4KOVA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefuroxime
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
b'MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Transferase
source organism Pseudomonas aeruginosa
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
total genus 44
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kovA00
4NCZA 2ZPAA 2A4NA 2REFA 4HNYB 3C26A 3TCVA 4M3SA 2BEIA 3ZJ0A 2AJ6A 4U9ZA 5FVJA 2OB0A 4MY0A 3EY5A 1SQHA 3T90A 2C27A 2BUEA 4F0YA 4K30A 4CAWA 4PSXA 5J8FA 1KUXA 3TFYA 1Y9KA 5ISVA 1RXTA 4CS0B 3DSBA 4RS2A 2FIWA 1S7LA 4JJXA 1PUAA 1MJAA 2J8RA 3R9GA 1Q2DA 1YVKA 5JPHA 2OZGA 2PDOA 5DWMA 2VEZA 1WK4A 2Q44A 3EC4A 4MBUA 3TO9A 4KOYA 1M4IA 4KUBA 1I1DA 4XNHC 3F8KA 1YR0A 4NSQA 3ZZIA 2BL1A 4UWIA 2QMLA 1S7KA 1S3ZA 3FB3A 4QUSA 2DXQA 1KZFA 1YVOA 3CXQA 4ZBGA 3BJ7A 3PGPA 3QAHA 4PSWA 4KVOE 2VZZA 1M4GA 2P6FA 5IV0A 3G8WA 2REEA 3EO4A 3OWCA 2B3VA 1PU9A 4U5YA 3LODA 5IX3A 3D2PA 2Q4VA 4HNXB 4CAVA 3QB8A 2B3UA 4AG9A 2GIVA 4PV6A 2P6GA 1XMTA 2ZXVA 4NXYA 3LD2A 2Q4YA 2FSRA 4JWPA 2J8MA 5IB0A 1VHSA 2K5TA 1I12A 4FD6A 1IIDA 4H6UA 4Y49B 3CXPA 4KLWA 1Q2YA 1S5KA 3D8PA 5HH1A 3SXNA 1IYLA 4QB9A 1Z4RA 2R98A 3TOAA 4R9MA 2OU2A 2HV2A 5CNPA 5KTCA 2Q04A 2Q7BA 5EC4A 3G3SA 4R87A 4CAXA 2F5IA 4FD4A 3VWEA 2Z10A 2FS5A 2ZW4A 2KCWA 2PR1A 3GKRA 5HMNA 1QSMA 2Z0ZA 4R3LA 5F49A 1QSOA 4AVAA 3FXTA 4OADA 2P6EA 2Z11A 5F48A 1MK4A 2D4PA 2QECA 3MGDA 3V8IA 3N7ZA 4R57A 4YFJA 1B6BA 1S7NA 4KZTA 3DR6A 2PC1A 4M85A 1QSTA 4ONUA 2GE3A 2ZW7A 1U6MA 3W91A 3WR7A 3DDDA 4JXQA 2R1IA 3BJ8A 4KOVA 3K9UA 2CNSA 5H84A 3E0KA 2G3TA 2X7BA 4KOXA 2OH1A 2QIRA 2JDDA 4B5OA 4H89A 4LUAA 1WWZA 3R96A 1KUYA 3TT2A 2B58A 4FD5A 2JDCA 1MJBA 3NE7A 3S6GA 5I0CA 3P2FA 3EXNA 2B4BA 2RC4A 3EFAA 1IB1E 4EVYA 4E8OA 3FBUA 4OLLA 2PSWA 2I79A 2WPWA 1P0HA 4I49A 4MHDA 3TOBA 3BLNA 3I9SA 5H86A 1V0CA 2EUIA 3W6XA 4II9A 2FE7A 2FT0A 1YX0A 5GCNA 4KOSA 1NMTA 2FIAA 4Y49C 2H5MA 4PK3A 1BO4A 4KLVA 2O28A 1YLEA 1XEBA 5F47A 4HNWB 3P2HA 4NEXA 5J8CA 1R57A 1NSLA 2PRBA 1YK3A 5F46A 1I21A 1S60A 1Z9UA 4ORFA 3R9FA 3FRMA 3KKWA 3SHPA 4B5PB 2R7HA 3F0AA 3R9EA 3VWDA 3UY5A 4UBRA 5EBVA 2OZUA 1VKCA 1FY7A 2BSWA 5KTDA 4AVCA 4KORA 4MY3A 1J4JA 3DNSA 4DNCA 4PK2A 3D2MA 3H4QA 3PZJA 3FYNA 2B4DB 4YRHA 4MI4A 3TE4A 2B5GA 4XPDB 3S6FA 4X5KA 1L0CA 1YREA 2B5GB 1N71A 1UFHA 2EVNA 4AVBA 4XNHB 1M1DA 3R1KA 2D4OA 1M44A 2PR8A 3JVNA 4LX9A 4U9YA 1M4DA 4H6ZA 5E96A 4J3GA 2CNMA 2VBQA 5C82A 2HQYA 3JUWA 3PP9A 1IYKA 4KVME 4KOTA 1S7FA 4IUSA 4UWJA 4IF5A 2I00A 4QC6A 2OZHA 4XPDC 1GHEA 3F5BA 4OAEA 4FD7A 3TTHA 2FL4A 1YGHA 1CJWA 4MJ8A 3TO6A 4L89A 2GANA 2JLMA 2JEVA 1XIXA 3T9YA 5C88A 2VZYA 1MJ9A 1Y9WA 1Y7RA 2VXKA 1RO5A 4BMHA 1QSRA 1IICA 3CXSA 2Y0MA 3W6SA 2VQYA 2CNTA 1BOBA 2FCKA 4B5PA 2B4DA 2ZW5A 2R8VA 1XE4A 1Z4EA 2NMTA 2G3AA 3FIXA 4KOWA 3S6HA 4UA3A 3GY9A 4CRYB 4JXRA 4AG7A 4GS4A 1OZPA 1ON0A 3IGRA 4RI1A 3B8GA 1XF8A 2Q0YA 5KTAA 2CY2A 3S6KA 1CM0A 4YGOA 4JD6A 2P0WA 1K4JA 1LRZA 4F6AA 3R95A 4R3KA 4L8AA 3SXOA 2VI7A 4QVTA 4XPLA 4E0AA 2FXFA 1P4NA 4E2AA 1NE9A 5DWNA 4KUAA 1Q2CA 4CRZB 2IL4A 2WPXA 4AB7A 2G0BA 1QSNA 4QBJA 3FNCA 2ZW6A 1B87A 3I3GA 4KVXA 2HUZA 4NF1A 2AE6A 3DR8A 3GYAA 3IWGA 5JQ4A 4JLYA 2ARHA 1KUVA 2ATRA 3D3SA 4XPKA 3RYOA 3TO7A 2PQ8A 2J8NA 4HKFA 4KOUA 1TIQA
chains in the Genus database with same CATH superfamily
4NCZA 2QJ8A 2ZPAA 2A4NA 4IHMA 2AFUA 2REFA 4HNYB 3C26A 3KL9A 3TCVA 3WC5A 4M3SA 2BEIA 5HXDA 4DYOA 3ZJ0A 3D4UA 1DE4C 2AJ6A 2ZEDA 4MRIA 4U9ZA 4MFZA 5FVJA 2OB0A 4MY0A 3EY5A 3S9NA 1YMEA 5LRKA 4A33A 2PVVA 3DLJA 4EMEA 4OMEA 1SQHA 3A9LA 3KQXA 4UEFA 3FH4A 2C27A 3T90A 2BUEA 4FBEA 1Y0RA 2AFOA 4NGMA 4F0YA 2CIJA 3JRUA 4K30A 4MHYA 2CF4A 3FX6A 4PSXA 4CAWA 1KUXA 5J8FA 3TFYA 1Y9KA 3GB0A 5ISVA 1RXTA 2PVWA 4CS0B 1H8LA 2ZOGA 3DSBA 3PEIA 4RS2A 3KR4A 1IOIA 3CPAA 4MHPA 2AFZA 1Z8TA 2FIWA 1S7LA 4OC0A 4R7MA 4JJXA 5JH9A 1PUAA 1MJAA 2GLJA 2J8RA 2Z3NA 4WJBA 3RAMA 8CPAA 4KSIA 2EO8A 3R9GA 4A2ZA 3IJ3A 1Q2DA 3KQZA 1YVKA 5JPHA 2PJ5A 2OZGA 5AG6A 5JGFA 3KI9A 1XRYA 2DPTA 2DPSA 5F09A 2PDOA 5DWMA 2VEZA 1WK4A 2Q44A 1Z8LA 4UFVA 5IX3A 4MFKA 4UIAA 3EC4A 4WWVA 1A2ZA 4MBUA 3TO9A 4YWYA 4A31A 3SJFA 4KOYA 3SI1A 4NGPA 5A28A 1M4IA 2O4HA 4KUBA 1I1DA 5LRGA 4XNHC 4KSAA 3F8KA 1YR0A 1ZG9A 4NSQA 2AFWA 2BL1A 3ZZIA 3IU1A 4UWIA 2QMLA 4UEEA 5CPAA 2PJ4A 1S7KA 1HDQA 1S3ZA 3FB3A 4QUSA 4ZYQA 5LYFA 2Z3OA 2DXQA 3D7DA 3PRTA 3HLPA 5G22A 1CX8A 1KZFA 4UEZA 3FMCA 2XEGA 1LANA 5G20A 1YVOA 2Q43A 2ZEGA 1YW4A 3CXQA 3ISZA 3K2KA 4ZBGA 3BJ7A 3PGPA 3QAHA 2IJZA 2QVPA 2WZNA 2ZEOA 3D68A 3NFZA 2PJ9A 4KVOE 2VZZA 2C6CA 1M4GA 3NE8A 1YLOA 2P6FA 5IV0A 3G8WA 2REEA 3EO4A 3OWCA 3SJXA 2B3VA 1PU9A 1LCPA 4U5YA 3V38A 4A30A 3LODA 1VGYA 4MHZA 1QMUA 3K9TA 1BLLE 3D2PA 2Q4VA 4Q38A 4C7IA 4DUKA 5LRJA 2GLFA 3H8GA 4PXCA 4HNXB 4CAVA 3QB8A 4OC3A 2B3UA 4AG9A 2EK8A 2GIVA 4IAVA 4PV6A 2P6GA 1TKHA 5G1ZA 4FAIA 1XMTA 2ZXVA 4F9UA 3PB6X 4M6IA 3D7FA 4NXYA 4C2ZA 3LD2A 4B12A 2Q4YA 2FSRA 2IMOA 3LMSA 4JWPA 3WT4A 3S9LA 1ARLA 2J8MA 4MFJA 1LAPA 2NYQA 5IB0A 5HVGA 1VHSA 4ZY0A 4UFXA 2ZENA 2K5TA 4MFLA 1I12A 1UWYA 2AFSA 4FD6A 5D8NA 3SI2A 1IIDA 4H6UA 4Y49B 2NSMA 2PJ6A 3CXPA 4KLWA 1Q2YA 1S5KA 3D8PA 5HH1A 3SXNA 1IYLA 4QB9A 3RNZA 4ZY1A 3CDXA 4B6ZA 1Z4RA 4ZGYB 2R98A 4CGLA 3TOAA 5K8MA 4R9MA 2V8VA 3IWEA 2OU2A 4A94A 2HV2A 7CPAA 2JEWA 5CNPA 5KTCA 2Q04A 3RBUA 3PFEA 1R43A 1IOFA 3IO1A 4R76A 2Q7BA 4LQ6A 1F57A 5EC4A 3G3SA 4R87A 2YNCC 3IFEA 1CP6A 4CAXA 2F5IA 2V8DA 4RN7A 4FD4A 5K8PA 2BOAA 4CYQA 3VWEA 2Z10A 2FS5A 2ZW4A 4X8IA 2KCWA 4C2YA 4P4IA 3KHXA 3B3SA 2PR1A 3GKRA 5HMNA 4BINA 4EWTA 1QSMA 4Z65A 3PFOA 4RUHA 2Z0ZA 4ONWA 1F2OA 4PXEA 4R3LA 5F49A 1Z5RA 2ZELA 1QSOA 1M4LA 4AVAA 3FXTA 5BWAB 2CTCA 2P6EA 3B3CA 1TF8A 2Z11A 2J9AA 3DGVA 2AFMA 4OADA 5F48A 1MK4A 2D4PA 3GIUA 3PBEA 4NGQA 2QECA 4ZY2A 2ZEEA 3NH5A 4A39A 3MGDA 5LYDA 3V8IA 3N7ZA 4R57A 2F8HA 5HVFA 1B6BA 1S7NA 4KZTA 4YFJA 3DR6A 1ZLIA 2PC1A 1XBUA 4M85A 1QSTA 3N5FA 4ONUA 4C68A 3SJGA 3KHZA 4NJRA 4B11A 4JZ0A 2RB7A 2GE3A 1NSAA 1U6MA 1F2PA 2ZW7A 3W91A 4ZI6A 3WR7A 2HB6A 3DDDA 3NH8A 1CP7A 4JXQA 2R1IA 2ODFA 3BJ8A 1XFOA 1YQEA 1OBRA 3QNVA 4KOVA 3K9UA 2PE3A 3SI0A 2CNSA 3CT9A 1R3NA 4X3RA 1ELLP 5H84A 3E0KA 2G3TA 5CBMA 2X7BA 4OKOA 4OC1A 1HDUA 4KOXA 2OH1A 2QIRA 2JDDA 4B5OA 4NGTA 3IWWA 3WABA 4H89A 2BO9A 4LUAA 2ZEHA 5HVHA 3MRUA 1WWZA 2IQ6A 5K8NA 3R96A 1KUYA 1RTQA 4TWEA 3TT2A 2B58A 4FD5A 2JDCA 4CAFA 1MJBA 2PRQA 4NFRA 3NE7A 1ZLHA 4A95A 3S6GA 5I0CA 1YW6A 3P2FA 3EXNA 3FEDA 2B4BA 2RC4A 3EFAA 1IB1E 2EK9A 4EVYA 4E8OA 2Q4ZA 2OOTA 1VIXA 3FBUA 4OLLA 2PSWA 2I79A 1ZO0A 2WPWA 1P0HA 4MMOA 4I49A 4MHDA 4P4DA 3TOBA 3BLNA 1PCAA 3I9SA 4P6YA 5H86A 2JBKA 1V0CA 2EUIA 3W6XA 1ELMP 2FE7A 2XEFA 3VARA 4II9A 2FT0A 2C6GA 4F8ZA 1YX0A 5GCNA 5G21A 4KOSA 1NMTA 2FIAA 4Y49C 2H5MA 4PK3A 1BO4A 2PJ1A 4KLVA 2O28A 1YLEA 1XEBA 1Y0YA 5F47A 1GYTA 4HNWB 1IU8A 1X12A 3MN8A 3P2HA 4NEXA 1VHOA 4O23A 5J8CA 3ISXA 1R57A 1NSLA 2PJBA 2PRBA 1YK3A 4CGNA 5F46A 3PB8X 1I21A 1S60A 1Z9UA 4H2KA 3PB4X 3RZAA 1IY7A 2XEIA 2XEJA 2G9DA 2PJ3A 2QYVA 4UFWA 3KR5A 4OC2A 4Q7AA 1BPMA 3FEEA 4ORFA 5AGEA 3QAYA 1YSJA 3R9FA 3FRMA 4P44A 3KKWA 3SHPA 1HEEA 4B5PB 2R7HA 6CPAA 2O53A 2Q51A 3F0AA 2F7VA 3R9EA 3VWDA 3UY5A 4UBRA 4JYWA 4P45A 5EBVA 3GLJA 3SJEA 2OZUA 2YNDA 4B10A 1VKCA 5J1QA 4P4BA 1FY7A 4HPSA 4CPAA 2BSWA 4P4FA 5KTDA 4OC5A 4AVCA 1AUGA 4OIWA 4KORA 4MY3A 4OC4A 1J4JA 4F0XA 3DNSA 4DNCA 4PK2A 3D2MA 2I3CA 2WYRA 5THWA 2RFHA 3H4QA 3PZJA 3FYNA 2B4DB 4FWUA 1PYTB 2GFQA 4YRHA 4MI4A 3TE4A 1CBXA 2B5GA 4R8FA 4XPDB 4PPZA 3VH9A 4GXHA 3S6FA 2YNEA 2CTBA 4X5KA 1L0CA 3D66A 4MCSA 4CAEA 1YREA 2B5GB 4NGNA 5IB9A 2Q7SA 1Z2LA 1Q7LA 4GM5A 4PXDA 3I1UA 3LACA 2PCUA 1N71A 1FNOA 1UFHA 3B35A 2EVNA 4CGPA 4AVBA 4XNHB 2PJ7A 1TKJA 1M1DA 3R1KA 2D4OA 4AXVA 1M44A 3HUVA 3LWUA 4M6HA 2PR8A 1ARMA 3JVNA 4LX9A 4U9YA 3TX8A 2PIYA 1M4DA 2V8GA 5EMIA 4W9YA 4H6ZA 4CGMA 2ZEPA 4KS9A 5E96A 4J3GA 4KSFA 4B14A 2CNMA 1XOVA 4CGOA 3B3VA 4MCPA 2VBQA 5AG7A 5C82A 4C2XA 3H8EA 4UCMA 1TKFA 2HQYA 1LOKA 2YGWA 3JUWA 3PP9A 1IYKA 4MCQA 4KVME 1XJOA 4KOTA 1S7FA 5D29A 4P4JA 3B2YA 4IUSA 4UWJA 1X10A 4UIBA 4CYOA 4DJLA 2EWBA 3D67A 2I00A 4IF5A 3TC8A 4QC6A 2OZHA 4XPDC 1GHEA 3RO0A 2GREA 3FJUA 3F5BA 2DEAA 3IU2A 4NGSA 2Z3KA 2PJCA 2Z3PA 4FD7A 4OAEA 3TTHA 3BI1A 2FL4A 1YGHA 2AFXA 1CJWA 4MFQA 4MJ8A 4OP4A 5LYLA 1IGBA 3TO6A 3B7IA 2C6PA 3GUXA 4L89A 2GANA 1EE3P 2JLMA 1KWMA 2JEVA 5ELYA 4NGRA 1XIXA 4M6GA 2C1CA 2WUUA 3T9YA 5DS0A 5C88A 4IK2A 3D7HA 2VZYA 2POKA 1MJ9A 1TXRA 4NJQA 1Y9WA 3IEHA 3KASA 2PJ0A 2HC9A 4F9VA 2V77A 3H5ZA 1XMBA 2VL1A 3D7GA 2V8HA 1Y7RA 2VXKA 1RO5A 2GU2A 1QSRA 4BMHA 1IICA 3CXSA 5K8OA 2Y0MA 1DTDA 2YNCA 4MCRA 3VATA 3W6SA 2VQYA 3KGQA 1ZG7A 4MFPA 2CNTA 1BOBA 2ZOFA 2FCKA 4B5PA 2B4DA 1LFWA 2Z3MA 2ZW5A 2R8VA 1XE4A 3B3WA 3CZXA 1CPSA 1Z4EA 2NMTA 2G3AA 1LAMA 3FIXA 1TF9A 4KOWA 3S6HA 3IC1A 1Z8XA 2ABZA 2JBJA 4UA3A 3GY9A 2DF5A 4OIDA 4CRYB 4JXRA 4AG7A 3WC7A 4GS4A 1OZPA 2ANPA 3BI0A 4MXUA 3V7ZA 2WSAA 5A27A 1ON0A 4A32A 1QQ9A 3IGRA 4PSWA 4RI1A 4CYNA 3B8GA 4UCPA 3BHXA 1XF8A 2Q0YA 1Y7EA 5AG5A 5KTAA 4C7HA 1CPXA 2PIZA 3KZWA 3FF3A 3H8FA 3PB7X 3FVLA 2CY2A 4UCNA 3S6KA 5AG4A 1CM0A 4YGOA 4EFDA 1CG2A 4G1PA 4JD6A 2P0WA 4R6TA 2CXAA 1AYEA 1K4JA 2PJ8A 4UF4A 1LRZA 2FVGA 3T8WA 1JQGA 3B3TA 5LYIA 4F6AA 3R95A 4R3KA 4L8AA 3SXOA 1Z8WA 3S9MA 2VI7A 4P10A 4QVTA 4XPLA 4A37A 1FT7A 4E0AA 3CPXA 1BAVA 4CYPA 2FXFA 5JM6A 1JWQA 5I4MA 1P4NA 4E2AA 1NE9A 5DWNA 4KUAA 3FECA 1Q2CA 4CRZB 2PJ2A 4Q36A 4K3NA 4ZX9A 2IL4A 3NH4A 2WPXA 4AB7A 2G0BA 1QSNA 4QBJA 2EBJA 2PJAA 3FNCA 2ZW6A 1B87A 3I3GA 3IIBA 4KVXA 2HUZA 4A38A 3L2NA 2OR4A 2AE6A 3DR8A 4NF1A 4ZX8A 3GYAA 4TNUA 3IWGA 5JQ4A 1ZG8A 2ZEMA 4PQAA 4JLYA 4PXBA 3WC6A 2ARHA 2BCOA 1KUVA 2ATRA 3D3SA 4FUUA 4XPKA 3PB9X 1AMPA 1BPNA 4LQGA 2Z3LA 3RYOA 4BBHA 4MHNA 4X2TA 4B13A 4P4EA 3TO7A 1VHEA 3BXMA 3NA6A 3PBBA 4BD9A 2PQ8A 3JTKA 2J8NA 2ZEFA 4HKFA 4KOUA 1TIQA 4YU9A
chains in the Genus database with same CATH topology
4NCZA 2ZPAA 2A4NA 2REFA 4HNYB 3C26A 3TCVA 4M3SA 2BEIA 3ZJ0A 2AJ6A 4U9ZA 4MFZA 5FVJA 2OB0A 4MY0A 3EY5A 4A33A 1SQHA 3A9LA 3T90A 2C27A 2BUEA 4F0YA 4K30A 4CAWA 4PSXA 5J8FA 1KUXA 3TFYA 1Y9KA 5ISVA 1RXTA 4CS0B 3DSBA 4RS2A 2FIWA 1S7LA 4JJXA 1PUAA 1MJAA 2J8RA 2Z3NA 3R9GA 4A2ZA 1Q2DA 1YVKA 5JPHA 2OZGA 5AG6A 2DPTA 2DPSA 2PDOA 5DWMA 2VEZA 1WK4A 2Q44A 4UFVA 4MFKA 3EC4A 4MBUA 3TO9A 4A31A 4KOYA 5A28A 1M4IA 4KUBA 1I1DA 4XNHC 4KSAA 3F8KA 1YR0A 4NSQA 3ZZIA 2BL1A 3IU1A 4UWIA 2QMLA 1S7KA 1S3ZA 3FB3A 4QUSA 2Z3OA 2DXQA 1KZFA 5G20A 1YVOA 3CXQA 4ZBGA 3BJ7A 3PGPA 3QAHA 4PSWA 4KVOE 2VZZA 1M4GA 2P6FA 5IV0A 3G8WA 2REEA 3EO4A 3OWCA 4A30A 2B3VA 1PU9A 4U5YA 3LODA 5IX3A 3D2PA 2Q4VA 4Q38A 4C7IA 4HNXB 4CAVA 3QB8A 2B3UA 4AG9A 2GIVA 4PV6A 2P6GA 5G1ZA 1XMTA 2ZXVA 4NXYA 4C2ZA 3LD2A 4B12A 2Q4YA 2FSRA 4JWPA 2J8MA 4MFJA 5IB0A 1VHSA 4UFXA 2K5TA 4MFLA 1I12A 4FD6A 1IIDA 4H6UA 4Y49B 3CXPA 4KLWA 1Q2YA 1S5KA 3D8PA 5HH1A 3SXNA 1IYLA 4QB9A 4ZGYB 1Z4RA 2R98A 4CGLA 3TOAA 4R9MA 3IWEA 2OU2A 2HV2A 5CNPA 5KTCA 2Q04A 2Q7BA 5EC4A 3G3SA 4R87A 2YNCC 4CAXA 2F5IA 4FD4A 4CYQA 3VWEA 2Z10A 2FS5A 2ZW4A 2KCWA 4C2YA 2PR1A 3GKRA 5HMNA 1QSMA 2Z0ZA 4R3LA 5F49A 1QSOA 4AVAA 3FXTA 5BWAB 4OADA 2P6EA 2Z11A 5F48A 1MK4A 2D4PA 2QECA 3MGDA 3V8IA 3N7ZA 4R57A 4YFJA 1B6BA 1S7NA 4KZTA 3DR6A 2PC1A 4M85A 1QSTA 4ONUA 4C68A 4B11A 2GE3A 2ZW7A 1U6MA 3W91A 3WR7A 3DDDA 4JXQA 2R1IA 3BJ8A 4KOVA 3K9UA 2CNSA 5H84A 3E0KA 2G3TA 2X7BA 4KOXA 2OH1A 2QIRA 2JDDA 4B5OA 4H89A 4LUAA 1WWZA 3R96A 1KUYA 3TT2A 2B58A 4FD5A 2JDCA 4CAFA 1MJBA 3NE7A 4A95A 3S6GA 5I0CA 3P2FA 3EXNA 2B4BA 2RC4A 3EFAA 1IB1E 4EVYA 4E8OA 3FBUA 4OLLA 2PSWA 2I79A 1ZO0A 2WPWA 1P0HA 4I49A 4MHDA 3TOBA 3BLNA 3I9SA 5H86A 1V0CA 2EUIA 3W6XA 4II9A 2FE7A 2FT0A 1YX0A 5GCNA 5G21A 4KOSA 1NMTA 2FIAA 4Y49C 2H5MA 4PK3A 1BO4A 4KLVA 2O28A 1YLEA 1XEBA 5F47A 4HNWB 3P2HA 4NEXA 5J8CA 1R57A 1NSLA 2PRBA 1YK3A 4CGNA 5F46A 1I21A 1S60A 1Z9UA 4UFWA 4ORFA 5AGEA 3R9FA 3FRMA 3KKWA 3SHPA 4B5PB 2R7HA 3F0AA 3R9EA 3VWDA 3UY5A 4UBRA 5EBVA 2OZUA 2YNDA 4B10A 1VKCA 1FY7A 2BSWA 5KTDA 4AVCA 4KORA 4MY3A 1J4JA 4F0XA 3DNSA 4DNCA 4PK2A 3D2MA 3H4QA 3PZJA 3FYNA 2B4DB 4YRHA 4MI4A 3TE4A 2B5GA 4XPDB 3S6FA 2YNEA 4X5KA 1L0CA 4CAEA 1YREA 2B5GB 1N71A 1UFHA 4CGPA 2EVNA 4AVBA 4XNHB 1M1DA 3R1KA 2D4OA 1M44A 2PR8A 3JVNA 4LX9A 4U9YA 1M4DA 4H6ZA 4CGMA 4KS9A 5E96A 4J3GA 4KSFA 4B14A 2CNMA 4CGOA 2VBQA 5AG7A 5C82A 4C2XA 4UCMA 2HQYA 2YGWA 3JUWA 3PP9A 1IYKA 4KVME 4KOTA 1S7FA 4IUSA 4UWJA 4CYOA 4IF5A 2I00A 4QC6A 2OZHA 4XPDC 1GHEA 3IU2A 5G22A 3F5BA 4OAEA 2Z3KA 2Z3PA 4FD7A 3TTHA 2FL4A 1YGHA 1CJWA 4MFQA 4MJ8A 3TO6A 4L89A 2GANA 2JLMA 2JEVA 1XIXA 3T9YA 2WUUA 5C88A 2VZYA 1MJ9A 1Y9WA 3H5ZA 1Y7RA 2VXKA 1RO5A 4BMHA 1QSRA 1IICA 3CXSA 2Y0MA 2YNCA 3W6SA 2VQYA 4MFPA 2CNTA 1BOBA 2FCKA 4B5PA 2B4DA 2Z3MA 2ZW5A 2R8VA 1XE4A 1Z4EA 2NMTA 2G3AA 3FIXA 4KOWA 3S6HA 4UA3A 3GY9A 4CRYB 4JXRA 4AG7A 4GS4A 1OZPA 2WSAA 5A27A 1ON0A 4A32A 3IGRA 4RI1A 4CYNA 3B8GA 4UCPA 1XF8A 2Q0YA 5AG5A 5KTAA 4C7HA 4UCNA 2CY2A 3S6KA 5AG4A 1CM0A 4YGOA 4JD6A 2P0WA 2CXAA 1K4JA 1LRZA 4F6AA 3R95A 4R3KA 4L8AA 3SXOA 2VI7A 4QVTA 4XPLA 4E0AA 4CYPA 2FXFA 1P4NA 4E2AA 1NE9A 5DWNA 4KUAA 1Q2CA 4CRZB 4Q36A 2IL4A 2WPXA 4AB7A 2G0BA 1QSNA 4QBJA 3FNCA 2ZW6A 1B87A 3I3GA 4KVXA 2HUZA 2AE6A 3DR8A 4NF1A 3GYAA 3IWGA 5JQ4A 4JLYA 2ARHA 1KUVA 2ATRA 3D3SA 4XPKA 2Z3LA 3RYOA 4BBHA 4B13A 3TO7A 2PQ8A 3JTKA 2J8NA 4HKFA 4KOUA 1TIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCZ A;  2ZPA A;  2A4N A;  2REF A;  4HNY B;  3C26 A;  3TCV A;  4M3S A;  2BEI A;  3ZJ0 A;  2AJ6 A;  4U9Z A;  5FVJ A;  2OB0 A;  4MY0 A;  3EY5 A;  1SQH A;  3T90 A;  2C27 A;  2BUE A;  4F0Y A;  4K30 A;  4CAW A;  4PSX A;  5J8F A;  1KUX A;  3TFY A;  1Y9K A;  5ISV A;  1RXT A;  4CS0 B;  3DSB A;  4RS2 A;  2FIW A;  1S7L A;  4JJX A;  1PUA A;  1MJA A;  2J8R A;  3R9G A;  1Q2D A;  1YVK A;  5JPH A;  2OZG A;  2PDO A;  5DWM A;  2VEZ A;  1WK4 A;  2Q44 A;  3EC4 A;  4MBU A;  3TO9 A;  4KOY A;  1M4I A;  4KUB A;  1I1D A;  4XNH C;  3F8K A;  1YR0 A;  4NSQ A;  3ZZI A;  2BL1 A;  4UWI A;  2QML A;  1S7K A;  1S3Z A;  3FB3 A;  4QUS A;  2DXQ A;  1KZF A;  1YVO A;  3CXQ A;  4ZBG A;  3BJ7 A;  3PGP A;  3QAH A;  4PSW A;  4KVO E;  2VZZ A;  1M4G A;  2P6F A;  5IV0 A;  3G8W A;  2REE A;  3EO4 A;  3OWC A;  2B3V A;  1PU9 A;  4U5Y A;  3LOD A;  5IX3 A;  3D2P A;  2Q4V A;  4HNX B;  4CAV A;  3QB8 A;  2B3U A;  4AG9 A;  2GIV A;  4PV6 A;  2P6G A;  1XMT A;  2ZXV A;  4NXY A;  3LD2 A;  2Q4Y A;  2FSR A;  4JWP A;  2J8M A;  5IB0 A;  1VHS A;  2K5T A;  1I12 A;  4FD6 A;  1IID A;  4H6U A;  4Y49 B;  3CXP A;  4KLW A;  1Q2Y A;  1S5K A;  3D8P A;  5HH1 A;  3SXN A;  1IYL A;  4QB9 A;  1Z4R A;  2R98 A;  3TOA A;  4R9M A;  2OU2 A;  2HV2 A;  5CNP A;  5KTC A;  2Q04 A;  2Q7B A;  5EC4 A;  3G3S A;  4R87 A;  4CAX A;  2F5I A;  4FD4 A;  3VWE A;  2Z10 A;  2FS5 A;  2ZW4 A;  2KCW A;  2PR1 A;  3GKR A;  5HMN A;  1QSM A;  2Z0Z A;  4R3L A;  5F49 A;  1QSO A;  4AVA A;  3FXT A;  4OAD A;  2P6E A;  2Z11 A;  5F48 A;  1MK4 A;  2D4P A;  2QEC A;  3MGD A;  3V8I A;  3N7Z A;  4R57 A;  4YFJ A;  1B6B A;  1S7N A;  4KZT A;  3DR6 A;  2PC1 A;  4M85 A;  1QST A;  4ONU A;  2GE3 A;  2ZW7 A;  1U6M A;  3W91 A;  3WR7 A;  3DDD A;  4JXQ A;  2R1I A;  3BJ8 A;  4KOV A;  3K9U A;  2CNS A;  5H84 A;  3E0K A;  2G3T A;  2X7B A;  4KOX A;  2OH1 A;  2QIR A;  2JDD A;  4B5O A;  4H89 A;  4LUA A;  1WWZ A;  3R96 A;  1KUY A;  3TT2 A;  2B58 A;  4FD5 A;  2JDC A;  1MJB A;  3NE7 A;  3S6G A;  5I0C A;  3P2F A;  3EXN A;  2B4B A;  2RC4 A;  3EFA A;  1IB1 E;  4EVY A;  4E8O A;  3FBU A;  4OLL A;  2PSW A;  2I79 A;  2WPW A;  1P0H A;  4I49 A;  4MHD A;  3TOB A;  3BLN A;  3I9S A;  5H86 A;  1V0C A;  2EUI A;  3W6X A;  4II9 A;  2FE7 A;  2FT0 A;  1YX0 A;  5GCN A;  4KOS A;  1NMT A;  2FIA A;  4Y49 C;  2H5M A;  4PK3 A;  1BO4 A;  4KLV A;  2O28 A;  1YLE A;  1XEB A;  5F47 A;  4HNW B;  3P2H A;  4NEX A;  5J8C A;  1R57 A;  1NSL A;  2PRB A;  1YK3 A;  5F46 A;  1I21 A;  1S60 A;  1Z9U A;  4ORF A;  3R9F A;  3FRM A;  3KKW A;  3SHP A;  4B5P B;  2R7H A;  3F0A A;  3R9E A;  3VWD A;  3UY5 A;  4UBR A;  5EBV A;  2OZU A;  1VKC A;  1FY7 A;  2BSW A;  5KTD A;  4AVC A;  4KOR A;  4MY3 A;  1J4J A;  3DNS A;  4DNC A;  4PK2 A;  3D2M A;  3H4Q A;  3PZJ A;  3FYN A;  2B4D B;  4YRH A;  4MI4 A;  3TE4 A;  2B5G A;  4XPD B;  3S6F A;  4X5K A;  1L0C A;  1YRE A;  2B5G B;  1N71 A;  1UFH A;  2EVN A;  4AVB A;  4XNH B;  1M1D A;  3R1K A;  2D4O A;  1M44 A;  2PR8 A;  3JVN A;  4LX9 A;  4U9Y A;  1M4D A;  4H6Z A;  5E96 A;  4J3G A;  2CNM A;  2VBQ A;  5C82 A;  2HQY A;  3JUW A;  3PP9 A;  1IYK A;  4KVM E;  4KOT A;  1S7F A;  4IUS A;  4UWJ A;  4IF5 A;  2I00 A;  4QC6 A;  2OZH A;  4XPD C;  1GHE A;  3F5B A;  4OAE A;  4FD7 A;  3TTH A;  2FL4 A;  1YGH A;  1CJW A;  4MJ8 A;  3TO6 A;  4L89 A;  2GAN A;  2JLM A;  2JEV A;  1XIX A;  3T9Y A;  5C88 A;  2VZY A;  1MJ9 A;  1Y9W A;  1Y7R A;  2VXK A;  1RO5 A;  4BMH A;  1QSR A;  1IIC A;  3CXS A;  2Y0M A;  3W6S A;  2VQY A;  2CNT A;  1BOB A;  2FCK A;  4B5P A;  2B4D A;  2ZW5 A;  2R8V A;  1XE4 A;  1Z4E A;  2NMT A;  2G3A A;  3FIX A;  4KOW A;  3S6H A;  4UA3 A;  3GY9 A;  4CRY B;  4JXR A;  4AG7 A;  4GS4 A;  1OZP A;  1ON0 A;  3IGR A;  4RI1 A;  3B8G A;  1XF8 A;  2Q0Y A;  5KTA A;  2CY2 A;  3S6K A;  1CM0 A;  4YGO A;  4JD6 A;  2P0W A;  1K4J A;  1LRZ A;  4F6A A;  3R95 A;  4R3K A;  4L8A A;  3SXO A;  2VI7 A;  4QVT A;  4XPL A;  4E0A A;  2FXF A;  1P4N A;  4E2A A;  1NE9 A;  5DWN A;  4KUA A;  1Q2C A;  4CRZ B;  2IL4 A;  2WPX A;  4AB7 A;  2G0B A;  1QSN A;  4QBJ A;  3FNC A;  2ZW6 A;  1B87 A;  3I3G A;  4KVX A;  2HUZ A;  4NF1 A;  2AE6 A;  3DR8 A;  3GYA A;  3IWG A;  5JQ4 A;  4JLY A;  2ARH A;  1KUV A;  2ATR A;  3D3S A;  4XPK A;  3RYO A;  3TO7 A;  2PQ8 A;  2J8N A;  4HKF A;  4KOU A;  1TIQ A; 
#chains in the Genus database with same CATH topology
 4NCZ A;  2QJ8 A;  2ZPA A;  2A4N A;  4IHM A;  2AFU A;  2REF A;  4HNY B;  3C26 A;  3KL9 A;  3TCV A;  3WC5 A;  4M3S A;  2BEI A;  5HXD A;  4DYO A;  3ZJ0 A;  3D4U A;  1DE4 C;  2AJ6 A;  2ZED A;  4MRI A;  4U9Z A;  4MFZ A;  5FVJ A;  2OB0 A;  4MY0 A;  3EY5 A;  3S9N A;  1YME A;  5LRK A;  4A33 A;  2PVV A;  3DLJ A;  4EME A;  4OME A;  1SQH A;  3A9L A;  3KQX A;  4UEF A;  3FH4 A;  2C27 A;  3T90 A;  2BUE A;  4FBE A;  1Y0R A;  2AFO A;  4NGM A;  4F0Y A;  2CIJ A;  3JRU A;  4K30 A;  4MHY A;  2CF4 A;  3FX6 A;  4PSX A;  4CAW A;  1KUX A;  5J8F A;  3TFY A;  1Y9K A;  3GB0 A;  5ISV A;  1RXT A;  2PVW A;  4CS0 B;  1H8L A;  2ZOG A;  3DSB A;  3PEI A;  4RS2 A;  3KR4 A;  1IOI A;  3CPA A;  4MHP A;  2AFZ A;  1Z8T A;  2FIW A;  1S7L A;  4OC0 A;  4R7M A;  4JJX A;  5JH9 A;  1PUA A;  1MJA A;  2GLJ A;  2J8R A;  2Z3N A;  4WJB A;  3RAM A;  8CPA A;  4KSI A;  2EO8 A;  3R9G A;  4A2Z A;  3IJ3 A;  1Q2D A;  3KQZ A;  1YVK A;  5JPH A;  2PJ5 A;  2OZG A;  5AG6 A;  5JGF A;  3KI9 A;  1XRY A;  2DPT A;  2DPS A;  5F09 A;  2PDO A;  5DWM A;  2VEZ A;  1WK4 A;  2Q44 A;  1Z8L A;  4UFV A;  5IX3 A;  4MFK A;  4UIA A;  3EC4 A;  4WWV A;  1A2Z A;  4MBU A;  3TO9 A;  4YWY A;  4A31 A;  3SJF A;  4KOY A;  3SI1 A;  4NGP A;  5A28 A;  1M4I A;  2O4H A;  4KUB A;  1I1D A;  5LRG A;  4XNH C;  4KSA A;  3F8K A;  1YR0 A;  1ZG9 A;  4NSQ A;  2AFW A;  2BL1 A;  3ZZI A;  3IU1 A;  4UWI A;  2QML A;  4UEE A;  5CPA A;  2PJ4 A;  1S7K A;  1HDQ A;  1S3Z A;  3FB3 A;  4QUS A;  4ZYQ A;  5LYF A;  2Z3O A;  2DXQ A;  3D7D A;  3PRT A;  3HLP A;  5G22 A;  1CX8 A;  1KZF A;  4UEZ A;  3FMC A;  2XEG A;  1LAN A;  5G20 A;  1YVO A;  2Q43 A;  2ZEG A;  1YW4 A;  3CXQ A;  3ISZ A;  3K2K A;  4ZBG A;  3BJ7 A;  3PGP A;  3QAH A;  2IJZ A;  2QVP A;  2WZN A;  2ZEO A;  3D68 A;  3NFZ A;  2PJ9 A;  4KVO E;  2VZZ A;  2C6C A;  1M4G A;  3NE8 A;  1YLO A;  2P6F A;  5IV0 A;  3G8W A;  2REE A;  3EO4 A;  3OWC A;  3SJX A;  2B3V A;  1PU9 A;  1LCP A;  4U5Y A;  3V38 A;  4A30 A;  3LOD A;  1VGY A;  4MHZ A;  1QMU A;  3K9T A;  1BLL E;  3D2P A;  2Q4V A;  4Q38 A;  4C7I A;  4DUK A;  5LRJ A;  2GLF A;  3H8G A;  4PXC A;  4HNX B;  4CAV A;  3QB8 A;  4OC3 A;  2B3U A;  4AG9 A;  2EK8 A;  2GIV A;  4IAV A;  4PV6 A;  2P6G A;  1TKH A;  5G1Z A;  4FAI A;  1XMT A;  2ZXV A;  4F9U A;  3PB6 X;  4M6I A;  3D7F A;  4NXY A;  4C2Z A;  3LD2 A;  4B12 A;  2Q4Y A;  2FSR A;  2IMO A;  3LMS A;  4JWP A;  3WT4 A;  3S9L A;  1ARL A;  2J8M A;  4MFJ A;  1LAP A;  2NYQ A;  5IB0 A;  5HVG A;  1VHS A;  4ZY0 A;  4UFX A;  2ZEN A;  2K5T A;  4MFL A;  1I12 A;  1UWY A;  2AFS A;  4FD6 A;  5D8N A;  3SI2 A;  1IID A;  4H6U A;  4Y49 B;  2NSM A;  2PJ6 A;  3CXP A;  4KLW A;  1Q2Y A;  1S5K A;  3D8P A;  5HH1 A;  3SXN A;  1IYL A;  4QB9 A;  3RNZ A;  4ZY1 A;  3CDX A;  4B6Z A;  1Z4R A;  4ZGY B;  2R98 A;  4CGL A;  3TOA A;  5K8M A;  4R9M A;  2V8V A;  3IWE A;  2OU2 A;  4A94 A;  2HV2 A;  7CPA A;  2JEW A;  5CNP A;  5KTC A;  2Q04 A;  3RBU A;  3PFE A;  1R43 A;  1IOF A;  3IO1 A;  4R76 A;  2Q7B A;  4LQ6 A;  1F57 A;  5EC4 A;  3G3S A;  4R87 A;  2YNC C;  3IFE A;  1CP6 A;  4CAX A;  2F5I A;  2V8D A;  4RN7 A;  4FD4 A;  5K8P A;  2BOA A;  4CYQ A;  3VWE A;  2Z10 A;  2FS5 A;  2ZW4 A;  4X8I A;  2KCW A;  4C2Y A;  4P4I A;  3KHX A;  3B3S A;  2PR1 A;  3GKR A;  5HMN A;  4BIN A;  4EWT A;  1QSM A;  4Z65 A;  3PFO A;  4RUH A;  2Z0Z A;  4ONW A;  1F2O A;  4PXE A;  4R3L A;  5F49 A;  1Z5R A;  2ZEL A;  1QSO A;  1M4L A;  4AVA A;  3FXT A;  5BWA B;  2CTC A;  2P6E A;  3B3C A;  1TF8 A;  2Z11 A;  2J9A A;  3DGV A;  2AFM A;  4OAD A;  5F48 A;  1MK4 A;  2D4P A;  3GIU A;  3PBE A;  4NGQ A;  2QEC A;  4ZY2 A;  2ZEE A;  3NH5 A;  4A39 A;  3MGD A;  5LYD A;  3V8I A;  3N7Z A;  4R57 A;  2F8H A;  5HVF A;  1B6B A;  1S7N A;  4KZT A;  4YFJ A;  3DR6 A;  1ZLI A;  2PC1 A;  1XBU A;  4M85 A;  1QST A;  3N5F A;  4ONU A;  4C68 A;  3SJG A;  3KHZ A;  4NJR A;  4B11 A;  4JZ0 A;  2RB7 A;  2GE3 A;  1NSA A;  1U6M A;  1F2P A;  2ZW7 A;  3W91 A;  4ZI6 A;  3WR7 A;  2HB6 A;  3DDD A;  3NH8 A;  1CP7 A;  4JXQ A;  2R1I A;  2ODF A;  3BJ8 A;  1XFO A;  1YQE A;  1OBR A;  3QNV A;  4KOV A;  3K9U A;  2PE3 A;  3SI0 A;  2CNS A;  3CT9 A;  1R3N A;  4X3R A;  1ELL P;  5H84 A;  3E0K A;  2G3T A;  5CBM A;  2X7B A;  4OKO A;  4OC1 A;  1HDU A;  4KOX A;  2OH1 A;  2QIR A;  2JDD A;  4B5O A;  4NGT A;  3IWW A;  3WAB A;  4H89 A;  2BO9 A;  4LUA A;  2ZEH A;  5HVH A;  3MRU A;  1WWZ A;  2IQ6 A;  5K8N A;  3R96 A;  1KUY A;  1RTQ A;  4TWE A;  3TT2 A;  2B58 A;  4FD5 A;  2JDC A;  4CAF A;  1MJB A;  2PRQ A;  4NFR A;  3NE7 A;  1ZLH A;  4A95 A;  3S6G A;  5I0C A;  1YW6 A;  3P2F A;  3EXN A;  3FED A;  2B4B A;  2RC4 A;  3EFA A;  1IB1 E;  2EK9 A;  4EVY A;  4E8O A;  2Q4Z A;  2OOT A;  1VIX A;  3FBU A;  4OLL A;  2PSW A;  2I79 A;  1ZO0 A;  2WPW A;  1P0H A;  4MMO A;  4I49 A;  4MHD A;  4P4D A;  3TOB A;  3BLN A;  1PCA A;  3I9S A;  4P6Y A;  5H86 A;  2JBK A;  1V0C A;  2EUI A;  3W6X A;  1ELM P;  2FE7 A;  2XEF A;  3VAR A;  4II9 A;  2FT0 A;  2C6G A;  4F8Z A;  1YX0 A;  5GCN A;  5G21 A;  4KOS A;  1NMT A;  2FIA A;  4Y49 C;  2H5M A;  4PK3 A;  1BO4 A;  2PJ1 A;  4KLV A;  2O28 A;  1YLE A;  1XEB A;  1Y0Y A;  5F47 A;  1GYT A;  4HNW B;  1IU8 A;  1X12 A;  3MN8 A;  3P2H A;  4NEX A;  1VHO A;  4O23 A;  5J8C A;  3ISX A;  1R57 A;  1NSL A;  2PJB A;  2PRB A;  1YK3 A;  4CGN A;  5F46 A;  3PB8 X;  1I21 A;  1S60 A;  1Z9U A;  4H2K A;  3PB4 X;  3RZA A;  1IY7 A;  2XEI A;  2XEJ A;  2G9D A;  2PJ3 A;  2QYV A;  4UFW A;  3KR5 A;  4OC2 A;  4Q7A A;  1BPM A;  3FEE A;  4ORF A;  5AGE A;  3QAY A;  1YSJ A;  3R9F A;  3FRM A;  4P44 A;  3KKW A;  3SHP A;  1HEE A;  4B5P B;  2R7H A;  6CPA A;  2O53 A;  2Q51 A;  3F0A A;  2F7V A;  3R9E A;  3VWD A;  3UY5 A;  4UBR A;  4JYW A;  4P45 A;  5EBV A;  3GLJ A;  3SJE A;  2OZU A;  2YND A;  4B10 A;  1VKC A;  5J1Q A;  4P4B A;  1FY7 A;  4HPS A;  4CPA A;  2BSW A;  4P4F A;  5KTD A;  4OC5 A;  4AVC A;  1AUG A;  4OIW A;  4KOR A;  4MY3 A;  4OC4 A;  1J4J A;  4F0X A;  3DNS A;  4DNC A;  4PK2 A;  3D2M A;  2I3C A;  2WYR A;  5THW A;  2RFH A;  3H4Q A;  3PZJ A;  3FYN A;  2B4D B;  4FWU A;  1PYT B;  2GFQ A;  4YRH A;  4MI4 A;  3TE4 A;  1CBX A;  2B5G A;  4R8F A;  4XPD B;  4PPZ A;  3VH9 A;  4GXH A;  3S6F A;  2YNE A;  2CTB A;  4X5K A;  1L0C A;  3D66 A;  4MCS A;  4CAE A;  1YRE A;  2B5G B;  4NGN A;  5IB9 A;  2Q7S A;  1Z2L A;  1Q7L A;  4GM5 A;  4PXD A;  3I1U A;  3LAC A;  2PCU A;  1N71 A;  1FNO A;  1UFH A;  3B35 A;  2EVN A;  4CGP A;  4AVB A;  4XNH B;  2PJ7 A;  1TKJ A;  1M1D A;  3R1K A;  2D4O A;  4AXV A;  1M44 A;  3HUV A;  3LWU A;  4M6H A;  2PR8 A;  1ARM A;  3JVN A;  4LX9 A;  4U9Y A;  3TX8 A;  2PIY A;  1M4D A;  2V8G A;  5EMI A;  4W9Y A;  4H6Z A;  4CGM A;  2ZEP A;  4KS9 A;  5E96 A;  4J3G A;  4KSF A;  4B14 A;  2CNM A;  1XOV A;  4CGO A;  3B3V A;  4MCP A;  2VBQ A;  5AG7 A;  5C82 A;  4C2X A;  3H8E A;  4UCM A;  1TKF A;  2HQY A;  1LOK A;  2YGW A;  3JUW A;  3PP9 A;  1IYK A;  4MCQ A;  4KVM E;  1XJO A;  4KOT A;  1S7F A;  5D29 A;  4P4J A;  3B2Y A;  4IUS A;  4UWJ A;  1X10 A;  4UIB A;  4CYO A;  4DJL A;  2EWB A;  3D67 A;  2I00 A;  4IF5 A;  3TC8 A;  4QC6 A;  2OZH A;  4XPD C;  1GHE A;  3RO0 A;  2GRE A;  3FJU A;  3F5B A;  2DEA A;  3IU2 A;  4NGS A;  2Z3K A;  2PJC A;  2Z3P A;  4FD7 A;  4OAE A;  3TTH A;  3BI1 A;  2FL4 A;  1YGH A;  2AFX A;  1CJW A;  4MFQ A;  4MJ8 A;  4OP4 A;  5LYL A;  1IGB A;  3TO6 A;  3B7I A;  2C6P A;  3GUX A;  4L89 A;  2GAN A;  1EE3 P;  2JLM A;  1KWM A;  2JEV A;  5ELY A;  4NGR A;  1XIX A;  4M6G A;  2C1C A;  2WUU A;  3T9Y A;  5DS0 A;  5C88 A;  4IK2 A;  3D7H A;  2VZY A;  2POK A;  1MJ9 A;  1TXR A;  4NJQ A;  1Y9W A;  3IEH A;  3KAS A;  2PJ0 A;  2HC9 A;  4F9V A;  2V77 A;  3H5Z A;  1XMB A;  2VL1 A;  3D7G A;  2V8H A;  1Y7R A;  2VXK A;  1RO5 A;  2GU2 A;  1QSR A;  4BMH A;  1IIC A;  3CXS A;  5K8O A;  2Y0M A;  1DTD A;  2YNC A;  4MCR A;  3VAT A;  3W6S A;  2VQY A;  3KGQ A;  1ZG7 A;  4MFP A;  2CNT A;  1BOB A;  2ZOF A;  2FCK A;  4B5P A;  2B4D A;  1LFW A;  2Z3M A;  2ZW5 A;  2R8V A;  1XE4 A;  3B3W A;  3CZX A;  1CPS A;  1Z4E A;  2NMT A;  2G3A A;  1LAM A;  3FIX A;  1TF9 A;  4KOW A;  3S6H A;  3IC1 A;  1Z8X A;  2ABZ A;  2JBJ A;  4UA3 A;  3GY9 A;  2DF5 A;  4OID A;  4CRY B;  4JXR A;  4AG7 A;  3WC7 A;  4GS4 A;  1OZP A;  2ANP A;  3BI0 A;  4MXU A;  3V7Z A;  2WSA A;  5A27 A;  1ON0 A;  4A32 A;  1QQ9 A;  3IGR A;  4PSW A;  4RI1 A;  4CYN A;  3B8G A;  4UCP A;  3BHX A;  1XF8 A;  2Q0Y A;  1Y7E A;  5AG5 A;  5KTA A;  4C7H A;  1CPX A;  2PIZ A;  3KZW A;  3FF3 A;  3H8F A;  3PB7 X;  3FVL A;  2CY2 A;  4UCN A;  3S6K A;  5AG4 A;  1CM0 A;  4YGO A;  4EFD A;  1CG2 A;  4G1P A;  4JD6 A;  2P0W A;  4R6T A;  2CXA A;  1AYE A;  1K4J A;  2PJ8 A;  4UF4 A;  1LRZ A;  2FVG A;  3T8W A;  1JQG A;  3B3T A;  5LYI A;  4F6A A;  3R95 A;  4R3K A;  4L8A A;  3SXO A;  1Z8W A;  3S9M A;  2VI7 A;  4P10 A;  4QVT A;  4XPL A;  4A37 A;  1FT7 A;  4E0A A;  3CPX A;  1BAV A;  4CYP A;  2FXF A;  5JM6 A;  1JWQ A;  5I4M A;  1P4N A;  4E2A A;  1NE9 A;  5DWN A;  4KUA A;  3FEC A;  1Q2C A;  4CRZ B;  2PJ2 A;  4Q36 A;  4K3N A;  4ZX9 A;  2IL4 A;  3NH4 A;  2WPX A;  4AB7 A;  2G0B A;  1QSN A;  4QBJ A;  2EBJ A;  2PJA A;  3FNC A;  2ZW6 A;  1B87 A;  3I3G A;  3IIB A;  4KVX A;  2HUZ A;  4A38 A;  3L2N A;  2OR4 A;  2AE6 A;  3DR8 A;  4NF1 A;  4ZX8 A;  3GYA A;  4TNU A;  3IWG A;  5JQ4 A;  1ZG8 A;  2ZEM A;  4PQA A;  4JLY A;  4PXB A;  3WC6 A;  2ARH A;  2BCO A;  1KUV A;  2ATR A;  3D3S A;  4FUU A;  4XPK A;  3PB9 X;  1AMP A;  1BPN A;  4LQG A;  2Z3L A;  3RYO A;  4BBH A;  4MHN A;  4X2T A;  4B13 A;  4P4E A;  3TO7 A;  1VHE A;  3BXM A;  3NA6 A;  3PBB A;  4BD9 A;  2PQ8 A;  3JTK A;  2J8N A;  2ZEF A;  4HKF A;  4KOU A;  1TIQ A;  4YU9 A; 
#chains in the Genus database with same CATH homology
 4NCZ A;  2ZPA A;  2A4N A;  2REF A;  4HNY B;  3C26 A;  3TCV A;  4M3S A;  2BEI A;  3ZJ0 A;  2AJ6 A;  4U9Z A;  4MFZ A;  5FVJ A;  2OB0 A;  4MY0 A;  3EY5 A;  4A33 A;  1SQH A;  3A9L A;  3T90 A;  2C27 A;  2BUE A;  4F0Y A;  4K30 A;  4CAW A;  4PSX A;  5J8F A;  1KUX A;  3TFY A;  1Y9K A;  5ISV A;  1RXT A;  4CS0 B;  3DSB A;  4RS2 A;  2FIW A;  1S7L A;  4JJX A;  1PUA A;  1MJA A;  2J8R A;  2Z3N A;  3R9G A;  4A2Z A;  1Q2D A;  1YVK A;  5JPH A;  2OZG A;  5AG6 A;  2DPT A;  2DPS A;  2PDO A;  5DWM A;  2VEZ A;  1WK4 A;  2Q44 A;  4UFV A;  4MFK A;  3EC4 A;  4MBU A;  3TO9 A;  4A31 A;  4KOY A;  5A28 A;  1M4I A;  4KUB A;  1I1D A;  4XNH C;  4KSA A;  3F8K A;  1YR0 A;  4NSQ A;  3ZZI A;  2BL1 A;  3IU1 A;  4UWI A;  2QML A;  1S7K A;  1S3Z A;  3FB3 A;  4QUS A;  2Z3O A;  2DXQ A;  1KZF A;  5G20 A;  1YVO A;  3CXQ A;  4ZBG A;  3BJ7 A;  3PGP A;  3QAH A;  4PSW A;  4KVO E;  2VZZ A;  1M4G A;  2P6F A;  5IV0 A;  3G8W A;  2REE A;  3EO4 A;  3OWC A;  4A30 A;  2B3V A;  1PU9 A;  4U5Y A;  3LOD A;  5IX3 A;  3D2P A;  2Q4V A;  4Q38 A;  4C7I A;  4HNX B;  4CAV A;  3QB8 A;  2B3U A;  4AG9 A;  2GIV A;  4PV6 A;  2P6G A;  5G1Z A;  1XMT A;  2ZXV A;  4NXY A;  4C2Z A;  3LD2 A;  4B12 A;  2Q4Y A;  2FSR A;  4JWP A;  2J8M A;  4MFJ A;  5IB0 A;  1VHS A;  4UFX A;  2K5T A;  4MFL A;  1I12 A;  4FD6 A;  1IID A;  4H6U A;  4Y49 B;  3CXP A;  4KLW A;  1Q2Y A;  1S5K A;  3D8P A;  5HH1 A;  3SXN A;  1IYL A;  4QB9 A;  4ZGY B;  1Z4R A;  2R98 A;  4CGL A;  3TOA A;  4R9M A;  3IWE A;  2OU2 A;  2HV2 A;  5CNP A;  5KTC A;  2Q04 A;  2Q7B A;  5EC4 A;  3G3S A;  4R87 A;  2YNC C;  4CAX A;  2F5I A;  4FD4 A;  4CYQ A;  3VWE A;  2Z10 A;  2FS5 A;  2ZW4 A;  2KCW A;  4C2Y A;  2PR1 A;  3GKR A;  5HMN A;  1QSM A;  2Z0Z A;  4R3L A;  5F49 A;  1QSO A;  4AVA A;  3FXT A;  5BWA B;  4OAD A;  2P6E A;  2Z11 A;  5F48 A;  1MK4 A;  2D4P A;  2QEC A;  3MGD A;  3V8I A;  3N7Z A;  4R57 A;  4YFJ A;  1B6B A;  1S7N A;  4KZT A;  3DR6 A;  2PC1 A;  4M85 A;  1QST A;  4ONU A;  4C68 A;  4B11 A;  2GE3 A;  2ZW7 A;  1U6M A;  3W91 A;  3WR7 A;  3DDD A;  4JXQ A;  2R1I A;  3BJ8 A;  4KOV A;  3K9U A;  2CNS A;  5H84 A;  3E0K A;  2G3T A;  2X7B A;  4KOX A;  2OH1 A;  2QIR A;  2JDD A;  4B5O A;  4H89 A;  4LUA A;  1WWZ A;  3R96 A;  1KUY A;  3TT2 A;  2B58 A;  4FD5 A;  2JDC A;  4CAF A;  1MJB A;  3NE7 A;  4A95 A;  3S6G A;  5I0C A;  3P2F A;  3EXN A;  2B4B A;  2RC4 A;  3EFA A;  1IB1 E;  4EVY A;  4E8O A;  3FBU A;  4OLL A;  2PSW A;  2I79 A;  1ZO0 A;  2WPW A;  1P0H A;  4I49 A;  4MHD A;  3TOB A;  3BLN A;  3I9S A;  5H86 A;  1V0C A;  2EUI A;  3W6X A;  4II9 A;  2FE7 A;  2FT0 A;  1YX0 A;  5GCN A;  5G21 A;  4KOS A;  1NMT A;  2FIA A;  4Y49 C;  2H5M A;  4PK3 A;  1BO4 A;  4KLV A;  2O28 A;  1YLE A;  1XEB A;  5F47 A;  4HNW B;  3P2H A;  4NEX A;  5J8C A;  1R57 A;  1NSL A;  2PRB A;  1YK3 A;  4CGN A;  5F46 A;  1I21 A;  1S60 A;  1Z9U A;  4UFW A;  4ORF A;  5AGE A;  3R9F A;  3FRM A;  3KKW A;  3SHP A;  4B5P B;  2R7H A;  3F0A A;  3R9E A;  3VWD A;  3UY5 A;  4UBR A;  5EBV A;  2OZU A;  2YND A;  4B10 A;  1VKC A;  1FY7 A;  2BSW A;  5KTD A;  4AVC A;  4KOR A;  4MY3 A;  1J4J A;  4F0X A;  3DNS A;  4DNC A;  4PK2 A;  3D2M A;  3H4Q A;  3PZJ A;  3FYN A;  2B4D B;  4YRH A;  4MI4 A;  3TE4 A;  2B5G A;  4XPD B;  3S6F A;  2YNE A;  4X5K A;  1L0C A;  4CAE A;  1YRE A;  2B5G B;  1N71 A;  1UFH A;  4CGP A;  2EVN A;  4AVB A;  4XNH B;  1M1D A;  3R1K A;  2D4O A;  1M44 A;  2PR8 A;  3JVN A;  4LX9 A;  4U9Y A;  1M4D A;  4H6Z A;  4CGM A;  4KS9 A;  5E96 A;  4J3G A;  4KSF A;  4B14 A;  2CNM A;  4CGO A;  2VBQ A;  5AG7 A;  5C82 A;  4C2X A;  4UCM A;  2HQY A;  2YGW A;  3JUW A;  3PP9 A;  1IYK A;  4KVM E;  4KOT A;  1S7F A;  4IUS A;  4UWJ A;  4CYO A;  4IF5 A;  2I00 A;  4QC6 A;  2OZH A;  4XPD C;  1GHE A;  3IU2 A;  5G22 A;  3F5B A;  4OAE A;  2Z3K A;  2Z3P A;  4FD7 A;  3TTH A;  2FL4 A;  1YGH A;  1CJW A;  4MFQ A;  4MJ8 A;  3TO6 A;  4L89 A;  2GAN A;  2JLM A;  2JEV A;  1XIX A;  3T9Y A;  2WUU A;  5C88 A;  2VZY A;  1MJ9 A;  1Y9W A;  3H5Z A;  1Y7R A;  2VXK A;  1RO5 A;  4BMH A;  1QSR A;  1IIC A;  3CXS A;  2Y0M A;  2YNC A;  3W6S A;  2VQY A;  4MFP A;  2CNT A;  1BOB A;  2FCK A;  4B5P A;  2B4D A;  2Z3M A;  2ZW5 A;  2R8V A;  1XE4 A;  1Z4E A;  2NMT A;  2G3A A;  3FIX A;  4KOW A;  3S6H A;  4UA3 A;  3GY9 A;  4CRY B;  4JXR A;  4AG7 A;  4GS4 A;  1OZP A;  2WSA A;  5A27 A;  1ON0 A;  4A32 A;  3IGR A;  4RI1 A;  4CYN A;  3B8G A;  4UCP A;  1XF8 A;  2Q0Y A;  5AG5 A;  5KTA A;  4C7H A;  4UCN A;  2CY2 A;  3S6K A;  5AG4 A;  1CM0 A;  4YGO A;  4JD6 A;  2P0W A;  2CXA A;  1K4J A;  1LRZ A;  4F6A A;  3R95 A;  4R3K A;  4L8A A;  3SXO A;  2VI7 A;  4QVT A;  4XPL A;  4E0A A;  4CYP A;  2FXF A;  1P4N A;  4E2A A;  1NE9 A;  5DWN A;  4KUA A;  1Q2C A;  4CRZ B;  4Q36 A;  2IL4 A;  2WPX A;  4AB7 A;  2G0B A;  1QSN A;  4QBJ A;  3FNC A;  2ZW6 A;  1B87 A;  3I3G A;  4KVX A;  2HUZ A;  2AE6 A;  3DR8 A;  4NF1 A;  3GYA A;  3IWG A;  5JQ4 A;  4JLY A;  2ARH A;  1KUV A;  2ATR A;  3D3S A;  4XPK A;  2Z3L A;  3RYO A;  4BBH A;  4B13 A;  3TO7 A;  2PQ8 A;  3JTK A;  2J8N A;  4HKF A;  4KOU A;  1TIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...