4KPTA

Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq from lactococcus lactis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
223
structure length
223
Chain Sequence
TVKIASDSSYAPFEFQNGQKKWVGIDVDIMQEVAKINDWKLEMSYPGFDAALQNLKAGQVDGIIAGMTITDERKETFDFSNPYYTSALTIATTKDSKLSDYSDLKGKAVGAKNGTAAQTWLQENQKKYGYTIKTYSDGVHMFAALSSGNIAGAMDEVPVISYAMKQGQDLAMNFPSISLPGGYGFAVMKGKNSTLVDGFNKALAEMKSNGDYDKILKKYGITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine ABC transporter permease and substrate binding pro
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transport protein
total genus 74
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kptA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kptA02
1LFGA 5CMMA 1D4NA 2DS9A 4R72A 4RPOA 2XX8A 3IOTA 4EDPA 5B70A 5KDTB 4X1BA 4GLIA 3JZJA 1IQ7A 2XX9A 3Q25A 4LQ2A 1ZMGA 4JDFA 2ONRA 2F35A 3G7WA 1BLFA 4MLVA 3C9HA 1MRPA 1IXCA 3K6UA 1MXUA 2OWSA 1MM6A 3VV5A 1B40A 4F3GA 3T96B 3K00A 3RN8A 2XXHA 1FQFA 3U1OA 2QRYA 1UTBB 4Z0IA 3TELA 1PC3A 3U92A 4F1YA 3OO7A 3VVEA 5IKBA 1EZ9A 3GBBA 4ELOA 3FUZA 3EQ1A 1Y1ZA 4ZEFA 2Q9TA 3K6WA 3TCHA 2Q88A 2REJA 5I2NA 2V25A 2R6GE 3PD8A 4FEBA 2H25A 4H6DA 3U72A 1R9LA 5ELVA 2ABHA 3MZ1A 4THIA 4O3AA 1DSNA 3FASA 3PPRA 4ESXA 2XXQA 1MQDA 4F1VA 5JK4A 3DELB 4XIGQ 2LAOA 3T9XB 3W15C 1A7LA 5ISUA 4YAHX 2IA4A 2XD3A 3KFMA 3PV0E 4GWOA 5H8QB 3MW0A 1JEVA 3O6GA 4KQPA 5I58A 1DPEA 1UIVA 3L6HA 4G8NA 1IXIA 2YPNA 3HHGA 3TTKA 3T9UA 2BJJX 4M1VA 1QUJA 3W9VA 2NOOA 2ZYOA 1A99A 3PPPA 1TFAA 1MY4A 2Q2AA 4EQ7A 4RJZA 4OZ9A 3IB1A 4IY5A 1HSLA 1FTKA 3QUFA 4EF1A 2DE4A 1AIVA 2X26A 3HHFA 1YTVA 3TTMA 2V3TA 1B3HA 3TTRA 4F2OA 2HXWA 1B1HA 2DQVA 4C1UA 1USYH 3P7IA 4NF4A 1O7TA 2F8DA 4HW8A 3ILUB 1B4HA 2P1SA 4ZE8A 1IEJA 3FJGA 3H03A 5I84A 2ALUA 1LBCA 5DVJA 2O1LA 2HQ0A 4NEDA 5FTIA 3R6UA 5H8NA 3TFLA 2OK2A 1ZIUA 4TQUQ 3E4RA 2Z23A 4L17A 5DEXB 2UYEA 2R71A 2F5XA 5AA3A 5AE4A 4FEDA 4ZZAA 5K2XA 1MXVA 3DP6A 4NF8B 4OQOA 2VP1A 5FTHA 1LAXA 2XXRA 4XKNA 1NH7A 4BDMA 4BDLA 1Y9UA 1POTA 3IAZA 4AQ4A 2VOZA 1B32A 3LC8A 1P1WA 4OFLA 3N94A 4FE8A 3LSLA 2I48A 1SYIA 4XXUA 2I58A 2I4BA 3OEMA 4HCWA 4OFOA 2OCUA 3LBSA 3GXAA 4G2ZA 3FJ7A 2KLFA 1Y20A 2QS4A 1GVCA 5H8FA 2I0BA 2F7BA 2PMSA 1FW0A 5I57B 4DCXA 2O6AA 2O7UA 5TPAA 1B46A 4DXCA 4F39A 3IOUA 3UN6A 1NNTA 3B6WA 4ELRA 2ZNUA 4YMBA 4KI0E 3M3FA 4RK2A 5TP9B 3K01A 1I6BA 4H8IA 3PPNA 1FQAA 3TCFA 4OHNA 5DT6A 3N26A 1OVTA 2V3QA 1M5BA 1VSOA 3RY3A 3WAEA 2O68A 3FXRA 5BUUA 4DLDA 1TXFA 3MVWA 3C4MA 4PFTA 1A54A 4M4GA 4PFYA 3ZS6A 3C33A 4KPTA 3A3UA 1AMFA 1A55A 1B05A 3VLVA 2YLNA 1USYE 4QFPA 3IJXB 4FORA 1MPDA 4LONB 1DOTA 5I56A 2XX7A 1ZLQA 1IIWA 2D3IA 2UVIA 5KCJA 4QRZA 3G3IA 5L9OA 1YAEA 3D4CA 2DWHA 4XTCQ 3TUSA 3EHSA 4ZZEA 4OXVA 2ONSA 1TWYA 4YB6A 4HTGA 1N04A 4ZEIA 1JVYA 3OO9A 3PU5A 4OFJA 1Y4TA 1L5TA 3VVDA 4EF2A 3G3FA 5I2NB 4WKMA 2GHAA 2D21A 3CSBA 2ZNTA 4U4XA 4RK9A 1EZOA 2B65A 2DOJA 3O6HA 3K6XA 1XC1A 4R6HA 3K1MA 1IXGA 2VD3A 4JWYA 5IAIA 2UXAA 4F1UA 4E0XA 1MDQA 1BP5A 4EQ9A 3FZVA 4RNSA 5CMKA 3KSXA 4UA8A 1N0TA 3MP1A 4R9GA 4QSDA 1TT1A 5I58B 3LR1A 4F3PA 3SEVA 1NKXA 2QL3A 1OVBA 4Z7EA 3FXQA 3T22A 3OSQA 4KYEA 4XKQA 5DTBA 4EUOA 4NF5B 5AA4A 1ELJA 3UGWA 3TZAA 2HAVA 1LAGE 3T66A 4KYDA 4GIZA 3BKIB 1B7HA 4IO5A 3FV2A 1LFIA 4OEVA 2I3WA 3UP9A 2ZXTA 2RCAA 1LSTA 1P1NA 1XS5A 3UORA 2I3VA 5CBRA 4NF4B 5CMCA 4RY1A 3DP8A 4GXAA 1FQEA 3B6TA 2DE2A 5I59A 1KWHA 1LBBA 4OMBA 2I0CA 2AIXA 5I2KA 1RYOA 1URDA 5KZTA 3T9HB 1LAFE 2HFBA 2UVJA 5H8NB 1UTHA 1FTMA 1H43A 4HCYA 4QFNA 4IY6A 3I3VA 3LUYA 3OEKA 3E13X 4F22A 4OETA 3S9EA 4IB2A 3MQ9A 1B3LA 4F29A 2QSXA 2Y7PA 4WXJA 3H6UA 1B5HA 3RQTA 2Q2CA 2RC9A 4H65A 3GLBA 2HEUA 3TQLA 1P1QA 3PUXE 1VR5A 3FXUA 3L6GA 3IX1A 2REGA 2Z8FA 1Z7NE 1LAHE 4MH5A 1XT8A 3H3GA 4F18A 5CBSA 2Z22A 3SKPA 4K3FA 1OMPA 1QUKA 2P2AA 3KEIA 1MH3A 1FTOA 3D4GA 2H4IA 4R9FA 5H8FB 3MPKA 2QS2A 2ZYKA 2PVUA 4XKPA 3VLUA 4H5FA 1LCTA 2XXVA 3G3GA 5L9MA 1MXWA 3IB2A 5TPAB 1B5IA 4I1DA 2X7QA 1US4A 1B0LA 3KOSA 5ITPA 2DE3A 3ODBA 2O69A 3QIMA 3O29A 2E1SA 4TLLB 4ZS9A 4GOTA 4G8MA 3MJNA 1Y3QA 4DXBA 5CM6A 4QFKA 5A5XA 4RA1A 5K2YA 3O9PA 4X9TA 1FTLA 3TAJA 3C34A 2AYSA 3ILTB 2G29A 1MY3A 4U22A 1N7XA 5FHOA 4GD5A 3CI8A 3MP8A 3Q29A 3FVOA 1MH4A 2XXWA 3CG1A 5FHNA 5F7VA 1PB7A 4OTEA 4BDRA 1JQFA 3CIJA 3MVYA 1NH8A 3TTNA 5I56B 3ZKKA 3BFTA 3M3KA 4QHQA 5KCJB 3EN3A 3G3JA 3QSLA 4U1OA 1SI1A 3RNNA 2X7PA 4PFUA 2O1MA 1B3GA 4YZZA 4IGTA 4RPNA 2PBWA 1I69A 4ONYA 1OIBA 4OEUA 1LCFA 1Q1KA 4PFWA 5H8SA 1SW5A 3QXMA 3R7XA 2DSFA 2HZKA 3S4UA 1OQGA 4IO6A 3K0VA 3OO8A 4NWCA 3DM0A 3KN8A 4MFIA 1MY0A 2XXPA 1LGBC 2O51A 1FQBA 1II5A 3H6VA 2V84A 3SEXA 1MPCA 4X48A 1WVJA 2ESNA 1IITA 3HCQA 4IO2A 4ELPA 3H7MA 4GF8A 3OO6A 2DP8A 4NTLA 3TODA 3CFZA 3QK6A 2RC8A 1JW4A 1SBPA 1M5FA 4Q0CA 1MY1A 3PUVE 3QUJA 2F6GA 3O2AA 1JW5A 3SESA 3N5LA 3KJ7A 3KOTA 1OQHA 1NL5A 4QF9A 3TKDA 3SDFA 4YU0A 1P99A 1JVXA 4TOZA 5F1QA 2RKMA 3JV9A 2F7CA 4GFRA 4PP0A 3Q28A 3TEPA 1EZPA 1S50A 4NF6A 3USDA 3I6VA 4TLMB 2GH9A 5H8HA 4MF3A 4JSDA 1O64A 1IZ1A 3RT6B 3FVGA 4KD5A 1B9JA 3IORA 3B6QA 5AA2A 5I59B 3C31A 1H76A 1D9VA 2RCBA 5ITOA 3K2DA 1WDNA 4I9DA 4YKIA 3KZGA 5I2KB 4FATA 3CFXA 3LSXA 4H67A 1JW1A 3SEUA 2B3FA 3CVGA 1UTHB 2CZLA 2Q8JA 3PPOA 4C0RA 1FTJA 3CRBA 4G8HA 2GFEA 4F2QA 1MQHA 3SERA 4OVJA 3V83A 4YB5A 4R75A 2Y7WA 4ESWA 2VGQA 3PMWA 3T93B 2I6EA 5DVFA 2P0SA 4H8JA 3WAFA 3IR1A 3M3LA 2YJPA 4JXIA 4ZEDA 2QS1A 1URSA 2QJEA 2DXRA 3R26A 3KN3A 3V5AA 3DLNA 4O3CA 3K1NA 3LSWA 1BIYA 1D9YA 2F34A 2NWJA 5CRYA 4JSOA 3O6IA 3KSJA 4QFOA 1JETA 1ZKBA 3H4ZA 2NUVA 3GBAA 1MXYA 3CSGA 3O66A 2I4CA 4O3BA 2QMXA 4KYSA 1GR2A 4LATA 4GQOA 2FYIA 1OLAA 4OYVA 2UVGA 3KN7A 2H5YA 1BKAA 1XOCA 1MQIA 2ZYNA 1ANFA 3VDFA 1VFEA 1ZJLA 1POY1 4R73A 4ZEBA 3HV1A 1M5CA 3ONMA 3EF7A 1MQGA 5A5XB 3Q26A 3TQWA 3TCGA 4FJPA 4G68A 3SEWA 2Y84A 1MQJA 1B3EA 2QPQA 4U2RA 3ZSFA 4KCDA 3IO6A 3OENA 2DYXA 3S9MC 3MPLA 4POWA 4JB7A 2OZZA 2HCAA 2ONKE 3HN0A 5JEIA 1QJMA 4ND9A 1ATGA 3DP4A 5L9SA 1B2HA 3RGYA 5M2VA 3IB0A 1EU8A 2DWAA 1B4ZA 4KCCA 2PT2A 4C1TA 4JBZA 2GHBA 5AA1A 2H99A 4BDNA 1NNPA 4WEDA 2UYFA 3O97A 3KJTA 3OOAA 3G3KA 3FV1A 3AXFA 4N6PA 2RC7A 4Q30B 5EHSA 2OBGA 4OWDA 4X1DA 1Y4CA 5FHMA 1JNFA 4G77A 4MLQA 4RYAA 4QSCA 3VVFA 4G68C 2PX1A 1Q35A 5HM4B 1IUDA 1SYHA 1Y1MA 2Z8DA 1B7ZA 2XXUA 3K1PA 1Y3PA 4DCYA 4F3SA 4ZDMA 2XXTA 2OLBA 1FCKA 4GVOA 2AL5A 5AA2D 1QKAA 1M5DA 4H1XA 4EXKA 1N3XA 1SW1A 2IEEA 3U8QA 4E0WA 3KBRA 1NMUA 3K6VA 2XXXA 4R6YA 3EHTA 1MY2A 1SVXB 1SW2A 3BFUA 3BBRA 4BLAA 1XHYA 4QSEA 5DYHA 3CR9A 2Y7KA 1TFDA 1QKBA 2A5TA 1AOVA 1B3FA 1MG1A 2DXYA 1N7WA 4F31B 3PGFA 3SEYA 3IJOB 2F6PA 3PUWE 4U23A 1B6HA 3K02A 4NF6B 3LSFB 2F78A 2OWTA 4NMYA 3CFLA 1PBPA 1PEBA 2NVUB 5H8HB 3VXCA 3RUMA 3RLFE 3PD9A 3W9WA 3FGSA 4DIGA 4R6KA 5HPQA 1B0HA 1HSEA 1R9QA 1US5A 4YKPA 4WEPA 3UA8A 2O84X 5J1DA 5AA2B 4BDOA 1Y3NA 4N07A 2V3UA 2QS3A 5CI5A 1N3WA 3OXNA 1FQDA 1R1NA 3IK6B 4GL0A 4BDQA 1B58A 3TPAA 1B51A 1Z7ME 3FD3A 4DE8A 1CE2A 1JEUA 2FA7A 2A5SA 4FECA 3PMVA 1F9BA 4OESA 2DWJA 3TMGA 1QULA 2ZNSA 4PETA 4NF5A 1XVXA 4LQ5A 2M8CA 1DPPA 1B1XA 4KFQA 3IOWA 2CMOA 3OSRA 1GTKA 3MP6A 3G3HA 2QMWA 4ISUA 4Q8RA 4GL8A 4KHZE 3PUZE 1NNKA 5CMBA 4IGRA 1NNFA 1I6AA 4Q5TA 1QVSA 3FATA 4ECFA 1RYXA 1J1NA 1PBQA 3KGCA 2XD2A 3EHUA 3ECRA 1RKMA 4PQJA 3TYHA 1IXHA 3PUYE 2UVHA 5JTYA 3PMXA 1MPBA 4H5GA 4EXLA 1N76A 4I62A 3OMBA 3MZBA 3TDJA 4JWOA 5KDTA 1QUIA 3CG3A 3HO7A 4I8CA 3RT8A 1SI0A 4N13A 3T9VA 4DZ1A 4LZ7A 2R9JA 2NXOA 4HS7A 1AH5A 3UIFA 1LFHA 2OJTA 4G68B 3IL1B 3QYTA 3VLWA 2PYYA 2W7YA 1CB6A 2AL4A 5B7DA 4FIMA 1GV8A 1LB8A 1WODA 2F97A 3C32A 3S9NC 4LA9A 1UTBA 2B3BA 3C35A 3IOVA 5EHMA 4LZ8A 3N6UA 3MUQA 1ZBMA 5BWJA 2ANJA 2FNCA 1LB9A 5AA4B 4F3BA 3S2VA 3Q27A 5ICQA 3I5OA 1ZU0A 1D3KA 1R6ZA 4QFLA 2I49A 4NE4A 4ELQA 2D5WA 1A8FA 3VFJA 3A3CA 3TTLA 1T0KA 1YCJA 2VHAA 3MZ9A 4ZEKA 4NWDA 4AB5A 1AL3A 3H06B 4ZE9A 1SDXA 3KG2A 3THIA 3OELA 3MC2A 1UIUA 3MWBA 1N84A 5DVIA 2ZMBA 4RXLA 4OERA 4P0IA 3B7DA 2G93A 4U4SA 5H8QA 3C36A 2DVZA 1S9TA 4LUBA 1ZTYA 1EH3A 3VE1B 5LOMA 2PT1A 3EPEA 4ZECA 2H9BA 1HSJA 1SQYA 3ZKLA 1SD3A 4EQBA 1PDAA 1S7YA 4LZ5A 5HBCA 2DVCA 2Z8EA 1BTJA 1VFDA 4R2BA 3U94A 2XXYA 3MVZA 2Q89A 1B52A 2Y7RA 1PB9A 4JWXA 4AB6A 2ZYMA 2A5TB 3JYRA 4DXUA 3N6TA 3F11A 2HAUA 1H45A 3RPWA 4IO3A 1MXZA 4LP2B 1OLCA 4YKKA 3QAXA 3M8UA 1O63A 4P11A 3V8XB 3S9LC 2Y7IA 2XXIA 2THIA 4LVQA 1URGA 3RTWB 3H6TA 2F36A 3VXBA 1I6QA 1DTGA 1B5JA 1A8EA 4R2FA 1SW4A 2GRVA 4KR5A 2O7IA 2RINA 2V93A 1LLSA 4YB7A 3HSTA 5EYFA 4U1ZA 3H6WA 4OENA 4U21A 5DEXA 4POXA 4H0WA 3GZGA 3FIRA 4NF8A 4UACA 1A40A 2DWIA 2RF1A 3A09A 4F19A 4IO7A 4MBPA 2F7AA 4IO4A 3E9XA 5TU0A 1DMBA 3FVNA 3FJMA 3K4UA 4P0GA 3V89B 1VE4A 3U93A 1FQCA 1H3DA 3OD7A 1MM7A 1PB8A 4GRKA 3FVKA 1MDP1 1XVYA 2VD2A 5L8DA 4YMAA 4G4PA 3HPIA 5CC2A 1YPNA 1H44A 4YKJA 1MS7A 5I57A 1QW0A 2HZLA 1DTZA 4PE5B 3RTFB 2WKYA 1NFTA 1UQWA 3E3KA 2E0SA 1P1UA 2XHDA 4FAJA 1MXXA 1P1OA 3PPQA 3IO4A 3UK4A 4XKRA 5ICTA 3O28A 5TP9A 1B7UA 1M5EA 3MVXA 4YICA 2H98A 3MAMA 1GGGA 3MBPA 3SETA 4R74A 4DDDA 4GXSB 5JTYB
chains in the Genus database with same CATH superfamily
1LBVA 1LFGA 5CMMA 1D4NA 2DS9A 4R72A 1FPLA 4RPOA 2XX8A 3IOTA 5EYGA 4EDPA 5B70A 5KDTB 4X1BA 4GLIA 3JZJA 1IQ7A 2XX9A 3Q25A 4LQ2A 4XEQA 4GX4A 1ZMGA 4JDFA 2ONRA 2Y5LA 2F35A 1IMCA 4MNIA 3G7WA 1BLFA 4MLVA 3C9HA 3ISPA 1MRPA 1IXCA 3K6UA 1MXUA 3HFUA 2OWSA 1MM6A 3VV5A 1B40A 2WYPA 5T3JA 4F3GA 3T96B 3K00A 5ET6A 1Q9DA 4JVIA 3RN8A 2XXHA 1FQFA 3U1OA 2QRYA 1UTBB 4Z0IA 3TELA 1PC3A 3U92A 4F1YA 3OO7A 3VVEA 5I3SA 5IKBA 1EZ9A 3GBBA 4ELOA 4G61A 3FUZA 3EQ1A 1Y1ZA 4ZEFA 2Q9TA 3K6WA 3TCHA 2Q88A 2REJA 5I2NA 4HE2A 4OVSA 2V25A 2R6GE 3PD8A 4FEBA 2H25A 4H6DA 4N6KA 3U72A 1R9LA 5ELVA 2ABHA 3MZ1A 4THIA 5LDZA 4O3AA 1DSNA 3FASA 3PPRA 4ESXA 2XXQA 1MQDA 4F1VA 5JK4A 3DELB 2XXKA 4XIGQ 1NUZA 2LAOA 3T9XB 3W15C 1A7LA 5ISUA 4YAHX 4N91A 2IA4A 2XD3A 3KFMA 3PV0E 4GWOA 5H8QB 3MW0A 1JEVA 3O6GA 4KQPA 5I58A 2HXRA 1DPEA 2ZZWA 1UIVA 3L6HA 4I3EA 4G8NA 1IXIA 2YPNA 3HHGA 2Y5KA 3TTKA 3T9UA 2BJJX 4M1VA 1QUJA 3W9VA 4MNCA 2NOOA 2ZYOA 1A99A 3PPPA 1TFAA 1MY4A 2Q2AA 4EQ7A 4RJZA 4OZ9A 3IB1A 1DK4A 4IY5A 1HSLA 1FTKA 3QUFA 4HE1A 4MIJA 4EF1A 2DE4A 1AIVA 2X26A 3HHFA 1YTVA 3TTMA 3BIGA 2V3TA 1B3HA 3TTRA 4F2OA 2HXWA 4PBQA 2WX9A 1B1HA 2DQVA 4C1UA 1USYH 3P7IA 4NF4A 1O7TA 2F8DA 1EYIA 4HW8A 3ILUB 1FJ6A 1B4HA 2P1SA 1FBPA 4ZE8A 1IEJA 3FJGA 3H03A 2QFLA 5I84A 2ALUA 1LBCA 5DVJA 2O1LA 2HQ0A 4NEDA 3RYDA 5FTIA 3R6UA 5H8NA 5J16A 3TFLA 2OK2A 3MYUA 1ZIUA 4TQUQ 2VPNA 3E4RA 2Z23A 4L17A 5DEXB 2UYEA 2R71A 2F5XA 5AA3A 5AE4A 4FEDA 4ZZAA 5K2XA 1MXVA 3DP6A 4NF8B 4OQOA 2VP1A 5FTHA 4OVPA 1LAXA 2XXRA 4GX6A 4XKNA 1NH7A 4GBVA 4BDMA 4BDLA 1Y9UA 1POTA 2CEYA 3IAZA 4AQ4A 2VOZA 1B32A 3LC8A 1P1WA 4OFLA 3N94A 1FSAA 4FE8A 3QMFA 3LSLA 2I48A 1SYIA 4XXUA 4OA4A 2I58A 2I4BA 3OEMA 4HCWA 4OFOA 2OCUA 3LBSA 3GXAA 1NV4A 4G2ZA 3FJ7A 2KLFA 1Y20A 2QS4A 1GVCA 5H8FA 2I0BA 2F7BA 4NX1A 2PMSA 1FW0A 5I57B 4DCXA 2O6AA 2O7UA 1NV7A 5TPAA 1B46A 5IZ1A 4DXCA 4F39A 3IOUA 4PFIA 3UN6A 1NNTA 3B6WA 4ELRA 2ZNUA 4YMBA 4KI0E 3M3FA 4RK2A 5TP9B 2CZIA 3K01A 1I6BA 4H8IA 3PPNA 1FQAA 3TCFA 2HPGA 4GWWA 4OHNA 5DT6A 2MKZA 3N26A 1BK4A 1OVTA 1M5BA 1VSOA 2V3QA 5IM2A 3RY3A 5A5LA 3WAEA 2O68A 4X04A 3FXRA 5BUUA 4DLDA 1TXFA 3MVWA 3C4MA 4PFTA 1A54A 5IZ3A 4M4GA 4PFYA 3ZS6A 3C33A 4KPTA 3A3UA 1AMFA 1A55A 1B05A 3VLVA 2YLNA 1USYE 4QFPA 3IJXB 4FORA 1LBYA 1MPDA 4LONB 1DOTA 3LV0A 5I56A 1LBWA 1NUXA 2FVZA 4P56A 2XX7A 1ZLQA 1IIWA 1SPIA 2D3IA 2UVIA 5KCJA 4QRZA 3G3IA 2OWZA 5L9OA 1YAEA 3D4CA 2DWHA 4XTCQ 3TUSA 3EHSA 4ZZEA 4OXVA 2ONSA 1TWYA 3U65A 2QVVA 4MHFA 4P1LA 4YB6A 4HTGA 1N04A 4ZEIA 1JVYA 3OO9A 3PU5A 4OFJA 4I40A 1Y4TA 1L5TA 3VVDA 1NV3A 3NOHA 4EF2A 3G3FA 5I2NB 4WKMA 2GHAA 2D21A 3CSBA 3BIHA 2ZNTA 1EYKA 4GWSA 4U4XA 4RK9A 1EZOA 2B65A 2DOJA 3O6HA 3K6XA 1XC1A 4R6HA 2PFZA 3K1MA 1IXGA 2VD3A 4JWYA 3KBZA 3PTYA 5IAIA 2UXAA 4F1UA 4E0XA 1FBGA 1MDQA 1BP5A 4N4UA 4EQ9A 3FZVA 4RNSA 5CMKA 3KSXA 4UA8A 1N0TA 5IZZA 3MP1A 4R9GA 4QSDA 1TT1A 2FIXA 5I58B 3LR1A 4H46A 4F3PA 3SEVA 1NKXA 1LEVA 2QL3A 1OVBA 4Z7EA 4OVTA 3FXQA 3T22A 4XF5A 3OSQA 4KYEA 4XKQA 5DTBA 4EUOA 1IMDA 4NN3A 4NF5B 4PF6A 5AA4A 1ELJA 4MJOA 3UGWA 3TZAA 1NUWA 2HAVA 1LAGE 3T66A 2XWOA 3CHGA 4KYDA 2ZZXA 4GIZA 3BKIB 1B7HA 4IO5A 3FV2A 1LFIA 4OEVA 2I3WA 3UP9A 2ZXTA 2RCAA 3FXBA 1LSTA 1P1NA 1XS5A 3UORA 2I3VA 5CBRA 3IFCA 4NF4B 5CMCA 4RY1A 3DP8A 4GXAA 1FQEA 3B6TA 2DE2A 5I59A 1FPFA 1KWHA 1LBBA 4NF0A 4OMBA 2I0CA 2AIXA 4PAKA 5I2KA 1RYOA 1URDA 5KZTA 3T9HB 1LAFE 2HFBA 2UVJA 5H8NB 1UTHA 1FTMA 1H43A 4HCYA 4QFNA 4FBPA 4IY6A 3I3VA 3LUYA 4PDHA 3OEKA 4HE0A 3E13X 4F22A 4OETA 3S9EA 4IB2A 2V4CA 3MQ9A 1B3LA 4F29A 2QSXA 2Y7PA 4WXJA 3H6UA 1B5HA 3RQTA 2Q2CA 2RC9A 4H65A 3GLBA 2HEUA 3TQLA 1P1QA 3PUXE 1VR5A 3IFAA 3FXUA 3L6GA 3IX1A 4NAPA 2REGA 2Z8FA 1Z7NE 1LAHE 4MH5A 4P47A 1XT8A 3H3GA 4F18A 2FHYA 5CBSA 2Z22A 3SKPA 1FJ9A 4O94A 4K3FA 1OMPA 1QUKA 2P2AA 3KEIA 1MH3A 1FTOA 3D4GA 2H4IA 1LBXA 4R9FA 5H8FB 3MPKA 2QS2A 2ZYKA 2PVUA 4XKPA 3VLUA 4H5FA 1LCTA 2XXVA 3G3GA 5L9MA 1MXWA 3IB2A 2OX3A 5TPAB 1B5IA 2F3DA 4I1DA 2X7QA 1US4A 1B0LA 3GYYA 3KOSA 4PC9A 5ITPA 2DE3A 3ODBA 2O69A 3QIMA 2BJIA 4IR8A 3O29A 2E1SA 4H45A 2QVRA 4TLLB 4ZS9A 4P9KA 4GOTA 4G8MA 2KQZA 1Y3QA 3MJNA 4DXBA 5CM6A 4GWZA 4QFKA 5A5XA 4RA1A 5K2YA 3O9PA 3T0JA 4X9TA 1FTLA 3TAJA 3C34A 2AYSA 3ILTB 2G29A 5IZ3B 1MY3A 4U22A 1N7XA 5FHOA 4GD5A 1FPDA 3CI8A 3MP8A 3Q29A 3FVOA 1MH4A 2XXWA 3CG1A 5FHNA 5F7VA 1PB7A 5I5PA 4OTEA 3A29A 4BDRA 1JQFA 3CIJA 3MVYA 1NH8A 3TTNA 5I56B 1IMBA 3ZKKA 3BFTA 2XWVA 3M3KA 4QHQA 5KCJB 3EN3A 3G3JA 3QSLA 4OVRA 4U1OA 1SI1A 3RNNA 2B4MA 2X7PA 4PFUA 3E79A 2O1MA 1B3GA 4YZZA 4IGTA 4PFBA 4RPNA 2PBWA 1I69A 4ONYA 1OIBA 4OEUA 1LCFA 1Q1KA 4PFWA 5H8SA 1SW5A 3QXMA 3R7XA 2DSFA 2HZKA 3S4UA 1OQGA 4IO6A 3K0VA 3OO8A 4NWCA 3DM0A 3KN8A 4MFIA 1MY0A 2XXPA 1LGBC 2O51A 1FQBA 1II5A 2CEXA 3H6VA 1FPBA 2V84A 3SEXA 1VDWA 1MPCA 4X48A 5DW8A 1WVJA 2ESNA 1IITA 3HCQA 4IO2A 1FBHA 4ELPA 3H7MA 4GF8A 3OO6A 2DP8A 4NTLA 1FBCA 3TODA 1FBFA 3CFZA 3QK6A 2RC8A 1JW4A 1SBPA 1M5FA 4Q0CA 1MY1A 3PUVE 1G0IA 3QUJA 2F6GA 3O2AA 2XA5A 1JW5A 3SESA 3N5LA 4MAGA 3KJ7A 4P1EA 3KOTA 1OQHA 5EQAA 1NL5A 5ET8A 4QF9A 4GWXA 3TKDA 3SDFA 4YU0A 1P99A 4AS5A 1NUYA 1JVXA 4TOZA 5F1QA 2RKMA 3JV9A 2F7CA 4GFRA 4PP0A 3Q28A 3TEPA 1EZPA 1S50A 1NV5A 1D9QA 4NF6A 3USDA 3I6VA 4TLMB 1NV2A 2GH9A 5H8HA 4MF3A 4JSDA 1LBZA 1O64A 1IZ1A 1FPEA 3RT6B 3FVGA 4KD5A 1B9JA 3IORA 1QGXA 3B6QA 5AA2A 5I59B 3C31A 5FBPA 1H76A 1D9VA 2RCBA 5ITOA 3K2DA 1WDNA 4I9DA 4YKIA 3KZGA 5I2KB 4FATA 3CFXA 3LSXA 4H67A 1IMFA 1JW1A 1FBEA 3SEUA 2B3FA 3CVGA 1UTHB 2CZLA 2Q8JA 2GQ1A 3PPOA 3FBPA 4C0RA 1FTJA 1NV1A 3CRBA 4G8HA 2GFEA 4F2QA 1MQHA 3SERA 2QVUA 4OVJA 3V83A 4YB5A 4R75A 2Y7WA 4ESWA 2VGQA 3PMWA 3T93B 2I6EA 4MMPA 5DVFA 2P0SA 4H8JA 3WAFA 3IR1A 3M3LA 2YJPA 4JXIA 4ZEDA 2QS1A 1URSA 4NQ8A 5IGAA 2QJEA 2DXRA 3R26A 3KN3A 3V5AA 3DLNA 4O3CA 3K1NA 3LSWA 1BIYA 4JVDA 4OANA 1D9YA 2F34A 2NWJA 5CRYA 4JSOA 3O6IA 2WEFA 3KSJA 4QFOA 1JETA 1K9YA 1ZKBA 3H4ZA 2NUVA 2Q8MA 1FPIA 3GBAA 1MXYA 1FRPA 3CSGA 3O66A 2I4CA 4O3BA 2QMXA 1NV0A 4KYSA 4PAFA 1GR2A 4LATA 4O7MA 2CZKA 4GQOA 2FYIA 1OLAA 1KA1A 4OYVA 2UVGA 3KN7A 2H5YA 1BKAA 1XOCA 1MQIA 2ZYNA 4MEVA 1ANFA 2CZHA 3VDFA 1VFEA 1ZJLA 1POY1 4R73A 1YXIA 3HV1A 4ZEBA 1M5CA 4LN5A 3ONMA 3EF7A 1MQGA 5A5XB 4PBHA 4UABA 3Q26A 3TQWA 3TCGA 2PFYA 4FJPA 4G68A 1FPKA 3SEWA 2Y84A 1MQJA 1B3EA 2QPQA 4U2RA 3ZSFA 4MX6A 4KCDA 3IO6A 3OENA 2DYXA 3S9MC 3MPLA 4POWA 4JB7A 2OZZA 2HCAA 2ONKE 3HN0A 5JEIA 4MCOA 1QJMA 4ND9A 1ATGA 4JVCA 3DP4A 5L9SA 1B2HA 3RGYA 5M2VA 3IB0A 1EU8A 4HXVA 2DWAA 1B4ZA 4KCCA 2PT2A 4C1TA 4JBZA 2GHBA 5AA1A 2H99A 4BDNA 1NNPA 4WEDA 2UYFA 3O97A 3KJTA 3OOAA 3G3KA 2B4LA 3FV1A 3AXFA 4N6PA 2RC7A 5F24A 4DI3D 3EKIA 4Q30B 5EHSA 2OBGA 4OWDA 4X1DA 1Y4CA 2WBBA 5FHMA 1JNFA 1RDXA 4G77A 4MLQA 4RYAA 4QSCA 3VVFA 4G68C 2PX1A 1Q35A 5HM4B 1IUDA 4PCDA 1SYHA 1Y1MA 2Z8DA 1B7ZA 2XXUA 3K1PA 3RPLA 1Y3PA 5ET7A 4DCYA 4F3SA 4ZDMA 2XXTA 2OLBA 1FCKA 4GVOA 2AL5A 2P3VA 4PF8A 5AA2D 1QKAA 1M5DA 3MSTA 4GWYA 4H1XA 4EXKA 2ZZVA 1N3XA 1SW1A 2IEEA 3U8QA 4E0WA 3KBRA 1NMUA 3K6VA 2XXXA 2VPOA 4QBAA 4R6YA 5EYHA 3EHTA 4O7IA 1MY2A 1SVXB 1SW2A 3BFUA 3BBRA 4BLAA 1XHYA 4QSEA 5DYHA 3CR9A 4DI4B 2Y7KA 1TFDA 4N17A 1QKBA 2A5TA 1AOVA 1B3FA 1MG1A 2DXYA 4N15A 1N7WA 2XWKA 4F31B 1IMAA 3PGFA 3SEYA 1FBDA 2HHMA 3IJOB 2F6PA 3PUWE 4U23A 1B6HA 2FIEA 4GX3A 1EYJA 1JP4A 3K02A 4NF6B 3LSFB 2F78A 5EQ9A 2OWTA 4NMYA 3CFLA 4PE3A 1PBPA 1PEBA 2P3NA 2NVUB 5H8HB 3VXCA 3RUMA 3RLFE 3PD9A 2WBDA 3W9WA 3FGSA 4DIGA 4QXDA 4R6KA 5HPQA 1B0HA 1HSEA 1R9QA 1US5A 4YKPA 4WEPA 3UA8A 2O84X 5J1DA 1YYZA 4P3LA 5AA2B 4BDOA 1Y3NA 4N07A 2V3UA 2QS3A 5CI5A 1N3WA 3OXNA 1FQDA 1R1NA 4MNPA 3IK6B 4GL0A 3B50A 2FBPA 4BDQA 1B58A 4P8BA 3TPAA 1B51A 1Z7ME 3FD3A 1KA0A 4DE8A 1AWBA 1CE2A 1JEUA 2FA7A 2A5SA 4FECA 3PMVA 1DBZA 1F9BA 4OESA 2DWJA 3SZPA 3TMGA 1QULA 2ZNSA 4PETA 4NF5A 1K9ZA 1XVXA 4LQ5A 4N6DA 4N8YA 2M8CA 1DPPA 1NV6A 1B1XA 4KFQA 3IOWA 1CNQA 2CMOA 3OSRA 1GTKA 3MP6A 3G3HA 2QMWA 4ISUA 4Q8RA 4GL8A 1IMEA 4KHZE 2VT5A 3PUZE 4AS4A 4N81A 1NNKA 1FPGA 4NGUA 5CMBA 4IGRA 1NNFA 1I6AA 4Q5TA 4GWUA 1QVSA 3FATA 4ECFA 1RYXA 2F3BA 1J1NA 1PBQA 3KGCA 2XD2A 3EHUA 3ECRA 1RKMA 4PQJA 2L5VA 3TYHA 1IXHA 3PUYE 2UVHA 4PDDA 5JTYA 3PMXA 1MPBA 4H5GA 4EXLA 1N76A 4I62A 3OMBA 3MZBA 4GBWA 3TDJA 4JWOA 5KDTA 1QUIA 3CG3A 3HO7A 4I8CA 3RT8A 1SI0A 4N13A 3T9VA 4DZ1A 4LZ7A 2R9JA 2NXOA 4HS7A 1AH5A 3B8BA 3UIFA 1RDYA 1LFHA 2OJTA 4G68B 3IL1B 3QYTA 3VLWA 2PYYA 2W7YA 3LUZA 1CB6A 1FPJA 4PGNA 2AL4A 5B7DA 4FIMA 1G0HA 4I3YA 1GV8A 1LB8A 1WODA 2F97A 3C32A 3S9NC 4LA9A 1UTBA 2B3BA 3C35A 3IOVA 5EHMA 4LZ8A 3N6UA 3MUQA 5EQ7A 1ZBMA 5BWJA 2ANJA 2FNCA 1LB9A 5AA4B 3T1BA 4F3BA 3S2VA 3Q27A 5ICQA 1INPA 1YZ0A 3I5OA 1ZU0A 1D3KA 1R6ZA 4QFLA 2I49A 4NE4A 4ELQA 2D5WA 1RDZA 1A8FA 2XWIA 3VFJA 3A3CA 3TTLA 1T0KA 1YCJA 2VHAA 2JJKA 3MZ9A 2R8TA 4ZEKA 4NWDA 4AB5A 1AL3A 3H06B 4ZE9A 1SDXA 3KG2A 3THIA 3OELA 3MC2A 1UIUA 3MWBA 1N84A 4PAIA 5DVIA 3RPLB 4PFRA 2ZMBA 4RXLA 4P0IA 4OERA 3B7DA 2G93A 1XI6A 4U4SA 5H8QA 5ESYA 3C36A 2DVZA 1S9TA 4LUBA 1ZTYA 1EH3A 3VE1B 5LOMA 2PT1A 3EPEA 4ZECA 2H9BA 1HSJA 1SQYA 3ZKLA 1SD3A 4EQBA 1PDAA 1S7YA 4LZ5A 1NI9A 4OVQA 5HBCA 2DVCA 2Z8EA 1BTJA 5EQ8A 1FTAA 1VFDA 4R2BA 3U94A 2XXYA 3MVZA 2WYKA 2Q89A 1B52A 2Y7RA 1PB9A 4JWXA 2KR0A 4AB6A 2ZYMA 2A5TB 3JYRA 4DXUA 3N6TA 3F11A 2HAUA 4NG7A 1H45A 3D1RA 3RPWA 2DDKA 4IO3A 1MXZA 4LP2B 1OLCA 4YKKA 3QAXA 3M8UA 1O63A 4P11A 4O8MA 3V8XB 3S9LC 2Y7IA 2XXIA 2THIA 4LVQA 1URGA 3RTWB 5I7IA 3H6TA 2F36A 4NHBA 1KZ8A 3VXBA 1I6QA 1DTGA 1B5JA 1A8EA 4R2FA 1SW4A 2GRVA 4KR5A 2O7IA 2RINA 2V93A 1DCUA 3KC1A 1LLSA 4YB7A 3HSTA 5EYFA 4U1ZA 3H6WA 4OENA 4U21A 5DEXA 4POXA 4H0WA 3GZGA 3ROJA 3FIRA 4NF8A 4UACA 1A40A 2DWIA 4PGPA 2RF1A 3A09A 5ET5A 4F19A 4PTKA 4IO7A 4MBPA 2F7AA 4IO4A 3E9XA 5TU0A 5LTCA 1DMBA 3FVNA 3FJMA 3K4UA 4P0GA 3V89B 1VE4A 3U93A 1FQCA 1H3DA 3OD7A 1MM7A 1PB8A 4GRKA 3FVKA 1MDP1 1XVYA 2VD2A 5L8DA 4X8RA 4YMAA 4G4PA 3KC0A 3HPIA 5CC2A 1YPNA 1H44A 2Q74A 4YKJA 1MS7A 5I57A 1QW0A 2HZLA 1DTZA 4PE5B 3RTFB 2PCRA 2WKYA 1NFTA 1UQWA 3E3KA 2E0SA 4KXPA 1P1UA 2XHDA 4FAJA 1MXXA 1P1OA 3PPQA 4N8GA 3IO4A 3UK4A 4XKRA 5ICTA 3O28A 5TP9A 1B7UA 1M5EA 3MVXA 4YICA 2H98A 3E78A 3MAMA 1GGGA 3MBPA 3SETA 4R74A 4XFEA 4DDDA 4GXSB 5JTYB
chains in the Genus database with same CATH topology
1LFGA 5CMMA 1D4NA 2DS9A 4R72A 4RPOA 2XX8A 3IOTA 4EDPA 5B70A 5KDTB 4X1BA 4GLIA 3JZJA 1IQ7A 2XX9A 3Q25A 4LQ2A 1ZMGA 4JDFA 2ONRA 2F35A 3G7WA 1BLFA 4MLVA 3C9HA 1MRPA 1IXCA 3K6UA 1MXUA 2OWSA 1MM6A 3VV5A 1B40A 4F3GA 3T96B 3K00A 3RN8A 2XXHA 1FQFA 3U1OA 2QRYA 1UTBB 4Z0IA 3TELA 1PC3A 3U92A 4F1YA 3OO7A 3VVEA 5IKBA 1EZ9A 3GBBA 4ELOA 3FUZA 3EQ1A 1Y1ZA 4ZEFA 2Q9TA 3K6WA 3TCHA 2Q88A 2REJA 5I2NA 2V25A 2R6GE 3PD8A 4FEBA 2H25A 4H6DA 3U72A 1R9LA 5ELVA 2ABHA 3MZ1A 4THIA 4O3AA 1DSNA 3FASA 3PPRA 4ESXA 2XXQA 1MQDA 4F1VA 5JK4A 3DELB 4XIGQ 2LAOA 3T9XB 3W15C 1A7LA 5ISUA 4YAHX 2IA4A 2XD3A 3KFMA 3PV0E 4GWOA 5H8QB 3MW0A 1JEVA 3O6GA 4KQPA 5I58A 1DPEA 1UIVA 3L6HA 4G8NA 1IXIA 2YPNA 3HHGA 3TTKA 3T9UA 2BJJX 4M1VA 1QUJA 3W9VA 2NOOA 2ZYOA 1A99A 3PPPA 1TFAA 1MY4A 2Q2AA 4EQ7A 4RJZA 4OZ9A 3IB1A 4IY5A 1HSLA 1FTKA 3QUFA 4EF1A 2DE4A 1AIVA 2X26A 3HHFA 1YTVA 3TTMA 2V3TA 1B3HA 3TTRA 4F2OA 2HXWA 1B1HA 2DQVA 4C1UA 1USYH 3P7IA 4NF4A 1O7TA 2F8DA 4HW8A 3ILUB 1B4HA 2P1SA 4ZE8A 1IEJA 3FJGA 3H03A 5I84A 2ALUA 1LBCA 5DVJA 2O1LA 2HQ0A 4NEDA 5FTIA 3R6UA 5H8NA 3TFLA 2OK2A 1ZIUA 4TQUQ 3E4RA 2Z23A 4L17A 5DEXB 2UYEA 2R71A 2F5XA 5AA3A 5AE4A 4FEDA 4ZZAA 5K2XA 1MXVA 3DP6A 4NF8B 4OQOA 2VP1A 5FTHA 1LAXA 2XXRA 4XKNA 1NH7A 4BDMA 4BDLA 1Y9UA 1POTA 3IAZA 4AQ4A 2VOZA 1B32A 3LC8A 1P1WA 4OFLA 3N94A 4FE8A 3LSLA 2I48A 1SYIA 4XXUA 2I58A 2I4BA 3OEMA 4HCWA 4OFOA 2OCUA 3LBSA 3GXAA 4G2ZA 3FJ7A 2KLFA 1Y20A 2QS4A 1GVCA 5H8FA 2I0BA 2F7BA 2PMSA 1FW0A 5I57B 4DCXA 2O6AA 2O7UA 5TPAA 1B46A 4DXCA 4F39A 3IOUA 3UN6A 1NNTA 3B6WA 4ELRA 2ZNUA 4YMBA 4KI0E 3M3FA 4RK2A 5TP9B 3K01A 1I6BA 4H8IA 3PPNA 1FQAA 3TCFA 4OHNA 5DT6A 3N26A 1OVTA 2V3QA 1M5BA 1VSOA 3RY3A 3WAEA 2O68A 3FXRA 5BUUA 4DLDA 1TXFA 3MVWA 3C4MA 4PFTA 1A54A 4M4GA 4PFYA 3ZS6A 3C33A 4KPTA 3A3UA 1AMFA 1A55A 1B05A 3VLVA 2YLNA 1USYE 4QFPA 3IJXB 4FORA 1MPDA 4LONB 1DOTA 5I56A 2XX7A 1ZLQA 1IIWA 2D3IA 2UVIA 5KCJA 4QRZA 3G3IA 5L9OA 1YAEA 3D4CA 2DWHA 4XTCQ 3TUSA 3EHSA 4ZZEA 4OXVA 2ONSA 1TWYA 4YB6A 4HTGA 1N04A 4ZEIA 1JVYA 3OO9A 3PU5A 4OFJA 1Y4TA 1L5TA 3VVDA 4EF2A 3G3FA 5I2NB 4WKMA 2GHAA 2D21A 3CSBA 2ZNTA 4U4XA 4RK9A 1EZOA 2B65A 2DOJA 3O6HA 3K6XA 1XC1A 4R6HA 3K1MA 1IXGA 2VD3A 4JWYA 5IAIA 2UXAA 4F1UA 4E0XA 1MDQA 1BP5A 4EQ9A 3FZVA 4RNSA 5CMKA 3KSXA 4UA8A 1N0TA 3MP1A 4R9GA 4QSDA 1TT1A 5I58B 3LR1A 4F3PA 3SEVA 1NKXA 2QL3A 1OVBA 4Z7EA 3FXQA 3T22A 3OSQA 4KYEA 4XKQA 5DTBA 4EUOA 4NF5B 5AA4A 1ELJA 3UGWA 3TZAA 2HAVA 1LAGE 3T66A 4KYDA 4GIZA 3BKIB 1B7HA 4IO5A 3FV2A 1LFIA 4OEVA 2I3WA 3UP9A 2ZXTA 2RCAA 1LSTA 1P1NA 1XS5A 3UORA 2I3VA 5CBRA 4NF4B 5CMCA 4RY1A 3DP8A 4GXAA 1FQEA 3B6TA 2DE2A 5I59A 1KWHA 1LBBA 4OMBA 2I0CA 2AIXA 5I2KA 1RYOA 1URDA 5KZTA 3T9HB 1LAFE 2HFBA 2UVJA 5H8NB 1UTHA 1FTMA 1H43A 4HCYA 4QFNA 4IY6A 3I3VA 3LUYA 3OEKA 3E13X 4F22A 4OETA 3S9EA 4IB2A 3MQ9A 1B3LA 4F29A 2QSXA 2Y7PA 4WXJA 3H6UA 1B5HA 3RQTA 2Q2CA 2RC9A 4H65A 3GLBA 2HEUA 3TQLA 1P1QA 3PUXE 1VR5A 3FXUA 3L6GA 3IX1A 2REGA 2Z8FA 1Z7NE 1LAHE 4MH5A 1XT8A 3H3GA 4F18A 5CBSA 2Z22A 3SKPA 4K3FA 1OMPA 1QUKA 2P2AA 3KEIA 1MH3A 1FTOA 3D4GA 2H4IA 4R9FA 5H8FB 3MPKA 2QS2A 2ZYKA 2PVUA 4XKPA 3VLUA 4H5FA 1LCTA 2XXVA 3G3GA 5L9MA 1MXWA 3IB2A 5TPAB 1B5IA 4I1DA 2X7QA 1US4A 1B0LA 3KOSA 5ITPA 2DE3A 3ODBA 2O69A 3QIMA 3O29A 2E1SA 4TLLB 4ZS9A 4GOTA 4G8MA 3MJNA 1Y3QA 4DXBA 5CM6A 4QFKA 5A5XA 4RA1A 5K2YA 3O9PA 4X9TA 1FTLA 3TAJA 3C34A 2AYSA 3ILTB 2G29A 1MY3A 4U22A 1N7XA 5FHOA 4GD5A 3CI8A 3MP8A 3Q29A 3FVOA 1MH4A 2XXWA 3CG1A 5FHNA 5F7VA 1PB7A 4OTEA 4BDRA 1JQFA 3CIJA 3MVYA 1NH8A 3TTNA 5I56B 3ZKKA 3BFTA 3M3KA 4QHQA 5KCJB 3EN3A 3G3JA 3QSLA 4U1OA 1SI1A 3RNNA 2X7PA 4PFUA 2O1MA 1B3GA 4YZZA 4IGTA 4RPNA 2PBWA 1I69A 4ONYA 1OIBA 4OEUA 1LCFA 1Q1KA 4PFWA 5H8SA 1SW5A 3QXMA 3R7XA 2DSFA 2HZKA 3S4UA 1OQGA 4IO6A 3K0VA 3OO8A 4NWCA 3DM0A 3KN8A 4MFIA 1MY0A 2XXPA 1LGBC 2O51A 1FQBA 1II5A 3H6VA 2V84A 3SEXA 1MPCA 4X48A 1WVJA 2ESNA 1IITA 3HCQA 4IO2A 4ELPA 3H7MA 4GF8A 3OO6A 2DP8A 4NTLA 3TODA 3CFZA 3QK6A 2RC8A 1JW4A 1SBPA 1M5FA 4Q0CA 1MY1A 3PUVE 3QUJA 2F6GA 3O2AA 1JW5A 3SESA 3N5LA 3KJ7A 3KOTA 1OQHA 1NL5A 4QF9A 3TKDA 3SDFA 4YU0A 1P99A 1JVXA 4TOZA 5F1QA 2RKMA 3JV9A 2F7CA 4GFRA 4PP0A 3Q28A 3TEPA 1EZPA 1S50A 4NF6A 3USDA 3I6VA 4TLMB 2GH9A 5H8HA 4MF3A 4JSDA 1O64A 1IZ1A 3RT6B 3FVGA 4KD5A 1B9JA 3IORA 3B6QA 5AA2A 5I59B 3C31A 1H76A 1D9VA 2RCBA 5ITOA 3K2DA 1WDNA 4I9DA 4YKIA 3KZGA 5I2KB 4FATA 3CFXA 3LSXA 4H67A 1JW1A 3SEUA 2B3FA 3CVGA 1UTHB 2CZLA 2Q8JA 3PPOA 4C0RA 1FTJA 3CRBA 4G8HA 2GFEA 4F2QA 1MQHA 3SERA 4OVJA 3V83A 4YB5A 4R75A 2Y7WA 4ESWA 2VGQA 3PMWA 3T93B 2I6EA 5DVFA 2P0SA 4H8JA 3WAFA 3IR1A 3M3LA 2YJPA 4JXIA 4ZEDA 2QS1A 1URSA 2QJEA 2DXRA 3R26A 3KN3A 3V5AA 3DLNA 4O3CA 3K1NA 3LSWA 1BIYA 1D9YA 2F34A 2NWJA 5CRYA 4JSOA 3O6IA 3KSJA 4QFOA 1JETA 1ZKBA 3H4ZA 2NUVA 3GBAA 1MXYA 3CSGA 3O66A 2I4CA 4O3BA 2QMXA 4KYSA 1GR2A 4LATA 4GQOA 2FYIA 1OLAA 4OYVA 2UVGA 3KN7A 2H5YA 1BKAA 1XOCA 1MQIA 2ZYNA 1ANFA 3VDFA 1VFEA 1ZJLA 1POY1 4R73A 4ZEBA 3HV1A 1M5CA 3ONMA 3EF7A 1MQGA 5A5XB 3Q26A 3TQWA 3TCGA 4FJPA 4G68A 3SEWA 2Y84A 1MQJA 1B3EA 2QPQA 4U2RA 3ZSFA 4KCDA 3IO6A 3OENA 2DYXA 3S9MC 3MPLA 4POWA 4JB7A 2OZZA 2HCAA 2ONKE 3HN0A 5JEIA 1QJMA 4ND9A 1ATGA 3DP4A 5L9SA 1B2HA 3RGYA 5M2VA 3IB0A 1EU8A 2DWAA 1B4ZA 4KCCA 2PT2A 4C1TA 4JBZA 2GHBA 5AA1A 2H99A 4BDNA 1NNPA 4WEDA 2UYFA 3O97A 3KJTA 3OOAA 3G3KA 3FV1A 3AXFA 4N6PA 2RC7A 4Q30B 5EHSA 2OBGA 4OWDA 4X1DA 1Y4CA 5FHMA 1JNFA 4G77A 4MLQA 4RYAA 4QSCA 3VVFA 4G68C 2PX1A 1Q35A 5HM4B 1IUDA 1SYHA 1Y1MA 2Z8DA 1B7ZA 2XXUA 3K1PA 1Y3PA 4DCYA 4F3SA 4ZDMA 2XXTA 2OLBA 1FCKA 4GVOA 2AL5A 5AA2D 1QKAA 1M5DA 4H1XA 4EXKA 1N3XA 1SW1A 2IEEA 3U8QA 4E0WA 3KBRA 1NMUA 3K6VA 2XXXA 4R6YA 3EHTA 1MY2A 1SVXB 1SW2A 3BFUA 3BBRA 4BLAA 1XHYA 4QSEA 5DYHA 3CR9A 2Y7KA 1TFDA 1QKBA 2A5TA 1AOVA 1B3FA 1MG1A 2DXYA 1N7WA 4F31B 3PGFA 3SEYA 3IJOB 2F6PA 3PUWE 4U23A 1B6HA 3K02A 4NF6B 3LSFB 2F78A 2OWTA 4NMYA 3CFLA 1PBPA 1PEBA 2NVUB 5H8HB 3VXCA 3RUMA 3RLFE 3PD9A 3W9WA 3FGSA 4DIGA 4R6KA 5HPQA 1B0HA 1HSEA 1R9QA 1US5A 4YKPA 4WEPA 3UA8A 2O84X 5J1DA 5AA2B 4BDOA 1Y3NA 4N07A 2V3UA 2QS3A 5CI5A 1N3WA 3OXNA 1FQDA 1R1NA 3IK6B 4GL0A 4BDQA 1B58A 3TPAA 1B51A 1Z7ME 3FD3A 4DE8A 1CE2A 1JEUA 2FA7A 2A5SA 4FECA 3PMVA 1F9BA 4OESA 2DWJA 3TMGA 1QULA 2ZNSA 4PETA 4NF5A 1XVXA 4LQ5A 2M8CA 1DPPA 1B1XA 4KFQA 3IOWA 2CMOA 3OSRA 1GTKA 3MP6A 3G3HA 2QMWA 4ISUA 4Q8RA 4GL8A 4KHZE 3PUZE 1NNKA 5CMBA 4IGRA 1NNFA 1I6AA 4Q5TA 1QVSA 3FATA 4ECFA 1RYXA 1J1NA 1PBQA 3KGCA 2XD2A 3EHUA 3ECRA 1RKMA 4PQJA 3TYHA 1IXHA 3PUYE 2UVHA 5JTYA 3PMXA 1MPBA 4H5GA 4EXLA 1N76A 4I62A 3OMBA 3MZBA 3TDJA 4JWOA 5KDTA 1QUIA 3CG3A 3HO7A 4I8CA 3RT8A 1SI0A 4N13A 3T9VA 4DZ1A 4LZ7A 2R9JA 2NXOA 4HS7A 1AH5A 3UIFA 1LFHA 2OJTA 4G68B 3IL1B 3QYTA 3VLWA 2PYYA 2W7YA 1CB6A 2AL4A 5B7DA 4FIMA 1GV8A 1LB8A 1WODA 2F97A 3C32A 3S9NC 4LA9A 1UTBA 2B3BA 3C35A 3IOVA 5EHMA 4LZ8A 3N6UA 3MUQA 1ZBMA 5BWJA 2ANJA 2FNCA 1LB9A 5AA4B 4F3BA 3S2VA 3Q27A 5ICQA 3I5OA 1ZU0A 1D3KA 1R6ZA 4QFLA 2I49A 4NE4A 4ELQA 2D5WA 1A8FA 3VFJA 3A3CA 3TTLA 1T0KA 1YCJA 2VHAA 3MZ9A 4ZEKA 4NWDA 4AB5A 1AL3A 3H06B 4ZE9A 1SDXA 3KG2A 3THIA 3OELA 3MC2A 1UIUA 3MWBA 1N84A 5DVIA 2ZMBA 4RXLA 4OERA 4P0IA 3B7DA 2G93A 4U4SA 5H8QA 3C36A 2DVZA 1S9TA 4LUBA 1ZTYA 1EH3A 3VE1B 5LOMA 2PT1A 3EPEA 4ZECA 2H9BA 1HSJA 1SQYA 3ZKLA 1SD3A 4EQBA 1PDAA 1S7YA 4LZ5A 5HBCA 2DVCA 2Z8EA 1BTJA 1VFDA 4R2BA 3U94A 2XXYA 3MVZA 2Q89A 1B52A 2Y7RA 1PB9A 4JWXA 4AB6A 2ZYMA 2A5TB 3JYRA 4DXUA 3N6TA 3F11A 2HAUA 1H45A 3RPWA 4IO3A 1MXZA 4LP2B 1OLCA 4YKKA 3QAXA 3M8UA 1O63A 4P11A 3V8XB 3S9LC 2Y7IA 2XXIA 2THIA 4LVQA 1URGA 3RTWB 3H6TA 2F36A 3VXBA 1I6QA 1DTGA 1B5JA 1A8EA 4R2FA 1SW4A 2GRVA 4KR5A 2O7IA 2RINA 2V93A 1LLSA 4YB7A 3HSTA 5EYFA 4U1ZA 3H6WA 4OENA 4U21A 5DEXA 4POXA 4H0WA 3GZGA 3FIRA 4NF8A 4UACA 1A40A 2DWIA 2RF1A 3A09A 4F19A 4IO7A 4MBPA 2F7AA 4IO4A 3E9XA 5TU0A 1DMBA 3FVNA 3FJMA 3K4UA 4P0GA 3V89B 1VE4A 3U93A 1FQCA 1H3DA 3OD7A 1MM7A 1PB8A 4GRKA 3FVKA 1MDP1 1XVYA 2VD2A 5L8DA 4YMAA 4G4PA 3HPIA 5CC2A 1YPNA 1H44A 4YKJA 1MS7A 5I57A 1QW0A 2HZLA 1DTZA 4PE5B 3RTFB 2WKYA 1NFTA 1UQWA 3E3KA 2E0SA 1P1UA 2XHDA 4FAJA 1MXXA 1P1OA 3PPQA 3IO4A 3UK4A 4XKRA 5ICTA 3O28A 5TP9A 1B7UA 1M5EA 3MVXA 4YICA 2H98A 3MAMA 1GGGA 3MBPA 3SETA 4R74A 4DDDA 4GXSB 5JTYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LFG A;  5CMM A;  1D4N A;  2DS9 A;  4R72 A;  4RPO A;  2XX8 A;  3IOT A;  4EDP A;  5B70 A;  5KDT B;  4X1B A;  4GLI A;  3JZJ A;  1IQ7 A;  2XX9 A;  3Q25 A;  4LQ2 A;  1ZMG A;  4JDF A;  2ONR A;  2F35 A;  3G7W A;  1BLF A;  4MLV A;  3C9H A;  1MRP A;  1IXC A;  3K6U A;  1MXU A;  2OWS A;  1MM6 A;  3VV5 A;  1B40 A;  4F3G A;  3T96 B;  3K00 A;  3RN8 A;  2XXH A;  1FQF A;  3U1O A;  2QRY A;  1UTB B;  4Z0I A;  3TEL A;  1PC3 A;  3U92 A;  4F1Y A;  3OO7 A;  3VVE A;  5IKB A;  1EZ9 A;  3GBB A;  4ELO A;  3FUZ A;  3EQ1 A;  1Y1Z A;  4ZEF A;  2Q9T A;  3K6W A;  3TCH A;  2Q88 A;  2REJ A;  5I2N A;  2V25 A;  2R6G E;  3PD8 A;  4FEB A;  2H25 A;  4H6D A;  3U72 A;  1R9L A;  5ELV A;  2ABH A;  3MZ1 A;  4THI A;  4O3A A;  1DSN A;  3FAS A;  3PPR A;  4ESX A;  2XXQ A;  1MQD A;  4F1V A;  5JK4 A;  3DEL B;  4XIG Q;  2LAO A;  3T9X B;  3W15 C;  1A7L A;  5ISU A;  4YAH X;  2IA4 A;  2XD3 A;  3KFM A;  3PV0 E;  4GWO A;  5H8Q B;  3MW0 A;  1JEV A;  3O6G A;  4KQP A;  5I58 A;  1DPE A;  1UIV A;  3L6H A;  4G8N A;  1IXI A;  2YPN A;  3HHG A;  3TTK A;  3T9U A;  2BJJ X;  4M1V A;  1QUJ A;  3W9V A;  2NOO A;  2ZYO A;  1A99 A;  3PPP A;  1TFA A;  1MY4 A;  2Q2A A;  4EQ7 A;  4RJZ A;  4OZ9 A;  3IB1 A;  4IY5 A;  1HSL A;  1FTK A;  3QUF A;  4EF1 A;  2DE4 A;  1AIV A;  2X26 A;  3HHF A;  1YTV A;  3TTM A;  2V3T A;  1B3H A;  3TTR A;  4F2O A;  2HXW A;  1B1H A;  2DQV A;  4C1U A;  1USY H;  3P7I A;  4NF4 A;  1O7T A;  2F8D A;  4HW8 A;  3ILU B;  1B4H A;  2P1S A;  4ZE8 A;  1IEJ A;  3FJG A;  3H03 A;  5I84 A;  2ALU A;  1LBC A;  5DVJ A;  2O1L A;  2HQ0 A;  4NED A;  5FTI A;  3R6U A;  5H8N A;  3TFL A;  2OK2 A;  1ZIU A;  4TQU Q;  3E4R A;  2Z23 A;  4L17 A;  5DEX B;  2UYE A;  2R71 A;  2F5X A;  5AA3 A;  5AE4 A;  4FED A;  4ZZA A;  5K2X A;  1MXV A;  3DP6 A;  4NF8 B;  4OQO A;  2VP1 A;  5FTH A;  1LAX A;  2XXR A;  4XKN A;  1NH7 A;  4BDM A;  4BDL A;  1Y9U A;  1POT A;  3IAZ A;  4AQ4 A;  2VOZ A;  1B32 A;  3LC8 A;  1P1W A;  4OFL A;  3N94 A;  4FE8 A;  3LSL A;  2I48 A;  1SYI A;  4XXU A;  2I58 A;  2I4B A;  3OEM A;  4HCW A;  4OFO A;  2OCU A;  3LBS A;  3GXA A;  4G2Z A;  3FJ7 A;  2KLF A;  1Y20 A;  2QS4 A;  1GVC A;  5H8F A;  2I0B A;  2F7B A;  2PMS A;  1FW0 A;  5I57 B;  4DCX A;  2O6A A;  2O7U A;  5TPA A;  1B46 A;  4DXC A;  4F39 A;  3IOU A;  3UN6 A;  1NNT A;  3B6W A;  4ELR A;  2ZNU A;  4YMB A;  4KI0 E;  3M3F A;  4RK2 A;  5TP9 B;  3K01 A;  1I6B A;  4H8I A;  3PPN A;  1FQA A;  3TCF A;  4OHN A;  5DT6 A;  3N26 A;  1OVT A;  2V3Q A;  1M5B A;  1VSO A;  3RY3 A;  3WAE A;  2O68 A;  3FXR A;  5BUU A;  4DLD A;  1TXF A;  3MVW A;  3C4M A;  4PFT A;  1A54 A;  4M4G A;  4PFY A;  3ZS6 A;  3C33 A;  4KPT A;  3A3U A;  1AMF A;  1A55 A;  1B05 A;  3VLV A;  2YLN A;  1USY E;  4QFP A;  3IJX B;  4FOR A;  1MPD A;  4LON B;  1DOT A;  5I56 A;  2XX7 A;  1ZLQ A;  1IIW A;  2D3I A;  2UVI A;  5KCJ A;  4QRZ A;  3G3I A;  5L9O A;  1YAE A;  3D4C A;  2DWH A;  4XTC Q;  3TUS A;  3EHS A;  4ZZE A;  4OXV A;  2ONS A;  1TWY A;  4YB6 A;  4HTG A;  1N04 A;  4ZEI A;  1JVY A;  3OO9 A;  3PU5 A;  4OFJ A;  1Y4T A;  1L5T A;  3VVD A;  4EF2 A;  3G3F A;  5I2N B;  4WKM A;  2GHA A;  2D21 A;  3CSB A;  2ZNT A;  4U4X A;  4RK9 A;  1EZO A;  2B65 A;  2DOJ A;  3O6H A;  3K6X A;  1XC1 A;  4R6H A;  3K1M A;  1IXG A;  2VD3 A;  4JWY A;  5IAI A;  2UXA A;  4F1U A;  4E0X A;  1MDQ A;  1BP5 A;  4EQ9 A;  3FZV A;  4RNS A;  5CMK A;  3KSX A;  4UA8 A;  1N0T A;  3MP1 A;  4R9G A;  4QSD A;  1TT1 A;  5I58 B;  3LR1 A;  4F3P A;  3SEV A;  1NKX A;  2QL3 A;  1OVB A;  4Z7E A;  3FXQ A;  3T22 A;  3OSQ A;  4KYE A;  4XKQ A;  5DTB A;  4EUO A;  4NF5 B;  5AA4 A;  1ELJ A;  3UGW A;  3TZA A;  2HAV A;  1LAG E;  3T66 A;  4KYD A;  4GIZ A;  3BKI B;  1B7H A;  4IO5 A;  3FV2 A;  1LFI A;  4OEV A;  2I3W A;  3UP9 A;  2ZXT A;  2RCA A;  1LST A;  1P1N A;  1XS5 A;  3UOR A;  2I3V A;  5CBR A;  4NF4 B;  5CMC A;  4RY1 A;  3DP8 A;  4GXA A;  1FQE A;  3B6T A;  2DE2 A;  5I59 A;  1KWH A;  1LBB A;  4OMB A;  2I0C A;  2AIX A;  5I2K A;  1RYO A;  1URD A;  5KZT A;  3T9H B;  1LAF E;  2HFB A;  2UVJ A;  5H8N B;  1UTH A;  1FTM A;  1H43 A;  4HCY A;  4QFN A;  4IY6 A;  3I3V A;  3LUY A;  3OEK A;  3E13 X;  4F22 A;  4OET A;  3S9E A;  4IB2 A;  3MQ9 A;  1B3L A;  4F29 A;  2QSX A;  2Y7P A;  4WXJ A;  3H6U A;  1B5H A;  3RQT A;  2Q2C A;  2RC9 A;  4H65 A;  3GLB A;  2HEU A;  3TQL A;  1P1Q A;  3PUX E;  1VR5 A;  3FXU A;  3L6G A;  3IX1 A;  2REG A;  2Z8F A;  1Z7N E;  1LAH E;  4MH5 A;  1XT8 A;  3H3G A;  4F18 A;  5CBS A;  2Z22 A;  3SKP A;  4K3F A;  1OMP A;  1QUK A;  2P2A A;  3KEI A;  1MH3 A;  1FTO A;  3D4G A;  2H4I A;  4R9F A;  5H8F B;  3MPK A;  2QS2 A;  2ZYK A;  2PVU A;  4XKP A;  3VLU A;  4H5F A;  1LCT A;  2XXV A;  3G3G A;  5L9M A;  1MXW A;  3IB2 A;  5TPA B;  1B5I A;  4I1D A;  2X7Q A;  1US4 A;  1B0L A;  3KOS A;  5ITP A;  2DE3 A;  3ODB A;  2O69 A;  3QIM A;  3O29 A;  2E1S A;  4TLL B;  4ZS9 A;  4GOT A;  4G8M A;  3MJN A;  1Y3Q A;  4DXB A;  5CM6 A;  4QFK A;  5A5X A;  4RA1 A;  5K2Y A;  3O9P A;  4X9T A;  1FTL A;  3TAJ A;  3C34 A;  2AYS A;  3ILT B;  2G29 A;  1MY3 A;  4U22 A;  1N7X A;  5FHO A;  4GD5 A;  3CI8 A;  3MP8 A;  3Q29 A;  3FVO A;  1MH4 A;  2XXW A;  3CG1 A;  5FHN A;  5F7V A;  1PB7 A;  4OTE A;  4BDR A;  1JQF A;  3CIJ A;  3MVY A;  1NH8 A;  3TTN A;  5I56 B;  3ZKK A;  3BFT A;  3M3K A;  4QHQ A;  5KCJ B;  3EN3 A;  3G3J A;  3QSL A;  4U1O A;  1SI1 A;  3RNN A;  2X7P A;  4PFU A;  2O1M A;  1B3G A;  4YZZ A;  4IGT A;  4RPN A;  2PBW A;  1I69 A;  4ONY A;  1OIB A;  4OEU A;  1LCF A;  1Q1K A;  4PFW A;  5H8S A;  1SW5 A;  3QXM A;  3R7X A;  2DSF A;  2HZK A;  3S4U A;  1OQG A;  4IO6 A;  3K0V A;  3OO8 A;  4NWC A;  3DM0 A;  3KN8 A;  4MFI A;  1MY0 A;  2XXP A;  1LGB C;  2O51 A;  1FQB A;  1II5 A;  3H6V A;  2V84 A;  3SEX A;  1MPC A;  4X48 A;  1WVJ A;  2ESN A;  1IIT A;  3HCQ A;  4IO2 A;  4ELP A;  3H7M A;  4GF8 A;  3OO6 A;  2DP8 A;  4NTL A;  3TOD A;  3CFZ A;  3QK6 A;  2RC8 A;  1JW4 A;  1SBP A;  1M5F A;  4Q0C A;  1MY1 A;  3PUV E;  3QUJ A;  2F6G A;  3O2A A;  1JW5 A;  3SES A;  3N5L A;  3KJ7 A;  3KOT A;  1OQH A;  1NL5 A;  4QF9 A;  3TKD A;  3SDF A;  4YU0 A;  1P99 A;  1JVX A;  4TOZ A;  5F1Q A;  2RKM A;  3JV9 A;  2F7C A;  4GFR A;  4PP0 A;  3Q28 A;  3TEP A;  1EZP A;  1S50 A;  4NF6 A;  3USD A;  3I6V A;  4TLM B;  2GH9 A;  5H8H A;  4MF3 A;  4JSD A;  1O64 A;  1IZ1 A;  3RT6 B;  3FVG A;  4KD5 A;  1B9J A;  3IOR A;  3B6Q A;  5AA2 A;  5I59 B;  3C31 A;  1H76 A;  1D9V A;  2RCB A;  5ITO A;  3K2D A;  1WDN A;  4I9D A;  4YKI A;  3KZG A;  5I2K B;  4FAT A;  3CFX A;  3LSX A;  4H67 A;  1JW1 A;  3SEU A;  2B3F A;  3CVG A;  1UTH B;  2CZL A;  2Q8J A;  3PPO A;  4C0R A;  1FTJ A;  3CRB A;  4G8H A;  2GFE A;  4F2Q A;  1MQH A;  3SER A;  4OVJ A;  3V83 A;  4YB5 A;  4R75 A;  2Y7W A;  4ESW A;  2VGQ A;  3PMW A;  3T93 B;  2I6E A;  5DVF A;  2P0S A;  4H8J A;  3WAF A;  3IR1 A;  3M3L A;  2YJP A;  4JXI A;  4ZED A;  2QS1 A;  1URS A;  2QJE A;  2DXR A;  3R26 A;  3KN3 A;  3V5A A;  3DLN A;  4O3C A;  3K1N A;  3LSW A;  1BIY A;  1D9Y A;  2F34 A;  2NWJ A;  5CRY A;  4JSO A;  3O6I A;  3KSJ A;  4QFO A;  1JET A;  1ZKB A;  3H4Z A;  2NUV A;  3GBA A;  1MXY A;  3CSG A;  3O66 A;  2I4C A;  4O3B A;  2QMX A;  4KYS A;  1GR2 A;  4LAT A;  4GQO A;  2FYI A;  1OLA A;  4OYV A;  2UVG A;  3KN7 A;  2H5Y A;  1BKA A;  1XOC A;  1MQI A;  2ZYN A;  1ANF A;  3VDF A;  1VFE A;  1ZJL A;  1POY 1;  4R73 A;  4ZEB A;  3HV1 A;  1M5C A;  3ONM A;  3EF7 A;  1MQG A;  5A5X B;  3Q26 A;  3TQW A;  3TCG A;  4FJP A;  4G68 A;  3SEW A;  2Y84 A;  1MQJ A;  1B3E A;  2QPQ A;  4U2R A;  3ZSF A;  4KCD A;  3IO6 A;  3OEN A;  2DYX A;  3S9M C;  3MPL A;  4POW A;  4JB7 A;  2OZZ A;  2HCA A;  2ONK E;  3HN0 A;  5JEI A;  1QJM A;  4ND9 A;  1ATG A;  3DP4 A;  5L9S A;  1B2H A;  3RGY A;  5M2V A;  3IB0 A;  1EU8 A;  2DWA A;  1B4Z A;  4KCC A;  2PT2 A;  4C1T A;  4JBZ A;  2GHB A;  5AA1 A;  2H99 A;  4BDN A;  1NNP A;  4WED A;  2UYF A;  3O97 A;  3KJT A;  3OOA A;  3G3K A;  3FV1 A;  3AXF A;  4N6P A;  2RC7 A;  4Q30 B;  5EHS A;  2OBG A;  4OWD A;  4X1D A;  1Y4C A;  5FHM A;  1JNF A;  4G77 A;  4MLQ A;  4RYA A;  4QSC A;  3VVF A;  4G68 C;  2PX1 A;  1Q35 A;  5HM4 B;  1IUD A;  1SYH A;  1Y1M A;  2Z8D A;  1B7Z A;  2XXU A;  3K1P A;  1Y3P A;  4DCY A;  4F3S A;  4ZDM A;  2XXT A;  2OLB A;  1FCK A;  4GVO A;  2AL5 A;  5AA2 D;  1QKA A;  1M5D A;  4H1X A;  4EXK A;  1N3X A;  1SW1 A;  2IEE A;  3U8Q A;  4E0W A;  3KBR A;  1NMU A;  3K6V A;  2XXX A;  4R6Y A;  3EHT A;  1MY2 A;  1SVX B;  1SW2 A;  3BFU A;  3BBR A;  4BLA A;  1XHY A;  4QSE A;  5DYH A;  3CR9 A;  2Y7K A;  1TFD A;  1QKB A;  2A5T A;  1AOV A;  1B3F A;  1MG1 A;  2DXY A;  1N7W A;  4F31 B;  3PGF A;  3SEY A;  3IJO B;  2F6P A;  3PUW E;  4U23 A;  1B6H A;  3K02 A;  4NF6 B;  3LSF B;  2F78 A;  2OWT A;  4NMY A;  3CFL A;  1PBP A;  1PEB A;  2NVU B;  5H8H B;  3VXC A;  3RUM A;  3RLF E;  3PD9 A;  3W9W A;  3FGS A;  4DIG A;  4R6K A;  5HPQ A;  1B0H A;  1HSE A;  1R9Q A;  1US5 A;  4YKP A;  4WEP A;  3UA8 A;  2O84 X;  5J1D A;  5AA2 B;  4BDO A;  1Y3N A;  4N07 A;  2V3U A;  2QS3 A;  5CI5 A;  1N3W A;  3OXN A;  1FQD A;  1R1N A;  3IK6 B;  4GL0 A;  4BDQ A;  1B58 A;  3TPA A;  1B51 A;  1Z7M E;  3FD3 A;  4DE8 A;  1CE2 A;  1JEU A;  2FA7 A;  2A5S A;  4FEC A;  3PMV A;  1F9B A;  4OES A;  2DWJ A;  3TMG A;  1QUL A;  2ZNS A;  4PET A;  4NF5 A;  1XVX A;  4LQ5 A;  2M8C A;  1DPP A;  1B1X A;  4KFQ A;  3IOW A;  2CMO A;  3OSR A;  1GTK A;  3MP6 A;  3G3H A;  2QMW A;  4ISU A;  4Q8R A;  4GL8 A;  4KHZ E;  3PUZ E;  1NNK A;  5CMB A;  4IGR A;  1NNF A;  1I6A A;  4Q5T A;  1QVS A;  3FAT A;  4ECF A;  1RYX A;  1J1N A;  1PBQ A;  3KGC A;  2XD2 A;  3EHU A;  3ECR A;  1RKM A;  4PQJ A;  3TYH A;  1IXH A;  3PUY E;  2UVH A;  5JTY A;  3PMX A;  1MPB A;  4H5G A;  4EXL A;  1N76 A;  4I62 A;  3OMB A;  3MZB A;  3TDJ A;  4JWO A;  5KDT A;  1QUI A;  3CG3 A;  3HO7 A;  4I8C A;  3RT8 A;  1SI0 A;  4N13 A;  3T9V A;  4DZ1 A;  4LZ7 A;  2R9J A;  2NXO A;  4HS7 A;  1AH5 A;  3UIF A;  1LFH A;  2OJT A;  4G68 B;  3IL1 B;  3QYT A;  3VLW A;  2PYY A;  2W7Y A;  1CB6 A;  2AL4 A;  5B7D A;  4FIM A;  1GV8 A;  1LB8 A;  1WOD A;  2F97 A;  3C32 A;  3S9N C;  4LA9 A;  1UTB A;  2B3B A;  3C35 A;  3IOV A;  5EHM A;  4LZ8 A;  3N6U A;  3MUQ A;  1ZBM A;  5BWJ A;  2ANJ A;  2FNC A;  1LB9 A;  5AA4 B;  4F3B A;  3S2V A;  3Q27 A;  5ICQ A;  3I5O A;  1ZU0 A;  1D3K A;  1R6Z A;  4QFL A;  2I49 A;  4NE4 A;  4ELQ A;  2D5W A;  1A8F A;  3VFJ A;  3A3C A;  3TTL A;  1T0K A;  1YCJ A;  2VHA A;  3MZ9 A;  4ZEK A;  4NWD A;  4AB5 A;  1AL3 A;  3H06 B;  4ZE9 A;  1SDX A;  3KG2 A;  3THI A;  3OEL A;  3MC2 A;  1UIU A;  3MWB A;  1N84 A;  5DVI A;  2ZMB A;  4RXL A;  4OER A;  4P0I A;  3B7D A;  2G93 A;  4U4S A;  5H8Q A;  3C36 A;  2DVZ A;  1S9T A;  4LUB A;  1ZTY A;  1EH3 A;  3VE1 B;  5LOM A;  2PT1 A;  3EPE A;  4ZEC A;  2H9B A;  1HSJ A;  1SQY A;  3ZKL A;  1SD3 A;  4EQB A;  1PDA A;  1S7Y A;  4LZ5 A;  5HBC A;  2DVC A;  2Z8E A;  1BTJ A;  1VFD A;  4R2B A;  3U94 A;  2XXY A;  3MVZ A;  2Q89 A;  1B52 A;  2Y7R A;  1PB9 A;  4JWX A;  4AB6 A;  2ZYM A;  2A5T B;  3JYR A;  4DXU A;  3N6T A;  3F11 A;  2HAU A;  1H45 A;  3RPW A;  4IO3 A;  1MXZ A;  4LP2 B;  1OLC A;  4YKK A;  3QAX A;  3M8U A;  1O63 A;  4P11 A;  3V8X B;  3S9L C;  2Y7I A;  2XXI A;  2THI A;  4LVQ A;  1URG A;  3RTW B;  3H6T A;  2F36 A;  3VXB A;  1I6Q A;  1DTG A;  1B5J A;  1A8E A;  4R2F A;  1SW4 A;  2GRV A;  4KR5 A;  2O7I A;  2RIN A;  2V93 A;  1LLS A;  4YB7 A;  3HST A;  5EYF A;  4U1Z A;  3H6W A;  4OEN A;  4U21 A;  5DEX A;  4POX A;  4H0W A;  3GZG A;  3FIR A;  4NF8 A;  4UAC A;  1A40 A;  2DWI A;  2RF1 A;  3A09 A;  4F19 A;  4IO7 A;  4MBP A;  2F7A A;  4IO4 A;  3E9X A;  5TU0 A;  1DMB A;  3FVN A;  3FJM A;  3K4U A;  4P0G A;  3V89 B;  1VE4 A;  3U93 A;  1FQC A;  1H3D A;  3OD7 A;  1MM7 A;  1PB8 A;  4GRK A;  3FVK A;  1MDP 1;  1XVY A;  2VD2 A;  5L8D A;  4YMA A;  4G4P A;  3HPI A;  5CC2 A;  1YPN A;  1H44 A;  4YKJ A;  1MS7 A;  5I57 A;  1QW0 A;  2HZL A;  1DTZ A;  4PE5 B;  3RTF B;  2WKY A;  1NFT A;  1UQW A;  3E3K A;  2E0S A;  1P1U A;  2XHD A;  4FAJ A;  1MXX A;  1P1O A;  3PPQ A;  3IO4 A;  3UK4 A;  4XKR A;  5ICT A;  3O28 A;  5TP9 A;  1B7U A;  1M5E A;  3MVX A;  4YIC A;  2H98 A;  3MAM A;  1GGG A;  3MBP A;  3SET A;  4R74 A;  4DDD A;  4GXS B;  5JTY B; 
#chains in the Genus database with same CATH topology
 1LBV A;  1LFG A;  5CMM A;  1D4N A;  2DS9 A;  4R72 A;  1FPL A;  4RPO A;  2XX8 A;  3IOT A;  5EYG A;  4EDP A;  5B70 A;  5KDT B;  4X1B A;  4GLI A;  3JZJ A;  1IQ7 A;  2XX9 A;  3Q25 A;  4LQ2 A;  4XEQ A;  4GX4 A;  1ZMG A;  4JDF A;  2ONR A;  2Y5L A;  2F35 A;  1IMC A;  4MNI A;  3G7W A;  1BLF A;  4MLV A;  3C9H A;  3ISP A;  1MRP A;  1IXC A;  3K6U A;  1MXU A;  3HFU A;  2OWS A;  1MM6 A;  3VV5 A;  1B40 A;  2WYP A;  5T3J A;  4F3G A;  3T96 B;  3K00 A;  5ET6 A;  1Q9D A;  4JVI A;  3RN8 A;  2XXH A;  1FQF A;  3U1O A;  2QRY A;  1UTB B;  4Z0I A;  3TEL A;  1PC3 A;  3U92 A;  4F1Y A;  3OO7 A;  3VVE A;  5I3S A;  5IKB A;  1EZ9 A;  3GBB A;  4ELO A;  4G61 A;  3FUZ A;  3EQ1 A;  1Y1Z A;  4ZEF A;  2Q9T A;  3K6W A;  3TCH A;  2Q88 A;  2REJ A;  5I2N A;  4HE2 A;  4OVS A;  2V25 A;  2R6G E;  3PD8 A;  4FEB A;  2H25 A;  4H6D A;  4N6K A;  3U72 A;  1R9L A;  5ELV A;  2ABH A;  3MZ1 A;  4THI A;  5LDZ A;  4O3A A;  1DSN A;  3FAS A;  3PPR A;  4ESX A;  2XXQ A;  1MQD A;  4F1V A;  5JK4 A;  3DEL B;  2XXK A;  4XIG Q;  1NUZ A;  2LAO A;  3T9X B;  3W15 C;  1A7L A;  5ISU A;  4YAH X;  4N91 A;  2IA4 A;  2XD3 A;  3KFM A;  3PV0 E;  4GWO A;  5H8Q B;  3MW0 A;  1JEV A;  3O6G A;  4KQP A;  5I58 A;  2HXR A;  1DPE A;  2ZZW A;  1UIV A;  3L6H A;  4I3E A;  4G8N A;  1IXI A;  2YPN A;  3HHG A;  2Y5K A;  3TTK A;  3T9U A;  2BJJ X;  4M1V A;  1QUJ A;  3W9V A;  4MNC A;  2NOO A;  2ZYO A;  1A99 A;  3PPP A;  1TFA A;  1MY4 A;  2Q2A A;  4EQ7 A;  4RJZ A;  4OZ9 A;  3IB1 A;  1DK4 A;  4IY5 A;  1HSL A;  1FTK A;  3QUF A;  4HE1 A;  4MIJ A;  4EF1 A;  2DE4 A;  1AIV A;  2X26 A;  3HHF A;  1YTV A;  3TTM A;  3BIG A;  2V3T A;  1B3H A;  3TTR A;  4F2O A;  2HXW A;  4PBQ A;  2WX9 A;  1B1H A;  2DQV A;  4C1U A;  1USY H;  3P7I A;  4NF4 A;  1O7T A;  2F8D A;  1EYI A;  4HW8 A;  3ILU B;  1FJ6 A;  1B4H A;  2P1S A;  1FBP A;  4ZE8 A;  1IEJ A;  3FJG A;  3H03 A;  2QFL A;  5I84 A;  2ALU A;  1LBC A;  5DVJ A;  2O1L A;  2HQ0 A;  4NED A;  3RYD A;  5FTI A;  3R6U A;  5H8N A;  5J16 A;  3TFL A;  2OK2 A;  3MYU A;  1ZIU A;  4TQU Q;  2VPN A;  3E4R A;  2Z23 A;  4L17 A;  5DEX B;  2UYE A;  2R71 A;  2F5X A;  5AA3 A;  5AE4 A;  4FED A;  4ZZA A;  5K2X A;  1MXV A;  3DP6 A;  4NF8 B;  4OQO A;  2VP1 A;  5FTH A;  4OVP A;  1LAX A;  2XXR A;  4GX6 A;  4XKN A;  1NH7 A;  4GBV A;  4BDM A;  4BDL A;  1Y9U A;  1POT A;  2CEY A;  3IAZ A;  4AQ4 A;  2VOZ A;  1B32 A;  3LC8 A;  1P1W A;  4OFL A;  3N94 A;  1FSA A;  4FE8 A;  3QMF A;  3LSL A;  2I48 A;  1SYI A;  4XXU A;  4OA4 A;  2I58 A;  2I4B A;  3OEM A;  4HCW A;  4OFO A;  2OCU A;  3LBS A;  3GXA A;  1NV4 A;  4G2Z A;  3FJ7 A;  2KLF A;  1Y20 A;  2QS4 A;  1GVC A;  5H8F A;  2I0B A;  2F7B A;  4NX1 A;  2PMS A;  1FW0 A;  5I57 B;  4DCX A;  2O6A A;  2O7U A;  1NV7 A;  5TPA A;  1B46 A;  5IZ1 A;  4DXC A;  4F39 A;  3IOU A;  4PFI A;  3UN6 A;  1NNT A;  3B6W A;  4ELR A;  2ZNU A;  4YMB A;  4KI0 E;  3M3F A;  4RK2 A;  5TP9 B;  2CZI A;  3K01 A;  1I6B A;  4H8I A;  3PPN A;  1FQA A;  3TCF A;  2HPG A;  4GWW A;  4OHN A;  5DT6 A;  2MKZ A;  3N26 A;  1BK4 A;  1OVT A;  1M5B A;  1VSO A;  2V3Q A;  5IM2 A;  3RY3 A;  5A5L A;  3WAE A;  2O68 A;  4X04 A;  3FXR A;  5BUU A;  4DLD A;  1TXF A;  3MVW A;  3C4M A;  4PFT A;  1A54 A;  5IZ3 A;  4M4G A;  4PFY A;  3ZS6 A;  3C33 A;  4KPT A;  3A3U A;  1AMF A;  1A55 A;  1B05 A;  3VLV A;  2YLN A;  1USY E;  4QFP A;  3IJX B;  4FOR A;  1LBY A;  1MPD A;  4LON B;  1DOT A;  3LV0 A;  5I56 A;  1LBW A;  1NUX A;  2FVZ A;  4P56 A;  2XX7 A;  1ZLQ A;  1IIW A;  1SPI A;  2D3I A;  2UVI A;  5KCJ A;  4QRZ A;  3G3I A;  2OWZ A;  5L9O A;  1YAE A;  3D4C A;  2DWH A;  4XTC Q;  3TUS A;  3EHS A;  4ZZE A;  4OXV A;  2ONS A;  1TWY A;  3U65 A;  2QVV A;  4MHF A;  4P1L A;  4YB6 A;  4HTG A;  1N04 A;  4ZEI A;  1JVY A;  3OO9 A;  3PU5 A;  4OFJ A;  4I40 A;  1Y4T A;  1L5T A;  3VVD A;  1NV3 A;  3NOH A;  4EF2 A;  3G3F A;  5I2N B;  4WKM A;  2GHA A;  2D21 A;  3CSB A;  3BIH A;  2ZNT A;  1EYK A;  4GWS A;  4U4X A;  4RK9 A;  1EZO A;  2B65 A;  2DOJ A;  3O6H A;  3K6X A;  1XC1 A;  4R6H A;  2PFZ A;  3K1M A;  1IXG A;  2VD3 A;  4JWY A;  3KBZ A;  3PTY A;  5IAI A;  2UXA A;  4F1U A;  4E0X A;  1FBG A;  1MDQ A;  1BP5 A;  4N4U A;  4EQ9 A;  3FZV A;  4RNS A;  5CMK A;  3KSX A;  4UA8 A;  1N0T A;  5IZZ A;  3MP1 A;  4R9G A;  4QSD A;  1TT1 A;  2FIX A;  5I58 B;  3LR1 A;  4H46 A;  4F3P A;  3SEV A;  1NKX A;  1LEV A;  2QL3 A;  1OVB A;  4Z7E A;  4OVT A;  3FXQ A;  3T22 A;  4XF5 A;  3OSQ A;  4KYE A;  4XKQ A;  5DTB A;  4EUO A;  1IMD A;  4NN3 A;  4NF5 B;  4PF6 A;  5AA4 A;  1ELJ A;  4MJO A;  3UGW A;  3TZA A;  1NUW A;  2HAV A;  1LAG E;  3T66 A;  2XWO A;  3CHG A;  4KYD A;  2ZZX A;  4GIZ A;  3BKI B;  1B7H A;  4IO5 A;  3FV2 A;  1LFI A;  4OEV A;  2I3W A;  3UP9 A;  2ZXT A;  2RCA A;  3FXB A;  1LST A;  1P1N A;  1XS5 A;  3UOR A;  2I3V A;  5CBR A;  3IFC A;  4NF4 B;  5CMC A;  4RY1 A;  3DP8 A;  4GXA A;  1FQE A;  3B6T A;  2DE2 A;  5I59 A;  1FPF A;  1KWH A;  1LBB A;  4NF0 A;  4OMB A;  2I0C A;  2AIX A;  4PAK A;  5I2K A;  1RYO A;  1URD A;  5KZT A;  3T9H B;  1LAF E;  2HFB A;  2UVJ A;  5H8N B;  1UTH A;  1FTM A;  1H43 A;  4HCY A;  4QFN A;  4FBP A;  4IY6 A;  3I3V A;  3LUY A;  4PDH A;  3OEK A;  4HE0 A;  3E13 X;  4F22 A;  4OET A;  3S9E A;  4IB2 A;  2V4C A;  3MQ9 A;  1B3L A;  4F29 A;  2QSX A;  2Y7P A;  4WXJ A;  3H6U A;  1B5H A;  3RQT A;  2Q2C A;  2RC9 A;  4H65 A;  3GLB A;  2HEU A;  3TQL A;  1P1Q A;  3PUX E;  1VR5 A;  3IFA A;  3FXU A;  3L6G A;  3IX1 A;  4NAP A;  2REG A;  2Z8F A;  1Z7N E;  1LAH E;  4MH5 A;  4P47 A;  1XT8 A;  3H3G A;  4F18 A;  2FHY A;  5CBS A;  2Z22 A;  3SKP A;  1FJ9 A;  4O94 A;  4K3F A;  1OMP A;  1QUK A;  2P2A A;  3KEI A;  1MH3 A;  1FTO A;  3D4G A;  2H4I A;  1LBX A;  4R9F A;  5H8F B;  3MPK A;  2QS2 A;  2ZYK A;  2PVU A;  4XKP A;  3VLU A;  4H5F A;  1LCT A;  2XXV A;  3G3G A;  5L9M A;  1MXW A;  3IB2 A;  2OX3 A;  5TPA B;  1B5I A;  2F3D A;  4I1D A;  2X7Q A;  1US4 A;  1B0L A;  3GYY A;  3KOS A;  4PC9 A;  5ITP A;  2DE3 A;  3ODB A;  2O69 A;  3QIM A;  2BJI A;  4IR8 A;  3O29 A;  2E1S A;  4H45 A;  2QVR A;  4TLL B;  4ZS9 A;  4P9K A;  4GOT A;  4G8M A;  2KQZ A;  1Y3Q A;  3MJN A;  4DXB A;  5CM6 A;  4GWZ A;  4QFK A;  5A5X A;  4RA1 A;  5K2Y A;  3O9P A;  3T0J A;  4X9T A;  1FTL A;  3TAJ A;  3C34 A;  2AYS A;  3ILT B;  2G29 A;  5IZ3 B;  1MY3 A;  4U22 A;  1N7X A;  5FHO A;  4GD5 A;  1FPD A;  3CI8 A;  3MP8 A;  3Q29 A;  3FVO A;  1MH4 A;  2XXW A;  3CG1 A;  5FHN A;  5F7V A;  1PB7 A;  5I5P A;  4OTE A;  3A29 A;  4BDR A;  1JQF A;  3CIJ A;  3MVY A;  1NH8 A;  3TTN A;  5I56 B;  1IMB A;  3ZKK A;  3BFT A;  2XWV A;  3M3K A;  4QHQ A;  5KCJ B;  3EN3 A;  3G3J A;  3QSL A;  4OVR A;  4U1O A;  1SI1 A;  3RNN A;  2B4M A;  2X7P A;  4PFU A;  3E79 A;  2O1M A;  1B3G A;  4YZZ A;  4IGT A;  4PFB A;  4RPN A;  2PBW A;  1I69 A;  4ONY A;  1OIB A;  4OEU A;  1LCF A;  1Q1K A;  4PFW A;  5H8S A;  1SW5 A;  3QXM A;  3R7X A;  2DSF A;  2HZK A;  3S4U A;  1OQG A;  4IO6 A;  3K0V A;  3OO8 A;  4NWC A;  3DM0 A;  3KN8 A;  4MFI A;  1MY0 A;  2XXP A;  1LGB C;  2O51 A;  1FQB A;  1II5 A;  2CEX A;  3H6V A;  1FPB A;  2V84 A;  3SEX A;  1VDW A;  1MPC A;  4X48 A;  5DW8 A;  1WVJ A;  2ESN A;  1IIT A;  3HCQ A;  4IO2 A;  1FBH A;  4ELP A;  3H7M A;  4GF8 A;  3OO6 A;  2DP8 A;  4NTL A;  1FBC A;  3TOD A;  1FBF A;  3CFZ A;  3QK6 A;  2RC8 A;  1JW4 A;  1SBP A;  1M5F A;  4Q0C A;  1MY1 A;  3PUV E;  1G0I A;  3QUJ A;  2F6G A;  3O2A A;  2XA5 A;  1JW5 A;  3SES A;  3N5L A;  4MAG A;  3KJ7 A;  4P1E A;  3KOT A;  1OQH A;  5EQA A;  1NL5 A;  5ET8 A;  4QF9 A;  4GWX A;  3TKD A;  3SDF A;  4YU0 A;  1P99 A;  4AS5 A;  1NUY A;  1JVX A;  4TOZ A;  5F1Q A;  2RKM A;  3JV9 A;  2F7C A;  4GFR A;  4PP0 A;  3Q28 A;  3TEP A;  1EZP A;  1S50 A;  1NV5 A;  1D9Q A;  4NF6 A;  3USD A;  3I6V A;  4TLM B;  1NV2 A;  2GH9 A;  5H8H A;  4MF3 A;  4JSD A;  1LBZ A;  1O64 A;  1IZ1 A;  1FPE A;  3RT6 B;  3FVG A;  4KD5 A;  1B9J A;  3IOR A;  1QGX A;  3B6Q A;  5AA2 A;  5I59 B;  3C31 A;  5FBP A;  1H76 A;  1D9V A;  2RCB A;  5ITO A;  3K2D A;  1WDN A;  4I9D A;  4YKI A;  3KZG A;  5I2K B;  4FAT A;  3CFX A;  3LSX A;  4H67 A;  1IMF A;  1JW1 A;  1FBE A;  3SEU A;  2B3F A;  3CVG A;  1UTH B;  2CZL A;  2Q8J A;  2GQ1 A;  3PPO A;  3FBP A;  4C0R A;  1FTJ A;  1NV1 A;  3CRB A;  4G8H A;  2GFE A;  4F2Q A;  1MQH A;  3SER A;  2QVU A;  4OVJ A;  3V83 A;  4YB5 A;  4R75 A;  2Y7W A;  4ESW A;  2VGQ A;  3PMW A;  3T93 B;  2I6E A;  4MMP A;  5DVF A;  2P0S A;  4H8J A;  3WAF A;  3IR1 A;  3M3L A;  2YJP A;  4JXI A;  4ZED A;  2QS1 A;  1URS A;  4NQ8 A;  5IGA A;  2QJE A;  2DXR A;  3R26 A;  3KN3 A;  3V5A A;  3DLN A;  4O3C A;  3K1N A;  3LSW A;  1BIY A;  4JVD A;  4OAN A;  1D9Y A;  2F34 A;  2NWJ A;  5CRY A;  4JSO A;  3O6I A;  2WEF A;  3KSJ A;  4QFO A;  1JET A;  1K9Y A;  1ZKB A;  3H4Z A;  2NUV A;  2Q8M A;  1FPI A;  3GBA A;  1MXY A;  1FRP A;  3CSG A;  3O66 A;  2I4C A;  4O3B A;  2QMX A;  1NV0 A;  4KYS A;  4PAF A;  1GR2 A;  4LAT A;  4O7M A;  2CZK A;  4GQO A;  2FYI A;  1OLA A;  1KA1 A;  4OYV A;  2UVG A;  3KN7 A;  2H5Y A;  1BKA A;  1XOC A;  1MQI A;  2ZYN A;  4MEV A;  1ANF A;  2CZH A;  3VDF A;  1VFE A;  1ZJL A;  1POY 1;  4R73 A;  1YXI A;  3HV1 A;  4ZEB A;  1M5C A;  4LN5 A;  3ONM A;  3EF7 A;  1MQG A;  5A5X B;  4PBH A;  4UAB A;  3Q26 A;  3TQW A;  3TCG A;  2PFY A;  4FJP A;  4G68 A;  1FPK A;  3SEW A;  2Y84 A;  1MQJ A;  1B3E A;  2QPQ A;  4U2R A;  3ZSF A;  4MX6 A;  4KCD A;  3IO6 A;  3OEN A;  2DYX A;  3S9M C;  3MPL A;  4POW A;  4JB7 A;  2OZZ A;  2HCA A;  2ONK E;  3HN0 A;  5JEI A;  4MCO A;  1QJM A;  4ND9 A;  1ATG A;  4JVC A;  3DP4 A;  5L9S A;  1B2H A;  3RGY A;  5M2V A;  3IB0 A;  1EU8 A;  4HXV A;  2DWA A;  1B4Z A;  4KCC A;  2PT2 A;  4C1T A;  4JBZ A;  2GHB A;  5AA1 A;  2H99 A;  4BDN A;  1NNP A;  4WED A;  2UYF A;  3O97 A;  3KJT A;  3OOA A;  3G3K A;  2B4L A;  3FV1 A;  3AXF A;  4N6P A;  2RC7 A;  5F24 A;  4DI3 D;  3EKI A;  4Q30 B;  5EHS A;  2OBG A;  4OWD A;  4X1D A;  1Y4C A;  2WBB A;  5FHM A;  1JNF A;  1RDX A;  4G77 A;  4MLQ A;  4RYA A;  4QSC A;  3VVF A;  4G68 C;  2PX1 A;  1Q35 A;  5HM4 B;  1IUD A;  4PCD A;  1SYH A;  1Y1M A;  2Z8D A;  1B7Z A;  2XXU A;  3K1P A;  3RPL A;  1Y3P A;  5ET7 A;  4DCY A;  4F3S A;  4ZDM A;  2XXT A;  2OLB A;  1FCK A;  4GVO A;  2AL5 A;  2P3V A;  4PF8 A;  5AA2 D;  1QKA A;  1M5D A;  3MST A;  4GWY A;  4H1X A;  4EXK A;  2ZZV A;  1N3X A;  1SW1 A;  2IEE A;  3U8Q A;  4E0W A;  3KBR A;  1NMU A;  3K6V A;  2XXX A;  2VPO A;  4QBA A;  4R6Y A;  5EYH A;  3EHT A;  4O7I A;  1MY2 A;  1SVX B;  1SW2 A;  3BFU A;  3BBR A;  4BLA A;  1XHY A;  4QSE A;  5DYH A;  3CR9 A;  4DI4 B;  2Y7K A;  1TFD A;  4N17 A;  1QKB A;  2A5T A;  1AOV A;  1B3F A;  1MG1 A;  2DXY A;  4N15 A;  1N7W A;  2XWK A;  4F31 B;  1IMA A;  3PGF A;  3SEY A;  1FBD A;  2HHM A;  3IJO B;  2F6P A;  3PUW E;  4U23 A;  1B6H A;  2FIE A;  4GX3 A;  1EYJ A;  1JP4 A;  3K02 A;  4NF6 B;  3LSF B;  2F78 A;  5EQ9 A;  2OWT A;  4NMY A;  3CFL A;  4PE3 A;  1PBP A;  1PEB A;  2P3N A;  2NVU B;  5H8H B;  3VXC A;  3RUM A;  3RLF E;  3PD9 A;  2WBD A;  3W9W A;  3FGS A;  4DIG A;  4QXD A;  4R6K A;  5HPQ A;  1B0H A;  1HSE A;  1R9Q A;  1US5 A;  4YKP A;  4WEP A;  3UA8 A;  2O84 X;  5J1D A;  1YYZ A;  4P3L A;  5AA2 B;  4BDO A;  1Y3N A;  4N07 A;  2V3U A;  2QS3 A;  5CI5 A;  1N3W A;  3OXN A;  1FQD A;  1R1N A;  4MNP A;  3IK6 B;  4GL0 A;  3B50 A;  2FBP A;  4BDQ A;  1B58 A;  4P8B A;  3TPA A;  1B51 A;  1Z7M E;  3FD3 A;  1KA0 A;  4DE8 A;  1AWB A;  1CE2 A;  1JEU A;  2FA7 A;  2A5S A;  4FEC A;  3PMV A;  1DBZ A;  1F9B A;  4OES A;  2DWJ A;  3SZP A;  3TMG A;  1QUL A;  2ZNS A;  4PET A;  4NF5 A;  1K9Z A;  1XVX A;  4LQ5 A;  4N6D A;  4N8Y A;  2M8C A;  1DPP A;  1NV6 A;  1B1X A;  4KFQ A;  3IOW A;  1CNQ A;  2CMO A;  3OSR A;  1GTK A;  3MP6 A;  3G3H A;  2QMW A;  4ISU A;  4Q8R A;  4GL8 A;  1IME A;  4KHZ E;  2VT5 A;  3PUZ E;  4AS4 A;  4N81 A;  1NNK A;  1FPG A;  4NGU A;  5CMB A;  4IGR A;  1NNF A;  1I6A A;  4Q5T A;  4GWU A;  1QVS A;  3FAT A;  4ECF A;  1RYX A;  2F3B A;  1J1N A;  1PBQ A;  3KGC A;  2XD2 A;  3EHU A;  3ECR A;  1RKM A;  4PQJ A;  2L5V A;  3TYH A;  1IXH A;  3PUY E;  2UVH A;  4PDD A;  5JTY A;  3PMX A;  1MPB A;  4H5G A;  4EXL A;  1N76 A;  4I62 A;  3OMB A;  3MZB A;  4GBW A;  3TDJ A;  4JWO A;  5KDT A;  1QUI A;  3CG3 A;  3HO7 A;  4I8C A;  3RT8 A;  1SI0 A;  4N13 A;  3T9V A;  4DZ1 A;  4LZ7 A;  2R9J A;  2NXO A;  4HS7 A;  1AH5 A;  3B8B A;  3UIF A;  1RDY A;  1LFH A;  2OJT A;  4G68 B;  3IL1 B;  3QYT A;  3VLW A;  2PYY A;  2W7Y A;  3LUZ A;  1CB6 A;  1FPJ A;  4PGN A;  2AL4 A;  5B7D A;  4FIM A;  1G0H A;  4I3Y A;  1GV8 A;  1LB8 A;  1WOD A;  2F97 A;  3C32 A;  3S9N C;  4LA9 A;  1UTB A;  2B3B A;  3C35 A;  3IOV A;  5EHM A;  4LZ8 A;  3N6U A;  3MUQ A;  5EQ7 A;  1ZBM A;  5BWJ A;  2ANJ A;  2FNC A;  1LB9 A;  5AA4 B;  3T1B A;  4F3B A;  3S2V A;  3Q27 A;  5ICQ A;  1INP A;  1YZ0 A;  3I5O A;  1ZU0 A;  1D3K A;  1R6Z A;  4QFL A;  2I49 A;  4NE4 A;  4ELQ A;  2D5W A;  1RDZ A;  1A8F A;  2XWI A;  3VFJ A;  3A3C A;  3TTL A;  1T0K A;  1YCJ A;  2VHA A;  2JJK A;  3MZ9 A;  2R8T A;  4ZEK A;  4NWD A;  4AB5 A;  1AL3 A;  3H06 B;  4ZE9 A;  1SDX A;  3KG2 A;  3THI A;  3OEL A;  3MC2 A;  1UIU A;  3MWB A;  1N84 A;  4PAI A;  5DVI A;  3RPL B;  4PFR A;  2ZMB A;  4RXL A;  4P0I A;  4OER A;  3B7D A;  2G93 A;  1XI6 A;  4U4S A;  5H8Q A;  5ESY A;  3C36 A;  2DVZ A;  1S9T A;  4LUB A;  1ZTY A;  1EH3 A;  3VE1 B;  5LOM A;  2PT1 A;  3EPE A;  4ZEC A;  2H9B A;  1HSJ A;  1SQY A;  3ZKL A;  1SD3 A;  4EQB A;  1PDA A;  1S7Y A;  4LZ5 A;  1NI9 A;  4OVQ A;  5HBC A;  2DVC A;  2Z8E A;  1BTJ A;  5EQ8 A;  1FTA A;  1VFD A;  4R2B A;  3U94 A;  2XXY A;  3MVZ A;  2WYK A;  2Q89 A;  1B52 A;  2Y7R A;  1PB9 A;  4JWX A;  2KR0 A;  4AB6 A;  2ZYM A;  2A5T B;  3JYR A;  4DXU A;  3N6T A;  3F11 A;  2HAU A;  4NG7 A;  1H45 A;  3D1R A;  3RPW A;  2DDK A;  4IO3 A;  1MXZ A;  4LP2 B;  1OLC A;  4YKK A;  3QAX A;  3M8U A;  1O63 A;  4P11 A;  4O8M A;  3V8X B;  3S9L C;  2Y7I A;  2XXI A;  2THI A;  4LVQ A;  1URG A;  3RTW B;  5I7I A;  3H6T A;  2F36 A;  4NHB A;  1KZ8 A;  3VXB A;  1I6Q A;  1DTG A;  1B5J A;  1A8E A;  4R2F A;  1SW4 A;  2GRV A;  4KR5 A;  2O7I A;  2RIN A;  2V93 A;  1DCU A;  3KC1 A;  1LLS A;  4YB7 A;  3HST A;  5EYF A;  4U1Z A;  3H6W A;  4OEN A;  4U21 A;  5DEX A;  4POX A;  4H0W A;  3GZG A;  3ROJ A;  3FIR A;  4NF8 A;  4UAC A;  1A40 A;  2DWI A;  4PGP A;  2RF1 A;  3A09 A;  5ET5 A;  4F19 A;  4PTK A;  4IO7 A;  4MBP A;  2F7A A;  4IO4 A;  3E9X A;  5TU0 A;  5LTC A;  1DMB A;  3FVN A;  3FJM A;  3K4U A;  4P0G A;  3V89 B;  1VE4 A;  3U93 A;  1FQC A;  1H3D A;  3OD7 A;  1MM7 A;  1PB8 A;  4GRK A;  3FVK A;  1MDP 1;  1XVY A;  2VD2 A;  5L8D A;  4X8R A;  4YMA A;  4G4P A;  3KC0 A;  3HPI A;  5CC2 A;  1YPN A;  1H44 A;  2Q74 A;  4YKJ A;  1MS7 A;  5I57 A;  1QW0 A;  2HZL A;  1DTZ A;  4PE5 B;  3RTF B;  2PCR A;  2WKY A;  1NFT A;  1UQW A;  3E3K A;  2E0S A;  4KXP A;  1P1U A;  2XHD A;  4FAJ A;  1MXX A;  1P1O A;  3PPQ A;  4N8G A;  3IO4 A;  3UK4 A;  4XKR A;  5ICT A;  3O28 A;  5TP9 A;  1B7U A;  1M5E A;  3MVX A;  4YIC A;  2H98 A;  3E78 A;  3MAM A;  1GGG A;  3MBP A;  3SET A;  4R74 A;  4XFE A;  4DDD A;  4GXS B;  5JTY B; 
#chains in the Genus database with same CATH homology
 1LFG A;  5CMM A;  1D4N A;  2DS9 A;  4R72 A;  4RPO A;  2XX8 A;  3IOT A;  4EDP A;  5B70 A;  5KDT B;  4X1B A;  4GLI A;  3JZJ A;  1IQ7 A;  2XX9 A;  3Q25 A;  4LQ2 A;  1ZMG A;  4JDF A;  2ONR A;  2F35 A;  3G7W A;  1BLF A;  4MLV A;  3C9H A;  1MRP A;  1IXC A;  3K6U A;  1MXU A;  2OWS A;  1MM6 A;  3VV5 A;  1B40 A;  4F3G A;  3T96 B;  3K00 A;  3RN8 A;  2XXH A;  1FQF A;  3U1O A;  2QRY A;  1UTB B;  4Z0I A;  3TEL A;  1PC3 A;  3U92 A;  4F1Y A;  3OO7 A;  3VVE A;  5IKB A;  1EZ9 A;  3GBB A;  4ELO A;  3FUZ A;  3EQ1 A;  1Y1Z A;  4ZEF A;  2Q9T A;  3K6W A;  3TCH A;  2Q88 A;  2REJ A;  5I2N A;  2V25 A;  2R6G E;  3PD8 A;  4FEB A;  2H25 A;  4H6D A;  3U72 A;  1R9L A;  5ELV A;  2ABH A;  3MZ1 A;  4THI A;  4O3A A;  1DSN A;  3FAS A;  3PPR A;  4ESX A;  2XXQ A;  1MQD A;  4F1V A;  5JK4 A;  3DEL B;  4XIG Q;  2LAO A;  3T9X B;  3W15 C;  1A7L A;  5ISU A;  4YAH X;  2IA4 A;  2XD3 A;  3KFM A;  3PV0 E;  4GWO A;  5H8Q B;  3MW0 A;  1JEV A;  3O6G A;  4KQP A;  5I58 A;  1DPE A;  1UIV A;  3L6H A;  4G8N A;  1IXI A;  2YPN A;  3HHG A;  3TTK A;  3T9U A;  2BJJ X;  4M1V A;  1QUJ A;  3W9V A;  2NOO A;  2ZYO A;  1A99 A;  3PPP A;  1TFA A;  1MY4 A;  2Q2A A;  4EQ7 A;  4RJZ A;  4OZ9 A;  3IB1 A;  4IY5 A;  1HSL A;  1FTK A;  3QUF A;  4EF1 A;  2DE4 A;  1AIV A;  2X26 A;  3HHF A;  1YTV A;  3TTM A;  2V3T A;  1B3H A;  3TTR A;  4F2O A;  2HXW A;  1B1H A;  2DQV A;  4C1U A;  1USY H;  3P7I A;  4NF4 A;  1O7T A;  2F8D A;  4HW8 A;  3ILU B;  1B4H A;  2P1S A;  4ZE8 A;  1IEJ A;  3FJG A;  3H03 A;  5I84 A;  2ALU A;  1LBC A;  5DVJ A;  2O1L A;  2HQ0 A;  4NED A;  5FTI A;  3R6U A;  5H8N A;  3TFL A;  2OK2 A;  1ZIU A;  4TQU Q;  3E4R A;  2Z23 A;  4L17 A;  5DEX B;  2UYE A;  2R71 A;  2F5X A;  5AA3 A;  5AE4 A;  4FED A;  4ZZA A;  5K2X A;  1MXV A;  3DP6 A;  4NF8 B;  4OQO A;  2VP1 A;  5FTH A;  1LAX A;  2XXR A;  4XKN A;  1NH7 A;  4BDM A;  4BDL A;  1Y9U A;  1POT A;  3IAZ A;  4AQ4 A;  2VOZ A;  1B32 A;  3LC8 A;  1P1W A;  4OFL A;  3N94 A;  4FE8 A;  3LSL A;  2I48 A;  1SYI A;  4XXU A;  2I58 A;  2I4B A;  3OEM A;  4HCW A;  4OFO A;  2OCU A;  3LBS A;  3GXA A;  4G2Z A;  3FJ7 A;  2KLF A;  1Y20 A;  2QS4 A;  1GVC A;  5H8F A;  2I0B A;  2F7B A;  2PMS A;  1FW0 A;  5I57 B;  4DCX A;  2O6A A;  2O7U A;  5TPA A;  1B46 A;  4DXC A;  4F39 A;  3IOU A;  3UN6 A;  1NNT A;  3B6W A;  4ELR A;  2ZNU A;  4YMB A;  4KI0 E;  3M3F A;  4RK2 A;  5TP9 B;  3K01 A;  1I6B A;  4H8I A;  3PPN A;  1FQA A;  3TCF A;  4OHN A;  5DT6 A;  3N26 A;  1OVT A;  2V3Q A;  1M5B A;  1VSO A;  3RY3 A;  3WAE A;  2O68 A;  3FXR A;  5BUU A;  4DLD A;  1TXF A;  3MVW A;  3C4M A;  4PFT A;  1A54 A;  4M4G A;  4PFY A;  3ZS6 A;  3C33 A;  4KPT A;  3A3U A;  1AMF A;  1A55 A;  1B05 A;  3VLV A;  2YLN A;  1USY E;  4QFP A;  3IJX B;  4FOR A;  1MPD A;  4LON B;  1DOT A;  5I56 A;  2XX7 A;  1ZLQ A;  1IIW A;  2D3I A;  2UVI A;  5KCJ A;  4QRZ A;  3G3I A;  5L9O A;  1YAE A;  3D4C A;  2DWH A;  4XTC Q;  3TUS A;  3EHS A;  4ZZE A;  4OXV A;  2ONS A;  1TWY A;  4YB6 A;  4HTG A;  1N04 A;  4ZEI A;  1JVY A;  3OO9 A;  3PU5 A;  4OFJ A;  1Y4T A;  1L5T A;  3VVD A;  4EF2 A;  3G3F A;  5I2N B;  4WKM A;  2GHA A;  2D21 A;  3CSB A;  2ZNT A;  4U4X A;  4RK9 A;  1EZO A;  2B65 A;  2DOJ A;  3O6H A;  3K6X A;  1XC1 A;  4R6H A;  3K1M A;  1IXG A;  2VD3 A;  4JWY A;  5IAI A;  2UXA A;  4F1U A;  4E0X A;  1MDQ A;  1BP5 A;  4EQ9 A;  3FZV A;  4RNS A;  5CMK A;  3KSX A;  4UA8 A;  1N0T A;  3MP1 A;  4R9G A;  4QSD A;  1TT1 A;  5I58 B;  3LR1 A;  4F3P A;  3SEV A;  1NKX A;  2QL3 A;  1OVB A;  4Z7E A;  3FXQ A;  3T22 A;  3OSQ A;  4KYE A;  4XKQ A;  5DTB A;  4EUO A;  4NF5 B;  5AA4 A;  1ELJ A;  3UGW A;  3TZA A;  2HAV A;  1LAG E;  3T66 A;  4KYD A;  4GIZ A;  3BKI B;  1B7H A;  4IO5 A;  3FV2 A;  1LFI A;  4OEV A;  2I3W A;  3UP9 A;  2ZXT A;  2RCA A;  1LST A;  1P1N A;  1XS5 A;  3UOR A;  2I3V A;  5CBR A;  4NF4 B;  5CMC A;  4RY1 A;  3DP8 A;  4GXA A;  1FQE A;  3B6T A;  2DE2 A;  5I59 A;  1KWH A;  1LBB A;  4OMB A;  2I0C A;  2AIX A;  5I2K A;  1RYO A;  1URD A;  5KZT A;  3T9H B;  1LAF E;  2HFB A;  2UVJ A;  5H8N B;  1UTH A;  1FTM A;  1H43 A;  4HCY A;  4QFN A;  4IY6 A;  3I3V A;  3LUY A;  3OEK A;  3E13 X;  4F22 A;  4OET A;  3S9E A;  4IB2 A;  3MQ9 A;  1B3L A;  4F29 A;  2QSX A;  2Y7P A;  4WXJ A;  3H6U A;  1B5H A;  3RQT A;  2Q2C A;  2RC9 A;  4H65 A;  3GLB A;  2HEU A;  3TQL A;  1P1Q A;  3PUX E;  1VR5 A;  3FXU A;  3L6G A;  3IX1 A;  2REG A;  2Z8F A;  1Z7N E;  1LAH E;  4MH5 A;  1XT8 A;  3H3G A;  4F18 A;  5CBS A;  2Z22 A;  3SKP A;  4K3F A;  1OMP A;  1QUK A;  2P2A A;  3KEI A;  1MH3 A;  1FTO A;  3D4G A;  2H4I A;  4R9F A;  5H8F B;  3MPK A;  2QS2 A;  2ZYK A;  2PVU A;  4XKP A;  3VLU A;  4H5F A;  1LCT A;  2XXV A;  3G3G A;  5L9M A;  1MXW A;  3IB2 A;  5TPA B;  1B5I A;  4I1D A;  2X7Q A;  1US4 A;  1B0L A;  3KOS A;  5ITP A;  2DE3 A;  3ODB A;  2O69 A;  3QIM A;  3O29 A;  2E1S A;  4TLL B;  4ZS9 A;  4GOT A;  4G8M A;  3MJN A;  1Y3Q A;  4DXB A;  5CM6 A;  4QFK A;  5A5X A;  4RA1 A;  5K2Y A;  3O9P A;  4X9T A;  1FTL A;  3TAJ A;  3C34 A;  2AYS A;  3ILT B;  2G29 A;  1MY3 A;  4U22 A;  1N7X A;  5FHO A;  4GD5 A;  3CI8 A;  3MP8 A;  3Q29 A;  3FVO A;  1MH4 A;  2XXW A;  3CG1 A;  5FHN A;  5F7V A;  1PB7 A;  4OTE A;  4BDR A;  1JQF A;  3CIJ A;  3MVY A;  1NH8 A;  3TTN A;  5I56 B;  3ZKK A;  3BFT A;  3M3K A;  4QHQ A;  5KCJ B;  3EN3 A;  3G3J A;  3QSL A;  4U1O A;  1SI1 A;  3RNN A;  2X7P A;  4PFU A;  2O1M A;  1B3G A;  4YZZ A;  4IGT A;  4RPN A;  2PBW A;  1I69 A;  4ONY A;  1OIB A;  4OEU A;  1LCF A;  1Q1K A;  4PFW A;  5H8S A;  1SW5 A;  3QXM A;  3R7X A;  2DSF A;  2HZK A;  3S4U A;  1OQG A;  4IO6 A;  3K0V A;  3OO8 A;  4NWC A;  3DM0 A;  3KN8 A;  4MFI A;  1MY0 A;  2XXP A;  1LGB C;  2O51 A;  1FQB A;  1II5 A;  3H6V A;  2V84 A;  3SEX A;  1MPC A;  4X48 A;  1WVJ A;  2ESN A;  1IIT A;  3HCQ A;  4IO2 A;  4ELP A;  3H7M A;  4GF8 A;  3OO6 A;  2DP8 A;  4NTL A;  3TOD A;  3CFZ A;  3QK6 A;  2RC8 A;  1JW4 A;  1SBP A;  1M5F A;  4Q0C A;  1MY1 A;  3PUV E;  3QUJ A;  2F6G A;  3O2A A;  1JW5 A;  3SES A;  3N5L A;  3KJ7 A;  3KOT A;  1OQH A;  1NL5 A;  4QF9 A;  3TKD A;  3SDF A;  4YU0 A;  1P99 A;  1JVX A;  4TOZ A;  5F1Q A;  2RKM A;  3JV9 A;  2F7C A;  4GFR A;  4PP0 A;  3Q28 A;  3TEP A;  1EZP A;  1S50 A;  4NF6 A;  3USD A;  3I6V A;  4TLM B;  2GH9 A;  5H8H A;  4MF3 A;  4JSD A;  1O64 A;  1IZ1 A;  3RT6 B;  3FVG A;  4KD5 A;  1B9J A;  3IOR A;  3B6Q A;  5AA2 A;  5I59 B;  3C31 A;  1H76 A;  1D9V A;  2RCB A;  5ITO A;  3K2D A;  1WDN A;  4I9D A;  4YKI A;  3KZG A;  5I2K B;  4FAT A;  3CFX A;  3LSX A;  4H67 A;  1JW1 A;  3SEU A;  2B3F A;  3CVG A;  1UTH B;  2CZL A;  2Q8J A;  3PPO A;  4C0R A;  1FTJ A;  3CRB A;  4G8H A;  2GFE A;  4F2Q A;  1MQH A;  3SER A;  4OVJ A;  3V83 A;  4YB5 A;  4R75 A;  2Y7W A;  4ESW A;  2VGQ A;  3PMW A;  3T93 B;  2I6E A;  5DVF A;  2P0S A;  4H8J A;  3WAF A;  3IR1 A;  3M3L A;  2YJP A;  4JXI A;  4ZED A;  2QS1 A;  1URS A;  2QJE A;  2DXR A;  3R26 A;  3KN3 A;  3V5A A;  3DLN A;  4O3C A;  3K1N A;  3LSW A;  1BIY A;  1D9Y A;  2F34 A;  2NWJ A;  5CRY A;  4JSO A;  3O6I A;  3KSJ A;  4QFO A;  1JET A;  1ZKB A;  3H4Z A;  2NUV A;  3GBA A;  1MXY A;  3CSG A;  3O66 A;  2I4C A;  4O3B A;  2QMX A;  4KYS A;  1GR2 A;  4LAT A;  4GQO A;  2FYI A;  1OLA A;  4OYV A;  2UVG A;  3KN7 A;  2H5Y A;  1BKA A;  1XOC A;  1MQI A;  2ZYN A;  1ANF A;  3VDF A;  1VFE A;  1ZJL A;  1POY 1;  4R73 A;  4ZEB A;  3HV1 A;  1M5C A;  3ONM A;  3EF7 A;  1MQG A;  5A5X B;  3Q26 A;  3TQW A;  3TCG A;  4FJP A;  4G68 A;  3SEW A;  2Y84 A;  1MQJ A;  1B3E A;  2QPQ A;  4U2R A;  3ZSF A;  4KCD A;  3IO6 A;  3OEN A;  2DYX A;  3S9M C;  3MPL A;  4POW A;  4JB7 A;  2OZZ A;  2HCA A;  2ONK E;  3HN0 A;  5JEI A;  1QJM A;  4ND9 A;  1ATG A;  3DP4 A;  5L9S A;  1B2H A;  3RGY A;  5M2V A;  3IB0 A;  1EU8 A;  2DWA A;  1B4Z A;  4KCC A;  2PT2 A;  4C1T A;  4JBZ A;  2GHB A;  5AA1 A;  2H99 A;  4BDN A;  1NNP A;  4WED A;  2UYF A;  3O97 A;  3KJT A;  3OOA A;  3G3K A;  3FV1 A;  3AXF A;  4N6P A;  2RC7 A;  4Q30 B;  5EHS A;  2OBG A;  4OWD A;  4X1D A;  1Y4C A;  5FHM A;  1JNF A;  4G77 A;  4MLQ A;  4RYA A;  4QSC A;  3VVF A;  4G68 C;  2PX1 A;  1Q35 A;  5HM4 B;  1IUD A;  1SYH A;  1Y1M A;  2Z8D A;  1B7Z A;  2XXU A;  3K1P A;  1Y3P A;  4DCY A;  4F3S A;  4ZDM A;  2XXT A;  2OLB A;  1FCK A;  4GVO A;  2AL5 A;  5AA2 D;  1QKA A;  1M5D A;  4H1X A;  4EXK A;  1N3X A;  1SW1 A;  2IEE A;  3U8Q A;  4E0W A;  3KBR A;  1NMU A;  3K6V A;  2XXX A;  4R6Y A;  3EHT A;  1MY2 A;  1SVX B;  1SW2 A;  3BFU A;  3BBR A;  4BLA A;  1XHY A;  4QSE A;  5DYH A;  3CR9 A;  2Y7K A;  1TFD A;  1QKB A;  2A5T A;  1AOV A;  1B3F A;  1MG1 A;  2DXY A;  1N7W A;  4F31 B;  3PGF A;  3SEY A;  3IJO B;  2F6P A;  3PUW E;  4U23 A;  1B6H A;  3K02 A;  4NF6 B;  3LSF B;  2F78 A;  2OWT A;  4NMY A;  3CFL A;  1PBP A;  1PEB A;  2NVU B;  5H8H B;  3VXC A;  3RUM A;  3RLF E;  3PD9 A;  3W9W A;  3FGS A;  4DIG A;  4R6K A;  5HPQ A;  1B0H A;  1HSE A;  1R9Q A;  1US5 A;  4YKP A;  4WEP A;  3UA8 A;  2O84 X;  5J1D A;  5AA2 B;  4BDO A;  1Y3N A;  4N07 A;  2V3U A;  2QS3 A;  5CI5 A;  1N3W A;  3OXN A;  1FQD A;  1R1N A;  3IK6 B;  4GL0 A;  4BDQ A;  1B58 A;  3TPA A;  1B51 A;  1Z7M E;  3FD3 A;  4DE8 A;  1CE2 A;  1JEU A;  2FA7 A;  2A5S A;  4FEC A;  3PMV A;  1F9B A;  4OES A;  2DWJ A;  3TMG A;  1QUL A;  2ZNS A;  4PET A;  4NF5 A;  1XVX A;  4LQ5 A;  2M8C A;  1DPP A;  1B1X A;  4KFQ A;  3IOW A;  2CMO A;  3OSR A;  1GTK A;  3MP6 A;  3G3H A;  2QMW A;  4ISU A;  4Q8R A;  4GL8 A;  4KHZ E;  3PUZ E;  1NNK A;  5CMB A;  4IGR A;  1NNF A;  1I6A A;  4Q5T A;  1QVS A;  3FAT A;  4ECF A;  1RYX A;  1J1N A;  1PBQ A;  3KGC A;  2XD2 A;  3EHU A;  3ECR A;  1RKM A;  4PQJ A;  3TYH A;  1IXH A;  3PUY E;  2UVH A;  5JTY A;  3PMX A;  1MPB A;  4H5G A;  4EXL A;  1N76 A;  4I62 A;  3OMB A;  3MZB A;  3TDJ A;  4JWO A;  5KDT A;  1QUI A;  3CG3 A;  3HO7 A;  4I8C A;  3RT8 A;  1SI0 A;  4N13 A;  3T9V A;  4DZ1 A;  4LZ7 A;  2R9J A;  2NXO A;  4HS7 A;  1AH5 A;  3UIF A;  1LFH A;  2OJT A;  4G68 B;  3IL1 B;  3QYT A;  3VLW A;  2PYY A;  2W7Y A;  1CB6 A;  2AL4 A;  5B7D A;  4FIM A;  1GV8 A;  1LB8 A;  1WOD A;  2F97 A;  3C32 A;  3S9N C;  4LA9 A;  1UTB A;  2B3B A;  3C35 A;  3IOV A;  5EHM A;  4LZ8 A;  3N6U A;  3MUQ A;  1ZBM A;  5BWJ A;  2ANJ A;  2FNC A;  1LB9 A;  5AA4 B;  4F3B A;  3S2V A;  3Q27 A;  5ICQ A;  3I5O A;  1ZU0 A;  1D3K A;  1R6Z A;  4QFL A;  2I49 A;  4NE4 A;  4ELQ A;  2D5W A;  1A8F A;  3VFJ A;  3A3C A;  3TTL A;  1T0K A;  1YCJ A;  2VHA A;  3MZ9 A;  4ZEK A;  4NWD A;  4AB5 A;  1AL3 A;  3H06 B;  4ZE9 A;  1SDX A;  3KG2 A;  3THI A;  3OEL A;  3MC2 A;  1UIU A;  3MWB A;  1N84 A;  5DVI A;  2ZMB A;  4RXL A;  4OER A;  4P0I A;  3B7D A;  2G93 A;  4U4S A;  5H8Q A;  3C36 A;  2DVZ A;  1S9T A;  4LUB A;  1ZTY A;  1EH3 A;  3VE1 B;  5LOM A;  2PT1 A;  3EPE A;  4ZEC A;  2H9B A;  1HSJ A;  1SQY A;  3ZKL A;  1SD3 A;  4EQB A;  1PDA A;  1S7Y A;  4LZ5 A;  5HBC A;  2DVC A;  2Z8E A;  1BTJ A;  1VFD A;  4R2B A;  3U94 A;  2XXY A;  3MVZ A;  2Q89 A;  1B52 A;  2Y7R A;  1PB9 A;  4JWX A;  4AB6 A;  2ZYM A;  2A5T B;  3JYR A;  4DXU A;  3N6T A;  3F11 A;  2HAU A;  1H45 A;  3RPW A;  4IO3 A;  1MXZ A;  4LP2 B;  1OLC A;  4YKK A;  3QAX A;  3M8U A;  1O63 A;  4P11 A;  3V8X B;  3S9L C;  2Y7I A;  2XXI A;  2THI A;  4LVQ A;  1URG A;  3RTW B;  3H6T A;  2F36 A;  3VXB A;  1I6Q A;  1DTG A;  1B5J A;  1A8E A;  4R2F A;  1SW4 A;  2GRV A;  4KR5 A;  2O7I A;  2RIN A;  2V93 A;  1LLS A;  4YB7 A;  3HST A;  5EYF A;  4U1Z A;  3H6W A;  4OEN A;  4U21 A;  5DEX A;  4POX A;  4H0W A;  3GZG A;  3FIR A;  4NF8 A;  4UAC A;  1A40 A;  2DWI A;  2RF1 A;  3A09 A;  4F19 A;  4IO7 A;  4MBP A;  2F7A A;  4IO4 A;  3E9X A;  5TU0 A;  1DMB A;  3FVN A;  3FJM A;  3K4U A;  4P0G A;  3V89 B;  1VE4 A;  3U93 A;  1FQC A;  1H3D A;  3OD7 A;  1MM7 A;  1PB8 A;  4GRK A;  3FVK A;  1MDP 1;  1XVY A;  2VD2 A;  5L8D A;  4YMA A;  4G4P A;  3HPI A;  5CC2 A;  1YPN A;  1H44 A;  4YKJ A;  1MS7 A;  5I57 A;  1QW0 A;  2HZL A;  1DTZ A;  4PE5 B;  3RTF B;  2WKY A;  1NFT A;  1UQW A;  3E3K A;  2E0S A;  1P1U A;  2XHD A;  4FAJ A;  1MXX A;  1P1O A;  3PPQ A;  3IO4 A;  3UK4 A;  4XKR A;  5ICT A;  3O28 A;  5TP9 A;  1B7U A;  1M5E A;  3MVX A;  4YIC A;  2H98 A;  3MAM A;  1GGG A;  3MBP A;  3SET A;  4R74 A;  4DDD A;  4GXS B;  5JTY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...