4KPTA

Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq from lactococcus lactis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
223
structure length
223
Chain Sequence
b'TVKIASDSSYAPFEFQNGQKKWVGIDVDIMQEVAKINDWKLEMSYPGFDAALQNLKAGQVDGIIAGMTITDERKETFDFSNPYYTSALTIATTKDSKLSDYSDLKGKAVGAKNGTAAQTWLQENQKKYGYTIKTYSDGVHMFAALSSGNIAGAMDEVPVISYAMKQGQDLAMNFPSISLPGGYGFAVMKGKNSTLVDGFNKALAEMKSNGDYDKILKKYGITA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine ABC transporter permease and substrate binding pro
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transport protein
total genus 74
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kptA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kptA02
2O6AA 1JETA 2DVCA 4XKRA 5I57B 1VE4A 1ELJA 2ZXTA 2OK2A 1XOCA 1S9TA 4NEDA 4OEVA 1YTVA 4IGTA 2WKYA 3T22A 3RTFB 1SW1A 1FQEA 2QS4A 3ILUB 1IXCA 4F1UA 1UTHB 3IR1A 4XXUA 3N5LA 2Z23A 1D9VA 1GV8A 2LAOA 3R6UA 4P11A 4G8MA 2F34A 4BLAA 2DWJA 1P1OA 3SESA 4N07A 1B32A 3FVNA 1LCTA 4ZEFA 3OEMA 2HXWA 2ZMBA 1D4NA 1R1NA 3G3IA 2ZYOA 5I57A 4Q8RA 2Y7RA 3LBSA 1OLAA 4H1XA 1MY4A 4RY1A 2HCAA 4F39A 5H8SA 2B65A 4Q30B 4JB7A 5I56B 1FTMA 4GXAA 4G8HA 2AL4A 1D9YA 4KHZE 3KBRA 4F2OA 4XKPA 3SEUA 1Q1KA 5AA2D 4I62A 2XD3A 5DTBA 3K6UA 4EUOA 3KG2A 4TQUQ 3SETA 2PT1A 2UXAA 3PPQA 1Y3NA 3MP8A 2XXTA 4FE8A 3VLUA 2A5SA 3GBAA 2XXXA 4XTCQ 4HS7A 3USDA 4MF3A 1ZJLA 3HV1A 4MBPA 3H6TA 3E3KA 5CMKA 4WEDA 4YKKA 3FZVA 5TPAA 3O97A 4YICA 4LA9A 4IO4A 1B1XA 1XS5A 2Z8FA 4WXJA 4ESWA 1N7XA 4NE4A 3H6UA 3RPWA 1A40A 1MQJA 2AIXA 1SI1A 5I59B 1MPCA 2ZNUA 2QS3A 4KR5A 4UACA 2YLNA 4GL0A 3U92A 1ZIUA 5H8NB 4ELQA 2PYYA 3IK6B 3VXBA 1EZ9A 1MRPA 3IOWA 1M5CA 2XX9A 2RF1A 1VFDA 1QJMA 3QAXA 1M5FA 2OCUA 4ZE9A 2IEEA 2Z8DA 3MC2A 3WAFA 5H8QB 3RT6B 4POXA 4U21A 1Y3QA 1Q35A 3IJOB 3PUWE 3S2VA 4F1VA 3Q27A 3FXRA 4BDNA 4U1ZA 4MH5A 1OVBA 3SKPA 1TT1A 2I6EA 3TTRA 1DTGA 1SI0A 5AA3A 1A7LA 3EQ1A 5A5XA 4R9GA 3T66A 1R9QA 3U94A 4RYAA 3CG3A 1OMPA 1GGGA 1QUJA 3K2DA 5BUUA 4R74A 1FTOA 5FHMA 3ONMA 3U72A 3VV5A 1MM6A 4PFUA 2XX8A 2ABHA 4RK9A 1NL5A 1PB9A 2FNCA 4UA8A 4ND9A 2NWJA 1S7YA 5DEXB 3BKIB 2DOJA 2DWIA 4OFJA 1MG1A 5EHMA 5HPQA 1Y1ZA 2F78A 5H8HB 3CFXA 1B3LA 4ZECA 4YAHX 3TODA 3QUJA 3H06B 4DXUA 4RXLA 1MY3A 3BFTA 3Q25A 2QL3A 5KCJA 3MW0A 2F97A 1IQ7A 3IOVA 4I9DA 3DM0A 3UK4A 1CE2A 3B7DA 3D4CA 4U2RA 4U4XA 4LZ8A 3HPIA 2DWHA 2D3IA 4RNSA 3CFLA 4F19A 1P1WA 2A5TB 3H3GA 1Y9UA 1VFEA 3W9VA 4ZEKA 1MY1A 4H6DA 1JW4A 2I4BA 3B6WA 1B6HA 3PPOA 4X1BA 2OBGA 4U4SA 4F2QA 3K02A 4H67A 4OFLA 3OD7A 2ZYKA 1QVSA 3TEPA 3GLBA 1FTJA 4FATA 1SBPA 3GZGA 3CR9A 4KI0E 3ZKLA 2Y7WA 2FYIA 3ZS6A 3KEIA 2X7PA 4BDLA 3CVGA 1L5TA 3A09A 3FV2A 3K0VA 3ODBA 4ZZEA 2I0CA 1I69A 1N3XA 4G4PA 2B3FA 1QULA 2AL5A 3CSGA 2ALUA 1WDNA 2DVZA 3PD8A 4DDDA 3S4UA 1DSNA 4NF6B 4EQ7A 4LUBA 2REGA 3MQ9A 1RYOA 3H7MA 2UVHA 1J1NA 4IO3A 4DCXA 2ONKE 1XHYA 4QFLA 1FW0A 2RKMA 3M3FA 5H8FA 4NWCA 1A55A 1FQCA 1UIUA 1AIVA 3E13X 5I2NA 2XXVA 4THIA 2YJPA 3T9HB 1Y3PA 3JYRA 2HAVA 2V84A 2V3TA 2F6PA 1IUDA 2HEUA 3IO4A 4F22A 3Q28A 1MXVA 1YAEA 3G3JA 4FJPA 3VLVA 3O28A 3OSRA 2O84X 1B9JA 3QK6A 1POY1 1A8FA 4R6YA 1HSLA 2YPNA 3KGCA 1MM7A 2QS2A 4GXSB 3TDJA 4YKPA 3L6GA 1JW1A 3G7WA 1OVTA 3MZ1A 3Q26A 2DSFA 3VVFA 4QHQA 1B3HA 4DZ1A 3HN0A 5FTIA 2VD2A 4OEUA 2D21A 3ILTB 3C9HA 3UA8A 4OYVA 1FQDA 1TXFA 2H9BA 3THIA 1Y4CA 3MZ9A 3IO6A 1OIBA 4QFOA 2DXYA 4YZZA 4G77A 4IY5A 1JQFA 2W7YA 4RJZA 1LB8A 3K6XA 4AB5A 3O6GA 1XVXA 4KCDA 1JNFA 4QFNA 4O3AA 3FUZA 5HBCA 2F35A 2I0BA 2PT2A 3CG1A 3D4GA 5K2XA 5CMMA 4N13A 4C1UA 4PFWA 1N7WA 4R9FA 2I49A 1LAXA 4XKQA 1QUIA 4Q0CA 4X1DA 1US5A 3EHTA 1P1NA 3LC8A 3QYTA 1ANFA 3TFLA 1FTKA 3MPLA 4KFQA 2NOOA 3N94A 1JVXA 2ONSA 1USYE 1XVYA 4FORA 3IB1A 2GH9A 4GVOA 2F7BA 3RGYA 1B7HA 4YMAA 4YU0A 4QSDA 3K1MA 3TTLA 1IXGA 1N84A 4EF2A 3PD9A 1ATGA 2P1SA 3PUYE 1QKAA 1M5BA 2HZLA 2BJJX 2XD2A 3SEVA 4Z7EA 4X48A 5DVFA 2PBWA 3FXUA 3T93B 4DCYA 3MJNA 2XXYA 2I58A 1LAFE 4JDFA 3TTMA 1CB6A 4F31B 2O51A 4U23A 3C31A 2F8DA 4IY6A 3KOTA 3VFJA 3TCGA 2CZLA 1MXXA 1ZTYA 5TPAB 4AQ4A 5IKBA 4QFKA 1ZU0A 5CMCA 1FQBA 3TUSA 2Z8EA 3DP8A 3V5AA 4H65A 3FJMA 4F3GA 3MUQA 3L6HA 1UIVA 2Q2AA 4NF8A 2F7AA 3K6WA 2XXPA 5B7DA 4EQBA 3FATA 4K3FA 4NF5A 2GFEA 1I6BA 2OLBA 2O68A 3RN8A 2F36A 3OO7A 3M3KA 5K2YA 2DQVA 2QRYA 3FXQA 1MQHA 3MAMA 4KYDA 4H8IA 1MY0A 4OHNA 4DE8A 4R2FA 1URDA 3MPKA 2F5XA 3LSXA 4ZS9A 3PUZE 3UN6A 3PMVA 4GOTA 3IJXB 1MH4A 2VHAA 3C34A 1PBPA 1B5JA 1OQHA 5J1DA 3HHFA 1EZOA 3H4ZA 3OO8A 3CRBA 1MQGA 4GRKA 1XT8A 2RC7A 2V93A 3P7IA 3K4UA 2V3UA 4ELOA 2OWSA 3FJGA 5A5XB 3SEXA 4RK2A 1RKMA 2DS9A 1B0LA 4X9TA 3RTWB 1B51A 1MXUA 3FASA 1Y1MA 3DP4A 5AA2A 4YB7A 1O63A 3T9XB 3C33A 3KJ7A 4IO6A 4MLVA 1N76A 5AA4A 3V83A 2M8CA 1MY2A 3A3CA 1FTLA 2XXIA 3SEWA 4PFTA 3H03A 4G68A 2G29A 3IOUA 1XC1A 4PFYA 4ISUA 5BWJA 2HFBA 3I6VA 2ANJA 1PDAA 1IXIA 5JK4A 1MPBA 5DT6A 3OELA 4QSEA 4Q5TA 3MVXA 3PPPA 3IB2A 4ELRA 2REJA 1O7TA 4NF4A 2GHBA 2IA4A 5KCJB 1JEUA 1EZPA 3H6VA 4R75A 3MWBA 4F29A 1GTKA 4R6HA 3TPAA 4JXIA 4FAJA 3A3UA 3LUYA 5TP9A 4LZ7A 3RNNA 1B2HA 2Q9TA 1N0TA 1FCKA 1B52A 1LGBC 3KSJA 3I3VA 3CFZA 1US4A 4KPTA 2OWTA 1NNTA 1PEBA 1MXYA 1QKBA 4ECFA 1QUKA 3QIMA 3KOSA 3U1OA 3F11A 4TLMB 1AMFA 4C0RA 3PUVE 4F1YA 1MDP1 1H3DA 4NMYA 2D5WA 3EF7A 1WODA 2Y84A 4OETA 2H98A 3RLFE 1ZBMA 3QXMA 2X26A 3HHGA 5JTYA 2HQ0A 4XKNA 4EDPA 4R2BA 4LVQA 4RA1A 1OLCA 2Z22A 3MBPA 4ZDMA 5H8FB 5I58B 3KSXA 2OZZA 5I2NB 1B0HA 3TKDA 1B3GA 2XXWA 4JBZA 2DWAA 5L9SA 2DXRA 3CI8A 4H0WA 2RCAA 1TWYA 2RC9A 5CBSA 3OXNA 4GQOA 3O29A 4GF8A 3HSTA 4G68C 4DXBA 4JSDA 5AA1A 1ZKBA 4I8CA 2B3BA 3MVYA 4KD5A 3HCQA 4F3SA 3G3GA 3C32A 5KZTA 3DLNA 1II5A 1KWHA 5I58A 2HAUA 1MXZA 3VXCA 2PMSA 3M8UA 4PQJA 3E4RA 2F6GA 4F18A 3QSLA 3EN3A 1SQYA 5KDTA 4G2ZA 3IL1B 3PU5A 4ZE8A 1UTBA 5AE4A 3IB0A 3BBRA 4ELPA 5I2KA 1B3EA 1POTA 3UGWA 2VP1A 3GBBA 1ZLQA 3KJTA 5ELVA 1SYIA 2VOZA 5F1QA 2AYSA 1IZ1A 2QPQA 3C35A 3SERA 2DE2A 2XXRA 4NTLA 2F7CA 3OSQA 3PGFA 4EXLA 4JSOA 3KFMA 1A8EA 3DP6A 1VSOA 5L9OA 4OERA 3BFUA 1PBQA 1LB9A 4YKJA 2P0SA 3N26A 3MP1A 1B4ZA 2DE3A 3RUMA 2THIA 2ZNTA 4WKMA 5CRYA 1IEJA 4BDRA 1LFIA 3DELB 5LOMA 2I4CA 3TMGA 2PX1A 2G93A 3PPNA 5DVIA 2ZYNA 1FQAA 2Y7KA 4POWA 2XXUA 3MP6A 4FIMA 2VGQA 3VLWA 4PE5B 3OO6A 2UVIA 1B05A 1B3FA 4M4GA 2UVGA 3IORA 2O7IA 4FEBA 1DPEA 3KZGA 4R6KA 3S9LC 2R9JA 2ZNSA 3OO9A 4I1DA 1B7UA 2OJTA 1B5HA 2FA7A 1H45A 1UQWA 4HTGA 2QJEA 4IO5A 3CSBA 4G8NA 3S9NC 5ITOA 4LONB 3AXFA 3LSLA 3Q29A 4NF8B 1SD3A 3E9XA 5CMBA 4KYSA 1AH5A 1HSJA 1LFHA 2QMWA 3G3HA 3O2AA 4H5FA 1EU8A 2ONRA 3LSWA 4NF5B 4MLQA 1I6QA 1R9LA 2E0SA 4YB6A 5I84A 3UORA 3OEKA 1Z7NE 4OESA 1LBBA 1GVCA 1H43A 3FVOA 1O64A 3VDFA 3I5OA 1P99A 3N6TA 1VR5A 3TTNA 2UVJA 1PC3A 3U8QA 4M1VA 4BDMA 4L17A 4E0XA 3C36A 2P2AA 4OVJA 3H6WA 4O3CA 3G3FA 1LAHE 4BDQA 3O6HA 4LQ2A 1WVJA 1UTHA 2V3QA 4GWOA 5JEIA 3T9VA 3IX1A 3TYHA 1DTZA 4IGRA 2XHDA 4KYEA 3U93A 3PMWA 3V8XB 4FEDA 4ONYA 2I3WA 4QF9A 2NVUB 5AA2B 4OZ9A 5EHSA 3C4MA 1SW5A 1URSA 5AA4B 3PUXE 4OXVA 1MQIA 2QMXA 5ICQA 3TCFA 3O9PA 1LCFA 4O3BA 3KN7A 4G68B 4IB2A 1BKAA 4HW8A 4ZEBA 5CM6A 4ESXA 5ISUA 4JWXA 1FQFA 5I56A 3G3KA 2VD3A 5L9MA 4QSCA 5CC2A 1B40A 4NWDA 1YCJA 1S50A 4NF4B 4R73A 1SW2A 2Y7PA 2H25A 3LSFB 4LATA 2O7UA 2NXOA 3K1PA 3KN8A 4HCWA 1BLFA 4R72A 4QRZA 3R7XA 1R6ZA 3TTKA 2H5YA 2ZYMA 5TP9B 3T9UA 1SDXA 1RYXA 2DE4A 4P0IA 5F7VA 4JWYA 4GIZA 1H44A 1LSTA 3OMBA 1B46A 1MDQA 2GHAA 3S9MC 3MZBA 1B1HA 4GL8A 2RINA 4WEPA 4E0WA 3O6IA 3PV0E 4TOZA 1MQDA 5DYHA 4JWOA 4GLIA 5I59A 4TLLB 2E1SA 4IO2A 4C1TA 5DVJA 3GXAA 1NNPA 4OFOA 1IXHA 2DP8A 1B4HA 5H8NA 3O66A 3IOTA 5CBRA 3V89B 3VVDA 1IIWA 5IAIA 4KCCA 2Q2CA 4OENA 3PPRA 1M5EA 3IAZA 1BP5A 2RC8A 3EPEA 2RCBA 3TCHA 4XIGQ 5JTYB 3W15C 1Y20A 1MPDA 4DIGA 2XXQA 3W9WA 3S9EA 5H8QA 1P1QA 4LQ5A 1MS7A 3ECRA 1QW0A 4DXCA 3OENA 3FGSA 5FTHA 3TELA 1H76A 1Y4TA 5FHNA 3R26A 1SYHA 1IITA 1LFGA 4LP2B 3N6UA 4OQOA 3B6TA 3FJ7A 1T0KA 1AL3A 1DPPA 4YMBA 2KLFA 1URGA 3SDFA 1MXWA 1NKXA 4RPNA 3EHSA 3MVWA 2Q89A 2Y7IA 2PVUA 2X7QA 5DEXA 4ZEIA 3FVGA 5ITPA 5EYFA 3UP9A 4DLDA 1N3WA 3VVEA 5CI5A 3ZKKA 1NNFA 4YKIA 5H8HA 4ZZAA 1Z7ME 3QUFA 2HZKA 1NH7A 4GD5A 1PB7A 5KDTB 4AB6A 4GFRA 1UTBB 4U22A 2XXHA 4EQ9A 5M2VA 3EHUA 4EXKA 4F3BA 4EF1A 4YB5A 1TFDA 1ZMGA 4PP0A 5I2KB 5L8DA 3B6QA 1I6AA 3TQWA 2NUVA 3RY3A 2QSXA 3TZAA 4PETA 2Q88A 1M5DA 1JW5A 1NMUA 3FD3A 2O1MA 2A5TA 1B5IA 3PMXA 5FHOA 3SEYA 1B7ZA 3HO7A 2UYFA 1NNKA 1F9BA 4BDOA 3FIRA 4IO7A 1JVYA 5B70A 3OOAA 5TU0A 1B58A 2QS1A 3K01A 3CIJA 1BTJA 3UIFA 1MH3A 1P1UA 1AOVA 4QFPA 3K6VA 4OTEA 3JV9A 2H99A 3K1NA 1PB8A 4H8JA 4LZ5A 4N6PA 2XX7A 4RPOA 4Z0IA 1A99A 1LAGE 2DYXA 5HM4B 2R6GE 3KN3A 2R71A 1LLSA 1N04A 1D3KA 1TFAA 3WAEA 4NF6A 2CMOA 1NH8A 4KQPA 3TAJA 4F3PA 2V25A 2O69A 4OMBA 3T96B 1HSEA 1YPNA 1DOTA 4H5GA 4HCYA 4U1OA 3VE1B 3ZSFA 1OQGA 3MVZA 3FVKA 1NFTA 1GR2A 3LR1A 4FECA 1SW4A 2H4IA 3M3LA 1EH3A 4OWDA 3K00A 5ICTA 3RQTA 2ESNA 4MFIA 1USYH 3TQLA 3FV1A 3JZJA 4P0GA 1A54A 2UYEA 4ZEDA 1LBCA 1SVXB 3RT8A 2O1LA 1DMBA 2I48A 2Q8JA 2GRVA 1JEVA 1BIYA 2I3VA
chains in the Genus database with same CATH superfamily
2O6AA 1JETA 4PGPA 2DVCA 4XKRA 3SZPA 5I57B 1VE4A 1ELJA 2ZXTA 2OK2A 1XOCA 1S9TA 4NEDA 4OEVA 1YTVA 4IGTA 2WKYA 3T22A 3RTFB 1SW1A 1FQEA 2QS4A 3ILUB 1IXCA 4F1UA 1UTHB 3IR1A 4XXUA 3N5LA 2Z23A 1D9VA 1GV8A 2LAOA 3R6UA 4P11A 4G8MA 2F34A 4BLAA 2DWJA 1P1OA 3SESA 4N07A 1B32A 3FVNA 1LCTA 4ZEFA 3OEMA 2HXWA 1FBDA 2ZMBA 4MIJA 1D4NA 1R1NA 3G3IA 2ZYOA 5I57A 4Q8RA 2Y7RA 4LN5A 3LBSA 1OLAA 4H1XA 1MY4A 4RY1A 2HCAA 4F39A 5H8SA 2B65A 4Q30B 4JB7A 5I56B 1FTMA 2ZZXA 4GXAA 1NV7A 4G8HA 2AL4A 1D9YA 4KHZE 3KBRA 4F2OA 4XKPA 2Q8MA 3LUZA 3SEUA 3MYUA 1Q1KA 5AA2D 4I62A 2XD3A 5DTBA 3K6UA 4PDHA 4EUOA 3KG2A 4TQUQ 4GWZA 3PTYA 3SETA 2PT1A 2UXAA 3PPQA 4OVTA 1Y3NA 3MP8A 2XXTA 4FE8A 3VLUA 2A5SA 3GBAA 2Y5LA 2XXXA 3HFUA 4XTCQ 4HS7A 3USDA 4MF3A 1ZJLA 3HV1A 1XI6A 4NGUA 4MBPA 3H6TA 3E3KA 5CMKA 4WEDA 4YKKA 4PGNA 3FZVA 5TPAA 3O97A 4YICA 4LA9A 4IO4A 3ROJA 3LV0A 1B1XA 1XS5A 2Z8FA 4WXJA 4ESWA 1N7XA 4OANA 4NE4A 3H6UA 1INPA 1A40A 3KBZA 3RPWA 1DCUA 1MQJA 2AIXA 1SI1A 5I59B 1MPCA 2ZNUA 2QS3A 4KR5A 4UACA 2YLNA 4GL0A 3U92A 2XXKA 1ZIUA 5H8NB 4P3LA 4ELQA 4GX3A 2PYYA 1K9ZA 3IK6B 3VXBA 1EZ9A 1MRPA 3IOWA 1M5CA 2PCRA 2XX9A 2RF1A 1VFDA 1QJMA 1EYJA 3QAXA 1M5FA 4DI4B 2OCUA 4ZE9A 2IEEA 2Z8DA 3MC2A 3WAFA 5H8QB 3RT6B 4POXA 4U21A 1Y3QA 1Q35A 3IJOB 3PUWE 3S2VA 4F1VA 3Q27A 3FXRA 4P56A 4BDNA 4U1ZA 4MH5A 1OVBA 3SKPA 3E78A 1TT1A 2I6EA 3TTRA 1DTGA 1SI0A 5AA3A 1A7LA 3EQ1A 4FBPA 5A5XA 5I5PA 4R9GA 3T66A 1R9QA 1YXIA 3U94A 4RYAA 3RPLA 2ZZVA 3CG3A 1OMPA 5I7IA 1G0IA 1GGGA 1KA0A 1QUJA 4PBQA 3K2DA 5BUUA 4R74A 1FTOA 1LBXA 5FHMA 3ONMA 3U72A 2R8TA 3VV5A 1MM6A 4PFUA 2XX8A 2ABHA 4RK9A 5ESYA 1NL5A 1PB9A 2FNCA 4UA8A 3IFCA 4ND9A 4GWYA 5IZ3B 2NWJA 1S7YA 5DEXB 3BKIB 2DOJA 2DWIA 4OFJA 1DK4A 1MG1A 5EHMA 5HPQA 1Y1ZA 2F78A 4MJOA 1FJ6A 5H8HB 3CFXA 1B3LA 4ZECA 4YAHX 3TODA 3QUJA 3H06B 1RDZA 4DXUA 4RXLA 1MY3A 3BFTA 3Q25A 4GWUA 2QL3A 1NUWA 2CZIA 5KCJA 3MW0A 2F97A 1IQ7A 3IOVA 4I9DA 3DM0A 3UK4A 1CE2A 3B7DA 3D4CA 4U2RA 4U4XA 4LZ8A 5ET5A 3HPIA 2DWHA 4N6DA 2D3IA 4RNSA 3CFLA 4F19A 1FTAA 1P1WA 2A5TB 5LTCA 3H3GA 1Y9UA 1VFEA 3W9VA 4ZEKA 1MY1A 4H6DA 1JW4A 1JP4A 2I4BA 3B6WA 4MNPA 1B6HA 3PPOA 4X1BA 4PAKA 2OBGA 4U4SA 4PAIA 4F2QA 3K02A 4H67A 4OFLA 3OD7A 4O7IA 2ZYKA 1QVSA 4PDDA 3TEPA 1LBWA 3GLBA 4PFIA 1FTJA 4FATA 1SBPA 4N91A 1FBHA 3GZGA 3CR9A 4KI0E 3ZKLA 2Y7WA 2FYIA 5F24A 3ZS6A 3KEIA 2X7PA 3NOHA 4BDLA 3CVGA 1L5TA 3A09A 3FV2A 3K0VA 3ODBA 4ZZEA 2I0CA 1I69A 1N3XA 4G4PA 2B3FA 1QULA 2AL5A 3CSGA 2ALUA 1WDNA 1YZ0A 2DVZA 3PD8A 4DDDA 3S4UA 1DSNA 4NF6B 4LUBA 4EQ7A 2REGA 3MQ9A 1RYOA 3H7MA 2UVHA 1J1NA 4IO3A 4DCXA 2ONKE 1XHYA 4QFLA 1FW0A 2RKMA 3M3FA 5H8FA 4NWCA 1A55A 1FQCA 1UIUA 1AIVA 3E13X 1NV6A 5I2NA 5FBPA 2XXVA 4THIA 2YJPA 3T9HB 1Y3PA 5IM2A 5EYGA 3JYRA 2HAVA 2V84A 2V3TA 2F6PA 1IUDA 2HEUA 3IO4A 4F22A 1LBVA 3Q28A 1MXVA 1YAEA 3G3JA 4FJPA 3VLVA 3O28A 3OSRA 4NX1A 2O84X 1B9JA 3QK6A 1POY1 1A8FA 4R6YA 1HSLA 1QGXA 2YPNA 3KGCA 1MM7A 2QS2A 4GXSB 3TDJA 1NV2A 4YKPA 3L6GA 1JW1A 3G7WA 1OVTA 3MZ1A 3Q26A 2DSFA 3VVFA 2ZZWA 4QHQA 1B3HA 4DZ1A 3HN0A 5FTIA 2VD2A 4OEUA 2D21A 3ILTB 3C9HA 3UA8A 4OYVA 1FQDA 1TXFA 2H9BA 3THIA 1Y4CA 3MZ9A 4PTKA 3IO6A 4P1EA 1OIBA 4QFOA 2DXYA 4YZZA 4G77A 4IY5A 1JQFA 2W7YA 4RJZA 1LB8A 3K6XA 4AB5A 3O6GA 1FPEA 1XVXA 4H46A 4KCDA 4P47A 1JNFA 4QFNA 4O3AA 3U65A 3FUZA 5HBCA 2F35A 2I0BA 1FPBA 2PT2A 3CG1A 3D4GA 4MAGA 5T3JA 5K2XA 5CMMA 2WYKA 4N13A 4C1UA 4NHBA 4PFWA 1N7WA 4R9FA 2I49A 1LAXA 4XKQA 1QUIA 4Q0CA 4HE0A 4X1DA 1US5A 3EHTA 1KZ8A 3ISPA 1P1NA 3LC8A 3QYTA 4PAFA 1ANFA 3TFLA 1FTKA 3MPLA 4KFQA 2NOOA 3N94A 1JVXA 2ONSA 1USYE 1XVYA 4FORA 4O94A 3IB1A 2GH9A 4GVOA 2F7BA 3RGYA 1B7HA 4YMAA 3FXBA 4YU0A 4QSDA 3K1MA 3TTLA 1IXGA 1N84A 4EF2A 3PD9A 1ATGA 2P1SA 3PUYE 1QKAA 1M5BA 2HZLA 2BJJX 2XD2A 2WBBA 3SEVA 4Z7EA 4X48A 5DVFA 2PBWA 3FXUA 3T93B 4DCYA 3MJNA 2XXYA 1IMEA 2I58A 1LAFE 4JDFA 3TTMA 1CB6A 1FPGA 4F31B 2O51A 2KR0A 2WYPA 4U23A 3C31A 2F8DA 4IY6A 2FBPA 3KOTA 3VFJA 3TCGA 2CZLA 1MXXA 2QVRA 1ZTYA 5TPAB 4AQ4A 5IKBA 4QFKA 1ZU0A 5CMCA 1FQBA 3EKIA 3TUSA 2Z8EA 3DP8A 3V5AA 4H65A 3FJMA 2P3NA 4XEQA 4F3GA 3MUQA 3L6HA 4GX4A 4N15A 1UIVA 1RDYA 2Q2AA 4NF8A 4DI3D 2DDKA 2F7AA 3K6WA 2XXPA 5B7DA 4EQBA 2L5VA 3FATA 4K3FA 4NF5A 2GFEA 2QVVA 1I6BA 2OLBA 4H45A 2O68A 4JVIA 3RN8A 3T1BA 2F36A 3OO7A 3M3KA 5K2YA 2DQVA 2QRYA 3FXQA 1MQHA 3MAMA 4KYDA 4H8IA 1MY0A 4OHNA 4DE8A 4R2FA 1URDA 3MPKA 4N81A 2F5XA 3LSXA 4ZS9A 3PUZE 3UN6A 3PMVA 4GOTA 3IJXB 1MH4A 2B4MA 2VHAA 3C34A 3KC0A 1PBPA 1B5JA 1OQHA 4MNIA 5J1DA 3HHFA 1FBEA 1EZOA 3H4ZA 3OO8A 3CRBA 1MQGA 4GRKA 1XT8A 2RC7A 2V93A 1FBGA 3P7IA 3K4UA 3BIGA 2V3UA 2HPGA 4PF8A 1FPKA 4ELOA 2OWSA 3FJGA 5A5XB 3SEXA 4RK2A 1RKMA 2DS9A 2P3VA 3RPLB 1B0LA 4X9TA 3RTWB 1B51A 1MXUA 3FASA 4P8BA 1Y1MA 3DP4A 5AA2A 4YB7A 4I3YA 1O63A 3T9XB 3C33A 3KJ7A 4IO6A 4MLVA 1N76A 5AA4A 3V83A 4GWSA 2M8CA 1MY2A 3A3CA 1FTLA 2XXIA 3SEWA 4PFTA 3H03A 4G68A 2G29A 3IOUA 1XC1A 4I40A 4PFYA 4ISUA 5BWJA 2HFBA 3I6VA 2ANJA 1PDAA 1IXIA 5JK4A 1MPBA 3E79A 5DT6A 3IFAA 3OELA 4QSEA 4Q5TA 3MVXA 5A5LA 3PPPA 3IB2A 4ELRA 2REJA 1O7TA 4NF4A 2GHBA 2IA4A 5KCJB 1JEUA 1EZPA 3H6VA 4R75A 3MWBA 4F29A 1GTKA 4R6HA 1D9QA 3TPAA 4JXIA 4FAJA 3A3UA 3LUYA 1FBPA 4P9KA 5EQ9A 5TP9A 4LZ7A 3RYDA 3RNNA 1B2HA 2Q9TA 1N0TA 1FCKA 1B52A 2KQZA 1LGBC 3KSJA 3I3VA 2FIEA 3CFZA 1Q9DA 1IMCA 1US4A 4KPTA 2OWTA 4O7MA 1NNTA 1PEBA 1MXYA 1QKBA 4ECFA 1QUKA 3QIMA 3KOSA 2XWIA 1KA1A 3U1OA 3F11A 4N6KA 4TLMB 1AMFA 4C0RA 3PUVE 4F1YA 1MDP1 1H3DA 4NMYA 4XFEA 2D5WA 3EF7A 1BK4A 1WODA 2Y84A 4OETA 1NUYA 2H98A 2QVUA 3RLFE 1ZBMA 3QXMA 2JJKA 2X26A 3HHGA 5JTYA 2HQ0A 4XKNA 4EDPA 4R2BA 4LVQA 2OX3A 4RA1A 1OLCA 3T0JA 2Z22A 3MBPA 1NI9A 4ZDMA 5H8FB 5I58B 3KSXA 2OZZA 5I2NB 1B0HA 3TKDA 1B3GA 2XXWA 4JBZA 1NV0A 2DWAA 5L9SA 2DXRA 3CI8A 4H0WA 2RCAA 1TWYA 2RC9A 5CBSA 3OXNA 3B50A 1LBZA 1YYZA 4GQOA 3O29A 4GF8A 3HSTA 4G68C 4DXBA 4JSDA 5AA1A 1ZKBA 4I8CA 2B3BA 3MVYA 4KD5A 3HCQA 1VDWA 4F3SA 5LDZA 3G3GA 4XF5A 3C32A 5KZTA 3DLNA 1II5A 1KWHA 5I58A 4GWXA 1IMBA 1FPLA 2HAUA 1MXZA 3VXCA 2PMSA 3M8UA 4PQJA 4N8YA 3E4RA 2WBDA 5ET8A 2F6GA 4F18A 1FBFA 5IZ1A 4PFBA 3QSLA 3EN3A 1SQYA 5KDTA 4G2ZA 4AS5A 3IL1B 3PU5A 4ZE8A 1UTBA 5AE4A 3IB0A 3BBRA 4ELPA 5I2KA 1B3EA 1POTA 1IMAA 4MMPA 3UGWA 2VP1A 3KC1A 4UABA 3GBBA 1FRPA 1ZLQA 3KJTA 5ELVA 1SYIA 2VOZA 2XA5A 5F1QA 2AYSA 1IZ1A 2QPQA 3C35A 3SERA 2DE2A 2XXRA 5EQ8A 4NTLA 2F7CA 3OSQA 3QMFA 3PGFA 4EXLA 4JSOA 3KFMA 1A8EA 3DP6A 1VSOA 5L9OA 4OERA 3BFUA 5IGAA 1PBQA 1LB9A 4YKJA 2P0SA 3N26A 5EQ7A 3MP1A 1B4ZA 2DE3A 3B8BA 3RUMA 4MX6A 2THIA 2ZNTA 4WKMA 5CRYA 1IEJA 2VPNA 4BDRA 1LFIA 3DELB 5LOMA 2I4CA 3TMGA 4HXVA 4PBHA 2PX1A 2G93A 3PPNA 5DVIA 2ZYNA 1FQAA 2Y7KA 4POWA 2XXUA 3MP6A 4FIMA 2VGQA 1FPFA 3VLWA 4PE5B 3OO6A 2UVIA 1B05A 4GX6A 1B3FA 4MEVA 4M4GA 2UVGA 3IORA 2O7IA 4FEBA 1DPEA 3KZGA 4R6KA 3S9LC 2R9JA 2ZNSA 3OO9A 2V4CA 4I1DA 1B7UA 2OJTA 1B5HA 4PCDA 2FA7A 1H45A 1RDXA 1UQWA 4HTGA 4JVDA 2QJEA 4IO5A 3CSBA 4G8NA 3S9NC 5ITOA 1IMFA 4LONB 3AXFA 4NG7A 3LSLA 3Q29A 4NF8B 1SD3A 2Q74A 3E9XA 5CMBA 4KYSA 1AH5A 1HSJA 1LFHA 2QMWA 3G3HA 3O2AA 4H5FA 1EU8A 4GBWA 2ONRA 3LSWA 2FIXA 4NF5B 4MLQA 1I6QA 1R9LA 2E0SA 4YB6A 5I84A 3UORA 3OEKA 1Z7NE 4OESA 1LBBA 1GVCA 1H43A 4PC9A 3FVOA 1O64A 2VT5A 3VDFA 3I5OA 1P99A 3N6TA 1VR5A 3TTNA 2UVJA 2CZKA 1PC3A 3U8QA 4M1VA 4P1LA 4BDMA 4L17A 4E0XA 3C36A 2P2AA 4OVQA 4OVJA 3H6WA 4GBVA 4O3CA 4NF0A 3G3FA 1LAHE 4BDQA 3O6HA 4LQ2A 1WVJA 1UTHA 2V3QA 5J16A 4GWOA 3MSTA 5JEIA 3T9VA 3IX1A 2CEYA 3TYHA 1DTZA 4IGRA 2XHDA 4KYEA 3U93A 2PFYA 3PMWA 3V8XB 4O8MA 4IR8A 4FEDA 4ONYA 2I3WA 4QF9A 3FBPA 2NVUB 5AA2B 4MNCA 4OZ9A 5EHSA 4N4UA 3C4MA 1SW5A 1URSA 4MHFA 5AA4B 5EQAA 3PUXE 4OXVA 1MQIA 2QMXA 5ICQA 3TCFA 3BIHA 4GWWA 3O9PA 1LCFA 4O3BA 3KN7A 4G68B 4IB2A 1BKAA 4HW8A 4ZEBA 5CM6A 4ESXA 5ISUA 4JWXA 1FQFA 5I56A 5DW8A 5ET6A 3G3KA 2VD3A 5L9MA 1AWBA 4QSCA 5CC2A 1B40A 4OVPA 4AS4A 4NWDA 1YCJA 1S50A 4NF4B 4R73A 1SW2A 2Y7PA 4X04A 1FPDA 2H25A 3LSFB 4LATA 2O7UA 2NXOA 3K1PA 3KN8A 1FJ9A 4HCWA 1BLFA 1NV1A 4R72A 4QRZA 3R7XA 1R6ZA 3GYYA 3TTKA 2H5YA 2ZYMA 5TP9B 3T9UA 1SDXA 1RYXA 2DE4A 4P0IA 5F7VA 4JWYA 1FPJA 4GIZA 1H44A 1LSTA 3OMBA 2WX9A 2F3BA 1B46A 1MDQA 2GHAA 3S9MC 3MZBA 1B1HA 4GL8A 2RINA 4WEPA 1EYIA 4E0WA 3O6IA 3PV0E 4TOZA 1MQDA 5DYHA 4OVSA 4JWOA 4GLIA 4N8GA 5I59A 2XWOA 2E1SA 4TLLB 4IO2A 4C1TA 5DVJA 2PFZA 3GXAA 1NNPA 4OFOA 1IXHA 2DP8A 1B4HA 5H8NA 3O66A 3IOTA 5CBRA 3V89B 3VVDA 2QFLA 1IIWA 5IAIA 4KCCA 4HE2A 2Q2CA 4OENA 1NV3A 3PPRA 1M5EA 2CZHA 3IAZA 1BP5A 1FSAA 2RC8A 3EPEA 2RCBA 3TCHA 4XIGQ 5JTYB 3W15C 1Y20A 2OWZA 5EYHA 1FPIA 1MPDA 4PE3A 2XWVA 4DIGA 2XXQA 3W9WA 3S9EA 5H8QA 1P1QA 4LQ5A 1MS7A 3ECRA 1QW0A 4DXCA 3OENA 3FGSA 4JVCA 5FTHA 3TELA 1H76A 1Y4TA 5FHNA 4NN3A 3R26A 2CEXA 1SYHA 1IITA 1LFGA 4LP2B 4QBAA 3N6UA 4OQOA 3B6TA 3FJ7A 1T0KA 1AL3A 2HXRA 1DPPA 4YMBA 2KLFA 1NV4A 1URGA 3SDFA 1NUXA 1MXWA 1NKXA 4I3EA 4RPNA 3EHSA 3MVWA 2Q89A 2Y7IA 5IZ3A 2PVUA 2X7QA 5DEXA 4ZEIA 3FVGA 5ITPA 5EYFA 3UP9A 4DLDA 1LBYA 1N3WA 3VVEA 5CI5A 3ZKKA 1NNFA 4YKIA 5H8HA 4ZZAA 1Z7ME 1DBZA 3QUFA 2WEFA 4NQ8A 3A29A 4NAPA 2HZKA 2MKZA 2BJIA 1NH7A 5I3SA 4GD5A 4HE1A 1PB7A 5KDTB 4AB6A 4GFRA 1UTBB 4U22A 2XXHA 4EQ9A 5M2VA 3EHUA 4EXKA 4F3BA 1CNQA 4EF1A 4YB5A 1TFDA 1ZMGA 4PP0A 5I2KB 5L8DA 5IZZA 3B6QA 1I6AA 3TQWA 2NUVA 3RY3A 2QSXA 3TZAA 4PETA 2Q88A 1M5DA 1JW5A 1NMUA 2GQ1A 3FD3A 2O1MA 2A5TA 1B5IA 3PMXA 5FHOA 3SEYA 1B7ZA 2FVZA 3HO7A 2UYFA 1NNKA 1F9BA 4BDOA 3FIRA 4IO7A 1JVYA 5B70A 3OOAA 5TU0A 1B58A 2QS1A 3K01A 1EYKA 2F3DA 3CIJA 1BTJA 3UIFA 1MH3A 1P1UA 1AOVA 4QFPA 3K6VA 4MCOA 4OA4A 4OTEA 1NV5A 3JV9A 2H99A 3K1NA 1PB8A 4H8JA 4LZ5A 4N6PA 2XX7A 4RPOA 4X8RA 4Z0IA 1A99A 1LAGE 2DYXA 5HM4B 1FBCA 1K9YA 2R6GE 3KN3A 2R71A 1LLSA 2B4LA 1N04A 1D3KA 2XWKA 1SPIA 1TFAA 4G61A 3WAEA 1NUZA 4NF6A 2CMOA 1NH8A 4KQPA 3TAJA 4F3PA 2V25A 2O69A 4PFRA 4OMBA 3T96B 1HSEA 1YPNA 1DOTA 4H5GA 4HCYA 4U1OA 3VE1B 3ZSFA 1OQGA 3D1RA 3MVZA 4OVRA 3FVKA 1NFTA 2FHYA 1GR2A 3LR1A 5ET7A 4FECA 1IMDA 1SW4A 4QXDA 2H4IA 3M3LA 1EH3A 2VPOA 4OWDA 3K00A 4N17A 4PF6A 5ICTA 3RQTA 4KXPA 2ESNA 3CHGA 4MFIA 1USYH 3TQLA 2HHMA 3FV1A 3JZJA 4P0GA 1A54A 2UYEA 4ZEDA 1LBCA 1SVXB 3RT8A 2O1LA 1DMBA 1G0HA 2I48A 2Q8JA 2GRVA 1JEVA 1BIYA 1LEVA 2Y5KA 2I3VA
chains in the Genus database with same CATH topology
2O6AA 1JETA 2DVCA 4XKRA 5I57B 1VE4A 1ELJA 2ZXTA 2OK2A 1XOCA 1S9TA 4NEDA 4OEVA 1YTVA 4IGTA 2WKYA 3T22A 3RTFB 1SW1A 1FQEA 2QS4A 3ILUB 1IXCA 4F1UA 1UTHB 3IR1A 4XXUA 3N5LA 2Z23A 1D9VA 1GV8A 2LAOA 3R6UA 4P11A 4G8MA 2F34A 4BLAA 2DWJA 1P1OA 3SESA 4N07A 1B32A 3FVNA 1LCTA 4ZEFA 3OEMA 2HXWA 2ZMBA 1D4NA 1R1NA 3G3IA 2ZYOA 5I57A 4Q8RA 2Y7RA 3LBSA 1OLAA 4H1XA 1MY4A 4RY1A 2HCAA 4F39A 5H8SA 2B65A 4Q30B 4JB7A 5I56B 1FTMA 4GXAA 4G8HA 2AL4A 1D9YA 4KHZE 3KBRA 4F2OA 4XKPA 3SEUA 1Q1KA 5AA2D 4I62A 2XD3A 5DTBA 3K6UA 4EUOA 3KG2A 4TQUQ 3SETA 2PT1A 2UXAA 3PPQA 1Y3NA 3MP8A 2XXTA 4FE8A 3VLUA 2A5SA 3GBAA 2XXXA 4XTCQ 4HS7A 3USDA 4MF3A 1ZJLA 3HV1A 4MBPA 3H6TA 3E3KA 5CMKA 4WEDA 4YKKA 3FZVA 5TPAA 3O97A 4YICA 4LA9A 4IO4A 1B1XA 1XS5A 2Z8FA 4WXJA 4ESWA 1N7XA 4NE4A 3H6UA 3RPWA 1A40A 1MQJA 2AIXA 1SI1A 5I59B 1MPCA 2ZNUA 2QS3A 4KR5A 4UACA 2YLNA 4GL0A 3U92A 1ZIUA 5H8NB 4ELQA 2PYYA 3IK6B 3VXBA 1EZ9A 1MRPA 3IOWA 1M5CA 2XX9A 2RF1A 1VFDA 1QJMA 3QAXA 1M5FA 2OCUA 4ZE9A 2IEEA 2Z8DA 3MC2A 3WAFA 5H8QB 3RT6B 4POXA 4U21A 1Y3QA 1Q35A 3IJOB 3PUWE 3S2VA 4F1VA 3Q27A 3FXRA 4BDNA 4U1ZA 4MH5A 1OVBA 3SKPA 1TT1A 2I6EA 3TTRA 1DTGA 1SI0A 5AA3A 1A7LA 3EQ1A 5A5XA 4R9GA 3T66A 1R9QA 3U94A 4RYAA 3CG3A 1OMPA 1GGGA 1QUJA 3K2DA 5BUUA 4R74A 1FTOA 5FHMA 3ONMA 3U72A 3VV5A 1MM6A 4PFUA 2XX8A 2ABHA 4RK9A 1NL5A 1PB9A 2FNCA 4UA8A 4ND9A 2NWJA 1S7YA 5DEXB 3BKIB 2DOJA 2DWIA 4OFJA 1MG1A 5EHMA 5HPQA 1Y1ZA 2F78A 5H8HB 3CFXA 1B3LA 4ZECA 4YAHX 3TODA 3QUJA 3H06B 4DXUA 4RXLA 1MY3A 3BFTA 3Q25A 2QL3A 5KCJA 3MW0A 2F97A 1IQ7A 3IOVA 4I9DA 3DM0A 3UK4A 1CE2A 3B7DA 3D4CA 4U2RA 4U4XA 4LZ8A 3HPIA 2DWHA 2D3IA 4RNSA 3CFLA 4F19A 1P1WA 2A5TB 3H3GA 1Y9UA 1VFEA 3W9VA 4ZEKA 1MY1A 4H6DA 1JW4A 2I4BA 3B6WA 1B6HA 3PPOA 4X1BA 2OBGA 4U4SA 4F2QA 3K02A 4H67A 4OFLA 3OD7A 2ZYKA 1QVSA 3TEPA 3GLBA 1FTJA 4FATA 1SBPA 3GZGA 3CR9A 4KI0E 3ZKLA 2Y7WA 2FYIA 3ZS6A 3KEIA 2X7PA 4BDLA 3CVGA 1L5TA 3A09A 3FV2A 3K0VA 3ODBA 4ZZEA 2I0CA 1I69A 1N3XA 4G4PA 2B3FA 1QULA 2AL5A 3CSGA 2ALUA 1WDNA 2DVZA 3PD8A 4DDDA 3S4UA 1DSNA 4NF6B 4EQ7A 4LUBA 2REGA 3MQ9A 1RYOA 3H7MA 2UVHA 1J1NA 4IO3A 4DCXA 2ONKE 1XHYA 4QFLA 1FW0A 2RKMA 3M3FA 5H8FA 4NWCA 1A55A 1FQCA 1UIUA 1AIVA 3E13X 5I2NA 2XXVA 4THIA 2YJPA 3T9HB 1Y3PA 3JYRA 2HAVA 2V84A 2V3TA 2F6PA 1IUDA 2HEUA 3IO4A 4F22A 3Q28A 1MXVA 1YAEA 3G3JA 4FJPA 3VLVA 3O28A 3OSRA 2O84X 1B9JA 3QK6A 1POY1 1A8FA 4R6YA 1HSLA 2YPNA 3KGCA 1MM7A 2QS2A 4GXSB 3TDJA 4YKPA 3L6GA 1JW1A 3G7WA 1OVTA 3MZ1A 3Q26A 2DSFA 3VVFA 4QHQA 1B3HA 4DZ1A 3HN0A 5FTIA 2VD2A 4OEUA 2D21A 3ILTB 3C9HA 3UA8A 4OYVA 1FQDA 1TXFA 2H9BA 3THIA 1Y4CA 3MZ9A 3IO6A 1OIBA 4QFOA 2DXYA 4YZZA 4G77A 4IY5A 1JQFA 2W7YA 4RJZA 1LB8A 3K6XA 4AB5A 3O6GA 1XVXA 4KCDA 1JNFA 4QFNA 4O3AA 3FUZA 5HBCA 2F35A 2I0BA 2PT2A 3CG1A 3D4GA 5K2XA 5CMMA 4N13A 4C1UA 4PFWA 1N7WA 4R9FA 2I49A 1LAXA 4XKQA 1QUIA 4Q0CA 4X1DA 1US5A 3EHTA 1P1NA 3LC8A 3QYTA 1ANFA 3TFLA 1FTKA 3MPLA 4KFQA 2NOOA 3N94A 1JVXA 2ONSA 1USYE 1XVYA 4FORA 3IB1A 2GH9A 4GVOA 2F7BA 3RGYA 1B7HA 4YMAA 4YU0A 4QSDA 3K1MA 3TTLA 1IXGA 1N84A 4EF2A 3PD9A 1ATGA 2P1SA 3PUYE 1QKAA 1M5BA 2HZLA 2BJJX 2XD2A 3SEVA 4Z7EA 4X48A 5DVFA 2PBWA 3FXUA 3T93B 4DCYA 3MJNA 2XXYA 2I58A 1LAFE 4JDFA 3TTMA 1CB6A 4F31B 2O51A 4U23A 3C31A 2F8DA 4IY6A 3KOTA 3VFJA 3TCGA 2CZLA 1MXXA 1ZTYA 5TPAB 4AQ4A 5IKBA 4QFKA 1ZU0A 5CMCA 1FQBA 3TUSA 2Z8EA 3DP8A 3V5AA 4H65A 3FJMA 4F3GA 3MUQA 3L6HA 1UIVA 2Q2AA 4NF8A 2F7AA 3K6WA 2XXPA 5B7DA 4EQBA 3FATA 4K3FA 4NF5A 2GFEA 1I6BA 2OLBA 2O68A 3RN8A 2F36A 3OO7A 3M3KA 5K2YA 2DQVA 2QRYA 3FXQA 1MQHA 3MAMA 4KYDA 4H8IA 1MY0A 4OHNA 4DE8A 4R2FA 1URDA 3MPKA 2F5XA 3LSXA 4ZS9A 3PUZE 3UN6A 3PMVA 4GOTA 3IJXB 1MH4A 2VHAA 3C34A 1PBPA 1B5JA 1OQHA 5J1DA 3HHFA 1EZOA 3H4ZA 3OO8A 3CRBA 1MQGA 4GRKA 1XT8A 2RC7A 2V93A 3P7IA 3K4UA 2V3UA 4ELOA 2OWSA 3FJGA 5A5XB 3SEXA 4RK2A 1RKMA 2DS9A 1B0LA 4X9TA 3RTWB 1B51A 1MXUA 3FASA 1Y1MA 3DP4A 5AA2A 4YB7A 1O63A 3T9XB 3C33A 3KJ7A 4IO6A 4MLVA 1N76A 5AA4A 3V83A 2M8CA 1MY2A 3A3CA 1FTLA 2XXIA 3SEWA 4PFTA 3H03A 4G68A 2G29A 3IOUA 1XC1A 4PFYA 4ISUA 5BWJA 2HFBA 3I6VA 2ANJA 1PDAA 1IXIA 5JK4A 1MPBA 5DT6A 3OELA 4QSEA 4Q5TA 3MVXA 3PPPA 3IB2A 4ELRA 2REJA 1O7TA 4NF4A 2GHBA 2IA4A 5KCJB 1JEUA 1EZPA 3H6VA 4R75A 3MWBA 4F29A 1GTKA 4R6HA 3TPAA 4JXIA 4FAJA 3A3UA 3LUYA 5TP9A 4LZ7A 3RNNA 1B2HA 2Q9TA 1N0TA 1FCKA 1B52A 1LGBC 3KSJA 3I3VA 3CFZA 1US4A 4KPTA 2OWTA 1NNTA 1PEBA 1MXYA 1QKBA 4ECFA 1QUKA 3QIMA 3KOSA 3U1OA 3F11A 4TLMB 1AMFA 4C0RA 3PUVE 4F1YA 1MDP1 1H3DA 4NMYA 2D5WA 3EF7A 1WODA 2Y84A 4OETA 2H98A 3RLFE 1ZBMA 3QXMA 2X26A 3HHGA 5JTYA 2HQ0A 4XKNA 4EDPA 4R2BA 4LVQA 4RA1A 1OLCA 2Z22A 3MBPA 4ZDMA 5H8FB 5I58B 3KSXA 2OZZA 5I2NB 1B0HA 3TKDA 1B3GA 2XXWA 4JBZA 2DWAA 5L9SA 2DXRA 3CI8A 4H0WA 2RCAA 1TWYA 2RC9A 5CBSA 3OXNA 4GQOA 3O29A 4GF8A 3HSTA 4G68C 4DXBA 4JSDA 5AA1A 1ZKBA 4I8CA 2B3BA 3MVYA 4KD5A 3HCQA 4F3SA 3G3GA 3C32A 5KZTA 3DLNA 1II5A 1KWHA 5I58A 2HAUA 1MXZA 3VXCA 2PMSA 3M8UA 4PQJA 3E4RA 2F6GA 4F18A 3QSLA 3EN3A 1SQYA 5KDTA 4G2ZA 3IL1B 3PU5A 4ZE8A 1UTBA 5AE4A 3IB0A 3BBRA 4ELPA 5I2KA 1B3EA 1POTA 3UGWA 2VP1A 3GBBA 1ZLQA 3KJTA 5ELVA 1SYIA 2VOZA 5F1QA 2AYSA 1IZ1A 2QPQA 3C35A 3SERA 2DE2A 2XXRA 4NTLA 2F7CA 3OSQA 3PGFA 4EXLA 4JSOA 3KFMA 1A8EA 3DP6A 1VSOA 5L9OA 4OERA 3BFUA 1PBQA 1LB9A 4YKJA 2P0SA 3N26A 3MP1A 1B4ZA 2DE3A 3RUMA 2THIA 2ZNTA 4WKMA 5CRYA 1IEJA 4BDRA 1LFIA 3DELB 5LOMA 2I4CA 3TMGA 2PX1A 2G93A 3PPNA 5DVIA 2ZYNA 1FQAA 2Y7KA 4POWA 2XXUA 3MP6A 4FIMA 2VGQA 3VLWA 4PE5B 3OO6A 2UVIA 1B05A 1B3FA 4M4GA 2UVGA 3IORA 2O7IA 4FEBA 1DPEA 3KZGA 4R6KA 3S9LC 2R9JA 2ZNSA 3OO9A 4I1DA 1B7UA 2OJTA 1B5HA 2FA7A 1H45A 1UQWA 4HTGA 2QJEA 4IO5A 3CSBA 4G8NA 3S9NC 5ITOA 4LONB 3AXFA 3LSLA 3Q29A 4NF8B 1SD3A 3E9XA 5CMBA 4KYSA 1AH5A 1HSJA 1LFHA 2QMWA 3G3HA 3O2AA 4H5FA 1EU8A 2ONRA 3LSWA 4NF5B 4MLQA 1I6QA 1R9LA 2E0SA 4YB6A 5I84A 3UORA 3OEKA 1Z7NE 4OESA 1LBBA 1GVCA 1H43A 3FVOA 1O64A 3VDFA 3I5OA 1P99A 3N6TA 1VR5A 3TTNA 2UVJA 1PC3A 3U8QA 4M1VA 4BDMA 4L17A 4E0XA 3C36A 2P2AA 4OVJA 3H6WA 4O3CA 3G3FA 1LAHE 4BDQA 3O6HA 4LQ2A 1WVJA 1UTHA 2V3QA 4GWOA 5JEIA 3T9VA 3IX1A 3TYHA 1DTZA 4IGRA 2XHDA 4KYEA 3U93A 3PMWA 3V8XB 4FEDA 4ONYA 2I3WA 4QF9A 2NVUB 5AA2B 4OZ9A 5EHSA 3C4MA 1SW5A 1URSA 5AA4B 3PUXE 4OXVA 1MQIA 2QMXA 5ICQA 3TCFA 3O9PA 1LCFA 4O3BA 3KN7A 4G68B 4IB2A 1BKAA 4HW8A 4ZEBA 5CM6A 4ESXA 5ISUA 4JWXA 1FQFA 5I56A 3G3KA 2VD3A 5L9MA 4QSCA 5CC2A 1B40A 4NWDA 1YCJA 1S50A 4NF4B 4R73A 1SW2A 2Y7PA 2H25A 3LSFB 4LATA 2O7UA 2NXOA 3K1PA 3KN8A 4HCWA 1BLFA 4R72A 4QRZA 3R7XA 1R6ZA 3TTKA 2H5YA 2ZYMA 5TP9B 3T9UA 1SDXA 1RYXA 2DE4A 4P0IA 5F7VA 4JWYA 4GIZA 1H44A 1LSTA 3OMBA 1B46A 1MDQA 2GHAA 3S9MC 3MZBA 1B1HA 4GL8A 2RINA 4WEPA 4E0WA 3O6IA 3PV0E 4TOZA 1MQDA 5DYHA 4JWOA 4GLIA 5I59A 4TLLB 2E1SA 4IO2A 4C1TA 5DVJA 3GXAA 1NNPA 4OFOA 1IXHA 2DP8A 1B4HA 5H8NA 3O66A 3IOTA 5CBRA 3V89B 3VVDA 1IIWA 5IAIA 4KCCA 2Q2CA 4OENA 3PPRA 1M5EA 3IAZA 1BP5A 2RC8A 3EPEA 2RCBA 3TCHA 4XIGQ 5JTYB 3W15C 1Y20A 1MPDA 4DIGA 2XXQA 3W9WA 3S9EA 5H8QA 1P1QA 4LQ5A 1MS7A 3ECRA 1QW0A 4DXCA 3OENA 3FGSA 5FTHA 3TELA 1H76A 1Y4TA 5FHNA 3R26A 1SYHA 1IITA 1LFGA 4LP2B 3N6UA 4OQOA 3B6TA 3FJ7A 1T0KA 1AL3A 1DPPA 4YMBA 2KLFA 1URGA 3SDFA 1MXWA 1NKXA 4RPNA 3EHSA 3MVWA 2Q89A 2Y7IA 2PVUA 2X7QA 5DEXA 4ZEIA 3FVGA 5ITPA 5EYFA 3UP9A 4DLDA 1N3WA 3VVEA 5CI5A 3ZKKA 1NNFA 4YKIA 5H8HA 4ZZAA 1Z7ME 3QUFA 2HZKA 1NH7A 4GD5A 1PB7A 5KDTB 4AB6A 4GFRA 1UTBB 4U22A 2XXHA 4EQ9A 5M2VA 3EHUA 4EXKA 4F3BA 4EF1A 4YB5A 1TFDA 1ZMGA 4PP0A 5I2KB 5L8DA 3B6QA 1I6AA 3TQWA 2NUVA 3RY3A 2QSXA 3TZAA 4PETA 2Q88A 1M5DA 1JW5A 1NMUA 3FD3A 2O1MA 2A5TA 1B5IA 3PMXA 5FHOA 3SEYA 1B7ZA 3HO7A 2UYFA 1NNKA 1F9BA 4BDOA 3FIRA 4IO7A 1JVYA 5B70A 3OOAA 5TU0A 1B58A 2QS1A 3K01A 3CIJA 1BTJA 3UIFA 1MH3A 1P1UA 1AOVA 4QFPA 3K6VA 4OTEA 3JV9A 2H99A 3K1NA 1PB8A 4H8JA 4LZ5A 4N6PA 2XX7A 4RPOA 4Z0IA 1A99A 1LAGE 2DYXA 5HM4B 2R6GE 3KN3A 2R71A 1LLSA 1N04A 1D3KA 1TFAA 3WAEA 4NF6A 2CMOA 1NH8A 4KQPA 3TAJA 4F3PA 2V25A 2O69A 4OMBA 3T96B 1HSEA 1YPNA 1DOTA 4H5GA 4HCYA 4U1OA 3VE1B 3ZSFA 1OQGA 3MVZA 3FVKA 1NFTA 1GR2A 3LR1A 4FECA 1SW4A 2H4IA 3M3LA 1EH3A 4OWDA 3K00A 5ICTA 3RQTA 2ESNA 4MFIA 1USYH 3TQLA 3FV1A 3JZJA 4P0GA 1A54A 2UYEA 4ZEDA 1LBCA 1SVXB 3RT8A 2O1LA 1DMBA 2I48A 2Q8JA 2GRVA 1JEVA 1BIYA 2I3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6A A;  1JET A;  2DVC A;  4XKR A;  5I57 B;  1VE4 A;  1ELJ A;  2ZXT A;  2OK2 A;  1XOC A;  1S9T A;  4NED A;  4OEV A;  1YTV A;  4IGT A;  2WKY A;  3T22 A;  3RTF B;  1SW1 A;  1FQE A;  2QS4 A;  3ILU B;  1IXC A;  4F1U A;  1UTH B;  3IR1 A;  4XXU A;  3N5L A;  2Z23 A;  1D9V A;  1GV8 A;  2LAO A;  3R6U A;  4P11 A;  4G8M A;  2F34 A;  4BLA A;  2DWJ A;  1P1O A;  3SES A;  4N07 A;  1B32 A;  3FVN A;  1LCT A;  4ZEF A;  3OEM A;  2HXW A;  2ZMB A;  1D4N A;  1R1N A;  3G3I A;  2ZYO A;  5I57 A;  4Q8R A;  2Y7R A;  3LBS A;  1OLA A;  4H1X A;  1MY4 A;  4RY1 A;  2HCA A;  4F39 A;  5H8S A;  2B65 A;  4Q30 B;  4JB7 A;  5I56 B;  1FTM A;  4GXA A;  4G8H A;  2AL4 A;  1D9Y A;  4KHZ E;  3KBR A;  4F2O A;  4XKP A;  3SEU A;  1Q1K A;  5AA2 D;  4I62 A;  2XD3 A;  5DTB A;  3K6U A;  4EUO A;  3KG2 A;  4TQU Q;  3SET A;  2PT1 A;  2UXA A;  3PPQ A;  1Y3N A;  3MP8 A;  2XXT A;  4FE8 A;  3VLU A;  2A5S A;  3GBA A;  2XXX A;  4XTC Q;  4HS7 A;  3USD A;  4MF3 A;  1ZJL A;  3HV1 A;  4MBP A;  3H6T A;  3E3K A;  5CMK A;  4WED A;  4YKK A;  3FZV A;  5TPA A;  3O97 A;  4YIC A;  4LA9 A;  4IO4 A;  1B1X A;  1XS5 A;  2Z8F A;  4WXJ A;  4ESW A;  1N7X A;  4NE4 A;  3H6U A;  3RPW A;  1A40 A;  1MQJ A;  2AIX A;  1SI1 A;  5I59 B;  1MPC A;  2ZNU A;  2QS3 A;  4KR5 A;  4UAC A;  2YLN A;  4GL0 A;  3U92 A;  1ZIU A;  5H8N B;  4ELQ A;  2PYY A;  3IK6 B;  3VXB A;  1EZ9 A;  1MRP A;  3IOW A;  1M5C A;  2XX9 A;  2RF1 A;  1VFD A;  1QJM A;  3QAX A;  1M5F A;  2OCU A;  4ZE9 A;  2IEE A;  2Z8D A;  3MC2 A;  3WAF A;  5H8Q B;  3RT6 B;  4POX A;  4U21 A;  1Y3Q A;  1Q35 A;  3IJO B;  3PUW E;  3S2V A;  4F1V A;  3Q27 A;  3FXR A;  4BDN A;  4U1Z A;  4MH5 A;  1OVB A;  3SKP A;  1TT1 A;  2I6E A;  3TTR A;  1DTG A;  1SI0 A;  5AA3 A;  1A7L A;  3EQ1 A;  5A5X A;  4R9G A;  3T66 A;  1R9Q A;  3U94 A;  4RYA A;  3CG3 A;  1OMP A;  1GGG A;  1QUJ A;  3K2D A;  5BUU A;  4R74 A;  1FTO A;  5FHM A;  3ONM A;  3U72 A;  3VV5 A;  1MM6 A;  4PFU A;  2XX8 A;  2ABH A;  4RK9 A;  1NL5 A;  1PB9 A;  2FNC A;  4UA8 A;  4ND9 A;  2NWJ A;  1S7Y A;  5DEX B;  3BKI B;  2DOJ A;  2DWI A;  4OFJ A;  1MG1 A;  5EHM A;  5HPQ A;  1Y1Z A;  2F78 A;  5H8H B;  3CFX A;  1B3L A;  4ZEC A;  4YAH X;  3TOD A;  3QUJ A;  3H06 B;  4DXU A;  4RXL A;  1MY3 A;  3BFT A;  3Q25 A;  2QL3 A;  5KCJ A;  3MW0 A;  2F97 A;  1IQ7 A;  3IOV A;  4I9D A;  3DM0 A;  3UK4 A;  1CE2 A;  3B7D A;  3D4C A;  4U2R A;  4U4X A;  4LZ8 A;  3HPI A;  2DWH A;  2D3I A;  4RNS A;  3CFL A;  4F19 A;  1P1W A;  2A5T B;  3H3G A;  1Y9U A;  1VFE A;  3W9V A;  4ZEK A;  1MY1 A;  4H6D A;  1JW4 A;  2I4B A;  3B6W A;  1B6H A;  3PPO A;  4X1B A;  2OBG A;  4U4S A;  4F2Q A;  3K02 A;  4H67 A;  4OFL A;  3OD7 A;  2ZYK A;  1QVS A;  3TEP A;  3GLB A;  1FTJ A;  4FAT A;  1SBP A;  3GZG A;  3CR9 A;  4KI0 E;  3ZKL A;  2Y7W A;  2FYI A;  3ZS6 A;  3KEI A;  2X7P A;  4BDL A;  3CVG A;  1L5T A;  3A09 A;  3FV2 A;  3K0V A;  3ODB A;  4ZZE A;  2I0C A;  1I69 A;  1N3X A;  4G4P A;  2B3F A;  1QUL A;  2AL5 A;  3CSG A;  2ALU A;  1WDN A;  2DVZ A;  3PD8 A;  4DDD A;  3S4U A;  1DSN A;  4NF6 B;  4EQ7 A;  4LUB A;  2REG A;  3MQ9 A;  1RYO A;  3H7M A;  2UVH A;  1J1N A;  4IO3 A;  4DCX A;  2ONK E;  1XHY A;  4QFL A;  1FW0 A;  2RKM A;  3M3F A;  5H8F A;  4NWC A;  1A55 A;  1FQC A;  1UIU A;  1AIV A;  3E13 X;  5I2N A;  2XXV A;  4THI A;  2YJP A;  3T9H B;  1Y3P A;  3JYR A;  2HAV A;  2V84 A;  2V3T A;  2F6P A;  1IUD A;  2HEU A;  3IO4 A;  4F22 A;  3Q28 A;  1MXV A;  1YAE A;  3G3J A;  4FJP A;  3VLV A;  3O28 A;  3OSR A;  2O84 X;  1B9J A;  3QK6 A;  1POY 1;  1A8F A;  4R6Y A;  1HSL A;  2YPN A;  3KGC A;  1MM7 A;  2QS2 A;  4GXS B;  3TDJ A;  4YKP A;  3L6G A;  1JW1 A;  3G7W A;  1OVT A;  3MZ1 A;  3Q26 A;  2DSF A;  3VVF A;  4QHQ A;  1B3H A;  4DZ1 A;  3HN0 A;  5FTI A;  2VD2 A;  4OEU A;  2D21 A;  3ILT B;  3C9H A;  3UA8 A;  4OYV A;  1FQD A;  1TXF A;  2H9B A;  3THI A;  1Y4C A;  3MZ9 A;  3IO6 A;  1OIB A;  4QFO A;  2DXY A;  4YZZ A;  4G77 A;  4IY5 A;  1JQF A;  2W7Y A;  4RJZ A;  1LB8 A;  3K6X A;  4AB5 A;  3O6G A;  1XVX A;  4KCD A;  1JNF A;  4QFN A;  4O3A A;  3FUZ A;  5HBC A;  2F35 A;  2I0B A;  2PT2 A;  3CG1 A;  3D4G A;  5K2X A;  5CMM A;  4N13 A;  4C1U A;  4PFW A;  1N7W A;  4R9F A;  2I49 A;  1LAX A;  4XKQ A;  1QUI A;  4Q0C A;  4X1D A;  1US5 A;  3EHT A;  1P1N A;  3LC8 A;  3QYT A;  1ANF A;  3TFL A;  1FTK A;  3MPL A;  4KFQ A;  2NOO A;  3N94 A;  1JVX A;  2ONS A;  1USY E;  1XVY A;  4FOR A;  3IB1 A;  2GH9 A;  4GVO A;  2F7B A;  3RGY A;  1B7H A;  4YMA A;  4YU0 A;  4QSD A;  3K1M A;  3TTL A;  1IXG A;  1N84 A;  4EF2 A;  3PD9 A;  1ATG A;  2P1S A;  3PUY E;  1QKA A;  1M5B A;  2HZL A;  2BJJ X;  2XD2 A;  3SEV A;  4Z7E A;  4X48 A;  5DVF A;  2PBW A;  3FXU A;  3T93 B;  4DCY A;  3MJN A;  2XXY A;  2I58 A;  1LAF E;  4JDF A;  3TTM A;  1CB6 A;  4F31 B;  2O51 A;  4U23 A;  3C31 A;  2F8D A;  4IY6 A;  3KOT A;  3VFJ A;  3TCG A;  2CZL A;  1MXX A;  1ZTY A;  5TPA B;  4AQ4 A;  5IKB A;  4QFK A;  1ZU0 A;  5CMC A;  1FQB A;  3TUS A;  2Z8E A;  3DP8 A;  3V5A A;  4H65 A;  3FJM A;  4F3G A;  3MUQ A;  3L6H A;  1UIV A;  2Q2A A;  4NF8 A;  2F7A A;  3K6W A;  2XXP A;  5B7D A;  4EQB A;  3FAT A;  4K3F A;  4NF5 A;  2GFE A;  1I6B A;  2OLB A;  2O68 A;  3RN8 A;  2F36 A;  3OO7 A;  3M3K A;  5K2Y A;  2DQV A;  2QRY A;  3FXQ A;  1MQH A;  3MAM A;  4KYD A;  4H8I A;  1MY0 A;  4OHN A;  4DE8 A;  4R2F A;  1URD A;  3MPK A;  2F5X A;  3LSX A;  4ZS9 A;  3PUZ E;  3UN6 A;  3PMV A;  4GOT A;  3IJX B;  1MH4 A;  2VHA A;  3C34 A;  1PBP A;  1B5J A;  1OQH A;  5J1D A;  3HHF A;  1EZO A;  3H4Z A;  3OO8 A;  3CRB A;  1MQG A;  4GRK A;  1XT8 A;  2RC7 A;  2V93 A;  3P7I A;  3K4U A;  2V3U A;  4ELO A;  2OWS A;  3FJG A;  5A5X B;  3SEX A;  4RK2 A;  1RKM A;  2DS9 A;  1B0L A;  4X9T A;  3RTW B;  1B51 A;  1MXU A;  3FAS A;  1Y1M A;  3DP4 A;  5AA2 A;  4YB7 A;  1O63 A;  3T9X B;  3C33 A;  3KJ7 A;  4IO6 A;  4MLV A;  1N76 A;  5AA4 A;  3V83 A;  2M8C A;  1MY2 A;  3A3C A;  1FTL A;  2XXI A;  3SEW A;  4PFT A;  3H03 A;  4G68 A;  2G29 A;  3IOU A;  1XC1 A;  4PFY A;  4ISU A;  5BWJ A;  2HFB A;  3I6V A;  2ANJ A;  1PDA A;  1IXI A;  5JK4 A;  1MPB A;  5DT6 A;  3OEL A;  4QSE A;  4Q5T A;  3MVX A;  3PPP A;  3IB2 A;  4ELR A;  2REJ A;  1O7T A;  4NF4 A;  2GHB A;  2IA4 A;  5KCJ B;  1JEU A;  1EZP A;  3H6V A;  4R75 A;  3MWB A;  4F29 A;  1GTK A;  4R6H A;  3TPA A;  4JXI A;  4FAJ A;  3A3U A;  3LUY A;  5TP9 A;  4LZ7 A;  3RNN A;  1B2H A;  2Q9T A;  1N0T A;  1FCK A;  1B52 A;  1LGB C;  3KSJ A;  3I3V A;  3CFZ A;  1US4 A;  4KPT A;  2OWT A;  1NNT A;  1PEB A;  1MXY A;  1QKB A;  4ECF A;  1QUK A;  3QIM A;  3KOS A;  3U1O A;  3F11 A;  4TLM B;  1AMF A;  4C0R A;  3PUV E;  4F1Y A;  1MDP 1;  1H3D A;  4NMY A;  2D5W A;  3EF7 A;  1WOD A;  2Y84 A;  4OET A;  2H98 A;  3RLF E;  1ZBM A;  3QXM A;  2X26 A;  3HHG A;  5JTY A;  2HQ0 A;  4XKN A;  4EDP A;  4R2B A;  4LVQ A;  4RA1 A;  1OLC A;  2Z22 A;  3MBP A;  4ZDM A;  5H8F B;  5I58 B;  3KSX A;  2OZZ A;  5I2N B;  1B0H A;  3TKD A;  1B3G A;  2XXW A;  4JBZ A;  2DWA A;  5L9S A;  2DXR A;  3CI8 A;  4H0W A;  2RCA A;  1TWY A;  2RC9 A;  5CBS A;  3OXN A;  4GQO A;  3O29 A;  4GF8 A;  3HST A;  4G68 C;  4DXB A;  4JSD A;  5AA1 A;  1ZKB A;  4I8C A;  2B3B A;  3MVY A;  4KD5 A;  3HCQ A;  4F3S A;  3G3G A;  3C32 A;  5KZT A;  3DLN A;  1II5 A;  1KWH A;  5I58 A;  2HAU A;  1MXZ A;  3VXC A;  2PMS A;  3M8U A;  4PQJ A;  3E4R A;  2F6G A;  4F18 A;  3QSL A;  3EN3 A;  1SQY A;  5KDT A;  4G2Z A;  3IL1 B;  3PU5 A;  4ZE8 A;  1UTB A;  5AE4 A;  3IB0 A;  3BBR A;  4ELP A;  5I2K A;  1B3E A;  1POT A;  3UGW A;  2VP1 A;  3GBB A;  1ZLQ A;  3KJT A;  5ELV A;  1SYI A;  2VOZ A;  5F1Q A;  2AYS A;  1IZ1 A;  2QPQ A;  3C35 A;  3SER A;  2DE2 A;  2XXR A;  4NTL A;  2F7C A;  3OSQ A;  3PGF A;  4EXL A;  4JSO A;  3KFM A;  1A8E A;  3DP6 A;  1VSO A;  5L9O A;  4OER A;  3BFU A;  1PBQ A;  1LB9 A;  4YKJ A;  2P0S A;  3N26 A;  3MP1 A;  1B4Z A;  2DE3 A;  3RUM A;  2THI A;  2ZNT A;  4WKM A;  5CRY A;  1IEJ A;  4BDR A;  1LFI A;  3DEL B;  5LOM A;  2I4C A;  3TMG A;  2PX1 A;  2G93 A;  3PPN A;  5DVI A;  2ZYN A;  1FQA A;  2Y7K A;  4POW A;  2XXU A;  3MP6 A;  4FIM A;  2VGQ A;  3VLW A;  4PE5 B;  3OO6 A;  2UVI A;  1B05 A;  1B3F A;  4M4G A;  2UVG A;  3IOR A;  2O7I A;  4FEB A;  1DPE A;  3KZG A;  4R6K A;  3S9L C;  2R9J A;  2ZNS A;  3OO9 A;  4I1D A;  1B7U A;  2OJT A;  1B5H A;  2FA7 A;  1H45 A;  1UQW A;  4HTG A;  2QJE A;  4IO5 A;  3CSB A;  4G8N A;  3S9N C;  5ITO A;  4LON B;  3AXF A;  3LSL A;  3Q29 A;  4NF8 B;  1SD3 A;  3E9X A;  5CMB A;  4KYS A;  1AH5 A;  1HSJ A;  1LFH A;  2QMW A;  3G3H A;  3O2A A;  4H5F A;  1EU8 A;  2ONR A;  3LSW A;  4NF5 B;  4MLQ A;  1I6Q A;  1R9L A;  2E0S A;  4YB6 A;  5I84 A;  3UOR A;  3OEK A;  1Z7N E;  4OES A;  1LBB A;  1GVC A;  1H43 A;  3FVO A;  1O64 A;  3VDF A;  3I5O A;  1P99 A;  3N6T A;  1VR5 A;  3TTN A;  2UVJ A;  1PC3 A;  3U8Q A;  4M1V A;  4BDM A;  4L17 A;  4E0X A;  3C36 A;  2P2A A;  4OVJ A;  3H6W A;  4O3C A;  3G3F A;  1LAH E;  4BDQ A;  3O6H A;  4LQ2 A;  1WVJ A;  1UTH A;  2V3Q A;  4GWO A;  5JEI A;  3T9V A;  3IX1 A;  3TYH A;  1DTZ A;  4IGR A;  2XHD A;  4KYE A;  3U93 A;  3PMW A;  3V8X B;  4FED A;  4ONY A;  2I3W A;  4QF9 A;  2NVU B;  5AA2 B;  4OZ9 A;  5EHS A;  3C4M A;  1SW5 A;  1URS A;  5AA4 B;  3PUX E;  4OXV A;  1MQI A;  2QMX A;  5ICQ A;  3TCF A;  3O9P A;  1LCF A;  4O3B A;  3KN7 A;  4G68 B;  4IB2 A;  1BKA A;  4HW8 A;  4ZEB A;  5CM6 A;  4ESX A;  5ISU A;  4JWX A;  1FQF A;  5I56 A;  3G3K A;  2VD3 A;  5L9M A;  4QSC A;  5CC2 A;  1B40 A;  4NWD A;  1YCJ A;  1S50 A;  4NF4 B;  4R73 A;  1SW2 A;  2Y7P A;  2H25 A;  3LSF B;  4LAT A;  2O7U A;  2NXO A;  3K1P A;  3KN8 A;  4HCW A;  1BLF A;  4R72 A;  4QRZ A;  3R7X A;  1R6Z A;  3TTK A;  2H5Y A;  2ZYM A;  5TP9 B;  3T9U A;  1SDX A;  1RYX A;  2DE4 A;  4P0I A;  5F7V A;  4JWY A;  4GIZ A;  1H44 A;  1LST A;  3OMB A;  1B46 A;  1MDQ A;  2GHA A;  3S9M C;  3MZB A;  1B1H A;  4GL8 A;  2RIN A;  4WEP A;  4E0W A;  3O6I A;  3PV0 E;  4TOZ A;  1MQD A;  5DYH A;  4JWO A;  4GLI A;  5I59 A;  4TLL B;  2E1S A;  4IO2 A;  4C1T A;  5DVJ A;  3GXA A;  1NNP A;  4OFO A;  1IXH A;  2DP8 A;  1B4H A;  5H8N A;  3O66 A;  3IOT A;  5CBR A;  3V89 B;  3VVD A;  1IIW A;  5IAI A;  4KCC A;  2Q2C A;  4OEN A;  3PPR A;  1M5E A;  3IAZ A;  1BP5 A;  2RC8 A;  3EPE A;  2RCB A;  3TCH A;  4XIG Q;  5JTY B;  3W15 C;  1Y20 A;  1MPD A;  4DIG A;  2XXQ A;  3W9W A;  3S9E A;  5H8Q A;  1P1Q A;  4LQ5 A;  1MS7 A;  3ECR A;  1QW0 A;  4DXC A;  3OEN A;  3FGS A;  5FTH A;  3TEL A;  1H76 A;  1Y4T A;  5FHN A;  3R26 A;  1SYH A;  1IIT A;  1LFG A;  4LP2 B;  3N6U A;  4OQO A;  3B6T A;  3FJ7 A;  1T0K A;  1AL3 A;  1DPP A;  4YMB A;  2KLF A;  1URG A;  3SDF A;  1MXW A;  1NKX A;  4RPN A;  3EHS A;  3MVW A;  2Q89 A;  2Y7I A;  2PVU A;  2X7Q A;  5DEX A;  4ZEI A;  3FVG A;  5ITP A;  5EYF A;  3UP9 A;  4DLD A;  1N3W A;  3VVE A;  5CI5 A;  3ZKK A;  1NNF A;  4YKI A;  5H8H A;  4ZZA A;  1Z7M E;  3QUF A;  2HZK A;  1NH7 A;  4GD5 A;  1PB7 A;  5KDT B;  4AB6 A;  4GFR A;  1UTB B;  4U22 A;  2XXH A;  4EQ9 A;  5M2V A;  3EHU A;  4EXK A;  4F3B A;  4EF1 A;  4YB5 A;  1TFD A;  1ZMG A;  4PP0 A;  5I2K B;  5L8D A;  3B6Q A;  1I6A A;  3TQW A;  2NUV A;  3RY3 A;  2QSX A;  3TZA A;  4PET A;  2Q88 A;  1M5D A;  1JW5 A;  1NMU A;  3FD3 A;  2O1M A;  2A5T A;  1B5I A;  3PMX A;  5FHO A;  3SEY A;  1B7Z A;  3HO7 A;  2UYF A;  1NNK A;  1F9B A;  4BDO A;  3FIR A;  4IO7 A;  1JVY A;  5B70 A;  3OOA A;  5TU0 A;  1B58 A;  2QS1 A;  3K01 A;  3CIJ A;  1BTJ A;  3UIF A;  1MH3 A;  1P1U A;  1AOV A;  4QFP A;  3K6V A;  4OTE A;  3JV9 A;  2H99 A;  3K1N A;  1PB8 A;  4H8J A;  4LZ5 A;  4N6P A;  2XX7 A;  4RPO A;  4Z0I A;  1A99 A;  1LAG E;  2DYX A;  5HM4 B;  2R6G E;  3KN3 A;  2R71 A;  1LLS A;  1N04 A;  1D3K A;  1TFA A;  3WAE A;  4NF6 A;  2CMO A;  1NH8 A;  4KQP A;  3TAJ A;  4F3P A;  2V25 A;  2O69 A;  4OMB A;  3T96 B;  1HSE A;  1YPN A;  1DOT A;  4H5G A;  4HCY A;  4U1O A;  3VE1 B;  3ZSF A;  1OQG A;  3MVZ A;  3FVK A;  1NFT A;  1GR2 A;  3LR1 A;  4FEC A;  1SW4 A;  2H4I A;  3M3L A;  1EH3 A;  4OWD A;  3K00 A;  5ICT A;  3RQT A;  2ESN A;  4MFI A;  1USY H;  3TQL A;  3FV1 A;  3JZJ A;  4P0G A;  1A54 A;  2UYE A;  4ZED A;  1LBC A;  1SVX B;  3RT8 A;  2O1L A;  1DMB A;  2I48 A;  2Q8J A;  2GRV A;  1JEV A;  1BIY A;  2I3V A; 
#chains in the Genus database with same CATH topology
 2O6A A;  1JET A;  4PGP A;  2DVC A;  4XKR A;  3SZP A;  5I57 B;  1VE4 A;  1ELJ A;  2ZXT A;  2OK2 A;  1XOC A;  1S9T A;  4NED A;  4OEV A;  1YTV A;  4IGT A;  2WKY A;  3T22 A;  3RTF B;  1SW1 A;  1FQE A;  2QS4 A;  3ILU B;  1IXC A;  4F1U A;  1UTH B;  3IR1 A;  4XXU A;  3N5L A;  2Z23 A;  1D9V A;  1GV8 A;  2LAO A;  3R6U A;  4P11 A;  4G8M A;  2F34 A;  4BLA A;  2DWJ A;  1P1O A;  3SES A;  4N07 A;  1B32 A;  3FVN A;  1LCT A;  4ZEF A;  3OEM A;  2HXW A;  1FBD A;  2ZMB A;  4MIJ A;  1D4N A;  1R1N A;  3G3I A;  2ZYO A;  5I57 A;  4Q8R A;  2Y7R A;  4LN5 A;  3LBS A;  1OLA A;  4H1X A;  1MY4 A;  4RY1 A;  2HCA A;  4F39 A;  5H8S A;  2B65 A;  4Q30 B;  4JB7 A;  5I56 B;  1FTM A;  2ZZX A;  4GXA A;  1NV7 A;  4G8H A;  2AL4 A;  1D9Y A;  4KHZ E;  3KBR A;  4F2O A;  4XKP A;  2Q8M A;  3LUZ A;  3SEU A;  3MYU A;  1Q1K A;  5AA2 D;  4I62 A;  2XD3 A;  5DTB A;  3K6U A;  4PDH A;  4EUO A;  3KG2 A;  4TQU Q;  4GWZ A;  3PTY A;  3SET A;  2PT1 A;  2UXA A;  3PPQ A;  4OVT A;  1Y3N A;  3MP8 A;  2XXT A;  4FE8 A;  3VLU A;  2A5S A;  3GBA A;  2Y5L A;  2XXX A;  3HFU A;  4XTC Q;  4HS7 A;  3USD A;  4MF3 A;  1ZJL A;  3HV1 A;  1XI6 A;  4NGU A;  4MBP A;  3H6T A;  3E3K A;  5CMK A;  4WED A;  4YKK A;  4PGN A;  3FZV A;  5TPA A;  3O97 A;  4YIC A;  4LA9 A;  4IO4 A;  3ROJ A;  3LV0 A;  1B1X A;  1XS5 A;  2Z8F A;  4WXJ A;  4ESW A;  1N7X A;  4OAN A;  4NE4 A;  3H6U A;  1INP A;  1A40 A;  3KBZ A;  3RPW A;  1DCU A;  1MQJ A;  2AIX A;  1SI1 A;  5I59 B;  1MPC A;  2ZNU A;  2QS3 A;  4KR5 A;  4UAC A;  2YLN A;  4GL0 A;  3U92 A;  2XXK A;  1ZIU A;  5H8N B;  4P3L A;  4ELQ A;  4GX3 A;  2PYY A;  1K9Z A;  3IK6 B;  3VXB A;  1EZ9 A;  1MRP A;  3IOW A;  1M5C A;  2PCR A;  2XX9 A;  2RF1 A;  1VFD A;  1QJM A;  1EYJ A;  3QAX A;  1M5F A;  4DI4 B;  2OCU A;  4ZE9 A;  2IEE A;  2Z8D A;  3MC2 A;  3WAF A;  5H8Q B;  3RT6 B;  4POX A;  4U21 A;  1Y3Q A;  1Q35 A;  3IJO B;  3PUW E;  3S2V A;  4F1V A;  3Q27 A;  3FXR A;  4P56 A;  4BDN A;  4U1Z A;  4MH5 A;  1OVB A;  3SKP A;  3E78 A;  1TT1 A;  2I6E A;  3TTR A;  1DTG A;  1SI0 A;  5AA3 A;  1A7L A;  3EQ1 A;  4FBP A;  5A5X A;  5I5P A;  4R9G A;  3T66 A;  1R9Q A;  1YXI A;  3U94 A;  4RYA A;  3RPL A;  2ZZV A;  3CG3 A;  1OMP A;  5I7I A;  1G0I A;  1GGG A;  1KA0 A;  1QUJ A;  4PBQ A;  3K2D A;  5BUU A;  4R74 A;  1FTO A;  1LBX A;  5FHM A;  3ONM A;  3U72 A;  2R8T A;  3VV5 A;  1MM6 A;  4PFU A;  2XX8 A;  2ABH A;  4RK9 A;  5ESY A;  1NL5 A;  1PB9 A;  2FNC A;  4UA8 A;  3IFC A;  4ND9 A;  4GWY A;  5IZ3 B;  2NWJ A;  1S7Y A;  5DEX B;  3BKI B;  2DOJ A;  2DWI A;  4OFJ A;  1DK4 A;  1MG1 A;  5EHM A;  5HPQ A;  1Y1Z A;  2F78 A;  4MJO A;  1FJ6 A;  5H8H B;  3CFX A;  1B3L A;  4ZEC A;  4YAH X;  3TOD A;  3QUJ A;  3H06 B;  1RDZ A;  4DXU A;  4RXL A;  1MY3 A;  3BFT A;  3Q25 A;  4GWU A;  2QL3 A;  1NUW A;  2CZI A;  5KCJ A;  3MW0 A;  2F97 A;  1IQ7 A;  3IOV A;  4I9D A;  3DM0 A;  3UK4 A;  1CE2 A;  3B7D A;  3D4C A;  4U2R A;  4U4X A;  4LZ8 A;  5ET5 A;  3HPI A;  2DWH A;  4N6D A;  2D3I A;  4RNS A;  3CFL A;  4F19 A;  1FTA A;  1P1W A;  2A5T B;  5LTC A;  3H3G A;  1Y9U A;  1VFE A;  3W9V A;  4ZEK A;  1MY1 A;  4H6D A;  1JW4 A;  1JP4 A;  2I4B A;  3B6W A;  4MNP A;  1B6H A;  3PPO A;  4X1B A;  4PAK A;  2OBG A;  4U4S A;  4PAI A;  4F2Q A;  3K02 A;  4H67 A;  4OFL A;  3OD7 A;  4O7I A;  2ZYK A;  1QVS A;  4PDD A;  3TEP A;  1LBW A;  3GLB A;  4PFI A;  1FTJ A;  4FAT A;  1SBP A;  4N91 A;  1FBH A;  3GZG A;  3CR9 A;  4KI0 E;  3ZKL A;  2Y7W A;  2FYI A;  5F24 A;  3ZS6 A;  3KEI A;  2X7P A;  3NOH A;  4BDL A;  3CVG A;  1L5T A;  3A09 A;  3FV2 A;  3K0V A;  3ODB A;  4ZZE A;  2I0C A;  1I69 A;  1N3X A;  4G4P A;  2B3F A;  1QUL A;  2AL5 A;  3CSG A;  2ALU A;  1WDN A;  1YZ0 A;  2DVZ A;  3PD8 A;  4DDD A;  3S4U A;  1DSN A;  4NF6 B;  4LUB A;  4EQ7 A;  2REG A;  3MQ9 A;  1RYO A;  3H7M A;  2UVH A;  1J1N A;  4IO3 A;  4DCX A;  2ONK E;  1XHY A;  4QFL A;  1FW0 A;  2RKM A;  3M3F A;  5H8F A;  4NWC A;  1A55 A;  1FQC A;  1UIU A;  1AIV A;  3E13 X;  1NV6 A;  5I2N A;  5FBP A;  2XXV A;  4THI A;  2YJP A;  3T9H B;  1Y3P A;  5IM2 A;  5EYG A;  3JYR A;  2HAV A;  2V84 A;  2V3T A;  2F6P A;  1IUD A;  2HEU A;  3IO4 A;  4F22 A;  1LBV A;  3Q28 A;  1MXV A;  1YAE A;  3G3J A;  4FJP A;  3VLV A;  3O28 A;  3OSR A;  4NX1 A;  2O84 X;  1B9J A;  3QK6 A;  1POY 1;  1A8F A;  4R6Y A;  1HSL A;  1QGX A;  2YPN A;  3KGC A;  1MM7 A;  2QS2 A;  4GXS B;  3TDJ A;  1NV2 A;  4YKP A;  3L6G A;  1JW1 A;  3G7W A;  1OVT A;  3MZ1 A;  3Q26 A;  2DSF A;  3VVF A;  2ZZW A;  4QHQ A;  1B3H A;  4DZ1 A;  3HN0 A;  5FTI A;  2VD2 A;  4OEU A;  2D21 A;  3ILT B;  3C9H A;  3UA8 A;  4OYV A;  1FQD A;  1TXF A;  2H9B A;  3THI A;  1Y4C A;  3MZ9 A;  4PTK A;  3IO6 A;  4P1E A;  1OIB A;  4QFO A;  2DXY A;  4YZZ A;  4G77 A;  4IY5 A;  1JQF A;  2W7Y A;  4RJZ A;  1LB8 A;  3K6X A;  4AB5 A;  3O6G A;  1FPE A;  1XVX A;  4H46 A;  4KCD A;  4P47 A;  1JNF A;  4QFN A;  4O3A A;  3U65 A;  3FUZ A;  5HBC A;  2F35 A;  2I0B A;  1FPB A;  2PT2 A;  3CG1 A;  3D4G A;  4MAG A;  5T3J A;  5K2X A;  5CMM A;  2WYK A;  4N13 A;  4C1U A;  4NHB A;  4PFW A;  1N7W A;  4R9F A;  2I49 A;  1LAX A;  4XKQ A;  1QUI A;  4Q0C A;  4HE0 A;  4X1D A;  1US5 A;  3EHT A;  1KZ8 A;  3ISP A;  1P1N A;  3LC8 A;  3QYT A;  4PAF A;  1ANF A;  3TFL A;  1FTK A;  3MPL A;  4KFQ A;  2NOO A;  3N94 A;  1JVX A;  2ONS A;  1USY E;  1XVY A;  4FOR A;  4O94 A;  3IB1 A;  2GH9 A;  4GVO A;  2F7B A;  3RGY A;  1B7H A;  4YMA A;  3FXB A;  4YU0 A;  4QSD A;  3K1M A;  3TTL A;  1IXG A;  1N84 A;  4EF2 A;  3PD9 A;  1ATG A;  2P1S A;  3PUY E;  1QKA A;  1M5B A;  2HZL A;  2BJJ X;  2XD2 A;  2WBB A;  3SEV A;  4Z7E A;  4X48 A;  5DVF A;  2PBW A;  3FXU A;  3T93 B;  4DCY A;  3MJN A;  2XXY A;  1IME A;  2I58 A;  1LAF E;  4JDF A;  3TTM A;  1CB6 A;  1FPG A;  4F31 B;  2O51 A;  2KR0 A;  2WYP A;  4U23 A;  3C31 A;  2F8D A;  4IY6 A;  2FBP A;  3KOT A;  3VFJ A;  3TCG A;  2CZL A;  1MXX A;  2QVR A;  1ZTY A;  5TPA B;  4AQ4 A;  5IKB A;  4QFK A;  1ZU0 A;  5CMC A;  1FQB A;  3EKI A;  3TUS A;  2Z8E A;  3DP8 A;  3V5A A;  4H65 A;  3FJM A;  2P3N A;  4XEQ A;  4F3G A;  3MUQ A;  3L6H A;  4GX4 A;  4N15 A;  1UIV A;  1RDY A;  2Q2A A;  4NF8 A;  4DI3 D;  2DDK A;  2F7A A;  3K6W A;  2XXP A;  5B7D A;  4EQB A;  2L5V A;  3FAT A;  4K3F A;  4NF5 A;  2GFE A;  2QVV A;  1I6B A;  2OLB A;  4H45 A;  2O68 A;  4JVI A;  3RN8 A;  3T1B A;  2F36 A;  3OO7 A;  3M3K A;  5K2Y A;  2DQV A;  2QRY A;  3FXQ A;  1MQH A;  3MAM A;  4KYD A;  4H8I A;  1MY0 A;  4OHN A;  4DE8 A;  4R2F A;  1URD A;  3MPK A;  4N81 A;  2F5X A;  3LSX A;  4ZS9 A;  3PUZ E;  3UN6 A;  3PMV A;  4GOT A;  3IJX B;  1MH4 A;  2B4M A;  2VHA A;  3C34 A;  3KC0 A;  1PBP A;  1B5J A;  1OQH A;  4MNI A;  5J1D A;  3HHF A;  1FBE A;  1EZO A;  3H4Z A;  3OO8 A;  3CRB A;  1MQG A;  4GRK A;  1XT8 A;  2RC7 A;  2V93 A;  1FBG A;  3P7I A;  3K4U A;  3BIG A;  2V3U A;  2HPG A;  4PF8 A;  1FPK A;  4ELO A;  2OWS A;  3FJG A;  5A5X B;  3SEX A;  4RK2 A;  1RKM A;  2DS9 A;  2P3V A;  3RPL B;  1B0L A;  4X9T A;  3RTW B;  1B51 A;  1MXU A;  3FAS A;  4P8B A;  1Y1M A;  3DP4 A;  5AA2 A;  4YB7 A;  4I3Y A;  1O63 A;  3T9X B;  3C33 A;  3KJ7 A;  4IO6 A;  4MLV A;  1N76 A;  5AA4 A;  3V83 A;  4GWS A;  2M8C A;  1MY2 A;  3A3C A;  1FTL A;  2XXI A;  3SEW A;  4PFT A;  3H03 A;  4G68 A;  2G29 A;  3IOU A;  1XC1 A;  4I40 A;  4PFY A;  4ISU A;  5BWJ A;  2HFB A;  3I6V A;  2ANJ A;  1PDA A;  1IXI A;  5JK4 A;  1MPB A;  3E79 A;  5DT6 A;  3IFA A;  3OEL A;  4QSE A;  4Q5T A;  3MVX A;  5A5L A;  3PPP A;  3IB2 A;  4ELR A;  2REJ A;  1O7T A;  4NF4 A;  2GHB A;  2IA4 A;  5KCJ B;  1JEU A;  1EZP A;  3H6V A;  4R75 A;  3MWB A;  4F29 A;  1GTK A;  4R6H A;  1D9Q A;  3TPA A;  4JXI A;  4FAJ A;  3A3U A;  3LUY A;  1FBP A;  4P9K A;  5EQ9 A;  5TP9 A;  4LZ7 A;  3RYD A;  3RNN A;  1B2H A;  2Q9T A;  1N0T A;  1FCK A;  1B52 A;  2KQZ A;  1LGB C;  3KSJ A;  3I3V A;  2FIE A;  3CFZ A;  1Q9D A;  1IMC A;  1US4 A;  4KPT A;  2OWT A;  4O7M A;  1NNT A;  1PEB A;  1MXY A;  1QKB A;  4ECF A;  1QUK A;  3QIM A;  3KOS A;  2XWI A;  1KA1 A;  3U1O A;  3F11 A;  4N6K A;  4TLM B;  1AMF A;  4C0R A;  3PUV E;  4F1Y A;  1MDP 1;  1H3D A;  4NMY A;  4XFE A;  2D5W A;  3EF7 A;  1BK4 A;  1WOD A;  2Y84 A;  4OET A;  1NUY A;  2H98 A;  2QVU A;  3RLF E;  1ZBM A;  3QXM A;  2JJK A;  2X26 A;  3HHG A;  5JTY A;  2HQ0 A;  4XKN A;  4EDP A;  4R2B A;  4LVQ A;  2OX3 A;  4RA1 A;  1OLC A;  3T0J A;  2Z22 A;  3MBP A;  1NI9 A;  4ZDM A;  5H8F B;  5I58 B;  3KSX A;  2OZZ A;  5I2N B;  1B0H A;  3TKD A;  1B3G A;  2XXW A;  4JBZ A;  1NV0 A;  2DWA A;  5L9S A;  2DXR A;  3CI8 A;  4H0W A;  2RCA A;  1TWY A;  2RC9 A;  5CBS A;  3OXN A;  3B50 A;  1LBZ A;  1YYZ A;  4GQO A;  3O29 A;  4GF8 A;  3HST A;  4G68 C;  4DXB A;  4JSD A;  5AA1 A;  1ZKB A;  4I8C A;  2B3B A;  3MVY A;  4KD5 A;  3HCQ A;  1VDW A;  4F3S A;  5LDZ A;  3G3G A;  4XF5 A;  3C32 A;  5KZT A;  3DLN A;  1II5 A;  1KWH A;  5I58 A;  4GWX A;  1IMB A;  1FPL A;  2HAU A;  1MXZ A;  3VXC A;  2PMS A;  3M8U A;  4PQJ A;  4N8Y A;  3E4R A;  2WBD A;  5ET8 A;  2F6G A;  4F18 A;  1FBF A;  5IZ1 A;  4PFB A;  3QSL A;  3EN3 A;  1SQY A;  5KDT A;  4G2Z A;  4AS5 A;  3IL1 B;  3PU5 A;  4ZE8 A;  1UTB A;  5AE4 A;  3IB0 A;  3BBR A;  4ELP A;  5I2K A;  1B3E A;  1POT A;  1IMA A;  4MMP A;  3UGW A;  2VP1 A;  3KC1 A;  4UAB A;  3GBB A;  1FRP A;  1ZLQ A;  3KJT A;  5ELV A;  1SYI A;  2VOZ A;  2XA5 A;  5F1Q A;  2AYS A;  1IZ1 A;  2QPQ A;  3C35 A;  3SER A;  2DE2 A;  2XXR A;  5EQ8 A;  4NTL A;  2F7C A;  3OSQ A;  3QMF A;  3PGF A;  4EXL A;  4JSO A;  3KFM A;  1A8E A;  3DP6 A;  1VSO A;  5L9O A;  4OER A;  3BFU A;  5IGA A;  1PBQ A;  1LB9 A;  4YKJ A;  2P0S A;  3N26 A;  5EQ7 A;  3MP1 A;  1B4Z A;  2DE3 A;  3B8B A;  3RUM A;  4MX6 A;  2THI A;  2ZNT A;  4WKM A;  5CRY A;  1IEJ A;  2VPN A;  4BDR A;  1LFI A;  3DEL B;  5LOM A;  2I4C A;  3TMG A;  4HXV A;  4PBH A;  2PX1 A;  2G93 A;  3PPN A;  5DVI A;  2ZYN A;  1FQA A;  2Y7K A;  4POW A;  2XXU A;  3MP6 A;  4FIM A;  2VGQ A;  1FPF A;  3VLW A;  4PE5 B;  3OO6 A;  2UVI A;  1B05 A;  4GX6 A;  1B3F A;  4MEV A;  4M4G A;  2UVG A;  3IOR A;  2O7I A;  4FEB A;  1DPE A;  3KZG A;  4R6K A;  3S9L C;  2R9J A;  2ZNS A;  3OO9 A;  2V4C A;  4I1D A;  1B7U A;  2OJT A;  1B5H A;  4PCD A;  2FA7 A;  1H45 A;  1RDX A;  1UQW A;  4HTG A;  4JVD A;  2QJE A;  4IO5 A;  3CSB A;  4G8N A;  3S9N C;  5ITO A;  1IMF A;  4LON B;  3AXF A;  4NG7 A;  3LSL A;  3Q29 A;  4NF8 B;  1SD3 A;  2Q74 A;  3E9X A;  5CMB A;  4KYS A;  1AH5 A;  1HSJ A;  1LFH A;  2QMW A;  3G3H A;  3O2A A;  4H5F A;  1EU8 A;  4GBW A;  2ONR A;  3LSW A;  2FIX A;  4NF5 B;  4MLQ A;  1I6Q A;  1R9L A;  2E0S A;  4YB6 A;  5I84 A;  3UOR A;  3OEK A;  1Z7N E;  4OES A;  1LBB A;  1GVC A;  1H43 A;  4PC9 A;  3FVO A;  1O64 A;  2VT5 A;  3VDF A;  3I5O A;  1P99 A;  3N6T A;  1VR5 A;  3TTN A;  2UVJ A;  2CZK A;  1PC3 A;  3U8Q A;  4M1V A;  4P1L A;  4BDM A;  4L17 A;  4E0X A;  3C36 A;  2P2A A;  4OVQ A;  4OVJ A;  3H6W A;  4GBV A;  4O3C A;  4NF0 A;  3G3F A;  1LAH E;  4BDQ A;  3O6H A;  4LQ2 A;  1WVJ A;  1UTH A;  2V3Q A;  5J16 A;  4GWO A;  3MST A;  5JEI A;  3T9V A;  3IX1 A;  2CEY A;  3TYH A;  1DTZ A;  4IGR A;  2XHD A;  4KYE A;  3U93 A;  2PFY A;  3PMW A;  3V8X B;  4O8M A;  4IR8 A;  4FED A;  4ONY A;  2I3W A;  4QF9 A;  3FBP A;  2NVU B;  5AA2 B;  4MNC A;  4OZ9 A;  5EHS A;  4N4U A;  3C4M A;  1SW5 A;  1URS A;  4MHF A;  5AA4 B;  5EQA A;  3PUX E;  4OXV A;  1MQI A;  2QMX A;  5ICQ A;  3TCF A;  3BIH A;  4GWW A;  3O9P A;  1LCF A;  4O3B A;  3KN7 A;  4G68 B;  4IB2 A;  1BKA A;  4HW8 A;  4ZEB A;  5CM6 A;  4ESX A;  5ISU A;  4JWX A;  1FQF A;  5I56 A;  5DW8 A;  5ET6 A;  3G3K A;  2VD3 A;  5L9M A;  1AWB A;  4QSC A;  5CC2 A;  1B40 A;  4OVP A;  4AS4 A;  4NWD A;  1YCJ A;  1S50 A;  4NF4 B;  4R73 A;  1SW2 A;  2Y7P A;  4X04 A;  1FPD A;  2H25 A;  3LSF B;  4LAT A;  2O7U A;  2NXO A;  3K1P A;  3KN8 A;  1FJ9 A;  4HCW A;  1BLF A;  1NV1 A;  4R72 A;  4QRZ A;  3R7X A;  1R6Z A;  3GYY A;  3TTK A;  2H5Y A;  2ZYM A;  5TP9 B;  3T9U A;  1SDX A;  1RYX A;  2DE4 A;  4P0I A;  5F7V A;  4JWY A;  1FPJ A;  4GIZ A;  1H44 A;  1LST A;  3OMB A;  2WX9 A;  2F3B A;  1B46 A;  1MDQ A;  2GHA A;  3S9M C;  3MZB A;  1B1H A;  4GL8 A;  2RIN A;  4WEP A;  1EYI A;  4E0W A;  3O6I A;  3PV0 E;  4TOZ A;  1MQD A;  5DYH A;  4OVS A;  4JWO A;  4GLI A;  4N8G A;  5I59 A;  2XWO A;  2E1S A;  4TLL B;  4IO2 A;  4C1T A;  5DVJ A;  2PFZ A;  3GXA A;  1NNP A;  4OFO A;  1IXH A;  2DP8 A;  1B4H A;  5H8N A;  3O66 A;  3IOT A;  5CBR A;  3V89 B;  3VVD A;  2QFL A;  1IIW A;  5IAI A;  4KCC A;  4HE2 A;  2Q2C A;  4OEN A;  1NV3 A;  3PPR A;  1M5E A;  2CZH A;  3IAZ A;  1BP5 A;  1FSA A;  2RC8 A;  3EPE A;  2RCB A;  3TCH A;  4XIG Q;  5JTY B;  3W15 C;  1Y20 A;  2OWZ A;  5EYH A;  1FPI A;  1MPD A;  4PE3 A;  2XWV A;  4DIG A;  2XXQ A;  3W9W A;  3S9E A;  5H8Q A;  1P1Q A;  4LQ5 A;  1MS7 A;  3ECR A;  1QW0 A;  4DXC A;  3OEN A;  3FGS A;  4JVC A;  5FTH A;  3TEL A;  1H76 A;  1Y4T A;  5FHN A;  4NN3 A;  3R26 A;  2CEX A;  1SYH A;  1IIT A;  1LFG A;  4LP2 B;  4QBA A;  3N6U A;  4OQO A;  3B6T A;  3FJ7 A;  1T0K A;  1AL3 A;  2HXR A;  1DPP A;  4YMB A;  2KLF A;  1NV4 A;  1URG A;  3SDF A;  1NUX A;  1MXW A;  1NKX A;  4I3E A;  4RPN A;  3EHS A;  3MVW A;  2Q89 A;  2Y7I A;  5IZ3 A;  2PVU A;  2X7Q A;  5DEX A;  4ZEI A;  3FVG A;  5ITP A;  5EYF A;  3UP9 A;  4DLD A;  1LBY A;  1N3W A;  3VVE A;  5CI5 A;  3ZKK A;  1NNF A;  4YKI A;  5H8H A;  4ZZA A;  1Z7M E;  1DBZ A;  3QUF A;  2WEF A;  4NQ8 A;  3A29 A;  4NAP A;  2HZK A;  2MKZ A;  2BJI A;  1NH7 A;  5I3S A;  4GD5 A;  4HE1 A;  1PB7 A;  5KDT B;  4AB6 A;  4GFR A;  1UTB B;  4U22 A;  2XXH A;  4EQ9 A;  5M2V A;  3EHU A;  4EXK A;  4F3B A;  1CNQ A;  4EF1 A;  4YB5 A;  1TFD A;  1ZMG A;  4PP0 A;  5I2K B;  5L8D A;  5IZZ A;  3B6Q A;  1I6A A;  3TQW A;  2NUV A;  3RY3 A;  2QSX A;  3TZA A;  4PET A;  2Q88 A;  1M5D A;  1JW5 A;  1NMU A;  2GQ1 A;  3FD3 A;  2O1M A;  2A5T A;  1B5I A;  3PMX A;  5FHO A;  3SEY A;  1B7Z A;  2FVZ A;  3HO7 A;  2UYF A;  1NNK A;  1F9B A;  4BDO A;  3FIR A;  4IO7 A;  1JVY A;  5B70 A;  3OOA A;  5TU0 A;  1B58 A;  2QS1 A;  3K01 A;  1EYK A;  2F3D A;  3CIJ A;  1BTJ A;  3UIF A;  1MH3 A;  1P1U A;  1AOV A;  4QFP A;  3K6V A;  4MCO A;  4OA4 A;  4OTE A;  1NV5 A;  3JV9 A;  2H99 A;  3K1N A;  1PB8 A;  4H8J A;  4LZ5 A;  4N6P A;  2XX7 A;  4RPO A;  4X8R A;  4Z0I A;  1A99 A;  1LAG E;  2DYX A;  5HM4 B;  1FBC A;  1K9Y A;  2R6G E;  3KN3 A;  2R71 A;  1LLS A;  2B4L A;  1N04 A;  1D3K A;  2XWK A;  1SPI A;  1TFA A;  4G61 A;  3WAE A;  1NUZ A;  4NF6 A;  2CMO A;  1NH8 A;  4KQP A;  3TAJ A;  4F3P A;  2V25 A;  2O69 A;  4PFR A;  4OMB A;  3T96 B;  1HSE A;  1YPN A;  1DOT A;  4H5G A;  4HCY A;  4U1O A;  3VE1 B;  3ZSF A;  1OQG A;  3D1R A;  3MVZ A;  4OVR A;  3FVK A;  1NFT A;  2FHY A;  1GR2 A;  3LR1 A;  5ET7 A;  4FEC A;  1IMD A;  1SW4 A;  4QXD A;  2H4I A;  3M3L A;  1EH3 A;  2VPO A;  4OWD A;  3K00 A;  4N17 A;  4PF6 A;  5ICT A;  3RQT A;  4KXP A;  2ESN A;  3CHG A;  4MFI A;  1USY H;  3TQL A;  2HHM A;  3FV1 A;  3JZJ A;  4P0G A;  1A54 A;  2UYE A;  4ZED A;  1LBC A;  1SVX B;  3RT8 A;  2O1L A;  1DMB A;  1G0H A;  2I48 A;  2Q8J A;  2GRV A;  1JEV A;  1BIY A;  1LEV A;  2Y5K A;  2I3V A; 
#chains in the Genus database with same CATH homology
 2O6A A;  1JET A;  2DVC A;  4XKR A;  5I57 B;  1VE4 A;  1ELJ A;  2ZXT A;  2OK2 A;  1XOC A;  1S9T A;  4NED A;  4OEV A;  1YTV A;  4IGT A;  2WKY A;  3T22 A;  3RTF B;  1SW1 A;  1FQE A;  2QS4 A;  3ILU B;  1IXC A;  4F1U A;  1UTH B;  3IR1 A;  4XXU A;  3N5L A;  2Z23 A;  1D9V A;  1GV8 A;  2LAO A;  3R6U A;  4P11 A;  4G8M A;  2F34 A;  4BLA A;  2DWJ A;  1P1O A;  3SES A;  4N07 A;  1B32 A;  3FVN A;  1LCT A;  4ZEF A;  3OEM A;  2HXW A;  2ZMB A;  1D4N A;  1R1N A;  3G3I A;  2ZYO A;  5I57 A;  4Q8R A;  2Y7R A;  3LBS A;  1OLA A;  4H1X A;  1MY4 A;  4RY1 A;  2HCA A;  4F39 A;  5H8S A;  2B65 A;  4Q30 B;  4JB7 A;  5I56 B;  1FTM A;  4GXA A;  4G8H A;  2AL4 A;  1D9Y A;  4KHZ E;  3KBR A;  4F2O A;  4XKP A;  3SEU A;  1Q1K A;  5AA2 D;  4I62 A;  2XD3 A;  5DTB A;  3K6U A;  4EUO A;  3KG2 A;  4TQU Q;  3SET A;  2PT1 A;  2UXA A;  3PPQ A;  1Y3N A;  3MP8 A;  2XXT A;  4FE8 A;  3VLU A;  2A5S A;  3GBA A;  2XXX A;  4XTC Q;  4HS7 A;  3USD A;  4MF3 A;  1ZJL A;  3HV1 A;  4MBP A;  3H6T A;  3E3K A;  5CMK A;  4WED A;  4YKK A;  3FZV A;  5TPA A;  3O97 A;  4YIC A;  4LA9 A;  4IO4 A;  1B1X A;  1XS5 A;  2Z8F A;  4WXJ A;  4ESW A;  1N7X A;  4NE4 A;  3H6U A;  3RPW A;  1A40 A;  1MQJ A;  2AIX A;  1SI1 A;  5I59 B;  1MPC A;  2ZNU A;  2QS3 A;  4KR5 A;  4UAC A;  2YLN A;  4GL0 A;  3U92 A;  1ZIU A;  5H8N B;  4ELQ A;  2PYY A;  3IK6 B;  3VXB A;  1EZ9 A;  1MRP A;  3IOW A;  1M5C A;  2XX9 A;  2RF1 A;  1VFD A;  1QJM A;  3QAX A;  1M5F A;  2OCU A;  4ZE9 A;  2IEE A;  2Z8D A;  3MC2 A;  3WAF A;  5H8Q B;  3RT6 B;  4POX A;  4U21 A;  1Y3Q A;  1Q35 A;  3IJO B;  3PUW E;  3S2V A;  4F1V A;  3Q27 A;  3FXR A;  4BDN A;  4U1Z A;  4MH5 A;  1OVB A;  3SKP A;  1TT1 A;  2I6E A;  3TTR A;  1DTG A;  1SI0 A;  5AA3 A;  1A7L A;  3EQ1 A;  5A5X A;  4R9G A;  3T66 A;  1R9Q A;  3U94 A;  4RYA A;  3CG3 A;  1OMP A;  1GGG A;  1QUJ A;  3K2D A;  5BUU A;  4R74 A;  1FTO A;  5FHM A;  3ONM A;  3U72 A;  3VV5 A;  1MM6 A;  4PFU A;  2XX8 A;  2ABH A;  4RK9 A;  1NL5 A;  1PB9 A;  2FNC A;  4UA8 A;  4ND9 A;  2NWJ A;  1S7Y A;  5DEX B;  3BKI B;  2DOJ A;  2DWI A;  4OFJ A;  1MG1 A;  5EHM A;  5HPQ A;  1Y1Z A;  2F78 A;  5H8H B;  3CFX A;  1B3L A;  4ZEC A;  4YAH X;  3TOD A;  3QUJ A;  3H06 B;  4DXU A;  4RXL A;  1MY3 A;  3BFT A;  3Q25 A;  2QL3 A;  5KCJ A;  3MW0 A;  2F97 A;  1IQ7 A;  3IOV A;  4I9D A;  3DM0 A;  3UK4 A;  1CE2 A;  3B7D A;  3D4C A;  4U2R A;  4U4X A;  4LZ8 A;  3HPI A;  2DWH A;  2D3I A;  4RNS A;  3CFL A;  4F19 A;  1P1W A;  2A5T B;  3H3G A;  1Y9U A;  1VFE A;  3W9V A;  4ZEK A;  1MY1 A;  4H6D A;  1JW4 A;  2I4B A;  3B6W A;  1B6H A;  3PPO A;  4X1B A;  2OBG A;  4U4S A;  4F2Q A;  3K02 A;  4H67 A;  4OFL A;  3OD7 A;  2ZYK A;  1QVS A;  3TEP A;  3GLB A;  1FTJ A;  4FAT A;  1SBP A;  3GZG A;  3CR9 A;  4KI0 E;  3ZKL A;  2Y7W A;  2FYI A;  3ZS6 A;  3KEI A;  2X7P A;  4BDL A;  3CVG A;  1L5T A;  3A09 A;  3FV2 A;  3K0V A;  3ODB A;  4ZZE A;  2I0C A;  1I69 A;  1N3X A;  4G4P A;  2B3F A;  1QUL A;  2AL5 A;  3CSG A;  2ALU A;  1WDN A;  2DVZ A;  3PD8 A;  4DDD A;  3S4U A;  1DSN A;  4NF6 B;  4EQ7 A;  4LUB A;  2REG A;  3MQ9 A;  1RYO A;  3H7M A;  2UVH A;  1J1N A;  4IO3 A;  4DCX A;  2ONK E;  1XHY A;  4QFL A;  1FW0 A;  2RKM A;  3M3F A;  5H8F A;  4NWC A;  1A55 A;  1FQC A;  1UIU A;  1AIV A;  3E13 X;  5I2N A;  2XXV A;  4THI A;  2YJP A;  3T9H B;  1Y3P A;  3JYR A;  2HAV A;  2V84 A;  2V3T A;  2F6P A;  1IUD A;  2HEU A;  3IO4 A;  4F22 A;  3Q28 A;  1MXV A;  1YAE A;  3G3J A;  4FJP A;  3VLV A;  3O28 A;  3OSR A;  2O84 X;  1B9J A;  3QK6 A;  1POY 1;  1A8F A;  4R6Y A;  1HSL A;  2YPN A;  3KGC A;  1MM7 A;  2QS2 A;  4GXS B;  3TDJ A;  4YKP A;  3L6G A;  1JW1 A;  3G7W A;  1OVT A;  3MZ1 A;  3Q26 A;  2DSF A;  3VVF A;  4QHQ A;  1B3H A;  4DZ1 A;  3HN0 A;  5FTI A;  2VD2 A;  4OEU A;  2D21 A;  3ILT B;  3C9H A;  3UA8 A;  4OYV A;  1FQD A;  1TXF A;  2H9B A;  3THI A;  1Y4C A;  3MZ9 A;  3IO6 A;  1OIB A;  4QFO A;  2DXY A;  4YZZ A;  4G77 A;  4IY5 A;  1JQF A;  2W7Y A;  4RJZ A;  1LB8 A;  3K6X A;  4AB5 A;  3O6G A;  1XVX A;  4KCD A;  1JNF A;  4QFN A;  4O3A A;  3FUZ A;  5HBC A;  2F35 A;  2I0B A;  2PT2 A;  3CG1 A;  3D4G A;  5K2X A;  5CMM A;  4N13 A;  4C1U A;  4PFW A;  1N7W A;  4R9F A;  2I49 A;  1LAX A;  4XKQ A;  1QUI A;  4Q0C A;  4X1D A;  1US5 A;  3EHT A;  1P1N A;  3LC8 A;  3QYT A;  1ANF A;  3TFL A;  1FTK A;  3MPL A;  4KFQ A;  2NOO A;  3N94 A;  1JVX A;  2ONS A;  1USY E;  1XVY A;  4FOR A;  3IB1 A;  2GH9 A;  4GVO A;  2F7B A;  3RGY A;  1B7H A;  4YMA A;  4YU0 A;  4QSD A;  3K1M A;  3TTL A;  1IXG A;  1N84 A;  4EF2 A;  3PD9 A;  1ATG A;  2P1S A;  3PUY E;  1QKA A;  1M5B A;  2HZL A;  2BJJ X;  2XD2 A;  3SEV A;  4Z7E A;  4X48 A;  5DVF A;  2PBW A;  3FXU A;  3T93 B;  4DCY A;  3MJN A;  2XXY A;  2I58 A;  1LAF E;  4JDF A;  3TTM A;  1CB6 A;  4F31 B;  2O51 A;  4U23 A;  3C31 A;  2F8D A;  4IY6 A;  3KOT A;  3VFJ A;  3TCG A;  2CZL A;  1MXX A;  1ZTY A;  5TPA B;  4AQ4 A;  5IKB A;  4QFK A;  1ZU0 A;  5CMC A;  1FQB A;  3TUS A;  2Z8E A;  3DP8 A;  3V5A A;  4H65 A;  3FJM A;  4F3G A;  3MUQ A;  3L6H A;  1UIV A;  2Q2A A;  4NF8 A;  2F7A A;  3K6W A;  2XXP A;  5B7D A;  4EQB A;  3FAT A;  4K3F A;  4NF5 A;  2GFE A;  1I6B A;  2OLB A;  2O68 A;  3RN8 A;  2F36 A;  3OO7 A;  3M3K A;  5K2Y A;  2DQV A;  2QRY A;  3FXQ A;  1MQH A;  3MAM A;  4KYD A;  4H8I A;  1MY0 A;  4OHN A;  4DE8 A;  4R2F A;  1URD A;  3MPK A;  2F5X A;  3LSX A;  4ZS9 A;  3PUZ E;  3UN6 A;  3PMV A;  4GOT A;  3IJX B;  1MH4 A;  2VHA A;  3C34 A;  1PBP A;  1B5J A;  1OQH A;  5J1D A;  3HHF A;  1EZO A;  3H4Z A;  3OO8 A;  3CRB A;  1MQG A;  4GRK A;  1XT8 A;  2RC7 A;  2V93 A;  3P7I A;  3K4U A;  2V3U A;  4ELO A;  2OWS A;  3FJG A;  5A5X B;  3SEX A;  4RK2 A;  1RKM A;  2DS9 A;  1B0L A;  4X9T A;  3RTW B;  1B51 A;  1MXU A;  3FAS A;  1Y1M A;  3DP4 A;  5AA2 A;  4YB7 A;  1O63 A;  3T9X B;  3C33 A;  3KJ7 A;  4IO6 A;  4MLV A;  1N76 A;  5AA4 A;  3V83 A;  2M8C A;  1MY2 A;  3A3C A;  1FTL A;  2XXI A;  3SEW A;  4PFT A;  3H03 A;  4G68 A;  2G29 A;  3IOU A;  1XC1 A;  4PFY A;  4ISU A;  5BWJ A;  2HFB A;  3I6V A;  2ANJ A;  1PDA A;  1IXI A;  5JK4 A;  1MPB A;  5DT6 A;  3OEL A;  4QSE A;  4Q5T A;  3MVX A;  3PPP A;  3IB2 A;  4ELR A;  2REJ A;  1O7T A;  4NF4 A;  2GHB A;  2IA4 A;  5KCJ B;  1JEU A;  1EZP A;  3H6V A;  4R75 A;  3MWB A;  4F29 A;  1GTK A;  4R6H A;  3TPA A;  4JXI A;  4FAJ A;  3A3U A;  3LUY A;  5TP9 A;  4LZ7 A;  3RNN A;  1B2H A;  2Q9T A;  1N0T A;  1FCK A;  1B52 A;  1LGB C;  3KSJ A;  3I3V A;  3CFZ A;  1US4 A;  4KPT A;  2OWT A;  1NNT A;  1PEB A;  1MXY A;  1QKB A;  4ECF A;  1QUK A;  3QIM A;  3KOS A;  3U1O A;  3F11 A;  4TLM B;  1AMF A;  4C0R A;  3PUV E;  4F1Y A;  1MDP 1;  1H3D A;  4NMY A;  2D5W A;  3EF7 A;  1WOD A;  2Y84 A;  4OET A;  2H98 A;  3RLF E;  1ZBM A;  3QXM A;  2X26 A;  3HHG A;  5JTY A;  2HQ0 A;  4XKN A;  4EDP A;  4R2B A;  4LVQ A;  4RA1 A;  1OLC A;  2Z22 A;  3MBP A;  4ZDM A;  5H8F B;  5I58 B;  3KSX A;  2OZZ A;  5I2N B;  1B0H A;  3TKD A;  1B3G A;  2XXW A;  4JBZ A;  2DWA A;  5L9S A;  2DXR A;  3CI8 A;  4H0W A;  2RCA A;  1TWY A;  2RC9 A;  5CBS A;  3OXN A;  4GQO A;  3O29 A;  4GF8 A;  3HST A;  4G68 C;  4DXB A;  4JSD A;  5AA1 A;  1ZKB A;  4I8C A;  2B3B A;  3MVY A;  4KD5 A;  3HCQ A;  4F3S A;  3G3G A;  3C32 A;  5KZT A;  3DLN A;  1II5 A;  1KWH A;  5I58 A;  2HAU A;  1MXZ A;  3VXC A;  2PMS A;  3M8U A;  4PQJ A;  3E4R A;  2F6G A;  4F18 A;  3QSL A;  3EN3 A;  1SQY A;  5KDT A;  4G2Z A;  3IL1 B;  3PU5 A;  4ZE8 A;  1UTB A;  5AE4 A;  3IB0 A;  3BBR A;  4ELP A;  5I2K A;  1B3E A;  1POT A;  3UGW A;  2VP1 A;  3GBB A;  1ZLQ A;  3KJT A;  5ELV A;  1SYI A;  2VOZ A;  5F1Q A;  2AYS A;  1IZ1 A;  2QPQ A;  3C35 A;  3SER A;  2DE2 A;  2XXR A;  4NTL A;  2F7C A;  3OSQ A;  3PGF A;  4EXL A;  4JSO A;  3KFM A;  1A8E A;  3DP6 A;  1VSO A;  5L9O A;  4OER A;  3BFU A;  1PBQ A;  1LB9 A;  4YKJ A;  2P0S A;  3N26 A;  3MP1 A;  1B4Z A;  2DE3 A;  3RUM A;  2THI A;  2ZNT A;  4WKM A;  5CRY A;  1IEJ A;  4BDR A;  1LFI A;  3DEL B;  5LOM A;  2I4C A;  3TMG A;  2PX1 A;  2G93 A;  3PPN A;  5DVI A;  2ZYN A;  1FQA A;  2Y7K A;  4POW A;  2XXU A;  3MP6 A;  4FIM A;  2VGQ A;  3VLW A;  4PE5 B;  3OO6 A;  2UVI A;  1B05 A;  1B3F A;  4M4G A;  2UVG A;  3IOR A;  2O7I A;  4FEB A;  1DPE A;  3KZG A;  4R6K A;  3S9L C;  2R9J A;  2ZNS A;  3OO9 A;  4I1D A;  1B7U A;  2OJT A;  1B5H A;  2FA7 A;  1H45 A;  1UQW A;  4HTG A;  2QJE A;  4IO5 A;  3CSB A;  4G8N A;  3S9N C;  5ITO A;  4LON B;  3AXF A;  3LSL A;  3Q29 A;  4NF8 B;  1SD3 A;  3E9X A;  5CMB A;  4KYS A;  1AH5 A;  1HSJ A;  1LFH A;  2QMW A;  3G3H A;  3O2A A;  4H5F A;  1EU8 A;  2ONR A;  3LSW A;  4NF5 B;  4MLQ A;  1I6Q A;  1R9L A;  2E0S A;  4YB6 A;  5I84 A;  3UOR A;  3OEK A;  1Z7N E;  4OES A;  1LBB A;  1GVC A;  1H43 A;  3FVO A;  1O64 A;  3VDF A;  3I5O A;  1P99 A;  3N6T A;  1VR5 A;  3TTN A;  2UVJ A;  1PC3 A;  3U8Q A;  4M1V A;  4BDM A;  4L17 A;  4E0X A;  3C36 A;  2P2A A;  4OVJ A;  3H6W A;  4O3C A;  3G3F A;  1LAH E;  4BDQ A;  3O6H A;  4LQ2 A;  1WVJ A;  1UTH A;  2V3Q A;  4GWO A;  5JEI A;  3T9V A;  3IX1 A;  3TYH A;  1DTZ A;  4IGR A;  2XHD A;  4KYE A;  3U93 A;  3PMW A;  3V8X B;  4FED A;  4ONY A;  2I3W A;  4QF9 A;  2NVU B;  5AA2 B;  4OZ9 A;  5EHS A;  3C4M A;  1SW5 A;  1URS A;  5AA4 B;  3PUX E;  4OXV A;  1MQI A;  2QMX A;  5ICQ A;  3TCF A;  3O9P A;  1LCF A;  4O3B A;  3KN7 A;  4G68 B;  4IB2 A;  1BKA A;  4HW8 A;  4ZEB A;  5CM6 A;  4ESX A;  5ISU A;  4JWX A;  1FQF A;  5I56 A;  3G3K A;  2VD3 A;  5L9M A;  4QSC A;  5CC2 A;  1B40 A;  4NWD A;  1YCJ A;  1S50 A;  4NF4 B;  4R73 A;  1SW2 A;  2Y7P A;  2H25 A;  3LSF B;  4LAT A;  2O7U A;  2NXO A;  3K1P A;  3KN8 A;  4HCW A;  1BLF A;  4R72 A;  4QRZ A;  3R7X A;  1R6Z A;  3TTK A;  2H5Y A;  2ZYM A;  5TP9 B;  3T9U A;  1SDX A;  1RYX A;  2DE4 A;  4P0I A;  5F7V A;  4JWY A;  4GIZ A;  1H44 A;  1LST A;  3OMB A;  1B46 A;  1MDQ A;  2GHA A;  3S9M C;  3MZB A;  1B1H A;  4GL8 A;  2RIN A;  4WEP A;  4E0W A;  3O6I A;  3PV0 E;  4TOZ A;  1MQD A;  5DYH A;  4JWO A;  4GLI A;  5I59 A;  4TLL B;  2E1S A;  4IO2 A;  4C1T A;  5DVJ A;  3GXA A;  1NNP A;  4OFO A;  1IXH A;  2DP8 A;  1B4H A;  5H8N A;  3O66 A;  3IOT A;  5CBR A;  3V89 B;  3VVD A;  1IIW A;  5IAI A;  4KCC A;  2Q2C A;  4OEN A;  3PPR A;  1M5E A;  3IAZ A;  1BP5 A;  2RC8 A;  3EPE A;  2RCB A;  3TCH A;  4XIG Q;  5JTY B;  3W15 C;  1Y20 A;  1MPD A;  4DIG A;  2XXQ A;  3W9W A;  3S9E A;  5H8Q A;  1P1Q A;  4LQ5 A;  1MS7 A;  3ECR A;  1QW0 A;  4DXC A;  3OEN A;  3FGS A;  5FTH A;  3TEL A;  1H76 A;  1Y4T A;  5FHN A;  3R26 A;  1SYH A;  1IIT A;  1LFG A;  4LP2 B;  3N6U A;  4OQO A;  3B6T A;  3FJ7 A;  1T0K A;  1AL3 A;  1DPP A;  4YMB A;  2KLF A;  1URG A;  3SDF A;  1MXW A;  1NKX A;  4RPN A;  3EHS A;  3MVW A;  2Q89 A;  2Y7I A;  2PVU A;  2X7Q A;  5DEX A;  4ZEI A;  3FVG A;  5ITP A;  5EYF A;  3UP9 A;  4DLD A;  1N3W A;  3VVE A;  5CI5 A;  3ZKK A;  1NNF A;  4YKI A;  5H8H A;  4ZZA A;  1Z7M E;  3QUF A;  2HZK A;  1NH7 A;  4GD5 A;  1PB7 A;  5KDT B;  4AB6 A;  4GFR A;  1UTB B;  4U22 A;  2XXH A;  4EQ9 A;  5M2V A;  3EHU A;  4EXK A;  4F3B A;  4EF1 A;  4YB5 A;  1TFD A;  1ZMG A;  4PP0 A;  5I2K B;  5L8D A;  3B6Q A;  1I6A A;  3TQW A;  2NUV A;  3RY3 A;  2QSX A;  3TZA A;  4PET A;  2Q88 A;  1M5D A;  1JW5 A;  1NMU A;  3FD3 A;  2O1M A;  2A5T A;  1B5I A;  3PMX A;  5FHO A;  3SEY A;  1B7Z A;  3HO7 A;  2UYF A;  1NNK A;  1F9B A;  4BDO A;  3FIR A;  4IO7 A;  1JVY A;  5B70 A;  3OOA A;  5TU0 A;  1B58 A;  2QS1 A;  3K01 A;  3CIJ A;  1BTJ A;  3UIF A;  1MH3 A;  1P1U A;  1AOV A;  4QFP A;  3K6V A;  4OTE A;  3JV9 A;  2H99 A;  3K1N A;  1PB8 A;  4H8J A;  4LZ5 A;  4N6P A;  2XX7 A;  4RPO A;  4Z0I A;  1A99 A;  1LAG E;  2DYX A;  5HM4 B;  2R6G E;  3KN3 A;  2R71 A;  1LLS A;  1N04 A;  1D3K A;  1TFA A;  3WAE A;  4NF6 A;  2CMO A;  1NH8 A;  4KQP A;  3TAJ A;  4F3P A;  2V25 A;  2O69 A;  4OMB A;  3T96 B;  1HSE A;  1YPN A;  1DOT A;  4H5G A;  4HCY A;  4U1O A;  3VE1 B;  3ZSF A;  1OQG A;  3MVZ A;  3FVK A;  1NFT A;  1GR2 A;  3LR1 A;  4FEC A;  1SW4 A;  2H4I A;  3M3L A;  1EH3 A;  4OWD A;  3K00 A;  5ICT A;  3RQT A;  2ESN A;  4MFI A;  1USY H;  3TQL A;  3FV1 A;  3JZJ A;  4P0G A;  1A54 A;  2UYE A;  4ZED A;  1LBC A;  1SVX B;  3RT8 A;  2O1L A;  1DMB A;  2I48 A;  2Q8J A;  2GRV A;  1JEV A;  1BIY A;  2I3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...