE8A 5JNSA 1CUGA 2BC9A 5CP8A 2C57A 4YROA 1GZHB 4J75A 4LN1A 1JFTA 5EP1A 1OFGA 1QTNA 1GT91 2D5AA 2HNAA 2IXEA 3RTAA 4ENWA 4NU6A 3PX7A 4EG4A 1YR9A 4YJ2A 1PUXA 3E9NA 2UYYA 1QS0A 1QP4A 1B0UA 1JFFA 1P7ZA 1YDHA 3IJEB 3E8MA 5HZMA 1W5AA 2QS9A 1NFQA 1ORHA 2HDNB 3NHLA 4MKGA 4TOIA 4JYZA 3GNTA 4RY8A 4IEIA 4BNXA 3PQ8A 2EOAA 1PV2A 3HP4A 4AZSA 1P1RA 1QZXA 5IH3A 4KR9A 2P68A 4E1VA 3I3OA 1Q7GA 4LSZA 1XUOA 2FN3A 2XOXA 3TSAA 1YGYA 2WJ3A 2Q6IA 3SC4A 3OTHA 2OZKA 4M7OA 4YIKA 5G3YA 4PTZA 3K2BA 3RANA 1A77A 1KH2A 3WGHA 4QJ3A 1A3CA 4AJNA 3A6KA 4ER7A 1J90A 1JR3E 3O3NB 4OEHA 2AQHA 4KW7A 4UHEA 1AGXA 4NDZA 1FS5A 4OAOA 3RAFC 3BN3A 2RHWA 3QXJA 2C78A 3C3PA 5FWDA 3T7RA 1KEWA 1WTAA 3BULA 5IJ0A 3TBFA 1U1DA 2NZ8A 3BICA 3HDHA 3VTFA 3L0PA 4V0MA 1KJIA 1F3LA 1UEJA 1XT6A 1PS9A 2PS9A 4H3SA 2P77A 2O0JA 2O57A 4YPVA 1ZOOA 1U2DC 3ZWYA 4S1PA 3IQHX 3SQNA 2QSZA 3TQRA 2CXQA 1VTKA 2XQGA 3MT8A 1SCQA 4MYRA 1A9ZA 1MC8A 3SJCA 5EFOA 2PGNA 2FWAA 2PJRA 4EAQA 3MIIA 5C5DA 5D84A 3U60B 2DT8A 2EL7A 2K4MA 4M0UA 3A31A 2B3TA 1SD2A 2H3EA 3K6JA 4KSBA 1YMQA 3UAGA 4YX9A 4Z4GA 4HMPA 1IFXA 4G2NA 3EAFA 3KKNA 3SD7A 4EF6A 3ROQA 4LWQA 4LBYA 5LU9A 1Z0DA 2IU0A 2IBTA 4EPTA 3QITA 4DYVA 3OJXA 5B37A 1U90A 1DIRA 5DHRA 4YXWD 3L7AA 3O3OB 4UAJA 5ERXA 4NAUA 3V1UA 3THYA 4M60A 5PGMA 4TN1A 4RIFA 1BTOA 1M9NA 2A9FA 5TMEA 3AGPA 3DUFB 3ZDBA 2YIDA 1V96A 2G0AA 4FNGA 1YCDA 3AUSA 4BKQA 5LXTA 1VG0B 4ENRA 1EXNA 1VIYA 2QUBA 5MN5A 1KEKA 1BNCA 5A1JA 2B6NA 1DBVO 2R6FA 4C21A 4DLUA 1N2ZA 1P8AA 6ADHA 4XVHA 4OXIA 2QUAA 3R4CA 3LIPA 5LD2C 1F20A 2QTZA 1UWKA 2FMTA 4LDNA 5JCOA 4TXMA 5E8RA 1GAWA 1PBTA 3ZKWB 1OTHA 3HKCA 1JG2A 2QX7A 1DP4A 3CIOA 1NLFA 1R27A 5H3CA 5F1PA 4DG8A 2O0HA 1T5OA 5HS4A 1U0EA 5A05A 4I55B 1XCPA 4B3CA 2A7XA 2R6HA 2VDQB 2ZS7A 4RZSA 1BHSA 4H7EA 4R2IA 3JAKB 3WDMA 3QU7A 4M6WB 5BT8A 5F64A 4IV5A 2WWWA 4DQ0A 1HFKA 4RTJA 5JVDA 2ZJ4A 3PTLA 4XTCS 2HQSA 1VCIA 2H4YA 3ZVMA 1NUSA 2V9ZA 2R1ZA 2B4QA 4JZYA 3I6IA 5DGDA 4UHJA 4YDSA 2C54A 4ARIA 1S2DA 4I1UA 4Y2UA 1M2FA 4OQEA 1EG7A 2P30A 1FOEB 5HYVA 2I67A 4IJUA 4L5AA 3EWIA 4F9TA 3RIYA 4R0NA 3W2IA 1ZMTA 3D0RA 3FYDA 2ZAMA 4F2DA 4TZKA 2ECKA 3A2KA 4CM4A 4DRYA 1QRTA 4E30A 3AR2A 2YZ2A 5AOVA 1DARA 1Z2EA 1YQEA 4XRRA 1M2VB 1KAHA 3FOBA 2X8BA 3HUUA 4JCCA 1L5HA 2ETXA 3A2MA 4QZVA 1YSCA 2QQEA 1KZ6A 1PWZA 2JFPA 5JRJA 4ALIA 1DKQA 2OVBA 3PI7A 3BGSA 5E0KB 5TRTA 5ALFA 4P58A 5DH9A 5JNRA 1KU6A 3L6DA 1D6SA 4D9JA 5D5QA 1Z3CA 2VPQA 2VN8A 1DDGA 3Q85A 3I2GA 4RS3A 4DA6A 4KO4S 4HT3B 4XYLA 5LQMA 5FYQA 3WIDA 1AGPA 2IC5A 5BVHB 2JVIA 1W88B 2QZ4A 1S2GA 3DDCA 3VU0A 2C5SA 3EOBI 3B82A 2ID4A 2PX6A 2GNAA 3L40A 2I78A 2JGDA 2BY4A 4C4YA 3DLPX 5JS8A 5DGCA 3BHMA 1W0JD 2CDBA 2ZWOA 2WV7A 5DT2A 1X1AA 1F0KA 2W93A 3OP1A 2E87A 3QK7A 4OYLA 4P4NA 4YXWA 2JF0A 2G09A 3MS7A 3BMQB 3VR6H 2LPMA 3OPYB 1RAHA 1XVIA 3U4MA 2IW3A 2WMDA 4KAAA 4Z9FA 2QNRA 2LV8A 3M3DA 1PQYA 1ZH4A 3ICWA 1OH6A 1Z06A 1OILA 3L8CA 3HCEA 5LJIA 1IRIA 4CZ2A 1O57A 2DERA 1FJHA 1R74A 2BD0A 3FN4A 4CE6A 1CQIA 3DMFA 1U1EA 3D31A 5P8WA 4K05A 5IYZF 4WFIA 1CY0A