4KPUA

Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
338
Chain Sequence
NTKGLKTGNEKDLWVYVEHYKGEPVHVVYELLGECRKLADKCNQKLAAVLITDDAKDVPSKLIARGADLVYVCQDPAFKYYSTDEYTNAFCEMIDEYQPSSVFIGATNDGRDLGPRIAARVNTGLCADCTILDAEEDGLIEWTRPAAGGNIMATILCKEHRPQMGTVRPKTFKAMEPDASRTGEVINYTLKNHVDDRVTCIRREEVVSEGEMAIDDAPFVCSGGRGMKAKENFSLLYDLAHALGGAVGGSRAAVDEGFIEHPRQVGQSGKTVTPKIYFACGISGSVQHKAGMSKSDTIVCINKDPDAPMFEISKYGIVGDALKILPLLTAKIKAFKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies on the Mechanism of Electron Bifurcation Catalyzed by Electron Transferring Flavoprotein (Etf) and Butyryl-CoA Dehydrogenase (Bcd) of Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Electron transport
molecule keywords Electron transfer flavoprotein alpha subunit
total genus 115
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
A PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kpuA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4kpuA02
2X3FA 1J1ZA 3FOCA 3N2YA 3RK0A 4FZ3A 1MCZA 1UPBA 1YC5A 3PKJA 1SURA 1Q11A 3IVGA 1XLTC 2CFOA 2UZ1B 3PKIA 2AKEA 4Q93A 2YWBA 3KT3A 1PFWA 2UZ1A 3RIGA 3U1VA 4CDMA 3A05A 1GTSA 4I6JA 3HMQA 2E89A 1O97D 4RMIA 1OWPA 4JUCA 3PNYA 3JWPA 1Q1AA 1O95D 4G5FA 2D54A 1YUMA 2WSIA 1QTQA 4MUJA 2JI7A 4QPZA 3TQOA 4S1OA 3MMXA 1WOYA 1A8HA 3N05A 4KKVA 1N2GA 4MLPA 3CLUD 1EFVB 1H3FA 3IDFA 2CYAA 4MW7A 4FEEA 3RIYA 4BN5A 4C78A 5DB4A 2H2IA 4MW0A 3PDHA 4ND7A 3FHJA 4GG1A 5FO0A 1WXHA 2DJIA 3QTTA 2B7LA 4P2BA 1V5GA 1N78A 3AIIA 4TS1A 2OD2A 4JD5A 5EJ5A 1WKBA 2WVHA 1UPCA 4V1CA 2WB2A 1U2GC 1F4LA 2A84A 2NSYA 2QJOA 4L2IA 1T6YA 1MOPA 2DERA 1PFYA 3E27A 5FYQA 3NV7A 2H29A 1EFPB 1MBZA 2PXHA 2TS1A 1LI5A 2CYCA 4ZT6A 2EJCA 4EG1A 2DR2A 5MGNA 2V0CA 2D5BA 2XRYA 3KFLA 2I1LA 4QBTA 3UK2A 4MUEA 2PG3A 4NZPA 1O5TA 2J4DA 3U31A 3CLSD 3OP1A 1XNHA 4I6EA 2JI8A 4J16C 3DPIA 1Q77A 3HGMA 3AFHA 4RJJA 2QTNA 1FYDA 1NUPA 2GOYA 3KT8A 4HD8A 4CT0A 2R5WA 3SDBA 1M8PA 4MW9A 1SZCA 3U3DA 2DLCX 2DETA 4O8ZA 2PANA 5HUJA 4JZYA 2FR8C 2VBFA 3UMVA 3COWA 4UTRA 1PO7A 1H3NA 1Y42X 1M8GA 3LCJA 4XFJA 1K4KA 1EUYA 2V0GA 2QUKA 1M2JA 3IOEA 3D6VA 3IOBA 4GPEA 4ZP1A 1N2OA 4K9QA 4YBRA 4ARCA 2JANA 3ZGZA 4PBSA 3IMGA 2JAXA 3FNRA 2Z3VA 3HZRA 4DE5A 3FG9A 4MWBA 1PFUA 2DUMA 1YI0A 1E3TA 1GPMA 1T9GS 2A1TS 1T9CA 1WXFA 1YIAA 1ZH0A 2QJTA 1JZSA 4UTNA 3CLRC 2H4JA 5FEMA 4G6ZA 2H2GA 4YMIA 1M2NA 4TWJA 1N2JA 5HG0A 3VGJA 2H4FA 2IHTA 1JMVA 1OZFA 1KQOA 4JSRA 1N77A 3D7KA 3ND6A 1VLHA 2E0IA 2IELA 3P0IA 4Q16A 3CVVA 3ZJVA 4MW1A 1PTJC 2VTBA 5BWNA 1RQGA 1WQ4A 5JBNA 2YY5A 4MPPA 1IQRA 3AG5A 4MWDA 4HPWA 4ZCSA 1T6XA 2NYRA 1O96B 1I6MA 4BVEA 2CYBA 3HV0A 1MAWA 2PFSA 1Q19A 2EL7A 2HMAA 3MUEA 1EXDA 2JLAA 3JR3A 1IHOA 3SEZA 4CQNA 1YC2A 4FEGA 1M8KA 1N2EA 4EG4A 1JGTA 4MUNA 1N2IA 1WXIA 2VTBB 4I5IA 1MRZA 4UTVA 1OVMA 1GTRA 1CT9A 4ZCQA 1TYAE 3M5WA 2OO5C 1KR2A 1KQPA 1OWNA 2VK4A 1ZJWA 2VBIA 3FI0A 4F56A 1J09A 3X1JA 1F9AA 2BTEA 1O94D 3OTWA 1NUSA 1K92A 1NI5A 2AG6A 3DO8A 3Q10A 4L3OA 1JECA 1U0BB 1XNJA 3H9BA 4EG7A 1JIIA 4JUFA 1ZPDA 5IJXA 1N3LA 1K4MA 2OORC 4C7BA 2PZ8A 1T9BA 3CA8A 5EJMA 4J76A 2YXNA 4V1CB 4MUIA 3ZJTA 4ZT3A 3IVCA 3COYA 4JUBA 2PIDA 4MVYA 1YHYA 3GLUA 3SP1A 1O6BA 3AG6A 3S3TA 1Q6ZA 1YNOA 3JXEA 5K0TA 1POXA 3GLRA 4COKA 3HWX1 2WQ7A 2JI6A 2QUJA 1PNOA 5DK4A 1KP2A 3C8ZA 1U7DA 3AKZA 2DPLA 3FH0A 3K9WA 5EJ4A 4QELA 4MUGA 1IRXA 1WQ3A 1G8HA 2FN3A 3ZXIA 4ZT5A 1XNGA 3IOCA 3ZUGA 1K97A 1QQTA 4BN4A 1U3DA 1I6LA 3G59A 1Q17A 3ZG6A 2Z09A 1YUNA 4DDKA 4UUAA 4IAOA 3HWWA 2O8VA 1I6KA 3KT0A 4MQ6A 4Y6LA 1IFXA 4CDNA 3SEQA 4JU9A 1F7UA 1OWLA 5J59A 3ILVA 1Y9DA 3TS1A 1ZH6A 2QTMA 4R2MA 1NURA 4HK4A 4A91A 4BVHA 1T6ZA 1B6TA 3TQIA 3H97A 3ZIUA 1X8XA 5TGTA 1OBCA 3CLUC 3ELBA 3MLBA 1VBMA 4UUBA 1NYLA 3GLSA 3ZGOA 4U7JA 2CUZA 2HJHA 4K9PA 5BWLA 3CVXA 3RJZA 2Q5OA 3SYTA 2Q28A 4HJRA 4JYZA 4GM1A 5MFPA 2H4HA 4PBRA 4KPUA 1D2RA 5FO1A 2IHVA 3UC5A 4KPUB 3MXTA 4UTZA 4IF6A 3EA4A 3FZNA 3CVUA 4UU8A 5K2OA 1R6UA 3H05A 4NATA 5IMSA 2H59A 4ZT2A 1JHDA 4KR7A 1VBKA 1SZDA 5MF6A 4GM0A 2IP1A 1KORA 3D4BA 3HFJA 3SZGA 3VU8A 2J07A 4EG8A 1MA3A 1O0CA 3CR8A 4BVGA 2QUIA 3RK1A 2FWNA 4NAHA 2A88A 3HL4A 1M8JA 1EFPA 1M8FA 1YHZA 4K9KA 3ZGVA 3PXUA 2QTRA 2HZ7A 2JIBA 4UU7A 1U31A 3DLAA 3KT6A 2DEUA 2D13A 1QNFA 2VJYA 5TEWA 4ZCTA 4HJXA 5J58A 1PG0A 1J20A 4DDHA 1IH8A 1MB2A 2QQFA 4Q9DA 4MWEA 1V8FA 4MVXA 1V5EA 4BVBA 2A1TR 2Q5QA 3LOQA 3TZLA 4ZCRA 1YI1A 1R6TA 3N8HA 1IQ0A 3N9IA 4K9NA 3FETA 2ZUEA 4GM4A 3F3MA 2CV2A 2E18A 3IMCA 4EF6A 3IODA 4MUKA 3CLSC 4DLPA 1WXGA 1J8FA 2A4MA 1J21A 3P0HA 5D7NA 1O0BA 5DGDA 5KHAA 1O97C 2OD9A 3UOWA 5K0SA 1EE1A 2EZUA 3EYAA 4OUDB 4HDAA 4MQ5A 4L2IB 5HUHA 1P7PA 1M2GA 2NZ2A 1NSYA 4OJMX 4MULA 2WQ6A 1OBHA 2Z08A 3X1MA 3D81A 3ZJUA 2OV4A 5AHKA 4MW2A 2W93A 5EJ6A 1NM5C 2J09A 5LLTA 1JILA 1UFVA 3GMIA 1WY5A 4JFAA 3PNBA 4KGDA 4RMJA 1IQUA 1OWMA 1PG2A 1VL2A 2GKSA 2X0KA 1M2HA 4MZXA 2A1UB 4ZZIA 3ND7A 5H7XA 1U2DC 2CV0A 1HZZC 5K6RA 1MJHA 1YI8A 3GUZA 4D5GA 1S5PA 1J70A 1U7XA 5EJ8A 4R8MA 1MAUA 2Q29A 1JEDA 4K9LA 1QRTA 2RD2A 1JZQA 3INNA 1S7GA 4QRDA 2J5BA 2PGOA 2H2AA 4PBTA 4RPIA 5J5AA 3LE8A 3AL0C 3IUBA 1NP7A 2J08A 2PZAA 3IH5A 4R0NA 1KP3A 1G8FA 1N2HA 4Y6QA 3RFFA 4UZFA 1N2BA 3G5AA 3K35A 1M2KA 1KAMA 3FSJX 1LI7A 5BWOA 3P52A 4OUDA 1GLNA 4X3PA 1M83A 3FY4A 4YP6A 5LM3A 3G6KA 3CVWA 1M1ZA 4DJAA 4NDAA 1OZGA 5EJAA 4EFKA 1D4OA 3COVA 3DV2A 1PFVA 4IG9A 2V3WA 4FZJA 3D6UA 2JLCA 5MFZA 4I6GA 1BFDA 1PNQA 2B4YA 1FFYA 2X1MA 1TYCA 1LW7A 4F4UA 3A4IA 1T9AA 1YTLA 1OZHA 4J75A 4JXXA 4AQ7A 4BVFA 5FNZA 4U8HA 3CLRD 1QPBA 2E21A 2AZXA 1F7VA 3MLAA 1OWOA 1ILEA 1Q15A 4MW5A 1O96A 5IHXA 1R6XA 1U3CA 4PY2A 2C31A 3TZEA 2H2HA 3PRHA 2CT8A 5EKDA 4ND6A 3CF4G 3Q4GA 3SZ3A 2AG0A 2FSVC 3F6EX 2QUHA 1PVDA 3H99A 4E1AA 3A04A 4YP5A 1N0HA 3IAEA 4GU5A 4X3OA 1VBNA 4MPJA 2QJFA 1YULA 1JIKA 2HGZA 2VXOA 2H2FA 2XRZA 5K6TA 1WXEA 4XSVA 4X0EA 4RJIA 1YIDA 4FVTA 1WJGA 1YBHA 3OE1A 3E9YA 1T9DA 3H9CA 4MAFA 1S4MA 1OD6A 4BV2A 5EJ9A 3COZA 4ARIA 4K0RA 2C5SA 4EGAA 1G59A 2YWCA 4DNXA 2JA2A 4XFDA 1PT9A 1V5FA 4DDMA 4QQ8A 1DNPA 3TNJA 1QRUA 4MVCA 1KKUA 5F23A 2NXWA 4NX2A 4AS1A 4EG6A 3IAFA 4JUAA 4KXQA 1V47A 3GLVA 2IJGX 4BUZA 4K9MA 2EZ4A 1G8GA 2GM3A 2CSXA 2FRDC 3GLTA 2A1UA 5EJ7A 2VBGA 4WSOA 1XJQA 2A86A 3RHSA 3VRHA 2X7JA 2BYTA 4RUKA 1HYBA 4MUFA 5DEOA 1ICIA 3IVXA 1GN8A 1KH1A 4U63A 2QQGA 4D5EA 4K9OA 4EG3A 1TFUA 1KQNA 3ND5A 1QU3A 1QRSA 3FLMA 4GP9A 1JEEA 2EZ8A 3RBAA 4JU8A 1EUQA 2EZTA 4F3RA 5TEVA 3A2KA 2O5RA 2CV1A 5DASA 4MPRA 4ZT4A 1TYBE 3NBAA 2H2DA 4JT8A 4K03A 4RMGA 1O94C 1COZA 4WNYA 3I05A 1GZUA 4ZCPA 4KR6A 1TQ8A 1I2DA 3CLTC 3UY4A 1U28C 2Q5LA 1NUQA 1ULHA 1KH3A 4R2LA 3ZXSA 2EZ9A 4RMHA 5H16A 3K32A 1JSCA 4NAUA 2IHUA 3CVYA 1TEZA 2JI9A 3LQ1A 4EG5A 2VK1A 1Z8NA 1MB9A 1WZ2A 4ZT7A 3CLTD 4V1CI 4BV3A 5BNZA 5DEIA 2WVAA 1QJCA 1UPAA 5DGTA 1DJLA 1N1DA 3P0JA 4JXZA 3EY9A 3PNVA 1O95C 3IMEA 1J1UA 4JUDX 4MW6A 2Q27A 3F6BX 1T9GR 2OD7A 4JT9A 2A7XA 1PYDA 3FDXA 1X6VA 1IVSA 2RE8A 3Q12A 1N75A 2BRUC 1H1TA 5LFAA 2AG1A 5KCMA 4F4HA 1JIJA 4UTXA 1POWA 4MUHA 3QE4A 4YP7A 4BWVA 1BS2A 5TS2A 4J1TC 1Q14A 1QU2A 3X1KA 2WVGA 4QREA 3ISJA 4GRIA 2ZUFA 1PI3A 3IUEA 1NUUA 3FWKA 4UZEA 1KAQA 4MW4A 3QTBA 1NUTA 4G1CA 2OQ2A 4MWCA 1EFVA 1GAXA 1ZUNA 3L93A 1NZJA 2X1LA 3NBKA 4G5YA 5KWVA 2PZBA 1H3EA 4KR9A 2DXIA 3FIUA 2Q5JA 4H3SA 1EJ2A 5K3SA 1MC1A 2PGNA 4MVWA 3L92A 2VK8A 3BL5A 1KH2A 5AHWA 1TYDE 4TWIA 2ZP1A 4Y6OA 4RJKA 2G36A
chains in the Genus database with same CATH superfamily
5K5EA 3JD3A 3PYXA 2HW8A 3WYFA 1P5ZB 3PFHA 1VRCA 4FK8A 4RQTA 1A2OA 2CXTA 2PUEA 6CHYA 1DFIA 1D07A 4UHHA 5F33A 4H1TA 3T0IA 2MSEB 3HB0A 5D51S 1FFSA 3PQ2A 4BO2A 1UH5A 2OVBA 1A76A 4F5ZA 4ENVA 5IRCD 1KKLA 2VYQA 2OV8A 3G2HA 5EXSA 3T1YB 2RGWA 3QFHA 1EZ1A 1RBYA 1XVAA 1O8CA 4W5QA 2D54A 1ODJA 4OQNA 1MRSA 3EG5A 4ZANA 4OYYA 3RPEA 2Y2UA 2CNWA 3GRVA 1DLJA 3L6EA 4UBLA 3G8CA 4D6XA 2BH2A 4MTLA 4C7OB 1CSEE 3GEBA 3QPVA 1USVA 5AW1A 2WKQA 1T0BA 1G6HA 3NC4A 4C6TA 1JR2A 2W2NA 4N5DA 1WXHA 2JLZA 1DC7A 1WTCA 1N5MA 1L1RA 1WKBA 3PXBA 1CUUA 1XMXA 3NJ4A 2CCJA 1X8JA 4NOJA 2JJMA 5IWCA 1O1YA 2QRVB 5IVPA 3B5EA 2IS2A 5AW6A 1T9ZA 3P9RA 3DMYA 3URKA 3IRUA 1XHLA 3DT9A 3QA3E 3NM5A 2DR2A 2QZ4A 3PGJA 1V26A 3SBOA 2EHDA 1PQYA 3PJFA 4QGGA 1LLUA 1TM3E 4E0BA 3EEFA 1VJGA 3TGPA 1W0CA 1JH9A 2C4HA 4ILKA 3KEMA 4OL0A 2GKOA 3LP8A 1NF9A 1QYWA 2GAAA 2ILTA 4KXNA 1NUPA 3R9XA 4F2PA 4LECA 3O90A 4DCGA 1PQUA 3YASA 1NRXA 4POAA 4X6XA 1MU0A 3FBTA 4FYPA 3GJ8A 2G3YA 1UXGA 2RC5A 1VJTA 2GRAA 1CP3A 2P1RA 3EF3A 1RMQA 1P31A 3GJ5A 2VBFA 3K5WA 5BSEA 3UV6A 3U7FB 3FRHA 4R51A 2Y05A 3ZEAA 1STOA 5AMXA 2IXGA 1RPZA 4W9RA 2A8YA 5AXAA 4ZHQA 4EYGA 3SKXA 4NCBA 5JJBA 3ZBTA 4JK3A 1OFHA 1QH1A 2QA5A 2GPBA 4IZOA 1E1CB 3IMGA 3RADC 3LX5A 1OV6A 4W7HA 721PA 5LCXA 3TCXB 1JWBB 3ZNOA 1ML4A 5EOVA 3S70A 4CCWA 1LDMA 4CQLB 5BPFA 2O6HA 3O83A 1E7YA 2GUGA 4XARA 4I9NA 1T9CA 4ZQIA 3V4LA 3ZGXA 3G23A 4EKEA 5ERYA 2C9ZA 4RZHA 4MYUA 3ORFA 3DFFA 3Q1KA 2FZ5A 4OFXA 5FQNA 3ENNA 1I32A 4G6ZA 4ZVMA 5DXFA 2X0DA 2C2OA 1N2JA 3JQAD 4CR7A 4BNNA 3QI7A 1W88A 3BWBA 1Y5IA 4QM7A 3F5QA 3EISA 3RU3A 3NKVA 4JUIA 3EXHC 2Q62A 2H92A 5JV5A 3UHOA 3ISTA 4BEBA 1CUAA 1H2FA 3O38A 3H3JA 4KWIA 2YY5A 4J0HA 4HQKA 4A9AA 1IIRA 3OQIB 3WA6A 4LZAA 2HCTA 2IYLD 3RJMA 4OI0A 5BUZA 2Y0BA 4RX1A 4K3UA 2EL7A 5ALRA 2CB9A 3FB1A 2FXIA 4C4ZA 2BN4A 3I0NA 2DAPA 2NX2A 4FEGA 1N2EA 3VYVA 2IUTA 4EG4A 5EIOA 4GOOD 4KQ2A 4DY6A 5K0ZA 1C4XA 2F8MA 3IUSA 3IR6A 5KS2A 3LX4A 3PXCX 1PJ8A 3E05A 3TQQA 2R6GA 2WD7B 1NZDA 3BTSA 1OWNA 1Z47A 2E1PA 2HLDA 3K3PA 4M0EA 4QUKA 5KJCA 2ZB4A 2NU8B 3I62A 1C3OA 4LYHA 2MOKA 1N34B 3J7AC 1T3GA 2YXDA 3KFXA 4FDVA 3HJHA 5K0EA 5L45A 1EQUA 1ZL2A 2AG6A 1L4UA 2YZKA 3OOHA 3GB9A 3P8ZA 4ZI7B 4EA6A 1I80A 1XNJA 1FMLA 2BCGY 1LTHR 3V9PA 2OAEA 3GYGA 5JY1A 2PZ8A 1G5RA 4NPCA 3V2HA 5CG1A 4YJKA 1D5CA 4BQIA 3WFIA 4S1TA 5LKRA 5J4VA 5B3AA 2UYYA 1UXIA 1TU0A 1TZJA 2V4MA 2Y1FA 4ZRDA 3AEKB 8LDHA 3GD7A 4DV4B 5BSGA 3LC1O 3FB4A 1HSOA 1PV2A 4Q0MA 4NENA 5IG2A 3EF1A 3GAFA 4CJXA 4D9NA 4DOMA 1X7ZA 3L0BA 2HPZA 1ZX1A 4NS4A 5ALJA 3QFSA 5CJJA 5T6MA 1GM5A 4M49A 4GMXA 3N86A 4C3VA 4G5OA 4YRGA 1FDUA 1U7DA 2HU2A 4UASA 3K9NA 4MUGA 5B6IA 2CJFA 3SVZA 3IOCA 1RC8A 1K97A 2E85A 3EMDA 1U1DA 4P22A 4QVKA 4EB0A 5AW3A 1UMDA 1O77A 3U80A 1SAYA 1XDWA 3M7IA 4IAOA 2VXCA 1GUYA 4ARBA 3HCDA 5C52B 2Q0XA 1UIRA 2NXEA 1JFSA 5FI5A 1KVRA 3O1JC 4E21A 1OXXK 3MIIA 3NHBA 3F96A 4B43A 1CS4C 1MC5A 2H4YA 2HRDA 3TG2A 3G0GA 5CT9A 2AUMA 5A9SB 4JVSB 4LXUA 5CB4A 1YL5A 2IIQA 3FPJA 3FSGD 4I4TA 3L9XA 5I7OA 4ZDJA 5KB3A 2P6MA 2DUJA 4UUBA 1F48A 4IIBA 3RHTA 4XVHA 3TLGB 3QPCA 1E96A 3NU1A 1R6BX 1FYWA 1W48A 2Q5OA 4GE3A 5JYEA 1F8FA 1QORA 3ESCA 1C0IA 4IH9A 3TLEA 3PA6A 2AF4C 4I9UA 3FYCA 4P4UA 4EDHA 3BXGA 2JDIA 2C84A 2J6IA 3ICQB 2JAQA 2AMVA 2ZRIA 4N47A 1UC5B 1U0FA 1CJMA 1WRBA 3CZMA 5MF6A 3GRPA 1SUWA 2VDVE 4OU4A 5IUJC 3RE1A 1OU0A 3S6JA 1VI5A 4BVGA 2O19A 2GLXA 1B42A 1A95A 4NAHA 1XA4A 2JFUA 3GDFA 4BE9A 2ZJ5A 5BYAA 1TRKA 4DL9A 4YT4A 2X4IA 4JP1A 2P79A 3T12A 4MPDA 4HGYA 1Y8RB 4XQGA 3KZXA 4ZC8A 3R1IA 1FXWA 2HQOA 2Z1MA 4TTAA 2Q7OE 2P9BA 3L8MA 3ETGA 3PFFA 3I09A 3HBNA 1BCRB 2QRKA 1L7BA 1J24A 2XGGA 4FYMA 4J7AA 4MITA 4U2BA 4FQ5A 5HFAA 5JJCA 2QY6A 1XHFA 4B3HA 4DDHA 4NBSA 4D4HA 5ADWA 2H06A 2IHYA 2ZSHA 3M1AA 1BO6A 1FC0A 2HDHA 2EVWX 4HMQA 3KHUA 2ZRGA 1YCGA 4Y6SA 2DR3A 3OEHD 3QG1A 3LOQA 1YI1A 2C9OA 5DLQC 3DQZA 4CM5A 2DYKA 2CNWD 3FUVA 4HX5A 1M1YE 3GH1A 4UCXA 4WXYB 2AKYA 2VTKA 3TR6A 1OLOA 4HNRA 2O20A 3Q7PA 1C30A 2YCLA 3NHMA 4FDLA 3WVNA 3CLSC 5K0JA 2LNDA 4H1VA 1EFRA 2GYWA 1WXGA 1E8DA 4N18A 1J21A 2W6IA 3MPUA 3O8DA 2YQZA 1K27A 1H5QA 3FPHA 5CXSA 2W71A 1ZK3A 4MGKR 3G8BA 5B37A 3UOWA 3UUWA 3WIVA 4MKGA 3W2HA 2A3RA 4MQ5A 3STUA 2J9FA 3I9LA 4FGJA 4KN9S 2IYQA 2HPVA 4R16A 3TK1A 3PFWO 3UAYA 3UH0A 4AKSA 1FFXB 1FMCA 3NAGA 2ZVDA 4WFIA 3ZN2A 4DLRA 4EGFA 4YUAA 2FVYA 3FLEA 4YJGB 5FI3A 5JEDA 1R5OA 1APBA 3D2CA 1E64A 2RDMA 2PBLA 4RIGA 3VAAA 1H0SA 3VTKA 3B6IA 4JA2A 2YTZA 4PLPA 1FRZA 2QTZA 3EARA 3JD1A 1XXHA 1JH8A 4IUCS 5TT1A 3NS7A 1Q0ZA 4GF5A 1N8KA 2GM5A 5H7XA 2D7DA 1KZGB 1O3YA 4N03A 5BUQA 1E4EB 1TMGE 4F06A 1HZZC 9MHTA 3PE6A 1L4HA 3P94A 1BEEA 4MMYB 4C7VA 4UQPA 1S8FA 2R65A 4HEA1 1AT1A 3GD5A 4MUBA 1ZUHA 2M6SA 4ZKDA 1EWRA 4DUPA 5CYGA 4FGKA 4KN8A 4II2A 5CDUA 4JP5A 2ZYHA 3E2MA 1JJFA 4PBTA 3EOZA 3NTLA 5F3DA 1Y7LA 1NP7A 3BXFA 3EXEA 3WWDA 5HGXA 1XKLA 3N7UA 4EI7A 2O7RA 3OCJA 3DSRA 4C21A 3VHXB 2CVFA 3KPUA 1XU4A 2G4LA 3QFRA 4QOJA 1T2DA 2YZMA 4S1NA 1GD1O 3T99A 1I4LD 1C9YA 2B78A 3AINA 5DZSA 4J3NA 4YP6A 2Y66A 3P45A 3DZFA 3K20A 4M0PA 3IAS1 1L4YA 3H7AA 1EWVA 2Q3EA 4G1MB 4O4JA 5FEUA 1OX4A 1B1CA 1FY2A 4ZYTA 5E38A 4ALJA 1YCDA 3AI2A 4P83A 1DCKA 1WE2A 3LBYA 4NPHA 2J7PD 1B93A 2IODA 1Y1RA 4QOFA 3S4YA 4C4RA 3GW8A 4LDZA 1Z0IA 4ZPJA 5F98A 3HVUA 4B4OA 4RKQA 1NY6A 3O21A 2BHNA 2D0IA 4N39A 1G3UA 2ONZA 1QTIA 3C8HA 4PZ0A 1M75A 3D6MA 4NJEB 5CJPA 1R0CA 2I7TA 4TS3A 4G9EA 1UBGA 3AV3A 3JD4A 1ACJA 4CV0A 1SXGA 4BMSA 5FA6A 1SD5A 1GQOA 2Z95A 4W82A 5ITZA 2MSLA 1GLVA 4QPCA 3DCYA 1Y8CA 2PWBA 4J4BA 3EXEB 4KB5A 3ONFA 3WQSB 3ABIA 3BFJA 3A04A 1QC5B 1REQA 4XQCA 1EDDA 4R5HA 1E9BA 1GTZA 3MGAA 1VBNA 4DMFA 1I7SB 2HGZA 2H2FA 2PVSA 3H75A 4RIFA 2CMDA 2Y92A 5K6TA 4B6PA 4RZSA 1DOAA 4NCNA 5B4VA 1ULTA 4CI9A 2YH2A 2H1OA 3DE2X 2HWYA 4Q7KA 1LSUA 3OPYA 2AEFA 3Q3GE 1K6JA 3G82C 1QGUB 3EWSA 4G0QA 4LYAA 4N7RA 4RHCA 5BR8B 1QHEA 2VWPA 3RYIB 4LF4B 1H2WA 1XB2A 3H86A 4G4GA 1DT5A 3ZGLA 1UR5A 3MINA 1EA5A 1CBUA 3BB4A 1HYQA 4YIKA 1RWOA 1QF6A 1U1IA 2Q6LA 3AI1A 4PF1A 4QYSA 1ONNA 1VSBA 2DBVO 2AOTB 3C3MA 3LCMA 1UZLA 3IT2A 1E61A 3LFHA 3C6YA 1DDGA 2C83A 3LKZA 3AUYA 4IIUA 4Z9AA 1J6UA 3A3YA 3O9VA 4NYMR 2IJGX 4OFWA 1UL1X 2YYZA 1GKIA 3AI3A 1YMVA 3DEZA 2QSUA 1ZD5A 3DDSA 2I0FA 3KZOA 3NATA 4O3FA 5CCBA 2V1UA 2NQ8A 3F4KA 2FRDC 3M1YA 3EMBA 4L8VA 1WMBA 2Z83A 5BQ5A 2IU0A 1BJRE 3KLMX 1N5LA 3L01A 3W9UA 1O8BA 3UB4A 2HWWA 3OE7A 5J47A 4TUYB 4IDOA 3IXMA 2CXSA 1HFWA 4KPEC 3L0YA 1TMOA 2KB0A 5FTWA 1GZ4A 3BGVA 1KQNA 4YUZA 5ESXA 5B55A 3FLMA 3PEEA 3OZEA 4BNUA 3FHOA 3G7UA 4OAQA 2PRSA 4DJDC 1DCMA 2D1YA 2UDPA 3CGGA 3L7NA 1YVRA 5JCJD 1EUQA 4PSCA 4Q9KA 3ZDCA 1OU4A 5AVVA 4TZ0A 1X7XB 1NRJB 3I6MA 2OECA 4BP8A 1NJFA 2QAGB 2PUVA 5BN4B 5THXA 2ZRMA 3VR4A 3SXJA 1XDGA 5D5HA 3ZU2A 4JL5A 1WD5A 2I2AA 4WGFA 3OHMA 4EYSA 3KELA 4HV4A 2HCFA 2CE2X 1TM7E 1TTPB 2GNPA 4P3XA 3LH5A 2BTQA 2UUAB 2FW9A 1UODA 4DLWA 1EFKA 2IGBA 4GX1A 4I19A 1XXHB 1RRFA 1ZAKA 2PXCA 1Y9JA 4D99A 1CVIA 3FJ1A 2CEAA 4JB8A 1RKVA 4J1QA 3HU1A 5DIFA 1RLOA 1IMJA 2RGGA 3WB9A 3IJ5A 4QRIA 5IASA 3QJ5A 2W2KB 3REQA 1X6VA 1G4UR 4Q02A 3Q12A 2GCEA 4D79A 3ZLUA 5CB6A 3VO1A 5JXJA 5KPDA 1DBWA 4KITB 1LJUA 2I78A 5JZ9A 2ODBA 1U0OC 2A9QA 4F4DA 1LX7A 3W34A 3OX3A 3UJ8A 1GRQA 4RL6A 1N5OX 4QREA 3RI3A 3ORHA 3OIFA 3V8MA 2A33A 1FSPA 2JF0A 1U9YA 1JTFA 3OX2A 2JRCA 1KAQA 4Q48A 2NO6A 2P35A 2QROA 1R0YA 4D2IA 3LT1A 1ZVVA 4Q7EA 2GB4A 3ESXA 3I9OA 3PIIA 4PSAA 4RF3A 1LBEA 2QG9A 3KR9A 5KYVA 4CQJA 2GPNA 4JJAA 3TNYA 2BOVA 4J0DA 2PUGA 1TLFA 3I37X 4UATA 2XBMA 4KNYA 1SVMA 1EDBA 2Q5JA 3IVAA 3UMJA 5B6JA 1TTTA 1X1QA 1Z8HA 2Q6VA 4P53A 3RKRA 6AT1A 2P7IA 2RGYA 4Z86A 5EESA 1VJ0A 2PRKA 1YFLA 2NU7A 3AVYA 3ZH2A 3PYMA 1DAKA 3LG2A 1ODTC 2RGUA 2Z5GA 5EXPA 3W6UA 5DP1A 4YV1A 4O4HB 2BFMA 5D2CA 3HN2A 1UFOA 4EO4A 3CZ9A 4YROA 1XCJA 2P8SA 1O97D 5E0KB 5I8ZA 4YDRA 2B20A 4GDMA 2JH9A 1YL7A 3NJRA 4OHKA 4RQBA 1BXKA 1XQ6A 2FH5B 1QIJA 1U8YA 4RA9B 1E1RD 1EXMA 4R2XA 3E3MA 4QTTB 4ZO4A 4H6VA 4CM6A 2WSBA 1NDUA 2VJKA 3GU3A 2ZBUA 3FYUB 4Y1EA 4JGGA 3VU3A 4BKRA 2XUHA 2Z30A 3CPSA 3HB1A 1PN3A 2FEPA 2N42A 1U6IA 1FX0A 1Q84A 4LWQA 4Q1DA 4MW7A 2J9ZB 1OFUA 3K9HA 4WINA 5JFTA 5G0WA 4X44A 4X8MA 3V97A 2W6OA 1NXPA 2RIPA 1UKZA 2QVXX 1J7JA 2OD2A 4TS1A 1RJDA 2OFFA 2Q46A 3V6MA 1I2AA 1JR3E 4PICA 4V1CA 4DR5B 4EAQA 2DFNA 5IUKC 2VK2A 1XFDA 5GOZA 1JDPA 1OAOC 1VMEA 1Z35A 4UD2A 1J0XO 5G2OA 4EB8A 4ZYYA 4YS6A 1LI5A 2H07A 1M6VB 3KEGA 1GDDA 2XY4A 3LFUA 4GUDA 4L3WA 2NVBA 1UBUS 2D5BA 2XRYA 2GPAA 1VG1A 1WNFA 3GJTA 2FWPA 4MRNA 4QBTA 3PU6A 4MUEA 3KYDA 1KK2A 1XCBA 3T0GA 4LYEA 5A5EA 2G76A 1XNHA 1T2CA 2DC1A 3AL3A 1QHXA 4C0XA 2IA5A 3V32A 3ERCA 3J7TA 2WHPA 1PJLA 4HLUC 2XYPA 4BKOA 1FTYA 1MV5A 2OOSA 1E6KA 4M0FA 1GXSB 4LY9A 4C87A 1I51A 1ZG3A 3BJRA 1S01A 4G8CA 3DDHA 4OBEA 4QU8A 4RPLA 4JZYA 1QIIA 5TT0A 4BB9A 2BEWA 2ZIWB 3QMVA 1JUDA 5J5CA 4IILA 4J90A 3JZFA 1HDYA 1AU9A 2W00A 4J43A 3QKSB 1Z4LA 3PD7A 1SK8A 4P34A 1BXRB 1RJGA 4IQ4A 3IOBA 2VP5A 2YRXA 3NASA 3TEJA 3ZGYA 2GK7A 1B2LA 4Z7JA 4IXTA 5T64A 3JQQA 4JYMA 3C14C 1IK4A 1FXWF 4C2TA 2ZDHA 3NGMA 2FPLA 2V97A 1JKXA 2W6ID 3TAUA 4FW9A 3KVNA 3C43A 5JD3A 4FHCA 1R6VA 3LHKA 4FYXA 2J3LA 1XVUA 1V3TA 3CRW1 4HAYA 1WIWA 2VJNA 3ZHRA 4YUWA 3NEAA 3U56A 4G07A 2FPRA 1Q3KA 5FUXA 4BLVA 3TWOA 3SIXA 5L51A 5ITZB 1IOZA 4JSRA 2B7CA 1DKMA 3PWKA 4GSKA 5T4EA 4QBIA 5KYTA 1YCHA 3ASYA 4Q16A 2A4KA 3OEEA 5C1PA 3ZJVA 2FDRA 3DDCA 3QVTA 5K05A 1FDVA 3UCEA 13PKA 4A92A 1V8PA 4P5EA 4QYMA 2A9VA 5YASA 1CJKC 4GYKA 3VKUA 3MC1A 1SCUB 3WL7A 1LFAA 2HMAA 4ENQA 5LU8A 3HXTA 2Q2QA 4MWSA 4Q9IA 1BDBA 1OOEA 3C8UA 1RPAA 4IHQA 1IHXA 1ORDA 5IUNC 1PUXA 4E5NA 1MEJA 3QX8A 3S8MA 1A5SB 3H5TA 5KBYA 3FCAA 1DJPA 3V4VB 3AL2A 1VLVA 2ZJYA 4W99A 2QVCA 3NDRA 3MTAA 3DMTA 4UAUA 4AJ2A 4U2GA 2JA1A 1CJSA 3CVJA 2AT1A 2NO4A 3QVWA 2EKLA 5CB4F 5HQ3B 4P33A 1ZLXA 2A0UA 5FOSA 4K7JA 2GN6A 3TFQA 1P5JA 3VV2A 4MARA 2OORC 1HTBA 2P67A 3AEZA 3C8MA 5CAEA 4FW8A 2IYYA 4YCLA 3B2EA 3JQRA 2D1QA 3B51X 4P0TA 4JI8B 3PQ5A 2HTFA 2XUGA 1W0KD 2V6MA 2CKMA 2D2EA 3T1HB 4NMLA 4PQFA 2ACWA 2EDAA 3HI4A 1EXVA 4CDRA 1L4BA 2CUKA 1TI7A 3H0EA 3WDSA 5B1DA 1VP3A 4B9AA 1VPVA 4O25A 1XP8A 3F7MA 1QHIA 1PHRA 2PWYA 2QRUA 2XQJA 3EZYA 3NHUA 3CIFA 3M33A 1JR6A 3A6ZA 3VXKA 4TMFA 1JDBB 2Z8ZA 1ETUA 4A6DA 3AKZA 4UC0A 1ID8A 2JFQA 3ECAA 5J3JA 5M3BA 4JJIA 2HBZA 4MJLA 2KBFA 3RNOA 3SE7A 3ANXA 3T9CA 1DDIA 1VL0A 4FM9A 3O82A 3FBGA 2WMYA 4J7XA 1X3SA 4M9XA 2FUKA 4TT8A 1QHHB 2WILA 1DKNA 1GRNA 4IPTA 4QFCA 2X77A 3NT4A 4KPYA 1ZMTA 2QPAA 3FBWA 2EWMA 1IFXA 2I5PO 4LBYA 3U7RA 4BIIA 4WN3A 1M5TA 2JD1A 3WYEA 4JYBA 5J59A 2LR0A 1E79A 1EIZA 3VHQA 2FN8A 4OHCA 2RBKA 1CUDA 2EQAA 4E94A 3BMOB 3GNSA 1W2WB 2X0RA 4MRRA 5EI5A 1ZI6A 2HLHA 4D74A 4CLRA 4JYPA 4Q3LA 1U3FA 2G6BA 2CNLA 3TAHA 121PA 2RFLA 3MQ4A 3IP5A 1IY9A 1XZGA 2CLMB 1IZ7A 1TZBA 1U7OA 3NT5A 3Q9LA 1SEPA 2C95A 4YJFB 1VE5A 3AM3A 1U7TA 2P5SA 3FAKA 2NZWA 4UULA 4XASA 5J2TF 5DLDA 4N6NA 4ACAA 2IDZA 1HBJA 3DV0B 4JLMA 1B8OA 1SZDA 2AR7A 3QKIA 4M8SA 2O5CA 1N1MA 4Y0NA 4XTCS 3ZIAA 4EVRA 1OTHA 1U0JA 3EEIA 5CB8A 4B3RB 2P3OA 4CLDA 4GXQA 4G5RA 2XB2A 3OZIA 1I0LA 2ADFA 4YAIA 1RAIA 5KYXA 3IEKA 5EGSA 1DRKA 2FWJA 2B5OA 2ZRLA 4LGCA 2L19A 4XCVA 2HV8A 1N9GB 2OFXA 3UMGA 2P5UA 3PWSA 1U31A 5G0UA 3S68A 4CEJA 4ZARA 3SJ7A 1PWXA 4HWRA 4LE1A 1KJJA 4B4VA 4DNOA 5CVTA 4MYDA 4YCCA 1TUIA 4CF5A 2G70A 2ODQA 1R0BA 5EUBA 3MJHA 1VKZA 1SUBA 2V3VA 2OO5A 4OXNA 2NUTB 1Z83A 2PL9A 4H17A 4TL8A 3TRKA 1P19A 1A4RA 1VB3A 1Z2DA 5CLFA 2J3IA 2VHQA 5AVWA 2R8PA 3VR6D 1ZM9A 4U00A 4G01B 5FBWB 3R7WA 2O05A 4HZUB 4B6QA 2A5FA 4KX3A 4WUVA 4KIFA 4PONA 3NC0C 3WQRA 4RGYA 2FR1A 3BXPA 2RH4A 3WKAA 1W73A 2GAJA 4NZMA 1WHTA 4KYUA 1KPIA 2HYIC 5C53B 1ENZA 3PVSA 3MYRA 3W1WA 1T5DX 2BI7A 2QD5A 5P21A 1TIKA 2QT1A 3D0QA 3TLGA 1KMMA 3DGEC 3EWIA 1X9HA 1CDZA 4X1KA 2Y8EA 1DWPA 3TDMA 2BGUA 1P39A 2R1VA 3T6KA 5I7VA 1AMUA 2NZ2A 3HACA 3IE2A 4R1PA 2ZCVA 2ZS8A 5A0FA 4J0IA 2Q4RA 3QRWA 2I8CA 3BE8A 1RCFA 3QYJA 1ZSVA 4ARVA 1QO0D 4E07A 1PRYA 3W2GA 2J09A 2OFPA 5DM4A 5AYVA 5B7QA 2REOA 5TQ2B 3ZHZA 1MF7A 3H1EA 3OE7D 2XRFA 3I52A 3WGGA 2ZRFA 3IOMA 5GJCA 4JFAA 5CRIA 1IQUA 1OWMA 1VC2A 2VUSA 2ZT7A 3C6XA 1M2HA 2BRUA 3HDVA 3MTQA 3QM1A 2VHTA 4LXXA 4LGMA 1AKUA 4HRAA 1L7VC 3AERA 5CLGA 1VKRA 3PZBA 2XMZA 3UWKA 3SZRA 3EVDA 2HLNA 4KI0A 2Y6UA 1MUUA 1XOIA 3GUHA 1IJBA 1NI4A 2I8AA 4K9LA 2Z2ZA 1A7KA 4V24A 5D3KA 2VSYA 5BWBA 1TA9A 3K8YA 2DH6A 1YDGA 1YB6A 4LHXA 2II6A 1WY7A 4XLTA 2COEA 4RPIA 3F6YA 1J2TA 3W90A 3FKJA 3K0AA 4C06A 4LNHA 4GEGA 4UZFA 2ZBRA 4B3BA 1MAVA 3FPBA 1HT2E 1ZN2A 2FMIA 2JBAA 3U4DA 1T2VA 2H7XA 1HTTA 1TF7A 4W5HA 4J1TA 4DPLA 3OQHA 2QAJA 1T91A 3B6MA 1F4PA 3KBOA 3FNEA 2K6GA 2XWBF 2Z1DA 3ZWCA 1TVCA 1RKBA 2HJSA 3H5NA 1HLDA 3LQYA 3B7GA 2BEKA 4HPXB 3WO0A 4DJAA 2BP7A 4ZOAA 1M66A 2ZT8A 5MFZA 3D7LA 2FKNA 2PH1A 2GCOA 2ZYGA 3T7AA 3CU5A 3N76A 5E9AA 1XQVA 3W05A 1MZPA 1LW7A 4YVFA 3ZWMA 1SKUA 1G3QA 4AFNA 3V33A 4F3NA 2Q4TA 4LDNA 3CW8X 2PU5A 4NYIQ 3RTDA 5HTKA 4AQ7A 1NVUQ 4DYHA 3E2PA 3KEFA 3E3NA 5EEHA 4YMVA 1N4DA 4G2NA 2PUJA 3SGLA 3E53A 1L2TA 3IELA 3WRXA 1R4NA 1F7VA 4B81A 3STHA 1M1NA 1D0VA 3QITA 4LMAA 3PUXA 4HZIA 1RU3A 1GEGA 2Y93A 1TK9A 1OGYA 3KKKA 1IPHA 4H16A 1RRGA 1I1NA 1LVGA 1RPTA 4PXYA 1A4UA 5KYNA 2VQEB 1LRJA 2H2HA 3A1VA 3DFKA 2G1UA 3QW2A 4ND6A 5TC4A 1R9JA 4CCSA 3H99A 3KU1A 1BGWA 1NNSA 3BWMA 4HZGA 3QXJA 3DS8A 2RHMA 3OTGA 5BNFA 2P11A 1ISIA 2VDMB 1KBQA 2CKDA 2TYSB 2VXOA 1JALA 4DM7A 1E1NA 4RXUA 1MT0A 4X0EA 4M1EA 3JZMA 2H0RA 3LUBA 2RHJA 1FFEA 1WJGA 3LV8A 2DPHA 5LP6F 4KVFA 4YV2A 5C81A 1NQ5A 2ECFA 4EKGA 4OX9B 4PHCA 5FX2A 1RXEA 2F1OA 4ARIA 2WJIA 3BXXA 3EVEA 4RY2A 1SIOA 2YUIA 4OI1A 4KQXA 4O4IA 3AW9A 1XJWA 4KNWA 3H3FA 4QNRA 1V5FA 1P9LA 4G09A 4HKTA 1TQ6A 2HSZA 4YXFA 2VQFB 1SUAA 4FLMA 5TNXA 4YECA 1EMDA 1VCHA 1R64A 2JFFA 3G13A 4HDQB 3HG7A 4ALKA 2Q4EA 4O08A 3O1LA 4BX2A 3HSYA 3O7MA 5AKJA 3D6HA 4B0OA 2P78A 1L4KA 1VSQA 3TLAA 2Q3LA 2ZAYA 2VJMA 3A25A 3TOSA 3VPFA 3ZV6A 2A1UA 1L5QA 1UJ5A 3DV0A 5K3EA 2XD9A 5FYDA 3KIPA 3VKFA 2RSLA 3TINA 4TUYA 4P36A 4DCSA 5FUBA 1G3IA 1OI3A 4KQ6A 2FK8A 2WFZA 2E49A 4LJAA 3LK6A 4PFSA 1F5NA 5AVRA 4W5NA 2AZTA 1Y4DE 1FMTA 1AVTA 4D8TA 1OGIA 4LYGA 4KO2S 4ZU3A 2WJ4A 2W4IA 3DNPA 2WHYA 4R2KA 5DASA 5LMCA 4BXOA 3HN6A 3NRJA 5DE3A 1YDEA 4U0JA 5ALEA 1CUYA 1SOMA 5DOZA 5EZYF 4C3OB 1BYUA 3KOZA 3GZNA 3LVRE 3BJIC 4NJMB 5AUOB 5DTQA 1QLHA 1SULA 3GJ0A 4PFKA 1LPPA 1LPNA 1RC0A 1KH3A 1KJ8A 1QIMA 3AV0B 1G20B 1SM4A 3EXAA 5SY4A 1W5TA 4MCIA 4BKUA 4XUEA 4ZZ3A 1ZUNB 3RS3A 2M32A 4B7XA 2UZ4A 3ILSA 4DV0B 2VK1A 3QVGB 3SBXA 2V7UA 3X3HA 1FVOA 4UNRA 5EMLA 1DFGA 3F67A 3TUIC 3L84A 3MZ0A 1YMUA 4IDPA 3ROMA 4HVCA 1CKEA 3LWDA 1Z73A 1RYEA 1RQXA 1KVTA 4ZJYA 3CSDA 3GY0A 2B4KA 4O59O 5IDYA 3OZDA 4PZAA 2ECKA 1D6MA 4ODIA 1JEAA 5CDFE 2Y6VA 1QQ5A 1XEWX 3FOBA 2Y1WA 2FW1A 2PH3A 2XVZA 3F9IA 5DWVA 2G83A 2QY9A 3T5BA 1I3MA 1CUXA 2W2QA 2CFRA 4UTXA 4YJHB 3VDQA 1NSTA 5ELLA 2X13A 1ONOA 1L4MA 1BDMA 4BX0A 2XMRA 2JLXA 3IP3A 1TAGA 4HDSB 3RRZA 1CFZA 3GAAA 3HDQA 1U1FA 1YQ9A 3IV6A 2BUCA 3A6GA 3I4LA 2OQ2A 4Q4JB 5KVVA 5IC4A 5BXQC 3JCZA 5L8VA 1JSXA 3T1QA 4YMWA 2IXTA 5KHOC 3RAFC 3FW1A 1NXOA 2GCOB 4K26A 2W7TA 5AM2A 1WLYA 5AM4A 2PGNA 1DG1G 3K2BA 1D2HA 5IAOA 4FNOA 4F11A 4J0JA 2PS0A 1D4ZA 1S8OA 3DZIA 2H18A 1C7JA 2R48A 2GK3A 1BMQA 3ZWOA 4MEBA 4P5DA 4DIOA 4GIBA 5CA0A 1DXQA 1X1RA 1QP8A 3DOHA 4HWKA 4GWLA 2VF2A 1EFRD 3KJHA 1V43A 1MRNA 4B3SB 2LTAA 1LUAA 3F74A 4N8DA 4I3FA 2UZ1A 4KE7A 3IDAA 2L17A 3JSXA 1WUYA 4NH0A 3MTBA 1PX2A 4BQQA 3E5HA 1AA9A 1A9SA 2CJWA 1J8DA 1NJ5A 2CXHA 4V3BA 1HR0B 1DAGA 3FFTA 1OWPA 4OP1A 4D8VA 3AVTA 4U4AA 4G5FA 1QCZA 1N3IA 3HEMA 3PIRA 4QASA 2QPLA 4X62B 1IN4A 1RM5A 4S1OA 2O8BB 3FWHA 4PGMA 1G5FA 1A8HA 4L3VA 4MLPA 1N2GA 1Y9EA 2D0OB 2SCUB 2WU0A 3BC1A 3P4XA 3QXSA 3FAZA 4GR5A 2BELA 2ORWA 1H3FA 4KMSA 4AJ4A 1XEXB 3W3AH 5C7LO 2CNBA 2X9GA 3ITNA 5IZ4A 2CEKA 3RUAA 5TQ2A 2B7LA 2IKSA 1LQ2A 3KYBA 3JQCA 2DWPA 1LC3A 4QSHA 4TM7A 2CNDA 3U3RA 4LF6B 1JQBA 1Q2XA 4UM9B 5FWXB 3THXB 5DYGA 4BNDA 3RUDA 5EC8A 4IIHA 4BO9A 4IL5A 3UJHA 3H04A 1Q22A 2E7ZA 3K4PA 1EGVB 3UK2A 3U7GA 3WL3A 2Q8PA 3ESBA 2B98A 3V8RA 2HA7A 2X42A 1G8JA 1VBFA 2ZJFA 3DE7X 3IMKA 4IUDS 4I6EA 4XJVA 2FZ4A 3R6LA 1Z7WA 3D6JA 2NAPA 4JODA 1G5TA 4MV6A 2WHPB 4YCDA 3AHGA 1TMKA 4J29A 3H1FA 3TZCA 2JKVA 4Z2YA 2EFHB 4W1QA 3SZOA 2AE1A 4XVRA 1B6GA 1CP2A 1FNSA 4FSXA 1TAQA 1E4OA 4D8XA 2TMGA 4Y2SA 3WLKX 4AQDA 1RYMA 5A6VA 2V0GA 1NYRA 2GSDA 1Z17A 1PGPA 3VPDA 1QTNA 4BFYA 1KMQA 3PGVA 4WVFA 1R4MA 4ZAFA 3M6IA 1Z4OA 1HNNA 3OURA 2GF0A 5FPSA 5HNKA 2JAXA 3W8FA 4CTKA 4JEHA 2Z3VA 3NTVA 4JJFA 3FG9A 4MWBA 4Y18A 2UXBB 1CNEA 2DUMA 1CQZA 1BVUA 4U02A 1CYDA 1XMPA 2KHZA 4QDTA 3TXAA 4E12A 1IONA 2X2EA 1ONSA 1RT9A 1WDTA 1ZH0A 3C6MA 1J39A 3CLRC 4DW8A 4OL9A 5AH0A 1I3OA 1FNCA 5BT8A 4DC1A 4E09A 5JI2E 3ETDA 3CUYA 3KUCA 4AIIA 1Y9AA 5A4JA 4RHFA 4K86A 5D6NA 3UT6A 5J43A 4RA6A 3RASA 3D7KA 5C4IA 1L7PA 2AFHE 1E1MA 4Q9HA 4IJQA 4ER3A 1B00A 4AYXA 3HXPA 6GPBA 4PX9A 3NWBA 1TRHA 3SZLA 3K15A 4D6PA 1NKTA 1XX6A 2ADMA 2RAPA 3C3YA 4BVEA 4RORA 1IM2A 1PGJA 4U2FA 2ID7A 5HF8A 2XOKD 4DJFC 2R8XA 2P2YA 3BHJA 2RB5A 3PUIA 3UW3A 1BYIA 2C4WA 1RCUA 2ZT6A 4PC6A 3BH0A 1B8PA 4WCDA 3ZY2A 1X7XA 4LQ4A 1WDWB 2EOAA 2GTIA 3AR4A 4PN3A 4YV0A 2G71A 1SOVA 3FDZB 3L6OO 4LCJA 5FFFA 3NB0A 1XA0A 3T3DA 2Z2XA 1AQIA 1IXRC 4FJ0A 3ZVRA 5B3JC 1SCKA 1NW5A 5JROA 1QQBA 2DQ4A 5KX5B 2R6CA 4PWYA 1YE8A 2QQ5A 1PR3A 2RHTA 1FBNA 3FCYA 2CDAA 1CUCA 3GN1A 1K92A 2W2OA 4DLZA 1Q57A 1NE2A 2H7CA 4ADSG 1MIHA 2HYDA 3D8UA 3FNGA 3G17A 3HL0A 1TVEA 4AJLA 4EFDA 1CZNA 5B3JA 5TIIA 1ZXLA 3ZJTA 5F51A 1NE7A 5FL7A 2PSDA 1I2MA 3OU2A 3AFGA 1NVTA 3MTDA 5AI4A 4IGEA 4MJXA 5D84A 4XGRA 1O6BA 1NWCA 3IQZA 1LTQA 3PDIB 3CEHA 1UJBA 3D59A 3JXEA 4IWYA 3OZRA 3PHJA 2P2SA 2QUJA 4XIJA 4IV8A 4KWCA 1T1SA 2I87A 4FEYA 4HDCA 2BPOA 3FGNA 3Q88A 3B8EA 4EJSC 3HO1A 4HTFB 2WAOA 3QWFA 4OFZA 4BFZA 2R79A 5J4LA 4OJNA 1G21A 2IXAA 2FN3A 3OEHA 5BVHA 4K28A 1QQTA 3G59A 5AK6A 1YKFA 3MCVA 5IN4A 1L1FA 4DKJA 2GNOA 1J8VA 2Z09A 3I9FA 3LZCA 4I2NA 5BN3A 1NLUA 5KYGA 2O07A 3VJKA 1H22A 2CFTA 3KT0A 1VPWA 3B70A 2Z9DA 5B58T 4JU9A 3EFOB 1YRQA 4PYMA 2IHZA 4RQUA 1UPUA 3GRFA 4R2MA 5A7HA 1Z75A 2YVQA 3DZHA 1KZHA 1T6ZA 4H59A 4LZLA 4EJ2A 1H2ZA 1OBCA 3LUGA 3QLTA 3R0IA 3SHFA 3QEKA 2AD1A 3A6DA 5FIUA 2GA9A 4R8LA 1JJAA 1VCMA 3FTDA 3MLBA 4MHTA 1SKMA 1VXRA 1FFCA 4GLJA 3FMPB 4Q37A 3GLSA 5E6SA 4CMAA 2JJ2A 3GP8A 3GQBA 1BTOA 3OJOA 2F1HA 4OCZA 4ZI7F 2Q28A 1JHQA 1ZGJA 1NPYA 3SYTA 2LDBA 1DC5A 3LVBA 1Y37A 3TDKA 4PPYA 1PGNA 2OAQ1 1ENOA 1KYZA 4EY5A 4UTZA 3U3OA 4D82A 4KSCA 3SICE 4BNMA 1I1OA 5IMSA 2J9XB 3U3XA 2IW3A 1ZMBA 3HVHA 2Q7DA 3DHNA 4H4EA 2Q21A 3Q3EA 4KXLA 3VU8A 1JAYA 4EG8A 2QTCA 4RTQA 3CR8A 4F3CA 1PL6A 3H65A 3KOWA 4HDSA 3LC7O 4XWKA 2F43A 1B8NA 1JU3A 3TW8B 1KR5A 2Q9UA 3TR5A 1B8VA 3LCUA 1UWLA 3EN0A 3RYFB 3PXUA 5JFOA 2BHRA 2WUDA 3ZW7A 4RJ2A 3KSRA 3TNLA 4V0OA 4E1BA 5I4IA 1HL3A 2QTGA 4RD3A 2FYTA 1NVWQ 1D7AA 1COWD 1DQZA 1UWKA 2YV4A 3B5IA 3MOSA 3LM8A 3U81A 3E9QA 5HX7A 1KJQA 1JSZA 1QJ4A 2NIPA 5FL3A 4ARUA 1ZONA 2W2LD 3FROA 1RSZA 3HA5A 3KHSA 3INRA 5IW8A 1QCCA 4A8JA 3NZEA 3V7UA 1V5EA 4GI7A 1OA0A 5CFMA 1ORTA 3CZCA 4NK5A 2J3MA 3FNFA 2XVAA 4KQIA 4PRYA 3HB9A 4U2DA 1P1BA 5DBFA 2CWDA 3EBPA 4FD2A 2UKDA 3GT3A 4Q3AA 2G1PA 5EP4A 1GGFA 2VRNA 4H4DA 2R7AA 2JIOA 2PEZA 4GE0A 2J5KA 3H84A 1V2GA 4IWNA 2B37A 4RD2A 1UKEA 5CX1A 3ZD9A 4F4CA 1W93A 1TAUA 1F1JA 2FEAA 4ML3A 1GEEA 1RWBA 4X1OA 5BT9A 1ABBA 3D0KA 1E66A 2J9FB 2OZVA 1VKHA 2J0QA 1XQ1A 2H5IA 1QIKA 3LHFA 2ZQZA 3K1YA 4UCQA 5B1EA 1NLYA 1TL7C 5BN3B 1PDVA 4C6TB 4KQWA 1U8EA 2EATA 4DABA 4EUHA 1O9HA 3KSBC 2DWUA 1C7FA 1PWZA 3EJWA 4JLOA 4LHZA 1HY3A 1A5AB 3FKQA 4NR0A 2RIRA 2BM1A 2WWXA 2X0KA 3NXKA 4ZZIA 2G7ZA 2OAGA 4PS1A 1XRLA 2Z3WA 4NSNA 1W581 3BULA 1DXYA 1NC3A 1PK8A 5FTMA 4TN1A 3BN3A 2XKBA 4QTZA 3V8NA 1AKVA 5CM2Z 2C7OA 4MP8A 5MN6A 5EJ8A 3L4KA 3CNEA 1AUPA 3A1DA 4OSEA 4QPJC 1IIBA 3IALA 1TGVA 3JSAA 3TIFA 2G9QA 3T4XA 4BRSA 4CHTA 3S8EA 3IUBA 4RC9A 4DZTA 3R24A 5H3LA 3M2PA 3RVMA 1TECE 1QGOA 4TMXA 3V8EA 1N2BA 1NX6A 4WY8A 2GI4A 3MB5A 5E4FA 3WBJA 4C7JA 2HEIA 1WB4A 1LI7A 1TM1E 5BWOA 4FZRA 4HAUA 2Y4NA 1DX9A 3WZ2A 3FYSA 1WF3A 1CY6A 1M2VB 2DKNA 3ANSA 1Z6GA 2DR0A 3CQ9A 3ENKA 3GJ3A 3L7KA 4QO8A 1OTYA 2UU9B 3DT6A 1S1MA 3AR2A 3G0BA 1C7QA 4WOCA 2ZR8A 1QUFA 1SU7A 2PSJA 2UVPB 3AIKA 1PNQA 4KQJA 3SJCA 1DAFA 3U4GA 2XTMA 3TBHA 4DIBA 1BGXT 2PJRA 1S3FA 4CM8A 2I62A 2IY7A 4PC7A 5JS7A 3DEFA 3VNVA 5JMWA 3DZCA 1NOKA 1VSUA 3E2IA 4NFLA 4BVFA 2WICA 1QHFA 3WQBA 2W2MA 3OFND 3GPLA 4BZXA 4CCYB 2WJWA 4Z4CA 3BL8A 4EKDA 1M6VA 5K3OA 4O1IA 1LVUA 4EB6B 1FMJA 4RK5A 3C1TA 3KHTA 3F8SA 4N0PA 1OXUA 3D8BA 1C4OA 1R6XA 2YRFA 2JJ1D 1HUQA 2ZIXB 3PG5A 2QLLA 2XDQA 2PV0A 4GECA 4DCNA 5K99A 1OB2A 4UE2A 4F5EA 1RZVA 1UMCA 1BA2A 1R8YA 2OTCA 3F6EX 1Z5GA 2QUHA 4JQOA 2DPMA 5BNWA 3NTOA 1F6DA 5DTRA 2P5TB 5FPQA 1XKQA 2R8OA 1JHMA 3IXQA 4PPFA 3C5HA 1QO7A 1S2NA 4UUNA 5I7EA 2DG2A 2PH5A 3MS2A 5AW9A 4EYOA 3UJ7A 1E69A 1OPRA 1ZKDA 2P4SA 2QIPA 5JNVA 1KARA 4MDYA 3ZTYA 2FLVA 4MKFA 4X97A 1E8NA 2D6FA 3I2YX 3PXXA 1JVBA 1IG0A 3G89A 4G24A 4LN1A 3LGXA 3OE1A 2ISSD 2W2XA 1GRCA 2AQIA 2X5OA 4GFDA 4LYFA 4R9RA 4DJ5X 2D5CA 4KFSA 1EK0A 1CDEA 1UIMA 2SKEA 4B4UA 4KXYA 4IFIA 2NUPA 2D00A 1SXJC 2E55A 3DCNA 4NTZA 2XHZA 3DO5A 4ALNA 4ZIRB 3IKJA 3FVRA 4K8RB 4QLOA 3VPGA 4ENTA 3PR3A 3AEKA 4QQ8A 1A77A 1ZRHA 1GL6A 5FP0A 2ARKA 1KKUA 5KC8A 2IP2A 4S1VA 4DBZA 2PUHA 4WHMA 1LK7A 5BN5B 4MVJM 2JCGA 3GHHA 2QRJA 3DBHA 1ZIOA 3IAM1 3LJKA 4IIJB 1KYQA 1DFHA 2GM3A 4ZOLF 4WADA 4RDCA 2BBWA 1NP6A 4Q9JA 4LY6A 3AUXA 1T34A 3OIYA 3UKJA 1VXOA 1SKQA 3CB2A 2IYUA 3C0KA 3DZ8A 4M1MA 2NV2B 1CU1A 5ETJA 2O5VA 5A2QA 3ND5A 1QU3A 1UZAA 3AF2A 1HE2A 4LBVA 3DM9B 4E5UA 4V3CA 1GAEO 1PCXA 2PGIA 5ALIA 4RV5A 2D5AA 5KEIA 3A2KA 2FW8A 2QZSA 3MGGA 2AYYA 5IEBA 2Z6UA 2CV1A 2OKGA 3RSFA 5LNK1 2ZEJA 1E9CA 5CR9A 2GD6A 5JAIA 4A2WA 3IUQA 3CWZA 1XZNA 4C4SA 3I0ZA 1NULA 3R23A 4R1OA 1LWNA 3TSAA 3PC2A 3VVBA 2SCUA 3G1TA 4IS2A 5H16A 3N6RA 3IXLA 1TX4B 2Y68A 1ADJA 5INTA 1KDZA 2Q9CA 4BU1A 5LNK6 1L7NA 3DMPA 4I55F 2OY0A 3VAZA 1SZJG 2YVUA 1CR2A 3GI1A 4N8EA 3A1NA 3DAFA 4XIIA 1QJCA 5EUMA 1U11A 3AHDA 4YQEA 4H7IA 3G2IA 5I4CA 2OHVA 2YV3A 4W8GA 2IZZA 3QX3A 3PNVA 2TECE 4Y2QA 1M73E 5CGZA 1QYDA 4V0KA 1YU6A 4N3NA 5IYZF 1Y5LA 1RLTA 1T9GR 2XKAA 4I1SA 1QC5A 4OF4A 2WW8A 5HXAA 3JQGA 1IVSA 3GK3A 4DDWA 5JLJA 16PKA 1VE9A 2M6RA 4K6OA 1H1TA 2HK9A 3EVTA 4YAUA 1DIRA 3A6KA 1EGMB 2FJPA 4HI0E 2C58A 2FK7A 1Z16A 3FMVA 3RTCA 3ZWDA 1JNXX 5GONA 4QNNA 1RHRA 3RVDA 2IF0A 4M36A 5DLPA 5EHGA 2PL5A 4AWBA 4DIEA 3T9EA 3O2JA 5AJWA 4UEJA 1D9ZA 2PUAA 2QE7D 3IUEA 4F2HA 1R5BA 1KVQA 4DRXA 3I5XA 2O0JA 3AR9A 2NVOA 5K9ZA 1PR9A 3QUCA 1GILA 5EWJA 4QYTA 1CEXA 1IEXA 4EHNA 1CQXA 1T6BY 4TQGA 4YP9A 4YJ3F 3BCHA 1VIMA 4KW7A 1WKCA 1YR6A 1YA8A 2HCJB 2J4CA 5EMMA 3IDZA 5F2NA 2BE9A 4H3SA 1DB3A 1G60A 3H2BA 1T43A 2CLSA 4TV9A 3BF8A 3USES 5JANA 4PC1A 5DRYA 3EZGA 2PH7A 4AQYB 1XTPA 5JE8A 5FTNA 3UXEA 5AJYA 3DBRB 4U7FA 2CLLB 5FLXA 4UDYX 1UPBA 1QAOA 2DE0X 3SIRA 2MINA 4F91B 1B3RA 3GLHA 1KAHA 5JCOC 3Q8MA 4IO1A 2OCBA 1WULS 1GT6A 1TCUA 2JRLA 4UDOA 3AQIA 4AWAA 3CZRA 1BFUA 2AE2A 4M9QA 1XTRA 2AI2A 1EA7A 2QV0A 1X1AA 2E89A 5I5EA 3U4IA 5TJHA 1AC5A 1X7WA 3PNYA 4GZ3A 4XQ9A 3JWPA 5JEEA 1E2LA 5AK3A 2PQ6A 4M55A 1JQEA 3JARA 2IV2X 4ENUA 2XHEA 1EG7A 3BAZA 4PRZA 4OREX 4EBFA 3I61A 1XDDA 2YVAA 1SVIA 2GESA 1WW3A 3N05A 5DLEA 2GF2A 4RETA 4BMDA 1SC6A 1E5LA 3U62A 1JLKA 3P2OA 3WRXC 4MKRA 4FZ5A 3O4HA 2LP4Y 3GJQA 1R10A 4JLKA 4PGGA 1NN0A 1G6KA 3GR6A 5GJWC 3TTYA 5IT5A 2HSGA 3AI7A 3TVDA 2ZR9A 3PUJA 2CJPA 3NMUF 3FYHA 1F4LA 4HNVA 2ZI5A 4L2IA 4S04A 4HGQA 3HBMA 3U4AA 1H8EA 1DG9A 1YZQA 2G72A 2I6UA 1TIPA 5EL0A 2PT9A 4YP1A 5FR2A 3VV3A 4B3FX 4CU5A 3J80A 3I72A 1W0JA 3BQNB 1M1NB 3NGLA 2HZBA 3ZQJA 4A2PA 2I1LA 4TZKA 3Q8WA 3DXXA 4CZ2A 5CK4A 1O5TA 2OC4A 1IWOA 2LKCA 5F7ZA 1E9VA 4RH0A 1C30B 4FR0A 5DHSA 5TPZD 3ZNNA 2J0SA 3R9XB 2DP4E 3T3OA 3WDMA 3ZHSA 1SK9A 2EG5A 2G5CA 3LPMA 3F5SA 2RBEA 2WYUA 1Y3IA 1FYVA 1YJXA 1CJBA 2FN7A 4GBMA 1QO0A 4OLHA 4Q05A 2B82A 4G23A 4MW9A 4GVXA 4LBZA 4F8YA 3VU0A 5K7SA 3IE1A 3S2IA 1GDTA 3N3AC 2DLCX 5KNDD 2G7MC 3LD9A 1KDOA 3F2VA 5AVTA 3AM1A 1ZD4A 4O4LF 2BONA 3HCEA 2QRZA 5C8YA 1OIVA 1ZISA 3BK2A 4AN0A 2UZAA 4BO4A 1ZKMA 3C87A 4PR3A 4G4SO 4DSOA 2IKQA 5KTPA 2ZVJA 5T5QA 4TYWA 3FCEA 2C9BA 4UBIA 3TIVA 1KA9H 1SVWA 2NW6A 3ZWPA 2V3CC 2JFNA 4K9QA 4PC2A 2GXSA 2HHLA 3O9MA 4PX5A 1G9TA 2HK7A 5E7QA 3FNRA 5BUSA 3SC3A 2B2NA 5B7GA 4L78A 4HQ0A 4P1ZA 1B14A 1M0TA 5HTOA 4XX0A 3FWNA 2B1QA 2ZBEA 2HQ1A 3FCXA 3NO4A 2CLKB 2O23A 1WXFA 1YIAA 3I2JA 1XWIA 4B6RA 5B1YA 1Z5VA 3AZOA 3CF0A 1E1YA 1N6HA 4KKXB 4X64B 1KJWA 2JBHA 1RQNA 3P2JA 4R1UA 1JMVA 2QHXA 2VUTA 5DI3B 2GFHA 5LDHA 1HDXA 2V54A 1P8AA 5EZ6B 1N77A 4B48A 2C2ZA 2QGNA 2K2WA 3NBQA 1RQGA 2OHJA 4BNZA 3NEJA 5JBNA 5L53A 1G0NA 4IFEA 4MWDA 4ZCSA 4L8FA 5IM5A 4YYZA 4YMGA 2XWSA 3B9RA 5IBQA 1KI3A 2R8YA 4JDPA 2CZCA 5JHHB 3ELDA 1KEEA 1SHTX 4Q1FA 2NU6B 5DF1A 5F73A 4EW2A 1LEHA 3AJRA 5H9VA 2JLAA 1Z6YA 1PP4A 1IHOA 1MT3A 3CTMA 3IJEB 1E1KA 3SBDA 3WGTA 4BOYA 3LKDA 3PFBA 3QYFA 2JFWA 1P7ZA 1G7SA 3JAWA 3ZTWA 4PPNA 5FCDA 2V98A 1CZLA 2XCUA 1ZA1A 3ELWA 2OO5C 4NU6A 5ALWA 2OSVA 1P60A 1EINA 3RF7A 2V6IA 3UA3A 4RM2A 5JSUA 5JAQA 4BKQA 2BTEA 2DU8A 2WF8A 2Z58A 2QTBA 4UVEA 3TZKA 3D9QX 4KO3S 4WXHA 4RIEA 2QLNA 1W35A 2RKWA 1GFIA 2AK2A 4FKZA 4EZEA 4DB2A 5EJGA 1E5TA 4DBLC 1K4MA 2XNCA 3QLJA 5CD1A 2A3NA 3F2IA 5AKEA 2NSDA 1LRKA 2MR6A 5DBEX 2BUBA 1XTKA 4I5EA 4TV8F 4CKXA 2IE0A 2VQ3A 1X8LA 2PIDA 5CDGA 1F0PA 4IXMA 1QG2A 4NBUA 2GJ9A 1YHYA 4JSYA 2P90A 1OTXA 2ID9A 4YALA 4KO4S 1JSRA 5EE1A 4PVDA 1Q6ZA 1Z5ZA 4FU0A 1IZ0A 1XJ5A 4PLFA 4CG3A 1E6WA 1WDMA 3EW9A 3HY4A 4EEZA 3GLRA 4W9MC 5EA2A 3RJ9A 2VDOB 3G2PA 2G5TA 3DW3X 4EKYA 1IM8A 3KZCA 3FCCA 2EFGA 1TO1E 3UHFA 4EUSA 2I2XB 3I53A 1M9NA 4KP7A 1OH8A 3EHEA 4MV1A 3FH0A 3IBFA 3MRTA 2GO1A 2P9EA 4GX2A 2GZ2A 3TZ6A 3EBLA 1ZO8A 1OFVA 4B8ZA 4BRZA 1IC6A 2WU3A 3MJRA 4HN2A 3CJRA 1OVGA 5TARA 4BLWA 1OAAA 4RHTA 1L8LA 3KSDO 3VYWA 2HA3A 2HI0A 1W96A 2Y4OA 1FSFA 1HURA 2XCLA 5FBRB 3F3YA 3SJZA 4R3UC 3AUUA 3SEQA 3VU9B 4CDNA 4YQFA 1XKXA 5CVUA 1Y9DA 3OEWA 5AI9A 1B6TA 2X41A 3ZD6A 1NBOA 1X8XA 5HIKA 1NMXA 4HAXA 2O8CB 4DARA 5TF0A 3KS9A 1XRQA 2H8KA 1YZTA 1C4KA 4FHDA 5KSPA 1RZRD 4RZ2A 1C9EA 2ESRA 2F9FA 5HJEA 3R0JA 2M1XA 4RZUA 5TQ0A 4ZU1X 2JC3A 3JWIA 3NTQA 3ZGOA 2QS9A 3DNMA 2J5QA 3G6WA 4TXLA 3GLIB 3CMMA 3G5MA 2FJUA 2Q4OA 4INOA 3WV5A 2BF7A 1OZ0A 1QKIA 1G8KA 2BVNA 2IHVA 3DEAA 3H11A 3IPAA 4IZHA 4LX0A 1JAIA 4IIDA 4M54A 1I14A 2ZRHA 3ESYA 4IF6A 1MO4A 1PLKA 1NA5A 3FZNA 1WEHA 3GXBA 3HBAA 3KWLA 4UU8A 4Y1RA 4F96A 1O03A 1K3FA 2VATA 1VBKA 3CINA 2VZ9A 4F46A 2VQSA 2MCFA 2FWNA 3ES9A 1TK2A 4RY0A 4HGNA 5ILQA 2KWIA 2C3UA 2H85A 2QRGA 3U44B 1MPTA 4BGIA 4ERXA 1G38A 1EFPA 1M1UA 2K5UA 1L9XA 2XADA 3H0CA 3VBEA 5A4AA 2HIGA 4AD8A 4WBNF 4KTTE 4LZNA 2PRIA 3D31A 2NWQA 1EEXB 2ZJ2A 2HC9A 1P6XA 3DLAA 4WT7A 2Z6VA 1Z2NX 3MELA 2YV5A 4TTTS 4WLFA 1JDUA 1GG8A 2J9RA 4XUDA 2AA3A 3RTGA 3TOVA 3WWEA 4AZSA 1JHPA 2FUNB 1UBOS 1K7FB 1VGRA 5L7WA 1J5EB 2F43B 2JGLA 2FCRA 3KJXA 4LA4A 4NV1A 3RNLA 3U09A 3VMMA 2BZSA 4PZLA 3ON5A 1QGDA 1P72A 4O4IF 1JYSA 1NRWA 2ZJ6A 2FZKA 2IWRA 3RYHA 5IHPA 4BVBA 1YBAA 4K5QA 4KLZA 3H8VA 1WVMA 1YO6A 1AZTA 3DEHA 4TTVA 4BJ5A 4IJWA 5HK9A 1YONA 3M9WA 4OIFA 3PF9A 4LTNA 5MN4A 1JF8A 2IQ5A 2ZUEA 1KZYC 2E4ZA 2ZIXA 1JJBA 2VJQA 1C14A 4LUCA 2A4MA 2ZSIA 4F97A 3IO5A 2J3EA 4D43A 2DULA 2QYSA 4H1WA 1QQ7A 5JATA 1D8TA 1JLRA 3CE9A 4REMA 1MHTA 3MJSA 3W1EA 3GPIA 1GGKA 4KI7A 4JBLA 1YDMA 3CKYA 1FS6A 4TOIA 5G4KB 5HILA 3ET4A 3M5CA 3MRXA 2WQ6A 2OV4A 4M9SA 1QHHA 1E63A 1Z12A 1SIUA 2R44A 1E60A 3H4TA 1WHSB 3QY0A 3ZVLA 3GZ4A 5LLTA 2UVPA 2LVBA 5JVDA 5IKOA 2XH8A 4MICA 3C48A 3HU2A 3H4IA 2R1TB 1FW6A 5LQSA 1JFRA 1FYFA 1GV0A 1VL2A 1N5KA 2YW9A 3GMDA 4HH3C 4MAMA 3OQBA 1QH8A 4R7ZA 5KKCA 2J5RA 1P5HA 2WU4A 1ACMA 4PZUA 2B4QA 3HJNA 4D5GA 4NQZA 2FHSA 4P86A 2VHZA 2YW2A 3RVOA 4A5SA 1DPFA 3A4NA 5ALYA 4AK9A 1USGA 4Y98A 3BB3A 3BSFA 1WV0A 2VDPB 1MHPA 4FE7A 3OCXA 3V4OA 3ID6C 2C8JA 1I7QB 3FOFC 4TMVA 1KC1A 3K35A 3GGOA 4YR7A 1ORHA 1U99A 3WRVA 3HA2A 3AVXA 4OUDA 4V38A 5EJIA 4XVUA 1MC8A 3JATA 5JD4A 4HRVA 2O8FA 1M1ZA 4KUEA 1SXJA 3FSRA 1OZGA 3R6GA 3RDPA 4L27A 1HDCA 1F60A 1A72A 3COVA 1JHOA 3EIWA 3JY6A 3NXSA 3OFJA 4NONA 5D3QA 1NR7A 2QI9C 1TZ2A 2GPYA 3MGKA 3OOSA 2YIVX 4AJ9A 4I1RA 2B4YA 3RD5A 1G59A 1WS6A 1OLUA 2IPOA 3PE4A 3W0LB 4DWVA 3UPTA 4F8JA 5ICMA 1RI3A 2C77A 1KNXA 5CPFA 2QM3A 3LLVA 4N48A 4KMRA 2G17A 5FJIA 3BG5A 2HV9A 1PAUA 4JXXA 4N0EA 1E1DA 4LFAB 2AVNA 1F2VA 2RHWA 5IFKA 2A5JA 4I4NA 1NNUA 1H0HA 1RNLA 2IPXA 4EY4A 5EMJA 5GV7A 1J07A 3EAFA 4JLAA 2D2VA 2J59A 5LQJA 4WLEA 3LQ2A 3Q6NA 1ARZA 2OPBA 2JEZA 2O8CA 2QW0X 2BT4A 1H8HD 2BL4A 3O1HB 4HDMA 4P2GA 2CT8A 1WTAA 3Q4GA 4PCUA 2NZXA 3C7TA 4QYIB 3WFJA 1JXOA 1T1RA 1IEVA 4WXRA 1FBTA 5LLSA 3OJLA 1BXGA 4ITVA 1VJRA 1BOOA 1U04A 1RTTA 4WJKB 1H5NA 3PDWA 3T3PB 4BNTA 1P73A 4JBYA 4L15A 4PM4A 4CMIB 3K9BA 1WG8A 2IW1A 2NUAA 2C88A 2OBMA 4JVMA 5JCPA 1GPUA 2YFQA 2CUNA 2O8FB 1Z7BA 3U4QB 4J7UA 1IDOA 1GAJA 4Z0NA 4RJIA 1QOQB 2HLDD 2C29D 3KYCA 4GL4A 4LOLA 2NVUB 4AT1A 2ATIA 3O8QB 1BE1A 3QU7A 4FQ8A 3ZCVA 1PT8A 2DY1A 4BV2A 3BILA 3ZLTA 2YDYA 1JW9B 2AC7A 3IBCA 3PUHA 3VSBA 4EGAA 3S81A 2YWCA 1OYVA 2DMRA 1WNTA 1F3LA 4X93A 1Q1ZA 1J2JA 4WDRA 1F14A 1RXSA 3KXKA 2HBYA 2Y3IA 4JJGA 4WKPA 3QW4B 5F23A 4AS1A 2OLKA 1SU8A 1YJ5A 1LGYA 3UTDA 1U2PA 3MMNA 2BIFA 3ORRA 3LBAA 1K7XB 1XYYA 3B2QA 3TBFA 2VHJA 3OCZA 1XAJA 1FW8A 2PKXA 5AHRA 3WK4A 2TSYB 1D2CA 1AK9A 5DEOA 5TRTA 1LCIA 1QAQA 4KQGA 2OGSA 2X5JO 2E87A 1AB6A 4M7PA 1BH6A 1J9GA 2XZDA 1ZBDA 2J85A 3IKMB 3E82A 3X1ZA 4AP9A 4B9EA 4C07A 5KTKA 4FNGA 3IRVA 2HRQA 1PZEA 4NE2A 2PVPA 3AVPA 3F7NA 3N2NA 1RQ7A 3JQ9C 4MRAA 1UEJA 3UJNA 3ZWKA 2VPIA 3HN7A 4YRIA 3LUCA 2H17A 2IOQA 4RF2A 1GPNA 1EWQA 2V74B 1I3LA 3QU4A 4YDQA 4QEZA 4EW3A 2AEJA 4EECA 3VR6H 1U2QA 2DBRA 2D1TA 2P91A 5LXTB 1X38A 3NNDA 3V4RA 1TQ8A 5T7BA 4FYVA 3E8SA 1LW6E 4BNXA 1FX0B 4FOSA 4FOOA 1X1CA 1AUQA 1PNVA 3G7NA 3C5CA 1OH6A 3ADDA 3BA6A 3BTVA 1T8UA 3L1VA 2AFIB 2XYGA 1VHJA 3D3WA 1PEDA 1EUZA 1Z8NA 4V0ME 3WJ2A 1HNWB 4GSLA 4RVNA 4S2UA 5H80A 1C80A 4ABTA 5DEIA 1LTKA 3GROA 1PGQA 5CFRA 2V9PA 1DJLA 3MN1A 1N1DA 3OJEA 3WWZA 5KOHA 1W8IA 4GUAA 1Y6ZA 2WINI 3QY9A 1D3AA 1J49A 3AOGA 2Y1XA 2X8BA 3WLNA 2RGDA 1NOIA 1ST2A 2KJQA 4O4HA 3V8PA 4BEWA 1FVXA 3INGA 1MQ9A 1ZM4A 3L7DA 2XMPA 1GZDA 3GCZA 2XXBA 1T1IA 1BRMA 2EWWA 4PO1A 4EY7A 3QWAA 1F20A 2VYFA 4YP7A 2AH5A 4X20B 4L4SA 2QP4A 2GO7A 4JQZA 2C2YA 4LPSA 3RU9A 2BEUA 5HZMA 1GTVA 3SPXA 2ZYRA 2BFBB 5A03A 3EUEA 4JLVA 3GFQA 2IIBA 2V96A 1ZJ4A 3HR4A 4DT1A 1P7CA 4YJ2F 4B2IA 5CEEA 4I3HA 4FHGA 1Q83A 4MWCA 1KEPA 1GUFA 1XPUA 3GN2A 4ESEA 1G9XA 3H18A 4L8YA 4WZBE 1KO1A 4HT3B 1E8MA 5JZMA 4A16A 2Y1CA 2H1VA 1EHCA 2EKPA 2R97A 4FR5A 3QLVC 1AQUA 2RGXA 1WKVA 1UXOA 2LZ0A 1AUVA 4EENA 1W8DA 3BL5A 5DK6A 3Q11A 4WBXC 1JEDA 1FU4A 1ZI8A 2FPUA 3FOCA 2V45A 2WP0A 1WABA 1T2EA 2J4FA 4ZZ2A 4FI3C 4S1PA 1SURA 4OVKA 4X1KB 5A4IS 2NSHA 4OO3A 4I55A 2DETA 1XCMA 4EVSA 3KJFA 5HIJA 3V3TA 3E9NA 3CE6A 3DUWA 4BVKA 4ZK6A 3KVVA 4NMHA 4MRMB 2P2GA 3MJEA 2GWHA 3LPNA 3OMWA 4HCJA 4J0CA 1EGAA 2E48A 3KPJA 4XWGA 5AOBA 1NL3A 5E95A 4U2CA 2WSIA 1J90A 4JJ4A 4A3SA 5AW7A 5AVUA 3RUIA 1TQDA 4TKMA 4F6CA 1WUHS 3NYQA 1RFGE 3NHFA 2AVDA 4RPKA 4X41A 4LNUB 5DYYA 5FHQA 4FJ2A 3QUSA 4MVJH 4WFKA 4QARA 3B78A 5GQSA 1NG9A 3IAM6 1W4BA 1PJAA 4PYNA 2W6PA 1UZNA 3PICA 3DXZA 2HRRA 2E5WA 3FHJA 3PT9A 3IR7A 4URUR 2WIAA 3GZTB 3B3GA 3U9TA 3DBLB 1JJIA 1W4ZA 4HAIA 3UJCA 3DOOA 3QOXA 4JLWA 2QJOA 1BWQA 1VDZA 3CEAA 3PF8A 1FCJA 1IY2A 1UOEA 4YAKA 5MN5A 1Q95A 1MBZA 2FPWA 3PFIA 1PZHA 3U17A 4A1OA 1DJMA 1QRRA 2QWXA 2WTMA 4MHSA 3VU1A 4CMCA 1NVEA 1A1SA 5J4HA 4AY2A 4NZPA 1Z0AA 1Q1QA 3CLSD 2F3PA 3HFSA 4RTOA 3DW1X 4H7DA 1ZNXA 3KQKA 3HCBA 2GOYA 3KT8A 4IH1A 1SA0B 2CDBA 2ZPAA 3E9RA 2WJ3A 1OX5A 3LXRA 2YHAA 4NFHA 3BDVA 4NZNA 1L5GB 4QUEA 2NXCA 2AXPA 4IDGA 1XFAA 4ACBA 5DHAA 3RC7A 3FKSD 3IPRA 2BUAA 2IU4A 1E62A 1M8GA 3GGDA 3GH3A 3LCJA 3M6FA 4YUVA 5TJ9A 4AY3A 2WSSA 3PFGA 5HIMA 3K31A 5KYUB 3K9FC 4QFDA 5H02A 1N2OA 1FQKA 4RK6A 1E20A 4NYMQ 3W5CA 2C9YA 1Z0FA 3KL4A 2VUIB 1XCOA 2VPXA 3C7CB 3I6BA 1NBIA 4AECA 1YB1A 1DXOA 4YXWD 4PLCA 4QBGB 4WA7A 5E4TA 3UCXA 1WPGA 4MKZA 4ZVSA 4AJKA 1K6XA 3QVGA 4TWJA 2IYZA 4DMGA 3G8DA 4EP1A 5KU1A 3M6VA 2DHQA 2I2BA 2IHTA 1KE2A 4BQOA 3OO0A 1M2FA 1KBZA 3F9CA 3WY9A 4WXMA 2MYUA 4AXBA 4B3MB 2ZOSA 3OI7A 2IY9A 4GRAA 4RD6A 2GRJA 3STYA 4CG1A 4Y9DA 5IKEA 4E2WA 2IBMA 3WNVA 4MPPA 3AG5A 2I2CA 4D9FA 1CERA 3H1PA 4LRWA 1D1SA 2GD2A 1O96B 3MHPA 4AZ3B 3TUZC 2GEUA 3ZE0B 1SPXA 3QSYA 1SZPA 3HV0A 3OHPA 2JVIA 4JXKA 1Q19A 3PHCA 1PR2A 1L4NA 1TYEB 1LBHA 3WRYA 2GTHA 4YRFA 1H23A 2TMYA 5ERGB 5CFOA 1KQGA 4WK0B 3H1AA 2UYOA 2C4KA 1N2IA 1QFZA 4MUNA 2PIAA 3BMCB 2PXAA 3EEYA 4KRYA 5LZ7A 1W1WA 3G3EA 1CT9A 2V8OA 3RTBA 4A26A 4EUEA 3FUWA 3DP9A 4CLEA 2BHTA 4XOIA 4MI1A 1CYEA 1F6WA 1ZNZA 2DUWA 1E6CA 5AJTA 3H0KA 1RM0A 1O5IA 2H57A 5A5VA 2FMFA 1JAXA 2DFPA 4CMBA 1NUSA 1OY1A 3AY6A 3GCXA 3ZCQA 2DBZA 3Q10A 5CVEA 1GQYA 1Q7RA 1EAYA 1KAGA 2F9LA 2Z04A 2JIPA 2WHEA 1DP4A 1IY0A 4UNQA 1VKOA 3TL2A 3Q7TA 2RKOA 2OCDA 2HF9A 3UWDA 5AQEA 5KIAA 3TLJA 1TD9A 2YYAA 3NT2A 3I32A 2JHPA 5EZ5A 3TIXB 5D3MB 4B3GA 4YRAA 3RIXA 4NCIA 4M1TA 4DTIA 5JAZA 2PT6A 5GVSA 1XVVA 3PDUA 3RUFA 3P0EA 4BLSA 2XCIA 1H2XA 2E1RA 1N36B 4WVLA 3Q5DA 1FL9A 5H4HA 5G1PA 2OHXA 1VECA 1SHZA 4CEIA 1JEYB 1NHGA 3LTNC 3PV0A 4LIPD 2DPLA 2XDWA 5EJ4A 3L4JA 4AC9A 1IRXA 2EU8A 3I34X 3IESA 3LSTA 4Q7LA 4ZT5A 5GPBA 4X24A 2W6QA 2BR4A 5TB5A 1P1FA 4AKHA 4ASUD 5BR1A 4L8WB 4RK7A 1JKJB 5REQA 5JNRA 1Y4UA 3EWNA 1RQLA 2YICA 4IXWA 5CT5A 4BFUA 2F3RA 1KYXA 1P45A 3B1FA 2CW5A 3N70A 3I8XA 5ES3A 4I1YA 3L7AA 1Z62A 4EI2A 2WJAA 1AXGA 3VAYA 4LZWA 3CRMA 3R9IA 4AY4A 3ZIUA 5ITVA 3A4YA 1GA1A 1GZHB 4MV3A 1RYDA 2X9NA 3RSSA 5CB4B 5AW2A 5JARA 2REQA 1AV6A 1NU8A 1C4WA 3FGZA 4IINA 4C4OA 1PR1A 3WYCA 1VIYA 4O2LA 3UMRA 4JVNA 1T9KA 3UM9A 3WBKA 2FWRA 3RAJA 3RJZA 5MFPA 1N6OA 2A9RA 3O94A 3QLUC 4GI5A 4WZBA 3M49A 4BAZA 1T0JB 4UUQA 5HK8A 3UAWA 4HNQA 3H05A 3MSXA 1KY5A 1DEKA 4YLYA 1U8CB 1ZFNA 3SZGA 1BCRA 3A3OA 3O8CA 2V0NA 2P0EA 3OJXA 5COAA 2WPDA 2BC9A 4GC5A 2A88A 3HL4A 4O4IB 2W6JD 4TQ9A 5LB4A 4HAZA 3ZCXA 4ALIA 3FOEC 1O5OA 3NBYC 4R9UC 4KHZA 1ILWA 2IVFA 4ZIRA 3C24A 4L1KA 4Z7QB 2QMYA 3OP4A 2NYAA 5KJEA 1QMPA 4BAGA 4M53A 2ONJA 5F3RA 4FONA