4KPUA

Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
338
Chain Sequence
NTKGLKTGNEKDLWVYVEHYKGEPVHVVYELLGECRKLADKCNQKLAAVLITDDAKDVPSKLIARGADLVYVCQDPAFKYYSTDEYTNAFCEMIDEYQPSSVFIGATNDGRDLGPRIAARVNTGLCADCTILDAEEDGLIEWTRPAAGGNIMATILCKEHRPQMGTVRPKTFKAMEPDASRTGEVINYTLKNHVDDRVTCIRREEVVSEGEMAIDDAPFVCSGGRGMKAKENFSLLYDLAHALGGAVGGSRAAVDEGFIEHPRQVGQSGKTVTPKIYFACGISGSVQHKAGMSKSDTIVCINKDPDAPMFEISKYGIVGDALKILPLLTAKIKAFKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Electron transfer flavoprotein alpha subunit
publication title Studies on the Mechanism of Electron Bifurcation Catalyzed by Electron Transferring Flavoprotein (Etf) and Butyryl-CoA Dehydrogenase (Bcd) of Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Electron transport
total genus 115
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
A PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kpuA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4kpuA02
3FHJA 2D54A 4ND6A 1O94C 3C8ZA 3COWA 2H2DA 4U8HA 4ZT5A 4KR6A 3FIUA 2HGZA 4MPPA 3IMEA 3I05A 2Q29A 1QQTA 3VU8A 2CYAA 2Q5QA 3PKIA 3PNBA 4KPUB 4J1TC 3FDXA 1VBKA 4MW2A 2UZ1A 3CR8A 4V1CA 4BUZA 2CUZA 3FY4A 1H3EA 4GM4A 1VBNA 2A88A 4CQNA 5MFPA 1H1TA 4MUNA 2ZP1A 3GLRA 2PFSA 2IJGX 3PNYA 4EG7A 1HYBA 2X7JA 1NI5A 1WKBA 2QJTA 2V0CA 2X1MA 1YTLA 1R6UA 4MPRA 4MQ6A 3MUEA 5DB4A 2QTMA 3CLSC 3S3TA 1S4MA 3PRHA 4MUEA 4JUDX 3F6BX 4QPZA 1QRUA 1S5PA 5HUJA 4UTXA 2E0IA 3Q10A 2JLAA 1U7DA 1EE1A 2QTRA 2TS1A 1NUTA 4HJRA 1N2EA 3EA4A 3NV7A 1Q19A 2C5SA 2VK4A 5HG0A 4JU9A 1G8GA 1V5FA 4Q16A 2IHTA 4K9OA 1YULA 4JYZA 4BN5A 4NX2A 1ZH6A 1O0BA 4V1CB 2Q5LA 2OD9A 5EJ6A 5LLTA 1K92A 2R5WA 4G5YA 1KR2A 2E21A 1OBCA 1K4KA 1LI5A 1M8KA 1N3LA 3NBKA 2DERA 1Y9DA 1K4MA 2H2AA 3P52A 3A04A 1N78A 1YBHA 2WVAA 2YY5A 4I6EA 3TS1A 4KXQA 1WXHA 1NUQA 5EJ8A 4QREA 1F9AA 4J75A 1TQ8A 5TEVA 1EUYA 2FR8C 2VK8A 3EYAA 2AG0A 3IODA 4RMHA 3CLUC 3K35A 1Q15A 3ZXSA 1MA3A 4TS1A 4HPWA 4YP7A 4A91A 3D6VA 1WY5A 1H3FA 3GLVA 1O95D 1NUPA 3CVYA 1OWOA 2JANA 2QUJA 2H4FA 4RJJA 1QNFA 4HK4A 4BN4A 2DUMA 3ILVA 5BNZA 4UZFA 1V47A 4EG3A 2EZ4A 2PGNA 4GM0A 4PBRA 2Q27A 1MOPA 2CYCA 2QJOA 1M8JA 4GRIA 4FVTA 1TYAE 1GZUA 5EJ4A 2QQGA 4GU5A 2VBFA 1M2KA 2H2GA 1ZUNA 3PNVA 4JXXA 2NXWA 4Q9DA 3HWWA 1PNQA 1S7GA 3SYTA 1NUUA 4CDNA 1XNHA 4RPIA 3CF4G 1BS2A 3P0JA 5FNZA 1Q17A 4WNYA 4FZJA 4MAFA 2HZ7A 4J16C 1QRSA 4K9NA 1O5TA 1JHDA 1T9GS 4EG8A 5D7NA 3LOQA 5H7XA 1D4OA 1SURA 4BWVA 1PFVA 1EFPB 1B6TA 1Q11A 1QRTA 1KQNA 1KAQA 4EG1A 2WVGA 4UZEA 3CVVA 3GLUA 1OWPA 3MMXA 2XRYA 5DK4A 1JEEA 1GN8A 4U7JA 4UU8A 1J1ZA 1FYDA 1K97A 1PO7A 2EZTA 4FZ3A 2O8VA 1QPBA 4MW5A 4GG1A 2AKEA 3CLRD 3UK2A 4V1CI 1JGTA 1TEZA 2AG6A 1SZCA 3EY9A 4TWIA 3X1MA 1EXDA 1N2BA 4I6JA 1TYBE 1IH8A 3LCJA 2VBIA 2FN3A 2IHUA 4ZCQA 1MB9A 5DEOA 2A1UA 3MXTA 1O96B 2XRZA 1MCZA 3IVCA 2FWNA 1YHYA 1V5GA 1J21A 4PBTA 4K9MA 3LE8A 3NBAA 1MBZA 1XNGA 1RQGA 4JFAA 2OORC 2ZUFA 1OD6A 1PVDA 1SZDA 1NZJA 4X3PA 2A7XA 1KAMA 2DJIA 2H4JA 3U31A 1GAXA 2I1LA 4BVFA 3SZ3A 1KH2A 1TFUA 1MC1A 1P7PA 2PZBA 1R6XA 3VGJA 3X1JA 2VTBB 1U28C 2E89A 4JU8A 1IVSA 2FSVC 4K03A 4PY2A 3D81A 2RD2A 1U3CA 1V8FA 1JEDA 5DGDA 1MJHA 5FO0A 1YUMA 2A1TS 4MWEA 2JI7A 3IMGA 1NP7A 3CLTC 1PTJC 1YIDA 2Z08A 1DJLA 4K9QA 3U3DA 5BWNA 4ND7A 1LI7A 2Z09A 5K0TA 1OZGA 4ZCSA 3SEQA 1I6LA 1KP2A 2A1UB 1PFUA 5KHAA 4RJKA 3FWKA 1M2GA 1YI8A 2PANA 2EZUA 1WXEA 3HZRA 4ZCTA 5IMSA 1U2DC 1D2RA 1ZH0A 2VXOA 2H2FA 1R6TA 1JIIA 2H29A 4WSOA 1PT9A 3ZIUA 1IRXA 2PZAA 4MUGA 3TZEA 2OD7A 4BVEA 3ZXIA 1M8PA 1N2IA 2OQ2A 4D5GA 3HV0A 1QU3A 1QJCA 1TYDE 1PFYA 1Q77A 4JXZA 4C7BA 4XFJA 2DXIA 1O97C 3UOWA 3ELBA 1M2NA 3HMQA 4MWDA 2VK1A 4F56A 4F4HA 4BVGA 4DJAA 3FG9A 4MUIA 2AG1A 3JWPA 2JI9A 3K9WA 2D13A 5BWLA 3RJZA 5TGTA 4GPEA 1UPBA 3KT6A 4G6ZA 2CV2A 4JUFA 4COKA 4DDMA 1M1ZA 4Q93A 3CVWA 4Y6QA 1OZHA 3L93A 1KKUA 3N2YA 3LQ1A 1PFWA 4UTZA 1O6BA 2EZ8A 3H99A 2BYTA 1YC2A 3F6EX 4MULA 1OVMA 5DGTA 1GLNA 3CVUA 3HGMA 4RMJA 3RHSA 3SDBA 4E1AA 2WQ7A 1PG0A 1T9AA 5FEMA 2J4DA 3AL0C 3RIYA 1O94D 1KP3A 3RIGA 1HZZC 5EJAA 1EFPA 4MLPA 2CFOA 3ND7A 4NAHA 1T9GR 2GM3A 1KH1A 5KWVA 4YP6A 3N9IA 2IP1A 3GLTA 4YP5A 2DEUA 3E27A 1M8GA 3IDFA 4K0RA 3AG6A 1NSYA 3AG5A 2WVHA 2D5BA 4HJXA 3X1KA 2E18A 3F3MA 4H3SA 2BTEA 1J20A 3FSJX 4JSRA 4MWCA 5DEIA 1M8FA 3CA8A 1YUNA 3OP1A 4MW9A 1X6VA 3RFFA 4JUAA 1O96A 3IUEA 3UMVA 2PG3A 4TWJA 3IVXA 1JZSA 4BVHA 2DPLA 3CLSD 1PI3A 1YNOA 1X8XA 2B7LA 3FOCA 4KR9A 1ULHA 1M2HA 4K9PA 4MZXA 4BVBA 2CV0A 3KT0A 3FH0A 4F4UA 3TZLA 3COVA 4JUBA 4UTVA 2Q28A 2J09A 1N1DA 2A86A 5J58A 3AKZA 1YI0A 4QELA 5AHKA 4L3OA 4DDKA 1G8HA 1T6YA 1N2JA 3A05A 1U0BB 4UTNA 4JT9A 4NATA 5J5AA 3ZGZA 1WXGA 4P2BA 3ND6A 4ZCRA 4GP9A 3P0HA 3BL5A 3QTBA 4J76A 5HUHA 2ZUEA 2VTBA 4MPJA 3JR3A 5K0SA 1U7XA 1IHOA 3UY4A 3HWX1 1JZQA 4KR7A 1ICIA 1OZFA 2EJCA 1QTQA 1WZ2A 3IOEA 2H4HA 5K6TA 5MFZA 3DPIA 5J59A 3IAEA 4L2IA 1U3DA 1N75A 2A1TR 5DASA 1GTRA 2PGOA 1V5EA 4EF6A 4O8ZA 2Q5JA 1DNPA 4X0EA 4ARCA 2QUIA 1N2GA 5IJXA 2H59A 3ND5A 4MVCA 2PZ8A 3RK1A 2OD2A 4OJMX 3H9CA 4QRDA 1PNOA 1OWNA 3QTTA 2WSIA 3CLUD 1IFXA 3FZNA 1KQOA 1JIJA 3JXEA 4NAUA 1CT9A 4IAOA 2NZ2A 1UFVA 3H05A 1NM5C 4QBTA 1U2GC 1T9DA 1J09A 4R0NA 1T9BA 3H97A 1XLTC 2YXNA 4MUJA 3ZGOA 2IHVA 1EFVB 2JA2A 4MW4A 5FYQA 4S1OA 1JILA 4OUDB 1ZJWA 3KT3A 1POWA 2CYBA 1N77A 1KH3A 2VBGA 4JZYA 1G59A 5IHXA 3ZJVA 1JSCA 5MF6A 5EJ7A 2HMAA 3SZGA 1WXFA 4CDMA 3PKJA 3TQOA 5BWOA 1N2OA 1PYDA 2C31A 3FI0A 4G5FA 1GPMA 3E9YA 4L2IB 4UUBA 2JAXA 2CV1A 3L92A 4QQ8A 4IF6A 1O95C 4EFKA 2OO5C 4AS1A 3DLAA 1LW7A 5LFAA 2DETA 2X3FA 1A8HA 2J08A 1NYLA 2NYRA 1MAUA 4DNXA 4BV2A 1J8FA 1WQ4A 5EJ9A 1NUSA 4MVXA 1JIKA 1PG2A 4ARIA 2DLCX 3PXUA 1VL2A 4R2LA 1F7VA 1NURA 3G59A 4D5EA 1JMVA 1J1UA 4IG9A 2JLCA 4MW0A 4ZP1A 2V3WA 3FETA 4GM1A 1MRZA 4YMIA 3SEZA 1WOYA 4DLPA 2CT8A 4FEGA 4RJIA 3IOBA 1I2DA 4DDHA 4JUCA 4EGAA 4Y6OA 3Q12A 3H9BA 2QUKA 1MAWA 2B4YA 5JBNA 2H2HA 1QU2A 2CSXA 1EJ2A 1I6KA 4R8MA 4MVYA 3UC5A 3ZJUA 2JIBA 3HFJA 1T6XA 1WJGA 3U1VA 4CT0A 2RE8A 1E3TA 1UPAA 2QTNA 2PXHA 4KKVA 3IOCA 1Y42X 2GOYA 5K2OA 4MWBA 4X3OA 3N8HA 4UU7A 3D4BA 1KQPA 3ISJA 5MGNA 3Q4GA 5K3SA 4AQ7A 4EG6A 2UZ1B 4ZT2A 5LM3A 1WXIA 2OV4A 1J70A 3G5AA 1UPCA 4R2MA 3CLRC 5TS2A 2A4MA 5AHWA 1OWLA 4MQ5A 3FLMA 2BRUC 4RMGA 3ZUGA 2QUHA 4C78A 1WQ3A 1M2JA 5KCMA 3AFHA 1OBHA 3A4IA 3A2KA 2W93A 1F4LA 4ZT4A 4MUHA 4ZT6A 3GMIA 1TYCA 3VRHA 1ILEA 4Y6LA 4XFDA 1VBMA 1COZA 3D6UA 5FO1A 5EJ5A 1KORA 4RUKA 2JI8A 2O5RA 3PDHA 2AZXA 2DR2A 3D7KA 4MW1A 1XJQA 1O0CA 3CLTD 4G1CA 1POXA 3M5WA 1GTSA 1BFDA 1MB2A 2QJFA 3OTWA 1H3NA 2PIDA 4MUFA 1G8FA 4MVWA 3COZA 3ZJTA 1EUQA 3IH5A 3INNA 3ZG6A 3DO8A 4HD8A 3KFLA 2Q5OA 4K9KA 1YC5A 4BV3A 3FNRA 3MLAA 4XSVA 2A84A 3N05A 1YHZA 2EZ9A 2H2IA 2NSYA 2IELA 3ZGVA 3RBAA 1OWMA 3K32A 1EFVA 4NDAA 4ZZIA 4OUDA 1Q14A 3G6KA 2YWBA 1FFYA 1O97D 3HL4A 3QE4A 4NZPA 4HDAA 5EJMA 2Z3VA 3GUZA 5EKDA 3SP1A 4ZCPA 4JD5A 4KGDA 5TEWA 1T6ZA 4F3RA 2V0GA 1T9CA 4MW6A 4EG4A 1M83A 3IMCA 1N0HA 4JT8A 1IQUA 4UTRA 3CVXA 1I6MA 4ZT3A 4RMIA 4PBSA 4UUAA 5H16A 4MW7A 2J5BA 4I6GA 4YBRA 1ZPDA 2GKSA 5F23A 2JI6A 3KT8A 4I5IA 2WQ6A 4KPUA 1YIAA 3AIIA 2HJHA 2X0KA 3IUBA 1IQRA 3RK0A 1JECA 1XNJA 3OE1A 1IQ0A 4EG5A 2YWCA 1YI1A 4FEEA 2VJYA 4ZT7A 3P0IA 3TNJA 5K6RA 2J07A 1VLHA 3DV2A 3MLBA 4MUKA 2QQFA 3TQIA 1Q1AA 4K9LA 1F7UA 1N2HA 2EL7A 3IAFA 3IVGA 3COYA 4U63A 1Q6ZA 3GLSA 4DE5A 2WB2A 2X1LA 1U31A 2FRDC 2G36A 1Z8NA
chains in the Genus database with same CATH superfamily
2W48A 1AHNA 2HUNA 2O4CA 2WWHA 2DY0A 4DXHA 2RGNA 4URWR 1XELA 4IXDA 4HQKA 3WBKA 4ZZ2A 2ZYWX 2H2DA 1VE6A 4U8HA 3AF2A 4YRDA 4DSZA 4KR6A 4DIMA 4Y7DA 5F52A 1BWSA 2AQ8A 1FRQA 1UJBA 3I01A 5KC8A 2HY7A 1QQTA 2PRIA 1Z0ZA 1ZNYA 2QL6A 3Q7TA 4JVOA 1KK3A 3AGPA 4GI2A 4Q9AA 4BFLA 2HNKA 1IOLA 4EVIA 3ZHZA 4ZI7B 2I7DA 1H1TA 3H04A 3ICCA 3WSVA 3PHGA 1QGUA 2VHEA 1HFKA 3DZDA 4TTRA 2W11A 3AEUA 4D44A 5CT8A 5AYVA 3DLTA 3CRMA 3MERA 3T9AA 3KQPA 4BLRA 1R6UA 1SOAA 1TM1E 2IXFA 2I7VA 1SC4A 4DQ0A 4Z4QA 2QTMA 5DULA 4LSWA 2IA5A 1SC1A 3QMVA 3G82C 4JUDX 1V1MA 3PIRA 1HE5A 4Q39A 4INJA 1ZXLA 1B76A 3EIUA 1N1EA 2XCLA 3E9ZA 4IGAA 5M3BA 3GK3A 3CT4A 1LWNA 3QLEA 4IIFA 4QO7A 4AZ3A 5BMVB 3BG5A 2OCIA 2QTHA 3O3OB 2RGEA 2QRPA 3IXQA 3PJEA 4K9OA 3H2ZA 5I7HA 2Y99A 1NDHA 4OJNA 1CY2A 4CLRB 3UV7A 3OUUA 4QT0A 1R3DA 3B3QA 3SIRA 1HTBA 2YXDA 2HQBA 5LLTA 1EXVA 5CAEA 4OIMA 3MJFA 4YDQA 3LSYA 2PHZA 2VDKB 3TRJA 4FQ7A 5JECA 1Y9DA 1K4MA 4KMMA 4UBKA 2C7OA 1D1TA 2X0JA 4N6GA 2WG2A 3H3JA 5LIRA 1XVVA 3OI7A 4CEIB 4UFOA 2UUCB 2W8BA 1PDVA 3QVSA 5AW5A 3IKVA 4GC5A 5G02A 4YUYA 4MS4A 4EHDA 3BFKA 2MINA 3N2IA 3QZUA 3QY9A 1VJ5A 3RSLA 4TTPA 4WN9B 1UPTA 1C7FA 2E4AA 2EGGA 3KLMX 1L4KA 3M3DA 1FMLA 3I6ZA 6LDHA 3RQSA 1EFKA 2AQIA 2XXAB 1GSOA 2GRJA 2I4NA 1FDRA 2AOVA 3FDIA 3BOSA 4YTEA 1NDQA 3CVYA 4FS3A 3AZOA 1ZMTA 4TVOA 4KH0A 3UGQA 2W58A 3GA5A 4RJJA 1QNFA 4BFUA 2TRSB 3NHJA 2GCEA 1LBHA 3VZRA 1IY1A 2OFOA 4O3FA 4UZFA 1W2HA 4C4ZA 2J0VA 1CJUC 1IUNA 2CYCA 3K9QO 3GFFA 1TYAE 4J7AA 3WYFA 1UCFA 1Y1RA 3RVKA 3OIUA 3EFOA 1QSGA 2W00A 4G67A 4FR2A 4HAWA 4U9IS 1II9A 4P35A 2ZUSA 3TYXA 1EA7A 4UZSA 5KNCH 1U7WA 5BQPA 1XKQA 4N3GA 1BVHA 4GGOA 2BEVA 2GEDA 2ZOSA 1VIVA 4C43A 5TXGA 3ZQKA 2VNAA 2R4TA 1RYZA 4ZXPA 1N4AA 3KYDB 3U09A 4J1QA 3G3EA 1TRKA 2XCQA 3U0VA 1Q0PA 2C8LA 1E1DA 2C58A 2JD2A 2W6JA 2HZ7A 3ELYA 5DBHX 5JZSA 1GITA 1W0CA 1J0AA 4NH0A 4RLQA 4ZRNA 5D7NA 4MIYA 2H9AA 2R8RA 3LD9A 1EFPB 1ZVKA 4L78A 3ABSB 5F3WB 1RJFA 1HK7A 2HU5A 1JEEA 3FUUA 1DWOA 3ANLA 3N8KA 3TQQA 4BLTA 3O8NA 1RI5A 1GGEA 3AHGA 5HRCA 3Q8WA 3NNDA 1NLYA 1DBWA 2G77B 1KZ6A 4YP1A 5LQDA 3E7PA 1LDEA 2BFNA 3LP8A 4MRAA 1TE2A 1T43A 4BC0A 2R25B 4BAZA 1UZNA 3EFBA 5AVKA 3FMGA 3PC8A 4LTNA 3RU7A 1R0BA 1W4BA 1XAGA 4AJIA 2DHQA 5AXCA 3V8MA 2YKGA 4G0VA 1FJHA 4NP6A 3RVOA 1GGKA 3L7DA 2W2XA 2V96A 1SZDA 2I66A 3A1TA 4XPZA 2ZBDA 1NJSA 2PO5A 1X7YB 2VXBA 4FZRA 1WM1A 5CPBA 1Y7TA 3N59A 4N7MA 4OP3A 4RZHA 2JAUA 5KTNA 4IDHA 3AP2A 3BH0A 4I50F 5FBLB 3VGJA 2VTBB 1D3AA 4BFCA 3DBHA 1SAYA 3D81A 4YJ3F 2BSAA 4A16A 1YNSA 3ZD9A 1COWA 1V8FA 4I5EA 5L7YA 4XIFA 4G5SA 5JBQA 1LBSA 1E9VA 1XTVA 2F1JA 2HMVA 3DZBA 2JGRA 1E63A 3E9QA 3G9TA 1D0VA 3R7AA 2D2EA 3BSSA 3S1AA 2AUTA 1NJ1A 1ESCA 1QIDA 3OCYA 4ZCSA 1I6LA 3FKJA 3I6BA 1EVIA 3FNQA 1IWPB 3IPRA 3JQ8B 3I61A 1HLDA 4OKSA 5AJUA 1X7ZB 1T91A 3LY9A 2P6RA 4CEJA 3DLBA 1SMKA 1TO6A 4H59A 2PMFA 5CU7A 5I8PA 3BGVA 2YW2A 1R6TA 3PWZA 3TPCA 4E88A 1M2FA 3HK2A 4WSOA 3K5WA 4RFSB 2CKDA 2R6CA 2QVCA 1JLSA 1GPLA 3GDFA 2NO6A 1G3RA 1G3UA 3IJ5A 3JR7A 3PA8A 4FX2A 4L8GA 4N7RA 1A0OA 4PTLA 3U16A 2XXJA 4WOPA 2NIPA 2ZSUA 1JFFB 4CMHA 1TFRA 4BQSA 1LPPA 1YONA 3SJAA 5K5EA 2CJPA 1X38A 5B3LA 4NXMB 2RHJA 2VJNA 1MH1A 2OL4A 1LLQA 2VP5A 1X14A 2ONJA 3ASYA 1FDUA 2NVBA 2QR3A 1XJ0A 1KAHA 3UUGA 3C6BA 4BRZA 3EFHA 4RM3A 4HUQA 1OAOA 4X8HA 4XDYA 4CG3A 4E21A 3V4RA 3KNZA 3DYBA 1QIGA 4YLYA 1SBIA 2Q3BA 3J7TA 4BX3A 2DWPA 2B1QA 2OY0A 3DL4A 4HATA 3CVWA 1YDFA 1KI4A 1XN4A 4D4JA 3ZGLA 1A9ZA 5E1OA 7MDHA 4AY6A 4TYYA 1Y34E 4V02A 3ITNA 5BV7A 2DUNA 3JQGA 5CX4A 1O03A 1RYDA 2W7TA 4QGFA 2QBYB 3O38A 1YR2A 3ZKWB 3DVAB 2ARKA 3UFXB 1E1MA 3I9NA 4HGZA 1JG4A 2ID9A 5AI9A 3V4LA 4HDNA 4RMJA 1PG0A 5FEMA 5FX2A 4MVJE 1X1AA 5A2GA 5FBHA 5FBWB 4YUVA 4JBNA 4P0PB 1DTWB 3KAQA 4WCDA 4FFOA 4RD0A 2IHBA 1PW7A 2HMSA 4IS3A 2VRNA 2GM3A 4C3OB 1L1RA 3N9IA 1OFIA 4N47A 3KL4A 2C04A 4MJLA 3GLTA 2BF4A 2V54A 4LSGA 2HD4A 3OQHA 4QIHA 1EAYA 4REQA 1LV7A 3B6JA 1ZM9A 2VWQA 4HB4A 3DTVA 3EOBI 1SC3A 1A2OA 1W5AA 2C8VA 2IEIA 4BBAA 3X1KA 3E2PA 2I80A 1R1DA 3L4KA 3ZQ4A 3GLGA 4HDSB 1Z73A 1ZCZA 2CWWA 1JE1A 3CV3A 3OPVA 5D01A 1YUNA 5F76A 5C7LO 3U7RA 1QMGA 5AUQA 1T1SA 4YAKA 1JKMA 2Z9BA 1WSAA 4J90A 4OB8A 2X42A 5ADVA 1X42A 1WETA 4E7PA 3SHFA 4ZREA 5H3LA 4HPJB 4LJ4A 3QMWA 4UCXA 2XCTB 3T3IA 5DZSA 1MGPA 8AT1A 3D8TA 4G84A 5GVRA 4L85A 3UMJA 1TTQB 2AJCA 3A05A 3CX8A 4L8FA 1IOVA 4IM7A 3TDMA 4GDFA 5KAPA 2XUOA 3PE6A 2J41A 4C0XA 1ZQ1A 4EOGA 1C3LA 3DCJA 4LYFA 1EKXA 2ZVQX 4YC7A 3W79A 4R3UC 2R85A 3A8TA 2OXFA 5FQNA 4IBOA 1ZH4A 2W6MA 3NHYA 1OI3A 2Y1KA 3UUEA 2BLNA 2CC2A 1V3TA 2ECQA 5KPDA 1GEEA 3B1YA 2XUHA 4RELA 4UXHA 2ANCA 5EXPA 1QTQA 1WZ2A 1GKYA 1BS9A 3SOZA 1TA9A 1ID8A 1U0HC 621PA 2VAPA 5E7JA 2A1TR 3CGGA 4O4LF 3G2JA 4IQ4A 3W6NA 2H5EA 1XPOA 4HT3B 2WJHA 1ZSVA 1XROA 5TQ0A 3CZQA 4XDZA 2OC4A 3QYFA 1DX6A 1L5GB 2AKAB 3T4XA 1V9SA 2AKYA 2CDBA 2ZULA 3RT1A 5BNIA 1XF9A 3DMPA 3LOUA 2BFFB 1VI6A 3PHBE 4V0OA 4W7SA 3T3GA 3IC5A 1W6UA 1OB5A 4S1TA 4Y2VA 5FFNA 4BB6A 3KR1A 1TKRA 1MO3A 4DY6A 2AS0A 5CCXA 2R6JA 3SS9X 1KK2A 3DMTC 3ED1A 4E30A 3ML1A 5IKMA 5D5QA 3QNUA 1RZRA 3W8DA 5A3JA 1G4AE 3NM6B 4A8JC 4OAQA 1MPTA 4FOSA 2O1SA 1HDGO 2EJBA 5ARDA 5JC1A 1P18A 2QI9F 1J97A 1JA9A 1KMNA 1IEQA 1MNAA 3HKCA 2NP6A 1MAVA 3GG9A 3DDWA 1W36B 2CXQA 3O91A 3PS9A 4UTOA 4PEVA 5CYGA 4QBHA 2O50A 2FRVA 4QOIA 5G53C 1O95C 5ESWA 4YVFA 5B55A 3L46A 3V6LA 4EFKA 5IAKA 3TLZA 1YQUA 4B47A 4HFMA 1VTKA 2BE7A 4X64B 3LY5A 4ARAA 4JKIA 4FFBA 1CJTC 4CETA 3A11A 1Z7WA 3RRMA 1B0ZA 3H18A 4MRMB 4F2PA 2IY9A 2XUIA 1JIKA 2OV3A 3C5EA 1V4VA 4EHIA 1QX3A 1KDZA 4A0RA 3A14A 2H1LA 2LIPA 1L8OA 1UQRA 4FEAA 2QT0A 4GX2A 1C9DB 3MCUA 2UVQA 2XF8A 4XLTA 3WLQA 2QX4A 2K87A 4MYCA 2B1JA 2CLMB 1JEQB 2VP3A 1SD1A 1GQOA 2YWGA 2I2CA 3A0UA 4ARBA 4N76A 4IKOA 2EU8A 3TCKA 3GPLA 2V3VA 4PLWA 3VDMA 3EVDA 5CDTA 4C22A 4EYOA 2CSXA 5JWOA 4OQ4A 4MPTA 3TFWA 1LX7A 4M54A 3BULA 1XL1A 5KNBD 2QT1A 3PDWA 3AHJA 3PQ5A 4DDTA 3LUPA 2FX5A 4JLWA 4OQZA 5H4GA 1HDYA 3FSRA 4DR7B 1Y82A 2J6BA 4LC0A 1TO2E 1IBMB 5J47A 3T1TA 2IUTA 5HA5A 1XQWA 3HFRA 2FSGA 1KQPA 4PLGA 2X6RA 1JI0A 3ISJA 4OPMA 2V8OA 3AOGA 5K3SA 4ZEVA 2I3GA 4ILEA 3D6NB 3EQ8A 5LM3A 1R0CA 2JLQA 1JVBA 1ILWA 2HQOA 3L0BA 2GB4A 1EAMA 2GRUA 1LBEA 4G1VA 1C30B 1DKPA 3L0PA 2XVAA 3VR5H 4Q3KA 4FLEA 3NWEA 3PPVA 4WMLA 3UQYS 3AUKA 2IYFA 4MQ5A 1UINA 4QUJA 4UAJA 5CG1A 1L5HB 3FOEC 4D9NA 1OH7A 5AK5A 1F48A 5JZVA 5TPZA 1AKQA 2PQMA 1P0IA 2HQ1A 1Z83A 2A0WA 4KFSA 2H52A 3T1QA 4WJKB 4QGGA 1F4LA 4FGLA 1E92A 3OTHA 4GNRA 4ZT6A 1RHQA 4DA4A 1EX1A 1XAIA 4DIFA 1VCMA 3S1LA 3C6XA 1MVNA 3L8ZA 2K7FA 2BFBB 5HK9A 1ZK4A 1PD0A 4DBLE 1YASA 4RA9A 5DBOA 4CCWA 2ZETA 3G2MA 3GLIB 1ZKMA 3BS4A 5H8WA 3WXBA 2RHGB 3AEQB 4E6PA 1ORDA 1J5EB 4EQ6A 1TAHA 5JJIA 1G8KA 1FMTA 1WMFA 4B3DA 4KWCA 1KVRA 3T8YA 2FR0A 1YQ9A 2AMJA 2VDOB 3OEED 4YMTA 1B15A 1BDIA 1KJYA 3TBHA 2IHNA 2Z9DA 1KGDA 1NOJA 4DUZB 1ZRNA 4OFWA 1Y3IA 3IS3A 3USZA 4US1R 1L4UA 2KBFA 4GWGA 2J5XA 3RYHA 1BXRA 5KS2A 3MLAA 4KXFB 4R54A 4Z1MD 4B48A 1SPXA 1FB5A 2IHZA 2V4UA 1QH8A 4HTFB 4MI3A 3A6ZA 4Q1VA 2Z2KA 3VNQA 3L0SA 1YZNA 2FOXA 2RGXA 1WVMA 3G2LA 1DHRA 1QONA 2CVOA 5TE9A 3RK4A 3V4PB 2DY1A 1NPDA 2CGEA 3K5IA 1FFYA 3W90A 2RAVA 4ZMSA 2UKDA 2XA9A 4DMMA 4QAJA 2HT6A 2NU6B 1ABFA 4H31A 2IIVA 4AL4A 4ZDIA 5A6SA 5BSEA 5HTOA 3GJ7A 3UUFA 3BIWA 4UTRA 3SE7A 1PKEA 1WUHS 1XPJA 2CDAA 4PNPA 5A3QA 5CVTA 2PR2A 3UV3A 1WHTA 3GF4A 3K20A 3DMGA 2ZKLA 3QE0A 1YCGA 4NS4A 5EE0A 3OTOB 2O06A 2XW6A 4KXMA 1DKNA 1YB1A 1DHTA 1JDNA 3NASA 1IQ0A 1PK8A 4UBIA 2JJ2D 4KMOA 3TLGA 5ADWA 3VKVA 3D6FA 3B78A 3D9QX 3T7KA 2PWYA 3UATA 4ARZB 4CNBA 4F92B 2O7SA 4C01A 1QIEA 2D5LA 2FPXA 3DDCA 3VV3A 2V55B 3WK4A 3GIWA 4I19A 2A0YA 4TKLA 3FR8A 3TQIA 3RS7A 1K6MA 1JHUA 1KI1A 3NM4A 4XTCS 1XEAA 1T4BA 4N9QA 4LYYA 1S6YA 3PL5A 4DANA 2D1RA 3K15A 4G5GA 5G0VA 4NCIA 4IUDS 4YCAA 4F9EA 2J9GA 3EWNA 1AUQA 3N53A 2HA2A 1XL0A 3C8ZA 2E1RA 1NR5A 1B23P 3ZHUA 5B58C 3FVVA 4NEQA 4F1WA 4U9UA 5KDDA 3DL7A 3QXCA 3D6HA 3EVEA 3S2SA 1KZGB 5BSVA 2O59A 2UZ1A 2WE7A 1RJ9A 4G4IA 3EAGA 4KXXA 1Q0LA 2RHWA 2XMQA 5E38A 3RNLA 3MAJA 3U48A 3VR3D 4R0VA 1OXBB 1VBNA 2YDYA 5CXSA 4OL9A 4L6IA 4A8JB 5A5VA 4Z4IA 1OUMA 1XVUA 3R5JA 4D92A 3GLRA 4JEHA 1JTEA 2GKGA 4FHGA 1VL8A 2HMYB 4TXNA 2PCJA 3P8ZA 4IIUA 3QUCA 3AF4A 4YS6A 5CCDA 1LY1A 4WXMA 3MUEA 2PRSA 1UIRA 5EPUA 1QIJA 4RHYA 4R69A 3RFUA 1OX5A 4DTIA 1TD9A 1DC3A 3ENNA 4JN6B 4NL4H 4QPZA 1SHKA 4QVKA 4TT8A 5JDIA 2X86A 1KEVA 3Q10A 4FNMA 2ZSHA 1Y7PA 2NT4A 3AEZA 5FV4A 1OYVA 1EE1A 3CNOA 3I8OA 4MVJI 4KPFC 1GQSA 4KJXA 4TQGA 5D2CA 1QANA 5BW8A 2FAXA 4TL6A 4YT8A 3H3FA 5JEEA 1EHCA 1ADBA 2J9FB 4M89A 4NFYA 5F12A 1PLLA 2CFTA 2IVZA 2YIMA 3CW9A 1UXJA 4NX2A 4D45A 1KDOA 3G0IA 4K9DA 5AOBA 5G40A 1G9XA 3IUNA 1OBCA 4D9BA 3PSHA 1EB9A 5I01A 4U00A 3NJ4A 3C7AA 3DMDA 4EEKA 5BVGA 2WVAA 2NO5A 1N2CB 3IP6A 3AQIA 4H60A 5B58T 2DPHA 1H94A 1NI3A 1OAAA 1PL6A 2B61A 4M7OA 4PO9A 5EJ8A 3NAMA 1QHGA 5KJEA 4C05A 2V7UA 2OCYC 3UWDA 1USVA 1OVGA 2CCGA 4MVJA 3L06A 4PRLA 3PFWO 3WL5A 4BMYA 4ND8B 5C8VA 3BE8A 3WHPA 3G68A 1SK8A 1LNSA 2OFXA 2ICAA 4OLFA 1W85A 5BO5A 4UCQA 3I6YA 2FWAA 3LUHA 2Q2NA 2GWHA 2OQVA 3UA3A 5HM6A 1O95D 2Q6VA 5HF9A 3CG0A 2B83A 1G9TA 3MTJA 4IUCS 4G65A 2GBGA 2CFRA 1MORA 2H4FA 1GT6A 3TR6A 3UK6A 1GNPA 1ZM7A 2P9HA 1GNLA 1E58A 3JQ7A 3KZOA 5DVZA 4FOTA 3SMQA 3U4HA 2EBWA 2YX1A 1THZA 1UOOA 2ZANA 1V47A 4JB3A 5BRJA 4F6RA 3SD7A 2GA8A 1KE2A 2Z6UA 5K3FA 2Q45A 1GZUA 5T4EA 3Q5EA 1DIGA 2ZEJA 1BXGA 3P5SA 3PIDA 1H1DA 5IEBA 3TGPA 1YKFA 2BLLA 5B57C 2V6GA 1I1NA 2O8BA 2O8DB 2DU8A 1PJ4A 1FIUA 1ZVMA 3C85A 4RLSA 3VI4B 1UDWA 3IPCA 1X1SA 4JITA 3GH1A 1N5LA 2ZU0C 4BNZA 4CDNA 4YCMA 1SUCA 3D8HA 2H54A 4CF6A 3T6KA 1C8LA 2AC4A 2BFAA 5FNZA 1Y5IA 4BKUA 2MDTA 1R9MA 1A7JA 2W2VA 1IB0A 2F3SA 1ODLA 1E2UA 4GX5A 4K9NA 4KIJA 1ZRHA 1VXRA 5C0OE 2FN9A 4Q3BA 1U9CA 5JXHA 3M3HA 1OFUA 1SBTA 4BFTA 4QYTA 4B9EA 1B6TA 1PRYA 2I62A 3LLSA 4WFQA 1DT5A 3TRFA 5SV2A 1OWPA 3M1AA 4FW9A 2Q1WA 2PY6A 4ZAFA 4F85A 5KYGA 1CQJB 1TMYA 1R5BA 3KD2A 1BDMA 3PI6A 4ZI7A 5ABPA 2EZTA 1HETA 4H7JA 3UAOA 4XKJA 1U2TA 4QG3A 1FF9A 4W8GA 1E7YA 4FDTA 2GD2A 4X62B 4C0BA 1HI9A 1RQPA 3GUHA 4BZZA 4DZTA 3LNTA 4KVAA 1M76A 1X0VA 1N2BA 4LRQA 3TSOA 4B82A 3OM9A 2GCNA 2FWNA 2ZBUA 3IVCA 4GX0A 1YOVB 4I1IA 1E6MA 1CS0A 2WMOB 1EQUA 3NX4A 5J1SB 2WTXA 1MP0A 1I36A 2JI4A 1DP4A 4JFAA 4DSOA 2HWKA 4AMBA 6Q21A 3MD0A 5KNDD 1QO0D 4URXR 3GGPA 2PQ0A 2CVPA 3DQPA 3JYHA 3L4SO 4CCSA 1L7VC 1EGMB 1YMQA 2Z3ZA 1BFKA 1I9CA 1QOPB 1XTSA 1XU4A 2DJIA 2HHLA 3CX6A 3AVWA 1R15A 4IGIA 4X6LA 4YHBA 1SOMA 2XZDA 1N8SA 2EG5A 2GMWA 5CPFA 3AVVA 1P7PA 4GT1A 2P9YA 4JWTA 3WL7A 1DBRA 2HPHA 1T8SA 3FWNA 3ZE1B 4MV8A 3C98A 4ZCMA 4AN4A 2RD2A 1I51A 2WF7A 2XTAA 4HFJA 2D1FA 3L7MA 2A1TS 5IJWA 5EZ5A 4F3TA 3JQBA 1W94A 2Z08A 1U0EA 5FXMA 5J2TF 3HVIA 4CEIA 4PC3A 1LI7A 3IP3A 3WY9A 5FTNA 1Q7GA 2JGEA 1XA4A 4EUEA 1HORA 4V0NA 1E5XA 4JLKA 2BZ0A 2WYOA 4ZCTA 2ZRMA 2VXOA 5BMOA 4FFVA 3C3WA 3WWOA 4HVLA 3KQNA 4D9MA 2XXAA 5CK4A 2PRZA 2ZM6B 4KDRA 1Z39A 3FBTA 4EPRA 1ZBQA 3BHMA 1PYOA 1PFYA 2A35A 3OQ1A 4M49A 1YB2A 3RHTA 3KQKA 3PF8A 3U4QB 2EJWA 3TMYA 2YFYA 4DIDA 2GZSA 3H5OA 1CG6A 2WIKA 4ITVA 1W52X 5BN5B 1IZZA 1XZJA 3UANA 4BVGA 1Z3IX 4C0JA 2G8NA 2OHOA 2RHBA 4MP6A 1C2YA 3DWGA 3QJGA 3C5CA 4U1RA 4EPVA 2NAPA 1N3BA 2D00A 2WYVA 3GI1A 3IGFA 1FFEA 3ZCTA 4E3ZA 3N0RA 4EJ6A 4PM4A 1ZBDA 3RR2A 1C3OB 2HEIA 2ZI5A 3FHTA 1S1MA 1XZ8A 1ZJ6A 2EKDA 2X3YA 1AUPA 1G55A 4R8LA 3TD2A 3ZDBA 3WRVA 2EZ8A 1J7JA 2CXRA 3V32A 3R6WA 1W34A 5BOSB 4YV7A 3EW9A 4C3VA 1HOTA 1Z29A 1R4MA 2PX2A 4I3HA 2D2IA 2RI0A 1XNQB 3MK31 1P0FA 4BFYA 4R01A 4R1QA 4TLDA 4ZTBA 4PG8A 3LLUA 2NUAB 3FE2A 1NI4B 1OLSB 3FOWA 4PZYA 2EQAA 1EFPA 3FIJA 4EUHA 4NAHA 4C06A 1KH1A 3L4BA 3ZH9B 3VC3A 1YE5A 5LMCA 3UH1A 3KKEA 3WJAA 4FKZA 4BE9A 2SKDA 2WB4A 1L7PA 1VJGA 3TVDA 1M8GA 2Y92A 3LHDA 4CMEA 4ECEA 2AG8A 2IODA 5F33A 4U7WA 2FK7A 4L4RA 5AW0A 1NYQA 1VOTA 3W6PA 4CDRA 4R40A 2NZUG 3A6DA 3D7NA 3O8BA 2BTEA 3R9XB 3ESDA 4JC8A 3RADC 2GWRA 4Q9IA 4PE5B 1H65A 1GYRA 2WAXA 1ZL2A 3AR6A 3MWDB 4OQXA 1XZMA 2XKBA 2BZSA 3QKUA 4G8CA 1O9BA 2DPLA 2FN7A 2IXAA 1PFQA 5AHRA 3DKRA 3FOCA 1WMAA 5GIOE 4HN4B 2XCSB 2CV0A 1IJEA 3MILA 1SULA 3N2ZB 4UAUA 2PFKA 1IUKA 3PNOA 3T4UA 1YR7A 1QKJA 5GM1A 4HGNA 4KBYA 5BXYA 5JSZB 3UJ6A 1IDOA 4G1FA 2FFHA 3UMMA 2Z6QA 3GELA 4WVFA 2RGGA 3M6MD 2AD5A 4JQYA 4JT9A 3WKEA 1HYGA 2EWMA 4W9MC 1J0CA 1CW2B 1GTZA 5CVCA 4G9GA 2QTZA 2VTBA 1HQDA 5FCDA 3VU9B 1XI2A 1XMVA 1AN0A 2RHDA 4G0ZA 4Q9LA 5D6OA 4RY9A 4DV7B 3QKRB 2FX2A 2O8NA 3IKLA 2ADFA 5K6TA 1DEAA 3AXTA 4GMKA 5K2MA 2EFEB 4GZMA 5LUBA 5IABA 1H9CA 5ETJA 4X95A 1N75A 4Q18A 5EL0A 2FQ1A 2P9JA 3NGLA 4RPHA 4F86A 1GTRA 1ZMRA 3HKEB 2FQQA 3JQ8A 2VF2A 3GUVA 2R8PA 3DCIA 1EDZA 1X7ZA 2FZLA 2OD2A 2PZ8A 5JQGF 2YL2A 2AMVA 1P1IA 3OZRA 2GF2A 4JP2A 4KSYA 4DLSA 3CX3A 3MIZA 3NANA 4FYVA 3EZ2A 1FXUA 2O2YA 2DUUA 2Y05A 3COPA 4LTMA 3ECAA 4RFSA 1EJ6A 2FPIB 3NU1A 4U39A 3EOZA 4QBTA 3W5BA 2HBRA 1MU0A 4K6CA 3DXZA 3CO0S 3EY4A 1Q3HA 2IHVA 1FUEA 3HA7A 5CVVA 3E9EA 5CEFA 2QGFA 3IV9A 3L1VA 3NP7A 1ORVA 4LWZA 2AJ8A 2RGAA 3BXXA 1NNEA 4C87A 3FYSA 4XVCA 5IHXA 4AZWA 3NETA 3NOQA 1WXFA 1T2UA 1J07A 3HR7A 1TW2A 1WG8A 1X3LA 3EQ2A 1ECPA 3SXUA 4B7XA 2PCLA 3L5OA 4NV3A 1BE0A 4B4VA 3C4VA 3RU2A 2WPDD 4D98A 3KHUA 2AOXA 1YCDA 3RB8A 3RVLA 1DAEA 2C5BA 4BP3A 3A36A 4NG5A 5CT6A 4L02A 3UBTA 1M1XB 3BD8A 4Y9TA 4DLRA 1PP4A 2ZRLA 1UJ2A 1AH2A 3EC1A 1FTYA 1NGSA 5CIQA 1N2CE 2YASA 3ZKWA 2FVXA 3UFXA 1HTWA 2G1AA 5C5IA 1GSAA 2GGSA 2C29D 1UKCA 2FPGB 5HR5A 3PZRA 4GBGA 4HRXA 1BH2A 4MW0A 4Q37A 4CKZA 4IWNA 1DTWA 4V0KA 5IK2D 3IP7A 1S3SA 1WOYA 1CUDA 1J2UA 2NZXA 4IXWA 4M6WB 1I2DA 1R9JA 3B3JA 3C74A 3SSAA 5L6MB 4G1EB 3LTEA 4TUYB 1NTRA 3LPCA 5BQ5A 1NJ6A 1BG6A 5THXA 4ALLA 5HRUA 3WDLA 4B6GA 4KE8A 4Z54A 1QU2A 3N39C 2OBFA 1D2CA 3PD0A 1EJ2A 5K99A 4QPNA 1XMIA 3QEBZ 3O0DA 3OQBA 3RVSA 1E8NA 2QTNA 4O08A 3ROMA 1K0UA 3PFHA 4YRRA 3T5DA 3OTGA 4HNAB 3V7NA 1FMFA 1J24A 1V95A 3LX6A 1KI2A 1P3JA 4Y9UA 3NPAA 4BCBA 3IPXA 3I4CA 1VJRA 5IDYA 4IWYA 3Q4GA 1EFLA 2CBXA 5C18A 3NATA 4B84A 4U2CA 4BX2A 6ABPA 2ZRJA 1CDEA 1E3IA 1FRZA 1U4NA 2FB9A 3OOWA 4CKEA 4AG3A 1X39A 2FQXA 5AH0A 1TF7A 1C4KA 2YN0A 3EH1A 2PKQO 3MWYW 2XVMA 3RSCA 4CG0A 3EEOA 2LDBA 5AHWA 2X76A 5AVZA 2PD4A 1RM5A 4NCKA 3S55A 1GWNA 3I6MA 4IDPA 4M1SA 2NM0A 4BLSA 5FP0A 4C78A 1RD4A 3LQKA 2GN6A 2RC6A 2F43B 2XKKA 2G25A 2MWMA 3K5HA 2B8JA 4MKIA 1QE3A 3FROA 1U1EA 2FN4A 1DMSA 2A2ZA 1F2TB 5FWYA 3EZ7A 4ROSA 3F73A 1J22A 4WCVA 4X84A 4D43A 1V1JA 2CN1A 1LPAB 2XE6A 3AR4A 5E9WA 4IGEA 3SHTA 2QLFA 5DHPA 3V46A 3ZU3A 3R0IA 5J2UF 1RPAA 5I9BA 3WLOA 4M46A 3BIOA 5U4QA 2D7DA 2QU7A 1NVTA 4QICA 4JP1A 4IRUB 2PM8A 4INAA 1UAYA 2XVYA 4GPZA 4H27A 3WOHA 4DJEC 2BFFA 3QX7A 3GPCA 4YT4A 3DO8A 2C88A 3U4AA 3TLEA 1JLHA 3V2IA 1V7PC 1JH8A 1VPLA 4O02B 3FNRA 3OLQA 4WV3A 2ETXA 3G1TA 3U9LA 3ZI7A 1HPLA 1HFWA 2J48A 1Y5MA 5EUMA 3WQHA 4TRNA 2G09A 4LF7B 3AVUA 4IHJB 3WSWA 4XX0B 2GLTA 4GGPA 1XLWA 2DR3A 3TZKA 3AHEA 4G86A 2YMPA 3FNHA 1Q7CA 3K0CC 3QE4A 4NZPA 4NABA 5JNVA 5EKDA 2G71A 2PAAA 4FSXA 3NH6A 1U0NA 4PX9A 4QTTB 4R2WA 1T6ZA 4GOKA 4BX0A 4C0SA 1F2VA 2ILTA 2VDJA 2YMMA 5AKYA 4F3RA 3IMCA 3TCNA 4GLBA 3IIMA 1E4VA 1G4UR 3AUUA 3WB0A 1Z0JA 1VA5A 1JBKA 3G13A 1Y8QA 4X1YB 2GKSA 4K0KB 4U7PB 3QFCA 1F5NA 2I5PO 4JJEA 3QW2A 1D07A 3HKDB 1PK9A 1GZ7A 4IZIA 2KB0A 3DV0B 3F8SA 4MRMA 1EVKA 2XDYA 4E51A 1NVVR 4EW6A 4C0KA 2BE9A 2BFOA 5ITZA 2WIGA 4ZAGA 1X19A 3BYZA 5K6RA 2YYZA 3VZPA 1YBMA 2Q4OA 3DOOA 3EGDB 3OIDA 1WW8A 4L8WB 5EMNA 4ZYTA 1DIHA 1MTOA 3STXA 1JEQA 5AW7A 4CDGA 3KTAB 1Y4AE 2B3TA 1WP9A 2ZUDA 3N2EA 1CHDA 1KKLA 3HLKA 2REQA 3B6IA 1SVOA 1IY9A 2ESRA 4B43A 5K6AC 3KJNA 3OEEA 4LJSA 3CUWA 3T5CA 4X45A 5CD1A 5KHOC 2ACVA 2DSNA 2P1ZA 3PVSA 2I54A 4MCJA 1E3SA 4RJTA 1Z0IA 3ES9A 3FTNA 3COWA 3OUTA 5IF9A 1U0LA 3TJZA 5LN1A 4KGZA 4Z1MA 4EUNA 4JVSB 4LX8A 1I4EB 1JJBA 1HE8B 3BJZA 2HLPA 4Y0AA 4ETWA 5GY7A 3STHA 2Y76A 4UHBA 2CUZA 4YRFA 1VDZA 2Q5CA 4JLDA 4QFMA 3CEPB 3AFIA 1RXCA 2I2AA 3SIXA 5FI3A 1C30A 1Q7EA 1TZKA 1UZMA 3WGHA 3V55A 2ZYRA 3WL4A 4XEUA 2PFSA 1RJEA 2OECA 4A6DA 4B31A 4E5VA 2DLDA 1Q7BA 3EZFA 1L7QA 4X44A 1I32A 1AJEA 1BO6A 2XD9A 3AF3A 1D2MA 2AHOA 2XNJA 3IT2A 2VLBA 1IAVA 4QC2A 5DF1A 4EO9A 1RC8A 3IQIX 3OCJA 2BONA 3M6IA 3PUXA 1NULA 2HZBA 4BGEA 1Z4MA 1ZJ5A 2RONA 3CLSC 4H7HA 4CLHA 4Q9KA 3VA7A 1L7NA 3IFSA 1WWKA 1JN0A 2RB5A 1J0BA 2RG1A 2QTRA 4M8LA 2JJ2A 4IMIB 5I8ZA 3MG9A 3AEQA 1K89A 1CXZA 5GV7A 1OXSC 2FMFA 1N6PA 4Q7KA 5KYVA 3PC4A 1WZEA 3QOFA 4QDOA 4R6XA 5AXBA 4ESEA 2R87A 3QSYA 1E1YA 1W7AA 4WKNA 1ETUA 3ACCA 3K6KA 4JGGA 3PEFA 3GFOA 5J23A 3X2EA 2VAMA 3GRRA 1T8WA 3RYFB 1K92A 1Z35A 4ZOLB 4XUGB 5E6RB 1PZGA 4F5YA 3S7TA 1Q0UA 4HTFA 3T4EA 2O3JA 3LWZA 2F1HA 5FUMA 2GUGA 3EA0A 4OBEA 1NUQA 2BUBA 2IITA 2PDAA 4EW1A 1HG0A 4K46A 2MSLA 2VOJA 1DQPA 1AKTA 3EYAA 1T0IA 4NBWA 4X6UA 3WGTA 3WIEA 1J33A 1QOZA 2YHAA 3HY3A 3IODA 2DRIA 3LXUX 2GHRA 4I1YA 4BKOA 4BU0A 4DJ5X 1QP7A 2BD0A 4MS3A 4ZV7A 5IT4A 3K5PA 1Q2XA 5KWIA 5LOVB 1WL8A 1LDNA 3H9JA 4UXIA 3TTYA 5ALMA 3SJZA 3VR3A 4FMCB 4DARA 5CA0B 1Q74A 3SY8A 1GNVA 2JEZA 3U61B 3N8NA 2X6QA 4MJ7A 4DT1B 1JG2A 4KN8A 3TCXB 3WGNA 5MHTA 2WG1A 2NXCA 3V42A 4NCHA 3K31A 2FSUA 1C0LA 2GUWA 2JKVA 3N0WA 5BOVA 5KYXB 2R6R1 5THKA 2P41A 3VPAA 5F2KA 2ZVDA 4EO4A 4J7XA 5FFFA 4BRUA 2ZZNA 5DOZA 4L7QA 2EZ4A 3OZAA 4IVNA 4YRLA 3IQXA 1GQYA 2NW6A 1CR4A 3AB8A 3D5EA 2HCBA 2QQGA 4YRMA 5M34A 4QUGA 1YGYA 5CMLA 5EP4A 3QEAZ 1Z45A 2Q8QA 1N6OA 4JJ7A 2NXWA 2Q2VA 3D6MA 2PGDA 1Y63A 1GA6A 3JATB 4JI5B 1RWNA 1PQWA 4OVKA 3CXRA 4YCSA 2PH3A 4RPIA 1YB7A 3SXJA 3CF4G 4JC4A 5DV9A 3OC6A 5C31A 1U8TA 3IULA 3DHYA 3JZFA 4FILA 1Q7RA 2J3HA 3IKMB 4HCJA 1U9JA 1TKAA 4J0CA 4YRTA 4PHTA 4YRJA 3UB2A 4FYKA 4O4IB 2M1ZA 4W5HA 5C8YB 2GT1A 3U44B 4N3CA 3VU3A 4DLYA 1PTKA 1XZLA 4UNSA 4BWVA 3COJA 3I3OA 2V98A 1GXSA 3BA6A 4Q7MB 1ZD4A 3DMTA 4KN6A 1RADA 4GKBA 2CF6A 5LZ2A 4B83A 2QN6A 2XRYA 1BS1A 5DK4A 2H1SA 3B6KA 4A8JA 1WCV1 1U99A 2P3OA 3PGMA 3N2LA 2DC1A 5T3YA 4IQFA 3F9CA 2R6DA 3GMDA 3GBVA 5HF8A 4HZUA 2AG6A 4J0DA 3LIPA 4OXYA 5EN4A 1P2UA 1P2VA 3OSZA 1T36B 2DFDA 3TLJA 3UHFA 2OBMA 3ASVA 3P97A 5E7IA 1DPGA 1O95A 1ZD9A 4G0XA 2H18A 4IX1A 2QR5A 1S7CA 4PBTA 3GZ4A 4E4YA 3W3ZB 4E6EA 2I22A 1HEIA 5G1PA 2W2OA 1TZ2A 2OCDA 2QN8A 5DYGA 3ZXXA 4Z3OA 1J06A 4MB0A 4NPHA 3RVJA 4EL0A 1I3NA 3NONA 3CUEF 3PXGA 2GK6A 4MCAA 4NYIQ 3ORHA 3ZEIA 4HRVA 4Y2UA 3M1LA 4LXUA 1LZLA 2NYVA 1JJ7A 2Q4BA 2X40A 3NPMA 5LQUA 1GO2A 2I2DA 4WCFB 2JFZA 2DSTA 2X0IA 2ISCA 1VSTA 1JYEA 1TU3A 1G6OA 2L69A 3EWSA 3Q40A 4JU8A 4PSAA 4LZAA 1U3CA 1UBHS 2PWAA 1GZDA 1RC1A 3H1BA 4YQZA 3JQCA 3L79A 1YUMA 4ZI2A 2VLIA 1GRNA 3HXKA 2A5YB 3RVRA 1N2CA 2WD8A 3ZE0B 2CF5A 2V5UA 3D7MA 4M1YA 5EWLA 3KBBA 1A3CA 2JAOA 4CKWA 4P3NA 3QYJA 3O93A 4L6CA 3WB2A 2GF0A 1B0PA 4ND8A 3ICEA 4KAJA 3M4ZA 4UCWA 2ZIAA 3K4HA 1NZFA 1U2DC 4PZ0A 3T7IA 3U17A 4RULA 3OZXA 2LE0A 1N9ZA 1PV4A 1X2BA 5KKNB 4TTVA 3R75A 4BVEA 3ZXIA 2Q0QA 1U3VA 4XYLA 5DHFA 4LZNA 4EO7A 3HV0A 1CZUA 4PR3A 1GT91 1KYVA 3OPYB 5AR1A 1Z7BA 3D1LA 4AK9A 4IIXA 1O97C 4AXXA 4DUPA 4ER5A 3SZRA 4RSMA 2CNDA 3AYZB 1DJPA 2WRZA 1IBRA 2RI6A 3HMQA 2CMHA 2HRQA 1N6KA 2BEUB 2VJCA 2VK1A 4ZOAA 3WVNA 1Y9EA 4C20A 4AB1A 5GJBA 1RYHA 2OBBA 4MUIA 3D0KA 3EVZA 3I2YX 2AR9A 2IP4A 4EECA 4ED9A 4Z4CA 5F5NA 1F4VA 3BBPA 1TOAA 5E8RA 3HE3A 3R3ZA 1P5JA 2RARA 3HDHA 4B0OA 4ZFNA 1ZIDA 1O58A 2XCOA 5KNDA 4NKRA 4HAIA 5HE8A 1QO0A 1D2EA 3IBTA 5LZ4A 1QM5A 2BJHA 4Q93A 5HW0A 1N9GB 1T4GA 3RVPA 1L3IA 2O8DA 1G7TA 4YRCA 1DG9A 1F14A 2PMBA 2H3HA 2HL6A 2XWQA 1LRKA 1Q21A 1ZK3A 4UTZA 4UM9B 1AXRA 4GYWA 5JD6A 3FBWA 3BIXA 2OHJA 2XGSA 3E7XA 3JD0A 2OO7A 1R6DA 4KO8A 5IFLA 3SLRA 1P5HA 4O5OA 3SE0A 4GKJB 1DUVG 3BCHA 3SVLA 2VDWB 5C1PA 5AVTA 2WAYA 1T13A 2Q1YA 3GLHB 1KP3A 3DUFA 4HPXB 4M22A 4UEOA 4A5SA 4ASUD 4LJ7A 2GJAA 3IEIA 3VU1A 2CFOA 3L7JA 4FDUA 1YIOA 5EWJB 4EY3A 2PEZA 3H5NA 3QMPA 2BMEA 4HGQA 3BFJA 4HLCA 4QXRA 1CQJA 4JP3A 1Q91A 1UDAA 3BIJA 1JFVA 1VPTA 1JQ3A 1XRJA 4ALIA 1VKRA 4G63A 1Z0FA 1WTCA 2EGUA 1GPUA 3G2PA 3OJOA 2WIFA 1XJ5A 3OCVA 3UT0A 3NHRA 1HRDA 2VF8A 5HMMA 3S99A 2REXB 2YQZA 5BQXA 4YAUA 1M8FA 1B43A 3TL6A 5B12A 4PZDA 3HJBA 2OUIA 4HFRA 4Y6SA 4B87A 4EELA 1DX9A 3JCZA 1YOVA 3HVHA 4ON9A 4MKHA 4U0JA 3CLSD 1PI3A 4ZKEA 3KXLA 2NTVA 3M5CA 3ND8A 2YNMC 4MZXA 1SA0A 4DNPA 3KZVA 4BVBA 1PJBA 2IYSA 3FH0A 3KKOA 1UMDA 2ZSJA 2PS9A 3ZWOA 5HZMA 1GPKA 1XQ9A 4PC1A 4XR9A 5B2EA 2PZEA 4HWPA 5EZYA 4G5RA 1N2JA 1BEEA 4Z3KA 5JNLA 2Z2IA 4PYJA 4W5JA 3RS2A 3ND6A 3JQQA 4UM9D 1I33A 3PK0A 3MJSA 3SCZA 2E4UA 1SUWA 2DWQA 3LUCA 4EFNA 1EVEA 3MSXA 1NC1A 2I2WA 4CKCB 3HO6A 2YV1A 4BASA 2RHMA 1TCAA 1E66A 3ONDA 4MV3A 4UDYX 2H92A 3QVKA 5J59A 2OYCA 3M5DA 1VKZA 2D5IA 1FNSA 4WHMA 2VDRB 4ZHQF 3T3NA 2WIDA 4MSUA 4EF6A 5FB3A 2FLKA 3P2OA 4GBMA 4GS5A 1QF9A 1QTNA 1UKBA 1SNYA 3DTYA 3UGTA 3NVKI 3A1CA 1N5OX 3AERB 3ND5A 4R5MA 4CUKA 3AUYA 3ZWKA 3LCRA 2RC5A 1S02A 2Z5VA 4IDAA 5C8DA 1RWKA 2ATIA 1ZGAA 3L9WA 2Y9PB 1M1NA 3OZWA 4IAOA 4NDNE 1YJAA 3O73A 3QX3A 1XQ6A 3EZ9A 3UCEA 3ZWAA 4A0GA 4UE3S 3D2LA 2V8BA 2IY7A 2XOEA 3QPWA 3VPSA 4BP9A 4OX9Y 1HMPA 1UEJA 4HAOA 1SKYB 2JVJA 2BGWA 1G1AA 1Q1GA 5MF6A 5ECGC 5K0GA 3FMPB 3ASZA 2I4RA 4D0GA 2ZITA 4GRDA 5FOTA 4BQFA 2EFHB 3T3HA 2R6AA 1LVUA 1PG5A 3NEYA 4EJMA 5JMOA 1NE2A 1QVWA 3A6HA 2OT3B 1W44A 4QYIB 1C3OA 3U7QB 3AP3A 1I0LA 2ZWAA 1PZXA 1SQGA 4HB3A 4IIYA 3DL2A 1T0HB 3SJBA 5FPSA 2DJ5A 3DE1X 2NV6A 3ZCVA 3ZS8A 4F6LA 3D4OA 3HPRA 1SXIA 2PGIA 4ND5A 5A5GA 3NIBA 3P9QA 2PKCA 1UBSB 3QELB 4TLMB 5KHLB 3ZDDA 5IEJA 3WK6A 2P69A 5FUYA 3I53A 1RRCA 4NFHA 3WIBA 4HEA6 2AI2A 3H2YA 2AEFA 3DE0X 3H7AA 4H1TA 2RHOA 4C88A 3JX9A 1TC1A 4TKZA 4B2LA 5BNWA 2HHHB 1XDBA 4IGFA 3L7KA 2PGJA 2YIDA 4IJMA 1Q2UA 1QH0A 4EGAA 4PLHA 3THYA 2HSGA 3RTEA 4BDTA 1P39A 2FPPB 5EJEA 3NRJA 4S1WA 4HXEB 1LPOA 2XKAA 1AS2A 3RLIA 3W9UA 1W46A 1T6XA 3GCXA 3D3QA 1SOWA 3ZNPA 4TZ0A 1CZRA 3OHSX 1ZVJA 3CINA 2PXHA 5FWXB 4ER0A 3AKYA 3QPVA 4AAYA 5LIPA 4HWTA 4AJPA 3BSYA 4BNGA 2JK0A 3D4BA 3CH4B 3REFA 3CZCA 3I92A 1ZOLA 1OV4A 5U1PA 2E5FA 3JALA 4QXMA 4RL4A 3VPDA 4AQ7A 3RUEA 3VYVA 5A62A 4MWZA 3OJCA 2PS3A 4QU8A 3VQTA 1ZGHA 4LS3A 2MU1A 1OTYA 2IBMA 3QXGA 5CURA 4NYMQ 5AM4A 2HF8A 3U19A 3FW1A 1AKYA 1PLKA 3F5MA 3RJ5A 4ALNA 3SQWA 1T9ZA 2HSDA 3L49A 4JLVA 2E55A 4RMGA 2MSKA 4TSKA 2CXOA 1KMCA 3KVOA 4E12A 2HHJA 2WPDA 3H16A 1OBHA 2CB0A 2G28A 3E8MA 1XFDA 3FLAA 3QEOA 2A9OA 4REMA 3HCPA 5CH8A 5SZIA 4AS3A 3S2GA 3GMIA 3VU9A 2FK8A 4CIBA 3W2FA 4PCAA 3TK1A 1D6MA 4A15A 4C7OB 2ZRFA 2Z04A 1UQTA 1ZGBA 2JKYA 2GHTA 4J29A 1VSVA 3ROKA 5LP1A 2FZKA 5ALHA 4N12A 5AK3A 1TTTA 1A27A 3I6IA 1MXHA 2QVZX 5C1IA 1XDSA 3LWBA 1A7AA 1B4DA 1WUKS 3CNLA 3NWPA 1XZCA 2V9CA 1F06A 1WD5A 3H83A 3DZJA 3K1TA 2EL9A 3M4YA 1YL6A 2PNJA 1XMQB 4PAMA 5TGDA 3PZBA 4QASA 4CHGA 5IK2A 2RBGA 4CGZA 2C3UA 4H4EA 2NTEA 3WRXA 2YJNA 3DQZA 1C4WA 1WCWA 2ONYA 2NPIA 2FPIA 5DIZA 4EX6A 2WT9A 3HZZA 1QV7A 3DVRX 3L1HA 5KTKA 4DV0B 3ZW9A 2NSYA 4TS3A 2AI3A 3GDGA 1N0WA 3PYMA 3FCUB 2X4IA 5CX1B 3HJFA 5DLYA 2ZTLA 8MHTA 3FJOA 3IEKA 4C3UA 5CDYA 3X1DA 3AJAA 1US8B 2YWBA 2AJDA 1O97D 2E37A 2Y4OA 3ADKA 2WWRA 3HL4A 4L5BA 1I6WA 1W2GA 3PXDA 1OQAA 4OK3A 4XCQA 3D8BA 5A7HA 1SHTX 3WO1A 4DSUA 2ZXFA 2EDCA 2BFWA 3AKEA 3WLTA 1RT9A 2P0YA 4G8DA 4H15A 2I3AA 1JXAA 4BLPA 1PUIA 2VYCA 3RUAA 4XYEA 2M1XA 4YO8A 3AK4A 3C3CA 3O4RA 2NYUA 4LISA 2O2XA 4G4JA 2WJAA 4I5IA 4S0ZA 4I55B 2R6FA 2N0SA 4HH0A 3NYQA 3VDRA 3WL6A 5LYJB 2X0KA 3OD5A 2ZAYA 1X3SA 1DAGA 5I4IA 3ER8A 4PANA 5ESXA 5JALA 3AU8A 1Z7GA 4G9EA 4U3JB 3DLPX 2FPGA 3NTQA 2AK3A 5BYAA 2GN2A 4QOHA 2BT4A 1TB4A 3DFUA 3FN4A 4ZANA 1KEKA 3GEIA 4IIJB 4M9SA 1KKMA 3QBDA 1QX4A 4KU4A 4M6WA 5TVKA 2A9KA 4W1QA 3TB4A 5D87A 3EF1A 2QRVB 3GA7A 3IAFA 4OMUA 3D4NA 2Z6VA 2PKQP 3OKPA 4RZQA 1YMUA 1ZS9A 1YZLA 3D3WB 4LRSB 2X1LA 2WB2A 1O7JA 4WINA 1SZJG 4HAYA 4WNIA 4JI3B 5JNWA 3R5XA 4AG6A 2AL7A 3FA2A 3BRQA 4G1UC 4J8PA 4Z0NA 1Z4LA 1ADYA 1DEOA 1G8PA 4DGSA 1V1RA 3C15C 2IW1A 3G49A 2VT2A 1EFRD 5HSGA 1YRQA 3HNRA 4N49A 3RTAA 3FYCA 1VKHA 2Q5QA 2CYAA 1YRBA 3AILA 3PKIA 4JOSA 1V48A 3ZHYA 1SKAA 4ND3A 1ULAA 4P7BA 1KSJA 1RDFA 4R3NA 3T9DA 3VVBA 2O8CA 5AVJA 1ZMXA 3PRKE 5IVIA 1DAFA 1NFQA 1PJQA 1EE2A 2RB4A 4XM0A 2QENA 1CP3A 2YNMD 2P5UA 1VG8A 3ZHQA 2ORWA 2HTFA 3VUEA 2UXBB 2DULA 3KJHA 4LNAA 5CB4B 3BX1A 4MUYA 3HJTA 4P82A 4WK6A 2HCRA 3UIEA 1W0JD 1OTXA 3QH4A 2F43A 4HGRA 1IB6A 2Q4RA 3O4FA 5BYJA 3WL8A 1GR1A 4Y9RA 4NVRA 2VT6A 4GOXA 2YMQA 4GVLA 1D1QA 4U7GA 4NE7A 3LFTA 4QULA 2CZCA 4PYNA 2J3JA 1PV1A 4JMPA 4M86A 2BP7A 3R3UA 4BJ6A 1P5RA 3Q98A 4MIOA 2GTIA 1BJRE 1JL3A 1ZWLA 2OFWA 3EA4A 1W5FA 2VPYA 4ZALA 4D0LB 1SIWA 3DZGA 5DN9A 2IPXA 3PDIB 2IDKA 2WFLB 4RHFA 1VHDA 3THRA 3DL0A 3ZU2A 1YULA 2HO5A 1UWKA 3D31A 3O7WA 3OMXA 1WCIA 4WLEA 3L6EA 4V1CB 4N6OA 4RZ3A 4JX8A 1RKXA 2FX3A 2O0MA 4OP2A 3OG9A 5DX0A 3MT7A 2R5WA 3BMQA 2QQEA 2JH9A 1AS3A 1RAIA 3Q6IA 1XJCA 2VH5R 1NMEA 1VGQA 1JDBC 3A04A 1TEVA 2BKUA 3P9YA 4WD3A 2YY5A 4RHXA 4NC9A 2G04A 2F17A 2R6GA 5CUQA 3ZV7A 5C81A 2H7YA 2GPSA 4A0FA 3JQ9A 1ES9A 1Y6JA 2IPOA 3GRPA 4MRPA 4QDUA 1WXQA 4FDVA 5I4CA 5IUNC 1PT8A 4R9RA 5J4VA 3BTUA 3EW7A 5BPHA 5EIHA 4GQIA 3M34A 1RKBA 3H0KA 3BTSA 3K35A 4JJGA 1EUCB 3SNKA 2EVWX 1GOTA 4II3A 4PSUA 2JFVA 5F51A 4YRAA 1ZU5A 1RXVA 1N7HA 4DG8A 4RKEA 3SR0A 3IQWA 3W9SA 3E9RA 1RYMA 4FGSA 2JJQA 1LI4A 3GLVA 4P3OA 3NUGA 4Q1CA 4URUR 4X1YA 3KSBC 4BTVA 5IT0A 4XCVA 3P9XA 1E3QA 4Y2HA 4K6FA 1X1DA 4IVRA 3SPXA 1B2LA 2DLNA 2WINI 3E05A 3DV0A 2KWIA 5K3AA 3LC0A 1Z68A 3UAYA 4N0DA 1H1LB 1SQSA 3OEWA 3QQ5A 4NRDA 2PUGA 4HGOA 1S3GA 2PLRA 4OAOA 5EXXA 5H80A 2FF7A 4R16A 3LXMA 3DNPA 3IAXA 3NHZA 4TXJA 5JS7A 1NXXA 3RSGA 5JPIA 1ONOA 2AB0A 3EGDA 3ISTA 3QWIA 4R6WA 3AETB 3IP8A 3U7GA 2I8LA 1O6GA 2JHGA 3WWZA 3MF4A 2WKPA 4M36A 5IWCA 4CKBA 4EGSA 1XHFA 3QOYA 2P75A 2UAGA 3OZBA 1WMBA 4V03A 3HYRA 3VNSA 3VZBA 5K4GA 2RJNA 1OXXK 3WLRA 1Y1TA 5E6UB 1GPYA 4P7GA 4MVJF 5L3QB 1AK2A 1SKYE 4HLUA 4NESA 2D5AA 3WK7A 3VKGA 2QTTA 5IVPA 4C9BA 3ANSA 3PXCX 4MVJG 3EDOA 1QZTA 1F9EA 3KTDA 1ZW1A 3JVDA 3NEPX 3GD5A 3OT1A 4WK4B 5I7AA 4XVUA 4A8HA 3SN6A 3IXMA 2FDCA 1TVEA 4H7KA 4Q3DA 4TT3D 1FYDA 3N0XA 3WWPA 2F9LA 2IQIA 2WSLA 1GPJA 2FUEA 4W8HA 5C7OO 1P4GA 2VDNB 1YQWA 4AC9A 2XMGA 1ONSA 3S44A 1X1QA 1BVYF 5ITZB 2PKWA 4I6JA 3EPLA 2GD1O 1ATZA 1I4LD 4Y98A 3HPQA 4J03A 3A4MA 3DR5A 2JFWA 4TLAA 2HB6A 4HDKB 1J21A 3NG1A 2QIOA 4GZ5A 3LE8A 4GYKA 4CMAA 2XCUA 4A0QA 4PAGA 4EJSB 5KNCD 2PX6A 2K2WA 2OORC 3KJZA 3ORSA 4LY9A 2YICA 1XXHB 1E5LA 2XYRA 1WXDA 3H4TA 3R4VA 3IIIA 3LGAA 3D8RA 1J0DA 1LVHA 1PU2A 4BVFA 1QFXA 1S8OA 2PPLA 5FH9A 1OYYA 1LDYA 2Y4NA 1O4VA 1KPIA 2HA7A 4OXKA 1DFIA 3SZ3A 1GCAA 1L8XA 121PA 4XTRA 3OLZA 3AHHA 3HS3A 3SJUA 2G0AA 3RYFA 4ZOLA 5E6RA 4MHOA 3PFGA 3K0KA 1F38A 2R66A 1QVZA 4JC5A 4PS0A 4XW2A 3STVA 3L9XA 5BRAA 4IXNA 3TLYA 4EY5A 3I8SA 4LRXA 1S2MA 4ZI7F 4DIEA 1JQBA 1PWYE 5IXYA 4PZZA 3BWDD 3F67A 5DM1A 5FBRB 5KHAA 3M5PA 4RGBA 1EGAA 1O0SA 4JVLA 2ZJAA 1XRRA 2EZUA 1WXEA 4IH9A 7GPBA 4MDFA 1EFTA 1PJ8A 3GEDA 3TOCA 5LOVA 1KBQA 2VPZA 1G7CA 4EFMA 4JL8A 3SYRA 3VO2A 5KBYA 2OD7A 3KG2A 3KOMA 1J9GA 1M8PA 5CA0A 3R7WB 3GJSA 2BSXA 1TYDE 4TN1A 1KBOA 4DT1A 5I8WA 1ECGA 1YUBA 2OCXA 4OH1A 3ET4A 1CY4A 4RPLA 4WXRA 3TOZA 3UJBA 5B3JC 1WQ1R 1GL3A 3KQSA 4ZJYA 4IHQA 2WV7A 1E0SA 5KX5A 4TXHA 1XU7A 2CHUA 2WV9A 3BB4A 3O3CA 4H3VA 1FVHA 3LX4A 3PJRA 3W7VA 2XXBA 1MJGM 4COKA 4BB5A 2DYKA 4K1LA 2XKJE 4UAGA 2R8ZA 4DPKA 3DB1A 1KSFX 4BJ3A 4P33A 5IAOA 1T8TA 1E2BA 1CPYA 1G5IA 2XBUA 3I32A 4MLCA 3L0OA 3HU2A 3D3NA 4E2YA 3UV6A 3JATA 2I9PA 4R51A 3HCBA 4WEOA 1K3UB 5DNCA 3PHHA 3RAGA 1QAMA 2PX4A 1E7RA 4B6JA 1E2QA 1O6FA 1M5TA 1BFUA 4KOEC 2XTMA 1WW2A 2JNWA 1KDPA 1A98A 1KR5A 2HCJB 3B89A 4U6SA 4X1KB 3C5VA 3C7DB 3SDBA 3NBFA 3PJGA 2IXEA 3IUPA 4O4IA 5C8YA 3U44A 4KIGA 2Z8YA 4ENVA 3OJXA 4FXPA 4RAQA 5EJAA 2ZIEA 5TPWB 4RTSA 4HLQB 1Z2EA 2EATA 3W4JA 1T4CB 1WA5A 1AF4A 2I6QA 2Y77A 4LMRA 1OU0A 4UE6A 3SU8A 2P67A 3DE4X 4HNUA 4BFSA 4DB4A 2M6KA 4IYJA 4E5UA 1X74A 3K0CA 4A6XA 1E3DA 3JD1A 2YVAA 1BXKA 2WU0A 5J5VA 5SY4A 4R05A 2G3YA 2WVHA 2ZRAA 3CIFA 3EPJA 3AT1A 4HEHA 2OHVA 2XTZA 1U0RA 4JSRA 4TQ9A 1T36A 3HN2A 4W9NC 1QFZA 3OP1A 5FL3A 1OHHD 4I4CA 3RFFA 3DHVA 2ZLBA 4OUKX 4TWJA 4HVAA 4HWKA 3IVXA 2FP3A 2QZJA 3WP1B 2G9NA 4M98A 4YV2A 4IIEA 4KR9A 1GCUA 4YJGA 3KHTA 4K9PA 4F4UA 4QNNA 3N2GA 4RF5A 4P5DA 2I1WA 1YI0A 2ZE7A 3ZCPA 2EYQA 5IH7A 2OAQ1 4ZVKA 4RTPA 3PITA 4M7PA 4DBVO 3LK6A 3JRWA 3K7EA 1PFKA 4RKWA 3WIDA 4NATA 3CUSA 5EKTA 1ZZGA 4KQGA 2C1EA 3C3PA 2ORYA 4CFZA 3PVCA 2HDHA 4FFSA 1GCIA 4HNQA 2PQ6A 4KAXA 1JLMA 4WCFA 3KALA 5K0SA 3OE7D 2HBZA 4UARA 2GBFA 4ZHQA 5DNEA 4Q01A 5AVSA 4DSNA 3WGYA 3DWIA 2VUSA 2ZQYA 4MVJH 2CDCA 1W8IA 1UXGA 1NIJA 5B6PA 5K6AA 3IUQA 4ENTA 3OWOA 1HBJA 1NG1A 2BGRA 3TTVA 1DNPA 1N92A 2FEKA 1N2GA 2QUIA 2TSYB 2ZROA 4H1HA 4XGRA 5ESDA 4ASUA 1OASA 2UYCA 2E2WA 2PR7A 3L6OO 4I3GA 4KNWA 4IMPA 2FY8A 4LJ6A 4JI0B 2GYWA 2HWUA 3EUEA 4NXNB 3MOSA 1IFXA 1OW3B 3IV7A 3JXEA 5AM5A 1P2SA 2DT8A 2QI9C 1PJTA 3TPFA 2OOSA 3OPYA 1ZJYA 2GJ4A 1NW3A 3MPUA 2JA2A 521PA 1QYIA 1AXGA 2H1RA 3EDMA 2N1MA 3T3EA 3KT3A 1RRVA 3NAQA 4TQUS 3V8QA 4YUWA 4QSHA 2LXNA 1YZFA 1PR4A 1N6RA 4EYKA 1HZJA 3JQAB 3LZDA 4BFVA 3TQOA 4EENA 1RLIA 4NULA 1PYDA 1U02A 2OLKA 2QY9A 4I0WB 4HDQB 3E9YA 3LP5A 2VK2A 4IINA 2O2EA 4RH3A 4PZAA 1N9GA 2JLXA 5CM2Z 2Q46A 4YWHA 4ZWNA 1BQEA 1U1GA 2J7PD 4CN9A 3LQYA 2C42A 5J40A 2ZJ1A 3V7YA 2ERCA 3ZV6A 5FOWA 2GR9A 2OILA 2ZBPA 4MKGA 4Y2XA 3R5SA 4DZZA 3EARA 2FJUA 2AOUB 2HA6A 5FBKA 4ZARA 5HUQA 1KXZA 4OGGA 2VDWA 4FJ1A 4IG9A 5EXDA 5G3ZA 3U0BA 3RI3A 4DILA 1FCJA 1Z8DA 5BORA 5JAMA 1UBEA 3UHAA 3ZHSA 2HRRA 2JLSA 2NZYA 2CT8A 1R5OA 3IOBA 2VJAA 1JEYA 1YBVA 3AU9A 4L75A 1V39A 4BEWA 2WWIA 5EWJA 1N0IA 3NAGA 2QUKA 1P6QA 5F3RA 3WLIA 4S3MA 1I7DA 2W6QA 1Q3TA 2YFHA 3RUIA 4F2GA 2JD0A 2P9EA 3EJWA 2BY4A 2Q6IA 5AW3A 2BTQB 2C7BA 2HMTA 2RE8A 2QVBA 4PFKA 4BZXA 4BQEA 1JXOA 1EP3B 2NO1A 3K8QA 4LXTA 1SKQA 2TMKA 2GFIA 2GOYA 3G89A 3M33A 2DTXA 1M7BA 1F0YA 5EP3A 1Z5GA 5C5DA 2XITA 3W78A 2GN1A 5JYEA 3T9EA 2IEDA 2H1HA 5TF0A 3UW3A 1R8QA 1TJYA 3BAZA 1GFSA 1U6KA 2EG9A 4B4KA 4PCVA 1ZCBA 2IKQA 2XDQB 1ND5A 2QW1A 1DCFA 4FCTA 1T0BA 4F1JA 3HEMA 5TS2A 1LRJA 3PQ6A 4RTLA 1BMDA 3PV0A 2CHVA 4GWLA 3PGLA 1YOBA 2YZ2A 3EJ6A 2PYDA 3EDYA 3M9LA 4OYLA 4WBSA 2AR0A 3C8MA 4QJBA 1PX2A 2CKMA 2PXXA 5CFMA 4N48A 4C6HA 2ZYDA 3H9QA 1I2CA 3TD6A 4BJHB 4B79A 5G4KB 4ZJPA 3IESA 3LQFA 3DP9A 5EFOA 3G6WA 5L8VA 4UBMA 5J1TB 3VDNB 4O3MA 2C1ZA 3EXEB 1JB9A 4MW1A 1RFGE 4LYDA 1G7SA 4LEIA 5C51B 4WXEA 1BE6A 1C9JA 3G0GA 4RV9A 3MWFA 1J99A 4MUFA 2Z83A 1J42A 4A0SA 1XMJA 2O7QA 5FTMA 1VJ1A 3KU1A 4Z51A 3EDQA 4KTVE 3B82A 4Q1DA 1E0JA 2H6EA 4WLOA 2X9GA 3AHCA 3OMLA 4WRRA 3AXSA 4AF8A 3LQ4A 1P74A 1GYQA 1T8YA 1OIVA 3H9UA 3IDZA 2O1EA 3A4YA 1P75A 2X0EA 3W5IA 4DG9A 5K09A 4DDWA 4BRWA 3VR5D 1XR3A 2ZR9A 3DUWA 3GW8A 2P6UA 4BNKA 4ETIA 3NTUA 2JFHA 4RJLA 5JD3A 1I5OA 2G4VA 3N6XA 4BX9A 4RBNA 3D4PA 2J1LA 4HQOA 1BHJA 2HI0A 2RAFA 3I39X 2QW8A 3PI7A 2BFEA 3WI7A 3HDQA 2BHNA 1CIVA 1H4VB 2PMKA 1P0QA 1NHWA 4QYIA 5HIMA 4M8SA 3U7QA 3ZWQA 3GFRA 4BDSA 3H8JA 3ANNA 3GJXC 1YF3A 1JXQA 4R0MA 5KQMA 1ND6A 1VE1A 3ESZA 1LBTA 1P2TA 3E9NA 3ILXA 2JZNA 3TIGA 5A4KA 4ZZ1A 4DLVA 4KPUA 4NZNA 1W1IA 1DXOA 5CJPA 1YDGA 5ARCA 4FONA 5GWXA 4I9UA 1ZHFA 5TQ2B 2JFQA 3V97A 2UYQA 1I1HA 3K9NA 4QFBA 3G7UA 1CRPA 3HCNA 4HKTA 3QELA 4Z49A 5K3OA 3HADA 1NQVA 3FWZA 3L7CA 3UK7A 1DBIA 1SVLA 4XARA 3PXEA 3TNJA 4TWZA 1YFLA 3P94A 1C1DA 4AP9A 2V7EA 2D8AA 5TJHA 3IUMA 3V33A 5JJKA 2IDZA 3AL2A 1JSLA 2D1SA 4M9UA 4NQRA 5KDLA 1FUUA 2PK3A 5KQPA 1RABA 4V39A 4GI7A 4LF6B 1U3UA 3OE5A 1E59A 4KCGA 2G36A 4OQPA 3ROEA 3S70A 1E1RD 1CFZA 1WV0A 4JVMA 2W6PA 4EHKA 2IK8A 2YIVX 3P2MA 4RENA 3TW0A 4D0NA 2UZ4A 4HSEA 1UANA 1CZOA 3IO3A 5C5EA 4BLVA 4O2LA 3A4TA 5AOVA 2IHKA 1MC5A 2UZIR 4IKPA 4OMCA 4LXQA 1EXMA 4W5RA 4EI2A 4WAUA 3VJKA 1E9EA 1M73E 4N03A 2BKXA 4TWRA 2WA1A 1RI3A 3QWHA 3UG6A 3KX2A 1KJZA 3MFYA 5EA2A 1WR8A 4B4DA 4Z4FA 4X20B 1T0UA 3WICA 1FDVA 2QTLA 1RZ3A 4FWBA 4I9NA 1K9VF 1XUOA 1J6UA 2CVHA 2G80A 3LYAA 2V4MA 4EG7A 1IAQA 2G40A 5I4KA 1N5IA 1CUBA 5L3RA 5F1YA 2QJTA 4Z99A 3H17A 1K8QA 3JYNA 2L18A 2JHAA 1J8MF 1UFKA 3DJFA 4LGYA 5AJHA 5AW8A 5FA5A 1P7ZA 2CHQA 4RDHA 3TGLA 4C7OA 2KMLA 2R6ZA 3FYUC 3R7FA 1W25A 2E0IA 4NHOA 5BSUA 2AZ4A 3A3PA 1LBIA 4AUNA 1VPWA 2VK4A 3CWQA 2JFFA 2PSFA 1G8GA 3EWIA 3BMNA 1N5KA 3JYLA 4FGJA 4MVJP 4JP5A 3U56A 5GZ3A 2O5CA 4QJ4A 5A4FS 3RH0A 1E69A 5KVCA 4NPAA 3E15A 3WLLA 3BWVA 1O0BA 3MMPA 5E4JA 1GAWA 1UJ4A 2OD9A 3T7EA 2IRWA 5EJ6A 3KKMA 4AJHA 4DCSA 1AKNA 3GFPA 4MV6A 1TMGE 4EHLA 1RPTA 1VHJA 4G0YA 4MS1A 2R3SA 3PDUA 4I6EA 2CXUA 4H6XA 5H83A 5HOEA 1WXHA 1SVKA 4JEIA 4KR0A 2LV8A 4JJ6A 3EGXB 4WGFA 1JQDA 1ZFNA 5HX7A 1EFRA 1N2ZA 2I6XA 3T5TA 4ID9A 1QIIA 5TEVA 4W5TA 1R10A 5ALPA 2X7HA 1C14A 3ICVA 5EYPB 4DQKA 4MUMA 4G5OA 4OJQA 3FMIA 4QO8A 1E9CA 1Q15A 2R44A 2M2IA 2DPYA 2AF4C 3GN1A 4HY3A 2H5JA 1Z2AA 3NBUA 5DU2A 3TOVA 4PO3X 1CLEA 3W2HA 2IX9A 3DM9B 2YNMA 3GEBA 5BR1A 2QM7A 4TL8A 4AIRA 1NDUA 3F2VA 4HEQA 1ZHHA 1WVGA 1OWOA 2C82A 2QUJA 2Z5GA 4KO4S 4NYIR 3TB6A 1N8TA 1I3OA 4PGAA 2GLUA 3IBFA 5EAIA 4KG7A 3QIAA 3U5TA 5F73A 3ZDAA 4HK4A 1G5FA 5HNKA 4LQLA 4TMKA 4JZKA 4ZO6A 2YVKA 3KOYA 5BNZA 1A9QA 1U6IA 3OCZA 1LPNA 3PC2A 4FT2A 4U3JA 4J3FA 1WF3A 1PKXA 4OJTA 1JEJA 3NCHA 3RSQA 1XCBA 2E7ZA 4B3HA 3KQLA 2QUZA 2HJGA 3KSZO 3I37X 1SN7A 1P1CA 2ZPUA 2QRVA 4QQNA 2VYVD 3AYXB 1Y4SA 3K9HA 1KE1A 3D3WA 3ZCQA 1QB8A 4C4RA 3HNOA 1QYRA 6YASA 2TMDA 5FNVB 1NT2A 4GC9A 4ALKA 2XYVA 1TCCA 2FUG1 4JCOA 4L27A 1LNZA 4GKAA 2ENWA 2RI1A 1Q7TA 1PGJA 3ZWWA 3P7MA 2J0QA 1VPEA 4AKHA 3I72A 1C3EA 1H23A 2JBHA 1BU5A 1T34A 1KDTA 5HKKD 1G38A 5H7XA 1W19A 2QYOA 3CN9A 4ARSA 1NW9B 1Z33A 2FN8A 2GZ2A 2NO0A 4XGIA 1JE0A 4KPGA 1DINA 3W5CA 4Q9NA 2FPOA 2EBFX 5B1DA 3VR2D 3PQFA 4ZKDA 1GN8A 1OREA 2P79A 2X3UA 1QZ3A 1QO9A 5H68A 1JALA 1JJAA 3I76A 4Z4GA 4ZVUA 4QWWA 2WOJA 3JAWB 2FSVA 5CB4A 3AVPA 3ANTA 3GP8A 4V1CI 2R1TA 1V2HE 2KW5A 3KVNA 2BUCA 1OIWA 1EXDA 2ZM5A 3C1TA 3ACBA 3X0DA 1DMRA 3I9V6 3M4NA 3S2EA 3MXTA 2LIVA 4DWOA 1CZNA 1V9LA 4S05A 4NBVA 2PUAA 3MJDA 4NICA 3HBMA 1T2FA 4FCCA 5T8KC 1DIAA 2UDPA 3SC3A 3LQRA 2FW7A 1GTJ1 3D59A 2QTGA 5TB5A 1T3LA 1WS6A 4ZOCA 3V48A 4A8TA 2ZUFA 2C2BA 3P32A 4JNCA 1AU9A 4X3PA 3NKVA 3FNGA 3CBQA 3VTKA 2FMKA 2CVZA 2ZIFA 3PDIA 4ZU3A 1AG9A 1SB8A 2XH8A 1LBQA 1P7YA 1VJTA 1PT6A 4CEHA 1U28C 1L5LA 1PR2A 3WNZA 4Q6WA 1CB0A 1YSCA 1IIBA 4N0EA 4NMLA 3O8OB 2IE8A 1NYRA 1YKSA 4XVHA 2DFTA 3BFXA 4P5EA 5HGXA 3ZH2A 1PDOA 4OHBA 3W8F