4KOWA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefoxitin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kowA00
3BLNA 3W91A 2K5TA 4AG7A 1OZPA 3MGDA 4MY3A 4JD6A 1KZFA 2FS5A 5F48A 2VZYA 4KOVA 1Y7RA 1YREA 1LRZA 1Z4RA 1M1DA 3UY5A 3VWDA 3TE4A 4II9A 4QC6A 3PZJA 2QMLA 4CAWA 3V8IA 4ORFA 4R87A 4R9MA 1TIQA 5JQ4A 2PR1A 3NE7A 2Z0ZA 3P2HA 1YK3A 4JXQA 5FVJA 1S3ZA 5DWMA 2AE6A 2R7HA 4XPKA 4U9ZA 1S5KA 3TOBA 1MJBA 2I00A 4LX9A 2HV2A 2Z11A 5DWNA 1UFHA 3S6FA 4H6ZA 2NMTA 4AVBA 1NE9A 2VZZA 2X7BA 4UWJA 1Q2CA 3R9FA 4AB7A 4PV6A 3FB3A 4CS0B 2EVNA 4KVME 2PC1A 2KCWA 3JVNA 5F47A 3EO4A 3F5BA 2PDOA 2FIAA 4U5YA 2VQYA 4R3LA 4PSWA 3P2FA 3VWEA 3R9GA 1WWZA 2A4NA 1KUXA 2OB0A 1S7NA 4FD7A 2RC4A 2OZHA 2QECA 5KTAA 4YRHA 4FD4A 4KZTA 1XIXA 2OZUA 2CNSA 3EY5A 4H89A 4MI4A 3CXPA 1M4IA 3D2PA 2ZPAA 4OAEA 4X5KA 2QIRA 1B87A 2FE7A 2JEVA 2BSWA 1QSTA 2F5IA 3F0AA 4XPLA 3FYNA 2REEA 1M4DA 4KVXA 2OH1A 4L89A 1WK4A 3BJ8A 4BMHA 3ZJ0A 1I12A 3SXOA 2JLMA 3R1KA 3JUWA 4KLWA 4KOYA 1S7FA 3DR6A 2B3VA 1P0HA 2GIVA 1I21A 2B5GA 1KUYA 4HKFA 2HUZA 2Q04A 2FXFA 4KUBA 4MJ8A 2P6EA 4DNCA 1XF8A 5GCNA 3K9UA 4U9YA 1N71A 5KTCA 2PRBA 3DDDA 4CRYB 4AVAA 4M85A 4NEXA 4B5PA 3TTHA 1IYLA 3BJ7A 2J8MA 2OU2A 3IWGA 5IV0A 1KUVA 4FD5A 4RI1A 2CY2A 3OWCA 2VEZA 4KOXA 2FL4A 2ATRA 2WPWA 1YX0A 4CAVA 4R57A 2Q44A 2FSRA 4LUAA 5I0CA 2GANA 4YGOA 3R9EA 4JLYA 2R8VA 5E96A 3EXNA 2B5GB 4CRZB 3I3GA 4PSXA 1VKCA 4QUSA 2O28A 2Y0MA 3TT2A 2WPXA 4Y49C 2Q0YA 2I79A 5H86A 4MHDA 3FBUA 5EBVA 1IYKA 4PK2A 1QSOA 4XNHC 5EC4A 3W6SA 4JJXA 4PK3A 2P0WA 3CXQA 4JWPA 1CM0A 3R96A 4KUAA 1MJ9A 2CNMA 3G3SA 1Q2DA 5C82A 3FRMA 5F49A 1QSNA 2B3UA 2ZW5A 4E0AA 4NXYA 4UBRA 3TO7A 2D4PA 4IUSA 2GE3A 1V0CA 3FIXA 2PQ8A 2G0BA 3LD2A 1QSMA 4OLLA 1SQHA 4KOTA 2AJ6A 3SXNA 3T9YA 5J8FA 1FY7A 4ZBGA 1J4JA 3KKWA 3DR8A 4EVYA 3DSBA 3EFAA 4XNHB 4B5PB 4L8AA 4E8OA 1M4GA 4JXRA 1ON0A 1RXTA 4AG9A 2ARHA 1B6BA 4NSQA 4CAXA 2VBQA 4KOUA 1Y9KA 2D4OA 1S60A 1YR0A 4KLVA 2VI7A 2Q7BA 2B4DA 2R98A 2P6FA 2ZXVA 1Y9WA 3CXSA 3S6KA 4GS4A 3T90A 4HNXB 3ZZIA 5IB0A 5J8CA 2P6GA 1XMTA 2G3AA 3QB8A 4UA3A 3D2MA 1NMTA 4MBUA 4H6UA 4I49A 1NSLA 3G8WA 1YVKA 3N7ZA 3GY9A 2B4BA 1YLEA 3RYOA 3LODA 1PUAA 3WR7A 1MK4A 2DXQA 4F6AA 5HH1A 4YFJA 2ZW6A 4KOWA 4KOSA 4R3KA 4KORA 5JPHA 1Z4EA 4QB9A 2EUIA 3TFYA 2REFA 1IB1E 1XE4A 2Q4VA 1GHEA 1S7KA 2JDDA 4M3SA 2CNTA 4F0YA 1VHSA 2PSWA 1BO4A 1QSRA 2G3TA 4K30A 4NCZA 4OADA 1MJAA 2B58A 3H4QA 4MY0A 1YVOA 2BUEA 2B4DB 1RO5A 2OZGA 1L0CA 1Z9UA 4UWIA 2FT0A 4XPDC 1CJWA 1YGHA 3D3SA 2J8NA 5CNPA 2FIWA 1PU9A 3SHPA 2BL1A 2JDCA 1XEBA 1IIDA 1S7LA 1I1DA 1U6MA 4KVOE 3C26A 1K4JA 2FCKA 3QAHA 3S6HA 2C27A 2J8RA 4FD6A 1R57A 4HNYB 3TO9A 2Q4YA 4ONUA 4HNWB 4IF5A 4J3GA 4B5OA 3TO6A 3PP9A 5ISVA 3FXTA 3F8KA 5C88A 4QVTA 3GKRA 2BEIA 2HQYA 1IICA 3I9SA 3S6GA 5KTDA 3TCVA 2H5MA 3IGRA 1Q2YA 3TOAA 4QBJA 4RS2A 4E2AA 1M44A 4AVCA 3PGPA 2VXKA 3E0KA 5H84A 2Z10A 3B8GA 4XPDB 1P4NA 2ZW4A 2IL4A 2R1IA 3GYAA 3EC4A 5F46A 3DNSA 3R95A 2PR8A 4Y49B 3D8PA 5HMNA 4NF1A 3W6XA 3FNCA 2ZW7A 1BOBA 5IX3A
chains in the Genus database with same CATH superfamily
3BLNA 3W91A 2K5TA 4P4JA 1OZPA 3MGDA 4AG7A 4M6HA 4UIBA 1TF9A 2AFOA 4MY3A 4JD6A 3PB4X 3SI2A 1KZFA 4JZ0A 4NJRA 2FS5A 4MCQA 1QMUA 5F48A 4H2KA 4C2XA 2IMOA 2VZYA 1IY7A 4KOVA 4Z65A 1F2OA 1Y7RA 2PJ7A 1YREA 1LRZA 1RTQA 1M1DA 1Z4RA 3UY5A 2CIJA 2V8GA 4B6ZA 3VWDA 3TE4A 4II9A 4QC6A 3CT9A 3PZJA 3SI0A 2QMLA 1Z2LA 3V8IA 4ORFA 4CAWA 4MFZA 5JM6A 2Q43A 1H8LA 3IU2A 4R87A 4R9MA 1F2PA 1TIQA 3DLJA 3RAMA 5JQ4A 2PR1A 3NE7A 2PJCA 4NGSA 2Z0ZA 6CPAA 3FJUA 4KSIA 1YLOA 3P2HA 1R43A 1YK3A 2ZEMA 4JXQA 3KI9A 5FVJA 4DUKA 3KASA 1S3ZA 5DWMA 2AFXA 2PJ3A 2AE6A 2R7HA 4A2ZA 4XPKA 5K8PA 4U9ZA 2PCUA 1S5KA 3TOBA 1MJBA 2I00A 4UCPA 4LX9A 3RBUA 2JEWA 2HV2A 2Z11A 5DWNA 1XFOA 1UFHA 3S6FA 4H6ZA 2YNDA 2NMTA 4AVBA 1NE9A 2VZZA 2X7BA 4UWJA 4K3NA 3IIBA 1Q2CA 4IHMA 1CP7A 1LAMA 2I3CA 2ZOFA 3R9FA 4MCSA 4AB7A 4PV6A 3FB3A 4CS0B 2EVNA 4KVME 2PC1A 2KCWA 2BCOA 7CPAA 1ARMA 2Z3OA 3JVNA 3FECA 2Q51A 4CYOA 5F47A 4ZY1A 3EO4A 3F5BA 3K2KA 2PDOA 2FIAA 5THWA 4U5YA 4CGLA 2VQYA 4NGTA 3D67A 4R3LA 4P44A 2DF5A 4EMEA 3SJGA 4PSWA 3P2FA 4MHPA 3WT4A 3VWEA 2O53A 3ISXA 1VHEA 1WWZA 2A4NA 4NGMA 3R9GA 1KUXA 5G21A 4EFDA 2OB0A 1AYEA 1CBXA 2ZEHA 1S7NA 4FD7A 4M6GA 4MRIA 2RC4A 1Z5RA 2OZHA 3VH9A 3B3VA 2AFSA 3WC6A 2Z3PA 2QECA 1Y0RA 4OC5A 4CPAA 5EMIA 5KTAA 4YRHA 2Q4ZA 2AFWA 4FD4A 4KS9A 2YGWA 4KZTA 1EE3P 1XIXA 4ONWA 4TNUA 5HVHA 2OZUA 2CNSA 3EY5A 1XJOA 4H89A 2O4HA 4MI4A 3CXPA 1M4IA 1BAVA 5F09A 3FEEA 3WC5A 3N5FA 3B3WA 4MHNA 4KSAA 4UCMA 4B13A 3D2PA 2ZPAA 4OAEA 4X5KA 2QIRA 5G20A 3FMCA 1B87A 2WZNA 4OMEA 5G1ZA 2FE7A 2V8DA 2PJ6A 2F8HA 1LOKA 2BSWA 2JEVA 3K9TA 1ELLP 1QSTA 2F5IA 2Z3LA 3D7HA 3FEDA 1XRYA 3F0AA 4XPLA 1ZG7A 2PVVA 3PBEA 3FYNA 2REEA 2DEAA 4FUUA 4MHYA 1M4DA 4KVXA 2PJBA 2CF4A 3PEIA 2OH1A 4TWEA 2AFMA 4L89A 1WK4A 4FWUA 4MFLA 3BJ8A 4BMHA 3CPXA 4HPSA 3ZJ0A 5ELYA 4W9YA 4IAVA 3SJFA 1I12A 3GLJA 3SXOA 2JLMA 5J1QA 1M4LA 3R1KA 3JUWA 3PB9X 4KLWA 4NGRA 3NE8A 3FX6A 3PB7X 4KOYA 5LYIA 2ZOGA 3QNVA 4F8ZA 1Q7LA 1NSAA 1S7FA 2CTBA 1HDUA 2B3VA 1JQGA 1P0HA 1ZO0A 1I21A 2GIVA 3MRUA 4BD9A 5A28A 2B5GA 1IOIA 2XEJA 1KUYA 4G1PA 4HKFA 4B14A 2HUZA 2Q04A 3BXMA 2ZEFA 3NH5A 4PQAA 4E2AA 2PJ2A 3B3CA 4A32A 2FXFA 4KUBA 1IGBA 1Z8XA 2PJ9A 2OOTA 4MFJA 4MJ8A 2ZENA 2P6EA 4DNCA 1TKHA 4F0XA 4OC2A 2NYQA 2RB7A 1XF8A 4P4DA 2EK9A 2PJ4A 5GCNA 3K9UA 3NA6A 4U9YA 5A27A 3IU1A 4UEFA 4RUHA 3DR6A 5AG7A 1N71A 2DPSA 3LWUA 4R8FA 1ELMP 2PRBA 3DDDA 5KTCA 4CGNA 1JWQA 4CRYB 4AVAA 3KQXA 5LRJA 1HEEA 1AMPA 4M85A 4NEXA 4UF4A 8CPAA 4YU9A 4ZY0A 4ZGYB 1Y7EA 4B5PA 3TTHA 4PXBA 1IYLA 3VATA 3BJ7A 3KR4A 2J8MA 2OU2A 3D7DA 2HB6A 4P10A 3S9LA 1YW4A 3B3TA 3IWGA 4YWYA 1KUVA 5IV0A 1DE4C 4FD5A 4OIDA 4RI1A 2CY2A 3OWCA 2VEZA 3IC1A 4KOXA 2EO8A 2EBJA 1FT7A 4P4BA 2FL4A 4BINA 2ATRA 3PB6X 4A94A 4FBEA 2WPWA 5JGFA 4CAFA 1YX0A 4NGNA 4CAVA 3LACA 1YQEA 2PJAA 2FSRA 2C6GA 2Q44A 4LUAA 4R57A 5I0CA 3IO1A 2GANA 4X2TA 4MMOA 4YGOA 2ZELA 3R9EA 4JLYA 2R8VA 2PVWA 2C6CA 5E96A 4FAIA 3EXNA 2B5GB 4CRZB 3I3GA 4PSXA 1VKCA 3SJEA 4QUSA 4BBHA 4F9VA 2O28A 4PXEA 2Y0MA 2DPTA 3TT2A 4A30A 4ZX9A 4ZI6A 1XMBA 2WPXA 3IWEA 2Q0YA 4Y49C 4R76A 3QAYA 2ZEGA 3B3SA 4MHZA 5K8OA 2I79A 2POKA 5H86A 3B35A 4C68A 4DYOA 2V77A 4MHDA 3PBBA 1QQ9A 3SI1A 4R7MA 2FVGA 3FBUA 4MXUA 3CZXA 4P45A 5EBVA 4B12A 2QYVA 1IYKA 2GU2A 4PK2A 4A39A 2XEFA 1QSOA 4XNHC 5EC4A 4ZY2A 5I4MA 3W6SA 4CGOA 4F9UA 5LYLA 4JJXA 3FVLA 4PK3A 2PJ0A 2ZEPA 4A38A 2P0WA 1KWMA 3CXQA 4OC1A 3H8EA 1UWYA 4JWPA 3I1UA 1X12A 1BPNA 1CM0A 3H8FA 4UEZA 3HLPA 4AXVA 4Q7AA 3R96A 4KUAA 1MJ9A 2CNMA 4MCRA 3G3SA 4GM5A 1Q2DA 5C82A 3FRMA 5LYFA 2GLJA 4LQ6A 1QSNA 5F49A 1LCPA 4IK2A 4CGPA 3KHZA 2B3UA 2ZW5A 4E0AA 4NXYA 2HC9A 4CGMA 4UBRA 3TO7A 2Z3KA 2D4PA 4IUSA 3B7IA 2GE3A 1V0CA 4C2ZA 2JBJA 3IEHA 4PXCA 3B2YA 3FIXA 2F7VA 2PQ8A 2G0BA 2YNCC 3KZWA 1QSMA 3LD2A 3MN8A 3PRTA 4OLLA 4OC4A 4MFPA 1SQHA 4MFKA 3A9LA 1TKFA 4KOTA 3IFEA 3KL9A 2AJ6A 3IJ3A 2Z3MA 3SXNA 3T9YA 5J8FA 1FY7A 4ZBGA 4A33A 1CG2A 1J4JA 3KKWA 4M6IA 4UIAA 3DR8A 4WWVA 4EVYA 3DSBA 3PFOA 3PFEA 3EFAA 4XNHB 4B5PB 4L8AA 4MCPA 4E8OA 4P4EA 1M4GA 4JXRA 2CTCA 2OR4A 2XEGA 1ON0A 4ZX8A 1RXTA 4AG9A 2ARHA 1B6BA 4NSQA 2AFUA 4CAXA 2VBQA 4KOUA 1Y9KA 3FH4A 3RNZA 2D4OA 3DGVA 1S60A 1YR0A 4KLVA 3IWWA 1TXRA 2VI7A 2Q7BA 5HVGA 2B4DA 5HXDA 1BPMA 2R98A 3FF3A 1PCAA 2P6FA 2ZXVA 1BLLE 1Y9WA 2JBKA 4Q36A 1ZG9A 3CXSA 1CPXA 4CYQA 4EWTA 3S6KA 1AUGA 4GS4A 3T90A 1FNOA 2PJ1A 3CDXA 4HNXB 4NFRA 3ZZIA 5IB0A 5J8CA 2P6GA 1PYTB 1XMTA 2G3AA 3QB8A 4UA3A 5CBMA 4LQGA 4R6TA 5AG5A 2GREA 3D2MA 4CAEA 1NMTA 4MBUA 4H6UA 4DJLA 1VHOA 1CPSA 2EWBA 4I49A 2PE3A 1NSLA 3G8WA 5DS0A 1YVKA 3N7ZA 4C2YA 3D7GA 3GY9A 2B4BA 2AFZA 1YLEA 3RO0A 1VIXA 3LODA 3RYOA 1PUAA 3BHXA 3BI0A 1X10A 3WR7A 5K8MA 4B11A 1MK4A 4OIWA 1HDQA 3RZAA 2DXQA 4F6AA 1R3NA 5HH1A 1ZG8A 2ZW6A 4KOWA 4YFJA 4KOSA 2PRQA 3D4UA 4R3KA 4Q38A 4C7IA 1CX8A 3GUXA 2QVPA 3KR5A 4KORA 4B10A 5JPHA 3D66A 2Q7SA 1Z4EA 3SJXA 4QB9A 2EUIA 3TFYA 2REFA 1IB1E 1XE4A 2Q4VA 3LMSA 1GHEA 1S7KA 2JDDA 3KHXA 2PJ8A 2BO9A 4M3SA 3VARA 2CNTA 4F0YA 1VHSA 2PSWA 1BO4A 1QSRA 3GIUA 2ODFA 3NH8A 1Z8LA 4OKOA 2G3TA 4K30A 4NCZA 5BWAB 4P4IA 4C7HA 4OADA 1MJAA 1DTDA 2B58A 2V8VA 2Z3NA 1YVOA 3H4QA 4MY0A 4NGPA 2BUEA 2CXAA 5CPAA 3WC7A 2G9DA 2B4DB 1RO5A 2V8HA 3JRUA 2OZGA 1L0CA 1Z9UA 4UWIA 2FT0A 1F57A 1LFWA 4NJQA 4UEEA 1CJWA 3H5ZA 4XPDC 1YGHA 3D3SA 2J8NA 5CNPA 2ABZA 2FIWA 2NSMA 1PU9A 5LYDA 3SHPA 5LRKA 3KQZA 4JYWA 4UFVA 2BL1A 1XBUA 2JDCA 3NFZA 1XEBA 1IIDA 1S7LA 1I1DA 1U6MA 3BI1A 4KVOE 2BOAA 4OP4A 2WUUA 2YNEA 3GB0A 3C26A 1K4JA 4A95A 2FCKA 3QAHA 4P6YA 3S9NA 3S6HA 2C27A 5D29A 4RN7A 4PPZA 2J8RA 2YNCA 3D68A 4FD6A 2QJ8A 1R57A 4HNYB 3T8WA 3TO9A 2Q4YA 4ONUA 4HNWB 1ZLHA 4IF5A 1IU8A 1TKJA 5G22A 4J3GA 4B5OA 2GLFA 3TO6A 4PXDA 3ISZA 3PP9A 5AG6A 4OC0A 5HVFA 5ISVA 4CYPA 1A2ZA 3FXTA 3F8KA 3D7FA 5C88A 3GKRA 4QVTA 3TX8A 2BEIA 3KGQA 1VGYA 2GFQA 2HQYA 4KSFA 1IICA 3I9SA 4A37A 5JH9A 3S6GA 5KTDA 3TCVA 2H5MA 4O23A 3IGRA 2VL1A 2ANPA 4OC3A 1Q2YA 1Z8TA 2XEIA 3TOAA 2ZEEA 3NH4A 3JTKA 1TF8A 4WJBA 4QBJA 2J9AA 4P4FA 4RS2A 2IJZA 1M44A 4UFWA 1ARLA 5AGEA 4AVCA 3PGPA 1IOFA 4CYNA 2VXKA 2C1CA 3HUVA 1OBRA 3E0KA 5H84A 4ZYQA 5D8NA 2RFHA 2Z10A 3B8GA 4XPDB 5IB9A 4MFQA 1P4NA 4A31A 1ZLIA 2ZW4A 2IL4A 2R1IA 3GYAA 2PIZA 5AG4A 1LAPA 1Z8WA 2IQ6A 4GXHA 1YSJA 1XOVA 1CP6A 3CPAA 3EC4A 2WSAA 5F46A 2ZEDA 2ZEOA 1YW6A 4NGQA 3DNSA 3R95A 2PR8A 3L2NA 1Y0YA 2PIYA 3H8GA 1YMEA 1LANA 2EK8A 5K8NA 1GYTA 4Y49B 3S9MA 3D8PA 5HMNA 2WYRA 2PJ5A 4UCNA 3TC8A 4NF1A 3PB8X 2C6PA 3V38A 3W6XA 4UFXA 3FNCA 2ZW7A 5LRGA 4X8IA 4X3RA 3WABA 1BOBA 3V7ZA 5IX3A
chains in the Genus database with same CATH topology
3BLNA 3W91A 2K5TA 4AG7A 1OZPA 3MGDA 4MY3A 4JD6A 1KZFA 2FS5A 4C2XA 5F48A 2VZYA 4KOVA 1Y7RA 1YREA 1LRZA 1Z4RA 1M1DA 3UY5A 3VWDA 3TE4A 4II9A 4QC6A 3PZJA 2QMLA 4CAWA 3V8IA 4ORFA 4MFZA 3IU2A 4R87A 4R9MA 1TIQA 5JQ4A 2PR1A 3NE7A 2Z0ZA 3P2HA 1YK3A 4JXQA 5FVJA 1S3ZA 5DWMA 2AE6A 2R7HA 4A2ZA 4XPKA 4U9ZA 1S5KA 3TOBA 1MJBA 2I00A 4UCPA 4LX9A 2HV2A 2Z11A 5DWNA 1UFHA 3S6FA 4H6ZA 2YNDA 2NMTA 4AVBA 1NE9A 2VZZA 2X7BA 4UWJA 1Q2CA 3R9FA 4AB7A 4PV6A 3FB3A 4CS0B 2EVNA 4KVME 2PC1A 2KCWA 2Z3OA 3JVNA 4CYOA 5F47A 3EO4A 3F5BA 2PDOA 2FIAA 4U5YA 4CGLA 2VQYA 4R3LA 4PSWA 3P2FA 3VWEA 3R9GA 1WWZA 2A4NA 1KUXA 5G21A 2OB0A 1S7NA 4FD7A 2RC4A 2OZHA 2Z3PA 2QECA 5KTAA 4YRHA 4KS9A 4FD4A 2YGWA 4KZTA 1XIXA 2OZUA 2CNSA 3EY5A 4H89A 4MI4A 3CXPA 1M4IA 4KSAA 4UCMA 4B13A 3D2PA 2ZPAA 4OAEA 4X5KA 2QIRA 5G20A 1B87A 5G1ZA 2FE7A 2JEVA 2BSWA 1QSTA 2F5IA 2Z3LA 3F0AA 4XPLA 3FYNA 2REEA 1M4DA 4KVXA 2OH1A 4L89A 1WK4A 4MFLA 3BJ8A 4BMHA 3ZJ0A 1I12A 3SXOA 2JLMA 3R1KA 3JUWA 4KLWA 4KOYA 1S7FA 3DR6A 2B3VA 1ZO0A 1P0HA 2GIVA 1I21A 5A28A 2B5GA 1KUYA 4HKFA 4B14A 2HUZA 2Q04A 4A32A 2FXFA 4KUBA 4MFJA 4MJ8A 2P6EA 4DNCA 4F0XA 1XF8A 5GCNA 3K9UA 4U9YA 3IU1A 5AG7A 1N71A 2DPSA 5KTCA 2PRBA 3DDDA 4CGNA 4CRYB 4AVAA 4M85A 4NEXA 4ZGYB 4B5PA 3TTHA 1IYLA 3BJ7A 2J8MA 2OU2A 3IWGA 5IV0A 1KUVA 4FD5A 4RI1A 2CY2A 3OWCA 2VEZA 4KOXA 2FL4A 2ATRA 2WPWA 4CAFA 1YX0A 4CAVA 4R57A 2Q44A 2FSRA 4LUAA 5I0CA 2GANA 4YGOA 3R9EA 4JLYA 2R8VA 5E96A 3EXNA 2B5GB 4CRZB 3I3GA 4PSXA 1VKCA 4QUSA 4BBHA 2O28A 4A30A 2Y0MA 2DPTA 3TT2A 2WPXA 3IWEA 2Q0YA 4Y49C 2I79A 4C68A 5H86A 4MHDA 3FBUA 5EBVA 4B12A 1IYKA 4PK2A 1QSOA 4XNHC 5EC4A 3W6SA 4CGOA 4JJXA 4PK3A 2P0WA 3CXQA 4JWPA 1CM0A 3R96A 4KUAA 1MJ9A 2CNMA 3G3SA 1Q2DA 5C82A 3FRMA 5F49A 1QSNA 4CGPA 2B3UA 2ZW5A 4E0AA 4NXYA 4CGMA 4UBRA 3TO7A 2Z3KA 2D4PA 4IUSA 2GE3A 1V0CA 4C2ZA 3FIXA 2PQ8A 2YNCC 2G0BA 3LD2A 1QSMA 4OLLA 4MFPA 1SQHA 4MFKA 3A9LA 4KOTA 2AJ6A 2Z3MA 3SXNA 3T9YA 5J8FA 1FY7A 4ZBGA 4A33A 1J4JA 3KKWA 3DR8A 4EVYA 3DSBA 3EFAA 4XNHB 4B5PB 4L8AA 4E8OA 1M4GA 4JXRA 1ON0A 1RXTA 4AG9A 2ARHA 1B6BA 4NSQA 4CAXA 2VBQA 4KOUA 1Y9KA 2D4OA 1S60A 1YR0A 4KLVA 2VI7A 2Q7BA 2B4DA 2R98A 2P6FA 2ZXVA 1Y9WA 4Q36A 3CXSA 4CYQA 3S6KA 4GS4A 3T90A 4HNXB 3ZZIA 5IB0A 5J8CA 2P6GA 1XMTA 2G3AA 3QB8A 4UA3A 5AG5A 3D2MA 1NMTA 4MBUA 4H6UA 4I49A 1NSLA 3G8WA 1YVKA 3N7ZA 4C2YA 3GY9A 2B4BA 1YLEA 3RYOA 3LODA 1PUAA 3WR7A 4B11A 1MK4A 2DXQA 4F6AA 5A27A 5HH1A 4YFJA 2ZW6A 4KOWA 4KOSA 4R3KA 4C7IA 4Q38A 4KORA 4B10A 5JPHA 1Z4EA 4QB9A 2EUIA 3TFYA 2REFA 1IB1E 1XE4A 2Q4VA 1GHEA 1S7KA 2JDDA 4M3SA 2CNTA 4F0YA 1VHSA 2PSWA 1BO4A 1QSRA 5BWAB 2G3TA 4K30A 4NCZA 4C7HA 4OADA 1MJAA 4CAEA 2B58A 2Z3NA 3H4QA 1YVOA 4MY0A 2BUEA 2CXAA 2B4DB 1RO5A 2OZGA 1L0CA 1Z9UA 4UWIA 2FT0A 4XPDC 1CJWA 3H5ZA 1YGHA 3D3SA 2J8NA 5CNPA 2FIWA 1PU9A 3SHPA 4UFVA 2BL1A 2JDCA 1XEBA 1IIDA 1S7LA 1I1DA 1U6MA 4KVOE 2WUUA 2YNEA 3C26A 1K4JA 4A95A 2FCKA 3QAHA 3S6HA 2C27A 2J8RA 2YNCA 4FD6A 1R57A 4HNYB 3TO9A 2Q4YA 4ONUA 4HNWB 4IF5A 5G22A 4J3GA 4B5OA 3TO6A 3PP9A 5AG6A 5ISVA 4CYPA 3FXTA 3F8KA 5C88A 3GKRA 4QVTA 2BEIA 2HQYA 4KSFA 1IICA 3I9SA 3S6GA 5KTDA 3TCVA 2H5MA 3IGRA 1Q2YA 3TOAA 4QBJA 3JTKA 4RS2A 4UFWA 5AGEA 4E2AA 1M44A 4CYNA 4AVCA 3PGPA 2VXKA 3E0KA 5H84A 2Z10A 3B8GA 4XPDB 4MFQA 1P4NA 4A31A 2ZW4A 2IL4A 2R1IA 3GYAA 5AG4A 3EC4A 2WSAA 5F46A 3DNSA 3R95A 2PR8A 4Y49B 3D8PA 5HMNA 4UCNA 4NF1A 3W6XA 4UFXA 3FNCA 2ZW7A 1BOBA 5IX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLN A;  3W91 A;  2K5T A;  4AG7 A;  1OZP A;  3MGD A;  4MY3 A;  4JD6 A;  1KZF A;  2FS5 A;  5F48 A;  2VZY A;  4KOV A;  1Y7R A;  1YRE A;  1LRZ A;  1Z4R A;  1M1D A;  3UY5 A;  3VWD A;  3TE4 A;  4II9 A;  4QC6 A;  3PZJ A;  2QML A;  4CAW A;  3V8I A;  4ORF A;  4R87 A;  4R9M A;  1TIQ A;  5JQ4 A;  2PR1 A;  3NE7 A;  2Z0Z A;  3P2H A;  1YK3 A;  4JXQ A;  5FVJ A;  1S3Z A;  5DWM A;  2AE6 A;  2R7H A;  4XPK A;  4U9Z A;  1S5K A;  3TOB A;  1MJB A;  2I00 A;  4LX9 A;  2HV2 A;  2Z11 A;  5DWN A;  1UFH A;  3S6F A;  4H6Z A;  2NMT A;  4AVB A;  1NE9 A;  2VZZ A;  2X7B A;  4UWJ A;  1Q2C A;  3R9F A;  4AB7 A;  4PV6 A;  3FB3 A;  4CS0 B;  2EVN A;  4KVM E;  2PC1 A;  2KCW A;  3JVN A;  5F47 A;  3EO4 A;  3F5B A;  2PDO A;  2FIA A;  4U5Y A;  2VQY A;  4R3L A;  4PSW A;  3P2F A;  3VWE A;  3R9G A;  1WWZ A;  2A4N A;  1KUX A;  2OB0 A;  1S7N A;  4FD7 A;  2RC4 A;  2OZH A;  2QEC A;  5KTA A;  4YRH A;  4FD4 A;  4KZT A;  1XIX A;  2OZU A;  2CNS A;  3EY5 A;  4H89 A;  4MI4 A;  3CXP A;  1M4I A;  3D2P A;  2ZPA A;  4OAE A;  4X5K A;  2QIR A;  1B87 A;  2FE7 A;  2JEV A;  2BSW A;  1QST A;  2F5I A;  3F0A A;  4XPL A;  3FYN A;  2REE A;  1M4D A;  4KVX A;  2OH1 A;  4L89 A;  1WK4 A;  3BJ8 A;  4BMH A;  3ZJ0 A;  1I12 A;  3SXO A;  2JLM A;  3R1K A;  3JUW A;  4KLW A;  4KOY A;  1S7F A;  3DR6 A;  2B3V A;  1P0H A;  2GIV A;  1I21 A;  2B5G A;  1KUY A;  4HKF A;  2HUZ A;  2Q04 A;  2FXF A;  4KUB A;  4MJ8 A;  2P6E A;  4DNC A;  1XF8 A;  5GCN A;  3K9U A;  4U9Y A;  1N71 A;  5KTC A;  2PRB A;  3DDD A;  4CRY B;  4AVA A;  4M85 A;  4NEX A;  4B5P A;  3TTH A;  1IYL A;  3BJ7 A;  2J8M A;  2OU2 A;  3IWG A;  5IV0 A;  1KUV A;  4FD5 A;  4RI1 A;  2CY2 A;  3OWC A;  2VEZ A;  4KOX A;  2FL4 A;  2ATR A;  2WPW A;  1YX0 A;  4CAV A;  4R57 A;  2Q44 A;  2FSR A;  4LUA A;  5I0C A;  2GAN A;  4YGO A;  3R9E A;  4JLY A;  2R8V A;  5E96 A;  3EXN A;  2B5G B;  4CRZ B;  3I3G A;  4PSX A;  1VKC A;  4QUS A;  2O28 A;  2Y0M A;  3TT2 A;  2WPX A;  4Y49 C;  2Q0Y A;  2I79 A;  5H86 A;  4MHD A;  3FBU A;  5EBV A;  1IYK A;  4PK2 A;  1QSO A;  4XNH C;  5EC4 A;  3W6S A;  4JJX A;  4PK3 A;  2P0W A;  3CXQ A;  4JWP A;  1CM0 A;  3R96 A;  4KUA A;  1MJ9 A;  2CNM A;  3G3S A;  1Q2D A;  5C82 A;  3FRM A;  5F49 A;  1QSN A;  2B3U A;  2ZW5 A;  4E0A A;  4NXY A;  4UBR A;  3TO7 A;  2D4P A;  4IUS A;  2GE3 A;  1V0C A;  3FIX A;  2PQ8 A;  2G0B A;  3LD2 A;  1QSM A;  4OLL A;  1SQH A;  4KOT A;  2AJ6 A;  3SXN A;  3T9Y A;  5J8F A;  1FY7 A;  4ZBG A;  1J4J A;  3KKW A;  3DR8 A;  4EVY A;  3DSB A;  3EFA A;  4XNH B;  4B5P B;  4L8A A;  4E8O A;  1M4G A;  4JXR A;  1ON0 A;  1RXT A;  4AG9 A;  2ARH A;  1B6B A;  4NSQ A;  4CAX A;  2VBQ A;  4KOU A;  1Y9K A;  2D4O A;  1S60 A;  1YR0 A;  4KLV A;  2VI7 A;  2Q7B A;  2B4D A;  2R98 A;  2P6F A;  2ZXV A;  1Y9W A;  3CXS A;  3S6K A;  4GS4 A;  3T90 A;  4HNX B;  3ZZI A;  5IB0 A;  5J8C A;  2P6G A;  1XMT A;  2G3A A;  3QB8 A;  4UA3 A;  3D2M A;  1NMT A;  4MBU A;  4H6U A;  4I49 A;  1NSL A;  3G8W A;  1YVK A;  3N7Z A;  3GY9 A;  2B4B A;  1YLE A;  3RYO A;  3LOD A;  1PUA A;  3WR7 A;  1MK4 A;  2DXQ A;  4F6A A;  5HH1 A;  4YFJ A;  2ZW6 A;  4KOW A;  4KOS A;  4R3K A;  4KOR A;  5JPH A;  1Z4E A;  4QB9 A;  2EUI A;  3TFY A;  2REF A;  1IB1 E;  1XE4 A;  2Q4V A;  1GHE A;  1S7K A;  2JDD A;  4M3S A;  2CNT A;  4F0Y A;  1VHS A;  2PSW A;  1BO4 A;  1QSR A;  2G3T A;  4K30 A;  4NCZ A;  4OAD A;  1MJA A;  2B58 A;  3H4Q A;  4MY0 A;  1YVO A;  2BUE A;  2B4D B;  1RO5 A;  2OZG A;  1L0C A;  1Z9U A;  4UWI A;  2FT0 A;  4XPD C;  1CJW A;  1YGH A;  3D3S A;  2J8N A;  5CNP A;  2FIW A;  1PU9 A;  3SHP A;  2BL1 A;  2JDC A;  1XEB A;  1IID A;  1S7L A;  1I1D A;  1U6M A;  4KVO E;  3C26 A;  1K4J A;  2FCK A;  3QAH A;  3S6H A;  2C27 A;  2J8R A;  4FD6 A;  1R57 A;  4HNY B;  3TO9 A;  2Q4Y A;  4ONU A;  4HNW B;  4IF5 A;  4J3G A;  4B5O A;  3TO6 A;  3PP9 A;  5ISV A;  3FXT A;  3F8K A;  5C88 A;  4QVT A;  3GKR A;  2BEI A;  2HQY A;  1IIC A;  3I9S A;  3S6G A;  5KTD A;  3TCV A;  2H5M A;  3IGR A;  1Q2Y A;  3TOA A;  4QBJ A;  4RS2 A;  4E2A A;  1M44 A;  4AVC A;  3PGP A;  2VXK A;  3E0K A;  5H84 A;  2Z10 A;  3B8G A;  4XPD B;  1P4N A;  2ZW4 A;  2IL4 A;  2R1I A;  3GYA A;  3EC4 A;  5F46 A;  3DNS A;  3R95 A;  2PR8 A;  4Y49 B;  3D8P A;  5HMN A;  4NF1 A;  3W6X A;  3FNC A;  2ZW7 A;  1BOB A;  5IX3 A; 
#chains in the Genus database with same CATH topology
 3BLN A;  3W91 A;  2K5T A;  4P4J A;  1OZP A;  3MGD A;  4AG7 A;  4M6H A;  4UIB A;  1TF9 A;  2AFO A;  4MY3 A;  4JD6 A;  3PB4 X;  3SI2 A;  1KZF A;  4JZ0 A;  4NJR A;  2FS5 A;  4MCQ A;  1QMU A;  5F48 A;  4H2K A;  4C2X A;  2IMO A;  2VZY A;  1IY7 A;  4KOV A;  4Z65 A;  1F2O A;  1Y7R A;  2PJ7 A;  1YRE A;  1LRZ A;  1RTQ A;  1M1D A;  1Z4R A;  3UY5 A;  2CIJ A;  2V8G A;  4B6Z A;  3VWD A;  3TE4 A;  4II9 A;  4QC6 A;  3CT9 A;  3PZJ A;  3SI0 A;  2QML A;  1Z2L A;  3V8I A;  4ORF A;  4CAW A;  4MFZ A;  5JM6 A;  2Q43 A;  1H8L A;  3IU2 A;  4R87 A;  4R9M A;  1F2P A;  1TIQ A;  3DLJ A;  3RAM A;  5JQ4 A;  2PR1 A;  3NE7 A;  2PJC A;  4NGS A;  2Z0Z A;  6CPA A;  3FJU A;  4KSI A;  1YLO A;  3P2H A;  1R43 A;  1YK3 A;  2ZEM A;  4JXQ A;  3KI9 A;  5FVJ A;  4DUK A;  3KAS A;  1S3Z A;  5DWM A;  2AFX A;  2PJ3 A;  2AE6 A;  2R7H A;  4A2Z A;  4XPK A;  5K8P A;  4U9Z A;  2PCU A;  1S5K A;  3TOB A;  1MJB A;  2I00 A;  4UCP A;  4LX9 A;  3RBU A;  2JEW A;  2HV2 A;  2Z11 A;  5DWN A;  1XFO A;  1UFH A;  3S6F A;  4H6Z A;  2YND A;  2NMT A;  4AVB A;  1NE9 A;  2VZZ A;  2X7B A;  4UWJ A;  4K3N A;  3IIB A;  1Q2C A;  4IHM A;  1CP7 A;  1LAM A;  2I3C A;  2ZOF A;  3R9F A;  4MCS A;  4AB7 A;  4PV6 A;  3FB3 A;  4CS0 B;  2EVN A;  4KVM E;  2PC1 A;  2KCW A;  2BCO A;  7CPA A;  1ARM A;  2Z3O A;  3JVN A;  3FEC A;  2Q51 A;  4CYO A;  5F47 A;  4ZY1 A;  3EO4 A;  3F5B A;  3K2K A;  2PDO A;  2FIA A;  5THW A;  4U5Y A;  4CGL A;  2VQY A;  4NGT A;  3D67 A;  4R3L A;  4P44 A;  2DF5 A;  4EME A;  3SJG A;  4PSW A;  3P2F A;  4MHP A;  3WT4 A;  3VWE A;  2O53 A;  3ISX A;  1VHE A;  1WWZ A;  2A4N A;  4NGM A;  3R9G A;  1KUX A;  5G21 A;  4EFD A;  2OB0 A;  1AYE A;  1CBX A;  2ZEH A;  1S7N A;  4FD7 A;  4M6G A;  4MRI A;  2RC4 A;  1Z5R A;  2OZH A;  3VH9 A;  3B3V A;  2AFS A;  3WC6 A;  2Z3P A;  2QEC A;  1Y0R A;  4OC5 A;  4CPA A;  5EMI A;  5KTA A;  4YRH A;  2Q4Z A;  2AFW A;  4FD4 A;  4KS9 A;  2YGW A;  4KZT A;  1EE3 P;  1XIX A;  4ONW A;  4TNU A;  5HVH A;  2OZU A;  2CNS A;  3EY5 A;  1XJO A;  4H89 A;  2O4H A;  4MI4 A;  3CXP A;  1M4I A;  1BAV A;  5F09 A;  3FEE A;  3WC5 A;  3N5F A;  3B3W A;  4MHN A;  4KSA A;  4UCM A;  4B13 A;  3D2P A;  2ZPA A;  4OAE A;  4X5K A;  2QIR A;  5G20 A;  3FMC A;  1B87 A;  2WZN A;  4OME A;  5G1Z A;  2FE7 A;  2V8D A;  2PJ6 A;  2F8H A;  1LOK A;  2BSW A;  2JEV A;  3K9T A;  1ELL P;  1QST A;  2F5I A;  2Z3L A;  3D7H A;  3FED A;  1XRY A;  3F0A A;  4XPL A;  1ZG7 A;  2PVV A;  3PBE A;  3FYN A;  2REE A;  2DEA A;  4FUU A;  4MHY A;  1M4D A;  4KVX A;  2PJB A;  2CF4 A;  3PEI A;  2OH1 A;  4TWE A;  2AFM A;  4L89 A;  1WK4 A;  4FWU A;  4MFL A;  3BJ8 A;  4BMH A;  3CPX A;  4HPS A;  3ZJ0 A;  5ELY A;  4W9Y A;  4IAV A;  3SJF A;  1I12 A;  3GLJ A;  3SXO A;  2JLM A;  5J1Q A;  1M4L A;  3R1K A;  3JUW A;  3PB9 X;  4KLW A;  4NGR A;  3NE8 A;  3FX6 A;  3PB7 X;  4KOY A;  5LYI A;  2ZOG A;  3QNV A;  4F8Z A;  1Q7L A;  1NSA A;  1S7F A;  2CTB A;  1HDU A;  2B3V A;  1JQG A;  1P0H A;  1ZO0 A;  1I21 A;  2GIV A;  3MRU A;  4BD9 A;  5A28 A;  2B5G A;  1IOI A;  2XEJ A;  1KUY A;  4G1P A;  4HKF A;  4B14 A;  2HUZ A;  2Q04 A;  3BXM A;  2ZEF A;  3NH5 A;  4PQA A;  4E2A A;  2PJ2 A;  3B3C A;  4A32 A;  2FXF A;  4KUB A;  1IGB A;  1Z8X A;  2PJ9 A;  2OOT A;  4MFJ A;  4MJ8 A;  2ZEN A;  2P6E A;  4DNC A;  1TKH A;  4F0X A;  4OC2 A;  2NYQ A;  2RB7 A;  1XF8 A;  4P4D A;  2EK9 A;  2PJ4 A;  5GCN A;  3K9U A;  3NA6 A;  4U9Y A;  5A27 A;  3IU1 A;  4UEF A;  4RUH A;  3DR6 A;  5AG7 A;  1N71 A;  2DPS A;  3LWU A;  4R8F A;  1ELM P;  2PRB A;  3DDD A;  5KTC A;  4CGN A;  1JWQ A;  4CRY B;  4AVA A;  3KQX A;  5LRJ A;  1HEE A;  1AMP A;  4M85 A;  4NEX A;  4UF4 A;  8CPA A;  4YU9 A;  4ZY0 A;  4ZGY B;  1Y7E A;  4B5P A;  3TTH A;  4PXB A;  1IYL A;  3VAT A;  3BJ7 A;  3KR4 A;  2J8M A;  2OU2 A;  3D7D A;  2HB6 A;  4P10 A;  3S9L A;  1YW4 A;  3B3T A;  3IWG A;  4YWY A;  1KUV A;  5IV0 A;  1DE4 C;  4FD5 A;  4OID A;  4RI1 A;  2CY2 A;  3OWC A;  2VEZ A;  3IC1 A;  4KOX A;  2EO8 A;  2EBJ A;  1FT7 A;  4P4B A;  2FL4 A;  4BIN A;  2ATR A;  3PB6 X;  4A94 A;  4FBE A;  2WPW A;  5JGF A;  4CAF A;  1YX0 A;  4NGN A;  4CAV A;  3LAC A;  1YQE A;  2PJA A;  2FSR A;  2C6G A;  2Q44 A;  4LUA A;  4R57 A;  5I0C A;  3IO1 A;  2GAN A;  4X2T A;  4MMO A;  4YGO A;  2ZEL A;  3R9E A;  4JLY A;  2R8V A;  2PVW A;  2C6C A;  5E96 A;  4FAI A;  3EXN A;  2B5G B;  4CRZ B;  3I3G A;  4PSX A;  1VKC A;  3SJE A;  4QUS A;  4BBH A;  4F9V A;  2O28 A;  4PXE A;  2Y0M A;  2DPT A;  3TT2 A;  4A30 A;  4ZX9 A;  4ZI6 A;  1XMB A;  2WPX A;  3IWE A;  2Q0Y A;  4Y49 C;  4R76 A;  3QAY A;  2ZEG A;  3B3S A;  4MHZ A;  5K8O A;  2I79 A;  2POK A;  5H86 A;  3B35 A;  4C68 A;  4DYO A;  2V77 A;  4MHD A;  3PBB A;  1QQ9 A;  3SI1 A;  4R7M A;  2FVG A;  3FBU A;  4MXU A;  3CZX A;  4P45 A;  5EBV A;  4B12 A;  2QYV A;  1IYK A;  2GU2 A;  4PK2 A;  4A39 A;  2XEF A;  1QSO A;  4XNH C;  5EC4 A;  4ZY2 A;  5I4M A;  3W6S A;  4CGO A;  4F9U A;  5LYL A;  4JJX A;  3FVL A;  4PK3 A;  2PJ0 A;  2ZEP A;  4A38 A;  2P0W A;  1KWM A;  3CXQ A;  4OC1 A;  3H8E A;  1UWY A;  4JWP A;  3I1U A;  1X12 A;  1BPN A;  1CM0 A;  3H8F A;  4UEZ A;  3HLP A;  4AXV A;  4Q7A A;  3R96 A;  4KUA A;  1MJ9 A;  2CNM A;  4MCR A;  3G3S A;  4GM5 A;  1Q2D A;  5C82 A;  3FRM A;  5LYF A;  2GLJ A;  4LQ6 A;  1QSN A;  5F49 A;  1LCP A;  4IK2 A;  4CGP A;  3KHZ A;  2B3U A;  2ZW5 A;  4E0A A;  4NXY A;  2HC9 A;  4CGM A;  4UBR A;  3TO7 A;  2Z3K A;  2D4P A;  4IUS A;  3B7I A;  2GE3 A;  1V0C A;  4C2Z A;  2JBJ A;  3IEH A;  4PXC A;  3B2Y A;  3FIX A;  2F7V A;  2PQ8 A;  2G0B A;  2YNC C;  3KZW A;  1QSM A;  3LD2 A;  3MN8 A;  3PRT A;  4OLL A;  4OC4 A;  4MFP A;  1SQH A;  4MFK A;  3A9L A;  1TKF A;  4KOT A;  3IFE A;  3KL9 A;  2AJ6 A;  3IJ3 A;  2Z3M A;  3SXN A;  3T9Y A;  5J8F A;  1FY7 A;  4ZBG A;  4A33 A;  1CG2 A;  1J4J A;  3KKW A;  4M6I A;  4UIA A;  3DR8 A;  4WWV A;  4EVY A;  3DSB A;  3PFO A;  3PFE A;  3EFA A;  4XNH B;  4B5P B;  4L8A A;  4MCP A;  4E8O A;  4P4E A;  1M4G A;  4JXR A;  2CTC A;  2OR4 A;  2XEG A;  1ON0 A;  4ZX8 A;  1RXT A;  4AG9 A;  2ARH A;  1B6B A;  4NSQ A;  2AFU A;  4CAX A;  2VBQ A;  4KOU A;  1Y9K A;  3FH4 A;  3RNZ A;  2D4O A;  3DGV A;  1S60 A;  1YR0 A;  4KLV A;  3IWW A;  1TXR A;  2VI7 A;  2Q7B A;  5HVG A;  2B4D A;  5HXD A;  1BPM A;  2R98 A;  3FF3 A;  1PCA A;  2P6F A;  2ZXV A;  1BLL E;  1Y9W A;  2JBK A;  4Q36 A;  1ZG9 A;  3CXS A;  1CPX A;  4CYQ A;  4EWT A;  3S6K A;  1AUG A;  4GS4 A;  3T90 A;  1FNO A;  2PJ1 A;  3CDX A;  4HNX B;  4NFR A;  3ZZI A;  5IB0 A;  5J8C A;  2P6G A;  1PYT B;  1XMT A;  2G3A A;  3QB8 A;  4UA3 A;  5CBM A;  4LQG A;  4R6T A;  5AG5 A;  2GRE A;  3D2M A;  4CAE A;  1NMT A;  4MBU A;  4H6U A;  4DJL A;  1VHO A;  1CPS A;  2EWB A;  4I49 A;  2PE3 A;  1NSL A;  3G8W A;  5DS0 A;  1YVK A;  3N7Z A;  4C2Y A;  3D7G A;  3GY9 A;  2B4B A;  2AFZ A;  1YLE A;  3RO0 A;  1VIX A;  3LOD A;  3RYO A;  1PUA A;  3BHX A;  3BI0 A;  1X10 A;  3WR7 A;  5K8M A;  4B11 A;  1MK4 A;  4OIW A;  1HDQ A;  3RZA A;  2DXQ A;  4F6A A;  1R3N A;  5HH1 A;  1ZG8 A;  2ZW6 A;  4KOW A;  4YFJ A;  4KOS A;  2PRQ A;  3D4U A;  4R3K A;  4Q38 A;  4C7I A;  1CX8 A;  3GUX A;  2QVP A;  3KR5 A;  4KOR A;  4B10 A;  5JPH A;  3D66 A;  2Q7S A;  1Z4E A;  3SJX A;  4QB9 A;  2EUI A;  3TFY A;  2REF A;  1IB1 E;  1XE4 A;  2Q4V A;  3LMS A;  1GHE A;  1S7K A;  2JDD A;  3KHX A;  2PJ8 A;  2BO9 A;  4M3S A;  3VAR A;  2CNT A;  4F0Y A;  1VHS A;  2PSW A;  1BO4 A;  1QSR A;  3GIU A;  2ODF A;  3NH8 A;  1Z8L A;  4OKO A;  2G3T A;  4K30 A;  4NCZ A;  5BWA B;  4P4I A;  4C7H A;  4OAD A;  1MJA A;  1DTD A;  2B58 A;  2V8V A;  2Z3N A;  1YVO A;  3H4Q A;  4MY0 A;  4NGP A;  2BUE A;  2CXA A;  5CPA A;  3WC7 A;  2G9D A;  2B4D B;  1RO5 A;  2V8H A;  3JRU A;  2OZG A;  1L0C A;  1Z9U A;  4UWI A;  2FT0 A;  1F57 A;  1LFW A;  4NJQ A;  4UEE A;  1CJW A;  3H5Z A;  4XPD C;  1YGH A;  3D3S A;  2J8N A;  5CNP A;  2ABZ A;  2FIW A;  2NSM A;  1PU9 A;  5LYD A;  3SHP A;  5LRK A;  3KQZ A;  4JYW A;  4UFV A;  2BL1 A;  1XBU A;  2JDC A;  3NFZ A;  1XEB A;  1IID A;  1S7L A;  1I1D A;  1U6M A;  3BI1 A;  4KVO E;  2BOA A;  4OP4 A;  2WUU A;  2YNE A;  3GB0 A;  3C26 A;  1K4J A;  4A95 A;  2FCK A;  3QAH A;  4P6Y A;  3S9N A;  3S6H A;  2C27 A;  5D29 A;  4RN7 A;  4PPZ A;  2J8R A;  2YNC A;  3D68 A;  4FD6 A;  2QJ8 A;  1R57 A;  4HNY B;  3T8W A;  3TO9 A;  2Q4Y A;  4ONU A;  4HNW B;  1ZLH A;  4IF5 A;  1IU8 A;  1TKJ A;  5G22 A;  4J3G A;  4B5O A;  2GLF A;  3TO6 A;  4PXD A;  3ISZ A;  3PP9 A;  5AG6 A;  4OC0 A;  5HVF A;  5ISV A;  4CYP A;  1A2Z A;  3FXT A;  3F8K A;  3D7F A;  5C88 A;  3GKR A;  4QVT A;  3TX8 A;  2BEI A;  3KGQ A;  1VGY A;  2GFQ A;  2HQY A;  4KSF A;  1IIC A;  3I9S A;  4A37 A;  5JH9 A;  3S6G A;  5KTD A;  3TCV A;  2H5M A;  4O23 A;  3IGR A;  2VL1 A;  2ANP A;  4OC3 A;  1Q2Y A;  1Z8T A;  2XEI A;  3TOA A;  2ZEE A;  3NH4 A;  3JTK A;  1TF8 A;  4WJB A;  4QBJ A;  2J9A A;  4P4F A;  4RS2 A;  2IJZ A;  1M44 A;  4UFW A;  1ARL A;  5AGE A;  4AVC A;  3PGP A;  1IOF A;  4CYN A;  2VXK A;  2C1C A;  3HUV A;  1OBR A;  3E0K A;  5H84 A;  4ZYQ A;  5D8N A;  2RFH A;  2Z10 A;  3B8G A;  4XPD B;  5IB9 A;  4MFQ A;  1P4N A;  4A31 A;  1ZLI A;  2ZW4 A;  2IL4 A;  2R1I A;  3GYA A;  2PIZ A;  5AG4 A;  1LAP A;  1Z8W A;  2IQ6 A;  4GXH A;  1YSJ A;  1XOV A;  1CP6 A;  3CPA A;  3EC4 A;  2WSA A;  5F46 A;  2ZED A;  2ZEO A;  1YW6 A;  4NGQ A;  3DNS A;  3R95 A;  2PR8 A;  3L2N A;  1Y0Y A;  2PIY A;  3H8G A;  1YME A;  1LAN A;  2EK8 A;  5K8N A;  1GYT A;  4Y49 B;  3S9M A;  3D8P A;  5HMN A;  2WYR A;  2PJ5 A;  4UCN A;  3TC8 A;  4NF1 A;  3PB8 X;  2C6P A;  3V38 A;  3W6X A;  4UFX A;  3FNC A;  2ZW7 A;  5LRG A;  4X8I A;  4X3R A;  3WAB A;  1BOB A;  3V7Z A;  5IX3 A; 
#chains in the Genus database with same CATH homology
 3BLN A;  3W91 A;  2K5T A;  4AG7 A;  1OZP A;  3MGD A;  4MY3 A;  4JD6 A;  1KZF A;  2FS5 A;  4C2X A;  5F48 A;  2VZY A;  4KOV A;  1Y7R A;  1YRE A;  1LRZ A;  1Z4R A;  1M1D A;  3UY5 A;  3VWD A;  3TE4 A;  4II9 A;  4QC6 A;  3PZJ A;  2QML A;  4CAW A;  3V8I A;  4ORF A;  4MFZ A;  3IU2 A;  4R87 A;  4R9M A;  1TIQ A;  5JQ4 A;  2PR1 A;  3NE7 A;  2Z0Z A;  3P2H A;  1YK3 A;  4JXQ A;  5FVJ A;  1S3Z A;  5DWM A;  2AE6 A;  2R7H A;  4A2Z A;  4XPK A;  4U9Z A;  1S5K A;  3TOB A;  1MJB A;  2I00 A;  4UCP A;  4LX9 A;  2HV2 A;  2Z11 A;  5DWN A;  1UFH A;  3S6F A;  4H6Z A;  2YND A;  2NMT A;  4AVB A;  1NE9 A;  2VZZ A;  2X7B A;  4UWJ A;  1Q2C A;  3R9F A;  4AB7 A;  4PV6 A;  3FB3 A;  4CS0 B;  2EVN A;  4KVM E;  2PC1 A;  2KCW A;  2Z3O A;  3JVN A;  4CYO A;  5F47 A;  3EO4 A;  3F5B A;  2PDO A;  2FIA A;  4U5Y A;  4CGL A;  2VQY A;  4R3L A;  4PSW A;  3P2F A;  3VWE A;  3R9G A;  1WWZ A;  2A4N A;  1KUX A;  5G21 A;  2OB0 A;  1S7N A;  4FD7 A;  2RC4 A;  2OZH A;  2Z3P A;  2QEC A;  5KTA A;  4YRH A;  4KS9 A;  4FD4 A;  2YGW A;  4KZT A;  1XIX A;  2OZU A;  2CNS A;  3EY5 A;  4H89 A;  4MI4 A;  3CXP A;  1M4I A;  4KSA A;  4UCM A;  4B13 A;  3D2P A;  2ZPA A;  4OAE A;  4X5K A;  2QIR A;  5G20 A;  1B87 A;  5G1Z A;  2FE7 A;  2JEV A;  2BSW A;  1QST A;  2F5I A;  2Z3L A;  3F0A A;  4XPL A;  3FYN A;  2REE A;  1M4D A;  4KVX A;  2OH1 A;  4L89 A;  1WK4 A;  4MFL A;  3BJ8 A;  4BMH A;  3ZJ0 A;  1I12 A;  3SXO A;  2JLM A;  3R1K A;  3JUW A;  4KLW A;  4KOY A;  1S7F A;  3DR6 A;  2B3V A;  1ZO0 A;  1P0H A;  2GIV A;  1I21 A;  5A28 A;  2B5G A;  1KUY A;  4HKF A;  4B14 A;  2HUZ A;  2Q04 A;  4A32 A;  2FXF A;  4KUB A;  4MFJ A;  4MJ8 A;  2P6E A;  4DNC A;  4F0X A;  1XF8 A;  5GCN A;  3K9U A;  4U9Y A;  3IU1 A;  5AG7 A;  1N71 A;  2DPS A;  5KTC A;  2PRB A;  3DDD A;  4CGN A;  4CRY B;  4AVA A;  4M85 A;  4NEX A;  4ZGY B;  4B5P A;  3TTH A;  1IYL A;  3BJ7 A;  2J8M A;  2OU2 A;  3IWG A;  5IV0 A;  1KUV A;  4FD5 A;  4RI1 A;  2CY2 A;  3OWC A;  2VEZ A;  4KOX A;  2FL4 A;  2ATR A;  2WPW A;  4CAF A;  1YX0 A;  4CAV A;  4R57 A;  2Q44 A;  2FSR A;  4LUA A;  5I0C A;  2GAN A;  4YGO A;  3R9E A;  4JLY A;  2R8V A;  5E96 A;  3EXN A;  2B5G B;  4CRZ B;  3I3G A;  4PSX A;  1VKC A;  4QUS A;  4BBH A;  2O28 A;  4A30 A;  2Y0M A;  2DPT A;  3TT2 A;  2WPX A;  3IWE A;  2Q0Y A;  4Y49 C;  2I79 A;  4C68 A;  5H86 A;  4MHD A;  3FBU A;  5EBV A;  4B12 A;  1IYK A;  4PK2 A;  1QSO A;  4XNH C;  5EC4 A;  3W6S A;  4CGO A;  4JJX A;  4PK3 A;  2P0W A;  3CXQ A;  4JWP A;  1CM0 A;  3R96 A;  4KUA A;  1MJ9 A;  2CNM A;  3G3S A;  1Q2D A;  5C82 A;  3FRM A;  5F49 A;  1QSN A;  4CGP A;  2B3U A;  2ZW5 A;  4E0A A;  4NXY A;  4CGM A;  4UBR A;  3TO7 A;  2Z3K A;  2D4P A;  4IUS A;  2GE3 A;  1V0C A;  4C2Z A;  3FIX A;  2PQ8 A;  2YNC C;  2G0B A;  3LD2 A;  1QSM A;  4OLL A;  4MFP A;  1SQH A;  4MFK A;  3A9L A;  4KOT A;  2AJ6 A;  2Z3M A;  3SXN A;  3T9Y A;  5J8F A;  1FY7 A;  4ZBG A;  4A33 A;  1J4J A;  3KKW A;  3DR8 A;  4EVY A;  3DSB A;  3EFA A;  4XNH B;  4B5P B;  4L8A A;  4E8O A;  1M4G A;  4JXR A;  1ON0 A;  1RXT A;  4AG9 A;  2ARH A;  1B6B A;  4NSQ A;  4CAX A;  2VBQ A;  4KOU A;  1Y9K A;  2D4O A;  1S60 A;  1YR0 A;  4KLV A;  2VI7 A;  2Q7B A;  2B4D A;  2R98 A;  2P6F A;  2ZXV A;  1Y9W A;  4Q36 A;  3CXS A;  4CYQ A;  3S6K A;  4GS4 A;  3T90 A;  4HNX B;  3ZZI A;  5IB0 A;  5J8C A;  2P6G A;  1XMT A;  2G3A A;  3QB8 A;  4UA3 A;  5AG5 A;  3D2M A;  1NMT A;  4MBU A;  4H6U A;  4I49 A;  1NSL A;  3G8W A;  1YVK A;  3N7Z A;  4C2Y A;  3GY9 A;  2B4B A;  1YLE A;  3RYO A;  3LOD A;  1PUA A;  3WR7 A;  4B11 A;  1MK4 A;  2DXQ A;  4F6A A;  5A27 A;  5HH1 A;  4YFJ A;  2ZW6 A;  4KOW A;  4KOS A;  4R3K A;  4C7I A;  4Q38 A;  4KOR A;  4B10 A;  5JPH A;  1Z4E A;  4QB9 A;  2EUI A;  3TFY A;  2REF A;  1IB1 E;  1XE4 A;  2Q4V A;  1GHE A;  1S7K A;  2JDD A;  4M3S A;  2CNT A;  4F0Y A;  1VHS A;  2PSW A;  1BO4 A;  1QSR A;  5BWA B;  2G3T A;  4K30 A;  4NCZ A;  4C7H A;  4OAD A;  1MJA A;  4CAE A;  2B58 A;  2Z3N A;  3H4Q A;  1YVO A;  4MY0 A;  2BUE A;  2CXA A;  2B4D B;  1RO5 A;  2OZG A;  1L0C A;  1Z9U A;  4UWI A;  2FT0 A;  4XPD C;  1CJW A;  3H5Z A;  1YGH A;  3D3S A;  2J8N A;  5CNP A;  2FIW A;  1PU9 A;  3SHP A;  4UFV A;  2BL1 A;  2JDC A;  1XEB A;  1IID A;  1S7L A;  1I1D A;  1U6M A;  4KVO E;  2WUU A;  2YNE A;  3C26 A;  1K4J A;  4A95 A;  2FCK A;  3QAH A;  3S6H A;  2C27 A;  2J8R A;  2YNC A;  4FD6 A;  1R57 A;  4HNY B;  3TO9 A;  2Q4Y A;  4ONU A;  4HNW B;  4IF5 A;  5G22 A;  4J3G A;  4B5O A;  3TO6 A;  3PP9 A;  5AG6 A;  5ISV A;  4CYP A;  3FXT A;  3F8K A;  5C88 A;  3GKR A;  4QVT A;  2BEI A;  2HQY A;  4KSF A;  1IIC A;  3I9S A;  3S6G A;  5KTD A;  3TCV A;  2H5M A;  3IGR A;  1Q2Y A;  3TOA A;  4QBJ A;  3JTK A;  4RS2 A;  4UFW A;  5AGE A;  4E2A A;  1M44 A;  4CYN A;  4AVC A;  3PGP A;  2VXK A;  3E0K A;  5H84 A;  2Z10 A;  3B8G A;  4XPD B;  4MFQ A;  1P4N A;  4A31 A;  2ZW4 A;  2IL4 A;  2R1I A;  3GYA A;  5AG4 A;  3EC4 A;  2WSA A;  5F46 A;  3DNS A;  3R95 A;  2PR8 A;  4Y49 B;  3D8P A;  5HMN A;  4UCN A;  4NF1 A;  3W6X A;  4UFX A;  3FNC A;  2ZW7 A;  1BOB A;  5IX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...