4KR6A

Crystal structure of a 4-thiouridine synthetase - rna complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
388
structure length
388
Chain Sequence
MEELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA sulfurtransferase
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/rna
total genus 132
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr6A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr6A02
4MW0A 2PZAA 1IVSA 4HJXA 4JXZA 4L2IB 1EE1A 1O6BA 4MW5A 5TS2A 1O5TA 1WXGA 1X6VA 1OWOA 1J1UA 2A4MA 1OWMA 4MW6A 1OD6A 4MUNA 3RJZA 4PBTA 3HZRA 2Z3VA 3INNA 3ZIUA 1QNFA 4RUKA 3K0BA 1MAWA 1O96A 2PG3A 3D6UA 3DO8A 1IQRA 1YULA 3FI0A 1M8PA 1MAUA 2RE8A 1WJGA 1JGTA 1N2JA 2VXOA 3M5WA 4DNXA 4YP5A 4U7JA 2HMAA 1G59A 2J07A 2WQ7A 2RD2A 1N75A 2WB2A 5HG0A 1J09A 3H99A 2YWCA 2CUZA 2CYBA 2ZP1A 4NDAA 4OUDA 1JILA 3UK2A 1OWNA 2QTNA 2GOYA 3KT0A 2A88A 1J1ZA 3IMCA 2ZUEA 2QUJA 3LDUA 2C5SA 1Y42X 3AG6A 4KR6A 3C8ZA 4EG6A 1QRSA 4ZCPA 5TEWA 1VBMA 2QUKA 4YBRA 4MUGA 3GUZA 1KH2A 1JEEA 3G6KA 4JYZA 4J76A 4WSOA 1JECA 3CLTC 2A1UA 1P7PA 3A04A 3IH5A 4KPUB 1KP2A 1KQOA 1YUMA 1T9GR 5KCMA 4HK4A 3VGJA 4ZT4A 1JMVA 1Q15A 3P0HA 2E18A 3LE8A 4PY2A 2B7LA 1NSYA 3ND6A 2PZ8A 4MUIA 2A1TR 4MW9A 4EF6A 3CLUC 3H05A 2QUHA 4A91A 1ZH0A 4MQ6A 2BTEA 3KT8A 4MVWA 1O97D 1JIKA 1WXHA 2YWBA 2D13A 1H3FA 3TQIA 1KH1A 2E0IA 2A86A 1HYBA 3Q4GA 3FY4A 4MVCA 1N2OA 1CT9A 3RBAA 4ND6A 1MB9A 3OTWA 4EGAA 4I6JA 1JIJA 3S3TA 2AG6A 3QTBA 2R5WA 5K0TA 1WQ3A 1B6TA 1IRXA 2DPLA 2XRYA 1D2RA 1F4LA 1JEDA 2JAXA 1J21A 3TM5A 1QRUA 1MOPA 4HJRA 4S1OA 4QRDA 1XNHA 2NSYA 1N2BA 1PFYA 3CLUD 4DE5A 3ZXSA 1KH3A 2NZ2A 1GAXA 3FOCA 3IMEA 1KP3A 3ZJVA 4QREA 4I6EA 3IUEA 5AHWA 4X0EA 1Q19A 5FNZA 3N8HA 2G36A 4Q93A 1NUSA 4DJAA 3IVGA 1IQ0A 3SYTA 1FYDA 5HUJA 2BYTA 3X1JA 1IQUA 2AKEA 2ZUFA 3OP1A 5LM3A 4FZJA 4Q16A 3PNVA 1GLNA 4BWVA 2WSIA 1JHDA 4MWCA 3VU8A 1EFVB 1J70A 1A8HA 3IOBA 4GU5A 2I1LA 1G8GA 1WQ4A 4CDNA 4NATA 1G8HA 3PRHA 3AFHA 4DDMA 1F7UA 3TLJA 1BS2A 1EFPB 1N2HA 3KFLA 3CLSC 4XFDA 3PXUA 3NBKA 1H3NA 4MW1A 3TS1A 1N2IA 1LW7A 2EL7A 5H16A 3MUEA 4MULA 4MW4A 2QUIA 1J20A 1PFVA 2H29A 1K4MA 3HGMA 4ARCA 1NUQA 2CT8A 3F3MA 1QU2A 1MRZA 4E1AA 3N9IA 4MW7A 1TYBE 1H3EA 4UZFA 5DK4A 2IJGX 3I05A 3FHJA 4DDKA 4YMIA 4JXXA 2EJCA 4MUEA 2DEUA 1O96B 3IOCA 4HPWA 3SP1A 1QJCA 1ZJWA 1RQGA 3ZJUA 4YP7A 3V97A 3AKZA 1U0BB 4I6GA 2CV1A 1M8GA 4KPUA 3L93A 4MWBA 2CV2A 1X8XA 3LDGA 4J75A 4EG1A 3E27A 2QTRA 3FIUA 1O0CA 1JZQA 2DR2A 3P0IA 2J08A 5HUHA 1WXIA 5TGTA 5J58A 3KT3A 3TMAA 4MWDA 2H2AA 4ZT3A 3MLAA 4WNYA 3TQOA 2TS1A 3ZXIA 4CQNA 4R2MA 1WXFA 3FETA 1TYCA 1O0BA 2CSXA 4EG3A 1S4MA 1ZH6A 4ARIA 1TYAE 1PFUA 1SURA 1WKBA 1OWPA 4P2BA 1MBZA 2VTBA 1V47A 3X1KA 1N3LA 3CLRC 1PFWA 1TQ8A 2Z08A 3CVXA 1YIDA 3CVYA 2J09A 3D6VA 1ZUNA 1KKUA 1WOYA 1O95C 1NUPA 3TM4A 4ZT6A 2DERA 1IHOA 2O5RA 1N78A 3RHSA 4MAFA 4QBTA 3NBAA 1NYLA 1G8FA 1I6KA 3MLBA 1EUYA 1QU3A 1WXEA 2J4DA 3CLTD 4MUHA 3X1MA 3NV7A 3U1VA 3G59A 2YXNA 3IDFA 2CYAA 3COWA 3V8VA 2JANA 4GRIA 3SZGA 1VBKA 5K0SA 3CVUA 3AG5A 1KQNA 5JBNA 4ZT2A 2DUMA 1KAMA 4NZPA 3ZJTA 2X3FA 3Q12A 5KHAA 5BNZA 4L2IA 1JZSA 3H9BA 1COZA 5IJXA 1U3CA 2Z09A 3CLRD 3SEZA 2D5BA 4MW2A 3SZ3A 1T6XA 1QQTA 1N77A 1O94C 3UY4A 1TEZA 1YI8A 3GLVA 1O95D 4CT0A 1OBHA 3ZUGA 4R2LA 3IVXA 4PBRA 3QTTA 1K4KA 2CFOA 4F4HA 1M8KA 2CV0A 3DPIA 5DASA 3GMIA 1KAQA 1K97A 4EG5A 5DEOA 3CVVA 5LLTA 2PIDA 3FG9A 3IUBA 2AZXA 3DLAA 3VRHA 1EUQA 4G6ZA 4JZYA 2JA2A 1T6YA 3P52A 1GN8A 2PFSA 3H97A 1EXDA 1TYDE 4JFAA 4EG8A 5J5AA 4ZCSA 3TNJA 3IVCA 3UOWA 1N1DA 3RFFA 3Q10A 4K0RA 3UMVA 2A7XA 2XRZA 4KR7A 2J5BA 5EKDA 1O94D 4MUKA 1M8JA 4KR9A 4AS1A 3SEQA 1R6TA 1JIIA 1OWLA 1IFXA 4MUJA 3BL5A 4AQ7A 4UZEA 3LOQA 4KKVA 4CDMA 3FH0A 1NI5A 4NX2A 1R6XA 2CYCA 4EG7A 1U7XA 1MJHA 3LCJA 1GZUA 4MVXA 1I6LA 1R6UA 1XJQA 3HMQA 1UFVA 2E21A 3PNBA 2GM3A 1T9GS 4U63A 4R0NA 1OBCA 1N2GA 2DLCX 1NUUA 1Q77A 3QE4A 4EG4A 2QJOA 5KWVA 4U8HA 2QTMA 1M83A 4G5YA 4RPIA 2A1TS 1VBNA 4ZCTA 3JXEA 3CA8A 2HGZA 4MLPA 1I2DA 1U3DA 2A84A 3CLSD 3TZEA 4XFJA 4DDHA 3AL0C 1T6ZA 3AIIA 3FWKA 3ZGZA 4ZT7A 2IP1A 1YUNA 5LFAA 3ND5A 5FO1A 3K9WA 1LI7A 4K03A 1I6MA 1XNJA 1TFUA 1VL2A 3A4IA 4OUDB 1M8FA 1YIAA 1ULHA 1IH8A 1MB2A 4ZCRA 2WQ6A 3RK1A 3CVWA 3MMXA 4TS1A 1F7VA 1O97C 1QTQA 1Q11A 1LI5A 3FNRA 4MVYA 4ND7A 1KR2A 3L92A 2QJFA 3MXTA 5F23A 1EJ2A 3HL4A 1VLHA 4ZT5A 3RK0A 1KQPA 1DNPA 3TZLA 1NUTA 1ILEA 2X0KA 5FO0A 2OV4A 3P0JA 3KT6A 3ND7A 3HV0A 1F9AA 3IODA 3FDXA 1WZ2A 4NAUA 3A05A 3G5AA 1NZJA 1XNGA 2DXIA 2A1UB 5H7XA 1N2EA 3ELBA 2V0GA 2D54A 4H3SA 1U7DA 4DLPA 2PZBA 3ISJA 2YY5A 1GTSA 2HZ7A 2PXHA 3K32A 3UC5A 1KORA 1K92A 5TEVA 2VTBB 3HFJA 3COYA 1V8FA 3IMGA 4XSVA 4EFKA 3COZA 5IHXA 1FFYA 4MWEA 1PG0A 2OQ2A 4OJMX 3PNYA 1MC1A 1GTRA 1EFVA 1M1ZA 2E89A 1H1TA 1GPMA 1WY5A 1PG2A 2IELA 2O8VA 2X1MA 2QJTA 3COVA 1QRTA 4PBSA 3H9CA 2DETA 5J59A 3N2YA 1EFPA 4ZCQA 4MUFA 3CR8A 4F3RA 3DV2A 3ILVA 4YP6A 4G5FA 1NURA 3N05A 3IOEA 3SDBA 2X1LA 1NP7A 5DB4A 3A2KA 4NAHA 2GKSA 2V0CA
chains in the Genus database with same CATH superfamily
5BY2A 1RZ3A 3CINA 1UBFA 1LX7A 3K94A 2W2QA 2WM9B 2WMYA 1MX3A 5KC9A 2BFBA 2QR2A 3QXGA 3FPCA 1VRWA 2EFJA 4U2FA 4W1RA 4A6PA 3Q88A 1EQAA 1VSUA 1A97A 1QBGA 1DHTA 2FEOA 4GC9A 4R8SA 4AWAA 2BM9A 5KX5F 1V3QE 2OB2A 1GUYA 2Q8QA 3TQSA 3JAWB 4MUNA 1UKAA 3CEHA 4KLAA 2OHIA 2PT5A 4FMCB 5LZ9A 3QW4B 1QNFA 2O6HA 4GSYA 5JSZA 1JDJA 1O96A 4UMDA 4C21A 3MQ4A 1T9CA 1I24A 4OFBA 5KTMA 1H65A 4MRMB 5A4IS 1ZDMA 4FFPA 5IRCD 5LIPA 5C5DA 3VC1A 4WHMA 1A4RA 1NXSA 2AK2A 1U0JA 2JIDA 3IYLW 2QDXA 3M5WA 1LRLA 3FSGA 4G1UC 4N5MA 3WLHA 5A5GA 5LKRA 5HCIA 4KLCA 4MYHA 4A26A 3LY9A 2ZBPA 3UXHA 1L7OA 5F1YA 3SYNA 1Z74A 3OT4A 2QVGA 3RG2A 3RUPA 3EWAA 2FU5C 3VVMA 2CYBA 1B1AA 3IEVA 4RVNA 4PZUA 2ZP1A 4OUDA 4C4XA 3UWOA 2WHQA 1ZRMA 3PC4A 3LYHA 1Z68A 3DFUA 3OEYA 2PVCA 4COKA 2PRSA 1JQKA 2JASA 2X22A 4EUHA 1T5TA 3OY7A 4HNAB 3UHJA 2O07A 3U7RA 1E9CA 5B1SA 4D4HA 1N5LA 1U5AA 4X9XA 2HIAA 2JHAA 3VHXA 1W34A 4JMPA 3QKSB 4C4YA 2J3LA 4B6GA 2FZCA 4PSDA 1PGNA 2Q07A 4Y1EA 5IK2A 3SNKA 3TNDA 4FFNA 2D6FA 3LPDA 5BNWA 2GCOA 1J7KA 1MG0A 1NSTA 1OAOA 2IPXA 3A11A 3G6KA 3HH8A 4X63A 1LC0A 1T3TA 3CR3C 4EJSA 1FL9A 4N9QA 5TX7A 1L8QA 4A6EA 4BGEA 5DKFA 5FWXA 1CQJA 3LUAA 4LHYA 3A1EA 4J1QA 2C9ZA 4UNSA 3NONA 2BMJA 3QVTA 4BNDA 4EYSA 4B75A 1QPZA 1K7FB 3A04A 4DVJA 2MINB 1IXKA 1DEKA 2FSVC 3N8GA 1GFWA 4D6PA 5TE9A 1PR9A 4ALKA 3L05A 1VCOA 1KY5A 1GAWA 4ZOCA 5ARDA 4DDWA 4K46A 5F3RA 4EWLA 1NN5A 3EZYA 3RDPA 5EHNA 1PT8A 5CFLA 3N7TA 4Q7MB 1Y4ZA 3GUVA 1NBMD 1QHFA 4PXYA 4WBXC 3TX2A 3ZWWA 1NR7A 2XE7A 4RADA 3HHPA 2J3EA 3VVCA 2WY2D 4B3MB 1WKCA 2RI1A 4BE7B 3OE5A 1UBEA 3AR4A 2X8AA 2VOJA 1A5BB 4ZHQA 4FFBB 4EUEA 4FFOA 4LF7B 4MV8A 1O97D 1B42A 1WXHA 2PWBA 3P4XA 5C4IA 5K8VA 4BFZA 1NNSA 3FGOA 3AYXB 1J8YF 3I32A 3P9PA 4OXQA 1E2UA 1GZSA 1HYBA 3E53A 3VOSA 4RHYA 4RTQA 3OI7A 3FB1A 3JWIA 3WBFA 4DQLA 2ZDGA 1XZAA 4Q9AA 3A58B 4OBXA 5BRAA 1DTEA 1TVCA 3MTJA 8GPBA 2J9GA 3TOVA 2VH5R 3PXBA 4FXPA 3U4QA 1KVSA 3GJ7A 2PQ0A 1EUDA 2X6TA 2AR9A 4C2UA 1JJAA 3TSWA 1RWBA 3MM4A 4L4XA 4N9WA 3WLEA 4BV8A 5EC8A 3FBTA 5HF8A 2NX2A 3JS5A 2BHNA 1G2OA 2NT4A 3IUQA 2CUNA 3WL3A 1N4AA 2PRZA 2YZ7A 3K2EA 4G8JA 1GCOA 2JA1A 3TM5A 2K6GA 2YWEA 2JGIA 3SYKA 1NVEA 1M5UA 2IY8A 1VKHA 3KZKA 4QC2A 1NDUA 2Z2JA 2HCFA 4RFSB 1Q6ZA 1ZNXA 4IH1A 5DWQA 4QQFA 3SFTA 4UEWA 3W6OA 1JR6A 4TQAA 3KR9A 4D3ZA 3QTLA 4S1PA 2OQVA 5KSOA 3EFHA 2BOVA 3VNBA 3TCNA 4E70A 5DNUA 2ZRPA 2XWPA 4H4CA 4J0JA 5K3FB 2D0DA 3THRA 2LCIA 2B69A 4Y0NA 2F06A 4QE3A 1N9GA 4ZTZB 1HO3A 5FNZA 1MPTA 3N8HA 4XB1A 3CX7A 3K1AA 1T8TA 1F17A 3T1QA 4CM9D 3Q8KA 3B1YA 1U99A 1O9BA 3PLNA 5B64A 4BKOA 4GI5A 4HN2A 2M6SA 3KYCB 4H08A 2IHKA 4IS3A 1E7SA 1DCKA 2UVPB 3I2JA 3IR5A 4FZJA 4Q1DA 1O8BA 3KE9A 2BKVA 1XWWA 4LYGA 4EY4A 1B3BA 4URZR 3H5IA 1ENPA 3L6EA 4JCCA 5JLAA 2JAHA 3L0YA 4PAQA 5F12A 2P40A 3LRTA 2QKYA 5T4EA 2GFHA 4W6ZA 1X7GA 3H1GA 5BT8A 1KJZA 4MJXA 3VU9B 4JQOA 1ZS9A 3UMBA 3TBFA 4BKMA 4GKKB 2W5UA 1GUAA 5IHPA 4HMOA 4IIFA 1R6DA 3AR2A 1TAHA 3A6DA 1YQTA 5C3MA 5T3YA 1NOIA 4UMEA 3V8PA 3E15A 3MRSA 4E1VA 3OIYA 3TQTA 3FPLA 5IWCA 1I2ZA 4UUAA 2PZLA 5CW2A 2ZE6A 3IDOA 3PT9A 4H7HA 4LK2A 3R3XA 4MS4A 4WXYB 4B83A 1IWPB 5D51S 1M1XB 3BH0A 1GPNA 2FSUA 2JDIA 2XBMA 5FBWB 4JR2A 3GLFE 1ENZA 1D2AA 2CLKB 2O2HA 1H3EA 3NKVA 3E23A 4WOBA 3TIGA 3TPCA 1SC6A 1XD2B 1ZHFA 2PUWA 2WZCA 3CNOA 2PMFA 1WRBA 2P69A 3JVUA 4XTCS 3BG5A 3RAGA 3X43A 1BW9B 3FCOA 1MGPA 4YMIA 3RTEA 2JRCA 1UM9A 5HYVA 2X0FA 1AE1A 2QZPA 1Y8QB 3PI7A 3JQAB 5COAA 1FOEB 1JG2A 1TJPB 4F56A 4IF4A 2O19A 4KPUA 4MQFA 4AL4A 3IHTA 1XCBA 1UIMA 2KBFA 3QEKA 4JT8A 4P1ZA 4A92A 2YMLA 4UJ5A 1RJDA 4OQEA 2CNLA 1XN1A 4RIEA 4Y2YA 2NZJA 5DWDA 3F1KA 2QGFA 3EEFA 1PHRA 3IAEA 4G1MB 3CUUA 2WD9A 5KHOC 4AKIA 2BJVA 4AYXA 3SM3A 2Y67A 3ISVA 1ZXXA 3D2LA 5I7AA 3VJKA 4K8OA 1G8KA 1VYVA 3NBUA 4LXGA 4UOQA 5TGTA 3Q15C 4U1RA 4MWDA 3VOBA 4F85A 5ERYA 1J23A 1ORDA 1XU7A 2Z98A 4CE6A 4CLOA 4EECA 5KU1A 1RWWA 1M33A 1NIJA 3QH4A 3BWMA 3NOVA 3D6JA 4ZDJA 3BJEA 5LCXA 1S4MA 2OENG 4NECA 1SR8A 1E77A 5AOCA 1YTLA 2PPLA 5B2ZA 3OVMA 1KDZA 4D0GA 1RJWA 1Z4PX 2IPMA 3EXG2 5FTKA 3CVYA 1CQZA 4A0FA 2ISCA 4M37A 4TMZA 3JZAA 4KOEC 3A25A 2RHMA 2XLBA 1KTVA 2FR8C 1DBSA 5CT4A 4MPRA 3I64A 1B73A 4BAUA 3G2LA 2AXPA 5EUBA 2IUUA 1RAFA 2FX2A 1Q17A 4E88A 1HNWB 1U3TA 1G8FA 1K9VF 3V4FA 2HXGA 4QDKA 3DT9A 2J4DA 1NP6A 1U7HA 3LY8A 2BEWA 3PWKA 4WADA 4ZAGA 3BVPA 3NV7A 1ZKDA 2BWJA 2C07A 4TV9A 4D6XA 4GPIB 1SU6A 2B94A 1GZ3A 1BHQ1 4Y9SA 2PH7A 1GG2A 3IDFA 2VQ3A 3JQBA 3R5TA 1SCAA 4RK5A 3UANA 3UV7A 1PJBA 2B83A 2B8WA 4MGEA 2CCKA 2ACWA 1KQNA 5MFPA 4GNRA 1ZSYA 3R6DA 4IOJA 4ES6A 1W9MA 2VJMB 4N4AA 4NFHA 4JWTA 1USVA 1UXIA 1MC8A 4QPZA 1WB6A 5DM0A 3RSOA 1BZYA 4RSHA 3ZNNA 3O7WA 4C0WA 1AMUA 3MWLA 1KAHA 3UMFA 3SEZA 4BEBA 5BXYA 3PPWA 2WIFA 1AUPA 1R4MB 4YMSA 4PYRA 4QTXA 3SZ3A 3V4VB 4F93B 3GFGA 1WB5A 1RE0A 1KHHA 3WLNA 1IZ7A 3I92A 1EK1A 1SA0A 3DD1A 4ISCA 4ARVA 3HCWA 1QTIA 4B79A 4A82A 3QJYA 1UJ4A 4FHGA 2JVJA 4N6NA 1N5OX 1J0DA 1CS0B 1MCZA 1Q0RA 2QVLA 3I3OA 4LX8A 3H2BA 1MFZA 3BILA 4U7HA 4QNNA 3VYUB 5EJ8A 2D7DA 3WL8A 1XLTC 4K6CA 1Q7GA 5KX5A 5EEHA 3AGQA 4EMUA 1RPZA 4A8JC 3E2IA 1EUQA 1GZ6A 3QI7A 4K2HA 4LJ6A 1EZZA 3DZBA 5K0NA 2FN3A 1TPZA 2C7QA 5B53A 3DAPA 3VHQA 3KQNA 4LJ8A 1MO5A 4S2EA 2XKBA 1RCUA 1ULAA 1L5SA 2GYVA 5JAIA 1NJ1A 4OFXA 3AVPA 5G1OA 2F64A 1Q83A 4DIOA 1JT2A 1XV5A 2W8BB 1ULSA 1N36B 2WP8J 1R0LA 3L0CA 2CDRA 3CLVA 1FFSA 4PGMA 2G25A 2X7XA 3TI7A 1V6SA 3OHMA 3KTDA 5DP2A 3A1FA 2RHOA 5GMOA 1P9RA 1RQLA 3B9RA 3DL7A 1G8JA 4H7PA 3PKIA 4YAIA 2JGDB 1VDZA 2IOHA 3IP6A 2PZMA 1JTVA 5IYZF 3TBHA 4IS2A 1U7XA 3BN3A 2YUIA 3LCJA 3G2IA 3GYGA 5I8WA 3K8QA 1CXZA 4R2JA 3DFIA 4QGSA 2CKMA 1PYDA 3O47A 4QBGB 1YQQA 4R0NA 3PKJA 3B70A 3FWYA 4ALLA 5CCBA 3LKVA 1P5FA 2JFXA 2P67A 1G20E 2Q28A 3O9ZA 4G5HA 4P36A 3PDIA 3JASB 4OB8A 4YWHA 2HA5A 3RTDA 4UTPA 2GRUA 4HNTA 2ZWVA 3QYJA 4I1IA 1FZTA 3PD7A 2FRXA 1KPGA 1ECFA 2IEGA 3L79A 4LF9B 1I4OA 2V97A 3LZCA 1CJUC 3EXIB 1ATZA 5IM5A 1G5IA 4E21A 4KXMA 1XKTA 3OKAA 4U02A 1J00A 1KBQA 3ETJA 5EP1A 1Q92A 1KO1A 1YMQA 4FONA 4RCVA 1GSAA 3WGZA 1M72A 3H11A 1U1DA 3G5TA 3RRBA 2OZKA 4LOHA 3J81k 4FYMA 3VOTA 5BN4B 5LA6B 2OFXA 1UMKA 1VIAA 3RRMA 5CDSA 4ZTUB 1FMFA 2X0NA 4K9RA 3WYFA 4J0CA 1FJXA 1M8FA 4GGMX 5A9TA 4ZRDA 1VOTA 2MSDB 4BN5A 3VPSA 1DXQA 1THTA 2Y9MB 4WE3A 2QUAA 5JU6A 3WK5A 2L2QA 3LVRE 1DGQA 3WLOA 3CTMA 4LNUB 4QULA 3MFQA 1G16A 2F3TA 2FN4A 2B1QA 2VRCA 1UOPA 4ND7A 5G41A 5I9SA 1EP1B 1XFDA 3GPBA 3T1OA 3MHPA 1JJVA 2HTEA 1XN4A 2YHSA 3RVSA 1E4YA 2RH8A 3PDWA 1YZYA 2GLXA 4NZNA 2ZXUA 1YZNA 2AEJA 4TKUA 5KQGA 3DKVA 4YROA 1GU1A 5TQVA 4TKLA 4D46A 1LDYA 3QV1A 3NDBB 4MWOA 3DDCA 5FO0A 4CEIA 1U0SY 1CRWG 3KT6A 3HV0A 4ZO7A 2JFHA 3QBEA 3REGA 2FMXA 1MVOA 3ZJ4A 1AUOA 5BSFA 3WGIA 1YS4A 5AVWA 1WZ2A 2JW5A 3RSFA 1PFQA 2A9RA 4G9GA 2PUEA 3A05A 1B41A 1MQ9A 3NH9A 4TLLB 2BH2A 3QW2A 3R3UA 2I2XB 2FUNB 1JAYA 1LLFA 1TW3A 2WU3A 1II8A 3U7JA 5C32A 1U65A 3IP9A 3AW9A 3KZVA 4FSDA 3EA5A 1P3DA 4LZAA 2C7PA 3DOCA 3AM1A 2LRHA 3W4JA 4RM2A 1T0UA 4IAOA 1TK3A 3ISJA 3EY9A 5FAXA 3EH2A 4Y7DA 4AM8A 4L08A 2PUFA 4BVEA 4PU0A 1WU8A 2P2DA 5H1YA 5FWAA 1JR3A 3UUEA 3KZMA 1EA5A 4H7JA 3B9BA 2G4LA 3LA6A 4MUMA 1J56A 2F1HA 5KNCH 4MR8A 4HR7A 5P21A 4E08A 3BXGA 2DHEA 3TOZA 5IDXA 1XMOB 1XNQB 3ZDYB 2JGKA 1B0PA 2O52A 3KJXA 3U7FB 4KBYA 5KVSA 3GPCA 2HWKA 1R0CA 5ABPA 5FIUA 4CNQA 1K9SA 1T34A 3T3EA 2R8ZA 3TQCA 1R0BA 3MTGA 3OQNA 3BDVA 3R8FA 4J94A 1TD1A 4CF7A 5K3EA 3TVTA 4S3MA 2SHKA 3COVA 1XF9A 2A94A 3BTUA 2BHLA 1NOJA 5AVOA 4ZD6A 3UMCA 1TMOA 4GNKA 1ZICA 1M7HA 4K9SA 4JT9A 4ZU1X 4ZEVA 3WK9A 1WF6A 3W04A 3EPHA 5ICEA 3W9UA 1NURA 3S2SA 4BHTA 2X15A 1QDEA 2WICA 2X1LA 3DMHA 4DLXA 1SVMA 5KB3A 2AXNA 2OZLA 4KH0A 4TYNA 2M2IA 3AVOA 4Z2YA 3GMTA 1RRKA 3UF0A 1WZNA 5IKXA 4JXZA 3FSEA 3LHDA 3NORA 4MI6A 1PDOA 1Z06A 3JZIA 2FZKA 5L3RA 3U60B 4YRGA 2J33A 3W5VA 2VDWA 3LC1O 4JP2A 4ITVA 2B0JA 1OVGA 1BD3A 3QOFA 2C8KA 5KEIA 3ILYA 1YCGA 1LB1B 4FKZA 4RJ2A 2JB9A 3A4VA 3TL3A 3FGNA 4OPMA 4XDYA 2HW8A 2F1OA 3ZDXB 4BQNA 4ZGGA 2I5PO 1QH8A 3KCQA 3LSTA 1KZ4A 3D6UA 4KU4A 5BMVF 1JHYA 1VJCA 4PX3A 3HGTA 1VLQA 1FSFA 1L4LA 5ALUA 1U6JA 3EBOA 1HC7A 1UKYA 1R8JA 3IJEB 4MGIR 5EINA 4PHCA 2FQQA 4PLGA 3T3IA 2CZCA 3SR3A 2Q1WA 1WTCA 1N2JA 2G4CA 3AY3A 3OCZA 1PIWA 1U0EA 3STYA 4U3JB 3LCUA 4YP5A 4G37A 4CNBA 3EUWA 3V80A 1U8YA 3L1JA 1N75A 1M2GA 5HZGA 3PGMA 1Z7EA 3WL7A 5C18A 1CLUA 1GAJA 4QDZA 5AJWA 4BNIA 2XQIA 2CUZA 3FIJA 2WZBA 3U0VA 1HE4A 5BVGB 1NXOA 4OB7A 5EUMA 5SZIA 3TIVA 4PIMA 3M7IA 4I8XA 1ODJA 2B1IA 3DTVA 1SB9A 2I78A 5JQGB 1J1ZA 3IA7A 2IYFA 3IMCA 5FQOA 2ZUEA 3OOSA 4OYYA 4P4NA 1M2VB 2GKOA 4MUBA 3EG9B 1OY1A 2A5LA 3LY7A 2JGEA 4CQMA 2WNHA 2FSSA 1RBMA 1NE2A 3BSYA 3CLHA 3DOJA 3JVDA 3L06A 5BSUA 4B17A 4B3JA 3H4IA 5KJ1A 2NAPA 3PPYA 4BQQA 1Z2AA 2OAGA 1T43A 2QT0A 1AV6A 4E7PA 2GSDA 4JIMA 4HLCA 1KJ8A 2QY9A 5IBRA 2VP5A 2CMKA 1AKMA 1WB4A 4E94A 2VAPA 4FE3A 5D87A 4LCEA 1E6UA 4CF5A 3VZPA 4XSHA 5HUQA 2C9OA 5EKUA 1GKKA 2VDNB 5BYAA 3RTCA 5HBRA 3D8UA 2ZBFA 4HADA 1YB6A 3IUSA 3PBKA 2P2LA 2YHAA 4HUTA 3HB5X 1CG6A 3ROTA 4ZVTA 2RHDA 3HBMA 1OFGA 2RGYA 3PFCA 4IFEA 1RJ9A 3WYAA 5EIBC 2HDHA 3M6MD 2ZUVA 4XDGA 2AMYA 2KSQA 3UC9A 2VSYA 4L5BA 3AV0B 2GN8A 2J9FA 4YJGB 2DWCA 1I14A 5KSPA 3WFIA 1Q15A 3ZHZA 2GESA 4MO9A 1ULTA 4EHKA 5TQ2A 5I5EA 3FOZA 3UWKA 5AJUA 3RYFA 3VVBA 3QVVA 2NYVA 1EHCA 1I1QB 1UBLS 2R8RA 2ZRHA 4HB4A 1DG9A 1BJRE 1QIHA 2ZJ6A 4B3HA 2Q2OA 4TT3A 3RNOA 2VSQA 1E20A 1FTNA 5LUAA 4K9QA 3MT8A 1A2KC 3PV0A 2E4WA 4FYYA 4D9GA 4IPTA 1PKEA 3TQIA 3ZU5A 5AVQA 2Z57A 1XXHA 1PV2A 3ZD9A 4DWWA 4GWKA 4N0MA 2TECE 2W6JA 4NH4A 4NZMA 3UK6A 2WWYA 1GIAA 3OPXA 4MKXA 1EFRD 2WJPA 5ECYA 2I99A 2IDJA 4I9HA 5B6IA 3G88A 4KNVA 4XKJA 2IZ6A 3GJRA 1AKQA 1M1NB 3L5OA 2D5CA 2JI7A 2YYYA 3M9LA 4RJKA 5DTQA 3SHTA 1FPMA 1HSOA 1F9EA 1I6WA 2XQKA 2BVNA 2I1WA 3AIKA 4S1OA 1ZVPA 1BNCA 1Y81A 1NW9B 4ESHA 2Y27A 10MHA 4IDOA 4B80A 1RLJA 1QAOA 2AZMA 3A4YA 4LBWA 3KTFA 5CH5A 1RAIA 1KMHB 3T7EA 4YP0A 3H3XA 3U3ZA 1KOJA 2JJ1A 5ELXA 1NKVA 2ZWPA 1G38A 3GQVA 4EITA 1DJQA 4MRMA 5CCDA 3B2QA 4FOPA 3OOJA 1KNQA 2GAIA 2W11A 3H7IA 4UREA 3D0OA 2O8NA 4Y2RA 1KYXA 4BZQA 5KHLB 3IVGA 3AVXA 1ZMOA 4BYGA 5C8DA 1Q1EA 5I7UA 3SJ7A 3X1ZA 5JS8A 3NZEA 4AP5A 1JKJB 1A96A 2VT6A 1C3OB 3SD7A 1HORA 3DQZA 4TUYF 1IL0A 2JHFA 2UKDA 4BMVA 2EWMA 5IYZA 3WKAA 2P62A 2WSIA 3DQPA 2FX3A 3SQOA 2ORIA 4PPQA 1HDCA 2AFIB 3TOCA 1RWKA 2OGSA 4CKWB 2C59A 1YJQA 5AH0A 1ZH8A 2W2OA 1O57A 3WLSA 4YMWA 2PUJA 2C0PA 4JJ7A 3USCS 4QDTA 2NSDA 4IXWA 4XFDA 4DBLE 1V1MB 4HNAA 1FW8A 4QVGA 2AN4A 2VP6A 5A0VA 4HYEA 1HI9A 2QU7A 4Q3EA 1IAVA 3EMBA 4WVLA 1W36C 3WHPA 2ID4A 1V4BA 1VG1A 2XQVA 3CM0A 2GWRA 3HN6A 1TMKA 1TNDA 4UM7A 2NMVA 2EP5A 5JPIA 1KSHA 4WEOA 2DTDA 2Y4NA 3BCSA 4MRAA 3WNDA 3E05A 1ACLA 1J9ZA 3DVRX 3Q3JB 3RBVA 4FGKA 5K0LA 3T5GA 5IH7A 5F4ZA 5IC4A 1B2RA 3PHIA 3QEOA 1QFSA 5HKLA 4KIGA 1P4RA 3V8QA 2PGDA 1GZ7A 4DCJA 1PEYA 1TYBE 4WDQA 4PRYA 1DVRA 1RHMA 2K5UA 4MKZA 4O4LB 3DOFA 1YR6A 2YHIB 2BBSA 2B9EA 4PPYA 1SHLA 5IJ0A 2EJCA 4FFLA 2PGAA 4QUAA 1JLLB 3DR3A 2O7RA 3ROEA 5IZCA 4HQ0A 1QJCA 1Y1SA 5DW3A 2J9XB 1C7RA 4XYBA 1DDOA 2WIAA 5UKDA 1SOWA 3V97A 1PK8A 3HFSA 1F60A 2H7CA 3JQ8B 2AYYA 5ARCA 4M46A 2OXFA 5LLSA 4H1VA 3RSCA 1VCMA 3B1WA 2JGLA 5EE3A 1W36D 3TTXA 3WYBA 5F9HA 1ZK4A 1O0CA 3CNEA 1E99A 5EE9A 4DBZA 1ZJ6A 3CH4B 2CL0X 1EDDA 3ZDCA 4KYVA 3SHOA 3O1JC 2OGZA 2ONJA 1BCSB 5DEIA 3IE2A 3KT3A 2H1LA 4L4RA 4HBZA 4X62B 3K4PA 3EQ6A 3MT7A 1ADFA 4X1IB 1DC4A 2TS1A 121PA 5JXWA 1Q91A 2HNAA 3P9KA 1J4AA 1ESNA 3RS9A 2VF2A 5EZYF 4EZBA 3G79A 4GI3A 5LMCA 3Q2IA 1BH6A 3GMDA 1FRZA 1NYTA 3ML1A 3Q5EA 1V47A 2ACEA 2OT3B 1WABA 3QBDA 3KKOA 2BC9A 4TPKA 5J1TB 3DYIA 1TCCA 1DIBA 1ZGHA 4P32A 4XLZA 2B2CA 1M74A 5CHEA 5LQCA 4V1CI 3F8WA 4LZJA 2CVZA 5FOSA 1N78A 3NCHA 3I52A 3BE4A 3AM5A 3LUCA 2XZLA 5CB6A 2IBMA 1X3SA 3QYFA 5CT8A 2HRQA 1JFFB 1RRGA 1CHNA 4I2NA 3JALB 3RC7A 3S44A 3BMXA 5EHXA 3RU3A 1Z82A 4ZI7B 1WLYA 3AH8A 3Q85A 4QGBA 3VO8A 4ZZ3A 3COWA 3VJMA 1P9OA 4YDQA 4XGIA 3A4LA 3GP8A 4O3FA 1U9JA 2SBTA 3AG5A 2OBNA 3V7FA 3HKDB 4KO8A 3HBAA 3BL8A 2VYVA 2X8JA 3HKEA 4BASA 1PZMA 4RTPA 3UJAA 3IVMA 4FOLA 1MDBA 1AQNA 2KBEA 4XIYA 4MHTA 1F8FA 1GSHA 1RAHA 3L4BC 5F2NA 2LKCA 3DMFA 4RTNA 1LPBB 4FQ5A 1L7BA 2GN4A 5ARBA 3VHRA 2NQ2C 3L4JA 3QWBA 2L18A 1UK8A 1TYZA 5SYAA 1UBSB 4NK5A 4O2BF 3ITEA 4IDGA 3ZUGA 5IASA 4DR6B 3KYCA 1V1RB 1P4HA 2PGIA 2FW9A 4KLZA 4B8WA 3I0NA 1CJMA 4EYGA 4CL0A 1KAQA 2DZDA 1F48A 1GQ2A 1M2FA 1ID1A 4ZDIA 2YQ4A 3IUBA 2IW3A 4ZVPA 4LBVA 3TRIA 5J23A 3TZHA 3UN1A 2BKEA 1AXGA 3R3SA 2HRDA 4HGQA 4D44A 3S99A 2NUAA 3H97A 1WUIS 2K7ZA 3F7OA 3LPCA 2ZQYA 4LQDA 4MVJP 1I1HA 1TUBA 5AUQA 3RVJA 3D6AA 2QN9A 5BMVA 4Z3DA 2FRDC 2V4UA 3WDSA 3OPQA 3I9LA 1TU0A 3FDZB 3GCDA 4URYR 4F2HA 3PE6A 4RK7A 4V0QA 5CD9A 5ICCA 2PR7A 3GW8A 3ICPA 3LT2A 4C0HA 3AP3A 4ZC1A 3WNZA 4PYKA 1DCTA 2PX8A 1R6TA 3HBJA 3Q3VA 4KFSA 1J9EA 1M1YE 2BGUA 1NF3A 2JAOA 3OMLA 4R2HA 1NYQA 4X7PA 5CBPB 1HL7A 1C1YA 4G56A 2WM8A 4TYPA 1BW9A 3LQ4A 4IJMA 1I4TD 4RD4A 1RXWA 1JHVA 3MOGA 4F7WA 1NW5A 3O92A 1T1RA 2ET6A 2D0PB 4KAFA 3LT1A 1GZUA 5AW8A 5TGZA 1R6UA 5KYNA 4W4TA 3BKXA 2P5YA 2NPOA 1B0AA 2XQJA 3BB1A 2V7VA 3OJEA 5IABA 1YVPA 3HK2A 2ZYAA 2GM3A 3EDYA 1FTQA 4E5PA 3FRHA 5JQGF 4HZGA 4JI1B 4WERA 1E2BA 1DKUA 1EZ4A 1GR1A 2IIQA 2PFKA 3UZUA 2HEIA 3OT5A 4HLQB 3BHIA 2GCEA 3TF5A 1NM5A 1QIGA 1RWXA 2PD6A 4F3KA 3W2TA 1P7ZA 1K6MA 4DS3A 2AZDA 3ICCA 3L6DA 4JJFA 5D1HA 4ARUA 2RBEA 2VJBA 3LTEA 2G72A 2ZSFA 3LZ6A 3S8YA 4AAYA 1U6IA 3FWKA 5LWQA 3ZGZA 1E1CB 2BTOA 2JI4A 2FKAA 4XYGA 3AUUA 4TRNA 3ZE9A 2HSGA 3C70A 3LIIA 1AO3A 5K09A 4ZDKA 4Y1RB 3CRW1 2C1ZA 4UXHA 3FYUB 1CEYA 1O58A 2GPTA 5C8VA 1USIA 3CW8X 3ZBTA 2XMBA 3IJRA 3BFPA 4GL4A 4FZVA 4LXHA 4Z0TA 5A4KA 1QVRA 3DE1X 1I3KA 1T36B 2IDKA 3M5DA 4M0UA 1TA9A 4UBIA 1Z75A 5E2BA 5CDFE 1GTVA 1E3EA 3C97A 3KFVA 3PJEA 4EKYA 7REQB 3BJZA 2YYSA 2EQAA 3PQEA 5DCWA 5JC1A 4EBFA 4QOGA 1XPUA 2HTFA 1ORTA 2XXAB 1TADA 2AFRA 4YMLA 2R1TA 1MLDA 2VYQA 1SIBE 2X0KA 2OV4A 2IYEA 4Q66C 1QKKA 2JH8A 1NKTA 2A58A 2GEDA 2PBFA 3D6HA 2XAAA 2HJGA 3QE2A 2J8ZA 3G8YA 2BMFA 3UV3A 5L3SB 1EBUA 3IOMA 4G0UA 4WQMA 3HE3A 1U0TA 2V98A 2HWXA 3AHGA 2IU4A 1PP4A 1R4MA 3EQ9A 1FMLA 1JQLB 1RRMA 5DIZA 4RTLA 1UT8A 5JY6A 1EVQA 3C5EA 4OLHA 4YRRA 5DYGA 2UUBB 3MUNA 3WBKA 1P2VA 1D1SA 2J46A 3G49A 2WVAA 3RG8A 4AIIA 3SIPA 2BF4A 2AG5A 3HRIA 3WKCA 4XCXA 4H3SA 2BDTA 2ZRKA 3TUJC 4BRWA 1E5XA 4ND8B 1CS0A 3RH0A 3RVRA 4AQYB 1XMPA 5FOTA 3ZKWB 1P1CA 1QPBA 2AQIA 2PXHA 2R6JA 3S1LA 4G0XA 2C5AA 1HF3A 2IYSA 2NYUA 2ONYA 3KK0A 2R65A 3I73A 5JCOA 3GLGB 2BE9A 3GEPA 1ODTC 3V5NA 4EY6A 2XA1A 3LVFO 4UUBA 3G17A 3WQBA 2PS0A 2BONA 2RAFA 3D8BA 4IDBA 4CLDA 1YE5A 3U0BA 2WJVA 4EQ6A 5LBUA 1G21B 1YMVA 3AM3A 3QPAA 4I9NA 4YAGA 2ZUSA 1MC1A 3QKTA 1LVUA 4ZVOA 4W5TA 2IYNA 3TXYA 3VKGA 2FWIA 2N1BA 3CQ9A 3EAGA 1LFDB 1WLSA 1JEAA 3PPVA 2QX8A 4HDAA 2G09A 3H9CA 5AO9A 4CMHA 4BQFA 5K5EA 1SXJC 1L7EA 1G63A 5J59A 3WAKA 5BSVA 1UFOA 4MUFA 5E0OA 2IE8A 4P7KA 3U4GA 5DHFA 2IPAB 2JIOA 3ESXA 5IKEA 5JW6A 2ZEJA 3F5DA 2WKQA 4TUYA 1INLA 1KYYA 3UG6A 2VC2B 4WY8A 4GBMA 4JVSB 2C2GA 2V0CA 4IILA 4B4WA 4EBBA 2VDPB 1XCJA 4TRJA 4KYTA 1PD1A 4FB4A 3OX4A 4YRAA 3RM3A 2ROQA 1AKTA 3MSXA 1I9CA 3VDMA 3KAQA 5K0CA 3I0MA 2EW1A 1YBVA 2AA3A 3Q3HA 4NJMB 1J5EB 1X6VA 3Q7QA 2D1SA 2J3JA 4R7GA 1EI9A 2C31A 1Y3IA 1QMPA 1SVWA 3A1WA 3BXOA 3EFEA 3P4UA 5AXCA 4NNOA 2H4ZA 2X0DA 5IARA 1XCLA 2J0QA 2YJ4A 4BX3A 2RHJA 5COBA 2D1FA 1ODSA 4UHBA 4A10A 3EW9A 5T6BA 3E82A 1T4MA 3K31A 4OXXA 2Z3WA 2FPRA 2QV7A 3RYTC 4XUDA 2ZI4A 2HJSA 2JAPA 1D2HA 3B13B 3EB9A 1HH4A 1B74A 4P81A 3SAJA 5A4FS 4E07A 5IFLA 2F8SA 2HNBA 1ZJ4A 2Z8ZA 4OM7A 3WFZA 3EWNA 4A2QA 5K03A 3DJFA 3NEJA 1C7EA 1CUAA 1U4NA 1O3YA 2IXGA 3AO0B 4OGFA 4Q5IA 3UOGA 2ZBQA 4WZAE 2E9SA 2B8EA 2HIHA 3IUPA 4X94A 1EGMB 3GJ8A 3I2HA 3KOXA 4IRMA 4PWYA 3ZS8A 3KQHA 3SVZA 4XSGA 5E3JA 5EJIA 4BY9E 4IIYA 1HDRA 2Q9CA 3P9QA 3EE6A 2QM3A 2C84A 3IQGX 5E4YA 3S2EA 5ALKA 4Z0HO 3W2HA 4DSNA 3OF2A 4HQNA 4HFRA 1K5PA 2QTNA 3U61B 3Q2OA 2AZ4A 1RQXA 1ZHOA 2KB0A 5TVKA 3WLMA 2F9FA 3IOYA 4HDMB 2A67A 3GEGA 1EK0A 2EKQA 4HX9A 4B7AA 2QUJA 3JYHA 4M99A 1C7IA 1V41E 3FDIA 2P3OA 3QU5A 1KEKA 1P5ZB 2H0AA 5JSHA 2BM0A 2WIDA 1DKLA 1N7GA 1BWPA 5HA5A 1BGVA 2OM2A 3KAKA 2HPHA 4JOQA 4IR7A 1E1NA 4EFDA 4RIIA 4Y0AA 1VHLA 4B34A 1FZQA 5ADWA 4KNYA 1PJTA 2P9GA 4QBIA 1WF3A 2WZDA 2A1IA 2C58A 3HVUA 2E5FA 5EZYA 1ZM4A 2UZ0A 4R2WA 5A4DA 3FAKA 3QVKA 1A9RA 1NR1A 3TRKA 2AOTB 1L3IA 3FOAA 1WM1A 1X38A 3NR2A 5JCZA 1UANA 2G9NA 1XTVA 2FEAA 1HZZA 2IOQA 2Q3FA 3C3KA 4N0QA 3S55A 3VH2A 3CGGA 3N3AC 1W4BA 4ISBA 2VJDA 1VDMA 2JLQA 1LJ8A 2QNIA 3L7YA 4YN3A 2UUAB 2BGMA 2ZS7A 3DHNA 3ZWOA 1TJ4A 2YV5A 1TXGA 1WDMA 1YVEI 5ECGC 3UCEA 1ZMRA 4QFCA 1X1DA 3ZWDA 1X7XA 2XODA 3AT1A 3LT5A 1IOZA 4NULA 3TPFA 1DTSA 5LBIA 4H7KA 1BN7A 4WINA 3P0HA 3O7MA 1XALA 4OHYA 4UU8A 4BDSA 2LE0A 3VH3A 3DV9A 3QA9A 2GKGA 3OCXA 1J33A 3OIVA 1M0TA 3STUA 3C98A 5JH7F 2PZ8A 1EWKA 2GBLC 1KZ7B 1MB4A 1NVDA 1P33A 2H1IA 2IXDA 3EIQA 3PE4A 1Z0JA 3Q0EA 4WV3A 3WRWA 4C7MA 4J1TA 4MVWA 2C42A 1QP0A 2OD7A 2FPKA 1JXQA 4Z0PA 2WHPB 3LA8A 2V4MA 3W3AD 2DBQA 4DQKA 4UPDA 1QE0A 2CN1A 2CZQA 3ZEIA 3C3PA 1RDFA 4CJXA 3OECA 1ZM3A 3G9TA 4ECAA 1RKQA 4O2BA 2O5CA 4R1UA 5JLJA 3CIFA 3DVLA 3F67A 3OTWA 4QDUA 2GCPA 2X9QA 4AJKA 2WILA 1N5KA 4FS8A 4KI7A 3WQHA 4PNHA 4PLTA 4Y9DA 5HMLA 1VE1A 4B82A 4Y3UA 2A0FA 1PG5A 1C30B 2PH5A 3C4QA 5CJ2A 2XB8A 3P9NA 1Z07A 3CR7A 3U1BA 5H4HA 2BRUC 4GE3A 4F04A 2C04A 1H2FA 2TSYB 2YXPX 4DZTA 4BFWA 5CXUA 3KD3A 3IBTA 3IE1A 3NHKA 2J6CA 1AUVA 1EFDN 4UDYX 3MS4A 4FW8A 1Y3BE 4DIKA 3FUXA 1Q22A 1RCFA 2G9UA 3TAUA 2BP7A 2DBVO 3EXFB 2C2OA 2AXEA 3UATA 4PYIA 4K5QA 5JSKA 4LAFA 1AMOA 2WM2A 5AQ1A 4PHHA 2FSHA 1M73E 2Z4TA 4DA4A 5IVKA 1MHPA 1FQOA 1VKJA 2F3RA 1OXSC 1L1QA 2ZWIA 3U3XA 5CH3A 3AVUA 3AR6A 4ITRC 5KOJA 3C2QA 4H6VA 3W79A 4KAJA 4U3JA 5HUJA 2IX3A 1T1GA 2H85A 5JYCA 4N5LA 1TO2E 4HWSA 2ZRGA 5IVDA 1XJCA 3RSSA 4AJNA 4M55A 4BEJA 2NPIA 2WT8A 2ZI7A 3NETA 1XA0A 4AZ3B 1EFVB 3ZGYA 4FYVA 2YWFA 3OQJA 1MVNA 1N6NA 1WAMA 4KOAA 3AOEA 1LS6A 1LNSA 4DG5A 2ZTVA 4RZHA 4YDSA 4EW3A 4B31A 3LRPA 3KFLA 5JQGA 1ZD5A 2QG6A 2WB4A 4ZK6A 1ZL2A 1ZONA 5HFJA 3IR6A 3HFGA 3F7MA 1NN3A 1PQYA 5ILOA 3O8DA 1KAEA 4Y2VA 1J9GA 3DEKA 1JW9B 2QRPA 5KZMB 4CF3A 1PU2A 1Q1QA 1VL5A 3TDMA 2ZCVA 1U2DC 3AUJB 2QBYB 1RPNA 2X9VA 4FN5A 2OPHA 2XR1A 1XVTA 2AOUB 3NVDA 3CVJA 1L5MA 2COUA 3HA5A 1D4OA 2O0KA 1SAYA 1J2TA 5CRIA 2C3MA 3CW2A 3K16A 5GP1A 4AJIA 2GPBA 3NIDB 2DULA 4Q4JB 3BDAA 3CE9A 4ZYXA 2VAVA 3GARA 5EJ9A 3T5AA 1LWOA 3AEKB 2FWAA 3AF6A 1QIKA 1DP4A 2F62A 2HAEA 3MC1A 5BV1A 1YJ5A 4S0ZA 1N9KA 3WO1A 4EI9A 1Z9BA 3GL9A 2DWOA 2OAP1 3U31A 4M21A 4AJOA 4J9VA 4EZIA 4Z49A 4YI5A 1O2DA 3UWSA 4PCUA 1SQFA 3SI7A 4FJ0A 4RNCA 4X54A 4H7IA 2PPVA 2JGMA 2REBA 3KJNA 4OO3A 5K0FA 3WK7A 3NIBA 3TXAA 4CL8A 3CV3A 5K99A 4QU9A 2UZ1A 3SZOA 4OVKA 2IXFA 4JL6A 2P6OA 4JHXA 1IZ9A 4V3BA 2IDMA 3EVEA 4ZVLA 2YFQA 3GBSA 1FNMA 9LDBA 2ZQ5A 4A6DA 6NULA 4OU4A 2JIQA 2X86A 3PS9A 4G4GA 5KTNA 3LGXA 2OV3A 2H2AA 3I9NA 2W0SA 4C2AA 4Z4FA 3L7JA 5F51A 3O8OB 1DEOA 5BRNA 3FETA 2OYCA 1Y5NA 5DOVA 1TYCA 1L9XA 1I7SB 5F98A 3E9QA 1MTOA 2WPNA 2JHCA 4IJWA 3VR4H 1XD8A 4L5IA 3EUAA 1SURA 1XCGB 2YQZA 3OTOB 1MBZA 1TZMA 3FPHA 5B1DA 3OPYB 2Y1XA 3HDJA 1QC5B 5CFQA 3CVXA 1KFBB 3CMMA 5CXQA 2PCJA 4JBNA 4HQOA 1JEYA 1G2IA 2Q2WA 1N0VC 4L85A 1UFQA 1AVTA 3H84A 3N86A 2WWWA 3EGCA 2VQFB 1TC2A 4DR4B 3PEVA 3W4IA 2BFOA 2VPWA 4EFLA 2FG6C 2HA0A 1E1KA 3MYRA 4J49A 1M1NA 2YJ6A 4WD3A 4WKBA 3G89A 3TIFA 3LO8A 4ZQGA 3FWPA 1SCNE 4MUHA 5KYYB 1P39A 4ZV7A 2FUKA 3KTOA 5JYBA 1SUIA 1GA1A 2Z5FA 2K87A 5IDVA 3PUWA 2BGNA 5I9LA 2VH2A 1S8OA 4PONA 1QB7A 1FX0B 5AVUA 5JNLA 1KI1A 2V55B 4OJQA 4OQMA 4PN7A 1R4NB 4JJIA 1BU8A 1VBKA 2GK7A 1BCRB 2J6IA 1EX7A 1TQ6A 3MJTA 4UU1A 3TSAA 3GZTB 1LTHR 4PX2A 2YMMA 4WN9B 4CCYA 4ZA2A 2NP7A 1YS2X 2QNRA 2QTAA 3STWA 3QHAA 7GPBA 4E2YA 3WRYA 1RW4A 1GDDA 5MN5A 1WEKA 3OCYA 3EGEA 2O23A 3JD3A 1NF8A 1YAHA 2HMWA 1Y6RA 2QT9A 2HEGA 2XNHA 1U3CA 3HR4A 3Q7PA 5AW1A 4RSGA 4KIJA 1P91A 2V7XA 1NJGA 1SVKA 1VG0B 2D74A 2XIJA 3KZCA 2UYHA 1B23P 3PXEA 1YI8A 4RTMA 5J4KA 2JFNA 5EGSA 2PLFA 4FOSA 2BFAA 3A28A 3UTDA 5CG1A 3EPLA 4JV5B 4E31A 4KV7A 4AWBA 2WFZA 3BREA 1RZVA 5FORA 4DFDA 1COWD 1DPFA 4GP7A 2FDCA 5A5DA 5FI0B 5J2TB 1I10A 3KQLA 3GJZA 1PNQA 5EXTA 5D3ZA 3WGVA 1MEJA 4F21A 5BO5A 5JEEA 2ZCJA 2LIVA 3HSKA 5DYIA 4PICA 4FX5A 3C5VA 1H1DA 2JBAB 4OQQA 4BEWA 4KQHA 4M0FA 3PEWA 1V1MA 1E63A 1Z17A 4K9OA 4OHKA 3WDMA 4D9JA 1JNXX 1KVUA 3ORQA 3F46A 3RVBA 1FPQA 4XEUA 4ND1A 3FFAA 3O0DA 4K0RA 5DNEA 5F1KA 4YRNA 1W36B 3L7LA 2XRMA 1GILA 3TLYA 1NBMA 2Z4RA 3FZEA 1H6DA 5KCZA 4LYDA 4Z9AA 2WT9A 3CTPA 1YHZA 4LDJA 5FLYA 1RYFA 3V42A 2TMDA 1R8QA 4BFLA 3P9RA 2DKOA 1N0HA 4UZEA 5BURA 1HDOA 5AM2A 4EB3A 3L7NA 1Z33A 2PX4A 4X92A 3PCXA 3AWDA 1R6XA 5IDYA 3U6BA 1JLLA 4W1QA 5GWXA 1EVEA 2IXAA 3RREA 2R0QC 2EBWA 5LP1A 4GL2A 4BIIA 4PR3A 4KGXA 4G5XA 3ZI0A 1VZ2A 2HQOA 1QGAA 3ANLA 1XZQA 3W9YA 4KR2A 4E3ZA 4GZ6A 3WL5A 4D4GA 1RWPA 2VXBA 1QK3A 3YASA 4DYDA 2JCSA 3X1XA 3HP7A 3E48A 3SC4A 3EQ2A 5IDWA 4G5YA 3VI3B 3KQWA 1OX4B 2O2SA 3W5SA 1KWKA 2Q4OA 1FJ2A 2PBLA 5JDCC 4PS1A 2HGZA 2XCQA 1VCHA 2XVXA 3P45A 2IHBA 4IO1A 5L53A 2A84A 5KOIA 4CVNA 4N0EA 4KITB 1SKQA 3LH5A 4KRFA 3AIIA 1LXCA 1L1RA 4KQWA 4YQZA 1DFGA 4JD5A 4EX6A 2HK7A 1X2EA 4OQXA 1RC1A 3OIGA 2UZIR 4E33A 3RF6A 4QD3A 3OQHA 2ZLBA 1YUBA 3AONB 4JB8A 4UDOA 5EFZA 1K89A 1OU0A 4L4UA 1Z62A 4HY3A 5SZJA 1MJ5A 4CIYA 2CVQA 3NKLA 5ER9A 1XEFA 1F0KA 1WHSB 4V24A 3GB9A 1JLRA 1YIAA 3PB3A 3PDCA 4RVOA 4I55B 1YZLA 1IHPA 1D6NA 4TTSA 4RZSA 2VF8A 1R0YA 3SE0A 5JZMA 4JDUA 4BO6A 1FXWF 3C39A 1EKXA 3K9CA 5JSYA 1NVVQ 5CVTA 5CB8A 4OTZA 3SZRA 2UUCB 1C8BA 3JALA 4B09A 3L92A 5JH7A 2K2WA 1ZW6A 2V7WA 2K2QB 4D82A 3ZDQA 5I6DA 3D5TA 2DFVA 2QD4A 1VLHA 4ZANA 5DWVA 3BWYA 2HYIC 2IBSA 1VJRA 4GLFA 4XEHA 2X41A 3PUVA 4TL8A 4BMNA 2BGIA 5LWHA 3WJ1A 4C0BA 1K06A 4XQ9A 2RHHA 4NARA 3MHTA 3GI1A 1NHWA 3TQHA 2GAFA 2WU4A 2XPCA 5E4TA 3EGXA 1L4EA 3DBLB 4J16C 4XASA 1G5QA 2JCVA 3SLKA 3SN6A 5H7XA 2FWJA 4DMKA 4RD0A 4EHFA 2D54A 1CB0A 3VR5D 1P17A 1PNVA 1P3JA 4LRSB 5JATA 2IYUA 5JAZA 5EI5A 3DF7A 1SZJG 3UC5A 1OTXA 2D0OB 2PEZA 2E4VA 2OYSA 2Q21A 1SUEA 3IBFA 1TT5A 2ESRA 3EOAI 1ORWA 1E6LA 1RTTA 2VF7A 1QGZA 3LPLA 4MR7B 4PINA 1LV8A 2XUIA 1R64A 1WDTA 1L4HA 2BBWA 3QYAA 4JKIA 4MWEA 2WHXA 1BSVA 3QQPA 4OJTA 4DCUA 1JBQA 3D6MA 3OZWA 1R9JA 1B7GO 1K27A 3FDZA 1ICIA 1B8UA 1GVNB 1XJWA 1TLFA 2E4ZA 3E2MA 4QPPA 5CIYA 2O3RA 1G7SA 3HYSA 1UAYA 3F47A 1E61A 4JLBA 3DVSX 4OEHA 3B89A 4B6JA 1W29A 2Q2VA 4B6RA 3SYLA 3MUFA 4DOMA 3N6RA 3N05A 4BVLA 2H0RA 4OXKA 5DB4A 3TQFA 4KK3A 5CBPA 5L6MB 1E5TA 3L5KA 2QL6A 1E2FA 3DVQX 5FPYA 5IEBA 4TMWA 4DGQA 1XAIA 1H85A 2XF2A 1YR9A 2B20A 2JLZA 4AUEA 1UEIA 1DBVO 3OTIA 5EJ5A 4MCJA 4H3VA 2JI8A 2RGNC 1BOFA 5HFNA 2F1JA 5EMJA 2YN2A 3D2AA 3ICQB 1XO1A 4XPZA 1YZUA 4YMTA 4DR2B 2DTXA 4WKOA 4FDAA 1W8IA 4PSUA 4RUKA 2DQZA 1C1XB 3PHCA 2ERYA 2H3HA 3RGGA 4MQ5A 4QO7A 1VM6A 3O2SB 3THOA 1ZR4A 1IN1A 3UV6A 3HU2A 5C7LO 5DN6D 2EYQA 2R6AA 3NHMA 4RJIA 1LLUA 4RMGA 4LNHA 3PEUA 4HNSA 3R0XA 5B3AA 2IS1A 4I3FA 1XMXA 2EEZA 2PL5A 2WBLC 2F1IA 2WTMA 5T6MA 3CNLA 2CE7A 2J5QA 3AF2A 3REFA 2PMBA 2CF5A 3CSSA 4IVNA 4Z9YA 3AY7A 1NU8A 1ICEA 1RKVA 2OEPA 2ODWA 3KELA 2FVYA 3OE7D 7ADHA 2RARA 2ZOSA 5AUNB 1H9BA 1OFTA 3B78A 1ZAKA 4MIYA 5BYBA 1BEZA 3PJDA 4HBGA 3P0EA 4C01A 3K30A 1AQYA 3LQYA 5LD2C 4MI9A 1E2QA 5FFMA 1H5UA 3TE6A 4G0VA 2D1RA 1C0IA 3AG6A 3GV0A 2O8CB 3Q3GE 2X8LA 5F2EA 3VPCA 5GJBA 1UXHA 2A5YB 4LBZA 1SWWA 3ZDAA 1IQPA 1IUKA 4FHDA 3E7PA 4GLBA 3P26A 2QSJA 5P8WA 4CIXA 2XXAA 2JC3A 5K0ZA 1D2CA 9LDTA 4PAOA 2MTBA 1QB8A 3BERA 1ISPA 5GVSA 5G02A 4YAEA 4Z7JA 3IURA 1E96A 2Q5CA 3FMPB 5DTRA 2Q5QA 5A7HA 5AFSA 5C53B 3R7BA 2P91A 2NV6A 3A3OA 1V35A 3JZMA 3MOIA 1JZTA 1PCXA 1QFZA 4FSXA 4G5SA 4KH1A 5EL0A 2IGTA 1P1HA 2BTQA 2FW7A 2XNDA 1OZHA 3FJYA 5JFTA 1CKEA 4CKCA 4OX9Y 1S8FA 3CRMA 3LDHA 4WGGA 1H93A 3ZY3A 2JZCA 3UYKA 4J03A 2P2GA 3DW3X 3GJ5A 4TZKA 2XT9A 4DL9A 5CNMA 5K8TA 1X87A 4ZJPA 4UVIA 5LZ4A 3LQFA 3UG7A 2WR8A 4MB2A 1RXCA 2H63A 3FLMA 5JSUA 4KWEA 4N5HX 4MPDA 2J9ZB 1SOUA 3GAMA 1QPGA 2I76A 4N41A 2AKAB 1NATA 1XJ5A 2R8OA 3CJQA 4HB2A 4FLFA 2J7PD 4ZYVA 3G68A 5KKCA 1ZSVA 2M1XA 5JECA 1J8FA 4MEBA 3W2GA 2Q9BA 1R0XA 1RD4A 1JPUA 3CN7A 5BP7A 3W5HA 3M6WA 4GD3Q 5CYPA 1G21A 4H4EA 1QK5A 3ODGA 2OK7A 1UODA 1X3LA 2HO4A 2JJ2A 2UYQA 4JC5A 4ML3A 4MQ6A 5EPEA 5TARA 4WWHA 2XXBA 1CJCA 4MVCA 4YC7A 3Q11A 5EIXA 1DRKA 2QU8A 3GLHE 4EDFA 5AKGA 3NYWA 2GYUA 4IIJF 5LZ8A 5JNVA 3ZZUA 1H1LB 1TIPA 3LX8A 3FMGA 3GDHA 3HNPA 5ALPA 2UYOA 1T5BA 4M49A 3DMNA 3PXXA 3KLBA 4LEIA 3RRXA 3H5VA 4AF6A 3ICWA 4CYMA 1M6NA 3LFUA 3O83A 1WQ3A 3F49S 4MV4A 1VPLA 4YCJA 1EP2B 3SGLA 3ZS9A 1YFLA 3MN1A 5EN4A 5IPFA 3MXOA 2Z9DA 3BUSA 4QLAA 5TT0A 2E48A 4X91A 5E6SB 4K6FA 5E1DA 1W5EA 5DSTA 3H5AA 1C81A 1JE0A 3DEFA 1A9XB 3FE2A 4FOOA 1N3IA 2HLNA 2OC4A 5DULA 1AXEA 5DLYA 4XPIA 4MJ3A 721PA 2A35A 2XAUA 1DPGA 3FN4A 4L16A 4DSOA 3ZJVA 1M54A 1UZLA 3A9SA 3R09A 3T1HB 1MP0A 4CFYA 2OR3A 5KQSA 1Z4IA 2J3MA 3QLVC 1RABA 3TW0A 1QHEA 1EDEA 4QTTB 3IAS1 1P0QA 1B76A 5CJPA 3TB6A 1IHXA 1QYRA 2PZKA 1CP2A 2FV8A 5DMHA 4RXMA 4XD2A 4HDQB 1W6RA 3SS8A 4PNPA 4TLEA 3F73A 4ESVA 1CUYA 2ZUFA 2FSGA 3E7WA 1Y1TA 2XDQB 4RHCA 3TPZA 1IAQA 2I1QA 4J7UA 2F9MA 1VLVA 1IM8A 1CEXA 1D1QA 3C1AA 1G7TA 4F5YA 2RGBA 5K2MA 2V54A 4XJSA 4MEAA 3DZFA 5GINE 1RWMA 2HHLA 1W85A 4KWCA 4OREX 4DEVA 3HB4X 3IVRA 4EK9A 2FXVA 1Y48E 1NN1A 3GUCA 3ZK9A 4DDMA 4C4ZA 1N2HA 1F7UA 1DJLA 4HDMA 3K0FB 1P9WA 1YRYE 1I80A 3IKVA 3SQMA 1SQ6A 3R4CA 1RIIA 5AYVA 4QM7A 1HTBA 4ZO8A 3GN1A 4J91A 1M34A 1RHKA 3EYWA 3C20A 4J0KA 2ZYUX 4GO1A 1VKNA 5CDYA 4ER0A 1QSGA 5E9QA 4WFJA 3E18A 4IQ0A 3C4JA 1XF1A 1JEQA 1SIWA 3IS3A 3LP5A 1ZYUA 1SHJA 1T6BY 1K4MA 3R9WA 1E79A 4B6FA 3TVDA 3HGMA 1RI5A 5J43A 4MZXA 4MKHA 4BKUA 1TCAA 3X0DA 1STOA 4R1LA 5K3SA 2IPNA 1NMYA 1Z5ZA 2QZZA 4DRZA 2ES4A 1XKXA 3AESB 3QOYA 3Q8LA 3QJGA 1U8TA 3CZAA 4AP6A 2HB6A 4RS4A 2PT6A 1HTWA 4AN4A 4ZARA 3IAAA 5IT9A 1DXHA 3Q0TA 4PW0A 5MDHA 3VGPA 3ITDA 4FJ2A 3KHKA 3HB0A 4JJEA 3RUIA 4D4MA 1XEAA 2JFGA 3BAZA 4I55F 4X6XA 4HV4A 1XG5A 3PC6A 1F6DA 1FXWA 4B40A 1PV1A 2BR3A 1U94A 4QXAA 4ER5A 1BHO1 1HKHA 4LYJA 4QYIA 3LM8A 1W4ZA 5A6VA 5MHTA 1XRJA 4UNPA 2VRNA 2HHAA 3TOXA 4OIMA 2ZSDA 3QLUA 4DM7A 1ZK2A 1WXIA 1WZUA 2MR5A 1OFHA 2PYDA 4D4JA 5J58A 4MTLA 5KNCD 1OLUB 4F6CA 4KSCA 4URWR 2HRCA 4YV2A 3LSYA 4ZT3A 4CQNA 4ARIA 2W9XA 4ZOBA 1T0HB 2NZXA 4LYYA 2C2MA 3RASA 5T5QA 4NL4H 3M6LA 1YV9A 3I76A 4D9MA 1FFHA 3NAMA 3T7SA 1QYCA 4H15A 4AMBA 4DLKA 4KB5A 4BXOA 1JQJC 4WNAB 1BE8A 2HYDA 2ZSAA 5M29A 2O8CA 5A02A 1IUOA 5C7YA 2O7VA 2BCJQ 1PJ3A 1Z39A 2J09A 3FCAA 3UUFA 4ANFA 4DILA 5B7PA 2ODBA 3OZSA 1T4GA 2OHJA 5ALGA 4X97A 4FDUA 1SOMA 1C30A 3QVGA 3OFND 2H1CA 1S1MA 3IQFA 1IZYA 4M9ZA 4N0PA 4NYJR 5LMUB 2FHSA 1PJ4A 3E3AA 5C52B 3P9YA 3X1MA 1ZGBA 4K8RB 1KK3A 4OG2A 1XMQB 4O3MA 2ZJ5A 3IGFA 4ITUA 1FNNA 3B5EA 4WBSA 5AIBA 1E3DA 1Z18A 1UKCA 1QOZA 1RYDA 3GMSA 4FU0A 1R0WA 1ZA1A 3SZGA 3KQSA 3HVHA 2G9RA 3EDRA 4JROA 1I5OA 4YMHA 1PYGA 3UA3A 3VNSA 1ANKA 2X3FA 4YGXB 4ZVUA 3WE7A 1F6BA 1RSZA 2H57A 2WWXA 3R74A 4I3GA 1U9IA 1R12A 1EFLA 1G17A 1VHQA 2XOKD 4GSKA 4TSFD 2H11A 4DTCA 5DM70 4BNZA 2HXYA 2D2XA 1FS5A 4L76A 5IC6A 4Q9NA 4B4OA 2JK0A 1TEZA 5I01A 1EBFA 5TLSA 4FFMA 1XTBA 1YBFA 4GWGA 3QTTA 3WB1A 3FYDA 1G9TA 5CVUA 1FDUA 3CG4A 4W5JA 2VDOB 3G0GA 4WA7A 3GA0A 3PRJA 5KYVA 1RLIA 3ERCA 5LLTA 2ZT5A 3FG9A 4O02B 3G0HA 3CCFA 1W5BA 3RIHA 2CMGA 4BRUA 3RYCB 3CZRA 5CBKA 1QTNA 4F91B 3IT3A 1R74A 1T6YA 1F2DA 3LW7A 3V2GA 1DQZA 1MW8X 4JFAA 2EX1A 4V39A 3ZQUA 1DAEA 1U3WA 2ICAA 5JVDB 2I4MA 5HKKA 5CFRA 2B34A 4A15A 3UOWA 1NRWA 3VZCA 2AOUA 1D8AA 3DXFA 3JARA 4G1VA 2A7XA 4OBBA 2AE2A 4MKIA 4QVKA 3UMVA 5KYKA 4F7DA 1Z63A 4NI5A 2V1XA 4LSWA 3PYMA 2KQUA 1OZ0A 2ORWA 5GGYA 5TS3A 3THSA 4DZZA 5HK8A 5B55A 2HMVA 3RTGA 1RWVA 4NVRA 1FW6A 3AEKA 3IQHX 2D4HA 4EYKA 1SC4A 5HXAA 4YV0A 3ZY2A 2V6FA 3WB2A 1U8AA 5REQA 1HOTA 3LOQA 3H8VA 4QYTA 1OAAA 3QWAA 1I51A 4ZALA 1USWA 4K3VA 3EC7A 2W22A 1AM4D 3U3OA 3TW8B 4BKQA 5AVTA 3QXXA 5LR6A 1P77A 3I01M 1DTWA 1SVNA 2H5EA 1ADCA 4BFVA 1JDZA 2WAOA 3D59A 4KLNA 4X6UA 1Y3HA 5IT4A 2PX5A 4Y2HA 5IANA 5I5GA 4BKRA 3F6CA 1ZMXA 3P9IA 4FMDB 1E2GA 2ZJYA 1UBMS 3PFBA 3ZGOA 4DBVO 1LGYA 4NABA 1THMA 9ABPA 5BR4A 3FX2A 1ZINA 3O8NA 1U2ZA 5BQXA 1JIXA 1I2DA 2R48A 3CLSD 5LMNB 1Z73A 2R00C 4A16A 1MH9A 1NASA 1R9MA 1WCIB 2ZVQX 3HCOA 2D2FA 4AG3A 2Y3IA 3PL5A 1V26A 4RVCA 5AQEA 2NU8B 4ZMRA 5K01A 2X4IA 1H66A 4GZ5A 3L7AA 4C89A 3RFCA 3ZTWA 4W63A 2R6CA 1KEUA 1TTHA 3D1VA 3OPYA 3A4MA 5AM1A 4B2LA 1LSOA 3NW9A 3I8SA 3KAPA 5TPZD 4R69A 4RL6A 3M6VA 2DLCX 4K05A 3ZQ4A 3D0KA 3RK1A 5TF4A 1VIVA 4MYCA 3SLRA 3WLQA 3I9MA 1JDBC 1QP4A 2AFVA 2AUTA 4UE3S 1ECGA 2PZGA 4W7IA 4M8KA 5TC4A 2SICE 2DFPA 5F78A 2I6FA 5KYYA 1OH8A 1JU3A 3WA6A 1AZTA 2Q3JA 3BRWA 3L8CA 2Y1CA 3SC3A 5KNBH 3C7DB 3S2FA 3E5HA 4C3OB 4NDZA 1PZNA 1YBAA 4LZPA 1U0GA 3EEQA 1UZUA 4WN9A 5HKBA 3M6XA 3RNLA 2Z3ZA 3ND7A 2BUBA 3D2CA 4FR2A 2O9JA 4M8LA 4DTIA 4OKNA 4IIJA 1FUIA 2IKSA 3W2EA 1G8YA 1YD7A 3U4CA 1TB4A 1UDCA 5ALFA 5LXTF 4ZYUA 5LVAA 3WV5A 3GJTA 2KE5A 3V2HA 3CT4A 2C94A 3ENKA 2DXIA 2QQ0A 3SBDA 1KF0A 4HEQA 4DLSA 1U98A 4J0IA 4JHLA 5F73A 3CB2A 3ZI7A 5EWMB 1GZ5A 5BN5A 1Z45A 2ZGVA 1H2EA 2YDXA 3FOWA 5NLLA 4CV2A 2XBLA 1I33A 1E2NA 1W76A 1K92A 1NMQA 3ETNA 1QR6A 3ZHXA 2AFIE 1K68A 2RJOA 3Q2KA 2YWHA 4Q1FA 1RJGA 1V8FA 4IGEA 4QQRA 1BQEA 4P0PB 3CISA 1H2AS 4BJ6A 2X5JO 3GJ0A 4IYRA 2AXQA 2F67A 3G1WA 2C83A 3L8GA 2P1DA 2B78A 4OJMX 3RQIA 3P4YA 3WL4A 4C6TB 1SUBA 2DUUA 3R44A 4QEDA 5ICGA 2UZ4A 3T7AA 1ZAYA 3BWDD 1YGPA 3SX2A 3ZLTA 2WJJA 3I2KA 3ZU4A 1OOEA 2O7QA 2GERA 2VF5X 3ZG6A 4K88A 1RBYA 4RF3A 3V48A 4UTRA 2Y1KA 1PEDA 2QK4A 1WBBA 3VAAA 2PUHA 3C5HA 4NJEA 1RYMA 2RGDA 3MD9A 2WT4A 3CR8A 1HRDA 3L1HA 3PQ3A 4JKOA 1ODIA 3PA8A 4IM7A 4YP6A 4H0NA 2VDLB 1LDNA 5EE5B 3BL6A 3FZQA 2PL1A 1CC1S 2IT1A 1N6PA 2NLOA 5AXAA 5ALIA 5I9IA 1N6HA 3HCFA 2QRQA 1Z6TA 2OV1A 2Q8NA 3EZ7A 4REQB 1ORVA 1N1MA 2GPAA 4XVHA 3HGQA 2AMJA 3TBKA 3QIAA 4AJLA 4CMCA 3C3CA 4CLHA 4E46A 4X3OA 1H05A 1NNI1 4M1KA 4CTMA 4XYEA 1X7WB 5KIAA 3WGOA 5J5VA 4Z4GA 2JG3A 1RBZA 2EGGA 2NXCA 2OG2A 3ZY4A 2Z6QA 1EM6A 1IATA 3D4PA 5DGXA 3ZCRA 2Q6VA 3PXCX 3KLPX 3QP9A 4F38A 4UOEA 4I5FA 3ZIAD 3Q7TA 4WESA 4NMHA 4EVIA 4AB1A 3SFZA 4BN4A 1QF6A 1OI4A 2YOHA 4N6OA 4WY5A 3V6MA 5EAIA 4QKQA 5FUQA 5KQMA 4BO0A 2Z8XA 3U48A 2G5PA 3DMRA 1AGPA 3INYA 4BE4A 3EYAA 2W37A 4MXDA 1OT3A 1E9RA 1WJGA 2BFCB 2EDCA 3A6EA 3AYZB 3EXHB 3WQRA 1O6GA 3GDOA 4U7JA 2R4UA 2I2AA 3H6KA 4Q34A 4QNMA 4RMJA 1P2TA 1V16A 2C96A 3B51X 1XEWX 3H99A 3MA0A 3ONWA 4Q6BA 2OXTA 3THYB 2PWPA 5FP0A 1Y8RA 2GF9A 4IXNA 5FR2A 4PO1A 3NANA 3QU4A 4YCMA 3U7EB 1FF9A 2WG1A 5AVZA 4RTOA 1V3VA 3AUKA 3HCNA 4HTFB 5BWCA 2C2ZA 5C8YB 1Y6ZA 4WL0A 3P20A 1DAFA 4I55A 1XRSB 3KEOA 1JJ7A 2QTTA 4BO4A 1CQPA 2EFGA 2ZITA 3H8JA 4TL9A 1K8ZB 1PS0A 3ZHRA 1X15A 1O1YA 3EZGA 1IPHA 3ROXA 4M7PA 1SVIA 3PUYA 1KA9H 2EZTA 1WSAA 1CUCA 4N39A 4YAOA 1BMFD 2ZRLA 1DKPA 5DBHX 4OY3A 1QHXA 1KU6A 3VOAA 3KQTA 3CNNA 2W4MA 3NIFB 4HVAA 4C07A 3R9KA 5CW1A 2BGLA 1DXYA 2VJOA 4NE2A 4C4RA 1XPOA 4BFCA 3MBOA 4K9LA 1ESCA 4MRRA 4HEA6 1Z7WA 2C8VA 2XWBF 3C3JA 3AZPA 5TT1A 3TW4A 1ADJA 1W0KA 2D2EA 2DPGA 3AVTA 1F12A 1TAGA 1E3WB 3NVAA 4PHTA 4UTXA 2VOEA 1S2MA 3H4MA 1POXA 3LFTA 4EO7A 3DPUA 1ISMA 1JJIA 2BEUB 2RGGA 3TNYA 2NT3A 1ZN9A 2IV7A 2GRJA 2P2SA 1IJFA 1OFUA 4A0SA 3SZMA 4M7WA 2QRMA 5KCMA 3OJLA 5C31A 3CX3A 5AMXA 3W8RA 1UC9A 3TQRA 3R0JA 4K6OA 3BZBA 1V5IA 3O31A 2E18A 2VHJA 1R0ZA 1N8SA 3A6ZA 1P1JA 1FE8A 2W43A 2J7KA 3L6RA 2AJDA 1REQA 2SKCA 4MRVA 3HJCA 4AU1A 1BQ3A 1K8YB 2UU9B 2HXSA 1P5JA 4INAA 4MR7A 3DWIA 1ZG3A 5AI5A 4HYTA 2ZIXB 1T1SA 1W30A 4OK6A 1JHAA 4CQLB 5LQAA 1MEEA 3I4CA 5IW8A 1XOIA 1EFCA 3THWB 3MLEA 3UH1A 4GM1A 4BNMA 4KO2S 4UU0A 4FYWA 1OX5A 1Y6JA 3C0KA 4LBYA 5BQFA 3NU1A 3NBQA 3RPEA 3SVTA 3OLXA 4WJZA 1ZKMA 3IIJA 3AF4A 3MJEA 1WD5A 2NACA 1VPEA 3OG9A 4QPJC 3FSGD 2DQYA 1GYRA 4AT1A 3T3MB 3S3TA 1OAOC 2G63A 4K9PA 3SIXA 2AQHA 1BYIA 5U1PA 4C20A 3PEYA 1OR8A 2NQ8A 3BTOA 3T1NA 2XJ4A 4EJSC 4UNNA 5EHQA 2W2LD 1X9HA 1EXNA 2E4YA 1N6IA 2G08A 3JAKB 1HA3A 1DSSG 4HAUA 2IV3A 2NU9B 4DCMA 1G2QA 1N5RA 5L40A 2AZTA 3FKSD 4WNCA 5B12A 4CUZA 1QRUA 2G70A 5AJYA 5H59A 1Q16A 2R8PA 1CY6A 2ZIZA 5IJZA 3NHWA 4QRDA 1NW3A 1AV7A 3RW9A 4YTEA 2OWDA 3HJFA 2CL5A 3VH1A 4AECA 4P35A 2O8FA 4GT1A 4V03A 3OM8A 1Q3KA 2Q1SA 4DMRA 2OFWA 4R1SA 1M5RA 5LDDC 1FP7A 9ATCA 3IXLA 3QVOA 3MCUA 4ADSG 1YRLA 3QFRA 1IMOA 2RMKA 4U2BA 3M5CA 2FVXA 4NZYA 3WGKA 3N59A 4X90A 1QGUB 3ZVKA 2YRXA 1GUZA 1UDAA 1EVIA 2OOSA 1RLTA 3NC4A 4AKEA 3TYXA 1I3CA 4CMAA 2EX0A 3IAM6 4RJTA 2AUMA 5IK2D 5TGDA 3QNMA 4GOJA 2IXEA 2F48A 3NXKA 4X65B 1HTTA 1E64A 2Z2ZA 5D86A 2QTFA 2AUNA 4M7OA 2AKEA 1Z6QA 2J0VA 3EZ6A 3WZMA 4EW1A 5CDTA 4WLOA 3E9DA 4HDNB 1N1EA 4TZTA 2PWAA 1GLNA 3S1AB 3ZWMA 2PKRA 1AT1A 1NGSA 1J0AA 2C5FA 4PRLA 3KR0A 1CU1A 2WV9A 3CEMA 4PYOA 3BD7A 1G8GA 1K5GA 4DMLA 1T8SA 1YZFA 3BXPA 5D3MB 1CQWA 4OHZA 4L28A 5SZHB 4LDQA 5C5IA 2HY7A 1JXAA 5NULA 1XMJA 3B1XA 2BCGY 4ZP1A 3TLJA 4K40A 3ZVLA 2P1ZA 2P5SA 2O2XA 3LBNA 4TS3A 3SR4A 1Q0HA 2ENWA 3WGUA 4PLVA 3ADOA 4NHOA 4WUVA 2ZR0A 1OV4A 2ZAOA 4MR9B 3ZWYA 1EEXB 3B12A 8ATCA 5AW0A 3TGPA 4YT4A 3SNHA 1Q0LA 3N8KA 4DV7B 3KYDA 1DRUA 4FMDF 4RVGA 3RKSA 1N3YA 3HY4A 5JJCA 1XTSA 2B9VA 3FI9A 3ORSA 1GV1A 2ZULA 1B8VA 3OWXA 5TDHA 2H4YA 4HDRB 2OQIA 1MV5A 1G7RA 1O5IA 5E2AA 3ZWVA 3O0TA 1ZXLA 4PFJA 5E4JA 4EEXA 1JFSA 4K81B 3CXUA 5F21A 3UJDA 3RO7A 4MV0A 5E95A 1TM3E 3G8BA 1VL1A 3HJNA 4OBWA 2UZ3A 4K0KB 1UINA 1RI2A 4B35A 4EI7A 4CEHA 4ZEOA 3GLIB 5DK4A 4HAOA 1XVIA 3ZZMA 1ZCBA 3F5SA 1J99A 4PZAA 3G8CA 3UWMA 1YC2A 2DCMA 5AI0A 4ZGWA 1UC4B 2PX6A 4MUEA 4P86A 4MX8A 5DNYB 4QHTA 1LF0A 1TIBA 4OP2A 3ZJUA 3H17A 1RQ7A 1S2IA 2PUTA 4RIFA 3SQNA 3CKLA 2J3DA 2ATCA 3A7DA 2GBCA 4B43A 1SULA 1G5TA 4ZKEA 3I5YA 1SQGA 3DG9A 4RGBA 3B1KA 4Z7NB 2AFHB 3EMKA 2OP1A 1QQ6A 1Y34E 2KPOA 1ZD4A 3ESCA 5JWHA 3TNLA 3CSUA 4Q4LA 4QGGA 2FP4B 2W2TA 1QMGA 2JL1A 4GBED 4WCFC 4B8ZA 2YVAA 4JITA 3DAGA 3GLGE 4WT7A 2ZE8A 4EY3A 4ZOQI 3AI1A 3BJMA 3KEGA 1B8PA 4PPGA 1JV2B 1FY2A 5GM1A 4X85A 4F84A 3WNVA 4PXAA 2J0UB 3WIUA 2B3TA 2C4TA 2XSZA 2YR0A 5K8JB 3L4SO 1O77A 2A2ZA 3PDHA 4TL7A 5IJ9B 3EY4A 3M83A 1C7JA 4MJ7A 5LXTA 2QW1A 1WKBA 1OWPA 1SEPA 1MABB 1AKVA 1S8NA 1GD1O 2AQKA 2PUCA 2YTZA 2PKEA 3CRNA 1F1JA 4O1MA 4W9NA 4V0LA 1OI2A 3G1UA 3TIIA 2OAQ1 3C3YA 2RBKA 1JTFA 4BWFB 1K08A 3CRVA 1R6BX 2IP2A 2O5RA 4DR7B 1V45E 3AY0A 3OOHA 4RV4A 4GMKA 1BFUA 3SSAA 2MR6A 1AX9A 2I3AA 4J4HA 1S01A 3WGNA 3QITA 2OV8A 4M60A 1SU8A 1GLVA 1XAHA 1CFZA 1CUVA 5E6SA 2IIPA 3TG8A 3DDOA 4S1WA 3RSZA 2B0CA 5B1EA 4G23A 1P1BA 5IAKA 1QKIA 4PAGA 2FSPA 5T41A 3NTOA 5K0SA 4DIUA 1VMAA 2JJYA 2UYGA 1WMEA 4N49A 4O4HA 2CJPA 4CG1A 5C7OO 2Y68A 4DV3B 3R9XA 2FR1A 3LD9A 4HNQA 3QX9A 4BJ3A 3JTMA 3AVYA 5IJXA 4OKSA 3RFVA 3QPWA 4GKAA 4DLAA 4QFDA 3KOUA 4QRIA 3URMA 5AI6A 1N77A 2YWXA 3LY5A 4JP1A 2VDVE 4WN3A 2JDID 2QQGA 4NBSA 1WP9A 2M6LA 2C4UA 4LUCA 3D7SA 1QXSA 2GN2A 4HQRA 1GN9A 1R8XA 3F5MA 3JW8A 3M4JA 4MPJA 5BSEA 4LFAB 3GGJA 2BT4A 2QGZA 1M6VB 4EFMA 3VKVA 2QP4A 1B0UA 5DBEX 2CC2A 2PUBA 3PVZA 1JIVA 2BLLA 2OLKA 3BX1A 2CXXA 4DMFA 4ENRA 3E9EA 1A8UA 2FMFA 3HA2A 3QFFA 4DUGA 5I48A 3AF1A 1QF7A 2Y2UA 4JZYA 5AK4A 3VQTA 4TMTA 2C9BA 2Q3EA 3J7AC 2HCTA 3DM5A 2UVQA 4KVZA 5KSWB 2IOFK 5ICMA 3UVEA 4OA8A 2UXCB 1BS9A 1XL1A 2GDZA 1GGJA 1HFWA 3AZQA 3EGDA 1UZNA 2RKOA 3ADPA 3K4HA 1U3UA 4R01A 4RFVA 3RVOA 3JQBC 4BNJA 1M2HA 3RS4A 1KU0A 1T25A 2QMZA 4I66A 1N0UA 2J30A 3P9ZA 1AS2A 3SJCA 1VJDA 1UH5A 1SFRA 3AVQA 3LHFA 4GBGA 5T64A 3RVPA 3WIEA 4KRGA 5I3CA 4JX9A 1JYSA 3U3MA 2BGJA 3RT7A 4OQLA 3AESA 4E2WA 2AN5A 1K5DA 2VK2A 3QIVA 3ICVA 2O3SA 4PNEA 3AJEA 3N7AA 3BEOA 2WVGA 1S3IA 3FH0A 4YGYA 3ZOKA 5HQ3B 5JFOA 5K8UA 2VSNA 2XUDA 3RUHA 3RJMA 4AMYA 3LUDA 2OTCA 2OGTA 3H5TA 4MVXA 4U8GA 4QATA 3G13A 4NESA 2O0LA 1A50B 4Q9DA 4B47A 3ENVA 4C4SA 4BWYA 3DC2A 1TM7E 1ZFNA 1QRDA 4XD7A 3RAPR 4HB3A 2CL7X 2OAEA 3DE3X 3IEUA 3JQRA 3HXLA 5D00A 4BL5A 2HLPA 4YAKA 2V6GA 3O1HB 3HG7A 2OC9A 5B30A 3M70A 3ZNQA 1UKBA 2IITA 3H19A 4RPIA 2OYRA 5EIFA 3RANA 1JG7A 2IS6A 4EMTA 2A1TS 2XEXA 5EP4A 2FQXA 2GCIA 1OLUA 1Y37A 2PL9A 3IJPA 2VFAA 5DE3A 1AOXA 5GV8A 2VBFA 2F1KA 3RC3A 3SHWA 1UK6A 1H2R