4KPUA

Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
338
structure length
338
Chain Sequence
NTKGLKTGNEKDLWVYVEHYKGEPVHVVYELLGECRKLADKCNQKLAAVLITDDAKDVPSKLIARGADLVYVCQDPAFKYYSTDEYTNAFCEMIDEYQPSSVFIGATNDGRDLGPRIAARVNTGLCADCTILDAEEDGLIEWTRPAAGGNIMATILCKEHRPQMGTVRPKTFKAMEPDASRTGEVINYTLKNHVDDRVTCIRREEVVSEGEMAIDDAPFVCSGGRGMKAKENFSLLYDLAHALGGAVGGSRAAVDEGFIEHPRQVGQSGKTVTPKIYFACGISGSVQHKAGMSKSDTIVCINKDPDAPMFEISKYGIVGDALKILPLLTAKIKAFKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Electron transfer flavoprotein alpha subunit
publication title Studies on the Mechanism of Electron Bifurcation Catalyzed by Electron Transferring Flavoprotein (Etf) and Butyryl-CoA Dehydrogenase (Bcd) of Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Electron transport
total genus 115
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain
A PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kpuA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4kpuA02
3ZXIA 2J08A 4HPWA 4MULA 4GM0A 4ZT5A 5TS2A 4Y6LA 2X1LA 5IMSA 2IP1A 1WKBA 2RD2A 2DUMA 1PFVA 3L92A 4G5YA 3AIIA 3SEQA 4JU9A 2V3WA 1S4MA 3MLAA 4J16C 1ZH6A 4EG6A 1TYDE 4WSOA 4YP7A 2ZUEA 1N2HA 1M2GA 3F3MA 4V1CI 4EFKA 2EJCA 3IVGA 3UC5A 1YC5A 3I05A 5J5AA 3KT6A 5DEOA 2H4HA 3DPIA 3P52A 4MPJA 4MPRA 1T9BA 4DJAA 1KH3A 4K9LA 4L2IB 4C7BA 2Q5LA 3PNYA 3COWA 3MMXA 1N1DA 1OBCA 4MW5A 3ZJUA 1A8HA 3MUEA 1IHOA 1LW7A 4QRDA 1U0BB 1UPBA 1O94D 2XRZA 4MUKA 4O8ZA 2G36A 3KT0A 3IVXA 1RQGA 3RFFA 5BWLA 2PIDA 2DETA 3H97A 3LQ1A 3TNJA 3U3DA 2DR2A 3G6KA 1ZH0A 2AG1A 5JBNA 3IUBA 1KORA 4XFJA 1JMVA 5AHWA 2EL7A 1S7GA 1V5FA 4KKVA 3K32A 1COZA 4FZJA 3D81A 3PKJA 1BS2A 4QQ8A 1TYCA 2V0GA 4RMHA 4HJRA 1N78A 1KP2A 4PBSA 1QU2A 3SYTA 2QQGA 1G8GA 1E3TA 5FO1A 1OZGA 1I2DA 4ZT4A 4RMIA 4V1CB 4R2MA 1J1ZA 2H2GA 1KH1A 2A1UB 1QPBA 3ZIUA 1U2DC 1GPMA 4U8HA 3SDBA 4I6GA 1NUQA 1K4MA 1FYDA 4OJMX 2CV2A 1V47A 4NX2A 2NYRA 2PG3A 4QPZA 2PFSA 2A7XA 2PZ8A 4MUHA 2JAXA 2O5RA 3COYA 4BVFA 4JUAA 3F6EX 1T9GR 1WQ3A 4RJIA 4UU7A 3AL0C 4UZEA 3GLSA 1VL2A 3FETA 1WXIA 5TGTA 3UOWA 1Q15A 4JSRA 1SURA 3D6UA 4X0EA 3A4IA 2Z08A 4K03A 2A86A 1P7PA 4GG1A 1JSCA 1KR2A 2DLCX 3IOCA 3ZXSA 4KXQA 1O96A 4U7JA 3X1MA 2D13A 5EJAA 2ZP1A 3GMIA 2HZ7A 1YUNA 3CLUD 4H3SA 4MLPA 3HWWA 2NXWA 4FVTA 5LM3A 4MVYA 2CUZA 2BYTA 2PZAA 4FEEA 1YI8A 1F9AA 4KPUA 4XSVA 4ND7A 4U63A 3OTWA 1PI3A 1IQ0A 5HUHA 1QTQA 1I6KA 1Q19A 3FY4A 1HZZC 1M2JA 4MUNA 3EA4A 3AG5A 3PKIA 1TQ8A 4MUFA 1YTLA 1SZDA 5EKDA 2VJYA 4FEGA 2QUJA 5HUJA 1SZCA 2OO5C 3KFLA 4X3OA 4NDAA 1PO7A 4MQ5A 1U7DA 1EJ2A 1PFWA 2E18A 2EZTA 1H3EA 1T9GS 2AG0A 2X0KA 2H2HA 2OV4A 1MAWA 3TQIA 1XJQA 4CDMA 4HJXA 1LI5A 3EY9A 5K6RA 3FHJA 2Q28A 2YWBA 1B6TA 1U28C 1R6TA 3MXTA 1YC2A 1KQNA 4L2IA 1QU3A 3AKZA 2WVAA 3GLUA 4EG8A 4I6EA 4ZT3A 4UTNA 2A88A 2GOYA 1TEZA 3CLRD 1J09A 4BN4A 3G59A 4UTZA 2AG6A 1J1UA 3HZRA 1IQUA 2HMAA 2H2AA 2A1TS 4BVEA 4UTXA 1NM5C 1YI0A 4K9QA 1EFPA 1JIJA 3K9WA 3JXEA 5H16A 1Q14A 1N2EA 4RJKA 4OUDB 1Q6ZA 2HGZA 3FLMA 3BL5A 3COVA 5DEIA 1EUQA 4A91A 1QJCA 1FFYA 1KQOA 3CLTD 4F56A 4UZFA 1MAUA 3IODA 3SEZA 1MCZA 2OORC 3SZ3A 4G6ZA 1VLHA 1R6UA 2E0IA 4CDNA 4GPEA 2A1UA 2J09A 3D6VA 3FH0A 2WVHA 2YXNA 3DLAA 4NATA 2FRDC 3GLTA 4E1AA 2FWNA 1Q77A 2AKEA 3N2YA 4GRIA 4ND6A 1EFVB 5DASA 1S5PA 2VXOA 1ILEA 3C8ZA 4DE5A 2A84A 5BNZA 1QQTA 2PANA 3ND5A 4QREA 4DLPA 2H2DA 3UK2A 1GTSA 4JT8A 3CVXA 2JIBA 4F3RA 2QTRA 4NZPA 4CQNA 4UU8A 1ZJWA 3D7KA 4JUCA 3FI0A 2JI9A 2O8VA 4MUJA 5F23A 4IF6A 1Q11A 4Q16A 4CT0A 1EE1A 1M2HA 3ND6A 4TS1A 4KR7A 4GM1A 4RMGA 1YUMA 4IAOA 4KR9A 5EJ9A 2IELA 2VK4A 1M8JA 1O5TA 1O94C 1MOPA 2D54A 1MRZA 1Q1AA 3IVCA 1N2JA 3N05A 5K2OA 1PTJC 4BWVA 2Q5JA 2Q27A 3P0JA 1ICIA 1IVSA 1NP7A 4WNYA 1UPAA 3INNA 1QRTA 1JEEA 2I1LA 1Q17A 4Y6OA 5EJMA 4BVGA 3FIUA 3NV7A 1F4LA 3OP1A 4UTVA 3IOEA 3Q10A 4X3PA 1Z8NA 1M8FA 4MWEA 3RIGA 1QRUA 4D5GA 1KP3A 4PY2A 2QJFA 2BRUC 1JGTA 1WXFA 3ND7A 1M8KA 4RUKA 5FNZA 4EGAA 3F6BX 5J58A 5EJ4A 4ZCRA 2IHUA 1J21A 3ZUGA 3HGMA 5BWOA 4GM4A 3FG9A 3N9IA 1KQPA 2PZBA 2QJOA 2H2FA 3GUZA 1F7UA 2X1MA 3VRHA 4RMJA 3QTBA 1BFDA 1GAXA 4NAHA 3CR8A 2FN3A 4ZP1A 3IAEA 1YBHA 2UZ1B 2B7LA 4MW2A 5IHXA 5EJ7A 1YNOA 5H7XA 1NI5A 2VTBB 4R0NA 1UPCA 4EG1A 3OE1A 1WZ2A 4L3OA 1TFUA 2VK1A 1OWPA 3IDFA 4BV3A 3CLUC 3LCJA 5J59A 3RIYA 1O95D 1OWLA 5DK4A 5D7NA 1OZHA 1O97D 1EXDA 3EYAA 3COZA 1G8HA 5KHAA 3TQOA 3P0HA 1JIIA 1HYBA 3FSJX 1CT9A 1JIKA 1O97C 5K0SA 4ZCQA 4MWCA 3A2KA 1XNGA 1JHDA 3PRHA 4HK4A 4MW7A 1EUYA 3X1KA 2ZUFA 1N2IA 1N0HA 1EFVA 2EZ4A 2HJHA 2W93A 2Z3VA 1XNHA 3A04A 4EG3A 5MFZA 2JLCA 1WXEA 4K9OA 4HD8A 4JYZA 4JT9A 2CV1A 2JI8A 2J5BA 2H2IA 4BVHA 1NZJA 4MZXA 1T6YA 1N3LA 1T9AA 2VK8A 3IMEA 3PNBA 4JUDX 2YY5A 1D2RA 2A4MA 4EG5A 4KGDA 3FOCA 3K35A 2WSIA 3RK0A 4UTRA 3CLRC 2EZ8A 1K4KA 1H3FA 4JXXA 2D5BA 1X8XA 3ZGZA 4S1OA 5K6TA 2VBFA 4RPIA 5EJ5A 1GLNA 2OD9A 1M8GA 4ZZIA 1TYBE 1VBKA 2H4FA 1NSYA 5K0TA 3IAFA 2QTMA 4PBRA 3FZNA 1ULHA 1I6LA 4NAUA 1ZPDA 2J4DA 5MF6A 2BTEA 1O6BA 5LLTA 1V5GA 2XRYA 4DDKA 3PDHA 4V1CA 2PXHA 4ZCSA 2B4YA 2DPLA 3CLTC 4JUBA 3RHSA 1PFUA 2IHTA 1YI1A 2Q5QA 1D4OA 1OZFA 3NBAA 3P0IA 2IJGX 1M8PA 4F4HA 4RJJA 5FO0A 2NSYA 2JA2A 1NUTA 4IG9A 4MW4A 2WB2A 1WOYA 1WXGA 4AQ7A 2EZ9A 1PFYA 4EF6A 2H4JA 2Q29A 1N2GA 2QQFA 2WQ7A 1ZUNA 3S3TA 2DXIA 3KT3A 3H9BA 5LFAA 2VBGA 1G59A 2QUKA 3LE8A 1PNQA 3UMVA 4YP5A 4MUIA 4F4UA 4JXZA 3CVWA 2UZ1A 1IFXA 4JUFA 2GKSA 4BN5A 2V0CA 3M5WA 3GLRA 1GTRA 2VTBA 3RJZA 3RBAA 2QTNA 1NURA 3DO8A 1IRXA 2E89A 1K92A 1MB2A 1JZSA 4DDMA 4ZT6A 4I6JA 1K97A 5TEVA 4G5FA 2DJIA 4PBTA 4MAFA 4ZCTA 1YHYA 3ZGOA 2FSVC 4HDAA 1N2BA 3SP1A 2JI6A 1MC1A 5EJ6A 4K9PA 2YWCA 3PXUA 4MW9A 3A05A 3U1VA 2NZ2A 3HMQA 3ZJVA 2DEUA 3MLBA 5MGNA 3HFJA 1V5EA 1WJGA 3H99A 3IOBA 4AS1A 5K3SA 1Y42X 3DV2A 3CVVA 5BWNA 2CT8A 1XLTC 1OWNA 2CYBA 3D4BA 4MVCA 2H59A 1PVDA 1O0BA 2PGOA 4K0RA 4MWBA 3NBKA 4ZCPA 2Q5OA 4TWJA 1PG2A 5FEMA 3U31A 1VBNA 3G5AA 2WVGA 3ZJTA 1POXA 5MFPA 1N2OA 4J75A 1NUSA 1EFPB 4J1TC 2CYCA 1OVMA 4COKA 2PGNA 3TS1A 3X1JA 1M2KA 1Y9DA 2QUHA 3IMCA 4BUZA 3TZEA 1H3NA 1MBZA 3VGJA 1WY5A 3E9YA 3HV0A 1PYDA 4Q93A 1NUPA 4EG7A 2J07A 4YP6A 2IHVA 1T6XA 2AZXA 1IH8A 3ELBA 4MW0A 4MQ6A 3FWKA 2X7JA 2CV0A 2EZUA 3ISJA 4GP9A 4OUDA 1KAMA 3ZG6A 4D5EA 4MUEA 5DGDA 4MPPA 1IQRA 4MWDA 4YBRA 4I5IA 1GN8A 1J20A 1OBHA 1DJLA 1M83A 4KR6A 2QUIA 1N77A 1PNOA 1GZUA 1PT9A 4ZT7A 5HG0A 1KAQA 5DB4A 4R2LA 2DERA 1N75A 3QE4A 4MVXA 1O95C 4P2BA 4ZT2A 4K9MA 4YMIA 5KCMA 3GLVA 4QBTA 2CSXA 2TS1A 2VBIA 2H29A 3JR3A 1YIAA 5FYQA 3SZGA 1OWMA 5AHKA 4J76A 1F7VA 2QJTA 3IUEA 1TYAE 1YULA 3FDXA 4MVWA 3TZLA 3AG6A 2JI7A 2A1TR 4QELA 4BVBA 2RE8A 1T9DA 1NYLA 1WQ4A 1QRSA 5KWVA 3E27A 3HL4A 1T6ZA 2C5SA 1KH2A 1UFVA 2JANA 3PNVA 3AFHA 4TWIA 4Y6QA 3LOQA 1OWOA 3IH5A 1JECA 1YIDA 4XFDA 4K9KA 1V8FA 2R5WA 1JZQA 1NUUA 2X3FA 3UY4A 1MA3A 1POWA 1J70A 1U2GC 1H1TA 4G1CA 4DDHA 1I6MA 1OD6A 1QNFA 3QTTA 4MW1A 1YHZA 4JD5A 1J8FA 3Q4GA 4JU8A 1M1ZA 3CVUA 1T9CA 2WQ6A 1MB9A 1JEDA 3VU8A 4EG4A 2CFOA 2FR8C 1R6XA 3ILVA 2JLAA 4UUAA 4UUBA 5DGTA 3KT8A 2C31A 4GU5A 1M2NA 4DNXA 1U31A 2OD7A 3CA8A 3JWPA 4FZ3A 1XNJA 3H05A 1WXHA 1U3DA 3N8HA 4JFAA 3HWX1 4K9NA 3H9CA 1O0CA 1MJHA 3IMGA 1LI7A 4ARCA 3L93A 4MUGA 3Q12A 4Q9DA 1KKUA 4ARIA 1DNPA 4R8MA 5EJ8A 1VBMA 2OQ2A 1O96B 2OD2A 1X6VA 1PG0A 4JZYA 1U7XA 5TEWA 3RK1A 2Z09A 3CLSD 2CYAA 5IJXA 1U3CA 3CVYA 4MW6A 3ZGVA 1JILA 2E21A 1G8FA 3CF4G 2GM3A 3FNRA 4C78A 4KPUB 3CLSC 4BV2A
chains in the Genus database with same CATH superfamily
4CMIB 2D1QA 1QF7A 1ISGA 2XXJA 5KWSA 1QH9A 3FMOB 2O3QA 3G13A 4GUAA 4CODB 2VQ3A 4D2IA 3QWBA 5AVYA 1PFVA 4A2PA 1XCOA 3PL5A 4PANA 3EC7A 3PUIA 1AQYA 4G23A 2ZJ6A 1F5NA 4RCZA 3LPAA 2XITA 3W34A 2QT9A 4J16C 2TYSB 3W1EA 3P5SA 3S2FA 1G98A 4BB6A 6ADHA 1MW9X 1VG8A 1WIWA 3AZPA 3U9SA 3E0QA 4ETIA 3N8KA 2GAOA 3L41A 3ADCA 1EIZA 3H3JA 5REQA 5A03A 4AN4A 4CCSA 2GCGA 2KI5A 2JDID 3G9QA 4NRDA 3CRW1 2H17A 4QDXA 2G80A 4UHCA 2H4YA 1OBCA 3W2IA 2HI0A 1UPBA 4DYHA 4L27A 1Y1SA 4M1KA 3TIVA 4EM6A 1O94D 4B6FA 3NI2A 4IKPA 4MIEA 4D0RA 5JNWA 1FYFA 1ZGZA 4DBLC 1YZ3A 1Z68A 1IM8A 3N0XA 2QORA 3CM0A 3RFFA 4E15A 1BKDR 2H31A 1H8EA 3I1FA 4IW3B 3F6PA 2AVNA 3RBXA 1MKYA 2QE7A 2R4TA 2EAUA 2XRFA 3VNRA 5DNVA 5L6LB 1T1GA 3L49A 4WKNA 4X44A 2JK0A 4QQ8A 2EFGA 4GZMA 3PFIA 4QPJC 4HMOA 4Z99A 4FOLA 1QU2A 3GRVA 2BTQA 3G5UA 1K6MA 3FCEA 3KQSA 3PUZA 4X92A 3KTOA 5B1SA 4ZT4A 1N2CB 4ZDIA 5HQ3A 4R2MA 4IIFA 4ZEOA 5KTSA 1KMCA 1E9DA 4IZHA 2BMFA 4RE6A 2FY8A 3H11A 4LYDA 4L8YA 1TVKA 1TXGA 1VPLA 1NUQA 2E5WA 1GV0A 5KSPA 2J59A 2REOA 3GDGA 3WZMA 4RK4A 4C0HA 2MDTA 4MUHA 2OCKA 1ZMRA 4FONA 3ZDYB 1TTPB 2JGAA 2QL5A 2UU9B 2ST1A 2VWQA 1EG7A 5IAOA 2MSDB 1Y1QA 2J5RA 1J7KA 2WAAA 2JEOA 4JSRA 1PJSA 3NBFA 4NU0A 1SPXA 1Z6QA 2IYEA 4RFSA 5BN4B 4EYQA 4F85A 3SYKA 4TM8A 3EASA 5AUOB 1XZEA 3V7FA 2GTPA 1P7PA 1ABFA 4GBED 2YWDA 5EIAA 2DLCX 5B12A 2B5WA 2CDAA 1KEZA 4GDFA 3EZ6A 1UKCA 3GWGA 4QJBA 1T0PA 1URPA 1BX3A 2HZ7A 2XCOA 3QUQA 1VLLA 1DFGA 3RVDA 1IHPA 3THWB 1I10A 1WXXA 3O90A 1M10A 1W25A 2GPAA 5AO9A 2JLZA 2UYYA 2HU8A 3EA4A 3H1PA 1REQB 2HHLA 1JB9A 2I8LA 2NVBA 3NXSA 1Q1BA 3K4QA 2OHOA 4FYJA 4GPIB 5FUXA 1PWEA 4MVJH 4HV4A 5EKDA 1F14A 4X8HA 4ZTZB 2MYPA 1SG6A 3L8EA 1JPNA 5D1HA 1VXOA 5CEFA 3Q7SA 1X7GA 1S8OA 2JGJA 3SC6A 1ZFNA 5LQNA 4U6QA 3MCTA 3CN7A 5IG2A 4M54A 2PZMA 3BH6A 4I19A 3IV7A 2FP4B 3DL2A 3U0BA 4NJOA 4FR0A 3H18A 1USKA 3HBMA 3KKOA 5FPTA 2B99A 5LZ4A 1LI5A 1PT6A 1XRPA 2Q28A 1EVEA 4FKZA 1GXSB 2BW0A 4HR7A 2GCEA 2Q4TA 5DTJA 4GXQA 1L1QA 2RAPA 3OF5A 4KPEC 3OQMA 4FKMA 1KQNA 4B5LA 3QLTA 3UEOA 4FLMA 4OX9Y 2QX6A 3ELYA 1FP4A 2AT1A 4FGSA 5C8YA 1ML3A 1J09A 3UMJA 1MA0A 1H22A 3NP7A 1MIOA 1R27A 3UJ9A 3UJDA 4O2BF 1WETA 2C9ZA 4MXDA 4RZIA 3RF7A 2DOKA 2H2AA 2VHJA 4YUVA 4CKWA 2KHZA 2VSOA 3EAFA 5ILQA 1U0HC 5LDGA 3WLLA 1VHJA 2X77A 3LJKA 2A35A 5I9BA 1D2AA 2W6ID 4Y1FA 1NPTO 3GCGA 1AURA 3CUWA 1K7SN 1WSDA 2F1IA 4FTWA 4J4HA 4AK9A 3FJYA 2NVWA 3HKBB 4GOND 5AQEA 2H63A 4ZPXA 3AF6A 4XEHA 4G6ZA 1R6UA 4G5GA 3R9XB 5FAXA 5KYXB 3KEFA 1IDOA 5B1DA 2NPIA 4H7PA 3HKCA 3Q40A 3QELB 1FP6A 2B4TO 2PUEA 2JIQA 3C98A 3WLTA 2IEYA 4QQFA 4C43A 1FJGB 5SY9A 5LB4A 4EL5A 4E5DA 4Z4QA 1NYRA 2WHEA 4GE3A 1EFVB 2WHPA 5HUQA 3QFTA 4HTAA 3DOOA 1S8NA 2OHJA 4IHJB 5DO9A 3OZFA 3ICOA 4JT8A 5DCUA 1GPAA 2NZVG 1QQ5A 5C81A 5IH7A 4HAOA 1FIUA 3GLFB 2LP4Y 4B73A 4OI4A 2O8BB 4RGVA 3L7BA 4PHFA 2JFUA 3AR4A 2LPMA 4F11A 2XMDA 2GLUA 4RFLA 3IEIA 2IXGA 4CT0A 1EE1A 2KBEA 2QVXX 4TS1A 2GCOA 4GM1A 4HFNA 3U4GA 1TT5A 3JRXA 1HQDA 2QQ5A 4LMAA 5DT9A 3SF8A 2GN1A 2QTBA 4IUBS 3INTA 4R9NA 1ADYA 3LF1A 3V2IA 1LFDB 3AUSA 3QPWA 4P1ZA 2EKBA 3HKDA 3NJ8A 4UAUA 4FHCA 3N05A 1L4HA 2E87A 3PRYA 1HNWB 1V7CA 2E2WA 3OZEA 1NP7A 1RQ2A 1QAMA 2PMDA 4NBNA 4O1HA 2NYUA 1CY2A 5CB0A 4G5OA 3C4JA 1GA4A 3IOEA 4JX9A 2COUA 1KI1A 4PYKA 4FQ7A 4REMA 3GCWA 1Q5PA 4KXWA 1ONPA 5DF1A 2DHRA 3TJMA 4CL0A 3WBFA 1Y1KE 3FW1A 3G79A 2TSYB 5E6RB 4B47A 4UD6A 2H07A 2QP4A 1CR6A 3UM9A 4J6EA 3T9FA 1KYYA 3E61A 5JH7B 5E95A 2IF2A 1P2UA 4PC7A 1JKXA 5JFOA 3BXHA 3EVAA 5THXA 1JIXA 5EJ4A 3T1TA 3D8SA 4DIMA 3KEMA 4WXEA 3L7JA 3B3JA 1RXCA 3E0XA 4OQXA 2RJNA 3HGMA 4NI5A 4V0SA 4B8YA 2PNFA 4HDNB 5U4XA 2J5QA 2AOTA 3DXXA 4DA0A 1SXPA 4ZOBA 3WGLA 4JI8B 2C3MA 4RY2A 2IUFA 1L4GA 3ETCA 3U26A 3QTBA 3SE0A 4BQQA 4QUAA 2ZYWX 2D06A 4C3VA 3GNSA 1IBLB 2W9XA 3EFBA 4HAYA 4KV7A 3WKBA 3PVCA 4I1YA 1U1DA 3FPSA 1LX7A 4NK5A 4PX2A 2FOIA 3PLAE 2QX9A 5TQVA 6ABPA 4OFWA 3LY5A 2IZ0A 1AM4D 1CQJB 1JHMA 2OAGA 3DDSA 2Q99A 4Z4GA 3IPAA 1HG0A 1OTXA 3S4YA 4BMOB 1Z33A 2FU5C 1IIRA 2FR1A 4G1MB 1ZC4A 3PDUA 3NT4A 5BVGA 3COZA 1JWBB 1N5MA 1NFFA 1X1DA 3BSYA 3UJ8A 4CKXA 4JR2A 1G9SA 1QS0B 3FZGA 3FSJX 5K8VA 2FETA 5HNKA 3SM9A 1PU2A 5AVKA 1JFVA 2AK3A 2WMNB 2WOJA 3DUFA 3JQAB 1BHJA 2XHZA 2QZPA 2ZVJA 2ZYRA 3K16A 3ZCQA 1U2DA 2HJHA 3THXA 5AXAA 1NX9A 1K7YA 1GLGA 2BFBB 2EYQA 4FLFA 4DYDA 2V58A 3QSYA 1P6UA 4X8MA 3PYXA 3GZNA 3IDQA 4ZKDA 1V4NA 3DE4X 1QE3A 2JFXA 2WU1A 4K9OA 4DLAA 2HQRA 4RKQA 1BX0A 3D0QA 4FJ2A 4CR6A 3P0EA 3KZ1E 2P6OA 1KO7A 1HT1E 2HPHA 5EKXA 1W2WB 3NBMA 1U8AA 1E1YA 2VIIA 1E0AA 4V3CA 1T2AA 1P1HA 1VA4A 2ZXFA 4JUDX 1R4AA 4OP2A 2A4MA 3IA7A 3JQ7A 4KGDA 4PAWA 4D4MA 4LAFA 2QTCA 4XIIA 1V9SA 3AV3A 2ABWA 4RVDA 4CI9A 4N03A 4UTRA 3WICA 1WF6A 3AUYA 2OK7A 2D5BA 1OSNA 3T35A 4H3VA 3DBVO 3NHWA 3QPUA 2ACEA 2WK1A 5K9ZA 1VE6A 3BREA 4JL5A 4ZZIA 3IXLA 4ZYZA 2CUNA 2VSXA 5ALXA 1YDWA 1Z4OA 2P9JA 1J8VA 1CP2A 2WJWA 3HY3A 3ZGXA 4DDTA 1V5IA 5MF6A 1QRRA 1J0XO 2VVTA 2YHAA 1SVMA 3PDHA 3K8ZA 2HMSA 1NRJB 1SK8A 3LZDA 3TCXB 4HZGA 1QXSA 2G5GX 3AF0A 3C6BA 3RGWS 3RHSA 1P17A 1RNLA 3UCFA 1AT1A 1DIHA 2IXFA 1CZNA 1P0CA 4WKOA 1O77A 1ZD5A 4RZ2A 1NNEA 5F35A 2BI4A 5KQMA 4M2LA 3UCXA 1HV8A 5KEIA 4DLWA 4AKEA 5CDFE 4A1FA 3O73A 1YGYA 4TYWA 1WXGA 4HWSA 3GRCA 4ER3A 4K6OA 4FBLA 2YDXA 3AIOA 4QU9A 2DR0A 2OCGA 4CTOA 3A6PC 5A3JA 2V7WA 1XVTA 4I9FA 4L78A 3NH9A 3SHWA 1Q7BA 2C5AA 3D3WB 4DMLA 4JXZA 3PI6A 3TLGA 4RTOA 1DWUA 3ZE9A 1KARA 4KQWA 4W5NA 2XTJA 1QZUA 1ESZA 1L5WA 2GYWA 1U2PA 4H1UA 5L7WA 5C3MA 1VMKA 2AHRA 1WXDA 4PQFA 4YJDA 4DABA 4YRQA 3A7DA 2Q1SA 4IILA 4NEGA 1IDN1 1NJGA 2ZBVA 3CZCA 4J0HA 4KB5A 4ZI3A 4ZCTA 2FSVC 2JI6A 3WAKA 1XWIA 1UC4B 3ZY3A 4DMCA 1GQ2A 5ARDA 4IVPA 4UXIA 1OI4A 4AZ0A 2Q1XA 2QV0A 5HM8A 3QFRA 1ZXXA 3ANLA 5ALNA 3L1HA 3FPHA 2GBIA 2L2QA 3OEWA 5ARBA 2ZTLA 5IM4F 1KMHB 1G42A 4MEAA 5FTNA 2P40A 3U4HA 4IDCA 3SR3A 2FGJA 4ZCPA 1OMOA 5AT1A 5HYVA 4DLXA 4IGKA 3RRJA 1IAQA 1POXA 3GT7A 1THZA 4WOKA 4CF6A 3H2JA 1YQUA 1IONA 4OH7A 3PC7A 4R6XA 3IURA 4XVQA 3DAGA 2ERCA 4DMFA 1PEAA 4FGZA 1LRKA 2PA3A 3B8EA 4LJ6A 1TVCA 3DXFA 3PX7A 4AY2A 1SKYB 1T3HA 3CNHA 1SVOA 4IZIA 3ROFA 1W5AA 3TBHA 4D3XA 4E09A 5L4LA 2XMRA 4B3HA 3IKVA 4N5MA 1E0SA 3ZCVA 2ORWA 2J07A 3VHXB 3LC1O 5DTMA 2O6LA 4UOEA 2ZBQA 4XIYA 5AXBA 3WRXA 4EI9A 6CHYA 3GEDA 3JWGA 4YRMA 5C5CA 3MJEA 4HH0A 5DNUA 2Q7DA 2ZI5A 1E5LA 1TQ6A 3E53A 5ER6A 4EHBA 3UCEA 1AQNA 1E9AA 1J20A 1M83A 2W2KA 1VL8A 1N3YA 2G5TA 2KB0A 2QN8A 1KXZA 4US1R 5I47A 3Q8KA 5JS7A 3DLCA 2DERA 1XHEA 1OFUA 1UK9A 3LUDA 4GI5A 4NF2A 3K0CC 2GAAA 3IAUA 4YMGA 3E8MA 5AW5A 3NS7A 3GAMA 3PI7A 8ADHA 4HXGA 3OT4A 1OXTA 1K8QA 2PLAA 1BHSA 1LBHA 4OJTA 5F2NA 1NRXA 4KO4S 4KJZA 1FUKA 1JDSA 2ZUTA 1ZMTA 3A1VA 3ZYZA 5EUCA 1RRMA 1H93A 2FG5A 4Q7LA 4CDGA 4DIUA 1RS0A 4R40A 3FOZA 3C4VA 3UFXA 1X3LA 3DEAA 3E27A 3X3HA 4LBZA 4HDOB 1KK2A 3E9ZA 3KU4A 4URHA 4ZVOA 1BN6A 2CZQA 2NU9A 2C07A 3DEHA 3LQQA 1FBTA 3ICVA 3DFFA 1QANA 1JECA 2D1RA 3G0BA 1V8FA 5AVZA 2KM1A 2WVJA 4Q4LA 3RTGA 2CLIB 1C9NA 4DGQA 2NQTA 1W0JD 2R11A 3PITA 1KO8A 3D3EA 4MKIA 2HDHA 4MKFA 4NMWA 3VSAA 1LQ2A 5TMBA 5JNSA 3U7QB 2AX3A 1AE1A 1I6MA 4QTUB 4DDHA 2W6ZA 3I23A 2I22A 4XQCA 2CW5A 2WRZA 1DRKA 5ULLA 2MCFA 3B9BA 2O0HA 3MA0A 1NP6A 1WB9A 2J9XB 3QOYA 3ABOB 3BHJA 3HYLA 2YKGA 4UUBA 5H0IA 5LL6P 5DK6A 4WZZA 5FT9A 3F8SA 4XVUA 4QFBA 1UZMA 4ZYVA 1CUEA 1D0SA 4YJHA 1QGUB 1PVOA 3B6MA 1K7EB 3GLHE 3N8HA 4ISCA 1F2DA 1QK5A 1UBGA 1UMDB 2BKAA 1E94E 2CUTA 4QQNA 4R54A 3IMGA 1DRVA 2CLSA 2ZIFA 3A28A 1B0PA 4FMPA 3KR0A 1IM5A 1ACLA 2NSDA 3EA0A 2H1OA 4J0IA 3JVIA 3AI2A 4X45A 1BWQA 4R5HA 4BNIA 4X65B 4JZYA 1L0BA 4F8YA 2IEIA 1LC0A 2HCRA 4B85A 3ZGVA 5CX4A 2OR3A 1CJVC 3D0OA 4YHBA 2B2NA 3WC4A 2GH1A 2C3UA 4UM5A 3DVAA 4M49A 4O33A 4OLFA 1L5RA 1AKYA 4BLVA 2A5LA 4PO9A 2OSBA 1OX6A 4LA4A 4ZT5A 2QPTA 5FIUA 5DULA 3EFOB 4KN6A 3RSLA 1MDBA 1TO1E 3O8NA 2VRCD 4G5YA 4TLCA 3NTLA 4NCHA 3B1KA 3ROKA 3MLAA 3CXRA 2W70A 5A4IS 3M1YA 3DDWA 1NW9B 5FOTA 4KP7A 2R7MA 1M3SA 2HMTA 2IU0A 3AR5A 6LDHA 5HF9A 1V8DA 2E4YA 3M5DA 1STOA 3DBLB 2QNRA 4Q05A 5L3QB 3I05A 4NLLA 3C5EA 1XEFA 4J43A 3T9BA 3Q5DA 3PRJA 4J3JA 1EKXA 4CE6A 2PZJA 1MEEA 2ZE7A 3FCAA 1RPTA 2WFAA 4IIJF 2BFFB 4DPLA 2HUPA 1KNXA 3U09A 1IOZA 3R5SA 5I8WA 3RSSA 5IT9A 3IIJA 4QRDA 1IHOA 3KPYA 1B0AA 2VF2A 4CCAA 4PPQA 5L95A 3AHFA 5FJIA 4BO3A 4K26A 1NQTA 2D1TA 4JN6B 4NBWA 5CCXA 1NXXA 4N48A 4OBWA 1X7YB 4DNQA 4J0KA 2FW9A 4UBNA 4EI8A 1M76A 1U8FO 1GFSA 1TNDA 1ZH0A 2H2FA 3A37A 3AR2A 3IUBA 3NASA 3Q8WA 2I4TA 2G63A 4LFCB 5KOIA 2XJ4A 2CWDA 3NYQA 1KJQA 1O03A 5DBFA 4AKGA 4O59O 5B2ZA 1K3TA 1AGRA 1M6NA 2Q4OA 4KDRA 5G0WA 2K6GA 4GR5A 4J0JA 3RHZA 3Q7IA 1YR9A 1E0DA 4RMIA 5LA6A 5INTA 2LRHA 1NAHA 2G40A 5FJJA 4CEHA 4J0CA 1RQLA 5ITSA 1U0JA 1U81A 4U8HA 1OW3B 3AVUA 2KX7A 3ZH9B 3BD9A 3GFBA 4EL0A 3GDOA 1RQNA 4EF4A 1RYMA 4TKUA 5JPCA 1UUFA 1LRLA 1X1TA 5KDOA 1WQ3A 2WC1A 1V39A 2Y4NA 1GTL1 3B5IA 1NC3A 4PS0A 2YHBA 4UHHA 4U5QA 5IKXA 2B8NA 1L5QA 2OOKA 4UTOA 1UQTA 1IATA 3LX6A 3C3JA 4H1HA 5G3ZA 2CBGA 3MZ0A 3GEMA 5JSZB 2BFAA 3G7NA 3HCFA 1LFAA 4FYKA 5JTTA 2BI7A 4M0FA 4RSRA 3EVEA 1FCJA 1XMJA 3EQZA 1CB7A 3CPEA 4JJAA 4K28A 2JBHA 3GROA 3MXOA 5IAKA 1I2AA 2QL6A 3X2EA 4Z6KA 3ZDCA 5ECYA 3VVLA 1D07A 1Y3DE 2QLLA 3O84A 1GPJA 1KAOA 4NVRA 1ZC3A 3TAUA 2QTZA 3AF5A 3WSWA 4YRSA 2GZRA 4CMIA 1QTQA 5DXAA 1PJTA 1UDCA 4EYKA 1K8ZB 2ZE6A 4F2DA 1SZDA 2NLOA 2XNHA 3SKYA 5ADVA 5CVVA 1J7JA 4EB8A 2OO5C 3KKPA 3SSAA 3K9HA 5IZCC 3DLIA 3EISA 3KZXA 1TRHA 1FUYB 4QBKA 1NQUA 1KI9A 1U7DA 2A0UA 4M1QA 2Z98A 5T6BA 3WSTA 4L1KA 4EUHA 1ISIA 2IH4A 4HKTA 4WBXC 1DBRA 1NHGA 2XMPA 3LTEA 4CFYA 2CZGA 4CDMA 3P9NA 2RIPA 3RRZA 4KVFA 3PT5A 4Q1CA 3B60A 1NNUA 3E4DA 1G41A 4MGHA 4MKGA 4EB6B 1TJ4A 1P77A 2FWJA 4LNUA 3NX4A 2X2FA 1LEHA 3EPRA 4AKIA 3CZ5A 4PPGA 3SSOA 3OQOA 2BFPA 2I8CA 3GVCA 3SZLA 4OLJA 5DISB 2PL9A 1J06A 1KU0A 2QG6A 4X54A 3DCNA 5DM1A 1JHXA 3S68A 2HMAA 4HQNA 4N9QA 2WF8A 4CM9A 4LBYA 2P6MA 1EFPA 2QZJA 3L6DA 3P4YA 4KFCA 3A4VA 1T0JB 4PSKA 2WD7A 3QVSA 4O4IF 4A91A 1FFYA 2CXHA 2QYTA 3I9V6 4KE8A 3VO9A 5ICSA 2EX4A 1OREA 2FFHA 5HSGA 1N2CA 3QBEA 1DP4A 1DO0A 1JS1X 4RIEA 4A73A 1X1EA 2WAXA 1X7WB 4S1TA 1U1FA 2HK9A 1DEKA 2Y0BA 5LZ8A 1NXVA 1MDFA 5TRTA 3TSYA 2GB4A 1Q77A 1W4LA 3N2YA 3VSDA 2R6GA 5AK5A 4CF7A 3ZCUA 4G07A 10MHA 1IVNA 1YRWA 2RB5A 5FUQA 2ZRPA 3C8ZA 5CVEA 2WG0A 2DQKA 1OASA 1ILEA 1AB5A 3K6SB 4AZWA 4H18A 4DQXA 3DZKA 1R8QA 4DLPA 3V4LA 3KQLA 3PD0A 1F48A 4XXHA 4EGSA 5BN4A 4FOTA 1Z0AA 2P6RA 4EJSC 1X74A 2ACKA 2G1UA 1KFEB 3O1LA 2PUGA 1LZKA 3AI3A 3AP1A 4TS3A 1CNMA 5LC1A 2WZCA 4BO9A 2OXTA 1P7VA 2XB8A 3U49A 3ZDZB 1RHKA 4C7OB 2RGNC 2GWHA 4EFMA 2H2WA 1E6MA 5HKBA 3RLFA 2IELA 4JSYA 4MV1A 3U4MA 4BFVA 5AHXA 4TSFA 5HKKA 3THWA 1C41A 1X13A 3R0XA 3MBKA 1HZJA 4LDPA 2HPVA 4FZ5A 1REQA 2FWRA 4HOYA 5DOZA 4BYGA 4P54A 2ICAA 4M55A 4AXBA 3DZFA 5EE0A 3TZHA 4Y6OA 5EJMA 3CKMA 4WK2B 3EPKA 2FZGA 2PLWA 3OZSA 4EEKA 2QGNA 5B6JA 2GM4A 4QOJA 1ZISA 2I1WA 4BYMA 5IHPA 2C61A 2GEDA 2WNSA 3C3CA 3LAWA 4QFCA 4AX8A 3HVRA 1EGVB 4BB9A 2FP4A 1D09A 3ZTWA 3MWYW 1CF9A 2AL7A 2QW1A 4LFBB 4OG2A 4RUKA 3WMXA 2FGKA 4HNSA 4OLHA 2C54A 3LP8A 4XJTA 1SOMA 1GXSA 1JJBA 2ZDGA 4UW9A 4Z7NB 2O2GA 1PDVA 7ABPA 5L7YA 2DZDA 3UUWA 3OMXA 5I8PA 1F3OA 3DOFA 1H6DA 2CCKA 3E22B 3ZY2A 2GMWA 3HABA 4BKQA 5DYNA 4K40A 2PX8A 2VJNA 1C9MA 4HDRB 4XGRA 4DQKA 4DB2A 1TTHA 3FUUA 5AVJA 2AVDA 5JDCA 4FFNA 5KBYA 1DWPA 4NFLA 4MRVA 3HUEA 1RYNA 3DFMA 1OH6A 1T5DX 1I0LA 2DQ4A 2GKOA 2HLDA 3EF3A 2SECE 3WP0A 1ZMXA 1FQKA 2NO9A 4BB5A 3DNMA 3TLBA 3NHAA 2CLFB 1CY8A 4UEJA 5H5JA 1NQAO 1UANA 2FPUA 5DK4A 3HKBA 1W30A 1S3SA 3C14C 4D79A 1PR6A 3ZHZA 3R23A 5JASA 4KJXA 1Z15A 4F4IA 1QX3A 3R9XA 5KYXA 3CF6R 1CT9A 3PICA 4HNHA 3QELA 2XCUA 5E8JA 1Y9ZA 1DBWA 5EIBD 2XCTB 1XRMA 3UMYA 3ZK8A 2PBZA 2K2WA 1JJIA 2C2KA 4M1WA 1T5LA 5GONF 3TR5A 4X85A 3K9QO 3CO0S 1EFVA 1FUUA 1RKUA 2LIPA 1LPPA 5BW6B 4DYVA 3CH6A 4KE9A 4MV7A 4ZEWA 5JSHA 3BMCB 4RS4A 5F7ZA 4XUGB 3LUKA 1KQ3A 3AHIA 4IHJA 5JCOA 1O6ZA 5TY0A 3WHIA 4B81A 4W5QA 2LCQA 1QOPB 4R41A 1DCTA 4HH1A 3G49A 1YS7A 5EVJA 1KEEB 3GLFA 1HDGO 3OQNA 1E1QD 4LK2A 4JT9A 3U5ZB 2AN3A 2RHGB 2ZSIA 3AWIA 4GSYA 3GELA 5GQSA 5B37A 5DHFA 3SHTA 1U3UA 2X8BA 1NT2A 3QBDA 4K5QA 2AXEA 4REOA 3NWEA 2H0AA 2XEXA 2Y0CA 3OZGA 1E2FA 1J39A 2P5YA 3K35A 2OFWA 3I3SR 4JP5A 1TU0A 2YYAA 4KU4A 3KKEA 3BJEA 3C3XA 2I71A 4MYTA 3BAZA 2CLDX 1FK8A 2YS7A 1KDVA 3WNBA 3CU5A 5J43A 1YB1A 1Z34A 1J2TA 3K9GA 5C18A 2PV7A 3DBHB 1XU4A 1CCWA 1T5SA 2R2GA 2QRVB 1Q16A 4CG3A 3PT9A 1ZI8A 4EO9A 1ECBA 5JPIA 4OHRA 1Q3HA 3LH5A 3SS8A 1WF3A 2Q07A 3AX6A 3OPYB 4WZBB 1I0IA 2VDMB 4NJMB 5DYWA 3OJEA 3W5AA 1J0EA 1PR5A 3JV7A 4G1FA 4W5JA 3ROEA 3ZWAA 5GZ1A 4BDTA 5C32A 5GIPE 1LWNA 3I2HA 1QHHB 1G5TA 1RPJA 4F4JA 4P0TA 2R6ZA 3TM4A 3P0IA 5L8VA 5T8KC 5JH7A 4LVCA 4RJJA 1I5OA 4L0QA 4U9UA 5JH7F 2JA2A 4OA8A 4MAAA 2WB2A 3LUHA 1VPTA 3WZ2A 1G20E 1XTKA 2EZ9A 1LJLA 2WT9A 4HDNA 4LMRA 4PYIA 1XKQA 4Q21A 1QIHA 2VP5A 3QJ5A 2UUPA 1X42A 5FNVF 2WQ7A 2VWHA 3QKIA 5IC6A 5I4CA 3IT3A 1PNQA 1SC9A 2BKXA 2ODNA 2P2NA 2PZEA 3LOPA 2HNKA 3OZIA 4G5SA 4N6GA 2IODA 2PTHA 3GN2A 3VSEA 2A4KA 1MQAA 4JUFA 2OENG 3W5HA 4BMSA 4D56A 4DJTA 5B7GA 5KYGA 3UUGA 4E5PA 2NZJA 2XUGA 1JR3D 3N2ZB 4KFRA 3I12A 3RBAA 1OI7A 4BE7B 2WF6A 1CQJA 3MIIA 1L8QA 3T3PB 1W8DA 3DO8A 5KSOA 5B1IA 3PHCA 1B00A 2ETXA 4G5XA 4CLHA 1FEZA 1GOTA 3CZ9A 1JFLA 5BORA 5CLFA 3B52X 5LD2B 1ORIA 2P4UA 1N4AA 2ZJAA 2P9HA 1XWFA 4KDFA 4M7PA 2PUTA 4N0MA 4RYDA 4DG8A 2Z1DA 4CFSA 3TTYA 3ZJVA 3U6BA 2AMJA 1DO8A 3VDRA 1QS0A 2WA1A 4K6GA 4Y2YA 1OH5A 4MVJG 1VYUA 3KXDA 4YAUA 1NGSA 2P8JA 3RBVA 3IE2A 4LG1A 3F5QA 3R7WB 3JQAA 4DLSA 2CYBA 4E12A 1NRIA 4URXR 3GZJA 3MCAA 4H6PA 2PGOA 2XW6A 2YOHA 4H4DA 4Z0HO 5CFLA 3I2IA 8ATCA 3OE7A 4B71A 4MZDA 5AM2A 1A4UA 2JD0A 4XM2A 3B7PA 3IKTA 5A5FA 3K96A 2QD4A 1HDEA 3F9RA 1II8A 1E3QA 3MERA 4R01A 2C9OA 5C1DA 3F3KA 2W2XA 1QM5A 4IJQA 4LNAA 4OJKA 1PR3A 4PCUA 1QORA 2P4HX 3GEIA 4MPTA 4MHSA 4C7KA 1MR3F 2NZYA 3NRBA 1T91A 2D4AA 3NHKA 1OBFO 4JHLA 1DAMA 1Y3CE 2LDXA 3L7KA 4CM4B 4QLAA 4BFZA 1AUOA 3FFAA 2OHGA 4B48A 1VJGA 3R5XA 3VR3D 3AR6A 5I9SA 3PS9A 3FWKA 1JKJB 1D6SA 3NJRA 3PJRA 2AZTA 4NMHA 1L4MA 2ZUCA 2BBOA 2RAFA 5AVOA 3DKVA 4U5XA 4YFVA 2QZZA 2I91A 1IOLA 1BMFD 4BTVA 4WINA 2OBLA 1GKIA 1JKFA 4HMPA 1LK7A 3TW8A 2F2TA 1QF9A 5CGQB 5AM0A 4QYMA 4R2LA 3UJNA 4OLAA 1J9GA 1DPFA 1N75A 4PPYA 3RIHA 2BSAA 2FN4A 1CZLA 1KYQA 1G6Q1 4OHPA 4MTCA 2UDPA 1KTIA 3PQ3A 4WZAE 3GH3A 2IPAB 3OMWA 4JYBA 2TS1A 2P9QA 2ZAOA 1E63A 3AY0A 1H2RS 5IN5A 1B6GA 1KZ7B 1SKQA 3FUCA 3B7WA 4IEEA 1K6JA 4GUDA 5H9WA 4JNCA 4R68A 3UK1A 3D3KA 1KIAA 2VJBA 3NEYA 4F4CA 2JG3A 4MLZA 2O5EA 2YVUA 2JIRA 3AM3A 5FTWA 2AUTA 2JHAA 3DLTA 3EF0A 3FOFC 2A3NA 1DKNA 1YOVB 3GUCA 4G56A 2J9ZB 4BXOA 2I1VB 2ZUWA 2PX6A 4WACA 2RI6A 3ZVNA 1BEUB 1NVWQ 5CA0B 3PC8C 2V1UA 4DCPA 121PA 1CK4A 1UKVY 1YK1A 3HJTA 4EA6A 3QU5A 1YH3A 3TOVA 1E9SA 4AG5A 1QMGA 4XDGA 4KVGA 2WYVA 1R8XA 1J1IA 1DKRA 1RQXA 4MW1A 3SY8A 1JR3E 1R5JA 3ER8A 3MCVA 1VCIA 5B57C 5K20A 1WW3A 4UCXA 1CB0A 1GZ3A 2CL6X 1P1JA 1R6XA 1WG8A 2AIRA 2RHOA 3MJDA 2GX6A 3P26A 2R6CA 3I9NA 4AJKA 4EO4A 5TQJA 1W75A 4XRGA 1ODFA 5BRAA 3BUSA 1H69A 2JHPA 2GBPA 4PLGA 4TKLA 5C35A 1WXHA 5IANA 2Q41A 4KVAA 4NOMA 1MJHA 4AO6A 3ZW7A 4NICA 3Q6MA 3EGXB 4R8MA 3A25A 4CIXA 5A2GA 5I7FA 1UBSB 1U0NA 2B98A 3QHQA 3UAGA 3AR9A 3K31A 4U6SA 3W6PA 5YASA 7MHTA 4DLTA 2XZTA 4DGSA 4LF6B 1O3YA 4J49A 4ZYUA 2BELA 4GWKA 4URZR 2ZYDA 3CVYA 4BLQA 2FEWB 4LYHA 1PTKA 4PZPA 4C78A 3H7AA 1NBMA 1RZRA 3KXIA 3UKOA 1C4WA 1W5TA 2J85A 3RTEA 3HM9A 1M1NB 1OC4A 1WV0A 3TMYA 3OESA 3VHXA 1GDDA 2BF7A 1XJ0A 5E6SA 4OQFA 3RQIA 2MT9A 2RGCA 3DDNA 4P93A 5F3DA 1YDMA 4C6TB 4ZICA 3HJFA 4HUQA 2JASA 3UBMA 1IZ7A 2YV2A 1KQFA 4WPGA 3B6KA 5K2OA 2ROQA 5EY5B 3AFNA 1DX6A 3UC5A 3V1NA 3KT6A 4JI5B 1R6BX 4TYYA 1NXWA 1L9XA 3L9XA 1WR8A 4KXFB 2O8DB 1BVHA 1DDIA 1ULAA 4RQTA 1XBTA 1YJAA 2RK3A 621PA 1RXSA 1IBRA 2IHKA 1SBHA 1YWGO 2BL4A 2JCVA 3IIMA 1JF8A 3JR3A 3SNHA 4B6OA 3ZJUA 5T3UA 4P5DA 4Q4HB 3WGIA 3R9WA 3I72A 2F3SA 3KT0A 5ICEA 1TZKA 2N75A 5C52B 1XZ8A 1VI2A 3GGDA 2WTBA 1RSZA 3H97A 1WZCA 2AG1A 2C04A 1YSCA 1KORA 2VDWA 1TQHA 3ZZNA 1KP9A 2BAGA 2YCLA 3UJHA 2BEVB 4JP2A 4EEXA 5DLEA 2V3CC 2I7TA 1Y6RA 1OT3A 3FSRA 1I33A 1I3LA 1N78A 1EHIA 4UNNA 3DD1A 1PK9A 2ZAGA 3SNKA 3UNXA 2GPNA 3H2ZA 4JLSA 1XAHA 2Z6QA 3SVLA 1GPMA 3MT9A 2WTXA 4OGLA 3U7QA 2AJDA 1J8MF 3U9LA 5F2OA 1CRLA 2W43A 4W82A 4IQFA 4EJ2A 1TUBB 1PJAA 2VNKA 3D4PA 4Z86A 4AECA 5JZVA 5IVHA 4EFLA 3FTEA 3MK31 2G8NA 2V6GA 4RIFA 4XLZA 3MAAC 4ADSG 1MHTA 1EZ4A 4CIDA 2GZ3A 1FU4A 4HH4A 4X66B 2A5GA 1QGUA 2YJNA 3O26A 3V6LA 5DYIA 4NYJQ 5HFJA 4RTKA 1BXZA 2VOJA 4XVHA 1R9MA 1ZW6A 2P90A 2YYYA 3D59A 3LCCA 3DHWC 2WZBA 1ACMA 3IOCA 1SIBE 3A36A 3THOA 2HKIA 2Y6UA 2O4CA 3MUOA 1Z4LA 1H0RA 3QX8A 3ZS9A 3LFTA 3MJVA 5H9VA 3W9BA 2GJAA 2FFAA 1T3TA 2R6FA 3CLUD 4HZUB 5BWBA 2M1ZA 4ZO4A 4F04A 1RMYA 4MVYA 2IY7A 4EGFA 2PZAA 4FEEA 1IOVA 4H59A 1IJBA 1DZIA 1JHYA 3A6HA 3PFHA 4AP5A 2C4MA 3UUEA 1GARA 4OQQA 4CF4A 2XYVA 3EFOA 4GH5A 3OT1B 1Z6AA 1RQPA 1ZSVA 3FKJA 4DQ0A 5BV2P 2Q6TA 4H6WA 3R77A 4Y2JA 2GHQA 2CUKA 3E4CA 1Z18A 3UBTA 1Z6ZA 4ZEMA 3BIFA 3DP7A 4WTOA 7MDHA 1NVBA 3DF7A 1PJ3A 4LX8A 5EJIA 2FCAA 3LPMA 2OV3A 5E2IA 4F3KA 2Q2WA 5DSXA 4CTNA 1DAIA 3FTPA 3PDJA 1M6VA 4ESEA 4FYWA 1QGAA 1CY4A 2YV1A 5FYDA 4YCJA 1ID8A 2PRJA 1FFWA 2BFFA 2CNDA 4M7WA 3VYUB 1RYYA 1IY1A 4OSOA 2OFFA 1ZU5A 3P9XA 4MKZA 4UTNA 1YONA 3CR7A 3CLRD 1CIJA 1HTBA 1RM4A 2O1SA 3IOMA 4OGGA 3QLJA 2Y1KA 4E2XA 1N5JA 1CG6A 2PKQP 1LTKA 4BRWA 5IWCA 3FUXA 5DHRA 4PLTA 5BXQC 1X7YA 2HPZA 2YX1A 2A1TS 4H35A 5DRTA 3ZCTA 4E5KA 4J1SA 2FEPA 1T29A 1DUSA 4KTTE 1JIJA 1KI2A 4GMKA 2YFHA 1SXJC 7GPBA 4HWPA 3CSUA 1XQ6A 4HEJA 3EZGA 2BDTA 1CNEA 1TYZA 3PUVA 1MVLA 5EKSA 2CVOA 3THSA 4YUAA 1PW7A 3QOXA 2IYNA 1KQOA 4Z1MD 3QKRB 4HQ6A 5F5NA 3CE9A 1N7JA 4M87A 3SEZA 2YHIB 1QV9A 2H4ZA 2RIRA 1VLHA 2XDWA 3UWPA 2C0PA 1EPUA 5AKXA 5BW5A 2YXNA 3U3MA 1D7OA 5EA2A 4B6QA 1XP8A 5J4HA 2IYUA 1JG2A 1VKHA 2HQBA 2NVOA 4JKYA 4REQB 2J45A 1OAOC 3DSRA 3OFKA 4QHYA 4UE2A 4D74A 2ZSJA 3GMSA 3PP8A 4JBWA 1O5OA 2ZKLA 3M6XA 3ND5A 4JEUA 4O63O 3DA8A 2AA3A 1E2DA 4GD3Q 1ZKDA 3CVXA 4HNTA 3DMPA 3E03A 2YIDA 3D4LA 4K9RA 4AYWA 3FPJA 2VDPB 1C81A 4BNHA 5JSZA 5AI0A 2BHSA 2G72A 1V8ZA 4P5EA 1QG4A 2VQEB 4DUYB 4WFQA 2PYDA 2L42A 4ZOEA 5J4KA 5JQWA 2DUWA 2NTYC 4YRGA 1T9HA 5ALYA 2IPOA 2UVQA 3DO5A 4K81B 4MJXA 5GVRA 2BF4A 1SC3A 1MRZA 4CM5A 1TW3A 1V11B 5ENDA 3G7SA 5JCPA 1LLDA 3OKPA 1D04A 4B83A 1WAMA 4YRZA 3OD1A 1XZBA 2YASA 1HSOA 4AN1A 3B1JA 2Y1OA 1MEOA 2EBWA 3QMVA 4MSUA 4ED9A 3KUDA 1CP3A 2XUJA 1E7SA 3BTSA 5DP2A 3NH6A 2ENWA 5FPYA 4EUFA 5F98A 1DT3A 1E9FA 4J90A 2I4MA 5AOVA 3PUJA 2HC9A 2ASEA 3BMXA 1ZNYA 2QU8A 4G5RA 3HPQA 4Q4JB 5DBOA 4IM7A 3HBLA 1UBTS 5EZ6B 1VYVA 3I0MA 3ID6C 1AZTA 1KYIA 3CLHA 3ZXXA 4GM4A 4QWWA 4DVGA 2YN2A 3DXZA 2FDRA 4AJOA 2O8NA 3W5IA 5LYJF 2VTKA 2VUHB 4TOIA 2Y6VA 2O52A 3SG0A 1U6IA 3D2CA 1F12A 3AMVA 5EXTA 1G3QA 5D6NA 4IOMA 5IVIA 1BFUA 2VPZA 2XGGA 2XCIA 4GLBA 1UAAA 4FS8A 4BBJA 2XOEA 1VHQA 2O50A 4OFZA 5JXWA 4UVGA 3B9PA 5JYCA 1NJ5A 3ZQ6A 2CXXA 4F72A 3FYUB 1P60A 4WKPA 3RIEA 3A70A 4C89A 1BNCA 4IDQA 1GZ6A 5JZBA 2PIAA 4Q4AB 3ZHXA 5IDWA 4CN9A 3DT9A 1JIIA 4KIWA 3ZBQA 2II6A 1QMPA 4PC2A 1X7WA 2Q5CA 4KQMA 1MHPA 4MVJM 3WTBA 4DM3A 1F8UA 4MWCA 5FH9A 1DCMA 1Z0JA 3MRXA 5AHRA 1G6HA 1ENYA 2EW8A 3D0RA 4WBNB 4UARA 3PX2A 5TMDA 4RCVA 4CR7A 2QL9A 1ODKA 3BZWA 1TUEA 4C87A 5EHQA 1JEYB 3K6SA 3M4NA 2QUBA 4Z4IA 4RKYA 2XTMA 3EGCA 1AOXA 3FAZA 4OHZA 4BOYA 5JWOA 1SUPA 1MH1A 3KB8A 2Z3ZA 3AR8A 3TOXA 5K05A 2FUEA 5HVNA 5GGXA 1ZONA 4B3DA 1EZZA 5K0EA 5JDIA 2PS0A 2A3RA 3MT0A 2M98A 3DPUA 2JJ1D 3K1ZA 1Z2NX 4C7OA 1KI8A 5CUQA 2X3YA 5JNVA 3NP9A 4TZKA 5KQSA 5D8DA 2DHEA 1ZNWA 4NQZA 4N3BA 1ONOA 4PVDA 1EFUA 2Z6VA 3JQ9A 5BSMA 1JDJA 3QBJA 5K6TA 1FMJA 3WRWA 3ESYA 1TYBE 2BUAA 2GRAA 1ZN2A 3AM5A 4BQIA 2YFYA 3DOEA 3OP4A 4OO3A 2FPXA 5EYPB 4WVFA 1I4LD 1S2NA 1NMSA 1I6LA 3B85A 1ZX1A 1TEVA 1NC1A 4MP6A 1T25A 1E5DA 2XQGA 3Q7EA 4JLUA 5AJZA 5BUCA 2YJ3A 2EFJA 2BTEA 4PRYA 1IEVA 5KWIA 1X8LA 4G3XA 4PG8A 1LDMA 1E3EA 3L8CA 3DV0A 1EU1A 2WV9A 1T10A 4F3CA 4FILA 1L9KA 1PK7A 3WB1A 1HLGA 3VR5A 3K8YA 1KWKA 3F5SA 2C9BA 1U4OA 1VKRA 4I36A 5FO0A 1SVIA 5L3ZA 3UA3A 4BWFB 5C8XA 5BQXA 4OBBA 3QSGA 3FIJA 4G65A 4KOAA 4RTJA 1DV2A 4AQ7A 3FKSD 2OBBA 3LA6A 1Y8ZA 5A5GA 2IC5A 3QEMB 3CEAA 4C21A 4JODA 3E22A 3I83A 1VLZA 3LE8A 1E4EB 1P1KA 2JF0A 4HB4A 1CULC 1N5IA 2EL9A 4LF8B 1PQ4A 2ECFA 2ODPA 3EOAI 2Q3EA 3H2GA 2FOXA 2MSCB 3WS7A 5KU7A 1YZQA 5B58T 3U13A 1NDUA 2GKSA 2D5AA 3ORFA 4EJMA 1JG4A 1RJ9B 2ODTX 4V0ME 2RFLA 4OI0A 4B46A 2QZ9A 4U7FA 3AUXA 3DS8A 1LV8A 3BWVA 4TTRA 1GWNA 1IVYA 3Q7TA 3N7TA 2R1VA 2ZJ4A 2WJ4A 3L7AA 4F38A 1H05A 1FSPA 4TTSA 1M1YE 3N0VA 1XTTA 3G8CA 1UJNA 2HXYA 1CTQA 2IHYA 3A05A 3BERA 3JAKA 1DARA 2C8JA 3EVGA 4L57A 4W1RA 4XH9B 1Z39A 3WJ2A 2V03A 3E7WA 3VC3A 1OXXK 3UMRA 2R7NA 2W6IA 1LS6A 3C1TA 4QXMA 2VYCA 3A4MA 5K3CA 4TWJA 5FWYA 1E96A 3BMCA 4WUVA 1FSFA 1QB8A 3QVVA 4ZVQA 4ZZ3A 5JVDF 3ZJTA 2WHQA 1X94A 4QQKA 4WOJA 1DJQA 5LVAA 2AJ8A 4RTPA 3QFHA 2PKXA 1E2NA 4HO1X 2G1AA 4JWTA 2QAIA 5K3BA 3WYNA 1KEEA 4LQDA 1LKZA 3BL8A 3OQIB 2YWFA 1II0A 3L0ZA 3P27A 3KKQA 4XYMA 3ZI4A 5DNCA 5JEEA 4C0QC 4M1OA 3HVKA 1L5GB 3AUTA 2FSFA 1UPTA 1RAHA 4MV6A 3N53A 3ONNA 4Q93A 4LXUA 5KKNB 3JX9A 5LLSA 4HVLA 1LY1A 2OHHA 3GU3A 3BTUA 3O5AA 1IH8A 4R51A 5LBIA 3SR0A 4IFEA 2X7JA 1JE0A 1HKHA 3I04A 4XX0B 3ADDA 3GX1A 2E4ZA 3ONWA 1LBQA 1XCJA 5FI0B 2JAPA 2CBZA 4JLJA 3DBHA 4ND3A 2VHXA 1QB7A 2Q6LA 1JYFA 2QRVA 4IRUB 4WZ6A 2BUCA 1WV1A 4K8OA 3EWNA 1A7KA 3S1SA 4QHSA 1WWKA 3OPYA 3Q87B 4WZBA 2OCBA 1KY4A 1KC1A 2WM8A 3M4XA 3WL4A 3GGJA 5GTDA 3OKCA 1SXIA 3CZPA 3I2JA 1G9XA 1QHHA 1QFYA 3HU2A 3ELUA 3O3CA 2W2VA 4K9MA 3KAKA 1IBSA 4MVXA 3SHVA 1DZ3A 1BKYA 4EPVA 4C0KA 2DPGA 5E4TA 2P2YA 2QLBA 1VJ1A 4P53A 3K70D 4O4JA 2BBTA 1ADJA 3JQ9C 5BPFA 3N2KB 2B4RO 3SAJA 4WZAB 5IJ9B 1JYSA 4O4JF 4PZZA 2V3VA 4NP6A 3TZLA 3BHIA 3OA0A 4PZ9A 4EATA 3EXEB 3IAHA 2Z8ZA 2BRUA 1GYQA 3L05A 4L73A 2JGMA 1VHTA 4PPFA 1Y5MA 1WHTB 1N9ZA 1SCQA 2VNAA 4KG7A 3CIFA 3SJUA 5A4DA 2LV8A 2HQSA 5ALKA 1LXCA 4XFDA 3U4DA 3ZBTA 3QHAA 2ILTA 4LOIA 1HDZA 4ZEVA 3TVTA 1GG2A 5I9IA 1IWPB 1JHZA 1PDWA 2VPPA 3V4FA 5JXJA 4LRYA 1U0EA 4H31A 2W6OA 1DJMA 1B8UA 1KZ9A 4MGYR 2C88A 4DCSA 1GGVA 4FBMA 1A5ZA 4PWYA 3HZZA 2QTFA 3L8MA 2WWYA 1EE2A 1ZIPA 2WWTA 1AHNA 1M1ZA 1FJ2A 2HU5A 2QD1A 3CN9A 4JU8A 4MV8A 3RVJA 4JFRA 5F21A 2WQ6A 3WE7A 4DJDC 3EFEA 2ZB4A 2Z57A 4PNEA 3ZHYA 1UMCB 3X1ZA 4ARZB 3O93A 2C31A 1BO6A 3OQPA 2W2LD 3ZV3A 4PTLA 5FHQA 1CY1A 4LGCA 1RJEA 2R62A 2IEGA 3AEKA 4WA8A 3R7WA 5HOQA 4ZVNA 3ANYB 1FW8A 5DNAA 2GEBA 2NTJA 4ITUA 3GUYA 4N8EA 1MF7A 4I5GA 1Q1GA 1W87A 3F6YA 2HY7A 3KOZA 1FPQA 2Q1YA 1N32B 2A9PA 2HF7A 4B0OA 1CVIA 2X6RA 4GOLD 2ZSHA 2W8ZA 3L0BA 4E4RA 4I08A 1MJFA 4DC1A 3LW7A 2NZUG 3FNRA 2PUVA 2BSXA 3I9FA 3CLSC 3QVMA 3LL7A 4I66A 2DPXA 2PCJA 2PKRA 4GI3A 1Z56C 1R8JA 3PQ4A 1JALA 2OBNA 4L9AA 421PA 1GSIA 2BMDA 4YWJA 3VISA 4CM4A 3BBLA 3D7SA 1YDHA 1CF2O 3G1WA 2DFVA 2F6RA 3UT0A 3VZRA 4QX6A 4BE9A 2OXRA 3TSAA 2FRVA 1TUGA 3ZDXB 4OHOA 5HE8A 1VLVA 5DWDA 1A69A 1UKYA 3LDAA 3WP1B 3P9SA 1UDWA 2VBCA 4HF7A 4WSOA 4RY9A 1ZR4A 1ECCA 2Y2VA 1N0WA 4GMHA 4X1OA 4EFKA 4YCCA 4BC0A 3B5EA 5FF9A 1NOJA 5ALUA 2RAVA 4F46A 1MORA 3WBJA 1YV9A 2X5NA 3OCJA 1BQEA 4D92A 3CVJA 1ZJ6A 1ODSA 4OIMA 3TQRA 3RAEC 2Q21A 2AR9A 2G9RA 2GEJA 1HL3A 3R0ZA 1OVGA 3QKSB 1YZLA 2FDXA 3OSZA 2GN8A 4ZYXA 3JYNA 2OAEA 5EE5B 5NLLA 3WQBA 4DA4A 1EI9A 2IXBA 4Z9XA 3L1IA 4KIGA 4RVNA 2VPTA 4P4TA 4AZVA 4CM8B 3DEJA 1C9DB 2CXUA 4XCQA 4C9BA 1YQTA 2O0KA 3I64A 4DOMA 2EXXA 4E5MA 4YR9A 2OAQ1 1I1QB 3WLHA 1UKZA 3BGVA 3RFXA 3RTBA 3REGA 1P75A 1P1RA 1R0SA 1NJFA 2PXCA 1FNNA 4KK4A 5CT5A 4YMVA 4LFAB 3EIQA 2F9LA 2I4NA 1Z6TA 4ILKA 1I2BA 2CL0X 3ZKAA 1MZPA 3C3WA 1B42A 1SVLA 1N8SA 1RP7A 1QPBA 1MIHA 2AE2A 3RPEA 4KWHA 4EI7A 3PIIA 4OJMX 3TJRA 3TNLA 3NBYC 4OSEA 3EG9A 5E0OA 1P2DA 2PPVA 4U2DA 1UBFA 3FWYA 4JUAA 5AM5A 4TLLB 3T4PA 3IBSA 2BTOA 3HB5X 2IK8A 4UU7A 2JH9A 1Y48E 1GFIA 3VH2A 2JPDA 2XNCA 4N40A 1W4BA 1UP6A 1VL2A 1QHIA 2EARA 2GJKA 4B3GA 3N39C 3LS2A 3ZE8A 1P91A 3WHPA 3ER9A 5LXTF 2A86A 2MR6A 1X1QA 3OJOA 5A71A 3EGXA 3S0JA 1DOAA 1K6EA 1KR2A 4A23A 1HRKA 3BGIA 1E2HA 4WY8A 5BNFA 4B5KA 5KINB 1S7CA 1I9GA 3CPSA 3P0FA 4EA8A 3LZCA 3ELDA 4BFXA 3ZE7A 1N5RA 2J6BA 3PL1A 4PZDA 3F0TA 2H1CA 4CMAA 2IZZA 2AI3A 3ABZA 4EENA 2JGFA 1XTVA 1JAYA 1F9AA 1JEJA 3OJXA 3RG8A 2FEMA 1GZHB 5DN6D 4X20B 3VR1A 3PKIA 1KKLA 1IXRC 3SIPA 3TIFA 2NG1A 1Z12A 4UE3S 1ML4A 3ZLUA 2ZTHA 4LSMA 2JRLA 3P9CA 3A58B 1XDBA 5F78A 3CJTA 1DHTA 2JHFA 3VBEA 4YO8A 4C6TA 2NTEA 3ML1A 5K3FB 4F1KA 1R0XA 4X3OA 3O91A 4NDAA 1QHYA 1WW8A 4LZZA 4JCCA 4I8XA 3AONB 1JWLA 1T9GS 4F12A 1KSGA 1RTTA 2WU4A 4KLCA 4L5CA 3DLHA 2O1XA 1NJ1A 1Z08A 1VHDA 3H3FA 3KFVA 3R3XA 2O8DA 1H2ZA 1LBIA 3KTDA 4RGBA 1TMYA 4TN5A 3AILA 1CDOA 3IILA 4WNIA 2M6KA 3RC7A 1WE2A 4QJIA 2C77A 1I1OA 2B3DA 3PVZA 4CXMA 3LLCA 5FL7D 2K5UA 2Y1EA 1PJLA 3KKMA 5G40A 3LQFA 4QXOA 2D8MA 3CX3A 1K98A 2VL7A 1BCSA 2AMFA 1NULA 1ZW1A 4PN7A 2C8LA 2X3UA 3F74A 4ZODA 3LIIA 1KMIY 2GSWA 3K0KA 4OXQA 5JALA 3ZY5A 4UTXA 3I61A 2XE4A 1RAAA 3K9WA 1N2EA 2BEVA 1A96A 4DCTA 1G7SA 5GGYA 1FRQA 2PQMA 3BF8A 5ADUS 1FYWA 5DMHA 2YVLA 2B2XA 4D41A 5CFQA 1RWOA 1Z5ZA 3AP2A 2A7QA 1PJ2A 4JEHA 4UDNA 1MXHA 1I7DA 2FPMA 2P3LA 2OORC 4IEIA 4RH0A 1H6CA 1B43A 2JFOA 2G8LA 4P9NA 1DUVG 3TECE 1T9ZA 4TV9B 1XALA 2I7CA 3CUVA 1IXSB 2CXNA 3IEUA 3HCWA 3B12A 4NULA 2H7XA 1TUBA 1DIGA 4KGVA 4LJYA 3PNMA 1E0JA 1WKVA 1YQ9A 1SCUB 1SVUA 3E5NA 1B15A 3N6XA 3FUVA 4HQLA 5JWHA 1JQAA 4CV0A 3RRMA 3HHEA 1EG2A 2A84A 2AN1A 3WFIA 1OYWA 4MRNA 4CZ2A 1TDJA 3R40A 2J9FB 3EBPA 5C4GB 3EXIB 1E8MA 4KV9A 4CLXA 1BE1A 4NOLA 4Q82A 5KO2A 3QUBA 1QFSA 3P71T 2FR8A 1KI4A 5K4AA 2PRSA 3N70A 3UHPA 4CQNA 1FRFS 5AVRA 1EBUA 5FOQA 3N0TA 3AGPA 1BGXT 1XK7A 4IXDA 2WTEA 4MI1A 1M2HA 4ZARA 5KVQA 3KD2A 1W36D 1DWOA 2ZT6A 3USCS 5KPDA 1D4ZA 5EJFA 2VK4A 4LXHA 1O5TA 4QASA 1E1MA 5CB4B 3I1YA 4B6GA 2WUWE 1SB8A 3N2LA 1SUDA 3IVCA 5AYVA 4I3GA 1U9JA 1KVTA 4XYEA 3NVAA 1AA9A 2IZ7A 2LBPA 5A6SB 5E3JA 1OH7A 1ZBDA 3OT5A 3VVBA 1NVUQ 5M2QA 2XH8A 5HFAA 4F6CA 3L4SO 1DTWB 1H9AA 2P4SA 2GVZC 1A5SB 3OHPA 4BMDA 1M8FA 2FPLA 3HSSA 3LQYA 4WESB 4M1EA 3RI3A 4AY4A 4B3CA 4L8WB 2IS1A 1Q6YA 1EHYA 1IUOA 4D5GA 3K8OE 4QNMA 1GZSA 3HH8A 2J9YB 4NPAA 1CDDA 2XTAA 3CE6A 3IUYA 1XZQA 2V7XA 3WGTA 2GDZA 1GRCA 4S0ZA 3VDMA 5J58A 2VRCA 5DNEA 4JI4B 3TVDA 2XVZA 3KPJA 2G9UA 4WEQA 3V1KA 4GFDA 4EABA 1KE2A 5BWOA 1GFWA 5AM4A 2QJOA 2ZU6A 3EJ6A 1Z4PX 1U7OA 1A8IA 1G4AE 2Q8NA 4D9FA 3F98A 3JQPA 4Y2GA 1IUNA 4U9IS 4ZP1A 3A06A 4EOGA 3I76A 3MT7A 5J3JA 1ENOA 1GYRA 3FMFA 2B7LA 3K72B 1NMQA 3EVBA 4RF3A 2INGX 3UN1A 4MH0R 3TTWA 3R4VA 1MZVA 4EG1A 3O0TA 3KSRA 3HA7A 4FOOA 4L3OA 2J46A 5BRJA 1XB2A 5K7SA 2BZ1A 4IKOA 4PTZA 4DT1B 1XZCA 3V6MA 3VKWA 1RP1A 2B5VA 2ODWA 4BV3A 3DOCA 5AKHA 3RJ5A 2D7JA 3K94A 3QKRA 5D7NA 1ISJA 3E05A 1AZLA 4ZXPA 1RLUA 2IHJA 3CZRA 4ARUA 2PBRA 2PJUA 4L4UA 521PA 4R1UA 3KQHA 1JT2A 3C41J 2IOYA 2DGDA 2PKYX 3SXUA 2I65A 4BNKA 1PZMA 2VPYA 4DV5B 1R9NA 1E2UA 5HPYB 1YT5A 1CR0A 2ZUVA 4LRXA 4ETWA 1X1AA 3IGFA 5ADWA 1EUYA 3X1KA 1HWYA 1Y5LA 4K87A 2W93A 3HN7A 4DLUA 2ZUFA 1CUVA 2CSUA 1R37A 1RRFA 4ZIRB 2O2JA 1VCOA 2VRNA 2Z1NA 5GV7A 5JCZA 3EWSA 1GZ4A 2GF0A 2FCRA 2YXDA 4OMFG 1MX3A 2P0YA 3BDVA 5BT9A 3DLBA 1FC0A 1T6BY 2HA0A 4MDYA 5KYVA 2AMVA 2NPFA 1EB9A 4MVJF 2GPSA 1WBJB 4EQZA 4KHPB 1O6GA 4Q9HA 1E7RA 1CUGA 1YD7A 1MC5A 2HJRA 2J4FA 4QNNA 2IU3A 5I01A 2PUWA 1IY2A 2W6PA 3A27A 1NI4B 2X14A 4M9QA 4PQYA 3FVQA 4HQ0A 2QVZX 4QPNA 4UMDA 3ZTYA 3G2MA 1B74A 2Q4EA 3S99A 1L5SA 3VJLA 1K4KA 5BSTA 2Z56A 4BMXA 4RVCA 4JXXA 2FX3A 4TXNA 1X8XA 1V11A 1LK5A 4A8JC 2BEKA 3AEXA 4FWBA 4Y9UA 1BDHA 4DDWA 1GTMA 3BEOA 2OD9A 3KAPA 2YWGA 3OFVA 5IU6A 4HS9A 4ZVMA 2QTMA 4F84A 3SD7A 1SZJG 4A4DA 5B4TA 4AN0A 3L7OA 1UC5B 2PM8A 1ZN7A 2WABA 1CETA 4PSVA 1N9KA 2ZOSA 3VKHA 1Q91A 3EG5A 1M1UA 3LHKA 4LYAA 5JS2A 1D4OA 2YNMC 1YFKA 3ZU4A 3K30A 5D01A 2Z43A 4KYIB 4F21A 4Q4JA 4E6EA 2X5OA 1ESCA 4B3XA 2NSYA 2WUEA 4QM7A 3UHJA 3DTVB 2D2IA 4P80A 3OO0A 4YV0A 4FHZA 3DZCA 3WIBA 2JEYA 1GR1A 4HAVA 1LSJA 3W3ZB 4LXIA 1AA6A 3H9BA 5DX1A 1DAEA 5HKAA 5ALHA 8MHTA 3LP6A 2QBYB 4B6EA 4X94A 1H4VB 3DPSA 4DLBA 4QIHA 3TOSA 5C80A 3OLWA 4IIVA 3AL2A 1U4NA 3PEUA 4KPFC 2VNSA 1LSSA 1P7YA 5F51A 2UUBB 1O08A 1G3IA 3EXHB 1CR2A 4Q3KA 3B20A 3QVXA 4D8TA 2WOOA 3EBLA 4RLSA 1CE8A 2P9FA 5K0FA 4ZT6A 4DG5A 2Q1TA 2VZ9A 4J0QA 3KLOA 3TUZC 5T4FA 1ZVJA 1XJWA 2AFVA 1E3WB 2GYYA 3L77A 1PFQA 2FW7A 2NNLD 4X63A 4PAMA 1L8LA 4Q4AA 1JA9A 2EG5A 2C42A 3WKAA 2ODAA 1YKFA 1M1YB 1VJ5A 3H99A 3PC2A 1PV2A 1SM4A 4DCJA 1LF0A 1ZL2A 3IUMA 3GA5A 1H2EA 3TO5A 4BNGA 1UPUA 4UHFA 1TMOA 1CX9B 1OWNA 1XFAA 2FV8A 2PX5A 5G4KB 3SK0A 4WBNA 4XGQA 1AMUA 3KYCB 3ZHRA 3HRIA 3OUZA 5AESA 4GRDA 1JEYA 4MQFB 2B94A 3C6YA 1VBNA 3TNYA 2NP6A 3R20A 1E59A 3AEZA 2Q3FA 1VXRA 1C8VB 5K8LA 1DC7A 3OLYA 5I4IA 5FLEX 4YJGB 4LXTA 2OQRA 2XNDD 1K5PA 1M2KA 3DEYX 5EWJB 1JTEA 2F59A 1N6RA 2JVKA 1HE4A 3V7WA 2FEKA 1B1AA 3D6MA 3RU3A 4K3UA 2I4OA 3WIUA 1PYDA 1AMNA 4CTKA 1NUPA 1V4VA 5J63A 1ZJJA 4WHMA 1N6HA 1QKKA 4LOJA 3TCKA 3F3SA 1GPDG 2P4QA 2XNKA 3ZG6A 3AFIA 4B9AA 3L04A 1IG3A 1CYDA 2CNWA 3OX1A 1FSZA 5EYPA 5SYAA 1SD1A 3ZC3A 1EFAA 3R9IA 3LW8A 4NCBA 2P30A 5FUWA 5JAZA 1W2HA 4K6CA 4RHTA 3KYJB 4F2GA 4HRVA 4HNUA 3DP9A 5C4IA 2ATCA 2Q46A 4E33A 1NUAA 3C3KA 1XOIA 5FOXA 1NY6A 1IY0A 3KJGA 4BE4A 1R00A 4TMTA 3O4FA 3V8NA 4CTJA 3GFQA 3GT0A 5BY2A 3INRA 4PLYA 1OXSC 5BP7A 4ZA2A 5CD1A 4XPIB 3RSCA 3QVGB 4IXNA 1GTVA 1DJOA 4YGYA 2E4UA 5JADA 4J3FA 3O4HA 1OFVA 4E5UA 3QEMA 4A27A 3FYTA 2A9VA 5FA8A 5ELMA 2LNDA 1E4EA 1TKRA 3HCPA 4KQIA 1CUJA 5LWHA 1US8B 4W9MC 2GHIA 4EGCB 4AS3A 3QKTA 3ZU6A 2C4UA 2WE7A 3WV5A 3S2YA 2PFGA 3KOXA 4MYUA 4D3FA 1KBQA 2AOUB 1YAHA 3G2JA 4BCCA 1M34E 2D7DA 1C3EA 3SZMA 3CC8A 1FTSA 3UV6A 4FS3A 3PFCA 3KDSE 4PCAA 5HF5A 3TYXA 3L06A 1P45A 5KDDA 3G02A 1OD6A 1OLUA 2R1TA 3R09A 4HYQA 4N01A 3E18A 5KKAA 1EWVA 2ZM5A 3NPMA 2A9QA 1W94A 2JD1A 2MHCA 1T9CA 3E3LA 2R00A 3RBZA 1U65A 3RYTC 2IEAA 2PQ0A 2X58A 2OYCA 3TLKA 5A4AA 5CA1F 3DHNA 2FUG1 2G17A 4G5HA 4R9UC 4MB6A 3JWPA 3IP7A 2J3KA 2OD7A 3FR7A 4IDDA 4Y0VA 2H06A 1CY6A 3FVTA 3T38A 4G8JA 4YRCA 6GPBA 3KD3A 3R7FA 1NLUA 1HPLA 1YCHA 2IA5A 2ZUUA 4FJ0A 3FM9A 3ON5A 4IQ8A 4K9NA 4LY9A 5AK0A 5U1PA 1O0CA 4N6NA 5AW2A 2GZMA 1V35A 3L93A 4Q9DA 1ZGGA 4XTRA 2O2EA 5FBRB 3ICWA 3LC2O 4ARIA 2FZCA 1IN4A 3I45A 4QECA 3G82C 1FDWA 3GB9A 3K92A 3U56A 1FFCA 3MUNA 1P7CA 4WD3A 3DFIA 3F7TA 4JP3A 2SBTA 1YOBA 5CT9A 3UANA 1OFTA 3OQIA 2CNOA 4NWIA 4F96A 3CEHA 3OPQA 2GT1A 3DBIA 3ZDBA 2J08A 3RG2A 2O0LA 5F4BA 3ZW9A 2WU3A 4RHXA 1QC5B 1LLQA 2JFNA 2IP1A 5IWAB 3MYRA 4MYRA 4XIFA 3PHGA 3S5JA 2XXAB 1ZICA 4YUWA 1TCVA 1ZMOA 3NYIA 5HDQA 2O48X 5EQFA 1E1QA 4XX0A 1BD3A 3A1DA 5LQSA 1B26A 3UAXA 1YBFA 3O1HB 2FJPA 2RKBA 4OYRA 4R1OA 1Q1QA 2BD0A 2Q3HA 5EOVA 1V6CA 4ASUD 4E6PA 3CNBA 1NM5A 2W6JA 1XA4A 1YC5A 3CKLA 4YPOA 4BIIA 3NQ41 4JJIA 5K6AA 3L40A 1W1UA 3L0CA 4BFTA 3ZDDA 4DJAA 4E88A 1T4CB 2WWFA 4XR4A 2CVHA 4DMHA 4YAKA 3RVNA 1I4OA 1ZM7A 2I6QA 3TZCA 3NORA 3R75A 4YROA 1Z28A 1FRZA 2D6FA 3BL6A 5A3SA 3PDCA 2AJCA 1P0PA 4PIPA 3WFZA 4Z4CA 5AKGA 2EQAA 1NR1A 2DWPA 4WZAA 5IJ9A 2NVUB 2DETA 2ZVPX 2N46A 5IS2A 1I80A 3EXEA 2BN4A 1EJBA 4BP3A 2BBSA 4IIXA 1P4HA 4DQVA 4ESVA 2O57A 3TB6A 1I4WA 1YZGA 4TRJA 1BEZA 1VLMA 1WHTA 1Y5RA 4C4TA 3TTSA 1JDVA 5CYGA 1VP3A 1WA5A 4D82A 1N7GA 4ZQGA 3K70B 2PH7A 3KOWA 4PC3A 2QQGA 3K3PA 3K1AB 1B8VA 3LKVA 4RU1A 2ZW9A 4IG4A 1KH1A 2QJWA 2G70A 2HNBA 4YIHA 1PGQA 3HO8A 3CGGA 3H2IA 4TT3A 4GPBA 2Q5IA 3BFXA 4BEWA 3N3AC 2VRBA 2PZ8A 3OZXA 4BX9A 4F9GA 3A9UA 1PX0A 4YASA 2BGWA 1XTRA 3U4AA 2FSUA 1UIRA 4ARZA 4MITA 1WXIA 3ZZ0A 3KO8A 2IT1A 1CPYA 1E9VA 4MHTA 4BNWA 4WDQA 1ZD4A 1DAFA 1LPBB 4M8KA 3DZ8A 2WA2A 2G4LA 2VHZA 5KU1A 1GCAA 2D0OB 3PFBA 4RANA 2ZIVB 4UTPA 3M34A 3FX2A 4X41A 1RR6A 3J80A 1KSFX 2H1IA 1FFBA 1RWMA 4NYIR 3SQDA 2WF7A 1X7HA 2JHGA 4OU5A 4AJLA 4D6YA 1Z5VA 2NTVA 3JD2A 3TQFA 4BVAA 3IP3A 4WT7A 3LWZA 3R8XA 4ER5A 3FCCA 4DG9A 1H65A 5A5DA 4OHBA 3C7DB 5HUHA 1XZFA 1PZNA 3AOGA 5ICMA 4GE0A 5M5BA 1WS6A 1XUOA 1OFUX 3C8UA 4DRYA 4P35A 2IIPA 2XOKA 4XA8A 4JI6B 3MOGA 4KRXA 1ZRNA 4CMEA 1Z2EA 5D3MA 1E8DA 4HTFB 1VKJA 4O2LA 4Z9BA 4ENSA 1E6CA 3FWHA 4LJLA 1NOIA 4HLDA 2XNJA 4MQ5A 4BJ6A 2E18A 3C6MA 1J42A 5DGCA 3WNQA 3C3YA 4X7PA 1JG6A 4K6FA 1WMBA 3TQIA 3EY9A 3QWIA 2QUZA 1JLSA 2GD6A 3M6AA 1IZ0A 2DFKB 3A9VA 1A9TA 2DQYA 3SHFA 1TLFA 3HEBA 3SSMA 1CUFA 1YS4A 4UHJA 5B6IA 1PUXA 1Z7EA 4GX1A 4RHCA 3DWIA 2P79A 3QKSA 1QIFA 1T8WA 1II9A 1KDZA 1TEZA 2ACVA 3M1LA 3MS7A 4PIVA 4R5MA 3LU1A 2BGGA 1R0CA 4AKTA 4DBLE 3FCSB 2Z0MA 2IE0A 1R12A 1SEPA 4C76A 4CM8A 5TXGA 3U44B 2AHOA 1NM5C 3EDYA 2UUCB 2FF5A 4GBJA 3S8YA 1Q14A 1SBTA 3G0IA 1THGA 4RVOA 1Z8DA 3EIFA 3V2UA 4UEQA 2NU7B 2R8OA 3WLAA 4BJ3A 2X42A 4X1YA 5KNCA 1DEOA 1OLOA 1EDZA 1XLWA 2P9CA 3G68A 3IA2A 4PZ0A 3EUAA 1P0QA 3RYFB 1MAUA 2LKCA 3IODA 3KJEA 3LRXA 3RWMB 4R1NA 4KAFA 1H8ED 4J2HA 2WJIA 1VMAA 3QI2A 3I01A 5AR1A 3V1MA 2QE7D 4JLBA 1WBBA 4HLCA 1TAHA 2VAVA 2DY1A 3EGVA 1IN8A 3BE5A 3IT0A 4PXSA 2G7ZA 3B1XA 2O8CB 3PTAA 2JJ8A 4L5IA 1MW8X 3VQTA 1NL3A 2CMFA 2P0AA 4XE5A 3H2YA 3DAHA 1KETA 2CNBA 2HQOA 2IZ6A 2J3QA 3KYDB 4KNWA 4V2IA 1FDSA 1ZIDA 1SC4A 3EQ6A 1PNTA 4ZOCA 1TZ2A 2PANA 4I9HA 1BQ3A 1ZMBA 2XOXA 3H5RA 3UK2A 4QZVA 3EMBA 1VA5A 1ONNA 2EEZA 3GGGA 2GZ2A 1TPZA 4DR3B 1CUXA 1CUWA 4NZPA 3T5MA 3W5BA 2PBFA 2XLBA 4B9EA 4B80A 4DA9A 4KFTA 7ADHA 2DECA 3Q3IA 2IBMA 4D02A 5F23A 3KJHA 2B36A 3GAFA 1IHDA 1NVMB 4CIVA 1Z2CA 1QH8B 2ZRCA 3LDUA 3RSOA 1P3JA 4KK3A 3UGKA 4WNAB 1M8JA 1KZYC 3N87A 4MJLA 3VKGA 2RBGA 4KFSA 3V2HA 4DLZA 3OAAA 3RS4A 1FF9A 5LP6F 2WP0A 1XCGB 2CLOB 4LV6A 4Q9AA 4QTTB 1PTJC 3IX7A 4NCJA 3G2IA 2MJLA 5HCUA 4HH3C 4M0KA 3KKLA 3DHVA 5CFOA 5CX1B 1K9VF 2QMYA 1F17A 1PL8A 2GXAA 1XCPA 1ZGHA 3OP1A 1I4EB 5KTNA 2VEOA 1C0EA 3T7DA 4DV7B 3RAFC 3ZH2A 3FYDA 3H7IA 4PIMA 3A0RB 4R98A 2JIOA 3M49A 1Z6GA 1EP1B 4GPD1 4TV8B 4F06A 1KP3A 3Q5EA 4PY2A 1ECPA 2EWMA 1E6WA 1Q0RA 3Q3GE 2CJPA 2X2PA 3MS2A 5CT6A 3VC1A 4A92A 1AHPA 2EERA 5BQPA 1B73A 3ELWA 3USES 1Z25A 2W2NA 3JWHA 3OLZA 1UMKA 2QMOA 3LX5A 4KO1S 3MBIA 1GZVA 1Z45A 3BA6A 4H3KB 5DH9A 3V4SA 1EVQA 4C4XA 2WTNA 2PZBA 1RBYA 2QVYX 2Y9PB 5HRCA 4FFLA 4KIUA 4P3XA 4CMEC 2R48A 1THMA 3EF1A 3SX2A 4B0PA 2CKDA 3HP7A 3W5UA 1NF2A 6REQB 5A7HA 2VP3A 2WSMA 4DKJA 3MWEB 5FCDA 4CJXA 4UOQA 1E2MA 4EF5A 2EJUA 4GVL