4KOYA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cephalosporin c
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4koyA00
4KVME 1KUVA 4M3SA 3TOBA 5KTAA 5EBVA 3FRMA 3EC4A 2VBQA 2ZXVA 1IYLA 1XEBA 5F49A 4F0YA 2J8RA 1U6MA 2R98A 4DNCA 1XF8A 1NE9A 4Y49B 1VHSA 4AVCA 1IIDA 2B3UA 4XNHB 4I49A 4RS2A 3W6XA 4ORFA 1P4NA 2QMLA 2CNSA 4R87A 2JEVA 1R57A 3R1KA 4CRZB 3TT2A 4NCZA 4R3LA 2OB0A 2ZW6A 3BLNA 2D4PA 5FVJA 1S3ZA 3T90A 2Y0MA 2VZYA 1MJBA 3R9FA 5JQ4A 3EY5A 1S7NA 2B4DA 3DR8A 4XPDB 4H6ZA 2Q4YA 3FNCA 4PSWA 4NXYA 4ONUA 4JXRA 3KKWA 2B58A 2CNTA 1BOBA 3TO7A 1GHEA 1YR0A 2G3TA 2ZW4A 1QSMA 1WK4A 2P0WA 4E0AA 1QSOA 2G0BA 3SXNA 1ON0A 1XIXA 4HNYB 4CAWA 2J8NA 2GIVA 3D2MA 1L0CA 1M44A 5F47A 3DNSA 4PK3A 5C88A 1YLEA 2A4NA 1Y9WA 2Q7BA 3D8PA 5IX3A 3TO9A 1S7LA 3D3SA 1YREA 2KCWA 3P2FA 4X5KA 3H4QA 3S6GA 4KOSA 1XMTA 1BO4A 2BUEA 1M4DA 2ARHA 2PC1A 2VQYA 4NF1A 4U9YA 2ZPAA 4QB9A 3CXSA 2VXKA 3CXPA 4U5YA 1M1DA 2P6EA 4F6AA 5H86A 3TCVA 4UA3A 4NEXA 4OAEA 1YX0A 4KOWA 2ZW7A 4OLLA 1QSTA 4HNXB 4B5OA 2GANA 2PR1A 2PQ8A 3PGPA 4QBJA 3SHPA 4R3KA 4JWPA 3S6KA 2O28A 4KUBA 3SXOA 4HNWB 5DWMA 1Q2YA 1MJ9A 1YGHA 5KTCA 1XE4A 4BMHA 1B6BA 3IWGA 1RO5A 1CJWA 1Z4RA 3GY9A 4HKFA 1I1DA 3PZJA 3K9UA 1WWZA 3TE4A 1QSRA 1IICA 4LX9A 2Z11A 5IV0A 3UY5A 3EO4A 1IB1E 4JD6A 2REFA 2BL1A 2OZGA 2FXFA 2Z10A 2JLMA 3VWEA 3QAHA 2PR8A 2HQYA 3FYNA 2B5GA 2G3AA 5E96A 5J8FA 3B8GA 3RYOA 4PSXA 4CRYB 2VZZA 1M4GA 2B5GB 4QUSA 2EUIA 3BJ7A 1FY7A 1S60A 1S7KA 3LODA 4II9A 4KOYA 3S6FA 2B4DB 2PRBA 4FD7A 3FBUA 2CNMA 2CY2A 3TOAA 4CAXA 5J8CA 3T9YA 4FD4A 4JJXA 4MY3A 2QECA 2R7HA 5ISVA 4AVAA 4NSQA 1YVOA 5JPHA 4E2AA 1B87A 4KVOE 2P6FA 4KLWA 2REEA 5I0CA 5F48A 2FCKA 4KOXA 1SQHA 2WPXA 2FIWA 2RC4A 3F0AA 3I9SA 3FXTA 2EVNA 3R95A 3I3GA 4CAVA 2GE3A 4XPKA 3VWDA 4KLVA 1MJAA 2PDOA 3JVNA 4J3GA 5IB0A 2Q04A 2FSRA 4M85A 3QB8A 1TIQA 4KORA 5CNPA 3R96A 1KUXA 3DR6A 4L89A 4KOUA 4UWJA 4KVXA 1Z4EA 1Y9KA 2FT0A 1PUAA 4L8AA 1K4JA 4LUAA 1P0HA 4XPLA 2I00A 4R57A 4AVBA 4UWIA 4QC6A 4Y49C 2ZW5A 2Q44A 1OZPA 4AG9A 3EFAA 1YVKA 2PSWA 3G3SA 3OWCA 2NMTA 4IUSA 4PK2A 3W91A 5H84A 4YFJA 2B3VA 2Q4VA 4KOTA 1MK4A 2Z0ZA 4K30A 4KUAA 1Y7RA 2OZHA 3N7ZA 4XPDC 1Q2CA 3E0KA 2K5TA 3PP9A 4E8OA 4H89A 4MBUA 2R8VA 1QSNA 4ZBGA 4OADA 4KZTA 3V8IA 1NMTA 1J4JA 3FB3A 2AJ6A 2FE7A 4YGOA 3WR7A 2WPWA 3NE7A 4UBRA 2H5MA 2R1IA 2AE6A 4GS4A 1N71A 1RXTA 5DWNA 3GKRA 3EXNA 4MY0A 1UFHA 4KOVA 2OZUA 3W6SA 5C82A 3TO6A 5HMNA 1M4IA 3TTHA 2OH1A 3G8WA 1IYKA 4CS0B 2BSWA 2OU2A 3C26A 1V0CA 3CXQA 4IF5A 2FIAA 5KTDA 3JUWA 1I12A 1LRZA 2F5IA 2FL4A 3D2PA 3DSBA 4JLYA 2DXQA 4EVYA 1NSLA 2I79A 2D4OA 5GCNA 2HUZA 2Q0YA 3R9GA 1YK3A 4MJ8A 4PV6A 3ZJ0A 2P6GA 2ATRA 4FD6A 2JDCA 2IL4A 1Q2DA 3F8KA 4AB7A 2C27A 2FS5A 3P2HA 3MGDA 3GYAA 1Z9UA 5EC4A 3ZZIA 3DDDA 4H6UA 5HH1A 3IGRA 5F46A 4R9MA 1I21A 4AG7A 1CM0A 4B5PA 3BJ8A 4RI1A 1PU9A 4JXQA 1S5KA 3LD2A 3R9EA 3F5BA 4QVTA 2VEZA 4XNHC 2BEIA 2HV2A 3S6HA 1KUYA 1KZFA 1S7FA 2B4BA 4FD5A 2J8MA 1VKCA 4B5PB 2VI7A 3TFYA 2JDDA 4U9ZA 2QIRA 4MI4A 4YRHA 4MHDA 2X7BA 3FIXA
chains in the Genus database with same CATH superfamily
4KVME 3VATA 4CYPA 3LWUA 4M6IA 4C2YA 3PFEA 1FNOA 3S9MA 1KUVA 4YWYA 2ZEOA 4M3SA 4NGNA 3TOBA 5G1ZA 5KTAA 1TF9A 2PJ7A 5LRGA 4DUKA 2Z3MA 5EBVA 3FRMA 3EC4A 1LOKA 2VBQA 2ZXVA 2DPSA 1IYLA 1XEBA 3PB8X 4KSFA 5LYIA 2FVGA 4OMEA 5F49A 3B3WA 5G22A 4F0YA 5JM6A 3A9LA 3NFZA 2J8RA 1U6MA 4PPZA 4ZGYB 2R98A 2AFSA 4DNCA 2G9DA 2CF4A 1XF8A 2NYQA 1NE9A 4TWEA 4Y49B 3V38A 1VHSA 2X7BA 2JBKA 4OC1A 4AVCA 1Z8LA 1IIDA 2B3UA 4XNHB 2QJ8A 3GB0A 4C2ZA 3D7FA 4I49A 4OP4A 2QYVA 4ORFA 4RS2A 1P4NA 3W6XA 4C2XA 5K8NA 2QMLA 2CNSA 3S9LA 4R87A 1VIXA 2BOAA 2JEVA 1R57A 3H8EA 2I3CA 3R1KA 1IOFA 2PJBA 3CDXA 1ELMP 4CRZB 3HUVA 4PXCA 2V8DA 2O53A 3TT2A 4NCZA 4R3LA 2OB0A 2ZW6A 3BLNA 2D4PA 5FVJA 1S3ZA 3T90A 2Y0MA 4MFZA 1BPNA 1IY7A 2VZYA 3KZWA 3PB9X 4NGSA 1MJBA 3R9FA 2PE3A 5JQ4A 2ZENA 3EY5A 1S7NA 2B4DA 2C1CA 3DR8A 4XPDB 4CYOA 2V77A 4H6ZA 4P6YA 3FNCA 4DJLA 4PSWA 4NXYA 4ONUA 4JXRA 3KKWA 2B58A 2CNTA 1Z8XA 1HDQA 1BOBA 3TO7A 3FJUA 4LQ6A 2XEFA 1GHEA 1CP7A 3D7GA 2CXAA 1YR0A 2G3TA 3MRUA 2PIZA 2ZW4A 4JYWA 3RAMA 1QSMA 1WK4A 2P0WA 1M4LA 4E0AA 1QSOA 2G0BA 4F0XA 3SXNA 1ON0A 1XIXA 2Q43A 3K2KA 1YMEA 4HNYB 5HVFA 4CAWA 4CGOA 2J8NA 1LCPA 2HC9A 4NGMA 4X8IA 4MHPA 6CPAA 4B12A 4C7IA 3B35A 2GIVA 3D2MA 4A95A 1L0CA 1M44A 5F47A 3PFOA 3DNSA 4CGLA 4PK3A 5C88A 4C7HA 1YLEA 2A4NA 2EWBA 2EBJA 1OBRA 1Y9WA 1CPSA 2Q7BA 3D8PA 5IX3A 1BPMA 1LFWA 5I4MA 3TO9A 1S7LA 3D3SA 5CPAA 1YREA 2KCWA 3FEDA 3P2FA 3PRTA 4FWUA 5IB9A 4X5KA 3H4QA 1XRYA 4IAVA 3S6GA 2JEWA 3CPXA 1F57A 3KHZA 4KOSA 1XMTA 1BO4A 2BUEA 1M4DA 2ARHA 2PC1A 3PEIA 2J9AA 2VQYA 4NF1A 4OKOA 2GFQA 4U9YA 2HB6A 1CX8A 2ZPAA 3CXSA 4LQGA 4QB9A 2VXKA 3CXPA 4U5YA 2WYRA 1M1DA 2P6EA 1ZG8A 4F6AA 1IGBA 5H86A 2ODFA 3TCVA 4UA3A 1YSJA 3WC7A 2O4HA 2PVVA 4NEXA 2AFUA 4OAEA 1YX0A 4KOWA 4RN7A 3D7DA 2V8HA 2ZW7A 4OLLA 1QSTA 4HNXB 5DS0A 4B5OA 3NH4A 2AFXA 1DTDA 2CTBA 2GANA 2PR1A 3WT4A 2PQ8A 4ZY2A 3PGPA 4OC5A 4MRIA 4ZX9A 1LAPA 2DF5A 4Q38A 5LRJA 4QBJA 3SHPA 3VARA 1Q7LA 2C6GA 4PXBA 4JWPA 4MHNA 4R3KA 3S6KA 3KASA 4Z65A 1IOIA 2O28A 4KUBA 5AG6A 2EO8A 2PJ4A 4HNWB 5DWMA 3SXOA 4ONWA 5D8NA 1Q2YA 1MJ9A 2PJ2A 1YGHA 3ISZA 5KTCA 1XE4A 2PJ1A 4BMHA 3FH4A 1B6BA 1IU8A 2PCUA 3IWGA 4A37A 1RO5A 1CJWA 1Z4RA 2Z3NA 5G20A 3GY9A 2PJ6A 1TKHA 4HKFA 1I1DA 3PZJA 3K9UA 2XEGA 4CGNA 1WWZA 3TE4A 4NJQA 1QSRA 4P4EA 1H8LA 1IICA 4LX9A 3D68A 2Z11A 1A2ZA 2RFHA 3I1UA 2EK9A 5IV0A 4MHYA 4MXUA 3UY5A 4A31A 3EO4A 4KSAA 4EMEA 5ELYA 2WSAA 1IB1E 5D29A 1CPXA 4NJRA 5J1QA 2XEIA 4JD6A 1FT7A 4UEFA 3PBBA 4P45A 2REFA 4R7MA 2BL1A 1AYEA 2FXFA 2OZGA 3IO1A 2Z10A 3IJ3A 3FX6A 2JLMA 3VWEA 2GLFA 3QAHA 2PR8A 1XFOA 2HQYA 1CG2A 3FYNA 2B5GA 4UFWA 4F9VA 3SJFA 2IJZA 3IU2A 2G3AA 5E96A 5J8FA 4R6TA 1GYTA 3V7ZA 3B8GA 3RYOA 3T8WA 3BHXA 3MN8A 4NFRA 1VHOA 1CP6A 3GLJA 2ZEEA 4MCQA 2RB7A 4PSXA 4CRYB 2VZZA 1VHEA 4Q36A 4CYQA 4KS9A 1Z8TA 1M4GA 2B5GB 4QUSA 1QMUA 2DPTA 4PQAA 2AFWA 2EUIA 1F2OA 1ZG7A 3BJ7A 1FY7A 4O23A 4A2ZA 1S60A 5HVHA 1XBUA 1S7KA 2ABZA 2Q51A 3LODA 4AXVA 4A30A 2QVPA 3KR5A 1JQGA 3K9TA 4OIWA 3IWEA 4KOYA 4II9A 1KWMA 3S6FA 5A28A 2B4DB 2YNCC 5K8OA 3GIUA 2PRBA 4FD7A 4UCMA 3FBUA 1HEEA 4NGQA 3WC6A 2CNMA 2CY2A 3TOAA 4CAXA 4K3NA 2JBJA 5J8CA 1ZLIA 3NH5A 3T9YA 4FD4A 4JJXA 5G21A 4MY3A 3DGVA 4P4IA 3TX8A 2GREA 4DYOA 2QECA 2R7HA 1AMPA 3VH9A 3B3CA 4GM5A 5ISVA 3FECA 4AVAA 4B10A 4IHMA 4NSQA 4OC2A 2VL1A 2Q4ZA 1YVOA 5JPHA 2YNDA 2ZOFA 4NGRA 1B87A 4E2AA 2PJ9A 4KVOE 4UEZA 4GXHA 4UCPA 2P6FA 4KLWA 2REEA 4P4DA 1BAVA 5I0CA 2YNCA 3D4UA 2PJ3A 1Z2LA 3QNVA 5F48A 2FCKA 3H8GA 4KOXA 4ZI6A 3KI9A 1SQHA 1YQEA 2PIYA 2FIWA 2RC4A 2WPXA 2Z3LA 4PXEA 3WC5A 3IIBA 1TXRA 3F0AA 3I9SA 4HPSA 4P10A 3FXTA 4C68A 1ELLP 3SJGA 4F9UA 2EVNA 2F7VA 3B3SA 3FEEA 4G1PA 2ANPA 3R95A 3I3GA 1DE4C 4CAVA 2GE3A 5LYDA 3B2YA 4XPKA 3VWDA 2AFMA 3B3TA 4B14A 4KLVA 4OC0A 1MJAA 2PDOA 3KQZA 3JVNA 4J3GA 5IB0A 4B11A 3QAYA 5JGFA 2Q04A 4A33A 1F2PA 2FSRA 1YW4A 3LMSA 3QB8A 1TIQA 2IMOA 4KORA 4M85A 5CNPA 1KUXA 3R96A 3B3VA 3DR6A 4L89A 3D66A 4B13A 1ZLHA 4Q7AA 2ZEGA 4KOUA 4UWJA 1VGYA 4KVXA 1Z4EA 1YLOA 2V8GA 1Y9KA 2FT0A 4UF4A 1PUAA 4L8AA 1K4JA 4LUAA 1P0HA 2Z3OA 4XPLA 2I00A 7CPAA 3NA6A 1Y7EA 4R57A 5F09A 4AVBA 1X12A 4UWIA 4QC6A 4Y49C 4FBEA 2ZW5A 2Q44A 2ZEPA 3SI2A 1R43A 3BXMA 2PJCA 5AG4A 5AG5A 1OZPA 1ZG9A 4AG9A 3EFAA 2PJAA 2AFOA 5LRKA 1XOVA 1YVKA 3ISXA 4UCNA 2PJ5A 2PSWA 3G3SA 3OWCA 2NMTA 1ZO0A 2ZEHA 4IUSA 4PK2A 5AG7A 5H84A 2OOTA 2B3VA 3W91A 2AFZA 2Q4VA 1ARLA 4YFJA 3IU1A 4KOTA 2Q7SA 1MK4A 2Z0ZA 4K30A 3PB7X 4OC3A 4KUAA 5BWAB 4MFQA 3CPAA 4NGPA 1Y7RA 2YGWA 2OZHA 3N7ZA 4XPDC 1Q2CA 3BI0A 2PJ0A 2CIJA 3E0KA 3IEHA 2K5TA 3PP9A 4MCRA 4ZX8A 4YU9A 3PB6X 4TNUA 4E8OA 2ZEFA 2ZEMA 4H89A 4CGPA 4ZY1A 4MBUA 5CBMA 4F8ZA 4CGMA 2PRQA 5K8PA 4MHZA 4BBHA 2R8VA 4RUHA 2YNEA 1QSNA 2BO9A 4ZBGA 1XJOA 4CAFA 4OADA 4KSIA 4KZTA 4PXDA 3SJEA 3V8IA 5HXDA 5JH9A 4UIAA 4MCPA 1NMTA 1J4JA 3FB3A 2AJ6A 2FE7A 4YGOA 3WR7A 3D7HA 3RNZA 4X2TA 3WABA 5LYFA 3FF3A 2WPWA 3NE7A 4UBRA 2H5MA 1UWYA 1HDUA 2R1IA 4A94A 2AE6A 4GS4A 4A39A 1N71A 4WWVA 1Y0YA 1RXTA 2C6PA 2F8HA 4WJBA 1RTQA 5DWNA 3TC8A 3JTKA 3KR4A 3GKRA 3KGQA 2OR4A 2POKA 3EXNA 4BD9A 4MY0A 2ZOGA 4MCSA 4UEEA 3SI1A 1UFHA 4UFXA 1AUGA 1Z8WA 3KQXA 4KOVA 2OZUA 1CBXA 3W6SA 5C82A 3IFEA 3TO6A 1M4IA 5A27A 5HMNA 5K8MA 4MFPA 3TTHA 3D67A 1X10A 2OH1A 3G8WA 3S9NA 2C6CA 1IYKA 4ZY0A 4UIBA 4CS0B 2BSWA 2OU2A 2ZEDA 3C26A 4OC4A 1V0CA 1TKJA 2Z3KA 3CXQA 4IF5A 2FIAA 4MFKA 3SJXA 4EFDA 5KTDA 3IWWA 3HLPA 2GU2A 3JUWA 4H2KA 2CTCA 1I12A 1LRZA 2F5IA 2FL4A 3D2PA 3DSBA 3JRUA 1JWQA 4JLYA 4CPAA 2DXQA 4EVYA 3KHXA 4MFJA 1NSLA 2I79A 2D4OA 5GCNA 1LAMA 2HUZA 2PJ8A 2Q0YA 1R3NA 5EMIA 3GUXA 4P4BA 3R9GA 1YK3A 3BI1A 4MFLA 1XMBA 4MJ8A 4PV6A 5AGEA 3SI0A 3ZJ0A 4BINA 2P6GA 2ATRA 1QQ9A 2WUUA 4FD6A 4M6HA 2JDCA 5THWA 2IL4A 4OIDA 4CAEA 3L2NA 4B6ZA 4R76A 1Q2DA 3F8KA 1Y0RA 1NSAA 2EK8A 1ARMA 4AB7A 4M6GA 4X3RA 1LANA 3NH8A 2GLJA 4P4JA 4A32A 2C27A 2ZELA 3CT9A 2FS5A 3P2HA 3MGDA 3LACA 3GYAA 3RBUA 4UFVA 1Z9UA 3PBEA 5EC4A 3ZZIA 3CZXA 1PYTB 3DDDA 4H6UA 5HH1A 3FMCA 3PB4X 3FVLA 3IGRA 4IK2A 3H5ZA 5F46A 4R9MA 1I21A 4JZ0A 4AG7A 1CM0A 4B5PA 3BJ8A 4P4FA 2XEJA 4RI1A 1PU9A 4W9YA 1Z5RA 4CYNA 3B7IA 4JXQA 5HVGA 8CPAA 3DLJA 2IQ6A 2NSMA 1S5KA 2BCOA 3LD2A 2Z3PA 3R9EA 3F5BA 4FAIA 1PCAA 4QVTA 2VEZA 4FUUA 4MMOA 4XNHC 1YW6A 2V8VA 5LYLA 2BEIA 2HV2A 3KL9A 3RZAA 3S6HA 1EE3P 4ZYQA 1BLLE 1TF8A 1KUYA 3RO0A 2DEAA 4EWTA 1KZFA 1S7FA 2B4BA 4FD5A 2J8MA 1VKCA 3N5FA 2VI7A 4NGTA 3IC1A 4B5PB 4R8FA 3TFYA 3H8FA 4P44A 2PVWA 2JDDA 2WZNA 4U9ZA 3NE8A 2QIRA 1TKFA 4A38A 4MI4A 4YRHA 4MHDA 2Q4YA 3FIXA
chains in the Genus database with same CATH topology
4KVME 4CYPA 4C2YA 1KUVA 4M3SA 3TOBA 5KTAA 5G1ZA 2Z3MA 5EBVA 3FRMA 3EC4A 2VBQA 2ZXVA 2DPSA 1IYLA 1XEBA 4KSFA 5G22A 5F49A 4F0YA 3A9LA 2J8RA 1U6MA 4ZGYB 2R98A 4DNCA 1XF8A 1NE9A 4Y49B 1VHSA 4AVCA 1IIDA 2B3UA 4XNHB 4C2ZA 4I49A 4RS2A 3W6XA 4ORFA 1P4NA 4C2XA 2QMLA 2CNSA 4R87A 2JEVA 1R57A 3R1KA 4CRZB 3TT2A 4NCZA 4R3LA 2OB0A 2ZW6A 3BLNA 2D4PA 5FVJA 1S3ZA 3T90A 2Y0MA 4MFZA 2VZYA 1MJBA 3R9FA 5JQ4A 3EY5A 1S7NA 2B4DA 3DR8A 4XPDB 4CYOA 4H6ZA 2Q4YA 3FNCA 4PSWA 4NXYA 4ONUA 4JXRA 3KKWA 2B58A 2CNTA 1BOBA 3TO7A 1GHEA 2CXAA 1YR0A 2G3TA 2ZW4A 1QSMA 1WK4A 2P0WA 4E0AA 1QSOA 2G0BA 4F0XA 3SXNA 1ON0A 1XIXA 4HNYB 4CAWA 4CGOA 2J8NA 4B12A 4C7IA 2GIVA 3D2MA 4A95A 1L0CA 1M44A 5F47A 3DNSA 4CGLA 4PK3A 5C88A 4C7HA 1YLEA 2A4NA 1Y9WA 2Q7BA 3D8PA 5IX3A 3TO9A 1S7LA 3D3SA 1YREA 2KCWA 3P2FA 4X5KA 3H4QA 3S6GA 4KOSA 1XMTA 1BO4A 2BUEA 1M4DA 2ARHA 2PC1A 2VQYA 4NF1A 4U9YA 2ZPAA 4QB9A 3CXSA 2VXKA 3CXPA 4U5YA 1M1DA 2P6EA 4F6AA 5H86A 3TCVA 4UA3A 4NEXA 4OAEA 1YX0A 4KOWA 2ZW7A 4OLLA 1QSTA 4HNXB 4B5OA 2GANA 2PR1A 2PQ8A 3PGPA 4Q38A 4QBJA 3SHPA 4R3KA 4JWPA 3S6KA 2O28A 4KUBA 3SXOA 5AG6A 4HNWB 5DWMA 1Q2YA 1MJ9A 1YGHA 5KTCA 1XE4A 4BMHA 1B6BA 3IWGA 1RO5A 1CJWA 1Z4RA 2Z3NA 5G20A 3GY9A 4HKFA 1I1DA 3PZJA 3K9UA 4CGNA 1WWZA 3TE4A 1QSRA 1IICA 4LX9A 2Z11A 5IV0A 3UY5A 4A31A 3EO4A 4KSAA 2WSAA 1IB1E 4JD6A 2REFA 2BL1A 2OZGA 2FXFA 2Z10A 2JLMA 3VWEA 3QAHA 2PR8A 2HQYA 3FYNA 4UFWA 2B5GA 3IU2A 2G3AA 5E96A 5J8FA 3B8GA 3RYOA 4PSXA 4CRYB 2VZZA 4Q36A 4CYQA 4KS9A 1M4GA 2B5GB 4QUSA 2DPTA 2EUIA 3BJ7A 1FY7A 4A2ZA 1S60A 1S7KA 3LODA 4A30A 4II9A 3IWEA 4KOYA 3S6FA 5A28A 2B4DB 2YNCC 2PRBA 4FD7A 4UCMA 3FBUA 2CNMA 2CY2A 3TOAA 4CAXA 5J8CA 3T9YA 4FD4A 4JJXA 5G21A 4MY3A 2QECA 2R7HA 5ISVA 4AVAA 4B10A 4NSQA 1YVOA 5JPHA 2YNDA 4E2AA 1B87A 4KVOE 4UCPA 2P6FA 4KLWA 2REEA 5I0CA 2YNCA 5F48A 2FCKA 4KOXA 1SQHA 2WPXA 2Z3LA 2FIWA 2RC4A 3F0AA 3I9SA 3FXTA 4C68A 2EVNA 3R95A 3I3GA 4CAVA 2GE3A 4XPKA 3VWDA 4B14A 4KLVA 1MJAA 2PDOA 3JVNA 4J3GA 5IB0A 4B11A 2Q04A 4A33A 2FSRA 3QB8A 4M85A 1TIQA 4KORA 5CNPA 3R96A 1KUXA 3DR6A 4L89A 4B13A 4KOUA 4UWJA 4KVXA 1Z4EA 1Y9KA 2FT0A 1PUAA 4L8AA 1K4JA 4LUAA 1P0HA 2Z3OA 4XPLA 2I00A 4R57A 4AVBA 4UWIA 4QC6A 4Y49C 2ZW5A 2Q44A 5AG4A 5AG5A 1OZPA 4AG9A 3EFAA 1YVKA 4UCNA 2PSWA 3G3SA 3OWCA 2NMTA 1ZO0A 4IUSA 4PK2A 5AG7A 5H84A 3W91A 4YFJA 2B3VA 2Q4VA 3IU1A 4KOTA 1MK4A 2Z0ZA 4K30A 4KUAA 5BWAB 4MFQA 1Y7RA 2YGWA 2OZHA 3N7ZA 4XPDC 1Q2CA 3E0KA 2K5TA 3PP9A 4E8OA 4H89A 4CGPA 4MBUA 4CGMA 4BBHA 2R8VA 2YNEA 1QSNA 4ZBGA 4CAFA 4OADA 4KZTA 3V8IA 1NMTA 1J4JA 3FB3A 2AJ6A 2FE7A 4YGOA 3WR7A 2WPWA 3NE7A 4UBRA 2H5MA 2R1IA 2AE6A 4GS4A 1N71A 1RXTA 5DWNA 3JTKA 3GKRA 3EXNA 4MY0A 1UFHA 4UFXA 4KOVA 2OZUA 3W6SA 5C82A 3TO6A 5HMNA 1M4IA 5A27A 4MFPA 3TTHA 2OH1A 3G8WA 1IYKA 4CS0B 2BSWA 2OU2A 3C26A 1V0CA 2Z3KA 3CXQA 4IF5A 2FIAA 4MFKA 5KTDA 3JUWA 1I12A 1LRZA 2F5IA 2FL4A 3D2PA 3DSBA 4JLYA 2DXQA 4EVYA 4MFJA 1NSLA 2I79A 2D4OA 5GCNA 2HUZA 2Q0YA 3R9GA 1YK3A 4MFLA 4MJ8A 4PV6A 5AGEA 3ZJ0A 2P6GA 2ATRA 2WUUA 4FD6A 2JDCA 2IL4A 4CAEA 1Q2DA 3F8KA 4AB7A 4A32A 2C27A 2FS5A 3P2HA 3MGDA 3GYAA 4UFVA 1Z9UA 5EC4A 3ZZIA 3DDDA 4H6UA 5HH1A 3IGRA 3H5ZA 5F46A 4R9MA 1I21A 4AG7A 1CM0A 4B5PA 3BJ8A 4CYNA 4RI1A 1PU9A 4JXQA 1S5KA 3LD2A 3R9EA 2Z3PA 3F5BA 4QVTA 2VEZA 4XNHC 2BEIA 2HV2A 3S6HA 1KUYA 1KZFA 1S7FA 2B4BA 4FD5A 2J8MA 1VKCA 4B5PB 2VI7A 3TFYA 2JDDA 4U9ZA 2QIRA 4MI4A 4YRHA 4MHDA 2X7BA 3FIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVM E;  1KUV A;  4M3S A;  3TOB A;  5KTA A;  5EBV A;  3FRM A;  3EC4 A;  2VBQ A;  2ZXV A;  1IYL A;  1XEB A;  5F49 A;  4F0Y A;  2J8R A;  1U6M A;  2R98 A;  4DNC A;  1XF8 A;  1NE9 A;  4Y49 B;  1VHS A;  4AVC A;  1IID A;  2B3U A;  4XNH B;  4I49 A;  4RS2 A;  3W6X A;  4ORF A;  1P4N A;  2QML A;  2CNS A;  4R87 A;  2JEV A;  1R57 A;  3R1K A;  4CRZ B;  3TT2 A;  4NCZ A;  4R3L A;  2OB0 A;  2ZW6 A;  3BLN A;  2D4P A;  5FVJ A;  1S3Z A;  3T90 A;  2Y0M A;  2VZY A;  1MJB A;  3R9F A;  5JQ4 A;  3EY5 A;  1S7N A;  2B4D A;  3DR8 A;  4XPD B;  4H6Z A;  2Q4Y A;  3FNC A;  4PSW A;  4NXY A;  4ONU A;  4JXR A;  3KKW A;  2B58 A;  2CNT A;  1BOB A;  3TO7 A;  1GHE A;  1YR0 A;  2G3T A;  2ZW4 A;  1QSM A;  1WK4 A;  2P0W A;  4E0A A;  1QSO A;  2G0B A;  3SXN A;  1ON0 A;  1XIX A;  4HNY B;  4CAW A;  2J8N A;  2GIV A;  3D2M A;  1L0C A;  1M44 A;  5F47 A;  3DNS A;  4PK3 A;  5C88 A;  1YLE A;  2A4N A;  1Y9W A;  2Q7B A;  3D8P A;  5IX3 A;  3TO9 A;  1S7L A;  3D3S A;  1YRE A;  2KCW A;  3P2F A;  4X5K A;  3H4Q A;  3S6G A;  4KOS A;  1XMT A;  1BO4 A;  2BUE A;  1M4D A;  2ARH A;  2PC1 A;  2VQY A;  4NF1 A;  4U9Y A;  2ZPA A;  4QB9 A;  3CXS A;  2VXK A;  3CXP A;  4U5Y A;  1M1D A;  2P6E A;  4F6A A;  5H86 A;  3TCV A;  4UA3 A;  4NEX A;  4OAE A;  1YX0 A;  4KOW A;  2ZW7 A;  4OLL A;  1QST A;  4HNX B;  4B5O A;  2GAN A;  2PR1 A;  2PQ8 A;  3PGP A;  4QBJ A;  3SHP A;  4R3K A;  4JWP A;  3S6K A;  2O28 A;  4KUB A;  3SXO A;  4HNW B;  5DWM A;  1Q2Y A;  1MJ9 A;  1YGH A;  5KTC A;  1XE4 A;  4BMH A;  1B6B A;  3IWG A;  1RO5 A;  1CJW A;  1Z4R A;  3GY9 A;  4HKF A;  1I1D A;  3PZJ A;  3K9U A;  1WWZ A;  3TE4 A;  1QSR A;  1IIC A;  4LX9 A;  2Z11 A;  5IV0 A;  3UY5 A;  3EO4 A;  1IB1 E;  4JD6 A;  2REF A;  2BL1 A;  2OZG A;  2FXF A;  2Z10 A;  2JLM A;  3VWE A;  3QAH A;  2PR8 A;  2HQY A;  3FYN A;  2B5G A;  2G3A A;  5E96 A;  5J8F A;  3B8G A;  3RYO A;  4PSX A;  4CRY B;  2VZZ A;  1M4G A;  2B5G B;  4QUS A;  2EUI A;  3BJ7 A;  1FY7 A;  1S60 A;  1S7K A;  3LOD A;  4II9 A;  4KOY A;  3S6F A;  2B4D B;  2PRB A;  4FD7 A;  3FBU A;  2CNM A;  2CY2 A;  3TOA A;  4CAX A;  5J8C A;  3T9Y A;  4FD4 A;  4JJX A;  4MY3 A;  2QEC A;  2R7H A;  5ISV A;  4AVA A;  4NSQ A;  1YVO A;  5JPH A;  4E2A A;  1B87 A;  4KVO E;  2P6F A;  4KLW A;  2REE A;  5I0C A;  5F48 A;  2FCK A;  4KOX A;  1SQH A;  2WPX A;  2FIW A;  2RC4 A;  3F0A A;  3I9S A;  3FXT A;  2EVN A;  3R95 A;  3I3G A;  4CAV A;  2GE3 A;  4XPK A;  3VWD A;  4KLV A;  1MJA A;  2PDO A;  3JVN A;  4J3G A;  5IB0 A;  2Q04 A;  2FSR A;  4M85 A;  3QB8 A;  1TIQ A;  4KOR A;  5CNP A;  3R96 A;  1KUX A;  3DR6 A;  4L89 A;  4KOU A;  4UWJ A;  4KVX A;  1Z4E A;  1Y9K A;  2FT0 A;  1PUA A;  4L8A A;  1K4J A;  4LUA A;  1P0H A;  4XPL A;  2I00 A;  4R57 A;  4AVB A;  4UWI A;  4QC6 A;  4Y49 C;  2ZW5 A;  2Q44 A;  1OZP A;  4AG9 A;  3EFA A;  1YVK A;  2PSW A;  3G3S A;  3OWC A;  2NMT A;  4IUS A;  4PK2 A;  3W91 A;  5H84 A;  4YFJ A;  2B3V A;  2Q4V A;  4KOT A;  1MK4 A;  2Z0Z A;  4K30 A;  4KUA A;  1Y7R A;  2OZH A;  3N7Z A;  4XPD C;  1Q2C A;  3E0K A;  2K5T A;  3PP9 A;  4E8O A;  4H89 A;  4MBU A;  2R8V A;  1QSN A;  4ZBG A;  4OAD A;  4KZT A;  3V8I A;  1NMT A;  1J4J A;  3FB3 A;  2AJ6 A;  2FE7 A;  4YGO A;  3WR7 A;  2WPW A;  3NE7 A;  4UBR A;  2H5M A;  2R1I A;  2AE6 A;  4GS4 A;  1N71 A;  1RXT A;  5DWN A;  3GKR A;  3EXN A;  4MY0 A;  1UFH A;  4KOV A;  2OZU A;  3W6S A;  5C82 A;  3TO6 A;  5HMN A;  1M4I A;  3TTH A;  2OH1 A;  3G8W A;  1IYK A;  4CS0 B;  2BSW A;  2OU2 A;  3C26 A;  1V0C A;  3CXQ A;  4IF5 A;  2FIA A;  5KTD A;  3JUW A;  1I12 A;  1LRZ A;  2F5I A;  2FL4 A;  3D2P A;  3DSB A;  4JLY A;  2DXQ A;  4EVY A;  1NSL A;  2I79 A;  2D4O A;  5GCN A;  2HUZ A;  2Q0Y A;  3R9G A;  1YK3 A;  4MJ8 A;  4PV6 A;  3ZJ0 A;  2P6G A;  2ATR A;  4FD6 A;  2JDC A;  2IL4 A;  1Q2D A;  3F8K A;  4AB7 A;  2C27 A;  2FS5 A;  3P2H A;  3MGD A;  3GYA A;  1Z9U A;  5EC4 A;  3ZZI A;  3DDD A;  4H6U A;  5HH1 A;  3IGR A;  5F46 A;  4R9M A;  1I21 A;  4AG7 A;  1CM0 A;  4B5P A;  3BJ8 A;  4RI1 A;  1PU9 A;  4JXQ A;  1S5K A;  3LD2 A;  3R9E A;  3F5B A;  4QVT A;  2VEZ A;  4XNH C;  2BEI A;  2HV2 A;  3S6H A;  1KUY A;  1KZF A;  1S7F A;  2B4B A;  4FD5 A;  2J8M A;  1VKC A;  4B5P B;  2VI7 A;  3TFY A;  2JDD A;  4U9Z A;  2QIR A;  4MI4 A;  4YRH A;  4MHD A;  2X7B A;  3FIX A; 
#chains in the Genus database with same CATH topology
 4KVM E;  3VAT A;  4CYP A;  3LWU A;  4M6I A;  4C2Y A;  3PFE A;  1FNO A;  3S9M A;  1KUV A;  4YWY A;  2ZEO A;  4M3S A;  4NGN A;  3TOB A;  5G1Z A;  5KTA A;  1TF9 A;  2PJ7 A;  5LRG A;  4DUK A;  2Z3M A;  5EBV A;  3FRM A;  3EC4 A;  1LOK A;  2VBQ A;  2ZXV A;  2DPS A;  1IYL A;  1XEB A;  3PB8 X;  4KSF A;  5LYI A;  2FVG A;  4OME A;  5F49 A;  3B3W A;  5G22 A;  4F0Y A;  5JM6 A;  3A9L A;  3NFZ A;  2J8R A;  1U6M A;  4PPZ A;  4ZGY B;  2R98 A;  2AFS A;  4DNC A;  2G9D A;  2CF4 A;  1XF8 A;  2NYQ A;  1NE9 A;  4TWE A;  4Y49 B;  3V38 A;  1VHS A;  2X7B A;  2JBK A;  4OC1 A;  4AVC A;  1Z8L A;  1IID A;  2B3U A;  4XNH B;  2QJ8 A;  3GB0 A;  4C2Z A;  3D7F A;  4I49 A;  4OP4 A;  2QYV A;  4ORF A;  4RS2 A;  1P4N A;  3W6X A;  4C2X A;  5K8N A;  2QML A;  2CNS A;  3S9L A;  4R87 A;  1VIX A;  2BOA A;  2JEV A;  1R57 A;  3H8E A;  2I3C A;  3R1K A;  1IOF A;  2PJB A;  3CDX A;  1ELM P;  4CRZ B;  3HUV A;  4PXC A;  2V8D A;  2O53 A;  3TT2 A;  4NCZ A;  4R3L A;  2OB0 A;  2ZW6 A;  3BLN A;  2D4P A;  5FVJ A;  1S3Z A;  3T90 A;  2Y0M A;  4MFZ A;  1BPN A;  1IY7 A;  2VZY A;  3KZW A;  3PB9 X;  4NGS A;  1MJB A;  3R9F A;  2PE3 A;  5JQ4 A;  2ZEN A;  3EY5 A;  1S7N A;  2B4D A;  2C1C A;  3DR8 A;  4XPD B;  4CYO A;  2V77 A;  4H6Z A;  4P6Y A;  3FNC A;  4DJL A;  4PSW A;  4NXY A;  4ONU A;  4JXR A;  3KKW A;  2B58 A;  2CNT A;  1Z8X A;  1HDQ A;  1BOB A;  3TO7 A;  3FJU A;  4LQ6 A;  2XEF A;  1GHE A;  1CP7 A;  3D7G A;  2CXA A;  1YR0 A;  2G3T A;  3MRU A;  2PIZ A;  2ZW4 A;  4JYW A;  3RAM A;  1QSM A;  1WK4 A;  2P0W A;  1M4L A;  4E0A A;  1QSO A;  2G0B A;  4F0X A;  3SXN A;  1ON0 A;  1XIX A;  2Q43 A;  3K2K A;  1YME A;  4HNY B;  5HVF A;  4CAW A;  4CGO A;  2J8N A;  1LCP A;  2HC9 A;  4NGM A;  4X8I A;  4MHP A;  6CPA A;  4B12 A;  4C7I A;  3B35 A;  2GIV A;  3D2M A;  4A95 A;  1L0C A;  1M44 A;  5F47 A;  3PFO A;  3DNS A;  4CGL A;  4PK3 A;  5C88 A;  4C7H A;  1YLE A;  2A4N A;  2EWB A;  2EBJ A;  1OBR A;  1Y9W A;  1CPS A;  2Q7B A;  3D8P A;  5IX3 A;  1BPM A;  1LFW A;  5I4M A;  3TO9 A;  1S7L A;  3D3S A;  5CPA A;  1YRE A;  2KCW A;  3FED A;  3P2F A;  3PRT A;  4FWU A;  5IB9 A;  4X5K A;  3H4Q A;  1XRY A;  4IAV A;  3S6G A;  2JEW A;  3CPX A;  1F57 A;  3KHZ A;  4KOS A;  1XMT A;  1BO4 A;  2BUE A;  1M4D A;  2ARH A;  2PC1 A;  3PEI A;  2J9A A;  2VQY A;  4NF1 A;  4OKO A;  2GFQ A;  4U9Y A;  2HB6 A;  1CX8 A;  2ZPA A;  3CXS A;  4LQG A;  4QB9 A;  2VXK A;  3CXP A;  4U5Y A;  2WYR A;  1M1D A;  2P6E A;  1ZG8 A;  4F6A A;  1IGB A;  5H86 A;  2ODF A;  3TCV A;  4UA3 A;  1YSJ A;  3WC7 A;  2O4H A;  2PVV A;  4NEX A;  2AFU A;  4OAE A;  1YX0 A;  4KOW A;  4RN7 A;  3D7D A;  2V8H A;  2ZW7 A;  4OLL A;  1QST A;  4HNX B;  5DS0 A;  4B5O A;  3NH4 A;  2AFX A;  1DTD A;  2CTB A;  2GAN A;  2PR1 A;  3WT4 A;  2PQ8 A;  4ZY2 A;  3PGP A;  4OC5 A;  4MRI A;  4ZX9 A;  1LAP A;  2DF5 A;  4Q38 A;  5LRJ A;  4QBJ A;  3SHP A;  3VAR A;  1Q7L A;  2C6G A;  4PXB A;  4JWP A;  4MHN A;  4R3K A;  3S6K A;  3KAS A;  4Z65 A;  1IOI A;  2O28 A;  4KUB A;  5AG6 A;  2EO8 A;  2PJ4 A;  4HNW B;  5DWM A;  3SXO A;  4ONW A;  5D8N A;  1Q2Y A;  1MJ9 A;  2PJ2 A;  1YGH A;  3ISZ A;  5KTC A;  1XE4 A;  2PJ1 A;  4BMH A;  3FH4 A;  1B6B A;  1IU8 A;  2PCU A;  3IWG A;  4A37 A;  1RO5 A;  1CJW A;  1Z4R A;  2Z3N A;  5G20 A;  3GY9 A;  2PJ6 A;  1TKH A;  4HKF A;  1I1D A;  3PZJ A;  3K9U A;  2XEG A;  4CGN A;  1WWZ A;  3TE4 A;  4NJQ A;  1QSR A;  4P4E A;  1H8L A;  1IIC A;  4LX9 A;  3D68 A;  2Z11 A;  1A2Z A;  2RFH A;  3I1U A;  2EK9 A;  5IV0 A;  4MHY A;  4MXU A;  3UY5 A;  4A31 A;  3EO4 A;  4KSA A;  4EME A;  5ELY A;  2WSA A;  1IB1 E;  5D29 A;  1CPX A;  4NJR A;  5J1Q A;  2XEI A;  4JD6 A;  1FT7 A;  4UEF A;  3PBB A;  4P45 A;  2REF A;  4R7M A;  2BL1 A;  1AYE A;  2FXF A;  2OZG A;  3IO1 A;  2Z10 A;  3IJ3 A;  3FX6 A;  2JLM A;  3VWE A;  2GLF A;  3QAH A;  2PR8 A;  1XFO A;  2HQY A;  1CG2 A;  3FYN A;  2B5G A;  4UFW A;  4F9V A;  3SJF A;  2IJZ A;  3IU2 A;  2G3A A;  5E96 A;  5J8F A;  4R6T A;  1GYT A;  3V7Z A;  3B8G A;  3RYO A;  3T8W A;  3BHX A;  3MN8 A;  4NFR A;  1VHO A;  1CP6 A;  3GLJ A;  2ZEE A;  4MCQ A;  2RB7 A;  4PSX A;  4CRY B;  2VZZ A;  1VHE A;  4Q36 A;  4CYQ A;  4KS9 A;  1Z8T A;  1M4G A;  2B5G B;  4QUS A;  1QMU A;  2DPT A;  4PQA A;  2AFW A;  2EUI A;  1F2O A;  1ZG7 A;  3BJ7 A;  1FY7 A;  4O23 A;  4A2Z A;  1S60 A;  5HVH A;  1XBU A;  1S7K A;  2ABZ A;  2Q51 A;  3LOD A;  4AXV A;  4A30 A;  2QVP A;  3KR5 A;  1JQG A;  3K9T A;  4OIW A;  3IWE A;  4KOY A;  4II9 A;  1KWM A;  3S6F A;  5A28 A;  2B4D B;  2YNC C;  5K8O A;  3GIU A;  2PRB A;  4FD7 A;  4UCM A;  3FBU A;  1HEE A;  4NGQ A;  3WC6 A;  2CNM A;  2CY2 A;  3TOA A;  4CAX A;  4K3N A;  2JBJ A;  5J8C A;  1ZLI A;  3NH5 A;  3T9Y A;  4FD4 A;  4JJX A;  5G21 A;  4MY3 A;  3DGV A;  4P4I A;  3TX8 A;  2GRE A;  4DYO A;  2QEC A;  2R7H A;  1AMP A;  3VH9 A;  3B3C A;  4GM5 A;  5ISV A;  3FEC A;  4AVA A;  4B10 A;  4IHM A;  4NSQ A;  4OC2 A;  2VL1 A;  2Q4Z A;  1YVO A;  5JPH A;  2YND A;  2ZOF A;  4NGR A;  1B87 A;  4E2A A;  2PJ9 A;  4KVO E;  4UEZ A;  4GXH A;  4UCP A;  2P6F A;  4KLW A;  2REE A;  4P4D A;  1BAV A;  5I0C A;  2YNC A;  3D4U A;  2PJ3 A;  1Z2L A;  3QNV A;  5F48 A;  2FCK A;  3H8G A;  4KOX A;  4ZI6 A;  3KI9 A;  1SQH A;  1YQE A;  2PIY A;  2FIW A;  2RC4 A;  2WPX A;  2Z3L A;  4PXE A;  3WC5 A;  3IIB A;  1TXR A;  3F0A A;  3I9S A;  4HPS A;  4P10 A;  3FXT A;  4C68 A;  1ELL P;  3SJG A;  4F9U A;  2EVN A;  2F7V A;  3B3S A;  3FEE A;  4G1P A;  2ANP A;  3R95 A;  3I3G A;  1DE4 C;  4CAV A;  2GE3 A;  5LYD A;  3B2Y A;  4XPK A;  3VWD A;  2AFM A;  3B3T A;  4B14 A;  4KLV A;  4OC0 A;  1MJA A;  2PDO A;  3KQZ A;  3JVN A;  4J3G A;  5IB0 A;  4B11 A;  3QAY A;  5JGF A;  2Q04 A;  4A33 A;  1F2P A;  2FSR A;  1YW4 A;  3LMS A;  3QB8 A;  1TIQ A;  2IMO A;  4KOR A;  4M85 A;  5CNP A;  1KUX A;  3R96 A;  3B3V A;  3DR6 A;  4L89 A;  3D66 A;  4B13 A;  1ZLH A;  4Q7A A;  2ZEG A;  4KOU A;  4UWJ A;  1VGY A;  4KVX A;  1Z4E A;  1YLO A;  2V8G A;  1Y9K A;  2FT0 A;  4UF4 A;  1PUA A;  4L8A A;  1K4J A;  4LUA A;  1P0H A;  2Z3O A;  4XPL A;  2I00 A;  7CPA A;  3NA6 A;  1Y7E A;  4R57 A;  5F09 A;  4AVB A;  1X12 A;  4UWI A;  4QC6 A;  4Y49 C;  4FBE A;  2ZW5 A;  2Q44 A;  2ZEP A;  3SI2 A;  1R43 A;  3BXM A;  2PJC A;  5AG4 A;  5AG5 A;  1OZP A;  1ZG9 A;  4AG9 A;  3EFA A;  2PJA A;  2AFO A;  5LRK A;  1XOV A;  1YVK A;  3ISX A;  4UCN A;  2PJ5 A;  2PSW A;  3G3S A;  3OWC A;  2NMT A;  1ZO0 A;  2ZEH A;  4IUS A;  4PK2 A;  5AG7 A;  5H84 A;  2OOT A;  2B3V A;  3W91 A;  2AFZ A;  2Q4V A;  1ARL A;  4YFJ A;  3IU1 A;  4KOT A;  2Q7S A;  1MK4 A;  2Z0Z A;  4K30 A;  3PB7 X;  4OC3 A;  4KUA A;  5BWA B;  4MFQ A;  3CPA A;  4NGP A;  1Y7R A;  2YGW A;  2OZH A;  3N7Z A;  4XPD C;  1Q2C A;  3BI0 A;  2PJ0 A;  2CIJ A;  3E0K A;  3IEH A;  2K5T A;  3PP9 A;  4MCR A;  4ZX8 A;  4YU9 A;  3PB6 X;  4TNU A;  4E8O A;  2ZEF A;  2ZEM A;  4H89 A;  4CGP A;  4ZY1 A;  4MBU A;  5CBM A;  4F8Z A;  4CGM A;  2PRQ A;  5K8P A;  4MHZ A;  4BBH A;  2R8V A;  4RUH A;  2YNE A;  1QSN A;  2BO9 A;  4ZBG A;  1XJO A;  4CAF A;  4OAD A;  4KSI A;  4KZT A;  4PXD A;  3SJE A;  3V8I A;  5HXD A;  5JH9 A;  4UIA A;  4MCP A;  1NMT A;  1J4J A;  3FB3 A;  2AJ6 A;  2FE7 A;  4YGO A;  3WR7 A;  3D7H A;  3RNZ A;  4X2T A;  3WAB A;  5LYF A;  3FF3 A;  2WPW A;  3NE7 A;  4UBR A;  2H5M A;  1UWY A;  1HDU A;  2R1I A;  4A94 A;  2AE6 A;  4GS4 A;  4A39 A;  1N71 A;  4WWV A;  1Y0Y A;  1RXT A;  2C6P A;  2F8H A;  4WJB A;  1RTQ A;  5DWN A;  3TC8 A;  3JTK A;  3KR4 A;  3GKR A;  3KGQ A;  2OR4 A;  2POK A;  3EXN A;  4BD9 A;  4MY0 A;  2ZOG A;  4MCS A;  4UEE A;  3SI1 A;  1UFH A;  4UFX A;  1AUG A;  1Z8W A;  3KQX A;  4KOV A;  2OZU A;  1CBX A;  3W6S A;  5C82 A;  3IFE A;  3TO6 A;  1M4I A;  5A27 A;  5HMN A;  5K8M A;  4MFP A;  3TTH A;  3D67 A;  1X10 A;  2OH1 A;  3G8W A;  3S9N A;  2C6C A;  1IYK A;  4ZY0 A;  4UIB A;  4CS0 B;  2BSW A;  2OU2 A;  2ZED A;  3C26 A;  4OC4 A;  1V0C A;  1TKJ A;  2Z3K A;  3CXQ A;  4IF5 A;  2FIA A;  4MFK A;  3SJX A;  4EFD A;  5KTD A;  3IWW A;  3HLP A;  2GU2 A;  3JUW A;  4H2K A;  2CTC A;  1I12 A;  1LRZ A;  2F5I A;  2FL4 A;  3D2P A;  3DSB A;  3JRU A;  1JWQ A;  4JLY A;  4CPA A;  2DXQ A;  4EVY A;  3KHX A;  4MFJ A;  1NSL A;  2I79 A;  2D4O A;  5GCN A;  1LAM A;  2HUZ A;  2PJ8 A;  2Q0Y A;  1R3N A;  5EMI A;  3GUX A;  4P4B A;  3R9G A;  1YK3 A;  3BI1 A;  4MFL A;  1XMB A;  4MJ8 A;  4PV6 A;  5AGE A;  3SI0 A;  3ZJ0 A;  4BIN A;  2P6G A;  2ATR A;  1QQ9 A;  2WUU A;  4FD6 A;  4M6H A;  2JDC A;  5THW A;  2IL4 A;  4OID A;  4CAE A;  3L2N A;  4B6Z A;  4R76 A;  1Q2D A;  3F8K A;  1Y0R A;  1NSA A;  2EK8 A;  1ARM A;  4AB7 A;  4M6G A;  4X3R A;  1LAN A;  3NH8 A;  2GLJ A;  4P4J A;  4A32 A;  2C27 A;  2ZEL A;  3CT9 A;  2FS5 A;  3P2H A;  3MGD A;  3LAC A;  3GYA A;  3RBU A;  4UFV A;  1Z9U A;  3PBE A;  5EC4 A;  3ZZI A;  3CZX A;  1PYT B;  3DDD A;  4H6U A;  5HH1 A;  3FMC A;  3PB4 X;  3FVL A;  3IGR A;  4IK2 A;  3H5Z A;  5F46 A;  4R9M A;  1I21 A;  4JZ0 A;  4AG7 A;  1CM0 A;  4B5P A;  3BJ8 A;  4P4F A;  2XEJ A;  4RI1 A;  1PU9 A;  4W9Y A;  1Z5R A;  4CYN A;  3B7I A;  4JXQ A;  5HVG A;  8CPA A;  3DLJ A;  2IQ6 A;  2NSM A;  1S5K A;  2BCO A;  3LD2 A;  2Z3P A;  3R9E A;  3F5B A;  4FAI A;  1PCA A;  4QVT A;  2VEZ A;  4FUU A;  4MMO A;  4XNH C;  1YW6 A;  2V8V A;  5LYL A;  2BEI A;  2HV2 A;  3KL9 A;  3RZA A;  3S6H A;  1EE3 P;  4ZYQ A;  1BLL E;  1TF8 A;  1KUY A;  3RO0 A;  2DEA A;  4EWT A;  1KZF A;  1S7F A;  2B4B A;  4FD5 A;  2J8M A;  1VKC A;  3N5F A;  2VI7 A;  4NGT A;  3IC1 A;  4B5P B;  4R8F A;  3TFY A;  3H8F A;  4P44 A;  2PVW A;  2JDD A;  2WZN A;  4U9Z A;  3NE8 A;  2QIR A;  1TKF A;  4A38 A;  4MI4 A;  4YRH A;  4MHD A;  2Q4Y A;  3FIX A; 
#chains in the Genus database with same CATH homology
 4KVM E;  4CYP A;  4C2Y A;  1KUV A;  4M3S A;  3TOB A;  5KTA A;  5G1Z A;  2Z3M A;  5EBV A;  3FRM A;  3EC4 A;  2VBQ A;  2ZXV A;  2DPS A;  1IYL A;  1XEB A;  4KSF A;  5G22 A;  5F49 A;  4F0Y A;  3A9L A;  2J8R A;  1U6M A;  4ZGY B;  2R98 A;  4DNC A;  1XF8 A;  1NE9 A;  4Y49 B;  1VHS A;  4AVC A;  1IID A;  2B3U A;  4XNH B;  4C2Z A;  4I49 A;  4RS2 A;  3W6X A;  4ORF A;  1P4N A;  4C2X A;  2QML A;  2CNS A;  4R87 A;  2JEV A;  1R57 A;  3R1K A;  4CRZ B;  3TT2 A;  4NCZ A;  4R3L A;  2OB0 A;  2ZW6 A;  3BLN A;  2D4P A;  5FVJ A;  1S3Z A;  3T90 A;  2Y0M A;  4MFZ A;  2VZY A;  1MJB A;  3R9F A;  5JQ4 A;  3EY5 A;  1S7N A;  2B4D A;  3DR8 A;  4XPD B;  4CYO A;  4H6Z A;  2Q4Y A;  3FNC A;  4PSW A;  4NXY A;  4ONU A;  4JXR A;  3KKW A;  2B58 A;  2CNT A;  1BOB A;  3TO7 A;  1GHE A;  2CXA A;  1YR0 A;  2G3T A;  2ZW4 A;  1QSM A;  1WK4 A;  2P0W A;  4E0A A;  1QSO A;  2G0B A;  4F0X A;  3SXN A;  1ON0 A;  1XIX A;  4HNY B;  4CAW A;  4CGO A;  2J8N A;  4B12 A;  4C7I A;  2GIV A;  3D2M A;  4A95 A;  1L0C A;  1M44 A;  5F47 A;  3DNS A;  4CGL A;  4PK3 A;  5C88 A;  4C7H A;  1YLE A;  2A4N A;  1Y9W A;  2Q7B A;  3D8P A;  5IX3 A;  3TO9 A;  1S7L A;  3D3S A;  1YRE A;  2KCW A;  3P2F A;  4X5K A;  3H4Q A;  3S6G A;  4KOS A;  1XMT A;  1BO4 A;  2BUE A;  1M4D A;  2ARH A;  2PC1 A;  2VQY A;  4NF1 A;  4U9Y A;  2ZPA A;  4QB9 A;  3CXS A;  2VXK A;  3CXP A;  4U5Y A;  1M1D A;  2P6E A;  4F6A A;  5H86 A;  3TCV A;  4UA3 A;  4NEX A;  4OAE A;  1YX0 A;  4KOW A;  2ZW7 A;  4OLL A;  1QST A;  4HNX B;  4B5O A;  2GAN A;  2PR1 A;  2PQ8 A;  3PGP A;  4Q38 A;  4QBJ A;  3SHP A;  4R3K A;  4JWP A;  3S6K A;  2O28 A;  4KUB A;  3SXO A;  5AG6 A;  4HNW B;  5DWM A;  1Q2Y A;  1MJ9 A;  1YGH A;  5KTC A;  1XE4 A;  4BMH A;  1B6B A;  3IWG A;  1RO5 A;  1CJW A;  1Z4R A;  2Z3N A;  5G20 A;  3GY9 A;  4HKF A;  1I1D A;  3PZJ A;  3K9U A;  4CGN A;  1WWZ A;  3TE4 A;  1QSR A;  1IIC A;  4LX9 A;  2Z11 A;  5IV0 A;  3UY5 A;  4A31 A;  3EO4 A;  4KSA A;  2WSA A;  1IB1 E;  4JD6 A;  2REF A;  2BL1 A;  2OZG A;  2FXF A;  2Z10 A;  2JLM A;  3VWE A;  3QAH A;  2PR8 A;  2HQY A;  3FYN A;  4UFW A;  2B5G A;  3IU2 A;  2G3A A;  5E96 A;  5J8F A;  3B8G A;  3RYO A;  4PSX A;  4CRY B;  2VZZ A;  4Q36 A;  4CYQ A;  4KS9 A;  1M4G A;  2B5G B;  4QUS A;  2DPT A;  2EUI A;  3BJ7 A;  1FY7 A;  4A2Z A;  1S60 A;  1S7K A;  3LOD A;  4A30 A;  4II9 A;  3IWE A;  4KOY A;  3S6F A;  5A28 A;  2B4D B;  2YNC C;  2PRB A;  4FD7 A;  4UCM A;  3FBU A;  2CNM A;  2CY2 A;  3TOA A;  4CAX A;  5J8C A;  3T9Y A;  4FD4 A;  4JJX A;  5G21 A;  4MY3 A;  2QEC A;  2R7H A;  5ISV A;  4AVA A;  4B10 A;  4NSQ A;  1YVO A;  5JPH A;  2YND A;  4E2A A;  1B87 A;  4KVO E;  4UCP A;  2P6F A;  4KLW A;  2REE A;  5I0C A;  2YNC A;  5F48 A;  2FCK A;  4KOX A;  1SQH A;  2WPX A;  2Z3L A;  2FIW A;  2RC4 A;  3F0A A;  3I9S A;  3FXT A;  4C68 A;  2EVN A;  3R95 A;  3I3G A;  4CAV A;  2GE3 A;  4XPK A;  3VWD A;  4B14 A;  4KLV A;  1MJA A;  2PDO A;  3JVN A;  4J3G A;  5IB0 A;  4B11 A;  2Q04 A;  4A33 A;  2FSR A;  3QB8 A;  4M85 A;  1TIQ A;  4KOR A;  5CNP A;  3R96 A;  1KUX A;  3DR6 A;  4L89 A;  4B13 A;  4KOU A;  4UWJ A;  4KVX A;  1Z4E A;  1Y9K A;  2FT0 A;  1PUA A;  4L8A A;  1K4J A;  4LUA A;  1P0H A;  2Z3O A;  4XPL A;  2I00 A;  4R57 A;  4AVB A;  4UWI A;  4QC6 A;  4Y49 C;  2ZW5 A;  2Q44 A;  5AG4 A;  5AG5 A;  1OZP A;  4AG9 A;  3EFA A;  1YVK A;  4UCN A;  2PSW A;  3G3S A;  3OWC A;  2NMT A;  1ZO0 A;  4IUS A;  4PK2 A;  5AG7 A;  5H84 A;  3W91 A;  4YFJ A;  2B3V A;  2Q4V A;  3IU1 A;  4KOT A;  1MK4 A;  2Z0Z A;  4K30 A;  4KUA A;  5BWA B;  4MFQ A;  1Y7R A;  2YGW A;  2OZH A;  3N7Z A;  4XPD C;  1Q2C A;  3E0K A;  2K5T A;  3PP9 A;  4E8O A;  4H89 A;  4CGP A;  4MBU A;  4CGM A;  4BBH A;  2R8V A;  2YNE A;  1QSN A;  4ZBG A;  4CAF A;  4OAD A;  4KZT A;  3V8I A;  1NMT A;  1J4J A;  3FB3 A;  2AJ6 A;  2FE7 A;  4YGO A;  3WR7 A;  2WPW A;  3NE7 A;  4UBR A;  2H5M A;  2R1I A;  2AE6 A;  4GS4 A;  1N71 A;  1RXT A;  5DWN A;  3JTK A;  3GKR A;  3EXN A;  4MY0 A;  1UFH A;  4UFX A;  4KOV A;  2OZU A;  3W6S A;  5C82 A;  3TO6 A;  5HMN A;  1M4I A;  5A27 A;  4MFP A;  3TTH A;  2OH1 A;  3G8W A;  1IYK A;  4CS0 B;  2BSW A;  2OU2 A;  3C26 A;  1V0C A;  2Z3K A;  3CXQ A;  4IF5 A;  2FIA A;  4MFK A;  5KTD A;  3JUW A;  1I12 A;  1LRZ A;  2F5I A;  2FL4 A;  3D2P A;  3DSB A;  4JLY A;  2DXQ A;  4EVY A;  4MFJ A;  1NSL A;  2I79 A;  2D4O A;  5GCN A;  2HUZ A;  2Q0Y A;  3R9G A;  1YK3 A;  4MFL A;  4MJ8 A;  4PV6 A;  5AGE A;  3ZJ0 A;  2P6G A;  2ATR A;  2WUU A;  4FD6 A;  2JDC A;  2IL4 A;  4CAE A;  1Q2D A;  3F8K A;  4AB7 A;  4A32 A;  2C27 A;  2FS5 A;  3P2H A;  3MGD A;  3GYA A;  4UFV A;  1Z9U A;  5EC4 A;  3ZZI A;  3DDD A;  4H6U A;  5HH1 A;  3IGR A;  3H5Z A;  5F46 A;  4R9M A;  1I21 A;  4AG7 A;  1CM0 A;  4B5P A;  3BJ8 A;  4CYN A;  4RI1 A;  1PU9 A;  4JXQ A;  1S5K A;  3LD2 A;  3R9E A;  2Z3P A;  3F5B A;  4QVT A;  2VEZ A;  4XNH C;  2BEI A;  2HV2 A;  3S6H A;  1KUY A;  1KZF A;  1S7F A;  2B4B A;  4FD5 A;  2J8M A;  1VKC A;  4B5P B;  2VI7 A;  3TFY A;  2JDD A;  4U9Z A;  2QIR A;  4MI4 A;  4YRH A;  4MHD A;  2X7B A;  3FIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...