4KPKA

Crystal structure of a enoyl-coa hydratase from shewanella pealeana atcc 700345
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
265
structure length
265
Chain Sequence
b'ATQTEILDQQLHYLSCTLNGGVAQMVLDRSDKHNAFDEVMISEMIQVLEHFKRNEQCQILLLKANGKNFSAGADLNWMRKQAKMDFEQNLADANELARLMSMLDKFPKPTITLVQGAAFGGALGLICCSDIAIANERASFCLSEVKLGLIPAVISPYVTRAMGQRAARRYMLTAERFDAQKALELQIIHDINDDLDAAAQPFIDALLSNSPQGMAWVKCLLSSLEDGVIDQNTLDHTSERIARIRVSEEGQEGLNAFFEKRSPQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/isomerase
publication title Crystal structure of a enoyl-CoA hydratase from Shewanella pealeana ATCC 700345
rcsb
source organism Shewanella pealeana
molecule tags Isomerase
total genus 91
structure length 265
sequence length 265
ec nomenclature
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4kpkA00
2W3PA 4GM2A 1EF8A 3P5MA 3PEAA 4JCSA 5E0NX 3GMAA 1O8UA 2J5IB 3HE2A 4K2NA 5INIA 3R9SA 3IB9A 4EMMA 1FC9A 2HW5A 3QWDA 3TZ3A 4RCNA 1VRGA 2BZRA 1UYVA 4B3JA 4LK5A 5KDRA 3R6HA 2ZL4A 4U0GH 3T8BA 3QMJA 4RYFH 4JCQA 2F9YA 3KTGA 4OG1A 5KDRB 3BF0A 4B3HA 1Q52A 3ISAA 1N6EA 2ZL2A 3LKEA 3BEZA 3GF3A 5FUSA 2X58A 1FCFA 3FDUA 3GLMA 2F6QA 1J7XA 2EJ5A 1RJMA 2J5SA 2VSUE 5E0SH 1XO6A 4U18A 5G1QA 4FZWA 1UYTA 4G2RA 3FF6A 3M6MA 3HLN1 3L3SA 4ZDDA 4YLHA 3ZW9A 4OLQA 2A7SA 1XNWA 4FNDA 2X24A 1OD4A 5DU4A 2QQ3A 4FB8A 4ELSA 1SG4A 5DKPA 4NNQA 3G64A 2VSSE 4KNPA 4U1AA 4JCTA 4WCZA 3IAVA 3KTJA 2J5GA 5E0SA 1SZOA 3LAOA 5DZKA 1ON3A 2A7KA 2GTRA 4K29A 3H0SA 1DUBA 2CBYA 1FC6A 5INGA 4JSBA 4HC8A 3TV5A 2F6IA 3I47A 4ZDBA 5CTBA 4I42A 5INFA 2J5IA 4B3IA 3R9QA 3GF7A 1WDKA 3M6NA 2VSUA 3H0UA 1ON9A 1YG8A 2F9IB 3TVWA 3V5IA 3IBBA 1PIXA 1UIYA 1NZYB 3U9TB 3K50A 3ZWAA 5C90A 2D3TA 2Q34A 3TRRA 4F47A 3T88A 2ZL3A 3T3WA 2ZQRA 4FJWD 4U19A 3OT6A 4EMPA 4KPKA 5JBWA 3TVUA 3VIVA 1X0UA 3ZWCA 1HNUA 1N6FA 3KTHA 3H81A 4QIIA 1UYSA 1HNOA 5DZKH 5DU8A 3PGQA 4MXIA 2J5II 2FBMA 4Q1IA 4I52A 2FZSA 3MT6A 5DTWA 4IZCA 4DI1A 4WYOB 2PBPA 3BPPA 2VREA 1MJ3A 3ST9A 1FC7A 2DUBA 3JU1A 3Q0JA 3STAA 5JBXA 4ELXA 3RRVA 1N6DA 1WDLA 3GKBA 3PE8A 3HINA 5IKLB 1EF9A 4EMLA 1JXZA 4IZDA 3DORA 5G1SA 4JJTA 5DUFA 3ZWBA 3OMEA 3ZW8A 4U0HA 3T89A 4ZDFA 3N6RB 4QIJA 5G1RA 3KQFA 2VSUC 4HNKA 4K3WA 2PG8A 3MFMA 2CE3A 2F9IA 3P2LA 3KTKA 2NP9A 4ZU2A 3Q1TA 4JCRA 3Q0GA 3RSTA 1NZYA 4GHNA 3NJDA 2A81A 1OD2A 1W2XA 3TLFA 4JOTA 3U9RB 3U9SB 1K39A 3HRXA 4NEKA 1WZ8A 2J5GD 2Q35A 4L8KA 5DUCA 3H0QA 5DU6A 1XNYA 1XX4A 2VSSA 4IZBA 3Q7HA 1Q51A 4L6WA 2IEXA 2UZFA 4FN8A 1PJHA 3MYBA 3QK8A 4FZWC 3PZKA 1YG6A 2Q2XA 2WTBA 3QXIA 2F9YB 3KTIA 3QXZA 4OMRA 4WZ8B 3R0OA 4KWBA 3SWXA 3H02A 1EY3A 4MI2A 4ELWA 3QKAA 4ZDCA 2ZL0A 4Q0GA 3WG5A 4KD6A 3QYRA 1WDMA 3HP0A 4I4ZA 4U0GA 2FW2A 3TT7A 1K32A 1TYFA 4RYFA 3OC7A 3TT6A 4JWVA 4JFCA 2C8TA 2VSUF 4MOUA 1TG6A 2ZQQA 3T8AA 1Y7OA 2VX2A 3MOYA 3NJBA 1XNVA 5FIFA 3K8XA 5MGBA 5CTCA 3RSIA 4QFEA 3SLLA 1UYRA 1DCIA 4ASIA 3H0JA 4Z0MA 5C9GA 3TDCA 3P85A 4FNBA 4JYJA 3V5EA 2DEOA 5DTPA 3QREA 3DJAA 4ZDEA 1RJNA 4FN7A 3R9TA 1HZDA 2VSSF 5DL1A 4JYLA 4JVTA 5KJPA 2PPYA
chains in the Genus database with same CATH superfamily
2W3PA 4GM2A 1EF8A 3P5MA 3PEAA 4JCSA 5E0NX 3GMAA 1O8UA 2J5IB 3HE2A 4K2NA 5INIA 3R9SA 3IB9A 4EMMA 1FC9A 2HW5A 3QWDA 3TZ3A 4RCNA 1VRGA 2BZRA 1UYVA 4B3JA 4LK5A 5KDRA 3R6HA 2ZL4A 4U0GH 3T8BA 3QMJA 4RYFH 4JCQA 2F9YA 3KTGA 4OG1A 5KDRB 3BF0A 4B3HA 1Q52A 3ISAA 1N6EA 2ZL2A 3LKEA 3BEZA 3GF3A 5FUSA 2X58A 1FCFA 3FDUA 4HDTA 3GLMA 2F6QA 1J7XA 2EJ5A 1RJMA 2J5SA 2VSUE 5E0SH 1XO6A 4U18A 5G1QA 4FZWA 1UYTA 4G2RA 3FF6A 3M6MA 3HLN1 3L3SA 4ZDDA 4YLHA 3ZW9A 4OLQA 2A7SA 1XNWA 4FNDA 2X24A 1OD4A 5DU4A 2QQ3A 4FB8A 4ELSA 1SG4A 5DKPA 4NNQA 3G64A 2VSSE 4NARA 4KNPA 4U1AA 4JCTA 4WCZA 3IAVA 3KTJA 2J5GA 5E0SA 1SZOA 3LAOA 5DZKA 1ON3A 2A7KA 2GTRA 4K29A 3H0SA 1DUBA 2CBYA 1FC6A 5INGA 4JSBA 4HC8A 3TV5A 2F6IA 3I47A 4ZDBA 5CTBA 4I42A 5INFA 2J5IA 4B3IA 3R9QA 3GF7A 1WDKA 3M6NA 2VSUA 3H0UA 1ON9A 1YG8A 2F9IB 3TVWA 3V5IA 2YJGA 3IBBA 1PIXA 1UIYA 1NZYB 3U9TB 3K50A 3ZWAA 5C90A 2D3TA 2Q34A 3TRRA 4F47A 3T88A 2ZL3A 3T3WA 2ZQRA 4FJWD 4U19A 3OT6A 4EMPA 4KPKA 5JBWA 3TVUA 3VIVA 1X0UA 3ZWCA 1HNUA 1N6FA 3KTHA 5HUQA 3H81A 4QIIA 1UYSA 1HNOA 5DZKH 5DU8A 3PGQA 4MXIA 2J5II 2FBMA 4Q1IA 4I52A 2FZSA 3MT6A 5DTWA 4IZCA 3BPTA 4DI1A 4WYOB 2PBPA 3BPPA 2VREA 1MJ3A 3ST9A 1FC7A 2DUBA 3JU1A 3Q0JA 3STAA 5JBXA 4ELXA 3RRVA 1N6DA 1WDLA 3GKBA 3PE8A 3HINA 5IKLB 1EF9A 4EMLA 1JXZA 4IZDA 3DORA 5G1SA 4JJTA 5DUFA 3ZWBA 3OMEA 3ZW8A 4U0HA 3T89A 4ZDFA 3N6RB 4QIJA 5G1RA 3KQFA 2VSUC 4HNKA 4K3WA 2PG8A 3MFMA 2CE3A 2F9IA 3P2LA 3KTKA 2NP9A 4ZU2A 3Q1TA 4JCRA 3Q0GA 3RSTA 1NZYA 4GHNA 3NJDA 2A81A 1OD2A 1W2XA 3TLFA 4JOTA 3U9RB 3U9SB 1K39A 3HRXA 4NEKA 1WZ8A 2J5GD 2Q35A 4L8KA 5DUCA 3H0QA 5DU6A 1XNYA 1XX4A 2VSSA 4IZBA 3Q7HA 1Q51A 4L6WA 2IEXA 2UZFA 4FN8A 1PJHA 3MYBA 3QK8A 4FZWC 3PZKA 1YG6A 2Q2XA 2WTBA 3QXIA 2F9YB 3KTIA 3QXZA 4OMRA 4WZ8B 3R0OA 4KWBA 3SWXA 3H02A 1EY3A 4MI2A 4ELWA 3QKAA 4ZDCA 2ZL0A 4Q0GA 3WG5A 4KD6A 3QYRA 1WDMA 3HP0A 4I4ZA 4U0GA 2FW2A 3TT7A 1K32A 1TYFA 4RYFA 3OC7A 3TT6A 4JWVA 4JFCA 2C8TA 2VSUF 4MOUA 1TG6A 2ZQQA 3T8AA 1Y7OA 2VX2A 3MOYA 3NJBA 1XNVA 5FIFA 3K8XA 5MGBA 5CTCA 3RSIA 4QFEA 3SLLA 1UYRA 1DCIA 4ASIA 3H0JA 4Z0MA 5C9GA 3TDCA 3P85A 4FNBA 4JYJA 4J2UA 3V5EA 2DEOA 5DTPA 3QREA 3DJAA 4ZDEA 1RJNA 4FN7A 3R9TA 1HZDA 2VSSF 5DL1A 4JYLA 4JVTA 5KJPA 2PPYA
chains in the Genus database with same CATH topology
2W3PA 4GM2A 1EF8A 3P5MA 3PEAA 4JCSA 5E0NX 3GMAA 1O8UA 2J5IB 3HE2A 4K2NA 5INIA 3R9SA 3IB9A 4EMMA 1FC9A 2HW5A 3QWDA 3TZ3A 4RCNA 1VRGA 2BZRA 1UYVA 4B3JA 4LK5A 5KDRA 3R6HA 2ZL4A 4U0GH 3T8BA 3QMJA 4RYFH 4JCQA 2F9YA 3KTGA 4OG1A 5KDRB 3BF0A 4B3HA 1Q52A 3ISAA 1N6EA 2ZL2A 3LKEA 3BEZA 3GF3A 5FUSA 2X58A 1FCFA 3FDUA 4HDTA 3GLMA 2F6QA 1J7XA 2EJ5A 1RJMA 2J5SA 2VSUE 5E0SH 1XO6A 4U18A 5G1QA 4FZWA 1UYTA 4G2RA 3FF6A 3M6MA 3HLN1 3L3SA 4ZDDA 4YLHA 3ZW9A 4OLQA 2A7SA 1XNWA 4FNDA 2X24A 1OD4A 5DU4A 2QQ3A 4FB8A 4ELSA 1SG4A 5DKPA 4NNQA 3G64A 2VSSE 4NARA 4KNPA 4U1AA 4JCTA 4WCZA 3IAVA 3KTJA 2J5GA 5E0SA 1SZOA 3LAOA 5DZKA 1ON3A 2A7KA 2GTRA 4K29A 3H0SA 1DUBA 2CBYA 1FC6A 5INGA 4JSBA 4HC8A 3TV5A 2F6IA 3I47A 4ZDBA 5CTBA 4I42A 5INFA 2J5IA 4B3IA 3R9QA 3GF7A 1WDKA 3M6NA 2VSUA 3H0UA 1ON9A 1YG8A 2F9IB 3TVWA 3V5IA 2YJGA 3IBBA 1PIXA 1UIYA 1NZYB 3U9TB 3K50A 3ZWAA 5C90A 2D3TA 2Q34A 3TRRA 4F47A 3T88A 2ZL3A 3T3WA 2ZQRA 4FJWD 4U19A 3OT6A 4EMPA 4KPKA 5JBWA 3TVUA 3VIVA 1X0UA 3ZWCA 1HNUA 1N6FA 3KTHA 5HUQA 3H81A 4QIIA 1UYSA 1HNOA 5DZKH 5DU8A 3PGQA 4MXIA 2J5II 2FBMA 4Q1IA 4I52A 2FZSA 3MT6A 5DTWA 4IZCA 3BPTA 4DI1A 4WYOB 2PBPA 3BPPA 2VREA 1MJ3A 3ST9A 1FC7A 2DUBA 3JU1A 3Q0JA 3STAA 5JBXA 4ELXA 3RRVA 1N6DA 1WDLA 3GKBA 3PE8A 3HINA 5IKLB 1EF9A 4EMLA 1JXZA 4IZDA 3DORA 5G1SA 4JJTA 5DUFA 3ZWBA 3OMEA 3ZW8A 4U0HA 3T89A 4ZDFA 3N6RB 4QIJA 5G1RA 3KQFA 2VSUC 4HNKA 4K3WA 2PG8A 3MFMA 2CE3A 2F9IA 3P2LA 3KTKA 2NP9A 4ZU2A 3Q1TA 4JCRA 3Q0GA 3RSTA 1NZYA 4GHNA 3NJDA 2A81A 1OD2A 1W2XA 3TLFA 4JOTA 3U9RB 3U9SB 1K39A 3HRXA 4NEKA 1WZ8A 2J5GD 2Q35A 4L8KA 5DUCA 3H0QA 5DU6A 1XNYA 1XX4A 2VSSA 4IZBA 3Q7HA 1Q51A 4L6WA 2IEXA 2UZFA 4FN8A 1PJHA 3MYBA 3QK8A 4FZWC 3PZKA 1YG6A 2Q2XA 2WTBA 3QXIA 2F9YB 3KTIA 3QXZA 4OMRA 4WZ8B 3R0OA 4KWBA 3SWXA 3H02A 1EY3A 4MI2A 4ELWA 3QKAA 4ZDCA 2ZL0A 4Q0GA 3WG5A 4KD6A 3QYRA 1WDMA 3HP0A 4I4ZA 4U0GA 2FW2A 3TT7A 1K32A 1TYFA 4RYFA 3OC7A 3TT6A 4JWVA 4JFCA 2C8TA 2VSUF 4MOUA 1TG6A 2ZQQA 3T8AA 1Y7OA 2VX2A 3MOYA 3NJBA 1XNVA 5FIFA 3K8XA 5MGBA 5CTCA 3RSIA 4QFEA 3SLLA 1UYRA 1DCIA 4ASIA 3H0JA 4Z0MA 5C9GA 3TDCA 3P85A 4FNBA 4JYJA 4J2UA 3V5EA 2DEOA 5DTPA 3QREA 3DJAA 4ZDEA 1RJNA 4FN7A 3R9TA 1HZDA 2VSSF 5DL1A 4JYLA 4JVTA 5KJPA 2PPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3P A;  4GM2 A;  1EF8 A;  3P5M A;  3PEA A;  4JCS A;  5E0N X;  3GMA A;  1O8U A;  2J5I B;  3HE2 A;  4K2N A;  5INI A;  3R9S A;  3IB9 A;  4EMM A;  1FC9 A;  2HW5 A;  3QWD A;  3TZ3 A;  4RCN A;  1VRG A;  2BZR A;  1UYV A;  4B3J A;  4LK5 A;  5KDR A;  3R6H A;  2ZL4 A;  4U0G H;  3T8B A;  3QMJ A;  4RYF H;  4JCQ A;  2F9Y A;  3KTG A;  4OG1 A;  5KDR B;  3BF0 A;  4B3H A;  1Q52 A;  3ISA A;  1N6E A;  2ZL2 A;  3LKE A;  3BEZ A;  3GF3 A;  5FUS A;  2X58 A;  1FCF A;  3FDU A;  3GLM A;  2F6Q A;  1J7X A;  2EJ5 A;  1RJM A;  2J5S A;  2VSU E;  5E0S H;  1XO6 A;  4U18 A;  5G1Q A;  4FZW A;  1UYT A;  4G2R A;  3FF6 A;  3M6M A;  3HLN 1;  3L3S A;  4ZDD A;  4YLH A;  3ZW9 A;  4OLQ A;  2A7S A;  1XNW A;  4FND A;  2X24 A;  1OD4 A;  5DU4 A;  2QQ3 A;  4FB8 A;  4ELS A;  1SG4 A;  5DKP A;  4NNQ A;  3G64 A;  2VSS E;  4KNP A;  4U1A A;  4JCT A;  4WCZ A;  3IAV A;  3KTJ A;  2J5G A;  5E0S A;  1SZO A;  3LAO A;  5DZK A;  1ON3 A;  2A7K A;  2GTR A;  4K29 A;  3H0S A;  1DUB A;  2CBY A;  1FC6 A;  5ING A;  4JSB A;  4HC8 A;  3TV5 A;  2F6I A;  3I47 A;  4ZDB A;  5CTB A;  4I42 A;  5INF A;  2J5I A;  4B3I A;  3R9Q A;  3GF7 A;  1WDK A;  3M6N A;  2VSU A;  3H0U A;  1ON9 A;  1YG8 A;  2F9I B;  3TVW A;  3V5I A;  3IBB A;  1PIX A;  1UIY A;  1NZY B;  3U9T B;  3K50 A;  3ZWA A;  5C90 A;  2D3T A;  2Q34 A;  3TRR A;  4F47 A;  3T88 A;  2ZL3 A;  3T3W A;  2ZQR A;  4FJW D;  4U19 A;  3OT6 A;  4EMP A;  4KPK A;  5JBW A;  3TVU A;  3VIV A;  1X0U A;  3ZWC A;  1HNU A;  1N6F A;  3KTH A;  3H81 A;  4QII A;  1UYS A;  1HNO A;  5DZK H;  5DU8 A;  3PGQ A;  4MXI A;  2J5I I;  2FBM A;  4Q1I A;  4I52 A;  2FZS A;  3MT6 A;  5DTW A;  4IZC A;  4DI1 A;  4WYO B;  2PBP A;  3BPP A;  2VRE A;  1MJ3 A;  3ST9 A;  1FC7 A;  2DUB A;  3JU1 A;  3Q0J A;  3STA A;  5JBX A;  4ELX A;  3RRV A;  1N6D A;  1WDL A;  3GKB A;  3PE8 A;  3HIN A;  5IKL B;  1EF9 A;  4EML A;  1JXZ A;  4IZD A;  3DOR A;  5G1S A;  4JJT A;  5DUF A;  3ZWB A;  3OME A;  3ZW8 A;  4U0H A;  3T89 A;  4ZDF A;  3N6R B;  4QIJ A;  5G1R A;  3KQF A;  2VSU C;  4HNK A;  4K3W A;  2PG8 A;  3MFM A;  2CE3 A;  2F9I A;  3P2L A;  3KTK A;  2NP9 A;  4ZU2 A;  3Q1T A;  4JCR A;  3Q0G A;  3RST A;  1NZY A;  4GHN A;  3NJD A;  2A81 A;  1OD2 A;  1W2X A;  3TLF A;  4JOT A;  3U9R B;  3U9S B;  1K39 A;  3HRX A;  4NEK A;  1WZ8 A;  2J5G D;  2Q35 A;  4L8K A;  5DUC A;  3H0Q A;  5DU6 A;  1XNY A;  1XX4 A;  2VSS A;  4IZB A;  3Q7H A;  1Q51 A;  4L6W A;  2IEX A;  2UZF A;  4FN8 A;  1PJH A;  3MYB A;  3QK8 A;  4FZW C;  3PZK A;  1YG6 A;  2Q2X A;  2WTB A;  3QXI A;  2F9Y B;  3KTI A;  3QXZ A;  4OMR A;  4WZ8 B;  3R0O A;  4KWB A;  3SWX A;  3H02 A;  1EY3 A;  4MI2 A;  4ELW A;  3QKA A;  4ZDC A;  2ZL0 A;  4Q0G A;  3WG5 A;  4KD6 A;  3QYR A;  1WDM A;  3HP0 A;  4I4Z A;  4U0G A;  2FW2 A;  3TT7 A;  1K32 A;  1TYF A;  4RYF A;  3OC7 A;  3TT6 A;  4JWV A;  4JFC A;  2C8T A;  2VSU F;  4MOU A;  1TG6 A;  2ZQQ A;  3T8A A;  1Y7O A;  2VX2 A;  3MOY A;  3NJB A;  1XNV A;  5FIF A;  3K8X A;  5MGB A;  5CTC A;  3RSI A;  4QFE A;  3SLL A;  1UYR A;  1DCI A;  4ASI A;  3H0J A;  4Z0M A;  5C9G A;  3TDC A;  3P85 A;  4FNB A;  4JYJ A;  3V5E A;  2DEO A;  5DTP A;  3QRE A;  3DJA A;  4ZDE A;  1RJN A;  4FN7 A;  3R9T A;  1HZD A;  2VSS F;  5DL1 A;  4JYL A;  4JVT A;  5KJP A;  2PPY A; 
#chains in the Genus database with same CATH topology
 2W3P A;  4GM2 A;  1EF8 A;  3P5M A;  3PEA A;  4JCS A;  5E0N X;  3GMA A;  1O8U A;  2J5I B;  3HE2 A;  4K2N A;  5INI A;  3R9S A;  3IB9 A;  4EMM A;  1FC9 A;  2HW5 A;  3QWD A;  3TZ3 A;  4RCN A;  1VRG A;  2BZR A;  1UYV A;  4B3J A;  4LK5 A;  5KDR A;  3R6H A;  2ZL4 A;  4U0G H;  3T8B A;  3QMJ A;  4RYF H;  4JCQ A;  2F9Y A;  3KTG A;  4OG1 A;  5KDR B;  3BF0 A;  4B3H A;  1Q52 A;  3ISA A;  1N6E A;  2ZL2 A;  3LKE A;  3BEZ A;  3GF3 A;  5FUS A;  2X58 A;  1FCF A;  3FDU A;  4HDT A;  3GLM A;  2F6Q A;  1J7X A;  2EJ5 A;  1RJM A;  2J5S A;  2VSU E;  5E0S H;  1XO6 A;  4U18 A;  5G1Q A;  4FZW A;  1UYT A;  4G2R A;  3FF6 A;  3M6M A;  3HLN 1;  3L3S A;  4ZDD A;  4YLH A;  3ZW9 A;  4OLQ A;  2A7S A;  1XNW A;  4FND A;  2X24 A;  1OD4 A;  5DU4 A;  2QQ3 A;  4FB8 A;  4ELS A;  1SG4 A;  5DKP A;  4NNQ A;  3G64 A;  2VSS E;  4NAR A;  4KNP A;  4U1A A;  4JCT A;  4WCZ A;  3IAV A;  3KTJ A;  2J5G A;  5E0S A;  1SZO A;  3LAO A;  5DZK A;  1ON3 A;  2A7K A;  2GTR A;  4K29 A;  3H0S A;  1DUB A;  2CBY A;  1FC6 A;  5ING A;  4JSB A;  4HC8 A;  3TV5 A;  2F6I A;  3I47 A;  4ZDB A;  5CTB A;  4I42 A;  5INF A;  2J5I A;  4B3I A;  3R9Q A;  3GF7 A;  1WDK A;  3M6N A;  2VSU A;  3H0U A;  1ON9 A;  1YG8 A;  2F9I B;  3TVW A;  3V5I A;  2YJG A;  3IBB A;  1PIX A;  1UIY A;  1NZY B;  3U9T B;  3K50 A;  3ZWA A;  5C90 A;  2D3T A;  2Q34 A;  3TRR A;  4F47 A;  3T88 A;  2ZL3 A;  3T3W A;  2ZQR A;  4FJW D;  4U19 A;  3OT6 A;  4EMP A;  4KPK A;  5JBW A;  3TVU A;  3VIV A;  1X0U A;  3ZWC A;  1HNU A;  1N6F A;  3KTH A;  5HUQ A;  3H81 A;  4QII A;  1UYS A;  1HNO A;  5DZK H;  5DU8 A;  3PGQ A;  4MXI A;  2J5I I;  2FBM A;  4Q1I A;  4I52 A;  2FZS A;  3MT6 A;  5DTW A;  4IZC A;  3BPT A;  4DI1 A;  4WYO B;  2PBP A;  3BPP A;  2VRE A;  1MJ3 A;  3ST9 A;  1FC7 A;  2DUB A;  3JU1 A;  3Q0J A;  3STA A;  5JBX A;  4ELX A;  3RRV A;  1N6D A;  1WDL A;  3GKB A;  3PE8 A;  3HIN A;  5IKL B;  1EF9 A;  4EML A;  1JXZ A;  4IZD A;  3DOR A;  5G1S A;  4JJT A;  5DUF A;  3ZWB A;  3OME A;  3ZW8 A;  4U0H A;  3T89 A;  4ZDF A;  3N6R B;  4QIJ A;  5G1R A;  3KQF A;  2VSU C;  4HNK A;  4K3W A;  2PG8 A;  3MFM A;  2CE3 A;  2F9I A;  3P2L A;  3KTK A;  2NP9 A;  4ZU2 A;  3Q1T A;  4JCR A;  3Q0G A;  3RST A;  1NZY A;  4GHN A;  3NJD A;  2A81 A;  1OD2 A;  1W2X A;  3TLF A;  4JOT A;  3U9R B;  3U9S B;  1K39 A;  3HRX A;  4NEK A;  1WZ8 A;  2J5G D;  2Q35 A;  4L8K A;  5DUC A;  3H0Q A;  5DU6 A;  1XNY A;  1XX4 A;  2VSS A;  4IZB A;  3Q7H A;  1Q51 A;  4L6W A;  2IEX A;  2UZF A;  4FN8 A;  1PJH A;  3MYB A;  3QK8 A;  4FZW C;  3PZK A;  1YG6 A;  2Q2X A;  2WTB A;  3QXI A;  2F9Y B;  3KTI A;  3QXZ A;  4OMR A;  4WZ8 B;  3R0O A;  4KWB A;  3SWX A;  3H02 A;  1EY3 A;  4MI2 A;  4ELW A;  3QKA A;  4ZDC A;  2ZL0 A;  4Q0G A;  3WG5 A;  4KD6 A;  3QYR A;  1WDM A;  3HP0 A;  4I4Z A;  4U0G A;  2FW2 A;  3TT7 A;  1K32 A;  1TYF A;  4RYF A;  3OC7 A;  3TT6 A;  4JWV A;  4JFC A;  2C8T A;  2VSU F;  4MOU A;  1TG6 A;  2ZQQ A;  3T8A A;  1Y7O A;  2VX2 A;  3MOY A;  3NJB A;  1XNV A;  5FIF A;  3K8X A;  5MGB A;  5CTC A;  3RSI A;  4QFE A;  3SLL A;  1UYR A;  1DCI A;  4ASI A;  3H0J A;  4Z0M A;  5C9G A;  3TDC A;  3P85 A;  4FNB A;  4JYJ A;  4J2U A;  3V5E A;  2DEO A;  5DTP A;  3QRE A;  3DJA A;  4ZDE A;  1RJN A;  4FN7 A;  3R9T A;  1HZD A;  2VSS F;  5DL1 A;  4JYL A;  4JVT A;  5KJP A;  2PPY A; 
#chains in the Genus database with same CATH homology
 2W3P A;  4GM2 A;  1EF8 A;  3P5M A;  3PEA A;  4JCS A;  5E0N X;  3GMA A;  1O8U A;  2J5I B;  3HE2 A;  4K2N A;  5INI A;  3R9S A;  3IB9 A;  4EMM A;  1FC9 A;  2HW5 A;  3QWD A;  3TZ3 A;  4RCN A;  1VRG A;  2BZR A;  1UYV A;  4B3J A;  4LK5 A;  5KDR A;  3R6H A;  2ZL4 A;  4U0G H;  3T8B A;  3QMJ A;  4RYF H;  4JCQ A;  2F9Y A;  3KTG A;  4OG1 A;  5KDR B;  3BF0 A;  4B3H A;  1Q52 A;  3ISA A;  1N6E A;  2ZL2 A;  3LKE A;  3BEZ A;  3GF3 A;  5FUS A;  2X58 A;  1FCF A;  3FDU A;  4HDT A;  3GLM A;  2F6Q A;  1J7X A;  2EJ5 A;  1RJM A;  2J5S A;  2VSU E;  5E0S H;  1XO6 A;  4U18 A;  5G1Q A;  4FZW A;  1UYT A;  4G2R A;  3FF6 A;  3M6M A;  3HLN 1;  3L3S A;  4ZDD A;  4YLH A;  3ZW9 A;  4OLQ A;  2A7S A;  1XNW A;  4FND A;  2X24 A;  1OD4 A;  5DU4 A;  2QQ3 A;  4FB8 A;  4ELS A;  1SG4 A;  5DKP A;  4NNQ A;  3G64 A;  2VSS E;  4NAR A;  4KNP A;  4U1A A;  4JCT A;  4WCZ A;  3IAV A;  3KTJ A;  2J5G A;  5E0S A;  1SZO A;  3LAO A;  5DZK A;  1ON3 A;  2A7K A;  2GTR A;  4K29 A;  3H0S A;  1DUB A;  2CBY A;  1FC6 A;  5ING A;  4JSB A;  4HC8 A;  3TV5 A;  2F6I A;  3I47 A;  4ZDB A;  5CTB A;  4I42 A;  5INF A;  2J5I A;  4B3I A;  3R9Q A;  3GF7 A;  1WDK A;  3M6N A;  2VSU A;  3H0U A;  1ON9 A;  1YG8 A;  2F9I B;  3TVW A;  3V5I A;  2YJG A;  3IBB A;  1PIX A;  1UIY A;  1NZY B;  3U9T B;  3K50 A;  3ZWA A;  5C90 A;  2D3T A;  2Q34 A;  3TRR A;  4F47 A;  3T88 A;  2ZL3 A;  3T3W A;  2ZQR A;  4FJW D;  4U19 A;  3OT6 A;  4EMP A;  4KPK A;  5JBW A;  3TVU A;  3VIV A;  1X0U A;  3ZWC A;  1HNU A;  1N6F A;  3KTH A;  5HUQ A;  3H81 A;  4QII A;  1UYS A;  1HNO A;  5DZK H;  5DU8 A;  3PGQ A;  4MXI A;  2J5I I;  2FBM A;  4Q1I A;  4I52 A;  2FZS A;  3MT6 A;  5DTW A;  4IZC A;  3BPT A;  4DI1 A;  4WYO B;  2PBP A;  3BPP A;  2VRE A;  1MJ3 A;  3ST9 A;  1FC7 A;  2DUB A;  3JU1 A;  3Q0J A;  3STA A;  5JBX A;  4ELX A;  3RRV A;  1N6D A;  1WDL A;  3GKB A;  3PE8 A;  3HIN A;  5IKL B;  1EF9 A;  4EML A;  1JXZ A;  4IZD A;  3DOR A;  5G1S A;  4JJT A;  5DUF A;  3ZWB A;  3OME A;  3ZW8 A;  4U0H A;  3T89 A;  4ZDF A;  3N6R B;  4QIJ A;  5G1R A;  3KQF A;  2VSU C;  4HNK A;  4K3W A;  2PG8 A;  3MFM A;  2CE3 A;  2F9I A;  3P2L A;  3KTK A;  2NP9 A;  4ZU2 A;  3Q1T A;  4JCR A;  3Q0G A;  3RST A;  1NZY A;  4GHN A;  3NJD A;  2A81 A;  1OD2 A;  1W2X A;  3TLF A;  4JOT A;  3U9R B;  3U9S B;  1K39 A;  3HRX A;  4NEK A;  1WZ8 A;  2J5G D;  2Q35 A;  4L8K A;  5DUC A;  3H0Q A;  5DU6 A;  1XNY A;  1XX4 A;  2VSS A;  4IZB A;  3Q7H A;  1Q51 A;  4L6W A;  2IEX A;  2UZF A;  4FN8 A;  1PJH A;  3MYB A;  3QK8 A;  4FZW C;  3PZK A;  1YG6 A;  2Q2X A;  2WTB A;  3QXI A;  2F9Y B;  3KTI A;  3QXZ A;  4OMR A;  4WZ8 B;  3R0O A;  4KWB A;  3SWX A;  3H02 A;  1EY3 A;  4MI2 A;  4ELW A;  3QKA A;  4ZDC A;  2ZL0 A;  4Q0G A;  3WG5 A;  4KD6 A;  3QYR A;  1WDM A;  3HP0 A;  4I4Z A;  4U0G A;  2FW2 A;  3TT7 A;  1K32 A;  1TYF A;  4RYF A;  3OC7 A;  3TT6 A;  4JWV A;  4JFC A;  2C8T A;  2VSU F;  4MOU A;  1TG6 A;  2ZQQ A;  3T8A A;  1Y7O A;  2VX2 A;  3MOY A;  3NJB A;  1XNV A;  5FIF A;  3K8X A;  5MGB A;  5CTC A;  3RSI A;  4QFE A;  3SLL A;  1UYR A;  1DCI A;  4ASI A;  3H0J A;  4Z0M A;  5C9G A;  3TDC A;  3P85 A;  4FNB A;  4JYJ A;  4J2U A;  3V5E A;  2DEO A;  5DTP A;  3QRE A;  3DJA A;  4ZDE A;  1RJN A;  4FN7 A;  3R9T A;  1HZD A;  2VSS F;  5DL1 A;  4JYL A;  4JVT A;  5KJP A;  2PPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...