4KP3C

Crystal structure of myova-gtd in complex with two cargos
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
EDEGALAKSPLQLTTDDVYDISYVVGRELMALGSDPRVTRLQFKIVRVMEMLETLVNEGSLAVEELRMERDNLKQEVEGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of cargo recognitions for class V myosins
pubmed doi rcsb
source organism Mus musculus
molecule tags Motor protein/protein transport
molecule keywords Unconventional myosin-Va
total genus 32
structure length 81
sequence length 81
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1770 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4kp3C00
4KP3C
chains in the Genus database with same CATH superfamily
3ZN0B 4EXTA 4Q25A 4GKJT 4DV6T 1W9RA 2NW7A 4ZXLA 2VKDA 3UUNA 3PE0A 1XZYA 4IE4A 4OYKA 4DV4T 2KZ7B 2A9UA 1UX5A 4V1Av 3ZJ2A 3G06A 4GK0E 5HXEA 1OEDE 1Z8UA 3QOFA 3UULA 5HEUA 4AXPA 3ETUA 2BS2A 3CVRA 2C5KT 2XQAA 4YFSA 1W0BA 3UUBA 4AIUA 5ABEA 2M6IA 3QB5K 2BKOA 5TAOA 2C5IT 2VB6A 3AEAA 2XJ7A 3KV9A 3L39A 3P4PA 2OA5A 5CA1E 2YDRA 2K9AA 2BBHA 3I9WA 2IIUA 1D1AA 3LBXA 4IL9A 3MA9A 2CA5A 5AQMB 3R84B 2RA1A 1T98A 3VRBA 4F6RC 4AKGA 4H9SE 2UXDT 1OEDC 3L8RA 1X9BA 4QH5A 4JI1T 2XQ8A 4QKNA 4IDOA 4TN7B 3FBZA 4DR4T 1HNWT 2AE9A 3UU3A 3K3QC 3NRXA 3PTRB 4X5TA 2WQYA 3ZLIA 2EHOC 4DMWA 4LMJA 1O3XA 2K5BB 1V9DA 3HI2A 4KMCA 5AQSB 3J9X1 4YT0A 2Y48B 2W67A 5LG3A 2WP9A 3KVBA 1KNPA 3JAEA 3UFEA 2BVLA 4CZZB 4JLEA 4CN6A 3LK42 1IJ6A 4AQFA 5JDNA 2V5CA 3ZCIA 4DR7T 5HXRA 4IE0A 5IHYA 4XBFB 3AE3A 5JR9B 2KNDA 1XDOA 2IC9A 2XQ6A 3Q5XA 1XNQT 1KF6A 2IUBA 4N78D 3AEEA 3KV6A 4UELA 4WW0A 4C91A 4NIQA 4DBRA 2IMLA 5CA0E 2LSKA 2ODUA 2LSJA 2QA7A 1U5PA 5AQPB 2CCQA 2KXPB 3PUYF 4HWHA 3IF8B 4WBNE 3GN5B 4U74A 2KSRA 3RQWA 4XZCA 3SFEA 1N34T 3F57A 3ZSTA 1Z0PA 2V5DA 3K1SA 5HWXA 4DR3T 2WAUA 3O1IA 1SE7A 3KDSE 1G8XA 4Z91A 3RPUA 2Z6EA 2LM2A 4TV9E 4PJNA 3BQIA 3N9QA 1GQEA 3NRYA 3C4XA 1MMAA 1J1JA 3U3IA 4IL4A 2XAGB 1S94A 4LF5T 1UUSA 4YSYA 3O1HA 4EEDA 2J47A 2X9WA 2X9YA 2VQET 2KLQA 5KX5E 2V7MA 2WY2A 5F8PA 2WSSV 2YINA 3EDVA 3ONJA 4JBWF 5H6QB 1UGOA 2WWVA 1HNZT 4YSZA 3UFGA 4NXMT 2JMKA 2CBJA 2BS4A 5FL0A 3QK6A 4G2AA 4NPPA 2K3WA 3AE6A 4IHJE 4X20E 2X51A 2V6YB 3P50A 2NR4A 4ASKA 4IIJE 5AQGB 2CRBA 2WZIA 5JREA 2Q9QB 3QUJA 5LHGB 4MALA 1I94T 2D0UA 2WU2A 3ONLC 2W0GA 1QLBA 5FYMA 5L3DB 3J7Yq 1US7B 5L47A 2YU2A 3M65A 5F3JA 4B3ST 2W4XA 3L3PA 5ABFA 2WM9A 4GOUA 3OKQA 2XQ7A 2V7LA 2YDSA 3ZCJA 3C64A 1JNZA 3N2KE 3EVYA 5LOVE 4JV5T 3GWHA 3ZC0A 2XQ9A 4K0KT 2WMOA 3EI0A 1D1CA 2X67A 2XAHB 4UEMA 4LF6T 3PUXF 4QXCB 3T8OA 3T1HT 2WBLA 3HKDE 3ETVA 4QWNB 5HCMA 1KFYA 1FEWA 4ZS2A 5AQQB 4CN4A 2IW5B 4TWDA 3DTOA 2CPTA 1SHZC 2M67A 2YOEA 3ZT6A 5KMGP 1HG2A 1HCIA 3UQ4A 4LMKA 3UQ7A 5IYZE 4IGUA 3EABA 5DJQC 3RI5A 4DV3T 2YEVC 1LVKA 3ANWA 4TWFA 5EK4A 1MMDA 3RC3A 3ZMUB 2XQ5A 2YN6A 1SUMB 2ZLYA 1ZEEA 2XUEA 3RRWA 1IAPA 4FI5A 2WB5A 3N9LA 1VOMA 3N2GE 1ZKEA 4HTEA 4DR1T 1XMQT 3SFDA 1HNXT 2CM0A 3N2OA 4H9NC 4P0AA 2KT9A 3K3NA 4HWDA 1BR0A 1JNRA 1UCUA 3ZKRA 1E7PA 2WZHA 2LOSA 2WDQA 4AQGA 3PUVF 2V7IA 2EHOB 1CUNA 4UVBB 4DVDA 1WCRA 2WMNA 2FJDA 3C51A 3Q9DA 4L0RA 3VU7H 5L3CB 2UXNB 3I9YA 4GKKT 2V6XA 2V26A 3F31A 4LFCT 2E5LT 1OEDB 5FXXA 3P4SA 4ERRA 5FXVA 2EHOD 3U78A 4YSXA 5HAXA 2R6GF 4ZEYA 1HF8A 1KK7A 4JI6T 4DUZT 1N36T 1KNZA 4KHZF 4ILUA 1WRDA 5HWYA 4F8HA 4A5XA 4BJMA 5FY0A 5C8YE 2SPCA 3GMIA 2N1GA 3PDYA 4HFHA 2MBGA 4CXWA 3ZT5A 4EAHA 3ZJ1A 3E0ZA 3HR0A 3FB2A 4FJOA 2BZBA 4JYAT 4B3TT 3AEBA 4UXNB 2CE7A 3W15B 2LRKA 1U4QA 5C3JA 4CI1B 2Y6XA 4YJ3E 5LA6E 4JI2T 1T8BA 2Q9QC 3AE5A 3VKGA 4YLHA 4YHHT 1MMGA 2NOXA 5FKYA 5JVDE 4TNVA 3CPZA 4C90A 5KXJA 2XZEA 2OLTA 3ZYKA 4DV5T 2BG9C 5JDGA 2LM9A 3PU8A 4KHPT 3NWIA 1MIYA 1MIWA 2IHR1 2YU1A 3KINB 2X68A 2JPFA 2L8KA 4GIWA 4IE5A 2VWAA 3N9OA 2CHNA 2NP9A 2XQ4A 3PJAA 4TNWA 3IHRA 3UTKA 1D1BA 2E8IA 2BG9A 4GYRA 4NUVA 2LRLA 4XAXB 4JI5T 1CHUA 1LKXA 2FJBA 1NWMX 1NAFA 1W0AA 3AE4A 5GONE 2OV9A 5FL1A 3MKDA 4B3MT 2WDVA 4OHFA 5EK2A 3V5UA 5FP3A 2MOZA 3CIRA 1WR6A 1ZP0A 4LMLA 5HXHA 1I6ZA 4HFIA 4AI6A 4OX9T 4H9PC 3AAEB 2B76A 4L9IA 3CMLA 3OJAA 4O2BE 5JR9A 3UU4A 5CFBA 5LNKA 2UUBT 1QUUA 3HKBE 1MNEA 4LF4T 2JJ9A 4UIGA 4ZI2C 4ZI3D 3AE7A 4J2CA 2D5UA 3LFMA 4K0UA 4KX6A 4U2YA 5LG4A 2BG9E 2PG8A 2HPJA 3PUWF 2D9DA 3I0OA 4UF0B 5DABA 3RIUC 4U72A 3PUGA 3RKOA 2FBWA 2J1DG 4GK5E 1Y01A 2LLYA 3FHNA 5AQOB 5LGTB 1HTJF 3N5LA 4KP3C 1VCTA 2CMRA 3AAAB 4ZI3C 4DMVA 5BR8T 2VKOA 3Q2MA 2FJEA 4PK4A 1YKHB 5LGUB 5AQTB 2L3LA 4AKRB 3RC8A 3P4WA 2ACXA 3ZT7A 2F4VT 2DWKA 4Z8XA 3RYCE 4HGAA 3DP7A 3QC9A 1WFDA 4ILBA 3AEFA 3LK3B 3V5SA 3ZMVB 3C98B 3H3MA 3KBTA 4UV8B 4EOZB 4HFCA 4HFVA 1KEYA 2DHRA 4QXBB 5JDFA 3TLWA 5HYAA 4DUYT 2JQHA 4AISA 3FZFB 2BKNA 2XAJB 3ZN1B 2CXFA 4QHOA 5HEHA 2K24A 3P4RA 4MBQA 5FY7A 4B3RT 3OVUA 3RGLA 4X1KE 4LFBT 3LSVA 3CKDA 2MTQA 2WS3A 3CX6B 4I43B 5AQUB 2LSGA 2C5JA 2LKHA 3F2EA 3HA4A 2VVSA 4HWFA 2PBIA 2PTFA 5A1LA 5ABFB 5LGNB 1E1HB 1HX1B 1ZV4X 1SA0E 2X9HA 3AXJB 3ZPOA 3Q5EA 3E08A 1D0XA 5AQJB 5C2TA 2LJLA 4YJ2E 3LBXB 1ZOYA 3L09A 3CQXC 3P4QA 4I4TE 2W00A 3SOLA 1XNRT 2H88A 2D0TA 2RPAA 5JDMA 1FMWA 4DV0T 5HEGA 5JQGE 2NTXA 3SRZA 3RHWA 5H6RB 2XAQB 1DU2A 2W62A 5LCYA 2ES0A 3K8PC 3ZYLA 1HX8A 4NXNT 4TV8E 3ANWB 3RIFA 3PJAJ 3H37A 1L0VA 5L4HA 4A97A 5JTGA 4TX5A 3NZPA 2QGSA 2DLRA 4O4HE 1IBKT 4O4IE 4IDZA 2W61A 4A56A 4U31A 1D0YA 2C0SA 2ZM8A 5JRCA 1WYCA 2IDOB 3AEDA 3UU8A 2LEHA 2IC6A 1FMVA 4MHCA 2UU9T 3A8YC 5HXSA 4YHJA 4E7ZA 4HFDA 5HEOA 5JR9C 2DI4A 4EZHA 3GN5A 3JC6C 3OYZA 4X62T 5DQVA 2NWBA 3TLSA 4CXYA 3X1DA 4KI0F 5IUXA 5L2LA 5CB4E 1T72A 1VCSA 2XM2A 4YY3T 3IEEA 4JUYA 3A5XA 1T7SA 2LT3A 3AA1B 1XMOT 4LF9T 2CLYC 4U7YA 1G73A 2JQ9A 2V8SV 4QH1A 4CI2B 5FMNA 3OTOT 4DV1T 4WYVA 3CK6A 3OBVE 2UUAT 2UXCT 3JCFA 4O4LE 5FNVE 3TLTA 5J2TE 3O9XA 4OFZA 4PNIA 4OYJA 2JQKA 2KWIB 4HWIB 1NENA 3CQCB 2N2NA 4HEAA 2M6BA 5HEJA 1WYBA 5E0OA 3IA3A 2NTYA 4CI3B 1S35A 4AKHA 2V6YA 5DQWA 1IZNB 2CEAA 2FJAA 1MNDA 2LSIA 3C50A 2V1DB 2VURA 3Q5DA 4I0UA 4X1IE 4X1YE 4O8SA 5FXZA 4AQFC 1H7CA 4YTMA 4DIDB 5LYJE 2UUCT 4YXDA 3TLVA 4ZHQE 2H7OA 3R6NA 5LMNT 3GA8A 3P7IA 3WAKA 1WR0A 2DL1A 2VVNA 2YDQA 1LVFA 4Z90A 5L3BB 2E9XB 3AA0B 5L3FB 2J4GA 4JEUB 3RX6A 2IAKA 2W63A 3RKGA 4A98A 4ZZCA 2JRKA 2XQYA 2W66A 5AQKB 2Y8DA 4WBOA 2YKSA 2I6HA 2MPKA 2ZMAA 1EZ3A 1XDPA 4PFPA 3NZQA 3KBUA 4H63V 5FVLA 2BS3A 3ZSSA 2A3DA 4TWHA 4WZXA 2JQQA 5BMVE 4DR2T 2N9DA 4EYUA 2XSBA 4ISSA 1IBMT 4KUMB 4LF8T 4NUUA 3SS1A 2ZM0A 3MK7C 5F5WA 5M4YA 4H9OC 3RRCA 4MLKA 2XHEB 4UR9A 2XM1A 2KMFA 4UVAB 5L4EA 1E2AA 2A2FX 3FZLB 3FZHB 3H3AA 4CQIA 2E9XC 3FXDB 3KV4A 4PJJA 1BR2A 1M7KA 3NBXX 5FXWA 4BAYB 2UXBT 5J1GA 3D0TA 3BK9A 2VASA 2ZM2A 4OK0A 4G63A 2JIWA 2CBIA 4DV2T 2FUPA 3C4WA 1Y64B 2VKHA 2W2UA 4E7SA 4EB6E 3TKLB 3VRAA 3UT5E 2BDEA 4CN1A 2X0YA 3UU6A 4IDNA 1NEKA 2X66A 4P0BA 2ODVA 4ISTA 4PK6A 2RP4A 5JDHA 3AE1A 2WCAA 3JC6D 4AKLA 3N9NA 4EIWA 2CXDA 3JADA 4DO0A 2V7JA 4YTPA 5ADXL 3O4XE 3BQKA 2B1EA 1YD8G 1VRBA 2Q9QD 4BA9A 3KVAA 3RYFE 4ADZA 1W09A 2LOPA 3FZKB 4H9RC 1HFAA 4P09A 5LHIB 1MIVA 3AECA 4U7IA 2E2AA 3UU5A 3RQUA 3ZMZB 4TUYE 4ZI7E 3WAJA 4COFA 1YQ4A 2AXDS 3CWZB 4YTNA 2I59A 2NW8A 4QXHB 2LSYA 3OPCA 4QH4A 4EEBA 2JMHA 3PUZF 3VR9A 2NW9A 2DNXA 5AQLB 5LBQB 4IREA 4U33A 1IBLT 5LMUT 2P9BA 3WI3A 4H9QC 3C4ZA 1YW0A 4ZOLE 1YQ3A 3ZMSB 4CXXA 2YK0A 1B7TA 2CWYA 2VKJA 3RIUA 3AB3B 2QVAA 3AXJA 4DNDA 3JAFA 3RH3A 4AKIA 3QNUA 2QYWA 2XSAA 5EK3A 3VKHA 5AQHB 5FVKA 4IDPA 3IBPA 3LDQB 2HN1A 5AQRB 2HH7A 5ABGA 4PJLA 3I0QA 4HFEA 5LBMA 2XPKA 1HG5A 4X65T 4DR5T 3VR8A 4JI3T 3HL6A 3B57A 4ZI2D 4X64T 4ZS3A 4DR6T 3OYXA 2ZM6T 2V7KA 2BG9B 5J2UE 4PK5A 4QX8B 2HPLA 4HFBA 1QSDA 2BKPA 2H89A 2EHOA 3MACA 3AE8A 4PAGA 4TZ4C 5LB7B 1UK5A 3BQLA 5AQVB 2ACZA 3LG7A 5FY1A 3PUAA 1FJGT 5LP6E 2X9XA 2KWHA 4BJNA 3CX8B 3S4UA 5AQFB 5JDQA 4DBQA 1OEDA 3AE2A 4PJMA 3RF1A 3FZMB 2VQFT 1HR0T 5JDLA 5AFUL 4JI7T 3RYHE 3EUHA 5LJNA 2QRXA 3K3OA 2BBJA 2DWGA 3MXZA 3B5MA 2VL0A 5JRCB 2CLYB 1YXRA 1AJ3A 4L5GA 5EZYE 2KINB 3P8CD 2CHOA 3EDUA 4I50E 2LHRA 2XAFB 3HKEE 2E5VA 2HHHT 4HWCA 3PUQA 2I0MA 1ZHCA 2H3RA 3O1JA 5AQNB 5IWAT 1WLXA 4UF0A 4P1NA 2X0HA 2LE8A 4EV6A 4X66T 4U2ZA 1BR1A 2A72A 2Q9QA 3I1AA 4I55E 5LHHB 4PFOA 1UX4A 3EHZA 4U3CA 1XWMA 1YKEB 3ZC1A 3NVOA 5LJMA 3N9PA 2GK9A 5ABHA 1J5ET 3B13A 1OXZA 1D0ZA 3DJBA 4MFRA 4H63H 1HS7A 3RLFF 4HKAA 5CJ5A 4ZZBA 3N9MA 3SWHA 2D2SA 3TLUA 3ZMTB 4AQYT 3PV0F 3LJCA 3ZYMA 3MZKB 1X79A 1N32T 2MAWA 1MMNA 2BVMA 1R8IA 2PFVA 4IDQA 2J62A 3QB5A 4HE8A 2X0LB 4ILCA 2XTLA 3UUXB 4PW8A 4M1PA 5HCJA 3NKZA 3PU3A 4B6XA 3AEGA 3KFWX 5LXTE 2CWOA 4LF7T 2DCFA 4EGWA 3Q5WA 4DV7T 2HN2A 2L9QA 2CXLA 1LRZA 3ESLA 2VL8A 5HXCA 1N33T 2VK9A 5J0ZA 2PJQA 3FXEB 3LK2B 5L3EB 3AVSA 5ETWA 3EAMA 4EYYR 3RYIE 2WWUA 4HN9A 1FIOA 2XY8B 2UXXB 2E9XA 3ABVA 2WDRA 4UVCB 1BR4A 4JI4T 4O2AE 3KV5A 3CX7B 2LKGA 2G0UA 2MYSA 3M3ZB 4JI8T 1UURA 3PUSA 2LHNA 2H7VC 3A7MA 5CGMA 3HKCE 2K48A 3MJXA 3AVRA 3ZEFB 3ONXA 4QX7B 5JH7E 3T1YT 4ILAA 4EZ4A 2XASB 1OWAA 2E9XD 3UUMA 5AQIB 3RIAA 3VHLA 3AAIA 1IJ5A 1J5WA 2WU5A 3AE9A 1KNRA 3PURA 4IT4A 4JEHB 4KBMB 4O4JE 5L3GB 4ANJA 2XQ3A 3E22E 4UV9B 3AA6B 4IE6A 4WNKA 3FBLA 4LFAT 3CQGB 4GYSA 5KDMC 1M62A 4JI0T 3AA7B 4IE7A
chains in the Genus database with same CATH topology
3ZN0B 4EXTA 2NW7A 3UUNA 2VKDA 3PE0A 4IE4A 4OYKA 2KZ7B 1UX5A 4V1Av 3ZJ2A 4GK0E 5HXEA 3UULA 4AXPA 3ETUA 3CVRA 2C5KT 4YFSA 5TAOA 2C5IT 2VB6A 3KV9A 2OA5A 5CA1E 2K9AA 3I9WA 3R84B 1D1AA 3LBXA 3MA9A 2CA5A 4AKGA 2RA1A 1T98A 4F6RC 4H9SE 4QKNA 4TN7B 3FBZA 3K3QC 3NRXA 3PTRB 3ZLIA 2EHOC 4DMWA 1O3XA 2K5BB 1V9DA 3HI2A 4KMCA 3J9X1 2Y48B 3KVBA 3UFEA 2BVLA 4JLEA 3LK42 1IJ6A 4AQFA 5JDNA 3ZCIA 5HXRA 4IE0A 5IHYA 4XBFB 5JR9B 2KNDA 3Q5XA 2IC9A 4N78D 3KV6A 4UELA 4C91A 4WW0A 4DBRA 5CA0E 2LSKA 2LSJA 2ODUA 2QA7A 1U5PA 2CCQA 2KXPB 3IF8B 4WBNE 3GN5B 4U74A 4XZCA 3F57A 1Z0PA 5HWXA 2WAUA 3O1IA 3KDSE 1G8XA 3RPUA 2Z6EA 4TV9E 4PJNA 3BQIA 3N9QA 3NRYA 3C4XA 1MMAA 3U3IA 2XAGB 1S94A 3O1HA 2X9WA 2X9YA 2KLQA 5KX5E 2V7MA 5F8PA 2WSSV 2YINA 3EDVA 5H6QB 2JMKA 3QK6A 4G2AA 4IHJE 4X20E 2X51A 4ASKA 4IIJE 5JREA 2Q9QB 3QUJA 5LHGB 4MALA 2D0UA 5FYMA 5L3DB 2W0GA 3J7Yq 1US7B 2YU2A 3M65A 5F3JA 3L3PA 2WM9A 4GOUA 3OKQA 3ZCJA 2V7LA 3C64A 3N2KE 3EVYA 5LOVE 3GWHA 3ZC0A 2WMOA 4UEMA 1D1CA 2X67A 2XAHB 4QXCB 3T8OA 2WBLA 3HKDE 3ETVA 4QWNB 1FEWA 4ZS2A 2IW5B 3DTOA 2M67A 1SHZC 5KMGP 1HG2A 1HCIA 5IYZE 4IGUA 5DJQC 2YEVC 1LVKA 3ANWA 5EK4A 1MMDA 3RC3A 3ZMUB 2ZLYA 1ZEEA 2XUEA 3RRWA 1IAPA 4FI5A 3N9LA 1VOMA 3N2GE 1ZKEA 4HTEA 2CM0A 3N2OA 4H9NC 4P0AA 2KT9A 3K3NA 1BR0A 1UCUA 2LOSA 4AQGA 2V7IA 2EHOB 1CUNA 4UVBB 4DVDA 3C51A 2WMNA 3VU7H 3Q9DA 4L0RA 5L3CB 2UXNB 3I9YA 2V26A 3F31A 5FXXA 4ERRA 5FXVA 2EHOD 3U78A 5HAXA 1HF8A 1KK7A 1KNZA 4ILUA 1WRDA 5HWYA 4BJMA 5FY0A 5C8YE 2SPCA 3GMIA 2N1GA 3PDYA 2MBGA 4CXWA 4EAHA 3ZJ1A 3E0ZA 3HR0A 3FB2A 4FJOA 2BZBA 4UXNB 2CE7A 3W15B 1U4QA 4CI1B 2Y6XA 4YJ3E 5LA6E 3VKGA 2Q9QC 4YLHA 1MMGA 2NOXA 5JVDE 4C90A 3CPZA 3ZYKA 5JDGA 2LM9A 3PU8A 1MIYA 1MIWA 2YU1A 3KINB 2X68A 2JPFA 2L8KA 4GIWA 4IE5A 2VWAA 3N9OA 2NP9A 3IHRA 3UTKA 1D1BA 2E8IA 4NUVA 4GYRA 4XAXB 4CZZB 5ADXL 1LKXA 5GONE 1NWMX 1NAFA 3MKDA 4OHFA 5EK2A 3V5UA 5FP3A 2MOZA 1WR6A 5HXHA 4AI6A 4H9PC 3AAEB 4L9IA 3CMLA 3OJAA 4O2BE 5JR9A 5LNKA 1QUUA 3HKBE 1MNEA 2JJ9A 4UIGA 4ZI2C 4ZI3D 4J2CA 2D5UA 3LFMA 4K0UA 5LG4A 2PG8A 2HPJA 3I0OA 4UF0B 5DABA 4U72A 3PUGA 3RKOA 2J1DG 4GK5E 5LGTB 3FHNA 1HTJF 3N5LA 4KP3C 2CMRA 3AAAB 4ZI3C 4DMVA 2VKOA 3Q2MA 4PK4A 1YKHB 5LGUB 2L3LA 4AKRB 3RC8A 2ACXA 2DWKA 4Z8XA 3RYCE 4HGAA 3DP7A 3QC9A 3V5SA 3ZMVB 3LK3B 3C98B 4UV8B 3KBTA 4EOZB 4HFVA 4QXBB 2DHRA 5JDFA 5HYAA 2XAJB 3ZN1B 2CXFA 4QHOA 2K24A 4MBQA 5FY7A 4X1KE 3CX6B 3CKDA 2MTQA 4I43B 2LSGA 2C5JA 3F2EA 3HA4A 5A1LA 2PBIA 5LGNB 1E1HB 2X9HA 1ZV4X 1SA0E 3ZPOA 3E08A 1D0XA 2LJLA 4YJ2E 3LBXB 3L09A 3CQXC 4I4TE 2W00A 3SOLA 2D0TA 5JDMA 1FMWA 5JQGE 2NTXA 3SRZA 5H6RB 2XAQB 2W62A 5LCYA 2ES0A 3K8PC 3ZYLA 1HX8A 4TV8E 3ANWB 3H37A 4TX5A 3NZPA 2QGSA 2DLRA 4O4HE 4O4IE 4IDZA 2W61A 4A56A 1D0YA 2C0SA 2ZM8A 5JRCA 1WYCA 2LEHA 2IC6A 1FMVA 4MHCA 5HXSA 4YHJA 4E7ZA 5JR9C 2DI4A 4EZHA 3GN5A 3JC6C 3OYZA 5DQVA 2NWBA 4CXYA 5L2LA 5CB4E 3IEEA 4JUYA 3A5XA 2LT3A 3AA1B 2CLYC 1G73A 4CI2B 5FMNA 3OBVE 5FNVE 4O4LE 5J2TE 3O9XA 4OFZA 4PNIA 4OYJA 2KWIB 3CQCB 2N2NA 4HEAA 1WYBA 5E0OA 2NTYA 4CI3B 1S35A 4AKHA 3ZYMA 5DQWA 3C50A 1IZNB 2CEAA 1MNDA 2LSIA 2V1DB 4X1IE 4X1YE 5FXZA 4AQFC 5LYJE 4O8SA 1H7CA 4ZHQE 2H7OA 3R6NA 3GA8A 3P7IA 3WAKA 1LVFA 5L3BB 2E9XB 3AA0B 5L3FB 4JEUB 3RX6A 2IAKA 2W63A 2JRKA 2XQYA 2Y8DA 4WBOA 2ZMAA 1EZ3A 4PFPA 3NZQA 3KBUA 4H63V 2A3DA 2JQQA 5BMVE 2N9DA 4EYUA 4ISSA 4KUMB 4NUUA 3SS1A 2ZM0A 3MK7C 5M4YA 4H9OC 3RRCA 4MLKA 2XHEB 2KMFA 4UVAB 2A2FX 3H3AA 4CQIA 2E9XC 3FXDB 3KV4A 4PJJA 1BR2A 3NBXX 5FXWA 4BAYB 5J1GA 3D0TA 3BK9A 2VASA 2ZM2A 4OK0A 4G63A 3C4WA 1Y64B 2VKHA 4E7SA 4EB6E 3TKLB 3UT5E 2BDEA 4P0BA 2X66A 2ODVA 4ISTA 4PK6A 2RP4A 5JDHA 3JC6D 4AKLA 4EIWA 3N9NA 2CXDA 4DO0A 2V7JA 3O4XE 3BQKA 2B1EA 1YD8G 1VRBA 2Q9QD 4BA9A 3KVAA 3RYFE 4ADZA 2LOPA 4H9RC 4P09A 1HFAA 5LHIB 1MIVA 3WAJA 3ZMZB 4ZI7E 4TUYE 3CWZB 2I59A 2NW8A 4QXHB 2LSYA 2JMHA 2NW9A 2DNXA 5LBQB 2P9BA 3WI3A 4H9QC 3C4ZA 1YW0A 4ZOLE 3ZMSB 4CXXA 2YK0A 1B7TA 2CWYA 2VKJA 4DNDA 3AB3B 4AKIA 3RH3A 5EK3A 3VKHA 3IBPA 2HH7A 4PJLA 3I0QA 5LBMA 1HG5A 3HL6A 3B57A 4ZI2D 4ZS3A 3OYXA 2V7KA 5J2UE 5JH7E 4PK5A 4QX8B 2HPLA 1QSDA 4PAGA 4TZ4C 2EHOA 3MACA 3BQLA 5FY1A 3LG7A 3PUAA 5LP6E 2X9XA 2KWHA 4BJNA 3CX8B 3S4UA 5JDQA 4DBQA 4PJMA 5JDLA 5AFUL 3RYHE 3EUHA 5LJNA 3K3OA 2DWGA 3MXZA 5JRCB 2CLYB 1AJ3A 4L5GA 5EZYE 2KINB 3P8CD 3EDUA 4I50E 2LHRA 2XAFB 3HKEE 3PUQA 1ZHCA 2H3RA 3O1JA 1WLXA 4UF0A 2LE8A 1BR1A 2A72A 2Q9QA 3I1AA 4I55E 5LHHB 4PFOA 1UX4A 5LJMA 1YKEB 3ZC1A 3N9PA 2GK9A 3B13A 1OXZA 1D0ZA 3DJBA 4MFRA 4H63H 1HS7A 4HKAA 3N9MA 3SWHA 2D2SA 3ZMTB 3LJCA 3MZKB 1X79A 1MMNA 2BVMA 2PFVA 4HE8A 2X0LB 3UUXB 2XTLA 4PW8A 4M1PA 3PU3A 4B6XA 3KFWX 5LXTE 2CWOA 2DCFA 3Q5WA 2L9QA 2CXLA 1LRZA 3ESLA 2VL8A 5HXCA 2VK9A 2PJQA 3FXEB 3LK2B 5L3EB 3AVSA 5ETWA 4EYYR 3RYIE 2WWUA 4HN9A 1FIOA 4UVCB 2UXXB 2E9XA 1BR4A 4O2AE 3KV5A 3CX7B 2G0UA 2MYSA 3PUSA 2LHNA 2H7VC 3HKCE 2K48A 3MJXA 3AVRA 3ZEFB 3ONXA 4QX7B 4EZ4A 2XASB 1OWAA 2E9XD 3UUMA 3VHLA 3AAIA 1IJ5A 3PURA 4KBMB 4JEHB 5L3GB 4O4JE 4ANJA 3E22E 4UV9B 3AA6B 4IE6A 4WNKA 3FBLA 3CQGB 4GYSA 5KDMC 3AA7B 4IE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KP3 C; 
#chains in the Genus database with same CATH topology
 3ZN0 B;  4EXT A;  4Q25 A;  4GKJ T;  4DV6 T;  1W9R A;  2NW7 A;  4ZXL A;  2VKD A;  3UUN A;  3PE0 A;  1XZY A;  4IE4 A;  4OYK A;  4DV4 T;  2KZ7 B;  2A9U A;  1UX5 A;  4V1A v;  3ZJ2 A;  3G06 A;  4GK0 E;  5HXE A;  1OED E;  1Z8U A;  3QOF A;  3UUL A;  5HEU A;  4AXP A;  3ETU A;  2BS2 A;  3CVR A;  2C5K T;  2XQA A;  4YFS A;  1W0B A;  3UUB A;  4AIU A;  5ABE A;  2M6I A;  3QB5 K;  2BKO A;  5TAO A;  2C5I T;  2VB6 A;  3AEA A;  2XJ7 A;  3KV9 A;  3L39 A;  3P4P A;  2OA5 A;  5CA1 E;  2YDR A;  2K9A A;  2BBH A;  3I9W A;  2IIU A;  1D1A A;  3LBX A;  4IL9 A;  3MA9 A;  2CA5 A;  5AQM B;  3R84 B;  2RA1 A;  1T98 A;  3VRB A;  4F6R C;  4AKG A;  4H9S E;  2UXD T;  1OED C;  3L8R A;  1X9B A;  4QH5 A;  4JI1 T;  2XQ8 A;  4QKN A;  4IDO A;  4TN7 B;  3FBZ A;  4DR4 T;  1HNW T;  2AE9 A;  3UU3 A;  3K3Q C;  3NRX A;  3PTR B;  4X5T A;  2WQY A;  3ZLI A;  2EHO C;  4DMW A;  4LMJ A;  1O3X A;  2K5B B;  1V9D A;  3HI2 A;  4KMC A;  5AQS B;  3J9X 1;  4YT0 A;  2Y48 B;  2W67 A;  5LG3 A;  2WP9 A;  3KVB A;  1KNP A;  3JAE A;  3UFE A;  2BVL A;  4CZZ B;  4JLE A;  4CN6 A;  3LK4 2;  1IJ6 A;  4AQF A;  5JDN A;  2V5C A;  3ZCI A;  4DR7 T;  5HXR A;  4IE0 A;  5IHY A;  4XBF B;  3AE3 A;  5JR9 B;  2KND A;  1XDO A;  2IC9 A;  2XQ6 A;  3Q5X A;  1XNQ T;  1KF6 A;  2IUB A;  4N78 D;  3AEE A;  3KV6 A;  4UEL A;  4WW0 A;  4C91 A;  4NIQ A;  4DBR A;  2IML A;  5CA0 E;  2LSK A;  2ODU A;  2LSJ A;  2QA7 A;  1U5P A;  5AQP B;  2CCQ A;  2KXP B;  3PUY F;  4HWH A;  3IF8 B;  4WBN E;  3GN5 B;  4U74 A;  2KSR A;  3RQW A;  4XZC A;  3SFE A;  1N34 T;  3F57 A;  3ZST A;  1Z0P A;  2V5D A;  3K1S A;  5HWX A;  4DR3 T;  2WAU A;  3O1I A;  1SE7 A;  3KDS E;  1G8X A;  4Z91 A;  3RPU A;  2Z6E A;  2LM2 A;  4TV9 E;  4PJN A;  3BQI A;  3N9Q A;  1GQE A;  3NRY A;  3C4X A;  1MMA A;  1J1J A;  3U3I A;  4IL4 A;  2XAG B;  1S94 A;  4LF5 T;  1UUS A;  4YSY A;  3O1H A;  4EED A;  2J47 A;  2X9W A;  2X9Y A;  2VQE T;  2KLQ A;  5KX5 E;  2V7M A;  2WY2 A;  5F8P A;  2WSS V;  2YIN A;  3EDV A;  3ONJ A;  4JBW F;  5H6Q B;  1UGO A;  2WWV A;  1HNZ T;  4YSZ A;  3UFG A;  4NXM T;  2JMK A;  2CBJ A;  2BS4 A;  5FL0 A;  3QK6 A;  4G2A A;  4NPP A;  2K3W A;  3AE6 A;  4IHJ E;  4X20 E;  2X51 A;  2V6Y B;  3P50 A;  2NR4 A;  4ASK A;  4IIJ E;  5AQG B;  2CRB A;  2WZI A;  5JRE A;  2Q9Q B;  3QUJ A;  5LHG B;  4MAL A;  1I94 T;  2D0U A;  2WU2 A;  3ONL C;  2W0G A;  1QLB A;  5FYM A;  5L3D B;  3J7Y q;  1US7 B;  5L47 A;  2YU2 A;  3M65 A;  5F3J A;  4B3S T;  2W4X A;  3L3P A;  5ABF A;  2WM9 A;  4GOU A;  3OKQ A;  2XQ7 A;  2V7L A;  2YDS A;  3ZCJ A;  3C64 A;  1JNZ A;  3N2K E;  3EVY A;  5LOV E;  4JV5 T;  3GWH A;  3ZC0 A;  2XQ9 A;  4K0K T;  2WMO A;  3EI0 A;  1D1C A;  2X67 A;  2XAH B;  4UEM A;  4LF6 T;  3PUX F;  4QXC B;  3T8O A;  3T1H T;  2WBL A;  3HKD E;  3ETV A;  4QWN B;  5HCM A;  1KFY A;  1FEW A;  4ZS2 A;  5AQQ B;  4CN4 A;  2IW5 B;  4TWD A;  3DTO A;  2CPT A;  1SHZ C;  2M67 A;  2YOE A;  3ZT6 A;  5KMG P;  1HG2 A;  1HCI A;  3UQ4 A;  4LMK A;  3UQ7 A;  5IYZ E;  4IGU A;  3EAB A;  5DJQ C;  3RI5 A;  4DV3 T;  2YEV C;  1LVK A;  3ANW A;  4TWF A;  5EK4 A;  1MMD A;  3RC3 A;  3ZMU B;  2XQ5 A;  2YN6 A;  1SUM B;  2ZLY A;  1ZEE A;  2XUE A;  3RRW A;  1IAP A;  4FI5 A;  2WB5 A;  3N9L A;  1VOM A;  3N2G E;  1ZKE A;  4HTE A;  4DR1 T;  1XMQ T;  3SFD A;  1HNX T;  2CM0 A;  3N2O A;  4H9N C;  4P0A A;  2KT9 A;  3K3N A;  4HWD A;  1BR0 A;  1JNR A;  1UCU A;  3ZKR A;  1E7P A;  2WZH A;  2LOS A;  2WDQ A;  4AQG A;  3PUV F;  2V7I A;  2EHO B;  1CUN A;  4UVB B;  4DVD A;  1WCR A;  2WMN A;  2FJD A;  3C51 A;  3Q9D A;  4L0R A;  3VU7 H;  5L3C B;  2UXN B;  3I9Y A;  4GKK T;  2V6X A;  2V26 A;  3F31 A;  4LFC T;  2E5L T;  1OED B;  5FXX A;  3P4S A;  4ERR A;  5FXV A;  2EHO D;  3U78 A;  4YSX A;  5HAX A;  2R6G F;  4ZEY A;  1HF8 A;  1KK7 A;  4JI6 T;  4DUZ T;  1N36 T;  1KNZ A;  4KHZ F;  4ILU A;  1WRD A;  5HWY A;  4F8H A;  4A5X A;  4BJM A;  5FY0 A;  5C8Y E;  2SPC A;  3GMI A;  2N1G A;  3PDY A;  4HFH A;  2MBG A;  4CXW A;  3ZT5 A;  4EAH A;  3ZJ1 A;  3E0Z A;  3HR0 A;  3FB2 A;  4FJO A;  2BZB A;  4JYA T;  4B3T T;  3AEB A;  4UXN B;  2CE7 A;  3W15 B;  2LRK A;  1U4Q A;  5C3J A;  4CI1 B;  2Y6X A;  4YJ3 E;  5LA6 E;  4JI2 T;  1T8B A;  2Q9Q C;  3AE5 A;  3VKG A;  4YLH A;  4YHH T;  1MMG A;  2NOX A;  5FKY A;  5JVD E;  4TNV A;  3CPZ A;  4C90 A;  5KXJ A;  2XZE A;  2OLT A;  3ZYK A;  4DV5 T;  2BG9 C;  5JDG A;  2LM9 A;  3PU8 A;  4KHP T;  3NWI A;  1MIY A;  1MIW A;  2IHR 1;  2YU1 A;  3KIN B;  2X68 A;  2JPF A;  2L8K A;  4GIW A;  4IE5 A;  2VWA A;  3N9O A;  2CHN A;  2NP9 A;  2XQ4 A;  3PJA A;  4TNW A;  3IHR A;  3UTK A;  1D1B A;  2E8I A;  2BG9 A;  4GYR A;  4NUV A;  2LRL A;  4XAX B;  4JI5 T;  1CHU A;  1LKX A;  2FJB A;  1NWM X;  1NAF A;  1W0A A;  3AE4 A;  5GON E;  2OV9 A;  5FL1 A;  3MKD A;  4B3M T;  2WDV A;  4OHF A;  5EK2 A;  3V5U A;  5FP3 A;  2MOZ A;  3CIR A;  1WR6 A;  1ZP0 A;  4LML A;  5HXH A;  1I6Z A;  4HFI A;  4AI6 A;  4OX9 T;  4H9P C;  3AAE B;  2B76 A;  4L9I A;  3CML A;  3OJA A;  4O2B E;  5JR9 A;  3UU4 A;  5CFB A;  5LNK A;  2UUB T;  1QUU A;  3HKB E;  1MNE A;  4LF4 T;  2JJ9 A;  4UIG A;  4ZI2 C;  4ZI3 D;  3AE7 A;  4J2C A;  2D5U A;  3LFM A;  4K0U A;  4KX6 A;  4U2Y A;  5LG4 A;  2BG9 E;  2PG8 A;  2HPJ A;  3PUW F;  2D9D A;  3I0O A;  4UF0 B;  5DAB A;  3RIU C;  4U72 A;  3PUG A;  3RKO A;  2FBW A;  2J1D G;  4GK5 E;  1Y01 A;  2LLY A;  3FHN A;  5AQO B;  5LGT B;  1HTJ F;  3N5L A;  4KP3 C;  1VCT A;  2CMR A;  3AAA B;  4ZI3 C;  4DMV A;  5BR8 T;  2VKO A;  3Q2M A;  2FJE A;  4PK4 A;  1YKH B;  5LGU B;  5AQT B;  2L3L A;  4AKR B;  3RC8 A;  3P4W A;  2ACX A;  3ZT7 A;  2F4V T;  2DWK A;  4Z8X A;  3RYC E;  4HGA A;  3DP7 A;  3QC9 A;  1WFD A;  4ILB A;  3AEF A;  3LK3 B;  3V5S A;  3ZMV B;  3C98 B;  3H3M A;  3KBT A;  4UV8 B;  4EOZ B;  4HFC A;  4HFV A;  1KEY A;  2DHR A;  4QXB B;  5JDF A;  3TLW A;  5HYA A;  4DUY T;  2JQH A;  4AIS A;  3FZF B;  2BKN A;  2XAJ B;  3ZN1 B;  2CXF A;  4QHO A;  5HEH A;  2K24 A;  3P4R A;  4MBQ A;  5FY7 A;  4B3R T;  3OVU A;  3RGL A;  4X1K E;  4LFB T;  3LSV A;  3CKD A;  2MTQ A;  2WS3 A;  3CX6 B;  4I43 B;  5AQU B;  2LSG A;  2C5J A;  2LKH A;  3F2E A;  3HA4 A;  2VVS A;  4HWF A;  2PBI A;  2PTF A;  5A1L A;  5ABF B;  5LGN B;  1E1H B;  1HX1 B;  1ZV4 X;  1SA0 E;  2X9H A;  3AXJ B;  3ZPO A;  3Q5E A;  3E08 A;  1D0X A;  5AQJ B;  5C2T A;  2LJL A;  4YJ2 E;  3LBX B;  1ZOY A;  3L09 A;  3CQX C;  3P4Q A;  4I4T E;  2W00 A;  3SOL A;  1XNR T;  2H88 A;  2D0T A;  2RPA A;  5JDM A;  1FMW A;  4DV0 T;  5HEG A;  5JQG E;  2NTX A;  3SRZ A;  3RHW A;  5H6R B;  2XAQ B;  1DU2 A;  2W62 A;  5LCY A;  2ES0 A;  3K8P C;  3ZYL A;  1HX8 A;  4NXN T;  4TV8 E;  3ANW B;  3RIF A;  3PJA J;  3H37 A;  1L0V A;  5L4H A;  4A97 A;  5JTG A;  4TX5 A;  3NZP A;  2QGS A;  2DLR A;  4O4H E;  1IBK T;  4O4I E;  4IDZ A;  2W61 A;  4A56 A;  4U31 A;  1D0Y A;  2C0S A;  2ZM8 A;  5JRC A;  1WYC A;  2IDO B;  3AED A;  3UU8 A;  2LEH A;  2IC6 A;  1FMV A;  4MHC A;  2UU9 T;  3A8Y C;  5HXS A;  4YHJ A;  4E7Z A;  4HFD A;  5HEO A;  5JR9 C;  2DI4 A;  4EZH A;  3GN5 A;  3JC6 C;  3OYZ A;  4X62 T;  5DQV A;  2NWB A;  3TLS A;  4CXY A;  3X1D A;  4KI0 F;  5IUX A;  5L2L A;  5CB4 E;  1T72 A;  1VCS A;  2XM2 A;  4YY3 T;  3IEE A;  4JUY A;  3A5X A;  1T7S A;  2LT3 A;  3AA1 B;  1XMO T;  4LF9 T;  2CLY C;  4U7Y A;  1G73 A;  2JQ9 A;  2V8S V;  4QH1 A;  4CI2 B;  5FMN A;  3OTO T;  4DV1 T;  4WYV A;  3CK6 A;  3OBV E;  2UUA T;  2UXC T;  3JCF A;  4O4L E;  5FNV E;  3TLT A;  5J2T E;  3O9X A;  4OFZ A;  4PNI A;  4OYJ A;  2JQK A;  2KWI B;  4HWI B;  1NEN A;  3CQC B;  2N2N A;  4HEA A;  2M6B A;  5HEJ A;  1WYB A;  5E0O A;  3IA3 A;  2NTY A;  4CI3 B;  1S35 A;  4AKH A;  2V6Y A;  5DQW A;  1IZN B;  2CEA A;  2FJA A;  1MND A;  2LSI A;  3C50 A;  2V1D B;  2VUR A;  3Q5D A;  4I0U A;  4X1I E;  4X1Y E;  4O8S A;  5FXZ A;  4AQF C;  1H7C A;  4YTM A;  4DID B;  5LYJ E;  2UUC T;  4YXD A;  3TLV A;  4ZHQ E;  2H7O A;  3R6N A;  5LMN T;  3GA8 A;  3P7I A;  3WAK A;  1WR0 A;  2DL1 A;  2VVN A;  2YDQ A;  1LVF A;  4Z90 A;  5L3B B;  2E9X B;  3AA0 B;  5L3F B;  2J4G A;  4JEU B;  3RX6 A;  2IAK A;  2W63 A;  3RKG A;  4A98 A;  4ZZC A;  2JRK A;  2XQY A;  2W66 A;  5AQK B;  2Y8D A;  4WBO A;  2YKS A;  2I6H A;  2MPK A;  2ZMA A;  1EZ3 A;  1XDP A;  4PFP A;  3NZQ A;  3KBU A;  4H63 V;  5FVL A;  2BS3 A;  3ZSS A;  2A3D A;  4TWH A;  4WZX A;  2JQQ A;  5BMV E;  4DR2 T;  2N9D A;  4EYU A;  2XSB A;  4ISS A;  1IBM T;  4KUM B;  4LF8 T;  4NUU A;  3SS1 A;  2ZM0 A;  3MK7 C;  5F5W A;  5M4Y A;  4H9O C;  3RRC A;  4MLK A;  2XHE B;  4UR9 A;  2XM1 A;  2KMF A;  4UVA B;  5L4E A;  1E2A A;  2A2F X;  3FZL B;  3FZH B;  3H3A A;  4CQI A;  2E9X C;  3FXD B;  3KV4 A;  4PJJ A;  1BR2 A;  1M7K A;  3NBX X;  5FXW A;  4BAY B;  2UXB T;  5J1G A;  3D0T A;  3BK9 A;  2VAS A;  2ZM2 A;  4OK0 A;  4G63 A;  2JIW A;  2CBI A;  4DV2 T;  2FUP A;  3C4W A;  1Y64 B;  2VKH A;  2W2U A;  4E7S A;  4EB6 E;  3TKL B;  3VRA A;  3UT5 E;  2BDE A;  4CN1 A;  2X0Y A;  3UU6 A;  4IDN A;  1NEK A;  2X66 A;  4P0B A;  2ODV A;  4IST A;  4PK6 A;  2RP4 A;  5JDH A;  3AE1 A;  2WCA A;  3JC6 D;  4AKL A;  3N9N A;  4EIW A;  2CXD A;  3JAD A;  4DO0 A;  2V7J A;  4YTP A;  5ADX L;  3O4X E;  3BQK A;  2B1E A;  1YD8 G;  1VRB A;  2Q9Q D;  4BA9 A;  3KVA A;  3RYF E;  4ADZ A;  1W09 A;  2LOP A;  3FZK B;  4H9R C;  1HFA A;  4P09 A;  5LHI B;  1MIV A;  3AEC A;  4U7I A;  2E2A A;  3UU5 A;  3RQU A;  3ZMZ B;  4TUY E;  4ZI7 E;  3WAJ A;  4COF A;  1YQ4 A;  2AXD S;  3CWZ B;  4YTN A;  2I59 A;  2NW8 A;  4QXH B;  2LSY A;  3OPC A;  4QH4 A;  4EEB A;  2JMH A;  3PUZ F;  3VR9 A;  2NW9 A;  2DNX A;  5AQL B;  5LBQ B;  4IRE A;  4U33 A;  1IBL T;  5LMU T;  2P9B A;  3WI3 A;  4H9Q C;  3C4Z A;  1YW0 A;  4ZOL E;  1YQ3 A;  3ZMS B;  4CXX A;  2YK0 A;  1B7T A;  2CWY A;  2VKJ A;  3RIU A;  3AB3 B;  2QVA A;  3AXJ A;  4DND A;  3JAF A;  3RH3 A;  4AKI A;  3QNU A;  2QYW A;  2XSA A;  5EK3 A;  3VKH A;  5AQH B;  5FVK A;  4IDP A;  3IBP A;  3LDQ B;  2HN1 A;  5AQR B;  2HH7 A;  5ABG A;  4PJL A;  3I0Q A;  4HFE A;  5LBM A;  2XPK A;  1HG5 A;  4X65 T;  4DR5 T;  3VR8 A;  4JI3 T;  3HL6 A;  3B57 A;  4ZI2 D;  4X64 T;  4ZS3 A;  4DR6 T;  3OYX A;  2ZM6 T;  2V7K A;  2BG9 B;  5J2U E;  4PK5 A;  4QX8 B;  2HPL A;  4HFB A;  1QSD A;  2BKP A;  2H89 A;  2EHO A;  3MAC A;  3AE8 A;  4PAG A;  4TZ4 C;  5LB7 B;  1UK5 A;  3BQL A;  5AQV B;  2ACZ A;  3LG7 A;  5FY1 A;  3PUA A;  1FJG T;  5LP6 E;  2X9X A;  2KWH A;  4BJN A;  3CX8 B;  3S4U A;  5AQF B;  5JDQ A;  4DBQ A;  1OED A;  3AE2 A;  4PJM A;  3RF1 A;  3FZM B;  2VQF T;  1HR0 T;  5JDL A;  5AFU L;  4JI7 T;  3RYH E;  3EUH A;  5LJN A;  2QRX A;  3K3O A;  2BBJ A;  2DWG A;  3MXZ A;  3B5M A;  2VL0 A;  5JRC B;  2CLY B;  1YXR A;  1AJ3 A;  4L5G A;  5EZY E;  2KIN B;  3P8C D;  2CHO A;  3EDU A;  4I50 E;  2LHR A;  2XAF B;  3HKE E;  2E5V A;  2HHH T;  4HWC A;  3PUQ A;  2I0M A;  1ZHC A;  2H3R A;  3O1J A;  5AQN B;  5IWA T;  1WLX A;  4UF0 A;  4P1N A;  2X0H A;  2LE8 A;  4EV6 A;  4X66 T;  4U2Z A;  1BR1 A;  2A72 A;  2Q9Q A;  3I1A A;  4I55 E;  5LHH B;  4PFO A;  1UX4 A;  3EHZ A;  4U3C A;  1XWM A;  1YKE B;  3ZC1 A;  3NVO A;  5LJM A;  3N9P A;  2GK9 A;  5ABH A;  1J5E T;  3B13 A;  1OXZ A;  1D0Z A;  3DJB A;  4MFR A;  4H63 H;  1HS7 A;  3RLF F;  4HKA A;  5CJ5 A;  4ZZB A;  3N9M A;  3SWH A;  2D2S A;  3TLU A;  3ZMT B;  4AQY T;  3PV0 F;  3LJC A;  3ZYM A;  3MZK B;  1X79 A;  1N32 T;  2MAW A;  1MMN A;  2BVM A;  1R8I A;  2PFV A;  4IDQ A;  2J62 A;  3QB5 A;  4HE8 A;  2X0L B;  4ILC A;  2XTL A;  3UUX B;  4PW8 A;  4M1P A;  5HCJ A;  3NKZ A;  3PU3 A;  4B6X A;  3AEG A;  3KFW X;  5LXT E;  2CWO A;  4LF7 T;  2DCF A;  4EGW A;  3Q5W A;  4DV7 T;  2HN2 A;  2L9Q A;  2CXL A;  1LRZ A;  3ESL A;  2VL8 A;  5HXC A;  1N33 T;  2VK9 A;  5J0Z A;  2PJQ A;  3FXE B;  3LK2 B;  5L3E B;  3AVS A;  5ETW A;  3EAM A;  4EYY R;  3RYI E;  2WWU A;  4HN9 A;  1FIO A;  2XY8 B;  2UXX B;  2E9X A;  3ABV A;  2WDR A;  4UVC B;  1BR4 A;  4JI4 T;  4O2A E;  3KV5 A;  3CX7 B;  2LKG A;  2G0U A;  2MYS A;  3M3Z B;  4JI8 T;  1UUR A;  3PUS A;  2LHN A;  2H7V C;  3A7M A;  5CGM A;  3HKC E;  2K48 A;  3MJX A;  3AVR A;  3ZEF B;  3ONX A;  4QX7 B;  5JH7 E;  3T1Y T;  4ILA A;  4EZ4 A;  2XAS B;  1OWA A;  2E9X D;  3UUM A;  5AQI B;  3RIA A;  3VHL A;  3AAI A;  1IJ5 A;  1J5W A;  2WU5 A;  3AE9 A;  1KNR A;  3PUR A;  4IT4 A;  4JEH B;  4KBM B;  4O4J E;  5L3G B;  4ANJ A;  2XQ3 A;  3E22 E;  4UV9 B;  3AA6 B;  4IE6 A;  4WNK A;  3FBL A;  4LFA T;  3CQG B;  4GYS A;  5KDM C;  1M62 A;  4JI0 T;  3AA7 B;  4IE7 A; 
#chains in the Genus database with same CATH homology
 3ZN0 B;  4EXT A;  2NW7 A;  3UUN A;  2VKD A;  3PE0 A;  4IE4 A;  4OYK A;  2KZ7 B;  1UX5 A;  4V1A v;  3ZJ2 A;  4GK0 E;  5HXE A;  3UUL A;  4AXP A;  3ETU A;  3CVR A;  2C5K T;  4YFS A;  5TAO A;  2C5I T;  2VB6 A;  3KV9 A;  2OA5 A;  5CA1 E;  2K9A A;  3I9W A;  3R84 B;  1D1A A;  3LBX A;  3MA9 A;  2CA5 A;  4AKG A;  2RA1 A;  1T98 A;  4F6R C;  4H9S E;  4QKN A;  4TN7 B;  3FBZ A;  3K3Q C;  3NRX A;  3PTR B;  3ZLI A;  2EHO C;  4DMW A;  1O3X A;  2K5B B;  1V9D A;  3HI2 A;  4KMC A;  3J9X 1;  2Y48 B;  3KVB A;  3UFE A;  2BVL A;  4JLE A;  3LK4 2;  1IJ6 A;  4AQF A;  5JDN A;  3ZCI A;  5HXR A;  4IE0 A;  5IHY A;  4XBF B;  5JR9 B;  2KND A;  3Q5X A;  2IC9 A;  4N78 D;  3KV6 A;  4UEL A;  4C91 A;  4WW0 A;  4DBR A;  5CA0 E;  2LSK A;  2LSJ A;  2ODU A;  2QA7 A;  1U5P A;  2CCQ A;  2KXP B;  3IF8 B;  4WBN E;  3GN5 B;  4U74 A;  4XZC A;  3F57 A;  1Z0P A;  5HWX A;  2WAU A;  3O1I A;  3KDS E;  1G8X A;  3RPU A;  2Z6E A;  4TV9 E;  4PJN A;  3BQI A;  3N9Q A;  3NRY A;  3C4X A;  1MMA A;  3U3I A;  2XAG B;  1S94 A;  3O1H A;  2X9W A;  2X9Y A;  2KLQ A;  5KX5 E;  2V7M A;  5F8P A;  2WSS V;  2YIN A;  3EDV A;  5H6Q B;  2JMK A;  3QK6 A;  4G2A A;  4IHJ E;  4X20 E;  2X51 A;  4ASK A;  4IIJ E;  5JRE A;  2Q9Q B;  3QUJ A;  5LHG B;  4MAL A;  2D0U A;  5FYM A;  5L3D B;  2W0G A;  3J7Y q;  1US7 B;  2YU2 A;  3M65 A;  5F3J A;  3L3P A;  2WM9 A;  4GOU A;  3OKQ A;  3ZCJ A;  2V7L A;  3C64 A;  3N2K E;  3EVY A;  5LOV E;  3GWH A;  3ZC0 A;  2WMO A;  4UEM A;  1D1C A;  2X67 A;  2XAH B;  4QXC B;  3T8O A;  2WBL A;  3HKD E;  3ETV A;  4QWN B;  1FEW A;  4ZS2 A;  2IW5 B;  3DTO A;  2M67 A;  1SHZ C;  5KMG P;  1HG2 A;  1HCI A;  5IYZ E;  4IGU A;  5DJQ C;  2YEV C;  1LVK A;  3ANW A;  5EK4 A;  1MMD A;  3RC3 A;  3ZMU B;  2ZLY A;  1ZEE A;  2XUE A;  3RRW A;  1IAP A;  4FI5 A;  3N9L A;  1VOM A;  3N2G E;  1ZKE A;  4HTE A;  2CM0 A;  3N2O A;  4H9N C;  4P0A A;  2KT9 A;  3K3N A;  1BR0 A;  1UCU A;  2LOS A;  4AQG A;  2V7I A;  2EHO B;  1CUN A;  4UVB B;  4DVD A;  3C51 A;  2WMN A;  3VU7 H;  3Q9D A;  4L0R A;  5L3C B;  2UXN B;  3I9Y A;  2V26 A;  3F31 A;  5FXX A;  4ERR A;  5FXV A;  2EHO D;  3U78 A;  5HAX A;  1HF8 A;  1KK7 A;  1KNZ A;  4ILU A;  1WRD A;  5HWY A;  4BJM A;  5FY0 A;  5C8Y E;  2SPC A;  3GMI A;  2N1G A;  3PDY A;  2MBG A;  4CXW A;  4EAH A;  3ZJ1 A;  3E0Z A;  3HR0 A;  3FB2 A;  4FJO A;  2BZB A;  4UXN B;  2CE7 A;  3W15 B;  1U4Q A;  4CI1 B;  2Y6X A;  4YJ3 E;  5LA6 E;  3VKG A;  2Q9Q C;  4YLH A;  1MMG A;  2NOX A;  5JVD E;  4C90 A;  3CPZ A;  3ZYK A;  5JDG A;  2LM9 A;  3PU8 A;  1MIY A;  1MIW A;  2YU1 A;  3KIN B;  2X68 A;  2JPF A;  2L8K A;  4GIW A;  4IE5 A;  2VWA A;  3N9O A;  2NP9 A;  3IHR A;  3UTK A;  1D1B A;  2E8I A;  4NUV A;  4GYR A;  4XAX B;  4CZZ B;  5ADX L;  1LKX A;  5GON E;  1NWM X;  1NAF A;  3MKD A;  4OHF A;  5EK2 A;  3V5U A;  5FP3 A;  2MOZ A;  1WR6 A;  5HXH A;  4AI6 A;  4H9P C;  3AAE B;  4L9I A;  3CML A;  3OJA A;  4O2B E;  5JR9 A;  5LNK A;  1QUU A;  3HKB E;  1MNE A;  2JJ9 A;  4UIG A;  4ZI2 C;  4ZI3 D;  4J2C A;  2D5U A;  3LFM A;  4K0U A;  5LG4 A;  2PG8 A;  2HPJ A;  3I0O A;  4UF0 B;  5DAB A;  4U72 A;  3PUG A;  3RKO A;  2J1D G;  4GK5 E;  5LGT B;  3FHN A;  1HTJ F;  3N5L A;  4KP3 C;  2CMR A;  3AAA B;  4ZI3 C;  4DMV A;  2VKO A;  3Q2M A;  4PK4 A;  1YKH B;  5LGU B;  2L3L A;  4AKR B;  3RC8 A;  2ACX A;  2DWK A;  4Z8X A;  3RYC E;  4HGA A;  3DP7 A;  3QC9 A;  3V5S A;  3ZMV B;  3LK3 B;  3C98 B;  4UV8 B;  3KBT A;  4EOZ B;  4HFV A;  4QXB B;  2DHR A;  5JDF A;  5HYA A;  2XAJ B;  3ZN1 B;  2CXF A;  4QHO A;  2K24 A;  4MBQ A;  5FY7 A;  4X1K E;  3CX6 B;  3CKD A;  2MTQ A;  4I43 B;  2LSG A;  2C5J A;  3F2E A;  3HA4 A;  5A1L A;  2PBI A;  5LGN B;  1E1H B;  2X9H A;  1ZV4 X;  1SA0 E;  3ZPO A;  3E08 A;  1D0X A;  2LJL A;  4YJ2 E;  3LBX B;  3L09 A;  3CQX C;  4I4T E;  2W00 A;  3SOL A;  2D0T A;  5JDM A;  1FMW A;  5JQG E;  2NTX A;  3SRZ A;  5H6R B;  2XAQ B;  2W62 A;  5LCY A;  2ES0 A;  3K8P C;  3ZYL A;  1HX8 A;  4TV8 E;  3ANW B;  3H37 A;  4TX5 A;  3NZP A;  2QGS A;  2DLR A;  4O4H E;  4O4I E;  4IDZ A;  2W61 A;  4A56 A;  1D0Y A;  2C0S A;  2ZM8 A;  5JRC A;  1WYC A;  2LEH A;  2IC6 A;  1FMV A;  4MHC A;  5HXS A;  4YHJ A;  4E7Z A;  5JR9 C;  2DI4 A;  4EZH A;  3GN5 A;  3JC6 C;  3OYZ A;  5DQV A;  2NWB A;  4CXY A;  5L2L A;  5CB4 E;  3IEE A;  4JUY A;  3A5X A;  2LT3 A;  3AA1 B;  2CLY C;  1G73 A;  4CI2 B;  5FMN A;  3OBV E;  5FNV E;  4O4L E;  5J2T E;  3O9X A;  4OFZ A;  4PNI A;  4OYJ A;  2KWI B;  3CQC B;  2N2N A;  4HEA A;  1WYB A;  5E0O A;  2NTY A;  4CI3 B;  1S35 A;  4AKH A;  3ZYM A;  5DQW A;  3C50 A;  1IZN B;  2CEA A;  1MND A;  2LSI A;  2V1D B;  4X1I E;  4X1Y E;  5FXZ A;  4AQF C;  5LYJ E;  4O8S A;  1H7C A;  4ZHQ E;  2H7O A;  3R6N A;  3GA8 A;  3P7I A;  3WAK A;  1LVF A;  5L3B B;  2E9X B;  3AA0 B;  5L3F B;  4JEU B;  3RX6 A;  2IAK A;  2W63 A;  2JRK A;  2XQY A;  2Y8D A;  4WBO A;  2ZMA A;  1EZ3 A;  4PFP A;  3NZQ A;  3KBU A;  4H63 V;  2A3D A;  2JQQ A;  5BMV E;  2N9D A;  4EYU A;  4ISS A;  4KUM B;  4NUU A;  3SS1 A;  2ZM0 A;  3MK7 C;  5M4Y A;  4H9O C;  3RRC A;  4MLK A;  2XHE B;  2KMF A;  4UVA B;  2A2F X;  3H3A A;  4CQI A;  2E9X C;  3FXD B;  3KV4 A;  4PJJ A;  1BR2 A;  3NBX X;  5FXW A;  4BAY B;  5J1G A;  3D0T A;  3BK9 A;  2VAS A;  2ZM2 A;  4OK0 A;  4G63 A;  3C4W A;  1Y64 B;  2VKH A;  4E7S A;  4EB6 E;  3TKL B;  3UT5 E;  2BDE A;  4P0B A;  2X66 A;  2ODV A;  4IST A;  4PK6 A;  2RP4 A;  5JDH A;  3JC6 D;  4AKL A;  4EIW A;  3N9N A;  2CXD A;  4DO0 A;  2V7J A;  3O4X E;  3BQK A;  2B1E A;  1YD8 G;  1VRB A;  2Q9Q D;  4BA9 A;  3KVA A;  3RYF E;  4ADZ A;  2LOP A;  4H9R C;  4P09 A;  1HFA A;  5LHI B;  1MIV A;  3WAJ A;  3ZMZ B;  4ZI7 E;  4TUY E;  3CWZ B;  2I59 A;  2NW8 A;  4QXH B;  2LSY A;  2JMH A;  2NW9 A;  2DNX A;  5LBQ B;  2P9B A;  3WI3 A;  4H9Q C;  3C4Z A;  1YW0 A;  4ZOL E;  3ZMS B;  4CXX A;  2YK0 A;  1B7T A;  2CWY A;  2VKJ A;  4DND A;  3AB3 B;  4AKI A;  3RH3 A;  5EK3 A;  3VKH A;  3IBP A;  2HH7 A;  4PJL A;  3I0Q A;  5LBM A;  1HG5 A;  3HL6 A;  3B57 A;  4ZI2 D;  4ZS3 A;  3OYX A;  2V7K A;  5J2U E;  5JH7 E;  4PK5 A;  4QX8 B;  2HPL A;  1QSD A;  4PAG A;  4TZ4 C;  2EHO A;  3MAC A;  3BQL A;  5FY1 A;  3LG7 A;  3PUA A;  5LP6 E;  2X9X A;  2KWH A;  4BJN A;  3CX8 B;  3S4U A;  5JDQ A;  4DBQ A;  4PJM A;  5JDL A;  5AFU L;  3RYH E;  3EUH A;  5LJN A;  3K3O A;  2DWG A;  3MXZ A;  5JRC B;  2CLY B;  1AJ3 A;  4L5G A;  5EZY E;  2KIN B;  3P8C D;  3EDU A;  4I50 E;  2LHR A;  2XAF B;  3HKE E;  3PUQ A;  1ZHC A;  2H3R A;  3O1J A;  1WLX A;  4UF0 A;  2LE8 A;  1BR1 A;  2A72 A;  2Q9Q A;  3I1A A;  4I55 E;  5LHH B;  4PFO A;  1UX4 A;  5LJM A;  1YKE B;  3ZC1 A;  3N9P A;  2GK9 A;  3B13 A;  1OXZ A;  1D0Z A;  3DJB A;  4MFR A;  4H63 H;  1HS7 A;  4HKA A;  3N9M A;  3SWH A;  2D2S A;  3ZMT B;  3LJC A;  3MZK B;  1X79 A;  1MMN A;  2BVM A;  2PFV A;  4HE8 A;  2X0L B;  3UUX B;  2XTL A;  4PW8 A;  4M1P A;  3PU3 A;  4B6X A;  3KFW X;  5LXT E;  2CWO A;  2DCF A;  3Q5W A;  2L9Q A;  2CXL A;  1LRZ A;  3ESL A;  2VL8 A;  5HXC A;  2VK9 A;  2PJQ A;  3FXE B;  3LK2 B;  5L3E B;  3AVS A;  5ETW A;  4EYY R;  3RYI E;  2WWU A;  4HN9 A;  1FIO A;  4UVC B;  2UXX B;  2E9X A;  1BR4 A;  4O2A E;  3KV5 A;  3CX7 B;  2G0U A;  2MYS A;  3PUS A;  2LHN A;  2H7V C;  3HKC E;  2K48 A;  3MJX A;  3AVR A;  3ZEF B;  3ONX A;  4QX7 B;  4EZ4 A;  2XAS B;  1OWA A;  2E9X D;  3UUM A;  3VHL A;  3AAI A;  1IJ5 A;  3PUR A;  4KBM B;  4JEH B;  5L3G B;  4O4J E;  4ANJ A;  3E22 E;  4UV9 B;  3AA6 B;  4IE6 A;  4WNK A;  3FBL A;  3CQG B;  4GYS A;  5KDM C;  3AA7 B;  4IE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...