4KPIA

Rotational order-disorder structure of reversibly photoswitchable red fluorescent protein rstagrfp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
224
structure length
223
Chain Sequence
ELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFSRTFINHTQGIPDFWKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEAATEMLYPADGGLEGRGDMALKLVGGGHLICNLKTTYRSKNPAKNLKMPGVYFVDHRLERIKEADKETYVEQHEVAVARYCDLPSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reversibly photoswitchable red fluorescent protein rsTagRFP
publication title The rotational order-disorder structure of the reversibly photoswitchable red fluorescent protein rsTagRFP.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
total genus 54
structure length 223
sequence length 224
ec nomenclature
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4kpiA00
2A48A 3DQUA 3SVRA 4ZF4A 3GJ1A 3EVPA 3GEXA 4IK9A 1H6RA 4P76A 4B5YA 2QLGB 3AKOA 2HQZA 4W6OA 4DXPA 1Z1PA 3DQ8A 2BTJA 3DQFA 2C9IA 3EK4A 1BFPA 3LVCA 5BT0A 4W6JA 2G5ZB 3ST4A 3ADFA 5HZUA 1EMEA 4R6BA 2EMOA 2WHSA 5EB6A 5HZSA 2DDDA 4KGEA 3SG3A 4XOWA 4W6FA 4R6DA 1EMAA 2DUIA 2OKYA 2AWMA 1RMPA 4OJ0A 4W6TA 1Q4EA 2OGRA 4DXOA 4EULA 3W1DA 2C9JA 1KYRA 4W7XA 4W73A 5FVGA 4JFGA 1XQMA 1Q4CA 4W6CA 2QU1A 5EB7A 5EXBA 4PFEA 1YHGA 5DTYA 4Z4MA 3NEDA 4LJBA 1Z1QA 3P8UA 3SG7A 2GW4B 3SG2A 5EHUA 1ZGOA 2G3OA 2VADA 1OXFA 3PJ7A 4PPLA 5H89A 3DQ9A 4BDUA 4AR7A 1GFLA 4J88A 1ZGPA 4ORNA 3VHTB 3CGLA 2QLHA 1OXDA 2FL1A 2PXSA 5FVIA 3DQDA 4IZNA 2ICRA 1MOVA 3E5TA 1JBYA 3SSHA 3U8PA 2IOVA 3DQOA 4W6KA 1GGXA 3DQMA 3DQ4A 2AHAA 4HVFA 1CV7A 2A52B 2QRFA 2Z6ZA 5DU0A 2V4EC 1EMMA 3EKHA 4OY4A 2VVIA 2DUEA 2QT2A 4W75A 3RWTA 3VICA 2P4MA 2G6YA 2G16B 2G6EA 3U8AA 1YJ2A 4W6UA 4GESB 4N3DA 1UISA 4H48A 4KF5C 3ST0A 2G6XA 1EMCA 2OKWA 2O2BA 2IB6A 2H5OA 1F0BA 4HE4A 1YJFA 2JADA 2EMNA 2IE2A 3O78A 3U0LA 2H6VA 4RYSA 2B3PA 4RYWA 2GW3A 3BX9A 2HGYA 3RWAA 3DPXA 3DQJA 2ZO6A 1EMLA 1GL4A 2WURA 4J8AA 4ZIOA 2EMDA 5BTTA 5EBJA 1RRXA 4AS8A 2HCGA 3E5WA 5DPJA 4ZFSA 4LW5A 5FHVA 2FWQA 3ZUFA 4KA9A 4ZF3A 1MOUA 3SSTA 2AWJA 4W69A 4KPIA 4KAGA 2VAEA 4W76A 2B3QA 2WISA 3LF4B 3SG4A 4DXQA 3WCKA 3SG6A 2Z1OA 2O24A 5EJUA 3GJ2A 2AWKA 3AI4A 4ZF5A 3UG0A 4TZAA 1QYQA 2OTEA 4RTCA 5DRGA 3DQ2A 4W6SA 2QLEA 4DKMA 3LF3A 4LQTA 4OGSA 1Q4DA 3LVAA 2DDCA 4IK1A 4KW9A 3LVDA 4EDSA 3V3DA 2RH7A 5LK4A 4HQ8A 3M22A 3OSRA 2Z6XA 4XGYA 4EN1A 5H88A 5LTRA 2VVJA 4W7RA 5HBDA 2A47A 2H5RA 3EVRA 4H3MA 4KF4A 3NF0A 3TMRA 4B30A 4XVPA 3CFAA 3TMTA 4OHSA 2DUGA 2HRSA 2V4EB 3S05A 1XA9A 2YDZA 4DXMA 1OXEA 4LQUA 3U8CA 4LJDA 4HQ9A 4DXIA 1EMGA 4W6LA 2DUHA 3ED8A 4W6RA 4W72A 4XOVA 1JC0A 3EVVA 3DQIA 3DQ3A 4J89A 2HGDA 3AI5A 3NT9A 1JC1A 4W6IA 1QY3A 5H87A 3IP2A 2VVHA 3DQ1A 3ST2A 1RMMA 3I19A 3OSQA 3NEZA 1W7SA 4IK3A 3DQ7A 4H3LA 3CD9A 2FZUA 3DQHA 4KGFA 4W74A 5DQMA 4W7CA 4L13A 2A56B 4W77A 4KW8A 1S6ZA 4EMQA 3ZULA 4W7AA 2ZMUA 4Q9WA 1KYSA 3A8SA 3WLDA 1C4FA 5HZOA 2A53B 4KW4A 3CFHA 5EXCI 4UTSA 2QZ0A 4IK8A 4LJCA 1YZWA 4JC2A 3DQCA 3SSPA 2YE0A 2WIQA 4IK5A 4Q7TA 3EKJA 2HFCA 3SSYA 4W6AA 4GF6B 5HZTA 3EK7A 4OQWA 2DD7A 2HPWA 3EVUA 2HJOA 3SRYA 2Z6YA 3SV5A 1YHHA 3CD1A 3BXCA 5LTQA 4GOBA 5DRFA 1XMZA 3SVBA 2ZMWA 4EDOA 3DQEA 2QLIA 1Q4AA 1RM9A 3UFZA 5HGEA 1KYPA 3DQLA 1EMKA 1EMBA 3DPZA 3KCSA 4W6BA 1EMFA 3DPWA 1HCJA 3DQNA 4PPKA 3U0NA 1ZGQA 2H5QA 3LS3A 4P1QA 2HQKA 4DKNA 3DQAA 5LTPA 1F09A 2H5PA 2G3DB 3CFFA 5DPIA 3P28A 4Q9XA 4JEOA 3SVNA 3SSLA 4I2YA 4W7DA 4W7EA 4KEXA 2PXWA 3PJ5A 3H1OA 4W6GA 2AH8A 1XAEA 3CB9A 3BXAA 2ZO7A 3SSKA 4DXNA 4HQCA 4Q7UA 3MGFA 5DTXA 2YFPA 3SG5A 2VZXA 2GX0A 2OTBA 4TZGA 1Q73A 2O29A 4LJDC 2DUFA 3ST3A 4ZBLA 3E5VA 4L1IA 1B9CA 3SVCA 2H8QA 2A50B 4Z4KA 3PIBA 1H4UA 4IK4A 5DY6A 3K1KA 4W6NA 2WSOA 2WHUA 3NT3A 3WLCA 3PJBA 3G9AA 4W7FA 2Y0GA 4PPJA 2QLGA 1KP5A 5BQLA 3SVDA 1HUYA 4W6PA 4W6DA 2OJKA 3GB3A 1XSSA 4ZB1A 1RMOA 5HW9A 3BXBA 4W6HA 2G2SB 3OGOA 3ZTFA 5EXUA 5BTTB 1QXTA 3M24A 1QYFA 3VK1A 2Q6PA 1ZUXA 4L12A 4XL5A 5KTGA 2AWLA 3LA1A 5DTLA 2WSNA 4Q7RA 3U0KA 3SVOA 1YFPA 3W1CA 3EK8A 2POXA 1MYWA 1W7UA 3DQKA 3O77A 3CBEA 4U2VA 3LSAA 2IB5A 4JRBA 5T3IA 1G7KA 2DD9A 4H47A 3ZUJA 4ZINA 3IR8A 1JBZA 3SS0A 2H9WA 2GX2A 2YE1A 4H3NA 5FVFA 4ANJA 5J2OA 1QYOA 3GL4A 3U0MA 5DTZA 4JF9A 3SVSA 4JGEA 2ARLA 5AQBB 2V4EA 4NWSA 5F9GA 2A54B 3KCTA 4W6MA 3H1RA 2Q57A 3DQ5A 3SSVA 3SVUA 1W7TA 2A46A 1Q4BA 1YHIA 3DQ6A 5DQBA 3VHTA 5DPGA 4B30B 4KF5A 5DPHA 2WHTA 3SVEA
chains in the Genus database with same CATH superfamily
2A48A 3DQUA 3SVRA 4ZF4A 3GJ1A 3EVPA 3GEXA 4IK9A 1H6RA 4P76A 4B5YA 2QLGB 3AKOA 2HQZA 4W6OA 4DXPA 1Z1PA 3DQ8A 2BTJA 3DQFA 2C9IA 3EK4A 1BFPA 3LVCA 5BT0A 4W6JA 2G5ZB 3ST4A 3ADFA 5HZUA 1EMEA 4R6BA 2EMOA 2WHSA 5EB6A 5HZSA 2DDDA 4KGEA 3SG3A 4XOWA 4W6FA 4R6DA 1EMAA 2DUIA 2OKYA 2AWMA 1RMPA 4OJ0A 4W6TA 1Q4EA 2OGRA 4DXOA 4EULA 3W1DA 2C9JA 1KYRA 4W7XA 4W73A 5FVGA 4JFGA 1XQMA 1Q4CA 4W6CA 2QU1A 5EB7A 5EXBA 4PFEA 1YHGA 5DTYA 4Z4MA 3NEDA 4LJBA 1Z1QA 3P8UA 3SG7A 2GW4B 3SG2A 5EHUA 1ZGOA 2G3OA 2VADA 1OXFA 3PJ7A 4PPLA 5H89A 3DQ9A 4BDUA 4AR7A 1GFLA 4J88A 1ZGPA 4ORNA 3VHTB 3CGLA 2QLHA 1OXDA 2FL1A 2PXSA 5FVIA 3DQDA 4IZNA 2ICRA 1MOVA 3E5TA 1JBYA 3SSHA 3U8PA 2IOVA 3DQOA 4W6KA 1GGXA 3DQMA 3DQ4A 2AHAA 4HVFA 1CV7A 2A52B 2QRFA 2Z6ZA 5DU0A 2V4EC 1EMMA 3EKHA 4OY4A 2VVIA 2DUEA 2QT2A 4W75A 3RWTA 3VICA 2P4MA 2G6YA 2G16B 2G6EA 3U8AA 1YJ2A 4W6UA 4GESB 4N3DA 1UISA 4H48A 4KF5C 3ST0A 2G6XA 1EMCA 2OKWA 2O2BA 2IB6A 2H5OA 1F0BA 4HE4A 1YJFA 2JADA 2EMNA 2IE2A 3O78A 3U0LA 2H6VA 4RYSA 2B3PA 4RYWA 2GW3A 3BX9A 2HGYA 3RWAA 3DPXA 3DQJA 2ZO6A 1EMLA 1GL4A 2WURA 4J8AA 4ZIOA 2EMDA 5BTTA 5EBJA 1RRXA 4AS8A 2HCGA 3E5WA 5DPJA 4ZFSA 4LW5A 5FHVA 2FWQA 3ZUFA 4KA9A 4ZF3A 1MOUA 3SSTA 2AWJA 4W69A 4KPIA 4KAGA 2VAEA 4W76A 2B3QA 2WISA 3LF4B 3SG4A 4DXQA 3WCKA 3SG6A 2Z1OA 2O24A 5EJUA 3GJ2A 2AWKA 3AI4A 4ZF5A 3UG0A 4TZAA 1QYQA 2OTEA 4RTCA 5DRGA 3DQ2A 4W6SA 2QLEA 4DKMA 3LF3A 4LQTA 4OGSA 1Q4DA 3LVAA 2DDCA 4IK1A 4KW9A 3LVDA 4EDSA 3V3DA 2RH7A 5LK4A 4HQ8A 3M22A 3OSRA 2Z6XA 4XGYA 4EN1A 5H88A 5LTRA 2VVJA 4W7RA 5HBDA 2A47A 2H5RA 3EVRA 4H3MA 4KF4A 3NF0A 3TMRA 4B30A 4XVPA 3CFAA 3TMTA 4OHSA 2DUGA 2HRSA 2V4EB 3S05A 1XA9A 2YDZA 4DXMA 1OXEA 4LQUA 3U8CA 4LJDA 4HQ9A 4DXIA 1EMGA 4W6LA 2DUHA 3ED8A 4W6RA 4W72A 4XOVA 1JC0A 3EVVA 3DQIA 3DQ3A 4J89A 2HGDA 3AI5A 3NT9A 1JC1A 4W6IA 1QY3A 5H87A 3IP2A 2VVHA 3DQ1A 3ST2A 1RMMA 3I19A 3OSQA 3NEZA 1W7SA 4IK3A 3DQ7A 4H3LA 3CD9A 2FZUA 3DQHA 4KGFA 4W74A 5DQMA 4W7CA 4L13A 2A56B 4W77A 4KW8A 1S6ZA 4EMQA 3ZULA 4W7AA 2ZMUA 4Q9WA 1KYSA 3A8SA 3WLDA 1C4FA 5HZOA 2A53B 4KW4A 3CFHA 5EXCI 4UTSA 2QZ0A 4IK8A 4LJCA 1YZWA 4JC2A 3DQCA 3SSPA 2YE0A 2WIQA 4IK5A 4Q7TA 3EKJA 2HFCA 3SSYA 4W6AA 4GF6B 5HZTA 3EK7A 4OQWA 2DD7A 2HPWA 3EVUA 2HJOA 3SRYA 2Z6YA 3SV5A 1YHHA 3CD1A 3BXCA 5LTQA 4GOBA 5DRFA 1XMZA 3SVBA 2ZMWA 4EDOA 3DQEA 2QLIA 1Q4AA 1RM9A 3UFZA 5HGEA 1KYPA 3DQLA 1EMKA 1EMBA 3DPZA 3KCSA 4W6BA 1EMFA 3DPWA 1HCJA 3DQNA 4PPKA 3U0NA 1ZGQA 2H5QA 3LS3A 4P1QA 2HQKA 4DKNA 3DQAA 5LTPA 1F09A 2H5PA 2G3DB 3CFFA 5DPIA 3P28A 4Q9XA 4JEOA 3SVNA 3SSLA 4I2YA 4W7DA 4W7EA 4KEXA 2PXWA 3PJ5A 3H1OA 4W6GA 2AH8A 1XAEA 3CB9A 3BXAA 2ZO7A 3SSKA 4DXNA 4HQCA 4Q7UA 3MGFA 5DTXA 2YFPA 3SG5A 2VZXA 2GX0A 2OTBA 4TZGA 1Q73A 2O29A 4LJDC 2DUFA 3ST3A 4ZBLA 3E5VA 4L1IA 1B9CA 3SVCA 2H8QA 2A50B 4Z4KA 3PIBA 1H4UA 4IK4A 5DY6A 3K1KA 4W6NA 2WSOA 2WHUA 3NT3A 3WLCA 3PJBA 3G9AA 4W7FA 2Y0GA 4PPJA 2QLGA 1KP5A 5BQLA 3SVDA 1HUYA 4W6PA 4W6DA 2OJKA 3GB3A 1XSSA 4ZB1A 1RMOA 5HW9A 3BXBA 4W6HA 2G2SB 3OGOA 3ZTFA 5EXUA 5BTTB 1QXTA 3M24A 1QYFA 3VK1A 2Q6PA 1ZUXA 4L12A 4XL5A 5KTGA 2AWLA 3LA1A 5DTLA 2WSNA 4Q7RA 3U0KA 3SVOA 1YFPA 3W1CA 3EK8A 2POXA 1MYWA 1W7UA 3DQKA 3O77A 3CBEA 4U2VA 3LSAA 2IB5A 4JRBA 5T3IA 1G7KA 2DD9A 4H47A 3ZUJA 4ZINA 3IR8A 1JBZA 3SS0A 2H9WA 2GX2A 2YE1A 4H3NA 5FVFA 4ANJA 5J2OA 1QYOA 3GL4A 3U0MA 5DTZA 4JF9A 3SVSA 4JGEA 2ARLA 5AQBB 2V4EA 4NWSA 5F9GA 2A54B 3KCTA 4W6MA 3H1RA 2Q57A 3DQ5A 3SSVA 3SVUA 1W7TA 2A46A 1Q4BA 1YHIA 3DQ6A 5DQBA 3VHTA 5DPGA 4B30B 4KF5A 5DPHA 2WHTA 3SVEA
chains in the Genus database with same CATH topology
2A48A 3DQUA 3SVRA 4ZF4A 3GJ1A 3EVPA 3GEXA 4IK9A 1H6RA 4P76A 4B5YA 2QLGB 3AKOA 2HQZA 4W6OA 4DXPA 1Z1PA 3DQ8A 2BTJA 3DQFA 2C9IA 3EK4A 1BFPA 3LVCA 5BT0A 4W6JA 2G5ZB 3ST4A 3ADFA 5HZUA 1EMEA 4R6BA 2EMOA 2WHSA 5EB6A 5HZSA 2DDDA 4KGEA 3SG3A 4XOWA 4W6FA 4R6DA 1EMAA 2DUIA 2OKYA 2AWMA 1RMPA 4OJ0A 4W6TA 1Q4EA 2OGRA 4DXOA 4EULA 3W1DA 2C9JA 1KYRA 4W7XA 4W73A 5FVGA 4JFGA 1XQMA 1Q4CA 4W6CA 2QU1A 5EB7A 5EXBA 4PFEA 1YHGA 5DTYA 4Z4MA 3NEDA 4LJBA 1Z1QA 3P8UA 3SG7A 2GW4B 3SG2A 5EHUA 1ZGOA 2G3OA 2VADA 1OXFA 3PJ7A 4PPLA 5H89A 3DQ9A 4BDUA 4AR7A 1GFLA 4J88A 1ZGPA 4ORNA 3VHTB 3CGLA 2QLHA 1OXDA 2FL1A 2PXSA 5FVIA 3DQDA 4IZNA 2ICRA 1MOVA 3E5TA 1JBYA 3SSHA 3U8PA 2IOVA 3DQOA 4W6KA 1GGXA 3DQMA 3DQ4A 2AHAA 4HVFA 1CV7A 2A52B 2QRFA 2Z6ZA 5DU0A 2V4EC 1EMMA 3EKHA 4OY4A 2VVIA 2DUEA 2QT2A 4W75A 3RWTA 3VICA 2P4MA 2G6YA 2G16B 2G6EA 3U8AA 1YJ2A 4W6UA 4GESB 4N3DA 1UISA 4H48A 4KF5C 3ST0A 2G6XA 1EMCA 2OKWA 2O2BA 2IB6A 2H5OA 1F0BA 4HE4A 1YJFA 2JADA 2EMNA 2IE2A 3O78A 3U0LA 2H6VA 4RYSA 2B3PA 4RYWA 2GW3A 3BX9A 2HGYA 3RWAA 3DPXA 3DQJA 2ZO6A 1EMLA 1GL4A 2WURA 4J8AA 4ZIOA 2EMDA 5BTTA 5EBJA 1RRXA 4AS8A 2HCGA 3E5WA 5DPJA 4ZFSA 4LW5A 5FHVA 2FWQA 3ZUFA 4KA9A 4ZF3A 1MOUA 3SSTA 2AWJA 4W69A 4KPIA 4KAGA 2VAEA 4W76A 2B3QA 2WISA 3LF4B 3SG4A 4DXQA 3WCKA 3SG6A 2Z1OA 2O24A 5EJUA 3GJ2A 2AWKA 3AI4A 4ZF5A 3UG0A 4TZAA 1QYQA 2OTEA 4RTCA 5DRGA 3DQ2A 4W6SA 2QLEA 4DKMA 3LF3A 4LQTA 4OGSA 1Q4DA 3LVAA 2DDCA 4IK1A 4KW9A 3LVDA 4EDSA 3V3DA 2RH7A 5LK4A 4HQ8A 3M22A 3OSRA 2Z6XA 4XGYA 4EN1A 5H88A 5LTRA 2VVJA 4W7RA 5HBDA 2A47A 2H5RA 3EVRA 4H3MA 4KF4A 3NF0A 3TMRA 4B30A 4XVPA 3CFAA 3TMTA 4OHSA 2DUGA 2HRSA 2V4EB 3S05A 1XA9A 2YDZA 4DXMA 1OXEA 4LQUA 3U8CA 4LJDA 4HQ9A 4DXIA 1EMGA 4W6LA 2DUHA 3ED8A 4W6RA 4W72A 4XOVA 1JC0A 3EVVA 3DQIA 3DQ3A 4J89A 2HGDA 3AI5A 3NT9A 1JC1A 4W6IA 1QY3A 5H87A 3IP2A 2VVHA 3DQ1A 3ST2A 1RMMA 3I19A 3OSQA 3NEZA 1W7SA 4IK3A 3DQ7A 4H3LA 3CD9A 2FZUA 3DQHA 4KGFA 4W74A 5DQMA 4W7CA 4L13A 2A56B 4W77A 4KW8A 1S6ZA 4EMQA 3ZULA 4W7AA 2ZMUA 4Q9WA 1KYSA 3A8SA 3WLDA 1C4FA 5HZOA 2A53B 4KW4A 3CFHA 5EXCI 4UTSA 2QZ0A 4IK8A 4LJCA 1YZWA 4JC2A 3DQCA 3SSPA 2YE0A 2WIQA 4IK5A 4Q7TA 3EKJA 2HFCA 3SSYA 4W6AA 4GF6B 5HZTA 3EK7A 4OQWA 2DD7A 2HPWA 3EVUA 2HJOA 3SRYA 2Z6YA 3SV5A 1YHHA 3CD1A 3BXCA 5LTQA 4GOBA 5DRFA 1XMZA 3SVBA 2ZMWA 4EDOA 3DQEA 2QLIA 1Q4AA 1RM9A 3UFZA 5HGEA 1KYPA 3DQLA 1EMKA 1EMBA 3DPZA 3KCSA 4W6BA 1EMFA 3DPWA 1HCJA 3DQNA 4PPKA 3U0NA 1ZGQA 2H5QA 3LS3A 4P1QA 2HQKA 4DKNA 3DQAA 5LTPA 1F09A 2H5PA 2G3DB 3CFFA 5DPIA 3P28A 4Q9XA 4JEOA 3SVNA 3SSLA 4I2YA 4W7DA 4W7EA 4KEXA 2PXWA 3PJ5A 3H1OA 4W6GA 2AH8A 1XAEA 3CB9A 3BXAA 2ZO7A 3SSKA 4DXNA 4HQCA 4Q7UA 3MGFA 5DTXA 2YFPA 3SG5A 2VZXA 2GX0A 2OTBA 4TZGA 1Q73A 2O29A 4LJDC 2DUFA 3ST3A 4ZBLA 3E5VA 4L1IA 1B9CA 3SVCA 2H8QA 2A50B 4Z4KA 3PIBA 1H4UA 4IK4A 5DY6A 3K1KA 4W6NA 2WSOA 2WHUA 3NT3A 3WLCA 3PJBA 3G9AA 4W7FA 2Y0GA 4PPJA 2QLGA 1KP5A 5BQLA 3SVDA 1HUYA 4W6PA 4W6DA 2OJKA 3GB3A 1XSSA 4ZB1A 1RMOA 5HW9A 3BXBA 4W6HA 2G2SB 3OGOA 3ZTFA 5EXUA 5BTTB 1QXTA 3M24A 1QYFA 3VK1A 2Q6PA 1ZUXA 4L12A 4XL5A 5KTGA 2AWLA 3LA1A 5DTLA 2WSNA 4Q7RA 3U0KA 3SVOA 1YFPA 3W1CA 3EK8A 2POXA 1MYWA 1W7UA 3DQKA 3O77A 3CBEA 4U2VA 3LSAA 2IB5A 4JRBA 5T3IA 1G7KA 2DD9A 4H47A 3ZUJA 4ZINA 3IR8A 1JBZA 3SS0A 2H9WA 2GX2A 2YE1A 4H3NA 5FVFA 4ANJA 5J2OA 1QYOA 3GL4A 3U0MA 5DTZA 4JF9A 3SVSA 4JGEA 2ARLA 5AQBB 2V4EA 4NWSA 5F9GA 2A54B 3KCTA 4W6MA 3H1RA 2Q57A 3DQ5A 3SSVA 3SVUA 1W7TA 2A46A 1Q4BA 1YHIA 3DQ6A 5DQBA 3VHTA 5DPGA 4B30B 4KF5A 5DPHA 2WHTA 3SVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A48 A;  3DQU A;  3SVR A;  4ZF4 A;  3GJ1 A;  3EVP A;  3GEX A;  4IK9 A;  1H6R A;  4P76 A;  4B5Y A;  2QLG B;  3AKO A;  2HQZ A;  4W6O A;  4DXP A;  1Z1P A;  3DQ8 A;  2BTJ A;  3DQF A;  2C9I A;  3EK4 A;  1BFP A;  3LVC A;  5BT0 A;  4W6J A;  2G5Z B;  3ST4 A;  3ADF A;  5HZU A;  1EME A;  4R6B A;  2EMO A;  2WHS A;  5EB6 A;  5HZS A;  2DDD A;  4KGE A;  3SG3 A;  4XOW A;  4W6F A;  4R6D A;  1EMA A;  2DUI A;  2OKY A;  2AWM A;  1RMP A;  4OJ0 A;  4W6T A;  1Q4E A;  2OGR A;  4DXO A;  4EUL A;  3W1D A;  2C9J A;  1KYR A;  4W7X A;  4W73 A;  5FVG A;  4JFG A;  1XQM A;  1Q4C A;  4W6C A;  2QU1 A;  5EB7 A;  5EXB A;  4PFE A;  1YHG A;  5DTY A;  4Z4M A;  3NED A;  4LJB A;  1Z1Q A;  3P8U A;  3SG7 A;  2GW4 B;  3SG2 A;  5EHU A;  1ZGO A;  2G3O A;  2VAD A;  1OXF A;  3PJ7 A;  4PPL A;  5H89 A;  3DQ9 A;  4BDU A;  4AR7 A;  1GFL A;  4J88 A;  1ZGP A;  4ORN A;  3VHT B;  3CGL A;  2QLH A;  1OXD A;  2FL1 A;  2PXS A;  5FVI A;  3DQD A;  4IZN A;  2ICR A;  1MOV A;  3E5T A;  1JBY A;  3SSH A;  3U8P A;  2IOV A;  3DQO A;  4W6K A;  1GGX A;  3DQM A;  3DQ4 A;  2AHA A;  4HVF A;  1CV7 A;  2A52 B;  2QRF A;  2Z6Z A;  5DU0 A;  2V4E C;  1EMM A;  3EKH A;  4OY4 A;  2VVI A;  2DUE A;  2QT2 A;  4W75 A;  3RWT A;  3VIC A;  2P4M A;  2G6Y A;  2G16 B;  2G6E A;  3U8A A;  1YJ2 A;  4W6U A;  4GES B;  4N3D A;  1UIS A;  4H48 A;  4KF5 C;  3ST0 A;  2G6X A;  1EMC A;  2OKW A;  2O2B A;  2IB6 A;  2H5O A;  1F0B A;  4HE4 A;  1YJF A;  2JAD A;  2EMN A;  2IE2 A;  3O78 A;  3U0L A;  2H6V A;  4RYS A;  2B3P A;  4RYW A;  2GW3 A;  3BX9 A;  2HGY A;  3RWA A;  3DPX A;  3DQJ A;  2ZO6 A;  1EML A;  1GL4 A;  2WUR A;  4J8A A;  4ZIO A;  2EMD A;  5BTT A;  5EBJ A;  1RRX A;  4AS8 A;  2HCG A;  3E5W A;  5DPJ A;  4ZFS A;  4LW5 A;  5FHV A;  2FWQ A;  3ZUF A;  4KA9 A;  4ZF3 A;  1MOU A;  3SST A;  2AWJ A;  4W69 A;  4KPI A;  4KAG A;  2VAE A;  4W76 A;  2B3Q A;  2WIS A;  3LF4 B;  3SG4 A;  4DXQ A;  3WCK A;  3SG6 A;  2Z1O A;  2O24 A;  5EJU A;  3GJ2 A;  2AWK A;  3AI4 A;  4ZF5 A;  3UG0 A;  4TZA A;  1QYQ A;  2OTE A;  4RTC A;  5DRG A;  3DQ2 A;  4W6S A;  2QLE A;  4DKM A;  3LF3 A;  4LQT A;  4OGS A;  1Q4D A;  3LVA A;  2DDC A;  4IK1 A;  4KW9 A;  3LVD A;  4EDS A;  3V3D A;  2RH7 A;  5LK4 A;  4HQ8 A;  3M22 A;  3OSR A;  2Z6X A;  4XGY A;  4EN1 A;  5H88 A;  5LTR A;  2VVJ A;  4W7R A;  5HBD A;  2A47 A;  2H5R A;  3EVR A;  4H3M A;  4KF4 A;  3NF0 A;  3TMR A;  4B30 A;  4XVP A;  3CFA A;  3TMT A;  4OHS A;  2DUG A;  2HRS A;  2V4E B;  3S05 A;  1XA9 A;  2YDZ A;  4DXM A;  1OXE A;  4LQU A;  3U8C A;  4LJD A;  4HQ9 A;  4DXI A;  1EMG A;  4W6L A;  2DUH A;  3ED8 A;  4W6R A;  4W72 A;  4XOV A;  1JC0 A;  3EVV A;  3DQI A;  3DQ3 A;  4J89 A;  2HGD A;  3AI5 A;  3NT9 A;  1JC1 A;  4W6I A;  1QY3 A;  5H87 A;  3IP2 A;  2VVH A;  3DQ1 A;  3ST2 A;  1RMM A;  3I19 A;  3OSQ A;  3NEZ A;  1W7S A;  4IK3 A;  3DQ7 A;  4H3L A;  3CD9 A;  2FZU A;  3DQH A;  4KGF A;  4W74 A;  5DQM A;  4W7C A;  4L13 A;  2A56 B;  4W77 A;  4KW8 A;  1S6Z A;  4EMQ A;  3ZUL A;  4W7A A;  2ZMU A;  4Q9W A;  1KYS A;  3A8S A;  3WLD A;  1C4F A;  5HZO A;  2A53 B;  4KW4 A;  3CFH A;  5EXC I;  4UTS A;  2QZ0 A;  4IK8 A;  4LJC A;  1YZW A;  4JC2 A;  3DQC A;  3SSP A;  2YE0 A;  2WIQ A;  4IK5 A;  4Q7T A;  3EKJ A;  2HFC A;  3SSY A;  4W6A A;  4GF6 B;  5HZT A;  3EK7 A;  4OQW A;  2DD7 A;  2HPW A;  3EVU A;  2HJO A;  3SRY A;  2Z6Y A;  3SV5 A;  1YHH A;  3CD1 A;  3BXC A;  5LTQ A;  4GOB A;  5DRF A;  1XMZ A;  3SVB A;  2ZMW A;  4EDO A;  3DQE A;  2QLI A;  1Q4A A;  1RM9 A;  3UFZ A;  5HGE A;  1KYP A;  3DQL A;  1EMK A;  1EMB A;  3DPZ A;  3KCS A;  4W6B A;  1EMF A;  3DPW A;  1HCJ A;  3DQN A;  4PPK A;  3U0N A;  1ZGQ A;  2H5Q A;  3LS3 A;  4P1Q A;  2HQK A;  4DKN A;  3DQA A;  5LTP A;  1F09 A;  2H5P A;  2G3D B;  3CFF A;  5DPI A;  3P28 A;  4Q9X A;  4JEO A;  3SVN A;  3SSL A;  4I2Y A;  4W7D A;  4W7E A;  4KEX A;  2PXW A;  3PJ5 A;  3H1O A;  4W6G A;  2AH8 A;  1XAE A;  3CB9 A;  3BXA A;  2ZO7 A;  3SSK A;  4DXN A;  4HQC A;  4Q7U A;  3MGF A;  5DTX A;  2YFP A;  3SG5 A;  2VZX A;  2GX0 A;  2OTB A;  4TZG A;  1Q73 A;  2O29 A;  4LJD C;  2DUF A;  3ST3 A;  4ZBL A;  3E5V A;  4L1I A;  1B9C A;  3SVC A;  2H8Q A;  2A50 B;  4Z4K A;  3PIB A;  1H4U A;  4IK4 A;  5DY6 A;  3K1K A;  4W6N A;  2WSO A;  2WHU A;  3NT3 A;  3WLC A;  3PJB A;  3G9A A;  4W7F A;  2Y0G A;  4PPJ A;  2QLG A;  1KP5 A;  5BQL A;  3SVD A;  1HUY A;  4W6P A;  4W6D A;  2OJK A;  3GB3 A;  1XSS A;  4ZB1 A;  1RMO A;  5HW9 A;  3BXB A;  4W6H A;  2G2S B;  3OGO A;  3ZTF A;  5EXU A;  5BTT B;  1QXT A;  3M24 A;  1QYF A;  3VK1 A;  2Q6P A;  1ZUX A;  4L12 A;  4XL5 A;  5KTG A;  2AWL A;  3LA1 A;  5DTL A;  2WSN A;  4Q7R A;  3U0K A;  3SVO A;  1YFP A;  3W1C A;  3EK8 A;  2POX A;  1MYW A;  1W7U A;  3DQK A;  3O77 A;  3CBE A;  4U2V A;  3LSA A;  2IB5 A;  4JRB A;  5T3I A;  1G7K A;  2DD9 A;  4H47 A;  3ZUJ A;  4ZIN A;  3IR8 A;  1JBZ A;  3SS0 A;  2H9W A;  2GX2 A;  2YE1 A;  4H3N A;  5FVF A;  4ANJ A;  5J2O A;  1QYO A;  3GL4 A;  3U0M A;  5DTZ A;  4JF9 A;  3SVS A;  4JGE A;  2ARL A;  5AQB B;  2V4E A;  4NWS A;  5F9G A;  2A54 B;  3KCT A;  4W6M A;  3H1R A;  2Q57 A;  3DQ5 A;  3SSV A;  3SVU A;  1W7T A;  2A46 A;  1Q4B A;  1YHI A;  3DQ6 A;  5DQB A;  3VHT A;  5DPG A;  4B30 B;  4KF5 A;  5DPH A;  2WHT A;  3SVE A; 
#chains in the Genus database with same CATH topology
 2A48 A;  3DQU A;  3SVR A;  4ZF4 A;  3GJ1 A;  3EVP A;  3GEX A;  4IK9 A;  1H6R A;  4P76 A;  4B5Y A;  2QLG B;  3AKO A;  2HQZ A;  4W6O A;  4DXP A;  1Z1P A;  3DQ8 A;  2BTJ A;  3DQF A;  2C9I A;  3EK4 A;  1BFP A;  3LVC A;  5BT0 A;  4W6J A;  2G5Z B;  3ST4 A;  3ADF A;  5HZU A;  1EME A;  4R6B A;  2EMO A;  2WHS A;  5EB6 A;  5HZS A;  2DDD A;  4KGE A;  3SG3 A;  4XOW A;  4W6F A;  4R6D A;  1EMA A;  2DUI A;  2OKY A;  2AWM A;  1RMP A;  4OJ0 A;  4W6T A;  1Q4E A;  2OGR A;  4DXO A;  4EUL A;  3W1D A;  2C9J A;  1KYR A;  4W7X A;  4W73 A;  5FVG A;  4JFG A;  1XQM A;  1Q4C A;  4W6C A;  2QU1 A;  5EB7 A;  5EXB A;  4PFE A;  1YHG A;  5DTY A;  4Z4M A;  3NED A;  4LJB A;  1Z1Q A;  3P8U A;  3SG7 A;  2GW4 B;  3SG2 A;  5EHU A;  1ZGO A;  2G3O A;  2VAD A;  1OXF A;  3PJ7 A;  4PPL A;  5H89 A;  3DQ9 A;  4BDU A;  4AR7 A;  1GFL A;  4J88 A;  1ZGP A;  4ORN A;  3VHT B;  3CGL A;  2QLH A;  1OXD A;  2FL1 A;  2PXS A;  5FVI A;  3DQD A;  4IZN A;  2ICR A;  1MOV A;  3E5T A;  1JBY A;  3SSH A;  3U8P A;  2IOV A;  3DQO A;  4W6K A;  1GGX A;  3DQM A;  3DQ4 A;  2AHA A;  4HVF A;  1CV7 A;  2A52 B;  2QRF A;  2Z6Z A;  5DU0 A;  2V4E C;  1EMM A;  3EKH A;  4OY4 A;  2VVI A;  2DUE A;  2QT2 A;  4W75 A;  3RWT A;  3VIC A;  2P4M A;  2G6Y A;  2G16 B;  2G6E A;  3U8A A;  1YJ2 A;  4W6U A;  4GES B;  4N3D A;  1UIS A;  4H48 A;  4KF5 C;  3ST0 A;  2G6X A;  1EMC A;  2OKW A;  2O2B A;  2IB6 A;  2H5O A;  1F0B A;  4HE4 A;  1YJF A;  2JAD A;  2EMN A;  2IE2 A;  3O78 A;  3U0L A;  2H6V A;  4RYS A;  2B3P A;  4RYW A;  2GW3 A;  3BX9 A;  2HGY A;  3RWA A;  3DPX A;  3DQJ A;  2ZO6 A;  1EML A;  1GL4 A;  2WUR A;  4J8A A;  4ZIO A;  2EMD A;  5BTT A;  5EBJ A;  1RRX A;  4AS8 A;  2HCG A;  3E5W A;  5DPJ A;  4ZFS A;  4LW5 A;  5FHV A;  2FWQ A;  3ZUF A;  4KA9 A;  4ZF3 A;  1MOU A;  3SST A;  2AWJ A;  4W69 A;  4KPI A;  4KAG A;  2VAE A;  4W76 A;  2B3Q A;  2WIS A;  3LF4 B;  3SG4 A;  4DXQ A;  3WCK A;  3SG6 A;  2Z1O A;  2O24 A;  5EJU A;  3GJ2 A;  2AWK A;  3AI4 A;  4ZF5 A;  3UG0 A;  4TZA A;  1QYQ A;  2OTE A;  4RTC A;  5DRG A;  3DQ2 A;  4W6S A;  2QLE A;  4DKM A;  3LF3 A;  4LQT A;  4OGS A;  1Q4D A;  3LVA A;  2DDC A;  4IK1 A;  4KW9 A;  3LVD A;  4EDS A;  3V3D A;  2RH7 A;  5LK4 A;  4HQ8 A;  3M22 A;  3OSR A;  2Z6X A;  4XGY A;  4EN1 A;  5H88 A;  5LTR A;  2VVJ A;  4W7R A;  5HBD A;  2A47 A;  2H5R A;  3EVR A;  4H3M A;  4KF4 A;  3NF0 A;  3TMR A;  4B30 A;  4XVP A;  3CFA A;  3TMT A;  4OHS A;  2DUG A;  2HRS A;  2V4E B;  3S05 A;  1XA9 A;  2YDZ A;  4DXM A;  1OXE A;  4LQU A;  3U8C A;  4LJD A;  4HQ9 A;  4DXI A;  1EMG A;  4W6L A;  2DUH A;  3ED8 A;  4W6R A;  4W72 A;  4XOV A;  1JC0 A;  3EVV A;  3DQI A;  3DQ3 A;  4J89 A;  2HGD A;  3AI5 A;  3NT9 A;  1JC1 A;  4W6I A;  1QY3 A;  5H87 A;  3IP2 A;  2VVH A;  3DQ1 A;  3ST2 A;  1RMM A;  3I19 A;  3OSQ A;  3NEZ A;  1W7S A;  4IK3 A;  3DQ7 A;  4H3L A;  3CD9 A;  2FZU A;  3DQH A;  4KGF A;  4W74 A;  5DQM A;  4W7C A;  4L13 A;  2A56 B;  4W77 A;  4KW8 A;  1S6Z A;  4EMQ A;  3ZUL A;  4W7A A;  2ZMU A;  4Q9W A;  1KYS A;  3A8S A;  3WLD A;  1C4F A;  5HZO A;  2A53 B;  4KW4 A;  3CFH A;  5EXC I;  4UTS A;  2QZ0 A;  4IK8 A;  4LJC A;  1YZW A;  4JC2 A;  3DQC A;  3SSP A;  2YE0 A;  2WIQ A;  4IK5 A;  4Q7T A;  3EKJ A;  2HFC A;  3SSY A;  4W6A A;  4GF6 B;  5HZT A;  3EK7 A;  4OQW A;  2DD7 A;  2HPW A;  3EVU A;  2HJO A;  3SRY A;  2Z6Y A;  3SV5 A;  1YHH A;  3CD1 A;  3BXC A;  5LTQ A;  4GOB A;  5DRF A;  1XMZ A;  3SVB A;  2ZMW A;  4EDO A;  3DQE A;  2QLI A;  1Q4A A;  1RM9 A;  3UFZ A;  5HGE A;  1KYP A;  3DQL A;  1EMK A;  1EMB A;  3DPZ A;  3KCS A;  4W6B A;  1EMF A;  3DPW A;  1HCJ A;  3DQN A;  4PPK A;  3U0N A;  1ZGQ A;  2H5Q A;  3LS3 A;  4P1Q A;  2HQK A;  4DKN A;  3DQA A;  5LTP A;  1F09 A;  2H5P A;  2G3D B;  3CFF A;  5DPI A;  3P28 A;  4Q9X A;  4JEO A;  3SVN A;  3SSL A;  4I2Y A;  4W7D A;  4W7E A;  4KEX A;  2PXW A;  3PJ5 A;  3H1O A;  4W6G A;  2AH8 A;  1XAE A;  3CB9 A;  3BXA A;  2ZO7 A;  3SSK A;  4DXN A;  4HQC A;  4Q7U A;  3MGF A;  5DTX A;  2YFP A;  3SG5 A;  2VZX A;  2GX0 A;  2OTB A;  4TZG A;  1Q73 A;  2O29 A;  4LJD C;  2DUF A;  3ST3 A;  4ZBL A;  3E5V A;  4L1I A;  1B9C A;  3SVC A;  2H8Q A;  2A50 B;  4Z4K A;  3PIB A;  1H4U A;  4IK4 A;  5DY6 A;  3K1K A;  4W6N A;  2WSO A;  2WHU A;  3NT3 A;  3WLC A;  3PJB A;  3G9A A;  4W7F A;  2Y0G A;  4PPJ A;  2QLG A;  1KP5 A;  5BQL A;  3SVD A;  1HUY A;  4W6P A;  4W6D A;  2OJK A;  3GB3 A;  1XSS A;  4ZB1 A;  1RMO A;  5HW9 A;  3BXB A;  4W6H A;  2G2S B;  3OGO A;  3ZTF A;  5EXU A;  5BTT B;  1QXT A;  3M24 A;  1QYF A;  3VK1 A;  2Q6P A;  1ZUX A;  4L12 A;  4XL5 A;  5KTG A;  2AWL A;  3LA1 A;  5DTL A;  2WSN A;  4Q7R A;  3U0K A;  3SVO A;  1YFP A;  3W1C A;  3EK8 A;  2POX A;  1MYW A;  1W7U A;  3DQK A;  3O77 A;  3CBE A;  4U2V A;  3LSA A;  2IB5 A;  4JRB A;  5T3I A;  1G7K A;  2DD9 A;  4H47 A;  3ZUJ A;  4ZIN A;  3IR8 A;  1JBZ A;  3SS0 A;  2H9W A;  2GX2 A;  2YE1 A;  4H3N A;  5FVF A;  4ANJ A;  5J2O A;  1QYO A;  3GL4 A;  3U0M A;  5DTZ A;  4JF9 A;  3SVS A;  4JGE A;  2ARL A;  5AQB B;  2V4E A;  4NWS A;  5F9G A;  2A54 B;  3KCT A;  4W6M A;  3H1R A;  2Q57 A;  3DQ5 A;  3SSV A;  3SVU A;  1W7T A;  2A46 A;  1Q4B A;  1YHI A;  3DQ6 A;  5DQB A;  3VHT A;  5DPG A;  4B30 B;  4KF5 A;  5DPH A;  2WHT A;  3SVE A; 
#chains in the Genus database with same CATH homology
 2A48 A;  3DQU A;  3SVR A;  4ZF4 A;  3GJ1 A;  3EVP A;  3GEX A;  4IK9 A;  1H6R A;  4P76 A;  4B5Y A;  2QLG B;  3AKO A;  2HQZ A;  4W6O A;  4DXP A;  1Z1P A;  3DQ8 A;  2BTJ A;  3DQF A;  2C9I A;  3EK4 A;  1BFP A;  3LVC A;  5BT0 A;  4W6J A;  2G5Z B;  3ST4 A;  3ADF A;  5HZU A;  1EME A;  4R6B A;  2EMO A;  2WHS A;  5EB6 A;  5HZS A;  2DDD A;  4KGE A;  3SG3 A;  4XOW A;  4W6F A;  4R6D A;  1EMA A;  2DUI A;  2OKY A;  2AWM A;  1RMP A;  4OJ0 A;  4W6T A;  1Q4E A;  2OGR A;  4DXO A;  4EUL A;  3W1D A;  2C9J A;  1KYR A;  4W7X A;  4W73 A;  5FVG A;  4JFG A;  1XQM A;  1Q4C A;  4W6C A;  2QU1 A;  5EB7 A;  5EXB A;  4PFE A;  1YHG A;  5DTY A;  4Z4M A;  3NED A;  4LJB A;  1Z1Q A;  3P8U A;  3SG7 A;  2GW4 B;  3SG2 A;  5EHU A;  1ZGO A;  2G3O A;  2VAD A;  1OXF A;  3PJ7 A;  4PPL A;  5H89 A;  3DQ9 A;  4BDU A;  4AR7 A;  1GFL A;  4J88 A;  1ZGP A;  4ORN A;  3VHT B;  3CGL A;  2QLH A;  1OXD A;  2FL1 A;  2PXS A;  5FVI A;  3DQD A;  4IZN A;  2ICR A;  1MOV A;  3E5T A;  1JBY A;  3SSH A;  3U8P A;  2IOV A;  3DQO A;  4W6K A;  1GGX A;  3DQM A;  3DQ4 A;  2AHA A;  4HVF A;  1CV7 A;  2A52 B;  2QRF A;  2Z6Z A;  5DU0 A;  2V4E C;  1EMM A;  3EKH A;  4OY4 A;  2VVI A;  2DUE A;  2QT2 A;  4W75 A;  3RWT A;  3VIC A;  2P4M A;  2G6Y A;  2G16 B;  2G6E A;  3U8A A;  1YJ2 A;  4W6U A;  4GES B;  4N3D A;  1UIS A;  4H48 A;  4KF5 C;  3ST0 A;  2G6X A;  1EMC A;  2OKW A;  2O2B A;  2IB6 A;  2H5O A;  1F0B A;  4HE4 A;  1YJF A;  2JAD A;  2EMN A;  2IE2 A;  3O78 A;  3U0L A;  2H6V A;  4RYS A;  2B3P A;  4RYW A;  2GW3 A;  3BX9 A;  2HGY A;  3RWA A;  3DPX A;  3DQJ A;  2ZO6 A;  1EML A;  1GL4 A;  2WUR A;  4J8A A;  4ZIO A;  2EMD A;  5BTT A;  5EBJ A;  1RRX A;  4AS8 A;  2HCG A;  3E5W A;  5DPJ A;  4ZFS A;  4LW5 A;  5FHV A;  2FWQ A;  3ZUF A;  4KA9 A;  4ZF3 A;  1MOU A;  3SST A;  2AWJ A;  4W69 A;  4KPI A;  4KAG A;  2VAE A;  4W76 A;  2B3Q A;  2WIS A;  3LF4 B;  3SG4 A;  4DXQ A;  3WCK A;  3SG6 A;  2Z1O A;  2O24 A;  5EJU A;  3GJ2 A;  2AWK A;  3AI4 A;  4ZF5 A;  3UG0 A;  4TZA A;  1QYQ A;  2OTE A;  4RTC A;  5DRG A;  3DQ2 A;  4W6S A;  2QLE A;  4DKM A;  3LF3 A;  4LQT A;  4OGS A;  1Q4D A;  3LVA A;  2DDC A;  4IK1 A;  4KW9 A;  3LVD A;  4EDS A;  3V3D A;  2RH7 A;  5LK4 A;  4HQ8 A;  3M22 A;  3OSR A;  2Z6X A;  4XGY A;  4EN1 A;  5H88 A;  5LTR A;  2VVJ A;  4W7R A;  5HBD A;  2A47 A;  2H5R A;  3EVR A;  4H3M A;  4KF4 A;  3NF0 A;  3TMR A;  4B30 A;  4XVP A;  3CFA A;  3TMT A;  4OHS A;  2DUG A;  2HRS A;  2V4E B;  3S05 A;  1XA9 A;  2YDZ A;  4DXM A;  1OXE A;  4LQU A;  3U8C A;  4LJD A;  4HQ9 A;  4DXI A;  1EMG A;  4W6L A;  2DUH A;  3ED8 A;  4W6R A;  4W72 A;  4XOV A;  1JC0 A;  3EVV A;  3DQI A;  3DQ3 A;  4J89 A;  2HGD A;  3AI5 A;  3NT9 A;  1JC1 A;  4W6I A;  1QY3 A;  5H87 A;  3IP2 A;  2VVH A;  3DQ1 A;  3ST2 A;  1RMM A;  3I19 A;  3OSQ A;  3NEZ A;  1W7S A;  4IK3 A;  3DQ7 A;  4H3L A;  3CD9 A;  2FZU A;  3DQH A;  4KGF A;  4W74 A;  5DQM A;  4W7C A;  4L13 A;  2A56 B;  4W77 A;  4KW8 A;  1S6Z A;  4EMQ A;  3ZUL A;  4W7A A;  2ZMU A;  4Q9W A;  1KYS A;  3A8S A;  3WLD A;  1C4F A;  5HZO A;  2A53 B;  4KW4 A;  3CFH A;  5EXC I;  4UTS A;  2QZ0 A;  4IK8 A;  4LJC A;  1YZW A;  4JC2 A;  3DQC A;  3SSP A;  2YE0 A;  2WIQ A;  4IK5 A;  4Q7T A;  3EKJ A;  2HFC A;  3SSY A;  4W6A A;  4GF6 B;  5HZT A;  3EK7 A;  4OQW A;  2DD7 A;  2HPW A;  3EVU A;  2HJO A;  3SRY A;  2Z6Y A;  3SV5 A;  1YHH A;  3CD1 A;  3BXC A;  5LTQ A;  4GOB A;  5DRF A;  1XMZ A;  3SVB A;  2ZMW A;  4EDO A;  3DQE A;  2QLI A;  1Q4A A;  1RM9 A;  3UFZ A;  5HGE A;  1KYP A;  3DQL A;  1EMK A;  1EMB A;  3DPZ A;  3KCS A;  4W6B A;  1EMF A;  3DPW A;  1HCJ A;  3DQN A;  4PPK A;  3U0N A;  1ZGQ A;  2H5Q A;  3LS3 A;  4P1Q A;  2HQK A;  4DKN A;  3DQA A;  5LTP A;  1F09 A;  2H5P A;  2G3D B;  3CFF A;  5DPI A;  3P28 A;  4Q9X A;  4JEO A;  3SVN A;  3SSL A;  4I2Y A;  4W7D A;  4W7E A;  4KEX A;  2PXW A;  3PJ5 A;  3H1O A;  4W6G A;  2AH8 A;  1XAE A;  3CB9 A;  3BXA A;  2ZO7 A;  3SSK A;  4DXN A;  4HQC A;  4Q7U A;  3MGF A;  5DTX A;  2YFP A;  3SG5 A;  2VZX A;  2GX0 A;  2OTB A;  4TZG A;  1Q73 A;  2O29 A;  4LJD C;  2DUF A;  3ST3 A;  4ZBL A;  3E5V A;  4L1I A;  1B9C A;  3SVC A;  2H8Q A;  2A50 B;  4Z4K A;  3PIB A;  1H4U A;  4IK4 A;  5DY6 A;  3K1K A;  4W6N A;  2WSO A;  2WHU A;  3NT3 A;  3WLC A;  3PJB A;  3G9A A;  4W7F A;  2Y0G A;  4PPJ A;  2QLG A;  1KP5 A;  5BQL A;  3SVD A;  1HUY A;  4W6P A;  4W6D A;  2OJK A;  3GB3 A;  1XSS A;  4ZB1 A;  1RMO A;  5HW9 A;  3BXB A;  4W6H A;  2G2S B;  3OGO A;  3ZTF A;  5EXU A;  5BTT B;  1QXT A;  3M24 A;  1QYF A;  3VK1 A;  2Q6P A;  1ZUX A;  4L12 A;  4XL5 A;  5KTG A;  2AWL A;  3LA1 A;  5DTL A;  2WSN A;  4Q7R A;  3U0K A;  3SVO A;  1YFP A;  3W1C A;  3EK8 A;  2POX A;  1MYW A;  1W7U A;  3DQK A;  3O77 A;  3CBE A;  4U2V A;  3LSA A;  2IB5 A;  4JRB A;  5T3I A;  1G7K A;  2DD9 A;  4H47 A;  3ZUJ A;  4ZIN A;  3IR8 A;  1JBZ A;  3SS0 A;  2H9W A;  2GX2 A;  2YE1 A;  4H3N A;  5FVF A;  4ANJ A;  5J2O A;  1QYO A;  3GL4 A;  3U0M A;  5DTZ A;  4JF9 A;  3SVS A;  4JGE A;  2ARL A;  5AQB B;  2V4E A;  4NWS A;  5F9G A;  2A54 B;  3KCT A;  4W6M A;  3H1R A;  2Q57 A;  3DQ5 A;  3SSV A;  3SVU A;  1W7T A;  2A46 A;  1Q4B A;  1YHI A;  3DQ6 A;  5DQB A;  3VHT A;  5DPG A;  4B30 B;  4KF5 A;  5DPH A;  2WHT A;  3SVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...