4KOWA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefoxitin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
b'MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Transferase
source organism Pseudomonas aeruginosa
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kowA00
2HV2A 3E0KA 4H89A 2JLMA 4L89A 4FD5A 4MHDA 1XMTA 3R9FA 4KVOE 4HKFA 2EUIA 2J8RA 4YRHA 3S6FA 2B3VA 1QSTA 4KUBA 4DNCA 2HUZA 3DR8A 3CXQA 5IB0A 1FY7A 3D3SA 4AVBA 2FIAA 4AB7A 1MJAA 2OB0A 2Q44A 2FSRA 4KLWA 1P0HA 4JXQA 4ONUA 3TOAA 5C82A 3DDDA 2FXFA 4R9MA 2OZHA 2R1IA 5F48A 4LX9A 2O28A 3GYAA 3DSBA 2JDDA 3C26A 1M4IA 3GKRA 2ZPAA 1S7FA 3N7ZA 3TCVA 2R7HA 2KCWA 4JJXA 4BMHA 2J8MA 4AG7A 3K9UA 3FIXA 3FB3A 2VQYA 4QVTA 1YX0A 3F0AA 5J8FA 2WPWA 2PRBA 2OZUA 1Q2DA 4U5YA 3CXSA 1M4DA 1VHSA 2X7BA 4I49A 3T9YA 4KOUA 2G3TA 4LUAA 4NSQA 5CNPA 2Z0ZA 4F6AA 4II9A 2H5MA 3QAHA 4AVCA 2G3AA 3PP9A 4PSXA 3UY5A 5GCNA 4PV6A 4XNHB 2ZW5A 1S3ZA 4CRYB 4MBUA 2OH1A 1OZPA 1YVKA 2CNMA 5JPHA 4OLLA 4UWIA 2GANA 2BL1A 2VEZA 3TT2A 5KTCA 4OADA 3I3GA 5EC4A 4E8OA 3LD2A 5F46A 5KTAA 3MGDA 4UWJA 2WPXA 4KOXA 3P2FA 5JQ4A 2ZW7A 2I79A 4ZBGA 3R9EA 3BJ7A 3OWCA 4E0AA 1V0CA 4F0YA 1S60A 2CNSA 2D4PA 1I1DA 4B5PB 2OZGA 2VZYA 1I12A 4MJ8A 1S5KA 3TFYA 4M3SA 4R3LA 2FL4A 3VWEA 2VBQA 1WK4A 5F49A 1Z4EA 5FVJA 4NCZA 4L8AA 4HNYB 4J3GA 2P6FA 2D4OA 1KUVA 4MY0A 2P0WA 5DWMA 1PUAA 5ISVA 1TIQA 4XPKA 4KOSA 3W6XA 4H6ZA 1WWZA 1K4JA 1MJ9A 4K30A 4R3KA 4M85A 4IF5A 1B6BA 2QIRA 1VKCA 2BEIA 2B5GA 2A4NA 3WR7A 1Z9UA 4MY3A 4CAXA 4R57A 3G8WA 1IYKA 3KKWA 3H4QA 4R87A 2IL4A 2BSWA 4H6UA 2OU2A 4Y49B 1IYLA 1Y9WA 2ARHA 2Y0MA 4AVAA 3SHPA 4Y49C 4KVME 1M1DA 1S7KA 4KORA 4JWPA 4FD7A 3R1KA 3SXOA 3EXNA 4ORFA 5DWNA 4QC6A 3PZJA 1S7LA 2R98A 1KUYA 3ZZIA 3LODA 4CS0B 1CJWA 4QUSA 1XF8A 4XPLA 2B4BA 2FS5A 2NMTA 1YK3A 1R57A 2G0BA 4NEXA 3T90A 4PK3A 3IWGA 2QECA 1XIXA 4XPDC 1MK4A 3P2HA 2FT0A 1YR0A 4MI4A 4B5OA 3FNCA 3EFAA 4FD4A 1Q2YA 2PR1A 1M44A 2JDCA 2B4DA 1Q2CA 4IUSA 4U9ZA 2B5GB 3IGRA 4YFJA 3FBUA 3TO6A 3TO7A 1ON0A 4KOYA 3DR6A 5I0CA 1B87A 3W91A 2ZXVA 3VWDA 4QBJA 2B3UA 1NE9A 5H86A 4KOTA 4KUAA 3F5BA 4QB9A 3G3SA 2Q4VA 3EO4A 4GS4A 4KVXA 1Y9KA 2Q7BA 3TOBA 3FXTA 1UFHA 1SQHA 4KZTA 1P4NA 5H84A 4RI1A 2Q4YA 4AG9A 2B4DB 1QSMA 4NF1A 2ZW4A 4XPDB 3R95A 4XNHC 5KTDA 3R9GA 5F47A 1U6MA 2REEA 3DNSA 1NMTA 3D8PA 2VI7A 2PQ8A 4PSWA 4X5KA 1GHEA 5HMNA 1RXTA 4CAWA 1IIDA 3S6GA 1IICA 3S6KA 2CNTA 3R96A 4KLVA 2AJ6A 2I00A 1RO5A 1XE4A 3JUWA 5C88A 1M4GA 2PR8A 1XEBA 3TE4A 3B8GA 3V8IA 1MJBA 4CAVA 3TTHA 2VZZA 4CRZB 3JVNA 4EVYA 2FIWA 2ZW6A 4JD6A 4UA3A 4HNXB 1YREA 3SXNA 5E96A 2EVNA 2Q0YA 2ATRA 2FCKA 3EY5A 1YVOA 2F5IA 1Z4RA 1QSOA 1QSRA 2VXKA 2BUEA 2HQYA 4U9YA 1YGHA 4KOVA 2CY2A 1S7NA 4FD6A 3EC4A 1IB1E 3NE7A 4UBRA 3RYOA 5IV0A 1J4JA 2PC1A 3TO9A 3FYNA 3ZJ0A 4HNWB 2JEVA 3F8KA 3D2PA 3I9SA 2R8VA 3S6HA 5EBVA 1LRZA 5J8CA 3D2MA 1PU9A 3FRMA 4KOWA 5HH1A 2AE6A 5IX3A 4PK2A 1KZFA 1N71A 2Q04A 2RC4A 2P6EA 1BOBA 2Z10A 2Z11A 3QB8A 1YLEA 2PDOA 2QMLA 4E2AA 1L0CA 1KUXA 4OAEA 2REFA 3CXPA 1QSNA 3GY9A 2GIVA 1BO4A 2C27A 3BJ8A 1Y7RA 4B5PA 1I21A 2GE3A 2DXQA 4YGOA 2PSWA 3PGPA 4JLYA 2K5TA 4RS2A 2B58A 4NXYA 3W6SA 2FE7A 2J8NA 4JXRA 3BLNA 1CM0A 2P6GA 1NSLA
chains in the Genus database with same CATH superfamily
2HV2A 3CPXA 3E0KA 4H89A 2JLMA 4L89A 3CZXA 4DJLA 4P4FA 4FD5A 2CIJA 4MHDA 1XMTA 3R9FA 4KVOE 4NGQA 1YQEA 3NH8A 3IWWA 4HKFA 2PE3A 2EUIA 2J8RA 2C1CA 3BI0A 4YRHA 3S6FA 2B3VA 4KSAA 1QSTA 3PBEA 7CPAA 4TNUA 4R6TA 4MHPA 4KUBA 4DNCA 4Q36A 3BXMA 2HUZA 3DR8A 3KHXA 1BPNA 3WC7A 3CXQA 5LYFA 5K8MA 1BPMA 1IY7A 3CDXA 5IB0A 4C2YA 1FY7A 3D3SA 4CGPA 3H8FA 4AVBA 4OIDA 2FIAA 4AB7A 4BINA 4M6HA 3GUXA 3D68A 3LACA 2ZEEA 3T8WA 1MJAA 2OB0A 4UEZA 2Q44A 2FSRA 4KLWA 5D29A 1P0HA 4JXQA 4ONUA 3TOAA 1TF8A 4ZGYB 5C82A 5K8PA 3DDDA 3D67A 2FXFA 2Z3KA 3N5FA 3NFZA 4R9MA 4X8IA 2OZHA 2R1IA 5F48A 1RTQA 4M6IA 4P6YA 1IOIA 4LX9A 2RFHA 3KQZA 1QQ9A 4MCRA 4MHYA 5AG4A 2O28A 3B35A 4B13A 3MN8A 2GLFA 5J1QA 2RB7A 2YNEA 3DSBA 3GYAA 2EWBA 1ZO0A 2JDDA 3C26A 1M4IA 3PBBA 4FUUA 4WJBA 3GKRA 2JEWA 2J9AA 2O4HA 2ZPAA 3IU2A 1S7FA 3KZWA 1ZLHA 4MCSA 1EE3P 3N7ZA 1PYTB 5EMIA 1QMUA 2R7HA 3TCVA 2KCWA 2PIZA 5HVGA 4JJXA 2Z3NA 4BMHA 4NFRA 2J8MA 4UF4A 2XEJA 3K9UA 3FIXA 4AG7A 5JH9A 3FB3A 4PXDA 2VQYA 4QVTA 2IJZA 1Z8XA 1BLLE 4CYQA 4M6GA 1YX0A 3F0AA 3PB9X 2YNDA 5I4MA 2WPWA 2PRBA 5J8FA 1H8LA 2OZUA 3D7DA 3SI2A 1Q2DA 4U5YA 2EK8A 2F8HA 3CXSA 4OC5A 1M4DA 1VHSA 2X7BA 4BBHA 1TKJA 3SJXA 4I49A 3T9YA 1HEEA 4KOUA 2G3TA 4LUAA 2ZELA 4NSQA 3RO0A 2PJ5A 3IEHA 4MHZA 5CNPA 2Z0ZA 4F6AA 5JGFA 4II9A 2ABZA 2XEIA 2WZNA 2H5MA 1DTDA 3QAHA 2JBKA 4UCPA 3SI1A 4OKOA 4PXCA 3TX8A 4AVCA 2G3AA 3PP9A 1XOVA 4PSXA 3S9LA 3UY5A 5GCNA 4PPZA 2ZEPA 4PV6A 3H8GA 4FAIA 3B3WA 4X2TA 1ELMP 4XNHB 3D7HA 3S9NA 3KHZA 1ELLP 2ZW5A 4UIBA 1S3ZA 1XRYA 4C7HA 4CRYB 1XFOA 2ZEGA 4MBUA 2OH1A 1CPXA 1OZPA 1YVKA 2POKA 2CNMA 2V77A 5JPHA 4OLLA 4UWIA 2GANA 4LQGA 3VH9A 2BL1A 1Z8TA 2VEZA 3BHXA 2DF5A 3JTKA 2BCOA 1ZG7A 3TT2A 5KTCA 2DEAA 5AGEA 4UFXA 3IC1A 4UIAA 3PB6X 4OADA 3I3GA 1VGYA 5EC4A 4E8OA 3LD2A 4ZX8A 5F46A 2Q51A 3PB7X 4OMEA 5KTAA 2ODFA 3MGDA 4UWJA 5F09A 2WPXA 4KOXA 3RAMA 2ZEHA 1CP6A 5A27A 1YMEA 4UCNA 3P2FA 4A95A 5JQ4A 4B14A 2ZW7A 2I79A 4ZBGA 3R9EA 5LRKA 3BJ7A 3OWCA 4E0AA 1V0CA 4MFPA 4GM5A 1Z5RA 4F0YA 1S60A 2CNSA 2D4PA 3FF3A 3IIBA 1I1DA 3KGQA 3ISXA 2WUUA 2CF4A 4B5PB 2PJ3A 2XEFA 4NGNA 4EFDA 3RNZA 2OZGA 2YNCA 2C6PA 2VL1A 2VZYA 3H8EA 4ZY0A 4ONWA 5LRGA 4EWTA 2DPTA 4ZYQA 3K2KA 1I12A 1TKFA 4MJ8A 1S5KA 3TFYA 4M3SA 1IOFA 1A2ZA 4R3LA 4CGNA 2FL4A 4NGPA 4ZY2A 5LRJA 2YGWA 3KASA 3VWEA 2EO8A 2VBQA 1GYTA 1WK4A 4A94A 5F49A 1Z4EA 3PFEA 4NCZA 5FVJA 1Z8WA 4A39A 4P10A 4NGSA 1OBRA 4PXBA 4CGMA 4MFJA 4DUKA 5BWAB 5HXDA 3NA6A 4LQ6A 3FX6A 5K8OA 3MRUA 4KS9A 4L8AA 4DYOA 4HNYB 4J3GA 3IJ3A 5A28A 2P6FA 2D4OA 1KUVA 1FT7A 4MY0A 2O53A 2P0WA 5DWMA 1PUAA 4CGOA 2PJ1A 5ISVA 5CPAA 1TIQA 4H2KA 2Q4ZA 3PEIA 4Q38A 1XMBA 4KOSA 4XPKA 2NSMA 3BI1A 3SJEA 3W6XA 4MFLA 2QYVA 4MCQA 4H6ZA 3WABA 1WWZA 2PJ4A 1K4JA 4IK2A 1MJ9A 4UEFA 4K30A 5DS0A 3FH4A 5G20A 4R3KA 4M85A 1B6BA 4IF5A 2QIRA 3HLPA 1VKCA 2BEIA 2B5GA 2A4NA 3WR7A 3D4UA 1Z9UA 4MY3A 4CAXA 3FECA 4R57A 3SJGA 1CP7A 5HVHA 3KI9A 4NGRA 2HB6A 4YWYA 3G8WA 4OC2A 3B2YA 2G9DA 4WWVA 1IYKA 3KKWA 2PIYA 3H4QA 4R87A 4CPAA 1Q7LA 2IL4A 2BSWA 4H6UA 4OC0A 4AXVA 2OU2A 3VATA 3V7ZA 1FNOA 1VIXA 4Y49B 4B10A 5JM6A 1IYLA 4NJQA 2AFOA 4CYNA 1Y9WA 1F2OA 1KWMA 2ARHA 2ZOFA 4MMOA 4P4IA 2Y0MA 3LWUA 4MXUA 2ZENA 4AVAA 3GLJA 1CPSA 3SHPA 4Y49C 2AFMA 4KVME 2PVVA 1M1DA 5LYIA 2Z3PA 1S7KA 3V38A 1Y0RA 4KORA 5D8NA 1LCPA 1R3NA 3D7GA 3KQXA 4FD7A 4JWPA 3R1KA 4NGMA 3EXNA 2I3CA 4ORFA 3SXOA 1JQGA 4A37A 5DWNA 4OIWA 4QC6A 3PZJA 2OR4A 1X12A 1S7LA 2R98A 1KUYA 3ZZIA 3LODA 4CS0B 1CJWA 4QUSA 6CPAA 2V8VA 1XF8A 4XPLA 4P4EA 2ZEDA 2AFUA 4CAEA 1TXRA 1XBUA 2B4BA 2WYRA 2FS5A 4MCPA 2NMTA 1YK3A 1R57A 2G0BA 4G1PA 4NEXA 3T90A 4CYPA 4HPSA 4PK3A 1BAVA 3IWGA 1ZLIA 2QECA 2V8GA 1F57A 1XIXA 3RBUA 4XPDC 3DGVA 1MK4A 3P2HA 2FT0A 4OC1A 1YR0A 3JRUA 4KSFA 2GU2A 4MI4A 2PJ8A 4B5OA 3FVLA 2BOAA 3TC8A 4ZY1A 3B3SA 3EFAA 3FNCA 4FD4A 1Q2YA 2PR1A 1R43A 1M44A 2PJ6A 3IWEA 3L2NA 1LOKA 5CBMA 2JDCA 2B4DA 2YNCC 1Q2CA 5THWA 4IUSA 4P4BA 4U9ZA 3IFEA 2B5GB 3CPAA 1X10A 4A38A 3IGRA 4YFJA 4A32A 4CYOA 4CAFA 3FBUA 3TO6A 3TO7A 1AUGA 1ON0A 3NH4A 4KOYA 4P4JA 3DR6A 5I0CA 1B87A 2FVGA 3W91A 4UEEA 2ZXVA 3VWDA 4QBJA 2B3UA 4OC3A 1NE9A 1Z8LA 1TKHA 1M4LA 5H86A 4KOTA 2PJ7A 4KUAA 4BD9A 3PRTA 2GLJA 4F0XA 2PJBA 3VARA 3F5BA 4QB9A 3G3SA 4EMEA 2Q4VA 3EO4A 4GS4A 4KVXA 1Y9KA 3NH5A 2Q7BA 3TOBA 1VHEA 3FXTA 3WT4A 1UFHA 3K9TA 5K8NA 3LMSA 1YLOA 1SQHA 4TWEA 3SJFA 1XJOA 1P4NA 4KZTA 4OC4A 5H84A 2CXAA 1ZG9A 4RI1A 3KR4A 2JBJA 2QVPA 3GB0A 4C68A 2Q4YA 2QJ8A 4MRIA 4AG9A 2B4DB 1QSMA 2WSAA 2ZW4A 4NF1A 4MFQA 2GFQA 2CTCA 1YSJA 4XPDB 5LYDA 1ARMA 4XNHC 3R95A 4CGLA 5KTDA 1VHOA 4KSIA 2PJ0A 3HUVA 3R9GA 4A33A 5F47A 4NGTA 1U6MA 2REEA 3DNSA 1NMTA 3D8PA 2VI7A 2PQ8A 4PSWA 4X5KA 2CTBA 2Z3LA 3SI0A 4NJRA 4R7MA 1GHEA 2DPSA 5HMNA 4O23A 1RXTA 4CAWA 1IIDA 2Q7SA 1IICA 2ANPA 3S6GA 4ZI6A 5G1ZA 3S6KA 2CNTA 3R96A 3PB4X 4KLVA 2AJ6A 1TF9A 2I00A 1RO5A 3KL9A 1XE4A 2Z3OA 3JUWA 5C88A 4F9VA 1M4GA 2PRQA 2PR8A 4UFVA 1XEBA 3TE4A 1UWYA 2ZOGA 1LFWA 4Q7AA 3B8GA 1YW6A 3V8IA 1MJBA 4CAVA 3FJUA 3TTHA 2VZZA 4CRZB 4RUHA 3D7FA 3JVNA 5AG5A 2PJAA 4EVYA 2FIWA 2ZEMA 3QAYA 4OP4A 4IAVA 2ZW6A 4JD6A 2AFWA 4UA3A 4HNXB 4P44A 5G22A 1YREA 5AG7A 4FWUA 3SXNA 5E96A 1IGBA 2EVNA 4UFWA 2Q0YA 4YU9A 3B7IA 4A30A 2PJ9A 3NE8A 2ATRA 3FMCA 2FCKA 2F7VA 3EY5A 4W9YA 3S9MA 1YVOA 2F5IA 4A2ZA 3WC6A 1Z4RA 1QSOA 3B3TA 1QSRA 2VXKA 2EBJA 2BUEA 4K3NA 1LAPA 2HQYA 5ELYA 4U9YA 1YGHA 4KOVA 2AFZA 2AFXA 2CY2A 1S7NA 4FD6A 3EC4A 3I1UA 4JYWA 1IB1E 3NE7A 3GIUA 4UBRA 3RYOA 5IV0A 1J4JA 2PC1A 2PJ2A 4F9UA 3TO9A 1HDQA 3FYNA 3ZJ0A 5HVFA 4HNWB 2JEVA 3F8KA 1AYEA 1F2PA 4B11A 2ZEFA 1NSAA 2IMOA 3D2PA 3I9SA 4P45A 4P4DA 2V8HA 2PCUA 2R8VA 3S6HA 3PFOA 2OOTA 4MHNA 5EBVA 5IB9A 1CG2A 1CBXA 1LANA 1LRZA 2EK9A 3FEDA 3IU1A 3A9LA 3D2MA 5AG6A 1PU9A 3FRMA 4KOWA 5HH1A 2AE6A 5IX3A 5J8CA 4PK2A 1KZFA 1LAMA 1N71A 2Q04A 2GREA 3WC5A 8CPAA 3B3VA 2RC4A 1Z2LA 1IU8A 1DE4C 3PB8X 2XEGA 4PXEA 5G21A 2P6EA 1BOBA 2Z10A 3CT9A 4X3RA 2Z11A 4F8ZA 3H5ZA 4C2XA 3QB8A 1YLEA 2PDOA 3B3CA 2QMLA 4E2AA 3ISZA 1L0CA 4PQAA 2C6GA 1KUXA 1PCAA 1ARLA 2Z3MA 3DLJA 3FEEA 4OAEA 4ZX9A 4MFZA 4RN7A 2REFA 3CXPA 1QSNA 2BO9A 2NYQA 3GY9A 2GIVA 4FBEA 1BO4A 2C27A 2Q43A 3D66A 4C7IA 3BJ8A 1Y7RA 1YW4A 2V8DA 1CX8A 2HC9A 4JZ0A 4B6ZA 4Z65A 4B5PA 4GXHA 2AFSA 1I21A 5LYLA 2GE3A 3QNVA 4A31A 2DXQA 2C6CA 4YGOA 2PSWA 4R8FA 3PGPA 2IQ6A 4JLYA 4IHMA 2K5TA 4RS2A 2B58A 3IO1A 4NXYA 3KR5A 1ZG8A 2ZEOA 1HDUA 4MFKA 3W6SA 2PJCA 4UCMA 1AMPA 2FE7A 1JWQA 2J8NA 3RZAA 2PVWA 4JXRA 4B12A 4R76A 3BLNA 1CM0A 1Y0YA 2P6GA 4C2ZA 1Y7EA 1NSLA
chains in the Genus database with same CATH topology
2HV2A 3E0KA 4H89A 2JLMA 4L89A 4FD5A 4MHDA 1XMTA 3R9FA 4KVOE 4HKFA 2EUIA 2J8RA 4YRHA 3S6FA 2B3VA 4KSAA 1QSTA 4KUBA 4DNCA 4Q36A 2HUZA 3DR8A 3CXQA 5IB0A 4C2YA 1FY7A 3D3SA 4CGPA 4AVBA 2FIAA 4AB7A 1MJAA 2OB0A 2Q44A 2FSRA 4KLWA 1P0HA 4JXQA 4ONUA 3TOAA 4ZGYB 5C82A 3DDDA 2FXFA 2Z3KA 4R9MA 2OZHA 2R1IA 5F48A 4LX9A 5AG4A 2O28A 4B13A 3GYAA 2YNEA 3DSBA 1ZO0A 2JDDA 3C26A 1M4IA 3GKRA 2ZPAA 3IU2A 1S7FA 3N7ZA 3TCVA 2R7HA 2KCWA 4JJXA 2Z3NA 4BMHA 2J8MA 4AG7A 3K9UA 3FIXA 3FB3A 2VQYA 4QVTA 4CYQA 1YX0A 3F0AA 5J8FA 2YNDA 2WPWA 2PRBA 2OZUA 1Q2DA 4U5YA 3CXSA 1M4DA 1VHSA 2X7BA 4BBHA 4I49A 3T9YA 4KOUA 2G3TA 4LUAA 4NSQA 5CNPA 2Z0ZA 4F6AA 4II9A 2H5MA 3QAHA 4UCPA 4AVCA 2G3AA 3PP9A 4PSXA 3UY5A 5GCNA 4PV6A 4XNHB 2ZW5A 1S3ZA 4CRYB 4C7HA 4MBUA 2OH1A 1OZPA 1YVKA 2CNMA 5JPHA 4OLLA 4UWIA 2GANA 2BL1A 2VEZA 3JTKA 3TT2A 5KTCA 5AGEA 4UFXA 4OADA 3I3GA 5EC4A 4E8OA 3LD2A 5F46A 5KTAA 3MGDA 4UWJA 2WPXA 4KOXA 5A27A 4UCNA 3P2FA 4A95A 5JQ4A 4B14A 2ZW7A 2I79A 4ZBGA 3R9EA 3BJ7A 3OWCA 4E0AA 1V0CA 4MFPA 4F0YA 1S60A 2CNSA 2D4PA 1I1DA 2WUUA 4B5PB 2OZGA 2YNCA 2VZYA 2DPTA 1I12A 4MJ8A 1S5KA 3TFYA 4M3SA 4R3LA 4CGNA 2FL4A 2YGWA 3VWEA 2VBQA 1WK4A 5F49A 1Z4EA 5FVJA 4NCZA 5BWAB 4CGMA 4MFJA 4KS9A 4L8AA 4HNYB 4J3GA 5A28A 2P6FA 2D4OA 1KUVA 4MY0A 2P0WA 5DWMA 1PUAA 4CGOA 5ISVA 1TIQA 4Q38A 4XPKA 4KOSA 3W6XA 4MFLA 4H6ZA 1WWZA 1K4JA 1MJ9A 5G20A 4K30A 4R3KA 4M85A 4IF5A 1B6BA 2QIRA 1VKCA 2BEIA 2B5GA 2A4NA 3WR7A 1Z9UA 4MY3A 4CAXA 4R57A 3G8WA 1IYKA 3KKWA 3H4QA 4R87A 2IL4A 2BSWA 4H6UA 2OU2A 4Y49B 4B10A 1IYLA 4CYNA 1Y9WA 2ARHA 2Y0MA 4AVAA 3SHPA 4Y49C 4KVME 1M1DA 2Z3PA 1S7KA 4KORA 4JWPA 4FD7A 3R1KA 3SXOA 3EXNA 4ORFA 5DWNA 4QC6A 3PZJA 1S7LA 2R98A 1KUYA 3ZZIA 3LODA 4CS0B 1CJWA 4QUSA 1XF8A 4XPLA 4CAEA 2B4BA 2FS5A 2NMTA 1YK3A 1R57A 2G0BA 4NEXA 3T90A 4CYPA 4PK3A 3IWGA 2QECA 1XIXA 4XPDC 1MK4A 3P2HA 2FT0A 1YR0A 4KSFA 4MI4A 4B5OA 3FNCA 3EFAA 4FD4A 1Q2YA 2PR1A 1M44A 3IWEA 2JDCA 2B4DA 2YNCC 1Q2CA 4IUSA 4U9ZA 2B5GB 3IGRA 4YFJA 4A32A 4CYOA 4CAFA 3FBUA 3TO6A 3TO7A 1ON0A 4KOYA 3DR6A 5I0CA 1B87A 3W91A 2ZXVA 3VWDA 4QBJA 2B3UA 1NE9A 5H86A 4KOTA 4KUAA 4F0XA 3F5BA 4QB9A 3G3SA 2Q4VA 3EO4A 4GS4A 4KVXA 1Y9KA 2Q7BA 3TOBA 3FXTA 1UFHA 1SQHA 4KZTA 1P4NA 5H84A 2CXAA 4RI1A 4C68A 2Q4YA 4AG9A 2B4DB 1QSMA 2WSAA 2ZW4A 4NF1A 4MFQA 4XPDB 3R95A 4XNHC 4CGLA 5KTDA 3R9GA 4A33A 5F47A 1U6MA 2REEA 3DNSA 1NMTA 3D8PA 2VI7A 2PQ8A 4PSWA 4X5KA 2Z3LA 1GHEA 2DPSA 5HMNA 1RXTA 4CAWA 1IIDA 3S6GA 1IICA 5G1ZA 3S6KA 2CNTA 3R96A 4KLVA 2AJ6A 2I00A 1RO5A 1XE4A 2Z3OA 3JUWA 5C88A 1M4GA 2PR8A 4UFVA 1XEBA 3TE4A 3B8GA 3V8IA 1MJBA 4CAVA 3TTHA 2VZZA 4CRZB 3JVNA 5AG5A 4EVYA 2FIWA 2ZW6A 4JD6A 4UA3A 4HNXB 5G22A 1YREA 5AG7A 3SXNA 5E96A 2EVNA 4UFWA 2Q0YA 4A30A 2ATRA 2FCKA 3EY5A 1YVOA 2F5IA 4A2ZA 1Z4RA 1QSOA 1QSRA 2VXKA 2BUEA 2HQYA 4U9YA 1YGHA 4KOVA 2CY2A 1S7NA 4FD6A 3EC4A 1IB1E 3NE7A 4UBRA 3RYOA 5IV0A 1J4JA 2PC1A 3TO9A 3FYNA 3ZJ0A 4HNWB 2JEVA 3F8KA 4B11A 3D2PA 3I9SA 2R8VA 3S6HA 5EBVA 3IU1A 1LRZA 5AG6A 3A9LA 3D2MA 5J8CA 1PU9A 3FRMA 4KOWA 5HH1A 2AE6A 5IX3A 4PK2A 1KZFA 1N71A 2Q04A 2RC4A 5G21A 2P6EA 1BOBA 2Z10A 2Z11A 3H5ZA 4C2XA 3QB8A 1YLEA 2PDOA 2QMLA 4E2AA 1L0CA 1KUXA 2Z3MA 4OAEA 4MFZA 2REFA 3CXPA 3GY9A 1QSNA 2GIVA 1BO4A 2C27A 4C7IA 3BJ8A 1Y7RA 4B5PA 1I21A 2GE3A 4A31A 2DXQA 4YGOA 2PSWA 3PGPA 4JLYA 2K5TA 4RS2A 2B58A 4NXYA 4MFKA 3W6SA 4UCMA 2FE7A 2J8NA 4JXRA 4B12A 3BLNA 1CM0A 2P6GA 4C2ZA 1NSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV2 A;  3E0K A;  4H89 A;  2JLM A;  4L89 A;  4FD5 A;  4MHD A;  1XMT A;  3R9F A;  4KVO E;  4HKF A;  2EUI A;  2J8R A;  4YRH A;  3S6F A;  2B3V A;  1QST A;  4KUB A;  4DNC A;  2HUZ A;  3DR8 A;  3CXQ A;  5IB0 A;  1FY7 A;  3D3S A;  4AVB A;  2FIA A;  4AB7 A;  1MJA A;  2OB0 A;  2Q44 A;  2FSR A;  4KLW A;  1P0H A;  4JXQ A;  4ONU A;  3TOA A;  5C82 A;  3DDD A;  2FXF A;  4R9M A;  2OZH A;  2R1I A;  5F48 A;  4LX9 A;  2O28 A;  3GYA A;  3DSB A;  2JDD A;  3C26 A;  1M4I A;  3GKR A;  2ZPA A;  1S7F A;  3N7Z A;  3TCV A;  2R7H A;  2KCW A;  4JJX A;  4BMH A;  2J8M A;  4AG7 A;  3K9U A;  3FIX A;  3FB3 A;  2VQY A;  4QVT A;  1YX0 A;  3F0A A;  5J8F A;  2WPW A;  2PRB A;  2OZU A;  1Q2D A;  4U5Y A;  3CXS A;  1M4D A;  1VHS A;  2X7B A;  4I49 A;  3T9Y A;  4KOU A;  2G3T A;  4LUA A;  4NSQ A;  5CNP A;  2Z0Z A;  4F6A A;  4II9 A;  2H5M A;  3QAH A;  4AVC A;  2G3A A;  3PP9 A;  4PSX A;  3UY5 A;  5GCN A;  4PV6 A;  4XNH B;  2ZW5 A;  1S3Z A;  4CRY B;  4MBU A;  2OH1 A;  1OZP A;  1YVK A;  2CNM A;  5JPH A;  4OLL A;  4UWI A;  2GAN A;  2BL1 A;  2VEZ A;  3TT2 A;  5KTC A;  4OAD A;  3I3G A;  5EC4 A;  4E8O A;  3LD2 A;  5F46 A;  5KTA A;  3MGD A;  4UWJ A;  2WPX A;  4KOX A;  3P2F A;  5JQ4 A;  2ZW7 A;  2I79 A;  4ZBG A;  3R9E A;  3BJ7 A;  3OWC A;  4E0A A;  1V0C A;  4F0Y A;  1S60 A;  2CNS A;  2D4P A;  1I1D A;  4B5P B;  2OZG A;  2VZY A;  1I12 A;  4MJ8 A;  1S5K A;  3TFY A;  4M3S A;  4R3L A;  2FL4 A;  3VWE A;  2VBQ A;  1WK4 A;  5F49 A;  1Z4E A;  5FVJ A;  4NCZ A;  4L8A A;  4HNY B;  4J3G A;  2P6F A;  2D4O A;  1KUV A;  4MY0 A;  2P0W A;  5DWM A;  1PUA A;  5ISV A;  1TIQ A;  4XPK A;  4KOS A;  3W6X A;  4H6Z A;  1WWZ A;  1K4J A;  1MJ9 A;  4K30 A;  4R3K A;  4M85 A;  4IF5 A;  1B6B A;  2QIR A;  1VKC A;  2BEI A;  2B5G A;  2A4N A;  3WR7 A;  1Z9U A;  4MY3 A;  4CAX A;  4R57 A;  3G8W A;  1IYK A;  3KKW A;  3H4Q A;  4R87 A;  2IL4 A;  2BSW A;  4H6U A;  2OU2 A;  4Y49 B;  1IYL A;  1Y9W A;  2ARH A;  2Y0M A;  4AVA A;  3SHP A;  4Y49 C;  4KVM E;  1M1D A;  1S7K A;  4KOR A;  4JWP A;  4FD7 A;  3R1K A;  3SXO A;  3EXN A;  4ORF A;  5DWN A;  4QC6 A;  3PZJ A;  1S7L A;  2R98 A;  1KUY A;  3ZZI A;  3LOD A;  4CS0 B;  1CJW A;  4QUS A;  1XF8 A;  4XPL A;  2B4B A;  2FS5 A;  2NMT A;  1YK3 A;  1R57 A;  2G0B A;  4NEX A;  3T90 A;  4PK3 A;  3IWG A;  2QEC A;  1XIX A;  4XPD C;  1MK4 A;  3P2H A;  2FT0 A;  1YR0 A;  4MI4 A;  4B5O A;  3FNC A;  3EFA A;  4FD4 A;  1Q2Y A;  2PR1 A;  1M44 A;  2JDC A;  2B4D A;  1Q2C A;  4IUS A;  4U9Z A;  2B5G B;  3IGR A;  4YFJ A;  3FBU A;  3TO6 A;  3TO7 A;  1ON0 A;  4KOY A;  3DR6 A;  5I0C A;  1B87 A;  3W91 A;  2ZXV A;  3VWD A;  4QBJ A;  2B3U A;  1NE9 A;  5H86 A;  4KOT A;  4KUA A;  3F5B A;  4QB9 A;  3G3S A;  2Q4V A;  3EO4 A;  4GS4 A;  4KVX A;  1Y9K A;  2Q7B A;  3TOB A;  3FXT A;  1UFH A;  1SQH A;  4KZT A;  1P4N A;  5H84 A;  4RI1 A;  2Q4Y A;  4AG9 A;  2B4D B;  1QSM A;  4NF1 A;  2ZW4 A;  4XPD B;  3R95 A;  4XNH C;  5KTD A;  3R9G A;  5F47 A;  1U6M A;  2REE A;  3DNS A;  1NMT A;  3D8P A;  2VI7 A;  2PQ8 A;  4PSW A;  4X5K A;  1GHE A;  5HMN A;  1RXT A;  4CAW A;  1IID A;  3S6G A;  1IIC A;  3S6K A;  2CNT A;  3R96 A;  4KLV A;  2AJ6 A;  2I00 A;  1RO5 A;  1XE4 A;  3JUW A;  5C88 A;  1M4G A;  2PR8 A;  1XEB A;  3TE4 A;  3B8G A;  3V8I A;  1MJB A;  4CAV A;  3TTH A;  2VZZ A;  4CRZ B;  3JVN A;  4EVY A;  2FIW A;  2ZW6 A;  4JD6 A;  4UA3 A;  4HNX B;  1YRE A;  3SXN A;  5E96 A;  2EVN A;  2Q0Y A;  2ATR A;  2FCK A;  3EY5 A;  1YVO A;  2F5I A;  1Z4R A;  1QSO A;  1QSR A;  2VXK A;  2BUE A;  2HQY A;  4U9Y A;  1YGH A;  4KOV A;  2CY2 A;  1S7N A;  4FD6 A;  3EC4 A;  1IB1 E;  3NE7 A;  4UBR A;  3RYO A;  5IV0 A;  1J4J A;  2PC1 A;  3TO9 A;  3FYN A;  3ZJ0 A;  4HNW B;  2JEV A;  3F8K A;  3D2P A;  3I9S A;  2R8V A;  3S6H A;  5EBV A;  1LRZ A;  5J8C A;  3D2M A;  1PU9 A;  3FRM A;  4KOW A;  5HH1 A;  2AE6 A;  5IX3 A;  4PK2 A;  1KZF A;  1N71 A;  2Q04 A;  2RC4 A;  2P6E A;  1BOB A;  2Z10 A;  2Z11 A;  3QB8 A;  1YLE A;  2PDO A;  2QML A;  4E2A A;  1L0C A;  1KUX A;  4OAE A;  2REF A;  3CXP A;  1QSN A;  3GY9 A;  2GIV A;  1BO4 A;  2C27 A;  3BJ8 A;  1Y7R A;  4B5P A;  1I21 A;  2GE3 A;  2DXQ A;  4YGO A;  2PSW A;  3PGP A;  4JLY A;  2K5T A;  4RS2 A;  2B58 A;  4NXY A;  3W6S A;  2FE7 A;  2J8N A;  4JXR A;  3BLN A;  1CM0 A;  2P6G A;  1NSL A; 
#chains in the Genus database with same CATH topology
 2HV2 A;  3CPX A;  3E0K A;  4H89 A;  2JLM A;  4L89 A;  3CZX A;  4DJL A;  4P4F A;  4FD5 A;  2CIJ A;  4MHD A;  1XMT A;  3R9F A;  4KVO E;  4NGQ A;  1YQE A;  3NH8 A;  3IWW A;  4HKF A;  2PE3 A;  2EUI A;  2J8R A;  2C1C A;  3BI0 A;  4YRH A;  3S6F A;  2B3V A;  4KSA A;  1QST A;  3PBE A;  7CPA A;  4TNU A;  4R6T A;  4MHP A;  4KUB A;  4DNC A;  4Q36 A;  3BXM A;  2HUZ A;  3DR8 A;  3KHX A;  1BPN A;  3WC7 A;  3CXQ A;  5LYF A;  5K8M A;  1BPM A;  1IY7 A;  3CDX A;  5IB0 A;  4C2Y A;  1FY7 A;  3D3S A;  4CGP A;  3H8F A;  4AVB A;  4OID A;  2FIA A;  4AB7 A;  4BIN A;  4M6H A;  3GUX A;  3D68 A;  3LAC A;  2ZEE A;  3T8W A;  1MJA A;  2OB0 A;  4UEZ A;  2Q44 A;  2FSR A;  4KLW A;  5D29 A;  1P0H A;  4JXQ A;  4ONU A;  3TOA A;  1TF8 A;  4ZGY B;  5C82 A;  5K8P A;  3DDD A;  3D67 A;  2FXF A;  2Z3K A;  3N5F A;  3NFZ A;  4R9M A;  4X8I A;  2OZH A;  2R1I A;  5F48 A;  1RTQ A;  4M6I A;  4P6Y A;  1IOI A;  4LX9 A;  2RFH A;  3KQZ A;  1QQ9 A;  4MCR A;  4MHY A;  5AG4 A;  2O28 A;  3B35 A;  4B13 A;  3MN8 A;  2GLF A;  5J1Q A;  2RB7 A;  2YNE A;  3DSB A;  3GYA A;  2EWB A;  1ZO0 A;  2JDD A;  3C26 A;  1M4I A;  3PBB A;  4FUU A;  4WJB A;  3GKR A;  2JEW A;  2J9A A;  2O4H A;  2ZPA A;  3IU2 A;  1S7F A;  3KZW A;  1ZLH A;  4MCS A;  1EE3 P;  3N7Z A;  1PYT B;  5EMI A;  1QMU A;  2R7H A;  3TCV A;  2KCW A;  2PIZ A;  5HVG A;  4JJX A;  2Z3N A;  4BMH A;  4NFR A;  2J8M A;  4UF4 A;  2XEJ A;  3K9U A;  3FIX A;  4AG7 A;  5JH9 A;  3FB3 A;  4PXD A;  2VQY A;  4QVT A;  2IJZ A;  1Z8X A;  1BLL E;  4CYQ A;  4M6G A;  1YX0 A;  3F0A A;  3PB9 X;  2YND A;  5I4M A;  2WPW A;  2PRB A;  5J8F A;  1H8L A;  2OZU A;  3D7D A;  3SI2 A;  1Q2D A;  4U5Y A;  2EK8 A;  2F8H A;  3CXS A;  4OC5 A;  1M4D A;  1VHS A;  2X7B A;  4BBH A;  1TKJ A;  3SJX A;  4I49 A;  3T9Y A;  1HEE A;  4KOU A;  2G3T A;  4LUA A;  2ZEL A;  4NSQ A;  3RO0 A;  2PJ5 A;  3IEH A;  4MHZ A;  5CNP A;  2Z0Z A;  4F6A A;  5JGF A;  4II9 A;  2ABZ A;  2XEI A;  2WZN A;  2H5M A;  1DTD A;  3QAH A;  2JBK A;  4UCP A;  3SI1 A;  4OKO A;  4PXC A;  3TX8 A;  4AVC A;  2G3A A;  3PP9 A;  1XOV A;  4PSX A;  3S9L A;  3UY5 A;  5GCN A;  4PPZ A;  2ZEP A;  4PV6 A;  3H8G A;  4FAI A;  3B3W A;  4X2T A;  1ELM P;  4XNH B;  3D7H A;  3S9N A;  3KHZ A;  1ELL P;  2ZW5 A;  4UIB A;  1S3Z A;  1XRY A;  4C7H A;  4CRY B;  1XFO A;  2ZEG A;  4MBU A;  2OH1 A;  1CPX A;  1OZP A;  1YVK A;  2POK A;  2CNM A;  2V77 A;  5JPH A;  4OLL A;  4UWI A;  2GAN A;  4LQG A;  3VH9 A;  2BL1 A;  1Z8T A;  2VEZ A;  3BHX A;  2DF5 A;  3JTK A;  2BCO A;  1ZG7 A;  3TT2 A;  5KTC A;  2DEA A;  5AGE A;  4UFX A;  3IC1 A;  4UIA A;  3PB6 X;  4OAD A;  3I3G A;  1VGY A;  5EC4 A;  4E8O A;  3LD2 A;  4ZX8 A;  5F46 A;  2Q51 A;  3PB7 X;  4OME A;  5KTA A;  2ODF A;  3MGD A;  4UWJ A;  5F09 A;  2WPX A;  4KOX A;  3RAM A;  2ZEH A;  1CP6 A;  5A27 A;  1YME A;  4UCN A;  3P2F A;  4A95 A;  5JQ4 A;  4B14 A;  2ZW7 A;  2I79 A;  4ZBG A;  3R9E A;  5LRK A;  3BJ7 A;  3OWC A;  4E0A A;  1V0C A;  4MFP A;  4GM5 A;  1Z5R A;  4F0Y A;  1S60 A;  2CNS A;  2D4P A;  3FF3 A;  3IIB A;  1I1D A;  3KGQ A;  3ISX A;  2WUU A;  2CF4 A;  4B5P B;  2PJ3 A;  2XEF A;  4NGN A;  4EFD A;  3RNZ A;  2OZG A;  2YNC A;  2C6P A;  2VL1 A;  2VZY A;  3H8E A;  4ZY0 A;  4ONW A;  5LRG A;  4EWT A;  2DPT A;  4ZYQ A;  3K2K A;  1I12 A;  1TKF A;  4MJ8 A;  1S5K A;  3TFY A;  4M3S A;  1IOF A;  1A2Z A;  4R3L A;  4CGN A;  2FL4 A;  4NGP A;  4ZY2 A;  5LRJ A;  2YGW A;  3KAS A;  3VWE A;  2EO8 A;  2VBQ A;  1GYT A;  1WK4 A;  4A94 A;  5F49 A;  1Z4E A;  3PFE A;  4NCZ A;  5FVJ A;  1Z8W A;  4A39 A;  4P10 A;  4NGS A;  1OBR A;  4PXB A;  4CGM A;  4MFJ A;  4DUK A;  5BWA B;  5HXD A;  3NA6 A;  4LQ6 A;  3FX6 A;  5K8O A;  3MRU A;  4KS9 A;  4L8A A;  4DYO A;  4HNY B;  4J3G A;  3IJ3 A;  5A28 A;  2P6F A;  2D4O A;  1KUV A;  1FT7 A;  4MY0 A;  2O53 A;  2P0W A;  5DWM A;  1PUA A;  4CGO A;  2PJ1 A;  5ISV A;  5CPA A;  1TIQ A;  4H2K A;  2Q4Z A;  3PEI A;  4Q38 A;  1XMB A;  4KOS A;  4XPK A;  2NSM A;  3BI1 A;  3SJE A;  3W6X A;  4MFL A;  2QYV A;  4MCQ A;  4H6Z A;  3WAB A;  1WWZ A;  2PJ4 A;  1K4J A;  4IK2 A;  1MJ9 A;  4UEF A;  4K30 A;  5DS0 A;  3FH4 A;  5G20 A;  4R3K A;  4M85 A;  1B6B A;  4IF5 A;  2QIR A;  3HLP A;  1VKC A;  2BEI A;  2B5G A;  2A4N A;  3WR7 A;  3D4U A;  1Z9U A;  4MY3 A;  4CAX A;  3FEC A;  4R57 A;  3SJG A;  1CP7 A;  5HVH A;  3KI9 A;  4NGR A;  2HB6 A;  4YWY A;  3G8W A;  4OC2 A;  3B2Y A;  2G9D A;  4WWV A;  1IYK A;  3KKW A;  2PIY A;  3H4Q A;  4R87 A;  4CPA A;  1Q7L A;  2IL4 A;  2BSW A;  4H6U A;  4OC0 A;  4AXV A;  2OU2 A;  3VAT A;  3V7Z A;  1FNO A;  1VIX A;  4Y49 B;  4B10 A;  5JM6 A;  1IYL A;  4NJQ A;  2AFO A;  4CYN A;  1Y9W A;  1F2O A;  1KWM A;  2ARH A;  2ZOF A;  4MMO A;  4P4I A;  2Y0M A;  3LWU A;  4MXU A;  2ZEN A;  4AVA A;  3GLJ A;  1CPS A;  3SHP A;  4Y49 C;  2AFM A;  4KVM E;  2PVV A;  1M1D A;  5LYI A;  2Z3P A;  1S7K A;  3V38 A;  1Y0R A;  4KOR A;  5D8N A;  1LCP A;  1R3N A;  3D7G A;  3KQX A;  4FD7 A;  4JWP A;  3R1K A;  4NGM A;  3EXN A;  2I3C A;  4ORF A;  3SXO A;  1JQG A;  4A37 A;  5DWN A;  4OIW A;  4QC6 A;  3PZJ A;  2OR4 A;  1X12 A;  1S7L A;  2R98 A;  1KUY A;  3ZZI A;  3LOD A;  4CS0 B;  1CJW A;  4QUS A;  6CPA A;  2V8V A;  1XF8 A;  4XPL A;  4P4E A;  2ZED A;  2AFU A;  4CAE A;  1TXR A;  1XBU A;  2B4B A;  2WYR A;  2FS5 A;  4MCP A;  2NMT A;  1YK3 A;  1R57 A;  2G0B A;  4G1P A;  4NEX A;  3T90 A;  4CYP A;  4HPS A;  4PK3 A;  1BAV A;  3IWG A;  1ZLI A;  2QEC A;  2V8G A;  1F57 A;  1XIX A;  3RBU A;  4XPD C;  3DGV A;  1MK4 A;  3P2H A;  2FT0 A;  4OC1 A;  1YR0 A;  3JRU A;  4KSF A;  2GU2 A;  4MI4 A;  2PJ8 A;  4B5O A;  3FVL A;  2BOA A;  3TC8 A;  4ZY1 A;  3B3S A;  3EFA A;  3FNC A;  4FD4 A;  1Q2Y A;  2PR1 A;  1R43 A;  1M44 A;  2PJ6 A;  3IWE A;  3L2N A;  1LOK A;  5CBM A;  2JDC A;  2B4D A;  2YNC C;  1Q2C A;  5THW A;  4IUS A;  4P4B A;  4U9Z A;  3IFE A;  2B5G B;  3CPA A;  1X10 A;  4A38 A;  3IGR A;  4YFJ A;  4A32 A;  4CYO A;  4CAF A;  3FBU A;  3TO6 A;  3TO7 A;  1AUG A;  1ON0 A;  3NH4 A;  4KOY A;  4P4J A;  3DR6 A;  5I0C A;  1B87 A;  2FVG A;  3W91 A;  4UEE A;  2ZXV A;  3VWD A;  4QBJ A;  2B3U A;  4OC3 A;  1NE9 A;  1Z8L A;  1TKH A;  1M4L A;  5H86 A;  4KOT A;  2PJ7 A;  4KUA A;  4BD9 A;  3PRT A;  2GLJ A;  4F0X A;  2PJB A;  3VAR A;  3F5B A;  4QB9 A;  3G3S A;  4EME A;  2Q4V A;  3EO4 A;  4GS4 A;  4KVX A;  1Y9K A;  3NH5 A;  2Q7B A;  3TOB A;  1VHE A;  3FXT A;  3WT4 A;  1UFH A;  3K9T A;  5K8N A;  3LMS A;  1YLO A;  1SQH A;  4TWE A;  3SJF A;  1XJO A;  1P4N A;  4KZT A;  4OC4 A;  5H84 A;  2CXA A;  1ZG9 A;  4RI1 A;  3KR4 A;  2JBJ A;  2QVP A;  3GB0 A;  4C68 A;  2Q4Y A;  2QJ8 A;  4MRI A;  4AG9 A;  2B4D B;  1QSM A;  2WSA A;  2ZW4 A;  4NF1 A;  4MFQ A;  2GFQ A;  2CTC A;  1YSJ A;  4XPD B;  5LYD A;  1ARM A;  4XNH C;  3R95 A;  4CGL A;  5KTD A;  1VHO A;  4KSI A;  2PJ0 A;  3HUV A;  3R9G A;  4A33 A;  5F47 A;  4NGT A;  1U6M A;  2REE A;  3DNS A;  1NMT A;  3D8P A;  2VI7 A;  2PQ8 A;  4PSW A;  4X5K A;  2CTB A;  2Z3L A;  3SI0 A;  4NJR A;  4R7M A;  1GHE A;  2DPS A;  5HMN A;  4O23 A;  1RXT A;  4CAW A;  1IID A;  2Q7S A;  1IIC A;  2ANP A;  3S6G A;  4ZI6 A;  5G1Z A;  3S6K A;  2CNT A;  3R96 A;  3PB4 X;  4KLV A;  2AJ6 A;  1TF9 A;  2I00 A;  1RO5 A;  3KL9 A;  1XE4 A;  2Z3O A;  3JUW A;  5C88 A;  4F9V A;  1M4G A;  2PRQ A;  2PR8 A;  4UFV A;  1XEB A;  3TE4 A;  1UWY A;  2ZOG A;  1LFW A;  4Q7A A;  3B8G A;  1YW6 A;  3V8I A;  1MJB A;  4CAV A;  3FJU A;  3TTH A;  2VZZ A;  4CRZ B;  4RUH A;  3D7F A;  3JVN A;  5AG5 A;  2PJA A;  4EVY A;  2FIW A;  2ZEM A;  3QAY A;  4OP4 A;  4IAV A;  2ZW6 A;  4JD6 A;  2AFW A;  4UA3 A;  4HNX B;  4P44 A;  5G22 A;  1YRE A;  5AG7 A;  4FWU A;  3SXN A;  5E96 A;  1IGB A;  2EVN A;  4UFW A;  2Q0Y A;  4YU9 A;  3B7I A;  4A30 A;  2PJ9 A;  3NE8 A;  2ATR A;  3FMC A;  2FCK A;  2F7V A;  3EY5 A;  4W9Y A;  3S9M A;  1YVO A;  2F5I A;  4A2Z A;  3WC6 A;  1Z4R A;  1QSO A;  3B3T A;  1QSR A;  2VXK A;  2EBJ A;  2BUE A;  4K3N A;  1LAP A;  2HQY A;  5ELY A;  4U9Y A;  1YGH A;  4KOV A;  2AFZ A;  2AFX A;  2CY2 A;  1S7N A;  4FD6 A;  3EC4 A;  3I1U A;  4JYW A;  1IB1 E;  3NE7 A;  3GIU A;  4UBR A;  3RYO A;  5IV0 A;  1J4J A;  2PC1 A;  2PJ2 A;  4F9U A;  3TO9 A;  1HDQ A;  3FYN A;  3ZJ0 A;  5HVF A;  4HNW B;  2JEV A;  3F8K A;  1AYE A;  1F2P A;  4B11 A;  2ZEF A;  1NSA A;  2IMO A;  3D2P A;  3I9S A;  4P45 A;  4P4D A;  2V8H A;  2PCU A;  2R8V A;  3S6H A;  3PFO A;  2OOT A;  4MHN A;  5EBV A;  5IB9 A;  1CG2 A;  1CBX A;  1LAN A;  1LRZ A;  2EK9 A;  3FED A;  3IU1 A;  3A9L A;  3D2M A;  5AG6 A;  1PU9 A;  3FRM A;  4KOW A;  5HH1 A;  2AE6 A;  5IX3 A;  5J8C A;  4PK2 A;  1KZF A;  1LAM A;  1N71 A;  2Q04 A;  2GRE A;  3WC5 A;  8CPA A;  3B3V A;  2RC4 A;  1Z2L A;  1IU8 A;  1DE4 C;  3PB8 X;  2XEG A;  4PXE A;  5G21 A;  2P6E A;  1BOB A;  2Z10 A;  3CT9 A;  4X3R A;  2Z11 A;  4F8Z A;  3H5Z A;  4C2X A;  3QB8 A;  1YLE A;  2PDO A;  3B3C A;  2QML A;  4E2A A;  3ISZ A;  1L0C A;  4PQA A;  2C6G A;  1KUX A;  1PCA A;  1ARL A;  2Z3M A;  3DLJ A;  3FEE A;  4OAE A;  4ZX9 A;  4MFZ A;  4RN7 A;  2REF A;  3CXP A;  1QSN A;  2BO9 A;  2NYQ A;  3GY9 A;  2GIV A;  4FBE A;  1BO4 A;  2C27 A;  2Q43 A;  3D66 A;  4C7I A;  3BJ8 A;  1Y7R A;  1YW4 A;  2V8D A;  1CX8 A;  2HC9 A;  4JZ0 A;  4B6Z A;  4Z65 A;  4B5P A;  4GXH A;  2AFS A;  1I21 A;  5LYL A;  2GE3 A;  3QNV A;  4A31 A;  2DXQ A;  2C6C A;  4YGO A;  2PSW A;  4R8F A;  3PGP A;  2IQ6 A;  4JLY A;  4IHM A;  2K5T A;  4RS2 A;  2B58 A;  3IO1 A;  4NXY A;  3KR5 A;  1ZG8 A;  2ZEO A;  1HDU A;  4MFK A;  3W6S A;  2PJC A;  4UCM A;  1AMP A;  2FE7 A;  1JWQ A;  2J8N A;  3RZA A;  2PVW A;  4JXR A;  4B12 A;  4R76 A;  3BLN A;  1CM0 A;  1Y0Y A;  2P6G A;  4C2Z A;  1Y7E A;  1NSL A; 
#chains in the Genus database with same CATH homology
 2HV2 A;  3E0K A;  4H89 A;  2JLM A;  4L89 A;  4FD5 A;  4MHD A;  1XMT A;  3R9F A;  4KVO E;  4HKF A;  2EUI A;  2J8R A;  4YRH A;  3S6F A;  2B3V A;  4KSA A;  1QST A;  4KUB A;  4DNC A;  4Q36 A;  2HUZ A;  3DR8 A;  3CXQ A;  5IB0 A;  4C2Y A;  1FY7 A;  3D3S A;  4CGP A;  4AVB A;  2FIA A;  4AB7 A;  1MJA A;  2OB0 A;  2Q44 A;  2FSR A;  4KLW A;  1P0H A;  4JXQ A;  4ONU A;  3TOA A;  4ZGY B;  5C82 A;  3DDD A;  2FXF A;  2Z3K A;  4R9M A;  2OZH A;  2R1I A;  5F48 A;  4LX9 A;  5AG4 A;  2O28 A;  4B13 A;  3GYA A;  2YNE A;  3DSB A;  1ZO0 A;  2JDD A;  3C26 A;  1M4I A;  3GKR A;  2ZPA A;  3IU2 A;  1S7F A;  3N7Z A;  3TCV A;  2R7H A;  2KCW A;  4JJX A;  2Z3N A;  4BMH A;  2J8M A;  4AG7 A;  3K9U A;  3FIX A;  3FB3 A;  2VQY A;  4QVT A;  4CYQ A;  1YX0 A;  3F0A A;  5J8F A;  2YND A;  2WPW A;  2PRB A;  2OZU A;  1Q2D A;  4U5Y A;  3CXS A;  1M4D A;  1VHS A;  2X7B A;  4BBH A;  4I49 A;  3T9Y A;  4KOU A;  2G3T A;  4LUA A;  4NSQ A;  5CNP A;  2Z0Z A;  4F6A A;  4II9 A;  2H5M A;  3QAH A;  4UCP A;  4AVC A;  2G3A A;  3PP9 A;  4PSX A;  3UY5 A;  5GCN A;  4PV6 A;  4XNH B;  2ZW5 A;  1S3Z A;  4CRY B;  4C7H A;  4MBU A;  2OH1 A;  1OZP A;  1YVK A;  2CNM A;  5JPH A;  4OLL A;  4UWI A;  2GAN A;  2BL1 A;  2VEZ A;  3JTK A;  3TT2 A;  5KTC A;  5AGE A;  4UFX A;  4OAD A;  3I3G A;  5EC4 A;  4E8O A;  3LD2 A;  5F46 A;  5KTA A;  3MGD A;  4UWJ A;  2WPX A;  4KOX A;  5A27 A;  4UCN A;  3P2F A;  4A95 A;  5JQ4 A;  4B14 A;  2ZW7 A;  2I79 A;  4ZBG A;  3R9E A;  3BJ7 A;  3OWC A;  4E0A A;  1V0C A;  4MFP A;  4F0Y A;  1S60 A;  2CNS A;  2D4P A;  1I1D A;  2WUU A;  4B5P B;  2OZG A;  2YNC A;  2VZY A;  2DPT A;  1I12 A;  4MJ8 A;  1S5K A;  3TFY A;  4M3S A;  4R3L A;  4CGN A;  2FL4 A;  2YGW A;  3VWE A;  2VBQ A;  1WK4 A;  5F49 A;  1Z4E A;  5FVJ A;  4NCZ A;  5BWA B;  4CGM A;  4MFJ A;  4KS9 A;  4L8A A;  4HNY B;  4J3G A;  5A28 A;  2P6F A;  2D4O A;  1KUV A;  4MY0 A;  2P0W A;  5DWM A;  1PUA A;  4CGO A;  5ISV A;  1TIQ A;  4Q38 A;  4XPK A;  4KOS A;  3W6X A;  4MFL A;  4H6Z A;  1WWZ A;  1K4J A;  1MJ9 A;  5G20 A;  4K30 A;  4R3K A;  4M85 A;  4IF5 A;  1B6B A;  2QIR A;  1VKC A;  2BEI A;  2B5G A;  2A4N A;  3WR7 A;  1Z9U A;  4MY3 A;  4CAX A;  4R57 A;  3G8W A;  1IYK A;  3KKW A;  3H4Q A;  4R87 A;  2IL4 A;  2BSW A;  4H6U A;  2OU2 A;  4Y49 B;  4B10 A;  1IYL A;  4CYN A;  1Y9W A;  2ARH A;  2Y0M A;  4AVA A;  3SHP A;  4Y49 C;  4KVM E;  1M1D A;  2Z3P A;  1S7K A;  4KOR A;  4JWP A;  4FD7 A;  3R1K A;  3SXO A;  3EXN A;  4ORF A;  5DWN A;  4QC6 A;  3PZJ A;  1S7L A;  2R98 A;  1KUY A;  3ZZI A;  3LOD A;  4CS0 B;  1CJW A;  4QUS A;  1XF8 A;  4XPL A;  4CAE A;  2B4B A;  2FS5 A;  2NMT A;  1YK3 A;  1R57 A;  2G0B A;  4NEX A;  3T90 A;  4CYP A;  4PK3 A;  3IWG A;  2QEC A;  1XIX A;  4XPD C;  1MK4 A;  3P2H A;  2FT0 A;  1YR0 A;  4KSF A;  4MI4 A;  4B5O A;  3FNC A;  3EFA A;  4FD4 A;  1Q2Y A;  2PR1 A;  1M44 A;  3IWE A;  2JDC A;  2B4D A;  2YNC C;  1Q2C A;  4IUS A;  4U9Z A;  2B5G B;  3IGR A;  4YFJ A;  4A32 A;  4CYO A;  4CAF A;  3FBU A;  3TO6 A;  3TO7 A;  1ON0 A;  4KOY A;  3DR6 A;  5I0C A;  1B87 A;  3W91 A;  2ZXV A;  3VWD A;  4QBJ A;  2B3U A;  1NE9 A;  5H86 A;  4KOT A;  4KUA A;  4F0X A;  3F5B A;  4QB9 A;  3G3S A;  2Q4V A;  3EO4 A;  4GS4 A;  4KVX A;  1Y9K A;  2Q7B A;  3TOB A;  3FXT A;  1UFH A;  1SQH A;  4KZT A;  1P4N A;  5H84 A;  2CXA A;  4RI1 A;  4C68 A;  2Q4Y A;  4AG9 A;  2B4D B;  1QSM A;  2WSA A;  2ZW4 A;  4NF1 A;  4MFQ A;  4XPD B;  3R95 A;  4XNH C;  4CGL A;  5KTD A;  3R9G A;  4A33 A;  5F47 A;  1U6M A;  2REE A;  3DNS A;  1NMT A;  3D8P A;  2VI7 A;  2PQ8 A;  4PSW A;  4X5K A;  2Z3L A;  1GHE A;  2DPS A;  5HMN A;  1RXT A;  4CAW A;  1IID A;  3S6G A;  1IIC A;  5G1Z A;  3S6K A;  2CNT A;  3R96 A;  4KLV A;  2AJ6 A;  2I00 A;  1RO5 A;  1XE4 A;  2Z3O A;  3JUW A;  5C88 A;  1M4G A;  2PR8 A;  4UFV A;  1XEB A;  3TE4 A;  3B8G A;  3V8I A;  1MJB A;  4CAV A;  3TTH A;  2VZZ A;  4CRZ B;  3JVN A;  5AG5 A;  4EVY A;  2FIW A;  2ZW6 A;  4JD6 A;  4UA3 A;  4HNX B;  5G22 A;  1YRE A;  5AG7 A;  3SXN A;  5E96 A;  2EVN A;  4UFW A;  2Q0Y A;  4A30 A;  2ATR A;  2FCK A;  3EY5 A;  1YVO A;  2F5I A;  4A2Z A;  1Z4R A;  1QSO A;  1QSR A;  2VXK A;  2BUE A;  2HQY A;  4U9Y A;  1YGH A;  4KOV A;  2CY2 A;  1S7N A;  4FD6 A;  3EC4 A;  1IB1 E;  3NE7 A;  4UBR A;  3RYO A;  5IV0 A;  1J4J A;  2PC1 A;  3TO9 A;  3FYN A;  3ZJ0 A;  4HNW B;  2JEV A;  3F8K A;  4B11 A;  3D2P A;  3I9S A;  2R8V A;  3S6H A;  5EBV A;  3IU1 A;  1LRZ A;  5AG6 A;  3A9L A;  3D2M A;  5J8C A;  1PU9 A;  3FRM A;  4KOW A;  5HH1 A;  2AE6 A;  5IX3 A;  4PK2 A;  1KZF A;  1N71 A;  2Q04 A;  2RC4 A;  5G21 A;  2P6E A;  1BOB A;  2Z10 A;  2Z11 A;  3H5Z A;  4C2X A;  3QB8 A;  1YLE A;  2PDO A;  2QML A;  4E2A A;  1L0C A;  1KUX A;  2Z3M A;  4OAE A;  4MFZ A;  2REF A;  3CXP A;  3GY9 A;  1QSN A;  2GIV A;  1BO4 A;  2C27 A;  4C7I A;  3BJ8 A;  1Y7R A;  4B5P A;  1I21 A;  2GE3 A;  4A31 A;  2DXQ A;  4YGO A;  2PSW A;  3PGP A;  4JLY A;  2K5T A;  4RS2 A;  2B58 A;  4NXY A;  4MFK A;  3W6S A;  4UCM A;  2FE7 A;  2J8N A;  4JXR A;  4B12 A;  3BLN A;  1CM0 A;  2P6G A;  4C2Z A;  1NSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...