4KOVA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefuroxime
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 44
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kovA00
3T90A 3GYAA 2OZUA 2PRBA 3T9YA 4PK3A 2X7BA 3LODA 2JLMA 3TTHA 1QSOA 4X5KA 4CAWA 1QSTA 2FE7A 2FIWA 1YVKA 1M44A 4MJ8A 4NSQA 5FVJA 3TOAA 4AVBA 4L89A 1Y9WA 5E96A 1RO5A 1I21A 1MJBA 1NE9A 5ISVA 3S6FA 2ZPAA 4AG9A 2K5TA 4IF5A 1BOBA 1Y7RA 1S7LA 2Q4YA 4JJXA 2FS5A 3EXNA 4QB9A 1YR0A 4PSXA 4XPDB 4UA3A 2IL4A 1S60A 1B87A 1LRZA 4KVOE 4OLLA 4KUAA 1P4NA 2QMLA 1M4IA 3FB3A 3P2FA 4OADA 2B4BA 3R9GA 1TIQA 4MHDA 2VBQA 3TO6A 5DWMA 2B5GB 5F47A 1CM0A 4ZBGA 2Z10A 1S5KA 1XF8A 2PQ8A 1XMTA 1YREA 3EY5A 3GKRA 4B5PB 1Q2DA 2BSWA 3S6HA 3C26A 2C27A 5J8CA 4PK2A 2Q0YA 3D2PA 2QIRA 3BLNA 3FYNA 4OAEA 1NMTA 5IB0A 3BJ7A 2OZGA 1OZPA 3F5BA 5F48A 1Z4RA 2GE3A 1MK4A 3S6GA 3UY5A 1K4JA 3P2HA 3WR7A 1XIXA 1YLEA 1NSLA 2JEVA 1I12A 4MBUA 3GY9A 2PDOA 3S6KA 3W6XA 4AG7A 2QECA 2ATRA 4KOSA 3EC4A 5HH1A 3LD2A 4R87A 3FRMA 4AVAA 2Z0ZA 2EVNA 2AJ6A 4QC6A 4U5YA 4JLYA 4KOYA 4R57A 3TO9A 4Y49C 3IGRA 1RXTA 1R57A 5KTDA 1IYLA 4KVME 3TT2A 3ZZIA 4GS4A 3DR6A 2D4OA 1XE4A 3TOBA 2FL4A 2FT0A 3SHPA 2GIVA 4K30A 2G0BA 2DXQA 3DSBA 1UFHA 5JPHA 4MY0A 1J4JA 2Y0MA 5F46A 3TCVA 1KZFA 1IIDA 4HNYB 4KVXA 2REFA 3TFYA 3EO4A 2Q4VA 2EUIA 4NXYA 1ON0A 2R7HA 4Y49B 4AVCA 3F0AA 4F0YA 4CRZB 1BO4A 1P0HA 1PUAA 1Q2CA 2Q44A 4RS2A 4RI1A 3V8IA 1I1DA 3SXNA 4KOXA 4KOUA 2CY2A 2G3AA 3I3GA 4R3KA 2OB0A 1WWZA 2P6FA 3CXSA 4NEXA 2ZXVA 2VZYA 2PR1A 2I00A 2BEIA 4LX9A 3FIXA 5I0CA 1N71A 3G3SA 4JXRA 1KUXA 5EC4A 4CAXA 4KORA 4E2AA 4HKFA 3H4QA 4QVTA 1Q2YA 4KOTA 5HMNA 4FD4A 4IUSA 1QSNA 3D2MA 1IICA 4PV6A 5JQ4A 4H89A 3BJ8A 2B3VA 2D4PA 2OU2A 4M85A 5J8FA 2FIAA 4YFJA 4R3LA 2H5MA 3PP9A 2PC1A 5H84A 1VKCA 1M4GA 1IB1E 5IX3A 2G3TA 1XEBA 2P0WA 5IV0A 3IWGA 5C82A 2REEA 5CNPA 3D3SA 2ARHA 1MJAA 3R95A 2BUEA 2VXKA 1S7NA 2JDCA 5H86A 3W6SA 5F49A 3R96A 2PSWA 4QUSA 3B8GA 1Z4EA 4UBRA 4FD5A 2R98A 4UWIA 1L0CA 3E0KA 3VWEA 4MI4A 4CS0B 4E0AA 2Q7BA 2I79A 1M4DA 4MY3A 2GANA 1YX0A 3JVNA 4QBJA 2CNTA 3CXPA 5GCNA 2B3UA 3R1KA 1YGHA 3FNCA 2ZW7A 2FSRA 3I9SA 3QAHA 2KCWA 1VHSA 4B5PA 1B6BA 2FCKA 1PU9A 2F5IA 3OWCA 2HUZA 4DNCA 4F6AA 2ZW6A 2Q04A 4U9YA 4NF1A 2ZW4A 4KZTA 2FXFA 4XNHC 2VZZA 1MJ9A 1WK4A 2B4DA 2VI7A 4FD6A 3D8PA 1YK3A 1V0CA 3DR8A 1KUVA 4HNXB 4YGOA 5EBVA 3K9UA 1S7FA 2VQYA 4KOVA 2J8RA 4KOWA 2OZHA 2VEZA 1SQHA 4YRHA 4I49A 3PGPA 4ONUA 3ZJ0A 4UWJA 2PR8A 4II9A 2BL1A 4H6UA 4B5OA 2P6GA 3SXOA 2A4NA 2CNSA 2NMTA 3VWDA 5DWNA 1S7KA 4E8OA 4ORFA 3JUWA 4R9MA 1CJWA 4BMHA 4JD6A 4LUAA 4XNHB 3W91A 3N7ZA 1QSMA 1Y9KA 2J8MA 1FY7A 2HQYA 4CAVA 2R1IA 3DDDA 3RYOA 1Z9UA 2Z11A 3G8WA 2B4DB 4KLWA 4NCZA 2B58A 3QB8A 2WPWA 4XPKA 4FD7A 3CXQA 3EFAA 2RC4A 1GHEA 4J3GA 3DNSA 3R9EA 4U9ZA 3TO7A 2R8VA 2AE6A 4AB7A 2HV2A 3R9FA 2JDDA 3FBUA 2WPXA 2P6EA 1U6MA 1KUYA 2ZW5A 3MGDA 4XPLA 4EVYA 2O28A 1QSRA 2J8NA 2OH1A 4M3SA 4JWPA 2CNMA 3FXTA 4HNWB 5KTAA 4PSWA 5KTCA 4JXQA 4KUBA 1IYKA 1YVOA 3F8KA 3KKWA 3PZJA 2B5GA 4XPDC 3TE4A 4H6ZA 4L8AA 3NE7A 5C88A 1S3ZA 4KLVA 4CRYB 1M1DA
chains in the Genus database with same CATH superfamily
1H8LA 3T90A 4B14A 3GYAA 4NGMA 2OZUA 1YW6A 2PRBA 3T9YA 4PK3A 3BXMA 2X7BA 4KSAA 3H8FA 2DEAA 4P4EA 3LODA 1Z2LA 4MCRA 2JLMA 3TTHA 4CGNA 4EFDA 1IOFA 3V38A 1QSOA 4DJLA 4X5KA 1CG2A 4CAWA 1QSTA 2FE7A 5D29A 2FIWA 1YVKA 1M44A 4MJ8A 4NSQA 5CBMA 5FVJA 3TOAA 4AVBA 4CGLA 4CGMA 4L89A 4KS9A 4GXHA 4NGSA 2AFOA 2AFXA 2ZEFA 4C68A 5LRJA 1Y9WA 5E96A 1RO5A 1I21A 1MJBA 1NE9A 5ISVA 3S6FA 4MHZA 2V77A 2ZPAA 4AG9A 2K5TA 4IF5A 1BOBA 1Y7RA 3SJXA 1VGYA 1S7LA 3B2YA 4GM5A 3WC7A 2Q4YA 2IQ6A 2JEWA 4JJXA 3HLPA 2FS5A 3B35A 3B3VA 3EXNA 4QB9A 1YR0A 2PJAA 4PSXA 4XPDB 5F09A 3CPXA 4UA3A 1OBRA 2IL4A 1S60A 2PJ2A 4NGQA 1B87A 1LRZA 1Z8TA 2JBKA 4KVOE 4OLLA 4OC3A 3FEDA 1Z8LA 4KUAA 1P4NA 2QMLA 1M4IA 3FB3A 1JWQA 3ISZA 3P2FA 4MCPA 4OADA 4X8IA 2B4BA 4F8ZA 5I4MA 5K8OA 3R9GA 1TIQA 4MHDA 1VIXA 2VBQA 3TO6A 5DWMA 1Z5RA 1CX8A 2B5GB 3BI0A 5F47A 1CM0A 4CPAA 4A39A 4ZBGA 1IGBA 4PXDA 4NGPA 2POKA 2Z3KA 4WWVA 3PBEA 4F9UA 5JM6A 2Z10A 1S5KA 1XF8A 2PQ8A 1XMTA 1RTQA 1YREA 3EY5A 3GKRA 3PBBA 3WC5A 4B5PB 1Q2DA 2BSWA 5AG5A 3S6HA 3C26A 4A32A 3PB8X 2PE3A 2C27A 5J8CA 4PK2A 2ZEOA 1Q7LA 4JYWA 4EWTA 2Q0YA 3D2PA 2QIRA 2V8VA 3BLNA 3FYNA 4OAEA 1NMTA 4B13A 2I3CA 2PJ8A 3BJ7A 4X3RA 2OZGA 4FBEA 5IB0A 1OZPA 2V8GA 1LAMA 2Q43A 3F5BA 2C6CA 2QJ8A 3LWUA 1Z4RA 5F48A 2OOTA 3VATA 4A2ZA 5ELYA 4CGOA 2GE3A 4DYOA 1ZG7A 1MK4A 1UWYA 3S6GA 3PFOA 4EMEA 3UY5A 1K4JA 2IJZA 3P2HA 3WR7A 1XIXA 1YLEA 1NSLA 2JEVA 2GFQA 5G22A 1I12A 2ZEHA 2ZOFA 4MBUA 3GY9A 2PDOA 3S6KA 3W6XA 1TF9A 4AG7A 5HXDA 2QECA 3KR4A 2ATRA 3GUXA 4KOSA 3WABA 3EC4A 2PJ4A 5HH1A 4RUHA 3LD2A 2AFWA 1FNOA 3FRMA 4R87A 3LACA 4AVAA 3GLJA 1IU8A 4PPZA 2Z0ZA 3KGQA 3S9NA 2EVNA 2AJ6A 2AFUA 3PB9X 4QC6A 2CXAA 4CYNA 4U5YA 2Z3NA 1ARLA 4JLYA 4KOYA 2VL1A 1ZG9A 4P6YA 4Q38A 2HB6A 4R57A 3TO9A 2DPTA 3IIBA 4Y49C 2Q4ZA 1ZO0A 4P10A 3IGRA 1RXTA 1R57A 3KHXA 3SI0A 5KTDA 1IYLA 4KVME 2GU2A 4ZX8A 3TT2A 5HVGA 3ZZIA 1XBUA 3IFEA 4GS4A 2PJ7A 4HPSA 3DR6A 2D4OA 1YQEA 1XE4A 1LFWA 1TKHA 1X10A 3IWEA 3TOBA 2FL4A 2FT0A 3SHPA 2O4HA 2ZOGA 2GIVA 4K30A 2G0BA 3JTKA 2DXQA 2EK9A 3DSBA 4KSFA 4M6GA 2WYRA 2PVWA 4Z65A 1UFHA 5A28A 5G1ZA 1KWMA 1Y0YA 3KASA 5JPHA 4MHPA 1ZLIA 4MY0A 1J4JA 2QYVA 2Y0MA 5F46A 4PQAA 4OIDA 3GIUA 4IHMA 3TCVA 1KZFA 3T8WA 2Z3PA 1IIDA 3A9LA 4HNYB 4FAIA 4KVXA 4P45A 4MHNA 4O23A 4WJBA 4IAVA 2REFA 3TFYA 3EO4A 1AYEA 2Q4VA 2O53A 3NA6A 1ARMA 3NH8A 4MCSA 1CBXA 1LANA 4F9VA 4C2ZA 2EUIA 2ZEPA 4NXYA 2ZELA 4ZX9A 2PJ1A 1ON0A 1CPSA 2F8HA 1Y0RA 2JBJA 2R7HA 4UF4A 3F0AA 4UIBA 2PJ6A 3D67A 4Y49B 3RAMA 3NH5A 4AVCA 4CRZB 1BO4A 3FF3A 1P0HA 2J9AA 3DGVA 1PUAA 3VH9A 1Q2CA 3IU1A 2V8HA 1F2OA 2Q44A 4NJRA 4UCNA 4UIAA 4RS2A 4MFZA 5J1QA 4CGPA 3MRUA 4RI1A 3V8IA 1I1DA 3B7IA 3SXNA 2YGWA 4KOXA 4KOUA 1FT7A 2CY2A 2G3AA 2PJ0A 3I3GA 4OMEA 4R3KA 2OB0A 4X2TA 4RN7A 4UFWA 3GB0A 3SJFA 4DUKA 2PRQA 5G21A 2PJ9A 3BI1A 5LYDA 1XOVA 2AFZA 1PYTB 1WWZA 2P6FA 3CXSA 4NEXA 3IWWA 4B11A 2ZXVA 2VZYA 4P4IA 4CAFA 2PR1A 4TNUA 2I00A 4BINA 2BEIA 2BO9A 4P4JA 1QMUA 4LX9A 1GYTA 3FIXA 3KL9A 1N71A 5I0CA 3G3SA 3TX8A 2QVPA 4JXRA 4M6HA 1KUXA 3FH4A 5EC4A 4CAXA 4KORA 4E2AA 4HKFA 4Q7AA 2C6GA 3H4QA 3V7ZA 4QVTA 3MN8A 1Q2YA 4K3NA 2ZEEA 4KOTA 5HMNA 3ISXA 1ELLP 1LCPA 4FD4A 1CP6A 2WZNA 4R8FA 3CDXA 4IUSA 5BWAB 1QSNA 3D2MA 1IICA 3KZWA 4PV6A 4XPKA 5JQ4A 1YSJA 4H89A 5THWA 2Q7SA 3BJ8A 2B3VA 1Y7EA 3D7GA 1XFOA 4KSIA 1VHOA 3IEHA 3PFEA 2D4PA 2OU2A 4LQ6A 1TKJA 4M85A 3NE8A 5AG4A 5J8FA 1M4LA 2FIAA 5D8NA 4YFJA 3RZAA 4MHYA 4B12A 1F2PA 3SJEA 2BCOA 2C6PA 4R3LA 2H5MA 1IOIA 4FUUA 3PP9A 2PC1A 5H84A 1VKCA 4A38A 1M4GA 2Z3LA 1HDQA 4MCQA 3B3WA 3D7HA 2XEGA 4PXBA 1IB1E 4UCMA 5IX3A 4OC4A 2RFHA 2G3TA 3CPAA 3B3SA 4P44A 1LOKA 1XEBA 2P0WA 5IV0A 3FJUA 3IWGA 3BHXA 5C82A 2REEA 5CNPA 3D3SA 2ARHA 4IK2A 4CYQA 4BBHA 4CYPA 4PXEA 4NGRA 4P4DA 1MJAA 4ZY1A 3R95A 2BUEA 2VXKA 1S7NA 5LYFA 4YWYA 2JDCA 5H86A 1TXRA 3W6SA 3K2KA 4Q36A 4A30A 5F49A 3R96A 4QBJA 2PSWA 4MFPA 4QUSA 3B8GA 1Z4EA 4NFRA 4UBRA 3KI9A 2ANPA 2NYQA 2PJ3A 3K9TA 4FD5A 4ZY0A 1Z8XA 2R98A 5CPAA 3HUVA 4OIWA 4UWIA 1L0CA 3E0KA 4F0XA 5LYIA 4B6ZA 3I1UA 5A27A 4R76A 3VWEA 2AFSA 2Z3OA 3SJGA 2XEJA 4MI4A 3WC6A 3H5ZA 4CS0B 5HVFA 4E0AA 5IB9A 3TC8A 2Q7BA 2I79A 4A94A 4CYOA 4OP4A 3S9LA 2G9DA 1M4DA 3H8EA 4MY3A 2GANA 2HC9A 3KQXA 1YX0A 3JVNA 4OKOA 2CNTA 2YNCA 3CXPA 4NJQA 3DLJA 5GCNA 2GREA 4UFXA 3CZXA 2B3UA 1AUGA 3FNCA 1YGHA 3R1KA 2ZW7A 2FSRA 3I9SA 3QAHA 4YU9A 2KCWA 2CIJA 4C7IA 1VHSA 4B5PA 5LRKA 1TF8A 1B6BA 1XRYA 2FCKA 1PU9A 4UEZA 2F5IA 2EWBA 3OWCA 2HUZA 2YNCC 4DNCA 4C2YA 3KHZA 1CP7A 4F6AA 2ZW6A 7CPAA 2FVGA 1BPNA 1BAVA 3CT9A 2EBJA 2Q04A 3FVLA 1EE3P 1LAPA 4U9YA 2PVVA 4NF1A 2ZW4A 1QQ9A 4KZTA 2FXFA 3H8GA 5LRGA 5K8NA 2EK8A 4R6TA 4XNHC 1BPMA 2VZZA 1MJ9A 2NSMA 1WK4A 1DTDA 2B4DA 4MMOA 1Z8WA 2VI7A 5JH9A 4FD6A 3D8PA 4A95A 4AXVA 3B3TA 4OC1A 1YK3A 3QAYA 1V0CA 4G1PA 4CAEA 2PJ5A 3DR8A 1KUVA 1A2ZA 4HNXB 2YNDA 4YGOA 4UEEA 4MFQA 5EBVA 5EMIA 3K9UA 3KR5A 4ONWA 5K8PA 1S7FA 2OR4A 3D4UA 5AG7A 2WUUA 2VQYA 3NH4A 3D7DA 4KOVA 3D66A 1YW4A 3PB6X 1YMEA 2PJBA 4UCPA 2J8RA 4KOWA 1YLOA 2OZHA 2VEZA 4NGNA 1JQGA 1SQHA 4C2XA 3SI2A 5DS0A 1X12A 4YRHA 3QNVA 4I49A 3PGPA 4ONUA 4ZGYB 4MRIA 6CPAA 5JGFA 3ZJ0A 2PJCA 4UWJA 1IY7A 1R43A 3D7FA 2PR8A 2DPSA 1ELMP 4II9A 2ODFA 2BL1A 4UEFA 4H6UA 5K8MA 4B5OA 2GLFA 2P6GA 3PB7X 2PCUA 3SXOA 1VHEA 2A4NA 1ZG8A 2CNSA 1ZLHA 2NMTA 3VWDA 5DWNA 4A33A 4A31A 1S7KA 3KQZA 4UFVA 4E8OA 4OC2A 1CPXA 4ORFA 3JUWA 3IC1A 4R9MA 1CJWA 4BMHA 4JD6A 8CPAA 4LUAA 2PIYA 4XNHB 3D68A 3FMCA 3S9MA 3W91A 2V8DA 4OC0A 3N7ZA 1AMPA 4H2KA 1QSMA 1HEEA 1Y9KA 3PEIA 2J8MA 2PIZA 1FY7A 3IO1A 5LYLA 2HQYA 2YNEA 2EO8A 3N5FA 3VARA 4CAVA 4LQGA 3WT4A 2R1IA 3DDDA 3RYOA 4F0YA 2ZEMA 2ZEDA 3B3CA 1Z9UA 4P4FA 3LMSA 2Z11A 3G8WA 4OC5A 2B4DB 4KLWA 3JRUA 2B58A 3QB8A 2WPWA 4NCZA 2CTCA 3FECA 4FD7A 3CXQA 2ZEGA 2XEIA 3EFAA 1DE4C 2RC4A 1GHEA 2GLJA 3DNSA 3L2NA 4J3GA 4B10A 2XEFA 4P4BA 3R9EA 3NFZA 4ZYQA 4U9ZA 4MFKA 2ABZA 2Q51A 3TO7A 1XMBA 2R8VA 3FEEA 4MXUA 2BOAA 1NSAA 4JZ0A 3SI1A 5AG6A 4NGTA 2AE6A 2ZENA 4MFJA 4AB7A 5HVHA 4BD9A 2AFMA 2HV2A 1HDUA 2JDDA 3PRTA 5G20A 3R9FA 3FBUA 4R7MA 2WPXA 2P6EA 1TKFA 3RO0A 1BLLE 1U6MA 1KUYA 2ZW5A 3MGDA 4XPLA 1XJOA 3IU2A 4PXCA 4EVYA 2CF4A 1QSRA 2O28A 2J8NA 4ZI6A 2OH1A 2IMOA 4M3SA 4A37A 4W9YA 4JWPA 3IJ3A 5AGEA 2DF5A 2CNMA 3FXTA 4HNWB 4MFLA 4ZY2A 2F7VA 2Z3MA 5KTAA 1F57A 4C7HA 4PSWA 4FWUA 5KTCA 2CTBA 3RBUA 3RNZA 1PCAA 3PB4X 1R3NA 4JXQA 4KUBA 4M6IA 1IYKA 4TWEA 1YVOA 2RB7A 3F8KA 3KKWA 3PZJA 2B5GA 3FX6A 4XPDC 3TE4A 4H6ZA 4L8AA 3NE7A 5C88A 1S3ZA 2C1CA 2WSAA 4KLVA 4CRYB 1M1DA
chains in the Genus database with same CATH topology
3T90A 4B14A 3GYAA 2OZUA 2PRBA 3T9YA 4PK3A 2X7BA 4KSAA 3LODA 2JLMA 3TTHA 4CGNA 1QSOA 4X5KA 4CAWA 1QSTA 2FE7A 2FIWA 1YVKA 1M44A 4MJ8A 4NSQA 5FVJA 3TOAA 4AVBA 4CGLA 4CGMA 4L89A 4KS9A 4C68A 1Y9WA 5E96A 1RO5A 1I21A 1MJBA 1NE9A 5ISVA 3S6FA 2ZPAA 4AG9A 2K5TA 4IF5A 1BOBA 1Y7RA 1S7LA 2Q4YA 4JJXA 2FS5A 3EXNA 4QB9A 1YR0A 4PSXA 4XPDB 4UA3A 2IL4A 1S60A 1B87A 1LRZA 4KVOE 4OLLA 4KUAA 1P4NA 2QMLA 1M4IA 3FB3A 3P2FA 4OADA 2B4BA 3R9GA 1TIQA 4MHDA 2VBQA 3TO6A 5DWMA 2B5GB 5F47A 1CM0A 4ZBGA 2Z3KA 2Z10A 1S5KA 1XF8A 2PQ8A 1XMTA 1YREA 3EY5A 3GKRA 4B5PB 1Q2DA 2BSWA 5AG5A 3S6HA 3C26A 4A32A 2C27A 5J8CA 4PK2A 2Q0YA 3D2PA 2QIRA 3BLNA 3FYNA 4OAEA 1NMTA 4B13A 5IB0A 3BJ7A 2OZGA 1OZPA 3F5BA 5F48A 1Z4RA 4CGOA 4A2ZA 2GE3A 1MK4A 3S6GA 3UY5A 1K4JA 3P2HA 3WR7A 1XIXA 1YLEA 1NSLA 2JEVA 5G22A 1I12A 4MBUA 3GY9A 2PDOA 3S6KA 3W6XA 4AG7A 2QECA 2ATRA 4KOSA 3EC4A 5HH1A 3LD2A 4R87A 3FRMA 4AVAA 2Z0ZA 2EVNA 2AJ6A 4QC6A 2CXAA 4CYNA 4U5YA 2Z3NA 4JLYA 4KOYA 4Q38A 4R57A 3TO9A 2DPTA 4Y49C 1ZO0A 3IGRA 1RXTA 1R57A 5KTDA 1IYLA 4KVME 3TT2A 3ZZIA 4GS4A 3DR6A 2D4OA 1XE4A 3IWEA 3TOBA 2FL4A 2FT0A 3SHPA 2GIVA 4K30A 2G0BA 3JTKA 2DXQA 4KSFA 3DSBA 1UFHA 5A28A 5G1ZA 5JPHA 4MY0A 1J4JA 2Y0MA 5F46A 3TCVA 1KZFA 2Z3PA 1IIDA 3A9LA 4HNYB 4KVXA 2REFA 3TFYA 3EO4A 2Q4VA 4C2ZA 2EUIA 4NXYA 1ON0A 2R7HA 4A30A 4Y49B 4AVCA 3F0AA 4F0YA 4CRZB 1BO4A 1P0HA 1PUAA 1Q2CA 3IU1A 2Q44A 4UCNA 4RS2A 4MFZA 4CGPA 4RI1A 3V8IA 1I1DA 3SXNA 2YGWA 4KOXA 4KOUA 2CY2A 2G3AA 3I3GA 4R3KA 2OB0A 4UFWA 5G21A 1WWZA 2P6FA 3CXSA 4NEXA 4B11A 2ZXVA 2VZYA 4CAFA 2PR1A 2I00A 2BEIA 4LX9A 3FIXA 5I0CA 1N71A 3G3SA 4JXRA 1KUXA 5EC4A 4CAXA 4KORA 4E2AA 4HKFA 3H4QA 4QVTA 1Q2YA 4KOTA 5HMNA 4FD4A 4IUSA 5BWAB 1QSNA 3D2MA 1IICA 4PV6A 5JQ4A 4H89A 3BJ8A 2B3VA 2D4PA 2OU2A 4M85A 5AG4A 5J8FA 2FIAA 4YFJA 4B12A 4R3LA 2H5MA 3PP9A 2PC1A 5H84A 1VKCA 1M4GA 2Z3LA 1IB1E 4UCMA 5IX3A 2G3TA 1XEBA 2P0WA 5IV0A 3IWGA 5C82A 2REEA 5CNPA 3D3SA 2ARHA 4CYQA 4BBHA 4CYPA 1MJAA 3R95A 2BUEA 2VXKA 1S7NA 2JDCA 5H86A 3W6SA 4Q36A 5F49A 3R96A 2PSWA 4MFPA 4QUSA 3B8GA 1Z4EA 4UBRA 4FD5A 2R98A 4UWIA 1L0CA 3E0KA 4F0XA 5A27A 3VWEA 2Z3OA 4MI4A 4CS0B 3H5ZA 4E0AA 2Q7BA 2I79A 4CYOA 1M4DA 4MY3A 2GANA 1YX0A 3JVNA 4QBJA 2CNTA 2YNCA 3CXPA 5GCNA 4UFXA 2B3UA 3R1KA 1YGHA 3FNCA 2ZW7A 2FSRA 3I9SA 3QAHA 2KCWA 4C7IA 1VHSA 4B5PA 1B6BA 2FCKA 1PU9A 2F5IA 3OWCA 2HUZA 2YNCC 4DNCA 4C2YA 4F6AA 2ZW6A 2Q04A 4U9YA 4NF1A 2ZW4A 4KZTA 2FXFA 4XNHC 2VZZA 1MJ9A 1WK4A 2B4DA 2VI7A 4FD6A 3D8PA 4A95A 1YK3A 1V0CA 4CAEA 3DR8A 1KUVA 4HNXB 2YNDA 4YGOA 4MFQA 5EBVA 3K9UA 1S7FA 5AG7A 2WUUA 2VQYA 4KOVA 4UCPA 2J8RA 4KOWA 2OZHA 2VEZA 1SQHA 4C2XA 4YRHA 4I49A 3PGPA 4ONUA 4ZGYB 3ZJ0A 4UWJA 2PR8A 2DPSA 4II9A 2BL1A 4H6UA 4B5OA 2P6GA 3SXOA 2A4NA 2CNSA 4A33A 2NMTA 3VWDA 5DWNA 4A31A 1S7KA 4UFVA 4E8OA 4ORFA 3JUWA 4R9MA 1CJWA 4BMHA 4JD6A 4LUAA 4XNHB 3W91A 3N7ZA 1QSMA 1Y9KA 2J8MA 1FY7A 2HQYA 2YNEA 4CAVA 2R1IA 3DDDA 3RYOA 1Z9UA 2Z11A 3G8WA 2B4DB 4KLWA 4NCZA 2B58A 3QB8A 2WPWA 4XPKA 4FD7A 3CXQA 3EFAA 2RC4A 1GHEA 4J3GA 3DNSA 4B10A 3R9EA 4U9ZA 4MFKA 3TO7A 2R8VA 5AG6A 2AE6A 4MFJA 4AB7A 2HV2A 3R9FA 2JDDA 5G20A 3FBUA 2WPXA 2P6EA 1U6MA 1KUYA 2ZW5A 3MGDA 4XPLA 3IU2A 4EVYA 2O28A 1QSRA 2J8NA 2OH1A 4M3SA 4JWPA 5AGEA 2CNMA 3FXTA 4HNWB 4MFLA 5KTAA 2Z3MA 4C7HA 4PSWA 5KTCA 4JXQA 4KUBA 1IYKA 1YVOA 3F8KA 3KKWA 3PZJA 2B5GA 4XPDC 3TE4A 4H6ZA 4L8AA 3NE7A 5C88A 1S3ZA 2WSAA 4KLVA 4CRYB 1M1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T90 A;  3GYA A;  2OZU A;  2PRB A;  3T9Y A;  4PK3 A;  2X7B A;  3LOD A;  2JLM A;  3TTH A;  1QSO A;  4X5K A;  4CAW A;  1QST A;  2FE7 A;  2FIW A;  1YVK A;  1M44 A;  4MJ8 A;  4NSQ A;  5FVJ A;  3TOA A;  4AVB A;  4L89 A;  1Y9W A;  5E96 A;  1RO5 A;  1I21 A;  1MJB A;  1NE9 A;  5ISV A;  3S6F A;  2ZPA A;  4AG9 A;  2K5T A;  4IF5 A;  1BOB A;  1Y7R A;  1S7L A;  2Q4Y A;  4JJX A;  2FS5 A;  3EXN A;  4QB9 A;  1YR0 A;  4PSX A;  4XPD B;  4UA3 A;  2IL4 A;  1S60 A;  1B87 A;  1LRZ A;  4KVO E;  4OLL A;  4KUA A;  1P4N A;  2QML A;  1M4I A;  3FB3 A;  3P2F A;  4OAD A;  2B4B A;  3R9G A;  1TIQ A;  4MHD A;  2VBQ A;  3TO6 A;  5DWM A;  2B5G B;  5F47 A;  1CM0 A;  4ZBG A;  2Z10 A;  1S5K A;  1XF8 A;  2PQ8 A;  1XMT A;  1YRE A;  3EY5 A;  3GKR A;  4B5P B;  1Q2D A;  2BSW A;  3S6H A;  3C26 A;  2C27 A;  5J8C A;  4PK2 A;  2Q0Y A;  3D2P A;  2QIR A;  3BLN A;  3FYN A;  4OAE A;  1NMT A;  5IB0 A;  3BJ7 A;  2OZG A;  1OZP A;  3F5B A;  5F48 A;  1Z4R A;  2GE3 A;  1MK4 A;  3S6G A;  3UY5 A;  1K4J A;  3P2H A;  3WR7 A;  1XIX A;  1YLE A;  1NSL A;  2JEV A;  1I12 A;  4MBU A;  3GY9 A;  2PDO A;  3S6K A;  3W6X A;  4AG7 A;  2QEC A;  2ATR A;  4KOS A;  3EC4 A;  5HH1 A;  3LD2 A;  4R87 A;  3FRM A;  4AVA A;  2Z0Z A;  2EVN A;  2AJ6 A;  4QC6 A;  4U5Y A;  4JLY A;  4KOY A;  4R57 A;  3TO9 A;  4Y49 C;  3IGR A;  1RXT A;  1R57 A;  5KTD A;  1IYL A;  4KVM E;  3TT2 A;  3ZZI A;  4GS4 A;  3DR6 A;  2D4O A;  1XE4 A;  3TOB A;  2FL4 A;  2FT0 A;  3SHP A;  2GIV A;  4K30 A;  2G0B A;  2DXQ A;  3DSB A;  1UFH A;  5JPH A;  4MY0 A;  1J4J A;  2Y0M A;  5F46 A;  3TCV A;  1KZF A;  1IID A;  4HNY B;  4KVX A;  2REF A;  3TFY A;  3EO4 A;  2Q4V A;  2EUI A;  4NXY A;  1ON0 A;  2R7H A;  4Y49 B;  4AVC A;  3F0A A;  4F0Y A;  4CRZ B;  1BO4 A;  1P0H A;  1PUA A;  1Q2C A;  2Q44 A;  4RS2 A;  4RI1 A;  3V8I A;  1I1D A;  3SXN A;  4KOX A;  4KOU A;  2CY2 A;  2G3A A;  3I3G A;  4R3K A;  2OB0 A;  1WWZ A;  2P6F A;  3CXS A;  4NEX A;  2ZXV A;  2VZY A;  2PR1 A;  2I00 A;  2BEI A;  4LX9 A;  3FIX A;  5I0C A;  1N71 A;  3G3S A;  4JXR A;  1KUX A;  5EC4 A;  4CAX A;  4KOR A;  4E2A A;  4HKF A;  3H4Q A;  4QVT A;  1Q2Y A;  4KOT A;  5HMN A;  4FD4 A;  4IUS A;  1QSN A;  3D2M A;  1IIC A;  4PV6 A;  5JQ4 A;  4H89 A;  3BJ8 A;  2B3V A;  2D4P A;  2OU2 A;  4M85 A;  5J8F A;  2FIA A;  4YFJ A;  4R3L A;  2H5M A;  3PP9 A;  2PC1 A;  5H84 A;  1VKC A;  1M4G A;  1IB1 E;  5IX3 A;  2G3T A;  1XEB A;  2P0W A;  5IV0 A;  3IWG A;  5C82 A;  2REE A;  5CNP A;  3D3S A;  2ARH A;  1MJA A;  3R95 A;  2BUE A;  2VXK A;  1S7N A;  2JDC A;  5H86 A;  3W6S A;  5F49 A;  3R96 A;  2PSW A;  4QUS A;  3B8G A;  1Z4E A;  4UBR A;  4FD5 A;  2R98 A;  4UWI A;  1L0C A;  3E0K A;  3VWE A;  4MI4 A;  4CS0 B;  4E0A A;  2Q7B A;  2I79 A;  1M4D A;  4MY3 A;  2GAN A;  1YX0 A;  3JVN A;  4QBJ A;  2CNT A;  3CXP A;  5GCN A;  2B3U A;  3R1K A;  1YGH A;  3FNC A;  2ZW7 A;  2FSR A;  3I9S A;  3QAH A;  2KCW A;  1VHS A;  4B5P A;  1B6B A;  2FCK A;  1PU9 A;  2F5I A;  3OWC A;  2HUZ A;  4DNC A;  4F6A A;  2ZW6 A;  2Q04 A;  4U9Y A;  4NF1 A;  2ZW4 A;  4KZT A;  2FXF A;  4XNH C;  2VZZ A;  1MJ9 A;  1WK4 A;  2B4D A;  2VI7 A;  4FD6 A;  3D8P A;  1YK3 A;  1V0C A;  3DR8 A;  1KUV A;  4HNX B;  4YGO A;  5EBV A;  3K9U A;  1S7F A;  2VQY A;  4KOV A;  2J8R A;  4KOW A;  2OZH A;  2VEZ A;  1SQH A;  4YRH A;  4I49 A;  3PGP A;  4ONU A;  3ZJ0 A;  4UWJ A;  2PR8 A;  4II9 A;  2BL1 A;  4H6U A;  4B5O A;  2P6G A;  3SXO A;  2A4N A;  2CNS A;  2NMT A;  3VWD A;  5DWN A;  1S7K A;  4E8O A;  4ORF A;  3JUW A;  4R9M A;  1CJW A;  4BMH A;  4JD6 A;  4LUA A;  4XNH B;  3W91 A;  3N7Z A;  1QSM A;  1Y9K A;  2J8M A;  1FY7 A;  2HQY A;  4CAV A;  2R1I A;  3DDD A;  3RYO A;  1Z9U A;  2Z11 A;  3G8W A;  2B4D B;  4KLW A;  4NCZ A;  2B58 A;  3QB8 A;  2WPW A;  4XPK A;  4FD7 A;  3CXQ A;  3EFA A;  2RC4 A;  1GHE A;  4J3G A;  3DNS A;  3R9E A;  4U9Z A;  3TO7 A;  2R8V A;  2AE6 A;  4AB7 A;  2HV2 A;  3R9F A;  2JDD A;  3FBU A;  2WPX A;  2P6E A;  1U6M A;  1KUY A;  2ZW5 A;  3MGD A;  4XPL A;  4EVY A;  2O28 A;  1QSR A;  2J8N A;  2OH1 A;  4M3S A;  4JWP A;  2CNM A;  3FXT A;  4HNW B;  5KTA A;  4PSW A;  5KTC A;  4JXQ A;  4KUB A;  1IYK A;  1YVO A;  3F8K A;  3KKW A;  3PZJ A;  2B5G A;  4XPD C;  3TE4 A;  4H6Z A;  4L8A A;  3NE7 A;  5C88 A;  1S3Z A;  4KLV A;  4CRY B;  1M1D A; 
#chains in the Genus database with same CATH topology
 1H8L A;  3T90 A;  4B14 A;  3GYA A;  4NGM A;  2OZU A;  1YW6 A;  2PRB A;  3T9Y A;  4PK3 A;  3BXM A;  2X7B A;  4KSA A;  3H8F A;  2DEA A;  4P4E A;  3LOD A;  1Z2L A;  4MCR A;  2JLM A;  3TTH A;  4CGN A;  4EFD A;  1IOF A;  3V38 A;  1QSO A;  4DJL A;  4X5K A;  1CG2 A;  4CAW A;  1QST A;  2FE7 A;  5D29 A;  2FIW A;  1YVK A;  1M44 A;  4MJ8 A;  4NSQ A;  5CBM A;  5FVJ A;  3TOA A;  4AVB A;  4CGL A;  4CGM A;  4L89 A;  4KS9 A;  4GXH A;  4NGS A;  2AFO A;  2AFX A;  2ZEF A;  4C68 A;  5LRJ A;  1Y9W A;  5E96 A;  1RO5 A;  1I21 A;  1MJB A;  1NE9 A;  5ISV A;  3S6F A;  4MHZ A;  2V77 A;  2ZPA A;  4AG9 A;  2K5T A;  4IF5 A;  1BOB A;  1Y7R A;  3SJX A;  1VGY A;  1S7L A;  3B2Y A;  4GM5 A;  3WC7 A;  2Q4Y A;  2IQ6 A;  2JEW A;  4JJX A;  3HLP A;  2FS5 A;  3B35 A;  3B3V A;  3EXN A;  4QB9 A;  1YR0 A;  2PJA A;  4PSX A;  4XPD B;  5F09 A;  3CPX A;  4UA3 A;  1OBR A;  2IL4 A;  1S60 A;  2PJ2 A;  4NGQ A;  1B87 A;  1LRZ A;  1Z8T A;  2JBK A;  4KVO E;  4OLL A;  4OC3 A;  3FED A;  1Z8L A;  4KUA A;  1P4N A;  2QML A;  1M4I A;  3FB3 A;  1JWQ A;  3ISZ A;  3P2F A;  4MCP A;  4OAD A;  4X8I A;  2B4B A;  4F8Z A;  5I4M A;  5K8O A;  3R9G A;  1TIQ A;  4MHD A;  1VIX A;  2VBQ A;  3TO6 A;  5DWM A;  1Z5R A;  1CX8 A;  2B5G B;  3BI0 A;  5F47 A;  1CM0 A;  4CPA A;  4A39 A;  4ZBG A;  1IGB A;  4PXD A;  4NGP A;  2POK A;  2Z3K A;  4WWV A;  3PBE A;  4F9U A;  5JM6 A;  2Z10 A;  1S5K A;  1XF8 A;  2PQ8 A;  1XMT A;  1RTQ A;  1YRE A;  3EY5 A;  3GKR A;  3PBB A;  3WC5 A;  4B5P B;  1Q2D A;  2BSW A;  5AG5 A;  3S6H A;  3C26 A;  4A32 A;  3PB8 X;  2PE3 A;  2C27 A;  5J8C A;  4PK2 A;  2ZEO A;  1Q7L A;  4JYW A;  4EWT A;  2Q0Y A;  3D2P A;  2QIR A;  2V8V A;  3BLN A;  3FYN A;  4OAE A;  1NMT A;  4B13 A;  2I3C A;  2PJ8 A;  3BJ7 A;  4X3R A;  2OZG A;  4FBE A;  5IB0 A;  1OZP A;  2V8G A;  1LAM A;  2Q43 A;  3F5B A;  2C6C A;  2QJ8 A;  3LWU A;  1Z4R A;  5F48 A;  2OOT A;  3VAT A;  4A2Z A;  5ELY A;  4CGO A;  2GE3 A;  4DYO A;  1ZG7 A;  1MK4 A;  1UWY A;  3S6G A;  3PFO A;  4EME A;  3UY5 A;  1K4J A;  2IJZ A;  3P2H A;  3WR7 A;  1XIX A;  1YLE A;  1NSL A;  2JEV A;  2GFQ A;  5G22 A;  1I12 A;  2ZEH A;  2ZOF A;  4MBU A;  3GY9 A;  2PDO A;  3S6K A;  3W6X A;  1TF9 A;  4AG7 A;  5HXD A;  2QEC A;  3KR4 A;  2ATR A;  3GUX A;  4KOS A;  3WAB A;  3EC4 A;  2PJ4 A;  5HH1 A;  4RUH A;  3LD2 A;  2AFW A;  1FNO A;  3FRM A;  4R87 A;  3LAC A;  4AVA A;  3GLJ A;  1IU8 A;  4PPZ A;  2Z0Z A;  3KGQ A;  3S9N A;  2EVN A;  2AJ6 A;  2AFU A;  3PB9 X;  4QC6 A;  2CXA A;  4CYN A;  4U5Y A;  2Z3N A;  1ARL A;  4JLY A;  4KOY A;  2VL1 A;  1ZG9 A;  4P6Y A;  4Q38 A;  2HB6 A;  4R57 A;  3TO9 A;  2DPT A;  3IIB A;  4Y49 C;  2Q4Z A;  1ZO0 A;  4P10 A;  3IGR A;  1RXT A;  1R57 A;  3KHX A;  3SI0 A;  5KTD A;  1IYL A;  4KVM E;  2GU2 A;  4ZX8 A;  3TT2 A;  5HVG A;  3ZZI A;  1XBU A;  3IFE A;  4GS4 A;  2PJ7 A;  4HPS A;  3DR6 A;  2D4O A;  1YQE A;  1XE4 A;  1LFW A;  1TKH A;  1X10 A;  3IWE A;  3TOB A;  2FL4 A;  2FT0 A;  3SHP A;  2O4H A;  2ZOG A;  2GIV A;  4K30 A;  2G0B A;  3JTK A;  2DXQ A;  2EK9 A;  3DSB A;  4KSF A;  4M6G A;  2WYR A;  2PVW A;  4Z65 A;  1UFH A;  5A28 A;  5G1Z A;  1KWM A;  1Y0Y A;  3KAS A;  5JPH A;  4MHP A;  1ZLI A;  4MY0 A;  1J4J A;  2QYV A;  2Y0M A;  5F46 A;  4PQA A;  4OID A;  3GIU A;  4IHM A;  3TCV A;  1KZF A;  3T8W A;  2Z3P A;  1IID A;  3A9L A;  4HNY B;  4FAI A;  4KVX A;  4P45 A;  4MHN A;  4O23 A;  4WJB A;  4IAV A;  2REF A;  3TFY A;  3EO4 A;  1AYE A;  2Q4V A;  2O53 A;  3NA6 A;  1ARM A;  3NH8 A;  4MCS A;  1CBX A;  1LAN A;  4F9V A;  4C2Z A;  2EUI A;  2ZEP A;  4NXY A;  2ZEL A;  4ZX9 A;  2PJ1 A;  1ON0 A;  1CPS A;  2F8H A;  1Y0R A;  2JBJ A;  2R7H A;  4UF4 A;  3F0A A;  4UIB A;  2PJ6 A;  3D67 A;  4Y49 B;  3RAM A;  3NH5 A;  4AVC A;  4CRZ B;  1BO4 A;  3FF3 A;  1P0H A;  2J9A A;  3DGV A;  1PUA A;  3VH9 A;  1Q2C A;  3IU1 A;  2V8H A;  1F2O A;  2Q44 A;  4NJR A;  4UCN A;  4UIA A;  4RS2 A;  4MFZ A;  5J1Q A;  4CGP A;  3MRU A;  4RI1 A;  3V8I A;  1I1D A;  3B7I A;  3SXN A;  2YGW A;  4KOX A;  4KOU A;  1FT7 A;  2CY2 A;  2G3A A;  2PJ0 A;  3I3G A;  4OME A;  4R3K A;  2OB0 A;  4X2T A;  4RN7 A;  4UFW A;  3GB0 A;  3SJF A;  4DUK A;  2PRQ A;  5G21 A;  2PJ9 A;  3BI1 A;  5LYD A;  1XOV A;  2AFZ A;  1PYT B;  1WWZ A;  2P6F A;  3CXS A;  4NEX A;  3IWW A;  4B11 A;  2ZXV A;  2VZY A;  4P4I A;  4CAF A;  2PR1 A;  4TNU A;  2I00 A;  4BIN A;  2BEI A;  2BO9 A;  4P4J A;  1QMU A;  4LX9 A;  1GYT A;  3FIX A;  3KL9 A;  1N71 A;  5I0C A;  3G3S A;  3TX8 A;  2QVP A;  4JXR A;  4M6H A;  1KUX A;  3FH4 A;  5EC4 A;  4CAX A;  4KOR A;  4E2A A;  4HKF A;  4Q7A A;  2C6G A;  3H4Q A;  3V7Z A;  4QVT A;  3MN8 A;  1Q2Y A;  4K3N A;  2ZEE A;  4KOT A;  5HMN A;  3ISX A;  1ELL P;  1LCP A;  4FD4 A;  1CP6 A;  2WZN A;  4R8F A;  3CDX A;  4IUS A;  5BWA B;  1QSN A;  3D2M A;  1IIC A;  3KZW A;  4PV6 A;  4XPK A;  5JQ4 A;  1YSJ A;  4H89 A;  5THW A;  2Q7S A;  3BJ8 A;  2B3V A;  1Y7E A;  3D7G A;  1XFO A;  4KSI A;  1VHO A;  3IEH A;  3PFE A;  2D4P A;  2OU2 A;  4LQ6 A;  1TKJ A;  4M85 A;  3NE8 A;  5AG4 A;  5J8F A;  1M4L A;  2FIA A;  5D8N A;  4YFJ A;  3RZA A;  4MHY A;  4B12 A;  1F2P A;  3SJE A;  2BCO A;  2C6P A;  4R3L A;  2H5M A;  1IOI A;  4FUU A;  3PP9 A;  2PC1 A;  5H84 A;  1VKC A;  4A38 A;  1M4G A;  2Z3L A;  1HDQ A;  4MCQ A;  3B3W A;  3D7H A;  2XEG A;  4PXB A;  1IB1 E;  4UCM A;  5IX3 A;  4OC4 A;  2RFH A;  2G3T A;  3CPA A;  3B3S A;  4P44 A;  1LOK A;  1XEB A;  2P0W A;  5IV0 A;  3FJU A;  3IWG A;  3BHX A;  5C82 A;  2REE A;  5CNP A;  3D3S A;  2ARH A;  4IK2 A;  4CYQ A;  4BBH A;  4CYP A;  4PXE A;  4NGR A;  4P4D A;  1MJA A;  4ZY1 A;  3R95 A;  2BUE A;  2VXK A;  1S7N A;  5LYF A;  4YWY A;  2JDC A;  5H86 A;  1TXR A;  3W6S A;  3K2K A;  4Q36 A;  4A30 A;  5F49 A;  3R96 A;  4QBJ A;  2PSW A;  4MFP A;  4QUS A;  3B8G A;  1Z4E A;  4NFR A;  4UBR A;  3KI9 A;  2ANP A;  2NYQ A;  2PJ3 A;  3K9T A;  4FD5 A;  4ZY0 A;  1Z8X A;  2R98 A;  5CPA A;  3HUV A;  4OIW A;  4UWI A;  1L0C A;  3E0K A;  4F0X A;  5LYI A;  4B6Z A;  3I1U A;  5A27 A;  4R76 A;  3VWE A;  2AFS A;  2Z3O A;  3SJG A;  2XEJ A;  4MI4 A;  3WC6 A;  3H5Z A;  4CS0 B;  5HVF A;  4E0A A;  5IB9 A;  3TC8 A;  2Q7B A;  2I79 A;  4A94 A;  4CYO A;  4OP4 A;  3S9L A;  2G9D A;  1M4D A;  3H8E A;  4MY3 A;  2GAN A;  2HC9 A;  3KQX A;  1YX0 A;  3JVN A;  4OKO A;  2CNT A;  2YNC A;  3CXP A;  4NJQ A;  3DLJ A;  5GCN A;  2GRE A;  4UFX A;  3CZX A;  2B3U A;  1AUG A;  3FNC A;  1YGH A;  3R1K A;  2ZW7 A;  2FSR A;  3I9S A;  3QAH A;  4YU9 A;  2KCW A;  2CIJ A;  4C7I A;  1VHS A;  4B5P A;  5LRK A;  1TF8 A;  1B6B A;  1XRY A;  2FCK A;  1PU9 A;  4UEZ A;  2F5I A;  2EWB A;  3OWC A;  2HUZ A;  2YNC C;  4DNC A;  4C2Y A;  3KHZ A;  1CP7 A;  4F6A A;  2ZW6 A;  7CPA A;  2FVG A;  1BPN A;  1BAV A;  3CT9 A;  2EBJ A;  2Q04 A;  3FVL A;  1EE3 P;  1LAP A;  4U9Y A;  2PVV A;  4NF1 A;  2ZW4 A;  1QQ9 A;  4KZT A;  2FXF A;  3H8G A;  5LRG A;  5K8N A;  2EK8 A;  4R6T A;  4XNH C;  1BPM A;  2VZZ A;  1MJ9 A;  2NSM A;  1WK4 A;  1DTD A;  2B4D A;  4MMO A;  1Z8W A;  2VI7 A;  5JH9 A;  4FD6 A;  3D8P A;  4A95 A;  4AXV A;  3B3T A;  4OC1 A;  1YK3 A;  3QAY A;  1V0C A;  4G1P A;  4CAE A;  2PJ5 A;  3DR8 A;  1KUV A;  1A2Z A;  4HNX B;  2YND A;  4YGO A;  4UEE A;  4MFQ A;  5EBV A;  5EMI A;  3K9U A;  3KR5 A;  4ONW A;  5K8P A;  1S7F A;  2OR4 A;  3D4U A;  5AG7 A;  2WUU A;  2VQY A;  3NH4 A;  3D7D A;  4KOV A;  3D66 A;  1YW4 A;  3PB6 X;  1YME A;  2PJB A;  4UCP A;  2J8R A;  4KOW A;  1YLO A;  2OZH A;  2VEZ A;  4NGN A;  1JQG A;  1SQH A;  4C2X A;  3SI2 A;  5DS0 A;  1X12 A;  4YRH A;  3QNV A;  4I49 A;  3PGP A;  4ONU A;  4ZGY B;  4MRI A;  6CPA A;  5JGF A;  3ZJ0 A;  2PJC A;  4UWJ A;  1IY7 A;  1R43 A;  3D7F A;  2PR8 A;  2DPS A;  1ELM P;  4II9 A;  2ODF A;  2BL1 A;  4UEF A;  4H6U A;  5K8M A;  4B5O A;  2GLF A;  2P6G A;  3PB7 X;  2PCU A;  3SXO A;  1VHE A;  2A4N A;  1ZG8 A;  2CNS A;  1ZLH A;  2NMT A;  3VWD A;  5DWN A;  4A33 A;  4A31 A;  1S7K A;  3KQZ A;  4UFV A;  4E8O A;  4OC2 A;  1CPX A;  4ORF A;  3JUW A;  3IC1 A;  4R9M A;  1CJW A;  4BMH A;  4JD6 A;  8CPA A;  4LUA A;  2PIY A;  4XNH B;  3D68 A;  3FMC A;  3S9M A;  3W91 A;  2V8D A;  4OC0 A;  3N7Z A;  1AMP A;  4H2K A;  1QSM A;  1HEE A;  1Y9K A;  3PEI A;  2J8M A;  2PIZ A;  1FY7 A;  3IO1 A;  5LYL A;  2HQY A;  2YNE A;  2EO8 A;  3N5F A;  3VAR A;  4CAV A;  4LQG A;  3WT4 A;  2R1I A;  3DDD A;  3RYO A;  4F0Y A;  2ZEM A;  2ZED A;  3B3C A;  1Z9U A;  4P4F A;  3LMS A;  2Z11 A;  3G8W A;  4OC5 A;  2B4D B;  4KLW A;  3JRU A;  2B58 A;  3QB8 A;  2WPW A;  4NCZ A;  2CTC A;  3FEC A;  4FD7 A;  3CXQ A;  2ZEG A;  2XEI A;  3EFA A;  1DE4 C;  2RC4 A;  1GHE A;  2GLJ A;  3DNS A;  3L2N A;  4J3G A;  4B10 A;  2XEF A;  4P4B A;  3R9E A;  3NFZ A;  4ZYQ A;  4U9Z A;  4MFK A;  2ABZ A;  2Q51 A;  3TO7 A;  1XMB A;  2R8V A;  3FEE A;  4MXU A;  2BOA A;  1NSA A;  4JZ0 A;  3SI1 A;  5AG6 A;  4NGT A;  2AE6 A;  2ZEN A;  4MFJ A;  4AB7 A;  5HVH A;  4BD9 A;  2AFM A;  2HV2 A;  1HDU A;  2JDD A;  3PRT A;  5G20 A;  3R9F A;  3FBU A;  4R7M A;  2WPX A;  2P6E A;  1TKF A;  3RO0 A;  1BLL E;  1U6M A;  1KUY A;  2ZW5 A;  3MGD A;  4XPL A;  1XJO A;  3IU2 A;  4PXC A;  4EVY A;  2CF4 A;  1QSR A;  2O28 A;  2J8N A;  4ZI6 A;  2OH1 A;  2IMO A;  4M3S A;  4A37 A;  4W9Y A;  4JWP A;  3IJ3 A;  5AGE A;  2DF5 A;  2CNM A;  3FXT A;  4HNW B;  4MFL A;  4ZY2 A;  2F7V A;  2Z3M A;  5KTA A;  1F57 A;  4C7H A;  4PSW A;  4FWU A;  5KTC A;  2CTB A;  3RBU A;  3RNZ A;  1PCA A;  3PB4 X;  1R3N A;  4JXQ A;  4KUB A;  4M6I A;  1IYK A;  4TWE A;  1YVO A;  2RB7 A;  3F8K A;  3KKW A;  3PZJ A;  2B5G A;  3FX6 A;  4XPD C;  3TE4 A;  4H6Z A;  4L8A A;  3NE7 A;  5C88 A;  1S3Z A;  2C1C A;  2WSA A;  4KLV A;  4CRY B;  1M1D A; 
#chains in the Genus database with same CATH homology
 3T90 A;  4B14 A;  3GYA A;  2OZU A;  2PRB A;  3T9Y A;  4PK3 A;  2X7B A;  4KSA A;  3LOD A;  2JLM A;  3TTH A;  4CGN A;  1QSO A;  4X5K A;  4CAW A;  1QST A;  2FE7 A;  2FIW A;  1YVK A;  1M44 A;  4MJ8 A;  4NSQ A;  5FVJ A;  3TOA A;  4AVB A;  4CGL A;  4CGM A;  4L89 A;  4KS9 A;  4C68 A;  1Y9W A;  5E96 A;  1RO5 A;  1I21 A;  1MJB A;  1NE9 A;  5ISV A;  3S6F A;  2ZPA A;  4AG9 A;  2K5T A;  4IF5 A;  1BOB A;  1Y7R A;  1S7L A;  2Q4Y A;  4JJX A;  2FS5 A;  3EXN A;  4QB9 A;  1YR0 A;  4PSX A;  4XPD B;  4UA3 A;  2IL4 A;  1S60 A;  1B87 A;  1LRZ A;  4KVO E;  4OLL A;  4KUA A;  1P4N A;  2QML A;  1M4I A;  3FB3 A;  3P2F A;  4OAD A;  2B4B A;  3R9G A;  1TIQ A;  4MHD A;  2VBQ A;  3TO6 A;  5DWM A;  2B5G B;  5F47 A;  1CM0 A;  4ZBG A;  2Z3K A;  2Z10 A;  1S5K A;  1XF8 A;  2PQ8 A;  1XMT A;  1YRE A;  3EY5 A;  3GKR A;  4B5P B;  1Q2D A;  2BSW A;  5AG5 A;  3S6H A;  3C26 A;  4A32 A;  2C27 A;  5J8C A;  4PK2 A;  2Q0Y A;  3D2P A;  2QIR A;  3BLN A;  3FYN A;  4OAE A;  1NMT A;  4B13 A;  5IB0 A;  3BJ7 A;  2OZG A;  1OZP A;  3F5B A;  5F48 A;  1Z4R A;  4CGO A;  4A2Z A;  2GE3 A;  1MK4 A;  3S6G A;  3UY5 A;  1K4J A;  3P2H A;  3WR7 A;  1XIX A;  1YLE A;  1NSL A;  2JEV A;  5G22 A;  1I12 A;  4MBU A;  3GY9 A;  2PDO A;  3S6K A;  3W6X A;  4AG7 A;  2QEC A;  2ATR A;  4KOS A;  3EC4 A;  5HH1 A;  3LD2 A;  4R87 A;  3FRM A;  4AVA A;  2Z0Z A;  2EVN A;  2AJ6 A;  4QC6 A;  2CXA A;  4CYN A;  4U5Y A;  2Z3N A;  4JLY A;  4KOY A;  4Q38 A;  4R57 A;  3TO9 A;  2DPT A;  4Y49 C;  1ZO0 A;  3IGR A;  1RXT A;  1R57 A;  5KTD A;  1IYL A;  4KVM E;  3TT2 A;  3ZZI A;  4GS4 A;  3DR6 A;  2D4O A;  1XE4 A;  3IWE A;  3TOB A;  2FL4 A;  2FT0 A;  3SHP A;  2GIV A;  4K30 A;  2G0B A;  3JTK A;  2DXQ A;  4KSF A;  3DSB A;  1UFH A;  5A28 A;  5G1Z A;  5JPH A;  4MY0 A;  1J4J A;  2Y0M A;  5F46 A;  3TCV A;  1KZF A;  2Z3P A;  1IID A;  3A9L A;  4HNY B;  4KVX A;  2REF A;  3TFY A;  3EO4 A;  2Q4V A;  4C2Z A;  2EUI A;  4NXY A;  1ON0 A;  2R7H A;  4A30 A;  4Y49 B;  4AVC A;  3F0A A;  4F0Y A;  4CRZ B;  1BO4 A;  1P0H A;  1PUA A;  1Q2C A;  3IU1 A;  2Q44 A;  4UCN A;  4RS2 A;  4MFZ A;  4CGP A;  4RI1 A;  3V8I A;  1I1D A;  3SXN A;  2YGW A;  4KOX A;  4KOU A;  2CY2 A;  2G3A A;  3I3G A;  4R3K A;  2OB0 A;  4UFW A;  5G21 A;  1WWZ A;  2P6F A;  3CXS A;  4NEX A;  4B11 A;  2ZXV A;  2VZY A;  4CAF A;  2PR1 A;  2I00 A;  2BEI A;  4LX9 A;  3FIX A;  5I0C A;  1N71 A;  3G3S A;  4JXR A;  1KUX A;  5EC4 A;  4CAX A;  4KOR A;  4E2A A;  4HKF A;  3H4Q A;  4QVT A;  1Q2Y A;  4KOT A;  5HMN A;  4FD4 A;  4IUS A;  5BWA B;  1QSN A;  3D2M A;  1IIC A;  4PV6 A;  5JQ4 A;  4H89 A;  3BJ8 A;  2B3V A;  2D4P A;  2OU2 A;  4M85 A;  5AG4 A;  5J8F A;  2FIA A;  4YFJ A;  4B12 A;  4R3L A;  2H5M A;  3PP9 A;  2PC1 A;  5H84 A;  1VKC A;  1M4G A;  2Z3L A;  1IB1 E;  4UCM A;  5IX3 A;  2G3T A;  1XEB A;  2P0W A;  5IV0 A;  3IWG A;  5C82 A;  2REE A;  5CNP A;  3D3S A;  2ARH A;  4CYQ A;  4BBH A;  4CYP A;  1MJA A;  3R95 A;  2BUE A;  2VXK A;  1S7N A;  2JDC A;  5H86 A;  3W6S A;  4Q36 A;  5F49 A;  3R96 A;  2PSW A;  4MFP A;  4QUS A;  3B8G A;  1Z4E A;  4UBR A;  4FD5 A;  2R98 A;  4UWI A;  1L0C A;  3E0K A;  4F0X A;  5A27 A;  3VWE A;  2Z3O A;  4MI4 A;  4CS0 B;  3H5Z A;  4E0A A;  2Q7B A;  2I79 A;  4CYO A;  1M4D A;  4MY3 A;  2GAN A;  1YX0 A;  3JVN A;  4QBJ A;  2CNT A;  2YNC A;  3CXP A;  5GCN A;  4UFX A;  2B3U A;  3R1K A;  1YGH A;  3FNC A;  2ZW7 A;  2FSR A;  3I9S A;  3QAH A;  2KCW A;  4C7I A;  1VHS A;  4B5P A;  1B6B A;  2FCK A;  1PU9 A;  2F5I A;  3OWC A;  2HUZ A;  2YNC C;  4DNC A;  4C2Y A;  4F6A A;  2ZW6 A;  2Q04 A;  4U9Y A;  4NF1 A;  2ZW4 A;  4KZT A;  2FXF A;  4XNH C;  2VZZ A;  1MJ9 A;  1WK4 A;  2B4D A;  2VI7 A;  4FD6 A;  3D8P A;  4A95 A;  1YK3 A;  1V0C A;  4CAE A;  3DR8 A;  1KUV A;  4HNX B;  2YND A;  4YGO A;  4MFQ A;  5EBV A;  3K9U A;  1S7F A;  5AG7 A;  2WUU A;  2VQY A;  4KOV A;  4UCP A;  2J8R A;  4KOW A;  2OZH A;  2VEZ A;  1SQH A;  4C2X A;  4YRH A;  4I49 A;  3PGP A;  4ONU A;  4ZGY B;  3ZJ0 A;  4UWJ A;  2PR8 A;  2DPS A;  4II9 A;  2BL1 A;  4H6U A;  4B5O A;  2P6G A;  3SXO A;  2A4N A;  2CNS A;  4A33 A;  2NMT A;  3VWD A;  5DWN A;  4A31 A;  1S7K A;  4UFV A;  4E8O A;  4ORF A;  3JUW A;  4R9M A;  1CJW A;  4BMH A;  4JD6 A;  4LUA A;  4XNH B;  3W91 A;  3N7Z A;  1QSM A;  1Y9K A;  2J8M A;  1FY7 A;  2HQY A;  2YNE A;  4CAV A;  2R1I A;  3DDD A;  3RYO A;  1Z9U A;  2Z11 A;  3G8W A;  2B4D B;  4KLW A;  4NCZ A;  2B58 A;  3QB8 A;  2WPW A;  4XPK A;  4FD7 A;  3CXQ A;  3EFA A;  2RC4 A;  1GHE A;  4J3G A;  3DNS A;  4B10 A;  3R9E A;  4U9Z A;  4MFK A;  3TO7 A;  2R8V A;  5AG6 A;  2AE6 A;  4MFJ A;  4AB7 A;  2HV2 A;  3R9F A;  2JDD A;  5G20 A;  3FBU A;  2WPX A;  2P6E A;  1U6M A;  1KUY A;  2ZW5 A;  3MGD A;  4XPL A;  3IU2 A;  4EVY A;  2O28 A;  1QSR A;  2J8N A;  2OH1 A;  4M3S A;  4JWP A;  5AGE A;  2CNM A;  3FXT A;  4HNW B;  4MFL A;  5KTA A;  2Z3M A;  4C7H A;  4PSW A;  5KTC A;  4JXQ A;  4KUB A;  1IYK A;  1YVO A;  3F8K A;  3KKW A;  3PZJ A;  2B5G A;  4XPD C;  3TE4 A;  4H6Z A;  4L8A A;  3NE7 A;  5C88 A;  1S3Z A;  2WSA A;  4KLV A;  4CRY B;  1M1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...