4KOVA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefuroxime
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 44
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kovA00
1CM0A 3P2FA 2ATRA 3H4QA 2P6FA 2Z11A 1IIDA 4KOYA 3W6XA 5HMNA 4JD6A 4LUAA 2P6EA 2X7BA 1K4JA 3W6SA 4CRZB 3K9UA 1J4JA 2OZUA 2O28A 4PSXA 1QSMA 3KKWA 3PGPA 5J8CA 3TTHA 2AJ6A 4MY3A 2CY2A 4L8AA 4KLVA 4KOXA 1B6BA 2B58A 5C88A 1L0CA 1FY7A 4KOVA 2R7HA 3MGDA 3S6HA 3N7ZA 5KTAA 2ZPAA 1IICA 1LRZA 4UBRA 4AG9A 2FXFA 2Z10A 2B3UA 3RYOA 2PR8A 1Z9UA 5EC4A 2PRBA 4XNHB 2J8NA 1ON0A 1S7LA 4ONUA 1PU9A 4YGOA 1KUVA 2OH1A 4JJXA 3EY5A 3R9EA 2REEA 3LD2A 3IWGA 1IYKA 2A4NA 2HUZA 3F8KA 2B5GA 3DNSA 4KOTA 3C26A 4X5KA 4XNHC 2PC1A 1NE9A 1KUXA 4JXRA 1KZFA 1I21A 2J8MA 3DSBA 2Q4YA 4CAVA 5JPHA 1B87A 3TO7A 2QMLA 2ZW4A 1QSNA 4R9MA 1M44A 3P2HA 1PUAA 2B4BA 2REFA 3W91A 2Q04A 3BLNA 4FD7A 4UWJA 2PQ8A 2H5MA 3T90A 3SXOA 1UFHA 4RS2A 5HH1A 3DDDA 4KVXA 2ZW5A 1Q2CA 4L89A 1YVKA 1S3ZA 1RO5A 2BEIA 2HV2A 2FL4A 1BO4A 1P4NA 5C82A 4MJ8A 3G3SA 5CNPA 4OAEA 2G0BA 3TOBA 2FCKA 3E0KA 1KUYA 4K30A 3D2MA 4MI4A 1YX0A 2FSRA 4R3KA 4QVTA 3F0AA 3FYNA 1YVOA 4JLYA 3D3SA 4AVBA 4E2AA 2ZW7A 2D4PA 4M85A 3WR7A 1V0CA 2EUIA 1N71A 3FIXA 4CRYB 4KOSA 2CNTA 2Q7BA 3QB8A 2Y0MA 2VI7A 3IGRA 1MJ9A 3DR6A 3JUWA 2JDCA 3D8PA 5F47A 1R57A 2NMTA 2I00A 4HNYB 5DWNA 4FD4A 1S7KA 4FD5A 5IV0A 2B4DA 4U9ZA 1NSLA 4HNXB 4KOWA 2GE3A 4NF1A 4AVAA 3EC4A 3ZZIA 1GHEA 4U9YA 4Y49B 2JDDA 1QSRA 4J3GA 3PP9A 4E8OA 4CAXA 4KZTA 3S6GA 4DNCA 4JXQA 4H6UA 3R96A 5GCNA 4NCZA 3S6FA 3ZJ0A 4AVCA 1S60A 3R1KA 1XIXA 2FIWA 4NEXA 1M1DA 4IUSA 1BOBA 3SXNA 4Y49C 4CAWA 3VWEA 2Q44A 4KUBA 4KOUA 2QECA 2RC4A 3FB3A 2OZHA 4XPDC 4OLLA 4PV6A 2VQYA 5I0CA 4KVOE 4UA3A 4I49A 4AG7A 1S5KA 2JEVA 3VWDA 1Y7RA 4UWIA 5DWMA 1QSTA 2CNMA 2HQYA 4OADA 4FD6A 3JVNA 4F6AA 1U6MA 1S7FA 3CXSA 3TO9A 1Q2DA 1YLEA 2VXKA 4QC6A 1IB1E 2WPXA 1Z4RA 4LX9A 1CJWA 1YR0A 5KTCA 4RI1A 4YFJA 4R57A 1RXTA 3TO6A 1Y9KA 2CNSA 3NE7A 3TFYA 3CXQA 1VHSA 5KTDA 2I79A 5EBVA 2QIRA 1WK4A 3BJ8A 4KLWA 2OZGA 3R9FA 4HNWB 2EVNA 5H86A 1SQHA 1Y9WA 3EO4A 1QSOA 2ARHA 2JLMA 2B3VA 2PDOA 4KVME 2PSWA 2K5TA 4GS4A 4ORFA 4II9A 2F5IA 5E96A 3OWCA 2KCWA 3T9YA 2ZW6A 2Z0ZA 1MJBA 3I9SA 1NMTA 4XPKA 4QUSA 2Q0YA 5ISVA 2OU2A 4B5PB 4EVYA 3I3GA 1WWZA 1M4IA 4AB7A 1Z4EA 5IX3A 4H89A 4NXYA 5FVJA 2B5GB 1P0HA 4PSWA 2G3AA 2VZZA 4E0AA 1I1DA 1S7NA 4JWPA 1XE4A 4XPDB 2GANA 1YK3A 3GKRA 3LODA 3G8WA 4NSQA 4F0YA 3GY9A 2ZXVA 5J8FA 2J8RA 4CS0B 3EFAA 3B8GA 3FRMA 4B5OA 3FBUA 1IYLA 1YGHA 3R95A 4KUAA 5F46A 3TCVA 1XEBA 4MHDA 3EXNA 1MK4A 3S6KA 4KORA 2VZYA 1M4GA 4B5PA 2P6GA 2VBQA 1M4DA 3PZJA 2AE6A 1TIQA 2C27A 2BL1A 2Q4VA 3R9GA 4MY0A 1XMTA 3BJ7A 3F5BA 4PK2A 5F48A 3V8IA 2VEZA 3TE4A 4R3LA 3FXTA 3SHPA 1Q2YA 2P0WA 2R8VA 2FE7A 4U5YA 3QAHA 2D4OA 2FIAA 4HKFA 4BMHA 3GYAA 3D2PA 2BUEA 2WPWA 2FT0A 4R87A 4PK3A 3FNCA 1YREA 3CXPA 5IB0A 1I12A 2BSWA 2IL4A 4YRHA 2B4DB 4XPLA 4QBJA 3DR8A 1OZPA 4ZBGA 2FS5A 2OB0A 3TOAA 2R98A 5H84A 4M3SA 4H6ZA 1MJAA 2GIVA 1XF8A 4IF5A 5JQ4A 5F49A 4QB9A 3TT2A 3UY5A 2DXQA 2G3TA 2PR1A 4MBUA 1VKCA 2R1IA
chains in the Genus database with same CATH superfamily
1CM0A 3P2FA 2ATRA 4MFKA 1X12A 3H4QA 5LYLA 2ZEMA 2P6FA 2Z11A 1IIDA 4KOYA 4KS9A 3W6XA 4CGMA 3KHZA 4MCQA 5CBMA 5HMNA 4NGNA 4JD6A 4ZY1A 4P4EA 3NH4A 4LUAA 4YWYA 4P45A 4CGPA 2QYVA 2WUUA 2WSAA 5LYIA 3FMCA 4K3NA 3SI1A 2P6EA 4M6IA 3MRUA 3WABA 3D7GA 4OIDA 4KSIA 4A2ZA 4EWTA 2X7BA 3KR4A 1K4JA 3W6SA 4CRZB 1IU8A 2Q7SA 3K9UA 1J4JA 1YW4A 2O28A 2OZUA 1XFOA 4PSXA 4KSFA 1QSMA 3KKWA 3PGPA 3PEIA 1XMBA 4DJLA 5CPAA 3D68A 5J8CA 4MRIA 3TTHA 4P6YA 2AJ6A 4MY3A 2CY2A 4L8AA 4FBEA 4KLVA 1RTQA 4KOXA 1B6BA 2B58A 5C88A 3IJ3A 1L0CA 2CTCA 4MFLA 1FY7A 5LYDA 1QMUA 4X8IA 1LCPA 4KOVA 2BO9A 2DPTA 4MCPA 4R8FA 4A33A 2OR4A 2R7HA 1GYTA 1ARMA 2ZENA 3KHXA 2DPSA 3K9TA 3MGDA 3S6HA 3N7ZA 5HXDA 2FVGA 1YLOA 3KASA 3TX8A 5KTAA 2ZPAA 4NGSA 1YMEA 5AG4A 4AXVA 5AG5A 1IICA 1LRZA 3B35A 4UBRA 2JBJA 4AG9A 2FXFA 2Z10A 2B3UA 3RYOA 4C68A 2PJ5A 1CP6A 4NJRA 2PR8A 1Z9UA 1ARLA 2HB6A 5EC4A 2PRBA 4NGMA 3K2KA 2ZEFA 5AGEA 3RNZA 4XNHB 3T8WA 4DYOA 1XJOA 1ON0A 2J8NA 1S7LA 3SJXA 4ZGYB 4ONUA 2Z3OA 1PU9A 4IAVA 2PJCA 4YGOA 1A2ZA 1KUVA 2OH1A 4JJXA 3EY5A 3R9EA 3B3WA 2REEA 3B3SA 1H8LA 3LD2A 3PFOA 2PCUA 1HDQA 3IWGA 5LRGA 4B11A 4RN7A 1IYKA 2RFHA 5F09A 2A4NA 2HUZA 3HLPA 3F8KA 2B5GA 3DNSA 2YNEA 3PB7X 4KOTA 3FH4A 3C26A 1XOVA 4X5KA 4XNHC 2PC1A 1NE9A 1Y0RA 3SJFA 1KUXA 2G9DA 4JXRA 1KZFA 1I21A 2J8MA 3DSBA 2Q4YA 4M6GA 4CAVA 1B87A 3KR5A 2QMLA 2ZW4A 3TO7A 5JPHA 1QSNA 2C6GA 4R9MA 3JTKA 1M44A 3P2HA 2Q43A 2GU2A 3V7ZA 2PJBA 2EWBA 1PUAA 2ZELA 2B4BA 2REFA 3W91A 2CF4A 2Q04A 3BLNA 3CDXA 4FD7A 1TKHA 1Y0YA 2PQ8A 3PB8X 2H5MA 4LQ6A 4UWJA 3T90A 2NYQA 3SXOA 1UFHA 3FF3A 2GLFA 2ANPA 5HVGA 1TF9A 4RS2A 5HH1A 4FUUA 3VARA 4CYNA 3DDDA 4KVXA 5IB9A 2ZW5A 1Q2CA 4L89A 4PXDA 3NH8A 4ZX8A 1YVKA 2PJ6A 1S3ZA 3IEHA 1RO5A 1ZLHA 2BEIA 4OC3A 4RUHA 2HV2A 2FL4A 2YGWA 1BO4A 1P4NA 1OBRA 3WC5A 3KL9A 2V8VA 2ABZA 4BINA 5C82A 5AG6A 3FECA 4MJ8A 3G3SA 5CNPA 4OAEA 4A94A 2G0BA 4OC4A 3TOBA 2FCKA 3D4UA 3E0KA 3PRTA 4R7MA 3SJGA 5JGFA 1KUYA 4K30A 3D2MA 4JZ0A 4MI4A 4NGRA 1YX0A 4MHZA 2Q51A 2FSRA 1TKFA 7CPAA 1Q7LA 2ZOFA 4CGLA 3DLJA 4CYOA 4GM5A 4R3KA 4QVTA 1ZG9A 3F0AA 3FYNA 1YVOA 4JLYA 3D3SA 4AVBA 4E2AA 2ZW7A 2D4PA 4M85A 5BWAB 3WR7A 1V0CA 2EUIA 1N71A 3FIXA 4CRYB 2F7VA 4KOSA 4EMEA 2CNTA 2Q7BA 4A31A 1YQEA 3QB8A 2Y0MA 5I4MA 2VI7A 3IGRA 4PXEA 1MJ9A 3DR6A 3PBEA 3B3VA 4P44A 3JUWA 2JDCA 3D8PA 2C1CA 1X10A 1XBUA 2NSMA 2Z3KA 2Z3NA 2IMOA 3D7HA 4P4FA 5F47A 1R57A 2PJAA 4A32A 4ZYQA 2NMTA 2I00A 2ZEPA 4HNYB 4P4DA 5DWNA 4FD4A 4LQGA 1S7KA 3FJUA 4FD5A 1F2OA 5IV0A 2B4DA 4U9ZA 2GREA 1NSLA 4WWVA 4HNXB 3H8EA 1ELLP 4KOWA 3SI2A 3CT9A 3D66A 2AFZA 2GE3A 1CPSA 1Z2LA 3B3CA 5K8OA 2XEIA 3WC7A 3BI1A 4NF1A 3EC4A 3NA6A 4AVAA 4FAIA 2EO8A 3BXMA 3ZZIA 4JYWA 4UCMA 4NJQA 1Z8TA 4MFPA 1GHEA 4U9YA 1KWMA 4Y49B 1IGBA 2Z3MA 4B14A 3CZXA 2JDDA 1QSRA 4J3GA 3PP9A 5D8NA 4E8OA 4CAXA 3CPXA 1AYEA 3H5ZA 4KZTA 3MN8A 4TWEA 3S6GA 4JXQA 4DNCA 3BI0A 1LFWA 4H6UA 1ZG8A 2WZNA 5GCNA 3R96A 4B6ZA 2BCOA 4X3RA 4Q36A 4NCZA 3S6FA 3VATA 1TXRA 3ZJ0A 2IJZA 4CYQA 4AVCA 4CGOA 1IOIA 1QQ9A 1S60A 1M4LA 3R1KA 4Z65A 1XIXA 2FIWA 4NEXA 4UEFA 4MHPA 1M1DA 3N5FA 4IUSA 1BPNA 1YSJA 3H8FA 5HVFA 3H8GA 1BOBA 3SXNA 4Y49C 3GLJA 4CAWA 4F8ZA 4UFXA 1ELMP 3VWEA 1BAVA 1DE4C 2Q44A 1CP7A 4C2ZA 4KUBA 4KOUA 2QECA 2RC4A 3FB3A 4R6TA 4X2TA 3IWWA 5G20A 2OZHA 2CTBA 5G21A 8CPAA 4XPDC 4MCRA 4OLLA 1HDUA 4PV6A 2VQYA 4BD9A 5I0CA 4KVOE 4UA3A 1Z8XA 3NFZA 4A37A 4I49A 1VIXA 5THWA 5EMIA 4AG7A 3I1UA 2AFMA 5D29A 2ODFA 3WT4A 1S5KA 1VHOA 2JEVA 3KGQA 4WJBA 3RO0A 3IIBA 3VWDA 2EK9A 1Y7RA 2F8HA 4UWIA 3WC6A 2PVVA 1QSTA 4W9YA 5DWMA 2C6PA 2BOAA 2CNMA 3SJEA 2IQ6A 2V8HA 1PCAA 2HQYA 2HC9A 2PVWA 4OADA 4GXHA 4FD6A 3JVNA 2AFUA 2V77A 4F6AA 4CGNA 1U6MA 1S7FA 3BHXA 3CXSA 3TO9A 5LYFA 1Q2DA 3DGVA 4F0XA 1YLEA 2J9AA 2VXKA 1TF8A 1IB1E 2WPXA 4QC6A 3LWUA 4NGQA 1Z4RA 3S9NA 2JBKA 3FVLA 4LX9A 4UEEA 3KQXA 1CJWA 1YR0A 5KTCA 2Z3LA 4RI1A 2YNCC 3LACA 4YFJA 3IFEA 4R57A 4TNUA 1RXTA 2RB7A 3TO6A 1AUGA 1Y9KA 2CNSA 3NE7A 3TFYA 4OC0A 3CXQA 1TKJA 1ZG7A 1VHSA 5KTDA 1CG2A 2VL1A 4OC2A 2I79A 5K8MA 5EBVA 2QIRA 2WYRA 4P4BA 1VGYA 1WK4A 3IC1A 3BJ8A 4KLWA 2OZGA 3NH5A 2ZEEA 4OKOA 3R9FA 4ZI6A 4HPSA 4HNWB 1BPMA 2PJ2A 2EVNA 4C7HA 1Z8LA 4MHNA 5H86A 3B2YA 1SQHA 5HVHA 3PB6X 1Y9WA 4F9UA 3EO4A 1QSOA 2ARHA 2JLMA 3LMSA 1LOKA 2B3VA 2PDOA 4KVME 4MCSA 4A95A 2PSWA 2K5TA 2PIZA 1R3NA 4FWUA 4GS4A 4ORFA 1LAMA 5AG7A 2F5IA 5E96A 3RBUA 4B13A 4DUKA 4II9A 2XEGA 1DTDA 5LRJA 1R43A 2KCWA 3OWCA 3T9YA 5J1QA 2ZW6A 1BLLE 1UWYA 3VH9A 4CAEA 4UCPA 2Z0ZA 1MJBA 2ZEDA 3I9SA 4NGPA 2I3CA 2EBJA 1NMTA 4NGTA 4XPKA 4PQAA 5DS0A 2OOTA 2O53A 4QUSA 4CYPA 2Q0YA 5ISVA 3B7IA 4KSAA 3B3TA 1PYTB 2OU2A 4B5PB 2PRQA 1FT7A 3A9LA 2PJ8A 2CIJA 4EVYA 4A39A 3D67A 2V8GA 5JM6A 1YW6A 3I3GA 1WWZA 1M4IA 4AB7A 1Z4EA 3JRUA 4CAFA 4H89A 5IX3A 1EE3P 4NXYA 3HUVA 1XRYA 5FVJA 2B5GB 2PJ9A 2PJ3A 3CPAA 4UIAA 1P0HA 4C2XA 4PSWA 2G3AA 2VZZA 4E0AA 4Q7AA 1I1DA 3KI9A 1CX8A 1S7NA 3FEDA 4JWPA 1XE4A 4XPDB 3IU2A 2GANA 4UFVA 1YK3A 3GKRA 3LODA 2AFWA 1CBXA 3G8WA 1AMPA 4NSQA 4F0YA 4H2KA 1FNOA 3TC8A 5G22A 4UCNA 4MFQA 3GY9A 2ZXVA 5J8FA 2J8RA 2PJ7A 4B10A 4CS0B 3EFAA 3B8GA 2AFSA 3FRMA 4B5OA 2JEWA 2Q4ZA 3D7FA 1CPXA 3FBUA 2DEAA 1IYLA 1YGHA 4IK2A 3R95A 4KUAA 5F46A 4ZY0A 3TCVA 1XEBA 1JQGA 4MHDA 1Y7EA 3EXNA 3S9LA 3PFEA 1MK4A 2YNDA 4ONWA 2V8DA 3L2NA 4UIBA 5G1ZA 4CPAA 4PXBA 3S6KA 4KORA 2VZYA 1M4GA 4O23A 2ZEHA 4B5PA 4P4JA 2P6GA 3NE8A 4UFWA 2VBQA 5JH9A 4B12A 4BBHA 1M4DA 2EK8A 1ZO0A 3PZJA 3ISXA 2AE6A 4Q38A 1TIQA 4MFJA 1VHEA 2C27A 2BL1A 2PJ0A 2Q4VA 1Z8WA 4R76A 3R9GA 3GIUA 4MY0A 2ZOGA 2ZEOA 1XMTA 5A28A 4MXUA 2AFXA 3BJ7A 1F2PA 1LAPA 4EFDA 3F5BA 3GUXA 4OC1A 3FX6A 3KQZA 4PK2A 2DF5A 5F48A 3PB9X 4PPZA 3IO1A 3V8IA 2VEZA 4C2YA 5A27A 4R3LA 5K8PA 3TE4A 3FXTA 1Z5RA 3SHPA 1Q2YA 2P0WA 2R8VA 2FE7A 3FEEA 3GB0A 2CXAA 3KZWA 4IHMA 4OP4A 3PB4X 1LANA 3QNVA 4U5YA 2Z3PA 3QAHA 2D4OA 2FIAA 4HKFA 4A38A 4OIWA 5ELYA 4BMHA 3RZAA 2PIYA 4OMEA 2POKA 2XEFA 3GYAA 3IU1A 3V38A 1IOFA 3D2PA 4ZY2A 1JWQA 6CPAA 3IWEA 4ZX9A 2BUEA 2ZEGA 1NSAA 2WPWA 2FT0A 4R87A 3SI0A 4PK3A 2GFQA 4NFRA 2QJ8A 3FNCA 4YU9A 1YREA 2PE3A 3CXPA 2AFOA 2C6CA 1I12A 2O4HA 2PJ1A 2QVPA 5IB0A 2BSWA 2IL4A 4MHYA 3RAMA 4YRHA 2B4DB 3S9MA 4A30A 5LRKA 4P4IA 2GLJA 4OC5A 4PXCA 4XPLA 4QBJA 3DR8A 1OZPA 4ZBGA 2FS5A 2OB0A 3TOAA 4MFZA 1HEEA 1F57A 3PBBA 2R98A 5H84A 4UF4A 4MMOA 4M3SA 2XEJA 3D7DA 1ZLIA 4H6ZA 4M6HA 4UEZA 4F9VA 1MJAA 4C7IA 2GIVA 4P10A 1XF8A 2YNCA 3ISZA 4IF5A 5JQ4A 5F49A 4QB9A 2PJ4A 4G1PA 3TT2A 5K8NA 3UY5A 2DXQA 3QAYA 2G3TA 1IY7A 2PR1A 4MBUA 1VKCA 2R1IA
chains in the Genus database with same CATH topology
1CM0A 3P2FA 2ATRA 4MFKA 3H4QA 2P6FA 2Z11A 1IIDA 4KOYA 4KS9A 3W6XA 4CGMA 5HMNA 4JD6A 4LUAA 4CGPA 2WUUA 2WSAA 2P6EA 4A2ZA 2X7BA 1K4JA 3W6SA 4CRZB 3K9UA 1J4JA 2OZUA 2O28A 4PSXA 4KSFA 1QSMA 3KKWA 3PGPA 5J8CA 3TTHA 2AJ6A 4MY3A 2CY2A 4L8AA 4KLVA 4KOXA 1B6BA 2B58A 5C88A 1L0CA 4MFLA 1FY7A 4KOVA 2DPTA 4A33A 2R7HA 3MGDA 2DPSA 3S6HA 3N7ZA 5KTAA 2ZPAA 5AG4A 5AG5A 1IICA 1LRZA 4UBRA 4AG9A 2FXFA 2Z10A 2B3UA 3RYOA 4C68A 2PR8A 1Z9UA 5EC4A 2PRBA 5AGEA 4XNHB 2J8NA 1ON0A 1S7LA 4ZGYB 4ONUA 2Z3OA 1PU9A 4YGOA 1KUVA 2OH1A 4JJXA 3EY5A 3R9EA 2REEA 3LD2A 3IWGA 4B11A 1IYKA 2A4NA 2HUZA 3F8KA 2B5GA 3DNSA 2YNEA 4KOTA 3C26A 4X5KA 4XNHC 2PC1A 1NE9A 1KUXA 4JXRA 1KZFA 1I21A 2J8MA 3DSBA 2Q4YA 4CAVA 5JPHA 1B87A 3TO7A 2QMLA 2ZW4A 1QSNA 4R9MA 3JTKA 1M44A 3P2HA 1PUAA 2B4BA 2REFA 3W91A 2Q04A 3BLNA 4FD7A 4UWJA 2PQ8A 2H5MA 3T90A 3SXOA 1UFHA 4RS2A 5HH1A 4CYNA 3DDDA 4KVXA 2ZW5A 1Q2CA 4L89A 1YVKA 1S3ZA 1RO5A 2BEIA 2HV2A 2FL4A 2YGWA 1BO4A 1P4NA 5C82A 5AG6A 4MJ8A 3G3SA 5CNPA 4OAEA 2G0BA 3TOBA 2FCKA 3E0KA 1KUYA 4K30A 3D2MA 4MI4A 1YX0A 2FSRA 4CGLA 4CYOA 4R3KA 4QVTA 3F0AA 3FYNA 1YVOA 4JLYA 3D3SA 4AVBA 4E2AA 2ZW7A 2D4PA 4M85A 5BWAB 3WR7A 1V0CA 2EUIA 1N71A 3FIXA 4CRYB 4KOSA 2CNTA 2Q7BA 4A31A 3QB8A 2Y0MA 2VI7A 3IGRA 1MJ9A 3DR6A 3JUWA 2JDCA 3D8PA 2Z3KA 2Z3NA 5F47A 1R57A 4A32A 2NMTA 2I00A 4HNYB 5DWNA 4FD4A 1S7KA 4FD5A 5IV0A 2B4DA 4U9ZA 1NSLA 4HNXB 4KOWA 2GE3A 4NF1A 4AVAA 3EC4A 3ZZIA 4UCMA 4MFPA 1GHEA 4U9YA 4Y49B 2Z3MA 4B14A 2JDDA 1QSRA 4J3GA 3PP9A 4E8OA 4CAXA 4KZTA 3S6GA 3H5ZA 4DNCA 4JXQA 4H6UA 3R96A 5GCNA 4Q36A 4NCZA 3S6FA 3ZJ0A 4CYQA 4AVCA 4CGOA 1S60A 3R1KA 1XIXA 2FIWA 4NEXA 1M1DA 4IUSA 1BOBA 3SXNA 4Y49C 4CAWA 4UFXA 3VWEA 2Q44A 4C2ZA 4KUBA 4KOUA 2QECA 2RC4A 3FB3A 5G20A 2OZHA 5G21A 4XPDC 4OLLA 4PV6A 2VQYA 5I0CA 4KVOE 4UA3A 4I49A 4AG7A 1S5KA 2JEVA 3VWDA 1Y7RA 4UWIA 5DWMA 1QSTA 2CNMA 2HQYA 4OADA 4FD6A 3JVNA 4F6AA 4CGNA 1U6MA 1S7FA 3CXSA 3TO9A 1Q2DA 4F0XA 1YLEA 2VXKA 4QC6A 1IB1E 2WPXA 1Z4RA 4LX9A 1CJWA 1YR0A 5KTCA 2Z3LA 4RI1A 2YNCC 4YFJA 4R57A 1RXTA 3TO6A 1Y9KA 2CNSA 3NE7A 3TFYA 3CXQA 1VHSA 5KTDA 2I79A 5EBVA 2QIRA 1WK4A 3BJ8A 4KLWA 2OZGA 3R9FA 4HNWB 2EVNA 4C7HA 5H86A 1SQHA 1Y9WA 3EO4A 1QSOA 2ARHA 2JLMA 2B3VA 2PDOA 4KVME 4A95A 2PSWA 2K5TA 5AG7A 4GS4A 4ORFA 4II9A 2F5IA 5E96A 4B13A 3OWCA 2KCWA 3T9YA 2ZW6A 4CAEA 4UCPA 2Z0ZA 1MJBA 3I9SA 1NMTA 4XPKA 4QUSA 4CYPA 2Q0YA 5ISVA 4KSAA 2OU2A 4B5PB 3A9LA 4EVYA 3I3GA 1WWZA 1M4IA 4AB7A 1Z4EA 4CAFA 5IX3A 4H89A 4NXYA 5FVJA 2B5GB 1P0HA 4C2XA 4PSWA 2G3AA 2VZZA 4E0AA 1I1DA 1S7NA 4JWPA 1XE4A 4XPDB 3IU2A 2GANA 4UFVA 1YK3A 3GKRA 3LODA 3G8WA 4NSQA 4F0YA 5G22A 4UCNA 4MFQA 3GY9A 2ZXVA 5J8FA 2J8RA 4B10A 4CS0B 3EFAA 3B8GA 3FRMA 4B5OA 3FBUA 1IYLA 1YGHA 3R95A 4KUAA 5F46A 3TCVA 1XEBA 4MHDA 3EXNA 1MK4A 2YNDA 5G1ZA 3S6KA 4KORA 2VZYA 1M4GA 4B5PA 2P6GA 4UFWA 2VBQA 4B12A 4BBHA 1M4DA 1ZO0A 3PZJA 4Q38A 2AE6A 1TIQA 4MFJA 2C27A 2BL1A 2Q4VA 3R9GA 4MY0A 5A28A 1XMTA 3BJ7A 3F5BA 4PK2A 5F48A 3V8IA 4C2YA 2VEZA 5A27A 3TE4A 4R3LA 3FXTA 3SHPA 1Q2YA 2P0WA 2R8VA 2FE7A 2CXAA 4U5YA 2Z3PA 3QAHA 2D4OA 2FIAA 4HKFA 4BMHA 3GYAA 3IU1A 3D2PA 3IWEA 2BUEA 2WPWA 2FT0A 4R87A 4PK3A 3FNCA 1YREA 3CXPA 5IB0A 1I12A 2BSWA 2IL4A 4A30A 4YRHA 2B4DB 4XPLA 4QBJA 3DR8A 1OZPA 4ZBGA 2FS5A 2OB0A 3TOAA 4MFZA 2R98A 5H84A 4M3SA 4H6ZA 1MJAA 4C7IA 2GIVA 1XF8A 2YNCA 4IF5A 5JQ4A 5F49A 4QB9A 3TT2A 3UY5A 2DXQA 2G3TA 2PR1A 4MBUA 1VKCA 2R1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM0 A;  3P2F A;  2ATR A;  3H4Q A;  2P6F A;  2Z11 A;  1IID A;  4KOY A;  3W6X A;  5HMN A;  4JD6 A;  4LUA A;  2P6E A;  2X7B A;  1K4J A;  3W6S A;  4CRZ B;  3K9U A;  1J4J A;  2OZU A;  2O28 A;  4PSX A;  1QSM A;  3KKW A;  3PGP A;  5J8C A;  3TTH A;  2AJ6 A;  4MY3 A;  2CY2 A;  4L8A A;  4KLV A;  4KOX A;  1B6B A;  2B58 A;  5C88 A;  1L0C A;  1FY7 A;  4KOV A;  2R7H A;  3MGD A;  3S6H A;  3N7Z A;  5KTA A;  2ZPA A;  1IIC A;  1LRZ A;  4UBR A;  4AG9 A;  2FXF A;  2Z10 A;  2B3U A;  3RYO A;  2PR8 A;  1Z9U A;  5EC4 A;  2PRB A;  4XNH B;  2J8N A;  1ON0 A;  1S7L A;  4ONU A;  1PU9 A;  4YGO A;  1KUV A;  2OH1 A;  4JJX A;  3EY5 A;  3R9E A;  2REE A;  3LD2 A;  3IWG A;  1IYK A;  2A4N A;  2HUZ A;  3F8K A;  2B5G A;  3DNS A;  4KOT A;  3C26 A;  4X5K A;  4XNH C;  2PC1 A;  1NE9 A;  1KUX A;  4JXR A;  1KZF A;  1I21 A;  2J8M A;  3DSB A;  2Q4Y A;  4CAV A;  5JPH A;  1B87 A;  3TO7 A;  2QML A;  2ZW4 A;  1QSN A;  4R9M A;  1M44 A;  3P2H A;  1PUA A;  2B4B A;  2REF A;  3W91 A;  2Q04 A;  3BLN A;  4FD7 A;  4UWJ A;  2PQ8 A;  2H5M A;  3T90 A;  3SXO A;  1UFH A;  4RS2 A;  5HH1 A;  3DDD A;  4KVX A;  2ZW5 A;  1Q2C A;  4L89 A;  1YVK A;  1S3Z A;  1RO5 A;  2BEI A;  2HV2 A;  2FL4 A;  1BO4 A;  1P4N A;  5C82 A;  4MJ8 A;  3G3S A;  5CNP A;  4OAE A;  2G0B A;  3TOB A;  2FCK A;  3E0K A;  1KUY A;  4K30 A;  3D2M A;  4MI4 A;  1YX0 A;  2FSR A;  4R3K A;  4QVT A;  3F0A A;  3FYN A;  1YVO A;  4JLY A;  3D3S A;  4AVB A;  4E2A A;  2ZW7 A;  2D4P A;  4M85 A;  3WR7 A;  1V0C A;  2EUI A;  1N71 A;  3FIX A;  4CRY B;  4KOS A;  2CNT A;  2Q7B A;  3QB8 A;  2Y0M A;  2VI7 A;  3IGR A;  1MJ9 A;  3DR6 A;  3JUW A;  2JDC A;  3D8P A;  5F47 A;  1R57 A;  2NMT A;  2I00 A;  4HNY B;  5DWN A;  4FD4 A;  1S7K A;  4FD5 A;  5IV0 A;  2B4D A;  4U9Z A;  1NSL A;  4HNX B;  4KOW A;  2GE3 A;  4NF1 A;  4AVA A;  3EC4 A;  3ZZI A;  1GHE A;  4U9Y A;  4Y49 B;  2JDD A;  1QSR A;  4J3G A;  3PP9 A;  4E8O A;  4CAX A;  4KZT A;  3S6G A;  4DNC A;  4JXQ A;  4H6U A;  3R96 A;  5GCN A;  4NCZ A;  3S6F A;  3ZJ0 A;  4AVC A;  1S60 A;  3R1K A;  1XIX A;  2FIW A;  4NEX A;  1M1D A;  4IUS A;  1BOB A;  3SXN A;  4Y49 C;  4CAW A;  3VWE A;  2Q44 A;  4KUB A;  4KOU A;  2QEC A;  2RC4 A;  3FB3 A;  2OZH A;  4XPD C;  4OLL A;  4PV6 A;  2VQY A;  5I0C A;  4KVO E;  4UA3 A;  4I49 A;  4AG7 A;  1S5K A;  2JEV A;  3VWD A;  1Y7R A;  4UWI A;  5DWM A;  1QST A;  2CNM A;  2HQY A;  4OAD A;  4FD6 A;  3JVN A;  4F6A A;  1U6M A;  1S7F A;  3CXS A;  3TO9 A;  1Q2D A;  1YLE A;  2VXK A;  4QC6 A;  1IB1 E;  2WPX A;  1Z4R A;  4LX9 A;  1CJW A;  1YR0 A;  5KTC A;  4RI1 A;  4YFJ A;  4R57 A;  1RXT A;  3TO6 A;  1Y9K A;  2CNS A;  3NE7 A;  3TFY A;  3CXQ A;  1VHS A;  5KTD A;  2I79 A;  5EBV A;  2QIR A;  1WK4 A;  3BJ8 A;  4KLW A;  2OZG A;  3R9F A;  4HNW B;  2EVN A;  5H86 A;  1SQH A;  1Y9W A;  3EO4 A;  1QSO A;  2ARH A;  2JLM A;  2B3V A;  2PDO A;  4KVM E;  2PSW A;  2K5T A;  4GS4 A;  4ORF A;  4II9 A;  2F5I A;  5E96 A;  3OWC A;  2KCW A;  3T9Y A;  2ZW6 A;  2Z0Z A;  1MJB A;  3I9S A;  1NMT A;  4XPK A;  4QUS A;  2Q0Y A;  5ISV A;  2OU2 A;  4B5P B;  4EVY A;  3I3G A;  1WWZ A;  1M4I A;  4AB7 A;  1Z4E A;  5IX3 A;  4H89 A;  4NXY A;  5FVJ A;  2B5G B;  1P0H A;  4PSW A;  2G3A A;  2VZZ A;  4E0A A;  1I1D A;  1S7N A;  4JWP A;  1XE4 A;  4XPD B;  2GAN A;  1YK3 A;  3GKR A;  3LOD A;  3G8W A;  4NSQ A;  4F0Y A;  3GY9 A;  2ZXV A;  5J8F A;  2J8R A;  4CS0 B;  3EFA A;  3B8G A;  3FRM A;  4B5O A;  3FBU A;  1IYL A;  1YGH A;  3R95 A;  4KUA A;  5F46 A;  3TCV A;  1XEB A;  4MHD A;  3EXN A;  1MK4 A;  3S6K A;  4KOR A;  2VZY A;  1M4G A;  4B5P A;  2P6G A;  2VBQ A;  1M4D A;  3PZJ A;  2AE6 A;  1TIQ A;  2C27 A;  2BL1 A;  2Q4V A;  3R9G A;  4MY0 A;  1XMT A;  3BJ7 A;  3F5B A;  4PK2 A;  5F48 A;  3V8I A;  2VEZ A;  3TE4 A;  4R3L A;  3FXT A;  3SHP A;  1Q2Y A;  2P0W A;  2R8V A;  2FE7 A;  4U5Y A;  3QAH A;  2D4O A;  2FIA A;  4HKF A;  4BMH A;  3GYA A;  3D2P A;  2BUE A;  2WPW A;  2FT0 A;  4R87 A;  4PK3 A;  3FNC A;  1YRE A;  3CXP A;  5IB0 A;  1I12 A;  2BSW A;  2IL4 A;  4YRH A;  2B4D B;  4XPL A;  4QBJ A;  3DR8 A;  1OZP A;  4ZBG A;  2FS5 A;  2OB0 A;  3TOA A;  2R98 A;  5H84 A;  4M3S A;  4H6Z A;  1MJA A;  2GIV A;  1XF8 A;  4IF5 A;  5JQ4 A;  5F49 A;  4QB9 A;  3TT2 A;  3UY5 A;  2DXQ A;  2G3T A;  2PR1 A;  4MBU A;  1VKC A;  2R1I A; 
#chains in the Genus database with same CATH topology
 1CM0 A;  3P2F A;  2ATR A;  4MFK A;  1X12 A;  3H4Q A;  5LYL A;  2ZEM A;  2P6F A;  2Z11 A;  1IID A;  4KOY A;  4KS9 A;  3W6X A;  4CGM A;  3KHZ A;  4MCQ A;  5CBM A;  5HMN A;  4NGN A;  4JD6 A;  4ZY1 A;  4P4E A;  3NH4 A;  4LUA A;  4YWY A;  4P45 A;  4CGP A;  2QYV A;  2WUU A;  2WSA A;  5LYI A;  3FMC A;  4K3N A;  3SI1 A;  2P6E A;  4M6I A;  3MRU A;  3WAB A;  3D7G A;  4OID A;  4KSI A;  4A2Z A;  4EWT A;  2X7B A;  3KR4 A;  1K4J A;  3W6S A;  4CRZ B;  1IU8 A;  2Q7S A;  3K9U A;  1J4J A;  1YW4 A;  2O28 A;  2OZU A;  1XFO A;  4PSX A;  4KSF A;  1QSM A;  3KKW A;  3PGP A;  3PEI A;  1XMB A;  4DJL A;  5CPA A;  3D68 A;  5J8C A;  4MRI A;  3TTH A;  4P6Y A;  2AJ6 A;  4MY3 A;  2CY2 A;  4L8A A;  4FBE A;  4KLV A;  1RTQ A;  4KOX A;  1B6B A;  2B58 A;  5C88 A;  3IJ3 A;  1L0C A;  2CTC A;  4MFL A;  1FY7 A;  5LYD A;  1QMU A;  4X8I A;  1LCP A;  4KOV A;  2BO9 A;  2DPT A;  4MCP A;  4R8F A;  4A33 A;  2OR4 A;  2R7H A;  1GYT A;  1ARM A;  2ZEN A;  3KHX A;  2DPS A;  3K9T A;  3MGD A;  3S6H A;  3N7Z A;  5HXD A;  2FVG A;  1YLO A;  3KAS A;  3TX8 A;  5KTA A;  2ZPA A;  4NGS A;  1YME A;  5AG4 A;  4AXV A;  5AG5 A;  1IIC A;  1LRZ A;  3B35 A;  4UBR A;  2JBJ A;  4AG9 A;  2FXF A;  2Z10 A;  2B3U A;  3RYO A;  4C68 A;  2PJ5 A;  1CP6 A;  4NJR A;  2PR8 A;  1Z9U A;  1ARL A;  2HB6 A;  5EC4 A;  2PRB A;  4NGM A;  3K2K A;  2ZEF A;  5AGE A;  3RNZ A;  4XNH B;  3T8W A;  4DYO A;  1XJO A;  1ON0 A;  2J8N A;  1S7L A;  3SJX A;  4ZGY B;  4ONU A;  2Z3O A;  1PU9 A;  4IAV A;  2PJC A;  4YGO A;  1A2Z A;  1KUV A;  2OH1 A;  4JJX A;  3EY5 A;  3R9E A;  3B3W A;  2REE A;  3B3S A;  1H8L A;  3LD2 A;  3PFO A;  2PCU A;  1HDQ A;  3IWG A;  5LRG A;  4B11 A;  4RN7 A;  1IYK A;  2RFH A;  5F09 A;  2A4N A;  2HUZ A;  3HLP A;  3F8K A;  2B5G A;  3DNS A;  2YNE A;  3PB7 X;  4KOT A;  3FH4 A;  3C26 A;  1XOV A;  4X5K A;  4XNH C;  2PC1 A;  1NE9 A;  1Y0R A;  3SJF A;  1KUX A;  2G9D A;  4JXR A;  1KZF A;  1I21 A;  2J8M A;  3DSB A;  2Q4Y A;  4M6G A;  4CAV A;  1B87 A;  3KR5 A;  2QML A;  2ZW4 A;  3TO7 A;  5JPH A;  1QSN A;  2C6G A;  4R9M A;  3JTK A;  1M44 A;  3P2H A;  2Q43 A;  2GU2 A;  3V7Z A;  2PJB A;  2EWB A;  1PUA A;  2ZEL A;  2B4B A;  2REF A;  3W91 A;  2CF4 A;  2Q04 A;  3BLN A;  3CDX A;  4FD7 A;  1TKH A;  1Y0Y A;  2PQ8 A;  3PB8 X;  2H5M A;  4LQ6 A;  4UWJ A;  3T90 A;  2NYQ A;  3SXO A;  1UFH A;  3FF3 A;  2GLF A;  2ANP A;  5HVG A;  1TF9 A;  4RS2 A;  5HH1 A;  4FUU A;  3VAR A;  4CYN A;  3DDD A;  4KVX A;  5IB9 A;  2ZW5 A;  1Q2C A;  4L89 A;  4PXD A;  3NH8 A;  4ZX8 A;  1YVK A;  2PJ6 A;  1S3Z A;  3IEH A;  1RO5 A;  1ZLH A;  2BEI A;  4OC3 A;  4RUH A;  2HV2 A;  2FL4 A;  2YGW A;  1BO4 A;  1P4N A;  1OBR A;  3WC5 A;  3KL9 A;  2V8V A;  2ABZ A;  4BIN A;  5C82 A;  5AG6 A;  3FEC A;  4MJ8 A;  3G3S A;  5CNP A;  4OAE A;  4A94 A;  2G0B A;  4OC4 A;  3TOB A;  2FCK A;  3D4U A;  3E0K A;  3PRT A;  4R7M A;  3SJG A;  5JGF A;  1KUY A;  4K30 A;  3D2M A;  4JZ0 A;  4MI4 A;  4NGR A;  1YX0 A;  4MHZ A;  2Q51 A;  2FSR A;  1TKF A;  7CPA A;  1Q7L A;  2ZOF A;  4CGL A;  3DLJ A;  4CYO A;  4GM5 A;  4R3K A;  4QVT A;  1ZG9 A;  3F0A A;  3FYN A;  1YVO A;  4JLY A;  3D3S A;  4AVB A;  4E2A A;  2ZW7 A;  2D4P A;  4M85 A;  5BWA B;  3WR7 A;  1V0C A;  2EUI A;  1N71 A;  3FIX A;  4CRY B;  2F7V A;  4KOS A;  4EME A;  2CNT A;  2Q7B A;  4A31 A;  1YQE A;  3QB8 A;  2Y0M A;  5I4M A;  2VI7 A;  3IGR A;  4PXE A;  1MJ9 A;  3DR6 A;  3PBE A;  3B3V A;  4P44 A;  3JUW A;  2JDC A;  3D8P A;  2C1C A;  1X10 A;  1XBU A;  2NSM A;  2Z3K A;  2Z3N A;  2IMO A;  3D7H A;  4P4F A;  5F47 A;  1R57 A;  2PJA A;  4A32 A;  4ZYQ A;  2NMT A;  2I00 A;  2ZEP A;  4HNY B;  4P4D A;  5DWN A;  4FD4 A;  4LQG A;  1S7K A;  3FJU A;  4FD5 A;  1F2O A;  5IV0 A;  2B4D A;  4U9Z A;  2GRE A;  1NSL A;  4WWV A;  4HNX B;  3H8E A;  1ELL P;  4KOW A;  3SI2 A;  3CT9 A;  3D66 A;  2AFZ A;  2GE3 A;  1CPS A;  1Z2L A;  3B3C A;  5K8O A;  2XEI A;  3WC7 A;  3BI1 A;  4NF1 A;  3EC4 A;  3NA6 A;  4AVA A;  4FAI A;  2EO8 A;  3BXM A;  3ZZI A;  4JYW A;  4UCM A;  4NJQ A;  1Z8T A;  4MFP A;  1GHE A;  4U9Y A;  1KWM A;  4Y49 B;  1IGB A;  2Z3M A;  4B14 A;  3CZX A;  2JDD A;  1QSR A;  4J3G A;  3PP9 A;  5D8N A;  4E8O A;  4CAX A;  3CPX A;  1AYE A;  3H5Z A;  4KZT A;  3MN8 A;  4TWE A;  3S6G A;  4JXQ A;  4DNC A;  3BI0 A;  1LFW A;  4H6U A;  1ZG8 A;  2WZN A;  5GCN A;  3R96 A;  4B6Z A;  2BCO A;  4X3R A;  4Q36 A;  4NCZ A;  3S6F A;  3VAT A;  1TXR A;  3ZJ0 A;  2IJZ A;  4CYQ A;  4AVC A;  4CGO A;  1IOI A;  1QQ9 A;  1S60 A;  1M4L A;  3R1K A;  4Z65 A;  1XIX A;  2FIW A;  4NEX A;  4UEF A;  4MHP A;  1M1D A;  3N5F A;  4IUS A;  1BPN A;  1YSJ A;  3H8F A;  5HVF A;  3H8G A;  1BOB A;  3SXN A;  4Y49 C;  3GLJ A;  4CAW A;  4F8Z A;  4UFX A;  1ELM P;  3VWE A;  1BAV A;  1DE4 C;  2Q44 A;  1CP7 A;  4C2Z A;  4KUB A;  4KOU A;  2QEC A;  2RC4 A;  3FB3 A;  4R6T A;  4X2T A;  3IWW A;  5G20 A;  2OZH A;  2CTB A;  5G21 A;  8CPA A;  4XPD C;  4MCR A;  4OLL A;  1HDU A;  4PV6 A;  2VQY A;  4BD9 A;  5I0C A;  4KVO E;  4UA3 A;  1Z8X A;  3NFZ A;  4A37 A;  4I49 A;  1VIX A;  5THW A;  5EMI A;  4AG7 A;  3I1U A;  2AFM A;  5D29 A;  2ODF A;  3WT4 A;  1S5K A;  1VHO A;  2JEV A;  3KGQ A;  4WJB A;  3RO0 A;  3IIB A;  3VWD A;  2EK9 A;  1Y7R A;  2F8H A;  4UWI A;  3WC6 A;  2PVV A;  1QST A;  4W9Y A;  5DWM A;  2C6P A;  2BOA A;  2CNM A;  3SJE A;  2IQ6 A;  2V8H A;  1PCA A;  2HQY A;  2HC9 A;  2PVW A;  4OAD A;  4GXH A;  4FD6 A;  3JVN A;  2AFU A;  2V77 A;  4F6A A;  4CGN A;  1U6M A;  1S7F A;  3BHX A;  3CXS A;  3TO9 A;  5LYF A;  1Q2D A;  3DGV A;  4F0X A;  1YLE A;  2J9A A;  2VXK A;  1TF8 A;  1IB1 E;  2WPX A;  4QC6 A;  3LWU A;  4NGQ A;  1Z4R A;  3S9N A;  2JBK A;  3FVL A;  4LX9 A;  4UEE A;  3KQX A;  1CJW A;  1YR0 A;  5KTC A;  2Z3L A;  4RI1 A;  2YNC C;  3LAC A;  4YFJ A;  3IFE A;  4R57 A;  4TNU A;  1RXT A;  2RB7 A;  3TO6 A;  1AUG A;  1Y9K A;  2CNS A;  3NE7 A;  3TFY A;  4OC0 A;  3CXQ A;  1TKJ A;  1ZG7 A;  1VHS A;  5KTD A;  1CG2 A;  2VL1 A;  4OC2 A;  2I79 A;  5K8M A;  5EBV A;  2QIR A;  2WYR A;  4P4B A;  1VGY A;  1WK4 A;  3IC1 A;  3BJ8 A;  4KLW A;  2OZG A;  3NH5 A;  2ZEE A;  4OKO A;  3R9F A;  4ZI6 A;  4HPS A;  4HNW B;  1BPM A;  2PJ2 A;  2EVN A;  4C7H A;  1Z8L A;  4MHN A;  5H86 A;  3B2Y A;  1SQH A;  5HVH A;  3PB6 X;  1Y9W A;  4F9U A;  3EO4 A;  1QSO A;  2ARH A;  2JLM A;  3LMS A;  1LOK A;  2B3V A;  2PDO A;  4KVM E;  4MCS A;  4A95 A;  2PSW A;  2K5T A;  2PIZ A;  1R3N A;  4FWU A;  4GS4 A;  4ORF A;  1LAM A;  5AG7 A;  2F5I A;  5E96 A;  3RBU A;  4B13 A;  4DUK A;  4II9 A;  2XEG A;  1DTD A;  5LRJ A;  1R43 A;  2KCW A;  3OWC A;  3T9Y A;  5J1Q A;  2ZW6 A;  1BLL E;  1UWY A;  3VH9 A;  4CAE A;  4UCP A;  2Z0Z A;  1MJB A;  2ZED A;  3I9S A;  4NGP A;  2I3C A;  2EBJ A;  1NMT A;  4NGT A;  4XPK A;  4PQA A;  5DS0 A;  2OOT A;  2O53 A;  4QUS A;  4CYP A;  2Q0Y A;  5ISV A;  3B7I A;  4KSA A;  3B3T A;  1PYT B;  2OU2 A;  4B5P B;  2PRQ A;  1FT7 A;  3A9L A;  2PJ8 A;  2CIJ A;  4EVY A;  4A39 A;  3D67 A;  2V8G A;  5JM6 A;  1YW6 A;  3I3G A;  1WWZ A;  1M4I A;  4AB7 A;  1Z4E A;  3JRU A;  4CAF A;  4H89 A;  5IX3 A;  1EE3 P;  4NXY A;  3HUV A;  1XRY A;  5FVJ A;  2B5G B;  2PJ9 A;  2PJ3 A;  3CPA A;  4UIA A;  1P0H A;  4C2X A;  4PSW A;  2G3A A;  2VZZ A;  4E0A A;  4Q7A A;  1I1D A;  3KI9 A;  1CX8 A;  1S7N A;  3FED A;  4JWP A;  1XE4 A;  4XPD B;  3IU2 A;  2GAN A;  4UFV A;  1YK3 A;  3GKR A;  3LOD A;  2AFW A;  1CBX A;  3G8W A;  1AMP A;  4NSQ A;  4F0Y A;  4H2K A;  1FNO A;  3TC8 A;  5G22 A;  4UCN A;  4MFQ A;  3GY9 A;  2ZXV A;  5J8F A;  2J8R A;  2PJ7 A;  4B10 A;  4CS0 B;  3EFA A;  3B8G A;  2AFS A;  3FRM A;  4B5O A;  2JEW A;  2Q4Z A;  3D7F A;  1CPX A;  3FBU A;  2DEA A;  1IYL A;  1YGH A;  4IK2 A;  3R95 A;  4KUA A;  5F46 A;  4ZY0 A;  3TCV A;  1XEB A;  1JQG A;  4MHD A;  1Y7E A;  3EXN A;  3S9L A;  3PFE A;  1MK4 A;  2YND A;  4ONW A;  2V8D A;  3L2N A;  4UIB A;  5G1Z A;  4CPA A;  4PXB A;  3S6K A;  4KOR A;  2VZY A;  1M4G A;  4O23 A;  2ZEH A;  4B5P A;  4P4J A;  2P6G A;  3NE8 A;  4UFW A;  2VBQ A;  5JH9 A;  4B12 A;  4BBH A;  1M4D A;  2EK8 A;  1ZO0 A;  3PZJ A;  3ISX A;  2AE6 A;  4Q38 A;  1TIQ A;  4MFJ A;  1VHE A;  2C27 A;  2BL1 A;  2PJ0 A;  2Q4V A;  1Z8W A;  4R76 A;  3R9G A;  3GIU A;  4MY0 A;  2ZOG A;  2ZEO A;  1XMT A;  5A28 A;  4MXU A;  2AFX A;  3BJ7 A;  1F2P A;  1LAP A;  4EFD A;  3F5B A;  3GUX A;  4OC1 A;  3FX6 A;  3KQZ A;  4PK2 A;  2DF5 A;  5F48 A;  3PB9 X;  4PPZ A;  3IO1 A;  3V8I A;  2VEZ A;  4C2Y A;  5A27 A;  4R3L A;  5K8P A;  3TE4 A;  3FXT A;  1Z5R A;  3SHP A;  1Q2Y A;  2P0W A;  2R8V A;  2FE7 A;  3FEE A;  3GB0 A;  2CXA A;  3KZW A;  4IHM A;  4OP4 A;  3PB4 X;  1LAN A;  3QNV A;  4U5Y A;  2Z3P A;  3QAH A;  2D4O A;  2FIA A;  4HKF A;  4A38 A;  4OIW A;  5ELY A;  4BMH A;  3RZA A;  2PIY A;  4OME A;  2POK A;  2XEF A;  3GYA A;  3IU1 A;  3V38 A;  1IOF A;  3D2P A;  4ZY2 A;  1JWQ A;  6CPA A;  3IWE A;  4ZX9 A;  2BUE A;  2ZEG A;  1NSA A;  2WPW A;  2FT0 A;  4R87 A;  3SI0 A;  4PK3 A;  2GFQ A;  4NFR A;  2QJ8 A;  3FNC A;  4YU9 A;  1YRE A;  2PE3 A;  3CXP A;  2AFO A;  2C6C A;  1I12 A;  2O4H A;  2PJ1 A;  2QVP A;  5IB0 A;  2BSW A;  2IL4 A;  4MHY A;  3RAM A;  4YRH A;  2B4D B;  3S9M A;  4A30 A;  5LRK A;  4P4I A;  2GLJ A;  4OC5 A;  4PXC A;  4XPL A;  4QBJ A;  3DR8 A;  1OZP A;  4ZBG A;  2FS5 A;  2OB0 A;  3TOA A;  4MFZ A;  1HEE A;  1F57 A;  3PBB A;  2R98 A;  5H84 A;  4UF4 A;  4MMO A;  4M3S A;  2XEJ A;  3D7D A;  1ZLI A;  4H6Z A;  4M6H A;  4UEZ A;  4F9V A;  1MJA A;  4C7I A;  2GIV A;  4P10 A;  1XF8 A;  2YNC A;  3ISZ A;  4IF5 A;  5JQ4 A;  5F49 A;  4QB9 A;  2PJ4 A;  4G1P A;  3TT2 A;  5K8N A;  3UY5 A;  2DXQ A;  3QAY A;  2G3T A;  1IY7 A;  2PR1 A;  4MBU A;  1VKC A;  2R1I A; 
#chains in the Genus database with same CATH homology
 1CM0 A;  3P2F A;  2ATR A;  4MFK A;  3H4Q A;  2P6F A;  2Z11 A;  1IID A;  4KOY A;  4KS9 A;  3W6X A;  4CGM A;  5HMN A;  4JD6 A;  4LUA A;  4CGP A;  2WUU A;  2WSA A;  2P6E A;  4A2Z A;  2X7B A;  1K4J A;  3W6S A;  4CRZ B;  3K9U A;  1J4J A;  2OZU A;  2O28 A;  4PSX A;  4KSF A;  1QSM A;  3KKW A;  3PGP A;  5J8C A;  3TTH A;  2AJ6 A;  4MY3 A;  2CY2 A;  4L8A A;  4KLV A;  4KOX A;  1B6B A;  2B58 A;  5C88 A;  1L0C A;  4MFL A;  1FY7 A;  4KOV A;  2DPT A;  4A33 A;  2R7H A;  3MGD A;  2DPS A;  3S6H A;  3N7Z A;  5KTA A;  2ZPA A;  5AG4 A;  5AG5 A;  1IIC A;  1LRZ A;  4UBR A;  4AG9 A;  2FXF A;  2Z10 A;  2B3U A;  3RYO A;  4C68 A;  2PR8 A;  1Z9U A;  5EC4 A;  2PRB A;  5AGE A;  4XNH B;  2J8N A;  1ON0 A;  1S7L A;  4ZGY B;  4ONU A;  2Z3O A;  1PU9 A;  4YGO A;  1KUV A;  2OH1 A;  4JJX A;  3EY5 A;  3R9E A;  2REE A;  3LD2 A;  3IWG A;  4B11 A;  1IYK A;  2A4N A;  2HUZ A;  3F8K A;  2B5G A;  3DNS A;  2YNE A;  4KOT A;  3C26 A;  4X5K A;  4XNH C;  2PC1 A;  1NE9 A;  1KUX A;  4JXR A;  1KZF A;  1I21 A;  2J8M A;  3DSB A;  2Q4Y A;  4CAV A;  5JPH A;  1B87 A;  3TO7 A;  2QML A;  2ZW4 A;  1QSN A;  4R9M A;  3JTK A;  1M44 A;  3P2H A;  1PUA A;  2B4B A;  2REF A;  3W91 A;  2Q04 A;  3BLN A;  4FD7 A;  4UWJ A;  2PQ8 A;  2H5M A;  3T90 A;  3SXO A;  1UFH A;  4RS2 A;  5HH1 A;  4CYN A;  3DDD A;  4KVX A;  2ZW5 A;  1Q2C A;  4L89 A;  1YVK A;  1S3Z A;  1RO5 A;  2BEI A;  2HV2 A;  2FL4 A;  2YGW A;  1BO4 A;  1P4N A;  5C82 A;  5AG6 A;  4MJ8 A;  3G3S A;  5CNP A;  4OAE A;  2G0B A;  3TOB A;  2FCK A;  3E0K A;  1KUY A;  4K30 A;  3D2M A;  4MI4 A;  1YX0 A;  2FSR A;  4CGL A;  4CYO A;  4R3K A;  4QVT A;  3F0A A;  3FYN A;  1YVO A;  4JLY A;  3D3S A;  4AVB A;  4E2A A;  2ZW7 A;  2D4P A;  4M85 A;  5BWA B;  3WR7 A;  1V0C A;  2EUI A;  1N71 A;  3FIX A;  4CRY B;  4KOS A;  2CNT A;  2Q7B A;  4A31 A;  3QB8 A;  2Y0M A;  2VI7 A;  3IGR A;  1MJ9 A;  3DR6 A;  3JUW A;  2JDC A;  3D8P A;  2Z3K A;  2Z3N A;  5F47 A;  1R57 A;  4A32 A;  2NMT A;  2I00 A;  4HNY B;  5DWN A;  4FD4 A;  1S7K A;  4FD5 A;  5IV0 A;  2B4D A;  4U9Z A;  1NSL A;  4HNX B;  4KOW A;  2GE3 A;  4NF1 A;  4AVA A;  3EC4 A;  3ZZI A;  4UCM A;  4MFP A;  1GHE A;  4U9Y A;  4Y49 B;  2Z3M A;  4B14 A;  2JDD A;  1QSR A;  4J3G A;  3PP9 A;  4E8O A;  4CAX A;  4KZT A;  3S6G A;  3H5Z A;  4DNC A;  4JXQ A;  4H6U A;  3R96 A;  5GCN A;  4Q36 A;  4NCZ A;  3S6F A;  3ZJ0 A;  4CYQ A;  4AVC A;  4CGO A;  1S60 A;  3R1K A;  1XIX A;  2FIW A;  4NEX A;  1M1D A;  4IUS A;  1BOB A;  3SXN A;  4Y49 C;  4CAW A;  4UFX A;  3VWE A;  2Q44 A;  4C2Z A;  4KUB A;  4KOU A;  2QEC A;  2RC4 A;  3FB3 A;  5G20 A;  2OZH A;  5G21 A;  4XPD C;  4OLL A;  4PV6 A;  2VQY A;  5I0C A;  4KVO E;  4UA3 A;  4I49 A;  4AG7 A;  1S5K A;  2JEV A;  3VWD A;  1Y7R A;  4UWI A;  5DWM A;  1QST A;  2CNM A;  2HQY A;  4OAD A;  4FD6 A;  3JVN A;  4F6A A;  4CGN A;  1U6M A;  1S7F A;  3CXS A;  3TO9 A;  1Q2D A;  4F0X A;  1YLE A;  2VXK A;  4QC6 A;  1IB1 E;  2WPX A;  1Z4R A;  4LX9 A;  1CJW A;  1YR0 A;  5KTC A;  2Z3L A;  4RI1 A;  2YNC C;  4YFJ A;  4R57 A;  1RXT A;  3TO6 A;  1Y9K A;  2CNS A;  3NE7 A;  3TFY A;  3CXQ A;  1VHS A;  5KTD A;  2I79 A;  5EBV A;  2QIR A;  1WK4 A;  3BJ8 A;  4KLW A;  2OZG A;  3R9F A;  4HNW B;  2EVN A;  4C7H A;  5H86 A;  1SQH A;  1Y9W A;  3EO4 A;  1QSO A;  2ARH A;  2JLM A;  2B3V A;  2PDO A;  4KVM E;  4A95 A;  2PSW A;  2K5T A;  5AG7 A;  4GS4 A;  4ORF A;  4II9 A;  2F5I A;  5E96 A;  4B13 A;  3OWC A;  2KCW A;  3T9Y A;  2ZW6 A;  4CAE A;  4UCP A;  2Z0Z A;  1MJB A;  3I9S A;  1NMT A;  4XPK A;  4QUS A;  4CYP A;  2Q0Y A;  5ISV A;  4KSA A;  2OU2 A;  4B5P B;  3A9L A;  4EVY A;  3I3G A;  1WWZ A;  1M4I A;  4AB7 A;  1Z4E A;  4CAF A;  5IX3 A;  4H89 A;  4NXY A;  5FVJ A;  2B5G B;  1P0H A;  4C2X A;  4PSW A;  2G3A A;  2VZZ A;  4E0A A;  1I1D A;  1S7N A;  4JWP A;  1XE4 A;  4XPD B;  3IU2 A;  2GAN A;  4UFV A;  1YK3 A;  3GKR A;  3LOD A;  3G8W A;  4NSQ A;  4F0Y A;  5G22 A;  4UCN A;  4MFQ A;  3GY9 A;  2ZXV A;  5J8F A;  2J8R A;  4B10 A;  4CS0 B;  3EFA A;  3B8G A;  3FRM A;  4B5O A;  3FBU A;  1IYL A;  1YGH A;  3R95 A;  4KUA A;  5F46 A;  3TCV A;  1XEB A;  4MHD A;  3EXN A;  1MK4 A;  2YND A;  5G1Z A;  3S6K A;  4KOR A;  2VZY A;  1M4G A;  4B5P A;  2P6G A;  4UFW A;  2VBQ A;  4B12 A;  4BBH A;  1M4D A;  1ZO0 A;  3PZJ A;  4Q38 A;  2AE6 A;  1TIQ A;  4MFJ A;  2C27 A;  2BL1 A;  2Q4V A;  3R9G A;  4MY0 A;  5A28 A;  1XMT A;  3BJ7 A;  3F5B A;  4PK2 A;  5F48 A;  3V8I A;  4C2Y A;  2VEZ A;  5A27 A;  3TE4 A;  4R3L A;  3FXT A;  3SHP A;  1Q2Y A;  2P0W A;  2R8V A;  2FE7 A;  2CXA A;  4U5Y A;  2Z3P A;  3QAH A;  2D4O A;  2FIA A;  4HKF A;  4BMH A;  3GYA A;  3IU1 A;  3D2P A;  3IWE A;  2BUE A;  2WPW A;  2FT0 A;  4R87 A;  4PK3 A;  3FNC A;  1YRE A;  3CXP A;  5IB0 A;  1I12 A;  2BSW A;  2IL4 A;  4A30 A;  4YRH A;  2B4D B;  4XPL A;  4QBJ A;  3DR8 A;  1OZP A;  4ZBG A;  2FS5 A;  2OB0 A;  3TOA A;  4MFZ A;  2R98 A;  5H84 A;  4M3S A;  4H6Z A;  1MJA A;  4C7I A;  2GIV A;  1XF8 A;  2YNC A;  4IF5 A;  5JQ4 A;  5F49 A;  4QB9 A;  3TT2 A;  3UY5 A;  2DXQ A;  2G3T A;  2PR1 A;  4MBU A;  1VKC A;  2R1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...