4KR6A

Crystal structure of a 4-thiouridine synthetase - rna complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
388
structure length
388
Chain Sequence
MEELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA sulfurtransferase
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/rna
total genus 132
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr6A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr6A02
1ZJWA 1PFWA 3LDGA 1GTRA 1QTQA 5H16A 3CVVA 1PFVA 1KH1A 4AS1A 4MW1A 2C5SA 4MW4A 4JXXA 3ZJTA 5FO0A 2X0KA 3L93A 3IDFA 3IVGA 3E27A 4MW9A 3HMQA 4CT0A 3DV2A 3UMVA 1O6BA 1KQPA 1N2IA 2X1LA 4MUNA 1ILEA 1K4KA 5H7XA 2YWBA 4RPIA 3IUEA 2PZ8A 4OUDA 1U7XA 4QREA 3IMCA 4MUHA 3RBAA 4BWVA 4K0RA 1X6VA 1JIIA 4ZT3A 4XSVA 2OV4A 3CLSC 3CVXA 1IQ0A 4J75A 3A4IA 1QU3A 4MW7A 1WJGA 1NUSA 1WKBA 1O97C 3LOQA 1N2BA 1XNJA 4Q93A 1N75A 3Q4GA 4EG5A 1IVSA 4K03A 2X3FA 4EFKA 3RK1A 1VBMA 4MUGA 3IODA 3VRHA 1Q77A 1CT9A 3TM4A 4ZCTA 4MUJA 5KCMA 1O94C 4GRIA 2V0GA 3H99A 1EUQA 1J20A 4KPUA 3LE8A 1J09A 3FOCA 3PNVA 4OJMX 4XFJA 2DPLA 4DLPA 2WB2A 2HZ7A 4HK4A 5TS2A 3SZ3A 1TYBE 4DDHA 5F23A 3COWA 3H9BA 2E21A 1G8GA 1LI7A 2CSXA 5LFAA 2AZXA 4NZPA 5J58A 3IVXA 5TEVA 1TEZA 1EUYA 2QUKA 4OUDB 2J08A 4A91A 1R6UA 1UFVA 4DJAA 1OBHA 3MUEA 3RFFA 2G36A 3AIIA 1JIKA 1A8HA 4I6EA 1V47A 5K0SA 5DASA 2WQ7A 1NUUA 5AHWA 4YP6A 4PBTA 4CQNA 2QUIA 4ZT2A 3CLRC 1RQGA 3A04A 3UK2A 1S4MA 2J5BA 2YWCA 4YP5A 1NURA 1YUMA 1O5TA 4UZEA 3G5AA 2RD2A 1P7PA 1XNHA 1OD6A 2A88A 2CYCA 3FETA 5IHXA 5LM3A 4KPUB 1Q19A 4TS1A 3CVWA 1K4MA 1PFYA 1KQNA 2DR2A 3P0JA 3FIUA 1J70A 2CV0A 3QTBA 4F3RA 2A1TS 4UZFA 4JFAA 2I1LA 4U7JA 3TS1A 1QRTA 2BYTA 3F3MA 5J59A 4DNXA 1F7VA 3NBAA 3RHSA 1V8FA 4MW0A 3HV0A 4MUIA 3K32A 4MWBA 1OWMA 3LCJA 2WQ6A 3CLUD 1QQTA 3ZIUA 1GZUA 1MB9A 2QUJA 1JZSA 3AL0C 2JA2A 1YIAA 4ZCPA 4KR9A 1MAUA 1HYBA 2R5WA 5BNZA 5IJXA 3H9CA 3ND6A 3S3TA 1N2OA 4EG3A 3ZJUA 4HJRA 2X1MA 3PNBA 1R6TA 3RK0A 5DK4A 5JBNA 1DNPA 1GN8A 1G8FA 2BTEA 3LDUA 2Z08A 1N78A 1EFVA 1K92A 1GAXA 4XFDA 1ZH0A 1QJCA 3IOCA 4MUEA 1U0BB 4PBRA 1M83A 4WSOA 4YMIA 1SURA 1OWPA 3X1KA 4EF6A 1N2GA 2OQ2A 3DPIA 4R2LA 1VLHA 4NATA 3JXEA 3V97A 1O95C 2O8VA 2QJTA 4NAHA 5DB4A 5K0TA 3SP1A 3TZEA 3V8VA 1Q11A 1WOYA 1FYDA 1J1UA 4EGAA 3GUZA 1NUPA 1KAMA 4L2IA 1JHDA 1KORA 5KHAA 3FY4A 3H97A 1M8GA 1OWOA 2A4MA 3X1JA 4ZCRA 4QBTA 1M8JA 1MAWA 3FH0A 3IVCA 3A2KA 3IOEA 1MOPA 2J09A 2A1TR 3VU8A 1IHOA 1H1TA 1I6MA 3COZA 4U63A 4ZT7A 2IELA 1WXHA 4MW2A 4NDAA 4P2BA 1IFXA 1R6XA 5HUHA 3CVUA 1H3EA 3TM5A 4EG1A 5KWVA 2RE8A 3ZJVA 1OWNA 1K97A 3MXTA 1IQUA 3ISJA 4MW6A 1PG2A 2AG6A 3GLVA 2D54A 2CV2A 4DE5A 4MWDA 1N77A 2CYBA 3FDXA 1F9AA 1VBKA 3ND5A 4PBSA 2DUMA 1N2JA 2QJFA 3A05A 2CYAA 2EJCA 2ZUEA 3RJZA 1O94D 1NI5A 1NUTA 1XNGA 1NP7A 4YBRA 4G6ZA 1G8HA 2XRZA 2E0IA 1T6ZA 4NX2A 3K0BA 4ZT6A 1U7DA 4EG7A 3AKZA 4L2IB 3VGJA 2A7XA 1J1ZA 2CUZA 1B6TA 2J07A 4JYZA 3HZRA 1KQOA 3UC5A 4MVYA 3C8ZA 2NSYA 3K9WA 2DLCX 1TYDE 2V0CA 5HUJA 3TMAA 2TS1A 3SEQA 1N2EA 1WY5A 3UY4A 3TQIA 3SYTA 4JXZA 2DEUA 4S1OA 1I6LA 3I05A 4KKVA 1WQ3A 2WSIA 3P0IA 1JEEA 4ND7A 2QTMA 1XJQA 1X8XA 1T6YA 2NZ2A 3CLTD 4MVCA 1PFUA 4NAUA 2Z3VA 3U1VA 3DO8A 1IH8A 1JECA 2GKSA 3KT8A 1Q15A 3CLRD 1O0CA 1M8KA 1M8FA 1NUQA 3IMGA 1JILA 1EFPA 3KFLA 3ZGZA 4I6GA 3N2YA 1H3NA 2PZAA 1EXDA 4G5YA 1YI8A 3HFJA 3MLBA 1M8PA 1KH2A 1O0BA 2IP1A 2QTNA 3FG9A 1PG0A 1WZ2A 1O96A 2VTBA 3BL5A 2HGZA 5DEOA 4X0EA 1F4LA 1VL2A 3TQOA 3X1MA 2DETA 4DDMA 3NBKA 1IQRA 1LW7A 1WQ4A 1YULA 3OTWA 2J4DA 2QTRA 3IUBA 3OP1A 3SDBA 4E1AA 1N3LA 3QTTA 3FNRA 2VXOA 4MULA 1T6XA 1JZQA 1LI5A 1TYCA 5LLTA 3MLAA 1MC1A 3N9IA 3INNA 3COYA 3Q12A 3TNJA 4EG8A 1U3CA 3Q10A 1FFYA 2YXNA 2D5BA 1MBZA 1NZJA 3ZXIA 1JIJA 1EFPB 3FHJA 4MQ6A 1NSYA 2PG3A 3KT0A 1WXFA 2A86A 2JANA 2PIDA 2PZBA 3ELBA 4MLPA 1N1DA 1KAQA 1M1ZA 4J76A 1KP3A 3MMXA 4YP7A 1ZUNA 4ZCQA 1KR2A 1WXGA 4MWCA 4Q16A 5TGTA 4KR6A 1YUNA 5EKDA 2A84A 2HMAA 1D2RA 3G6KA 4ND6A 1EJ2A 3AFHA 5FO1A 1ULHA 4MWEA 4ZCSA 1O96B 2VTBB 1QRSA 4I6JA 2PXHA 3L92A 3DLAA 3SZGA 3IH5A 1G59A 1MRZA 3PRHA 4ARCA 1TFUA 2Z09A 1T9GR 1EFVB 2ZUFA 3PNYA 2YY5A 4FZJA 4G5FA 1O95D 4HPWA 2A1UA 4MVWA 1GLNA 1JGTA 1TYAE 3CLSD 1IRXA 1I2DA 3D6UA 4MAFA 4R2MA 2GOYA 1QU2A 1OWLA 3ND7A 1BS2A 1O97D 4H3SA 5J5AA 3G59A 3N8HA 1NYLA 3IOBA 2H2AA 2ZP1A 4MUKA 4EG6A 4DDKA 4CDMA 1VBNA 2CFOA 1GPMA 1I6KA 2H29A 2CT8A 1QNFA 3GMIA 4QRDA 1U3DA 1Y42X 3D6VA 5HG0A 4ARIA 4F4HA 2CV1A 3SEZA 1ZH6A 1OBCA 4HJXA 4PY2A 1F7UA 2IJGX 1J21A 2AKEA 1KH3A 1N2HA 3N05A 3UOWA 1JMVA 2E89A 4U8HA 2DXIA 3FI0A 1EE1A 1TQ8A 4KR7A 4JZYA 4GU5A 3TZLA 3PXUA 3ZXSA 2JAXA 3KT6A 1WXIA 3HL4A 3NV7A 1GTSA 1QRUA 1MB2A 1JEDA 3HGMA 3CLTC 3IMEA 4ZT5A 2EL7A 2A1UB 4EG4A 3TLJA 3H05A 1MJHA 1WXEA 1T9GS 2QUHA 3CLUC 4MUFA 1COZA 3CVYA 1KP2A 4MVXA 3CA8A 3FWKA 3ILVA 4AQ7A 2O5RA 4RUKA 3M5WA 3QE4A 2PFSA 1H3FA 4ZT4A 3COVA 2QJOA 3CR8A 4R0NA 4WNYA 3P52A 1KKUA 2GM3A 5FNZA 4MW5A 3ZUGA 3AG5A 2XRYA 2D13A 3P0HA 3KT3A 4CDNA 1YIDA 2B7LA 3AG6A 2DERA 5TEWA 2E18A
chains in the Genus database with same CATH superfamily
3MHPA 3SKYA 2WD7B 3W6OA 1T9DA 1VSTA 1VSVA 4NI5A 3UVEA 1HI9A 2PUCA 4I50F 3L06A 3ICQB 4B82A 3B6ZA 4UARA 3CUSA 2BGWA 3VTKA 3U62A 1P29A 3AI1A 3FPLA 3ZJTA 2W7TA 5LNK1 1V26A 3D6FA 4ICIA 1T4DA 1H93A 5ILGA 3WGLA 5INTA 2AF3C 4G0UA 3BXEA 4LHZA 1UP6A 2B1IA 1OI3A 1O87A 2C0CA 1XHFA 5CTJA 2JGDB 1Z37A 2EYQA 4H3KB 1YCHA 2XQFA 5GJWC 1GKIA 4PC1A 5BVGA 3OZVA 3LZ6A 2IYYA 2ODEA 2FLVA 4YNBA 4E09A 2QMYA 3GFTA 3QVSA 2XF8A 2XUAA 1VG0B 3FPAA 4WECA 2ICAA 4MCJA 1VFNA 1T8YA 1SVWA 4CKEB 4MVJM 1UPBA 4HZUA 2NTEA 3AKDA 2JEZA 2DC1A 2ZT7A 2QLBA 3NBMA 4V0OA 5BP7A 3HUFA 4FEEA 1QDEA 2WJ6A 4ZT3A 2OG1A 1R8QA 3PXGA 1SC9A 3MPOA 1XMOB 1R6DA 3ONVA 3G2JA 4HMQA 3WRYC 4X6YA 3QXXA 4FCCA 4MW7A 4UOEA 3B12A 4BVAA 1GPYA 3OPYI 4KDRA 4UTNA 1GCIA 3O4VA 1CR6A 5CX1B 1VHQA 4S0ZA 5HGXA 3ZY6A 4REQA 1NPDA 2J31A 1BXRB 1RZ3A 3FYTA 4MR8B 4N5HX 4RQTA 3LK7A 5EHQA 4C7KA 3URKA 1DFIA 4YUXA 2WZDA 3E7FA 3LCUA 1MJ5A 2IL1A 3D7SA 4O59O 1ZK4A 2O8CA 4DVJA 1JLKA 2FW7A 3HHEA 3ISTA 4UE3S 3J7AC 4GICA 2R79A 1VOTA 2V0GA 1VG9B 5AXDA 1VI5A 5T3YA 3DCYA 2JLAA 3MJEA 4H0FA 1TCCA 2Q5HA 4XPIB 4G0PA 5CK5A 1ZGAA 4ERXA 4YJKA 2ZATA 2DHCA 3FLMA 3I72A 4JYBA 1WVMA 1LI7A 1YS4A 4HMPA 1QUFA 3KUUA 2CNWD 4DPLA 3W4KA 4A16A 4ZYTA 2HNKA 3NVAA 3UXHA 1MG5A 1YRQA 2CFRA 3U3OA 2W2TA 4LDPA 3U3DA 3UZUA 3ZX4A 1HYQA 4K9LA 4YMWA 2P9TA 1XAHA 1H8HD 4K9RA 4JSYA 2IYRA 3MOIA 3JYPA 5EJ9A 1LVHA 4AWBA 5C1PA 3GFBA 3VR6H 1JPJA 4V0QA 2I1QA 4P3YA 4R3WA 1P2UA 2BFFB 3P9RA 4RVSA 5SY4A 5K0SA 1G4UR 1OX5A 2ZS7A 1D09A 4JJ6A 2F3RA 1GNRA 5EJFA 3M70A 3RAPR 4HNRA 5KTPA 5J2UA 2BFAA 2YQZA 1KPIA 4FEYA 4G23A 4KDEA 5DM0A 2QQEA 1UQUA 2IEZA 3GRPA 4GZ5A 4IUYA 4JKOA 4M1EA 3U37A 1TQ6A 4DCUA 2Q4BA 4YP5A 4M0DA 4Z9AA 4BMYA 3O21A 4DLBA 2LTAA 4B80A 3FR8A 4W1PA 4EI2A 4PGAA 5LJLA 1QRDA 4KLNA 1BQEA 1VGQA 2VCYA 2H0AA 3W77A 1AK9A 1VSUA 3IHLA 1C4XA 2NWQA 2VT7A 3H2ZA 4TS1A 1T5BA 1F4PA 2MU1A 3MWJA 2UYGA 1K4MA 3LXMA 3AWIA 3MELA 3UCEA 5TQ2A 1J0DA 4XQ0A 1ONOA 5A0TA 3M6MD 4BNUA 4R05A 3DBRA 3TQQA 1UF9A 3AJDA 4Q9NA 3EULA 3DHWC 4EB6A 3H8JA 4MMYB 1OT5A 3EJ6A 5KOHB 4WEQA 2PJZA 3W79A 3DFIA 5EE5B 1E18A 2D74A 4WZAB 4BV8A 2PVCA 4A15A 3S8YA 1J8DA 1GSOA 4B6RA 5M04A 3V3TA 5BSMA 3RARA 3G49A 3VO8A 3HV0A 4EMTA 2HCFA 1W581 5JC8A 3HM2A 2AUTA 3P0FA 5GQSA 4AO6A 4TL8A 1FU8A 3ANLA 4GZ3A 4HWOA 1VE1A 2IEIA 3COSA 5K8JB 1JR6A 2IW3A 5IVPA 1E60A 1ZIYA 1RAHA 1U9YA 1V8PA 1YR2A 2I67A 3HR8A 3I9V6 2ISCA 4L22A 4RW0A 4PQFA 5EKUA 5H0IA 5B57C 1M54A 2QM8A 3UMGA 1F12A 3AR9A 4KR9A 1TNDA 4G89A 3JD4A 4EENA 3JV7A 2VSOA 3L05A 4M89A 3PLRA 5IJXA 4CQLB 3MFQA 4EG3A 1WP9A 2CNOA 1V9SA 5E9QA 3ZJUA 2MYNA 3KV3O 2X14A 4H4CA 4ZEOA 3CF4A 4O2AA 1MF7A 2WJ3A 4U7HA 3QFSA 5IRCD 5HVNA 1X1BA 1YDEA 1A71A 4Q3BA 4AVYA 4IZIA 3DT8A 3TF5A 4TSFD 4L0QA 2YVKA 2FWNA 4Z4EA 3AXSA 4ITUA 4UW9A 5EP2A 2BSAA 3WNBA 2X0FA 4MNTA 1MR3F 4PBRA 2O3RA 2I4RA 1Y6RA 4E2FA 3EFHA 2M32A 3WTBA 2QORA 3S2YA 4HDCA 4IM7A 4C0WA 1J8FA 5CAEA 1KOJA 1JR2A 1FE8A 3O95A 4QWMA 5TV2A 1Z5UA 3R9XB 5E8JA 2ZJYA 3HJCA 2QP3A 4NJMA 2QRVB 4W7HA 1SG0A 4JU9A 4NAHA 2OGTA 4ZQIA 4P3XA 1JJVA 2YFYA 3H8WA 3QV2A 5K0ZA 4NYJR 4BYGA 3G7UA 1HDZA 5EPEA 1LSJA 1NIPA 1MV5A 1ATZA 1E0DA 1Q14A 2CHEA 4U2BA 2G9QA 5KTMA 4DT1A 5JCXA 1GILA 3BMNB 1A2QA 3TFQA 1KIMA 1MXHA 2Y0BA 3D2AA 4K1XA 1V1MB 1J8QA 3PRJA 1R1DA 3CIFA 3CMMA 5A9RA 1MTOA 5E9JA 5U1PA 1TOAA 2VG8A 3U17A 3EG5A 4EHNA 1O77A 3P1JA 1NVDA 2GN1A 4LZPA 5EN4A 5EUCA 3A27A 3PJFA 1EDDA 2ZI6A 5ARCA 3V8EA 4ZI3A 5JROA 4NMXB 1ZR4A 1U80A 3W5AA 1T2CA 4LJ6A 4KXVA 4BQIA 3V1NA 3VU8A 6ADHA 3UQYS 1H1TA 1TEXA 2R6CA 2ZETA 2CFTA 2F06A 2NYUA 3HXQA 3DXXA 1B6GA 3IIJA 2YIJA 4FYYA 1X8LA 1F0NA 1JA1A 2J7KA 2JLCA 3VUEA 4NDAA 2WHPA 4XQCA 4JUFA 3CVUA 4Z4QA 2HH9A 2J5XA 1A88A 2DR0A 2C7GA 3MM4A 3PHBE 4EG1A 1LDGA 4KE8A 1Y6QA 2O2IA 3T1HB 4UAJA 3BGOS 3GLVA 1AMUA 1HLGA 3RS8A 5FFNA 1SKMA 3WLFA 5J2UF 3BULA 4DC9A 1FX0B 3FMGA 4DKXA 3GZJA 2AG0A 2RDMA 1UMDA 3N0VA 1IN6A 1AMOA 1Z4NA 2PGDA 3LKDA 3A05A 3OT1B 2FN4A 2EJCA 4GR5A 1SQ5A 2C4NA 2HSGA 5EY5B 4RZQA 3QFFA 3Q6NA 5EJ6A 5JFTA 1HH4A 4Y2QA 3P2KA 3OA0A 3KPVA 4F85A 3WV4A 1XOIA 4N40A 3K0BA 2HRDA 2ZRLA 4BV9A 2IRWA 2X42A 1Z4IA 1Z17A 3DL4A 3PR1A 4MWSA 3P9NA 4Y9TA 4M0KA 4QX6A 2G67A 1ZC4A 3AKEA 5FJJA 1JF8A 1ZN7A 4KLZA 4KTTE 4RIHA 3QMWA 2WF8A 5IN5A 3JVEA 1WABA 4IVRA 5LQRA 1N7IA 2PANA 2RAPA 2WUWE 3KJXA 4D3ZA 1QQ6A 3K9WA 1I36A 4PYLA 5KDOA 3QPBA 5FOTA 4P0TA 4WFKA 3GT3A 3ZU4A 3HLYA 2BHSA 2RHWA 4I4LA 2VT2A 1N2EA 2FWIA 3EAGA 3TQIA 5FP0A 1YH3A 1ES9A 1H0HA 5LSAA 3V2HA 3QENA 3LQ1A 1TJNA 2XXAB 1Z8NA 4L85A 1DJOA 3HCDA 4LJKA 1X1DA 4UNNA 2VYFA 4PONA 1P1JA 2GNAA 3U1VA 3PHCA 4EPTA 2C94A 2O8NA 3BN3A 5TVGA 2Q5JA 4UUBA 2AE2A 4LCJA 3K70C 1G5TA 2A0XA 4TQAA 2AOXA 3E2MA 1XAIA 4FWBA 1EDEA 5F7JA 3AFIA 1NUQA 1NYRA 3IMGA 4HX5A 3BMXA 1K8QA 2OKCA 3QVTA 4K3UA 3GJ4A 4O4JA 5DYYA 5H70A 3TNYA 2B1QA 2NTNA 1UC5B 4OHFA 3RAEC 1Z4LA 2Y1KA 2Z04A 4O2AF 1H3NA 2C9DA 2IYTA 5EZYF 1PL7A 3UW3A 2IEGA 2P27A 1TF7A 1YZFA 5CM9C 2JGFA 2O05A 3CT6A 1K68A 2HWWA 4MIYA 4AIRA 1YDWA 2DQKA 2JIQA 2W6PA 1CUHA 3DZCA 3VGPA 2J32A 3OZEA 1SBYA 4M0MA 3BIJA 3W2EA 3OM8A 1GGVA 3FRHA 2DETA 4LV5B 1FRFS 2VP3A 3LX6A 4HB4A 1FVXA 5EP3A 1GV1A 2VKQA 2Y99A 3SQNA 5TPZA 3TLKA 5COAA 5CCDA 3DDZX 1ZJ6A 2Y2UA 1BYIA 2XDYA 4G1MB 1OXXK 1TAGA 2EJBA 2ONYA 2V7WA 2VYCA 4D02A 1AU9A 4A0RA 2NZWA 4X3PA 2GLUA 3UG6A 4C4YA 3W6ZA 3A2LA 1O1YA 3TQTA 5FULA 1FIUA 1NIJA 4LWOA 3VZSA 3T41A 1CY4A 1XPUA 1FFXA 2EBUA 3TTSA 4EG8A 2ADFA 3THYB 4NU6A 2KWIA 1XK6A 1DU4A 5I9IA 1M6YA 2EGHA 2MSWA 3QWHA 4KVZA 3UJ9A 1TM2A 2WHEA 3RC9A 5K3BA 1R9NA 2C2ZA 2C5FA 5DGHA 4ALLA 2RHTA 2DPXA 1NSYA 2PG3A 3JQDA 3MCUA 2HIHA 3RF6A 1IG0A 2PZFA 4OATA 1HE1C 3DB2A 3K5PA 3O5AA 3PS9A 3BA1A 2UVQA 4UXHA 1FSZA 4IR7A 4DRXA 2JLXA 1PD0A 3SYMA 5AO9A 1GA1A 1Y5RA 2FPSA 3TRIA 5LQAA 4XWKA 4M98A 3R9KA 4DCOA 1DG1G 2OAQ1 2Q62A 3P9IA 1EJ2A 1AUOA 2X4DA 1X0XA 1H0RA 3KEOA 5FO1A 3M4YA 3QYPA 4IOMA 1JXQA 1C8LA 1NY5A 1WLSA 1V3UA 2B8EA 3I3OA 4NL4H 3VSDA 1R66A 2ZR0A 4JLVA 4WY2A 3WRYA 2OV2A 3Q9SA 4ZI7F 4PSDA 2MHCA 4WKGA 3BERA 5EZ6B 3RFUA 3QVOA 1O4WA 1EFDN 1SUAA 4X65B 2IIBA 4U8GA 4RXTA 3QX3A 1G42A 1XTUA 2BGKA 2DBZA 2IEAA 2UYCA 1SNYA 5CVUA 3EC7A 1EIWA 2FZCA 3K30A 1QTIA 5TB5A 5EJAA 3JTEA 2ZW9A 1S3IA 1PJQA 3P9XA 3CR7A 4CMIA 4TWIA 3R9WA 3QY0A 3KXIA 2BRUC 2ZE6A 3IUPA 2EC5A 2CXTA 3P27A 2H2AA 1G4HA 2WSYB 4MRRA 1L5WA 2XMCA 4X45A 1MNAA 4QBHA 5IABA 3D3WA 3M9LA 4MV6A 2FSGA 1IVNA 3UPDA 4Z7OB 5AW8A 5AW6A 2FU5C 4WZAE 1L8QA 4TZ6A 3BDAA 3SJBA 4J6EA 2PLAA 1ARZA 3K6JA 3N8NA 3WB1A 3A4TA 5HWSA 3NDBB 4XX1A 1ISPA 5TXGA 5HBRA 4RELA 2X15A 3H2GA 3AFMA 4KMSA 3LXXA 1F8FA 4Z3KA 4L6IA 1HE4A 2FPKA 4Q02A 1YRBA 4ZHQA 4CF7A 2IE8A 1XZ8A 1CB0A 1JMVA 1TXGA 2ZAGA 3ZK8A 2PCLA 4EVIA 1F5NA 5J5CA 1IVYA 3MAJA 3OTHA 4FOLA 2NIPA 2JIMA 8OHMA 4Q4LA 5COBA 1HTWA 1WB9A 1NVUQ 4MV8A 5F4BA 1HLPA 1VXOA 5D1NA 5C7IO 1ESDA 2CVHA 1TCUA 2G9UA 3C5WP 4YN3A 4AUKA 2QX4A 4YDSA 4BFZA 5LA6F 3ZWXA 3ICCA 1RYHA 1FFGA 2FY8A 2CUNA 2JF0A 2PTGA 3HDVA 4REOA 2Z43A 1EJ0A 3D5QA 4E5KA 1RZUA 2PM8A 3BHMA 3YASA 2FKAA 5EXDA 1OLXA 4F9GA 3TLJA 2DT8A 2K87A 1CZNA 1X1CA 1U2PA 4DQLA 2FP3A 1W5SA 5JG7A 3CVYA 4J0HA 3ZDYB 5EYPB 3K9BA 2GAAA 1KQFA 1Q7BA 3D6AA 1IK4A 4LV8B 1FFCA 4D9NA 5BNTA 3B1ZA 1IPEA 1JHOA 3R75A 3UPTA 2O5RA 2RONA 1LC3A 2PFSA 4EKNB 1BQ4A 2M6KA 1R2QA 3FFAA 4BB9A 3VUFA 3PFKA 3MD9A 2FEWB 2ZRIA 1M3SA 4JNCA 4WNYA 3Q0IA 2OD7A 5HZGA 1QFSA 5D00A 3C3XA 3WYEA 4L5AA 4O02B 1U7OA 2GZRA 2QMZA 1FSGA 4MJ3A 1Q6YA 3ZDZB 1JHZA 2REXB 1ZCBA 1QB7A 4E11A 1VMKA 2I2BA 3I39X 1DKOA 1OUMA 2XUZA 1V3VA 2H4FA 4PRKA 1SO8A 2NT3A 4H9GA 1G2OA 3ZNPA 1H65A 4HVAA 2OCAA 2HRCA 4KYVA 4KP7A 5HMMA 3UNXA 4BLRA 1DP4A 2ZVPX 3DXFA 5JZ9A 1GU7A 3MERA 4Q47A 3DMTC 4YRZA 2HJGA 4BMXA 4XQ9A 4GMXA 1G8AA 4TMXA 4W1QA 1Z29A 1PZEA 3RF7A 4FI3C 4IIYA 2YV5A 1CYDA 5HJ5A 3H5WA 2VHWA 2YRFA 4PX2A 3GXOA 1B8OA 4EKDA 2Y1OA 3G0BA 3P96A 4EW3A 3S81A 5JJKA 2BAGA 1EFRA 1HFKA 4B7XA 1C80A 2C5SA 1ZN9A 3N5CA 5AVUA 1FDWA 4MLZA 3K0AB 4I9GA 2ADOA 5DIZA 1JR3A 3HMQA 4YQYA 3B1YA 3LT5A 4G1UC 3A4YA 4II2A 3G8CA 3WP1B 4RVHA 4GX2A 3WP0A 3TFWA 4PZZA 4AJPA 3L41A 1OBFO 1Q83A 4U6QA 3ZXUB 3D2LA 3A1TA 1OU0A 4JR0A 2G6BA 4XJVA 5ENDA 3UMBA 3VR6A 4DG5A 2O2JA 4A1FA 1RXEA 2GXUA 5C8DA 3UKJA 3C8DA 4PLWA 4IF4A 1MO3A 3MWLA 4AK9A 4RA9B 3FA2A 4YRBA 3QVWA 1Y1LA 4ZVOA 2I6GA 4FOOA 4BCDA 4F45A 3LO5A 4KNVA 2CNLA 1GNLA 1S5PA 3L8HA 2PEYA 5E7QA 1WJGA 4P0QB 4UNIA 1O97C 2QN6A 4ML3A 4C9BA 3B6EA 3TXXA 1HX7A 4IOLA 1UDXA 2EVWX 4TXLA 2SNIE 3RHFA 4K2AA 5GONB 3DAPA 2P9HA 4FOPA 1SIUA 2JAUA 2ZUUA 5JEDA 2PLFA 1KEEA 2W37A 1N3YA 4FOTA 4QUDA 2X8JA 5DBGA 3ZDQA 1PYOA 3FMFA 4HS4A 3EY4A 2Q9CA 1WL8A 5CNJA 5H68A 3V4PB 4J1TC 3I58A 1NQAO 3JAKA 3KQUA 2BGMA 3E3OA 2GCEA 1N2CA 3FYUB 3WZMA 1IHPA 2NO5A 1VE5A 3GWZA 3GXBA 3O7MA 1SEVA 4UEWA 3H99A 3RYIB 2XMGA 4KPUA 4ZHQF 4BEBA 2C2WA 3SZ3A 3WO1A 4I50B 3NHWA 5KYWA 2BEWA 1UFOA 3QVMA 1OXVA 3RNOA 4ZGGA 4MVJG 1JEQB 4C20A 3PE3A 3HM9A 3HKEA 1CKEA 2DWUA 1PR6A 4E6PA 3Q9UA 1G291 1EP9A 5CVEA 3C1MA 4ND8A 1Z3IX 3MJSA 4E07A 4OUDB 1XLVA 4WKOA 3RVPA 4C04A 4DJAA 4KMMA 4B4WA 3X1DA 3W7VA 2BCEA 1F06A 3EOAI 2VXBA 3P19A 1IHYA 3AIIA 3CF2A 4ZHSA 5AVWA 1ZL2A 5LN1A 2XGSA 3THWA 2Z6UA 3EQ7A 1I1HA 1XJ5A 2Z5FA 4OHOA 2P9GA 3U4GA 5ECGC 4C4AA 3NLLA 1B8PA 5A06A 3O75A 5FQNA 3GGCA 4FUTA 4L51A 3KS9A 5J3JA 1NVVR 3NYIA 5JXWA 5SV2A 1XYVA 2NACA 3KCQA 3M3HA 5BSFA 4MPRA 4CEHB 2D5IA 4XZ3A 1Y7PA 2IEBA 3EWNA 1J0XO 4B5LA 4CM3A 5JOQA 3E1KA 3E6AA 4EP1A 3PQ2A 3TG8A 3IQGX 4IWYA 1YQWA 4QRIA 5DP1A 2PGXA 3NRCA 4XI9A 4YBZA 1BEZA 1XMPA 5AKJA 3W5CA 1YGPA 5JNVA 2DM6A 3AL2A 5CA1F 4DGSA 2XQIA 1SBTA 2QRKA 4D9IA 2FZKA 3QTBA 4MYSA 3REQB 2A1TS 4EW2A 5LD2C 1LK7A 4JASB 1G8MA 2IS2A 1GQQA 2Y6VA 3QA3E 4PYKA 3TNLA 4HEHA 4FFSA 5A4FS 1HT1E 1VCHA 1SC4A 4XVQA 2QRPA 3OC6A 2P6PA 2WD9A 5EUBA 2ZJFA 3WGVA 4I5FA 3W4IA 1P9RA 5DNDA 1A4RA 5ICMA 2DFNA 4MUIA 1NQUA 4FBGA 2QD2A 1J07A 5BNFA 3VPXA 5GMOA 4AUEA 5D3MA 2FPXA 2WQ6A 1YL6A 1XDUA 1P0QA 1OVMA 4BGIA 1XCLA 1B7GO 1C9EA 1U2DC 4NBRA 3KTAB 1UAAA 4Y2XA 4RTQA 2DZDA 4WFIA 3F49S 5LQCA 1EBFA 1OXKB 1APBA 2RHCA 1Y3HA 3LT1A 4A27A 3KEFA 1R3DA 3OOEA 1WHTA 5F52A 3AL0C 3FGNA 4Z0HO 4QJ4A 2VRCD 3M81A 1E9CA 1I3CA 4ZQFA 2XKAA 4AQYB 3AB7A 1MENA 3SZLA 1VPEA 3RTGA 1YFZA 4CMCA 2NYRA 4TWBA 1KGSA 1FW8A 5FA6A 3HCBA 4YC7A 3IPRA 3GLGB 4DV3B 4UVGA 4N8EA 2OD2A 5A7GA 4E46A 1FDRA 3GLHA 4GMDA 2UZ1B 5FOUA 4QLOA 2IEDA 4KXXA 2G28A 5F1PA 1T3GA 5A5DA 3DVLA 3FYCA 3KK0A 2E82A 3G2LA 3IOCA 4YRTA 1R10A 2EQAA 1NFQA 2HMWA 1K7EB 2X5XA 3BYZA 1DBPA 4UTVA 1E2BA 2M1XA 1TI7A 4PHHA 1ENZA 3HJTA 4YPVA 4M1KA 4R1NA 2CV0A 3TTVA 2HHCA 1FVFA 4DCPA 1BH6A 2E4UA 2ZIEA 3OQHA 4JN6B 4QNRA 3ZIDA 3V97A 4TMVA 2AOTA 3HYSA 4RVDA 2DG2A 3W7AA 2H7CA 1ZWLA 1J2YA 1W75A 4J0EA 4N47A 3AINA 1YRAA 3EN0A 4QNMA 3L0ZA 4YRLA 1KYZA 1H8EA 5IUNC 5C4IA 2P9BA 3GFGA 5F5XA 3AF1A 3QXHA 2HYDA 2PS1A 2QN7A 2GCPA 3I2HA 1XTTA 3DV0A 1PEAA 3B60A 4RFLA 3F6SA 1Z4OA 1T8WA 3R77A 5JLJA 2RGNC 3DLIA 5U9CA 4LHYA 1MAWA 2X7JA 2HRZA 3EDCA 5KI6A 3PNKA 4Y9UA 4ZODA 5B12A 2YJ6A 4L8WB 3RUFA 3OKFA 4N5LA 5LIPA 2B6NA 1WUTA 1ADCA 1F51E 3AVPA 4L5IA 1JWBB 5I4BA 2VDNB 2G7MC 3O2QB 4A82A 5K6AA 3FR7A 4XGIA 1BDJA 3HKCA 4DY6A 3PD0A 3I4LA 2DWOA 2O2EA 5ALDA 3W05A 2C7PA 1KGDA 3PL5A 5GWXA 1IN5A 3C3BA 4XLZA 3T1TA 2PQ0A 1X77A 2RC6A 1ESCA 3NBQA 4HZUB 1DRKA 2M98A 2I1WA 4YT8A 3AZOA 2XDAA 1H2HA 3AETA 1TUEA 2BRUA 4GBJA 5D2CA 4KK4A 4M6WA 3RANA 5KYXA 4KE6A 4NS4A 3HP1A 3DTVA 2J3KA 2PUJA 3E7PA 4R3NA 5JBQA 1H6BA 2C3OA 1Y8AA 3D0QA 4OK5A 1T8UA 3ZVRA 3H4VA 3FUXA 1V11A 5C3MA 2VI5A 2NV2B 1FQJA 2QL7A 5TX7A 1U5BA 2AGVA 3F98A 1CE8B 2AE1A 3D4NA 3LBFA 3O03A 3SNKA 4UD2A 1NQWA 3L0OA 4OJNA 4DA8A 4IL5A 4GC5A 4LRTB 2A7XA 1A5SB 2ECOA 4RMHA 3T3PB 3UUEA 1I1OA 1LLCA 5IBQA 3AVXA 4KXFB 3QPWA 5KQMA 4ID9A 2YBEA 4C7XA 3BE5A 1HQCA 1GEGA 4OP3A 4QDXA 4F12A 3F7OA 1PEDA 4BX8A 4DOMA 4FT2A 3MGGA 3OZAA 4MK4A 4K3VA 3H6KA 3WLQA 4ENQA 3ILSA 3S0JA 1PV4A 4P7BA 3M6VA 4UDOA 1M67A 2HPHA 3SYTA 3COJA 1Q22A 3AJEA 4KKXB 1I6LA 5BRNA 4B2PA 2I6XA 2PUHA 4JLPA 1WZUA 1KMNA 2FRVA 1A9QA 3R5SA 2Z3VA 4F2WA 1IH8A 4YA6A 3OFND 4QWWA 4YV0A 3WLTA 1GPH1 1ORWA 2XUHA 4GYKA 4X71A 3I5AA 1Z0ZA 2OORC 4P8RA 1W5TA 5JC1A 5HYVA 3UGQA 1P1FA 5DDIP 2DHDA 3KZNA 2ZWMA 3GBSA 5K4HA 2XWBF 3STUA 2DBYA 3MA0A 3DONA 1MAHA 3EWAA 1G2IA 1QH8A 2R6GA 3FCXA 5TMEA 3S29A 1YC2A 4YCLA 1M6VA 4DR5B 5J2UB 2F90A 4KHPB 1OZFA 4B3FX 5BN3B 4I55A 2Y66A 3DR3A 4QASA 5F2EA 2P2YA 1AHIA 1FTYA 2JKYA 2P2NA 4HNTA 1L3IA 2OOKA 3GJ3A 3W5HA 1WB5A 1N7JA 3A9UA 5JH7B 2Z8XA 3GU3A 1HEYA 4R54A 1E79A 1RWBA 3NW9A 5FA5A 3GZNB 3B9BA 4X1IB 3RTBA 2I62A 2HDWA 4DF3A 3MWDA 4WXHA 3WQRA 4HXFB 2X7HA 1JALA 3HU2A 5CB4F 1QLHA 2P2GA 2LKDA 2J4DA 4X7RA 2XE7A 5B4VA 3DMTA 3PNQA 5HKAA 3OP1A 1THTA 2OLJA 2GHIA 1OXMA 1QZUA 3DBRB 3SSAA 3ZJ4A 3GEPA 4MULA 3TIFA 4EB6B 4WBNA 1UK6A 2B8TA 1XZIA 1VG8A 1WE2A 1LB1B 2IQIA 2I4LA 1P4AA 3B1KA 3KR2A 1KBZA 2X77A 3FGPA 4IIVA 3RM3A 5DNWA 1C0EA 4UM9D 1P8JA 5HZMA 3EMKA 2QZZA 2O1EA 1EFRD 3DV9A 1B0PA 2VWHA 1MBZA 3DT9A 3FOAA 4JT2A 3T06B 4ZTUB 2QUZA 5EJIA 4D80A 1Y7LA 1ZOPA 4BMVA 4DWOA 2GM4A 1NF2A 2Q9BA 1BKSB 4LDRA 4GRAA 1VPWA 2PYIA 4N9QA 2BMDA 4YAWA 1JR3D 3Q87B 3JR7A 1BG6A 3UJNA 1ICEA 1PX2A 3IKMB 5D5QA 4BTVA 3ZI4A 4Q6WA 3MPUA 1OU4A 5DNYB 1D2RA 3STXA 2KPOA 3VR6D 1SBZA 3HB4X 4EGFA 1H4QA 3FVRA 3HRIA 1SXGA 5EZYB 5CGZA 1U3FA 2CDNA 3JQAB 2DQ4A 4PNHA 3DMYA 4HS9A 4WBXC 1RBZA 2IPMA 3SHFA 3GFPA 4PGMA 4MHSA 3OJXA 4YCCA 2BUBA 1JFRA 5KYYA 4KEAA 1FW6A 1NI3A 1LLQA 3WGQA 5BRJA 3QE0A 3K9FC 1BKYA 3I01M 4IG4A 5ARDA 2IXDA 5J5AA 2IYQA 4B47A 1KI6A 4ENRA 5A9SA 3G59A 3THXA 2DYKA 3N8HA 4KMOA 1P1RA 4JV5B 1A5BB 1VB5A 3ND8A 2IYVA 3KOMA 1N6NA 2P62A 1N0UA 4KOAA 1ZR2A 1NTOA 5FB3A 2W6NA 5JSUA 1S4QA 4BEJA 2C7VA 3L8GA 3WE7A 1U8UA 1FJXA 4PO3X 1ZRMA 3SF8B 2IX3A 5K51A 5I7SA 3ZW7A 4KYTA 3S5UA 4G81A 4JBGA 4DT1B 1WM1A 4L07A 2EWMA 4RPJA 3VSAA 5JO0A 2GCGA 1RXIA 4Q7MB 2IJGX 3F1LA 3MEQA 4NYMQ 3CEAA 4P3OA 1JW9B 1YHYA 3P9SA 2C0PA 4QGFA 4OD0A 3MFYA 4NARA 4J0QA 4LKRA 3WV5A 1TQ8A 1JSLA 4HN2A 3SSOA 4YMUA 4BO2A 1MD9A 2Y1CA 3TMYA 3GO4A 4RADA 1VIDA 1QRUA 4BNVA 4MTLA 2WKSA 2VHYA 5IT4A 2VZ9A 3G8AA 4I1OA 4PYQA 4QQNA 4XWAA 1FMFA 1YZ3A 2A9VA 1TX4B 1AKQA 4LY6A 4OI4A 4WUTA 5EQTA 4MR7A 3GLGE 1IBKB 3ZD7A 1ZD9A 2I33A 1R37A 3GEIA 4NY1A 4IH9A 4UDNA 1MJHA 3FNBA 1Q50A 3F4KA 3JALA 3S4YA 1XU7A 1I7LA 1VYVA 2CLOB 2AMYA 3ZYZA 1BWRA 2O1XA 4RTSA 1HDCA 1VJDA 3PC4A 4KXNA 4TRNA 4ZI7B 3BSFA 2OLEA 2HCJB 2UYOA 4RUKA 3C4JA 4I55F 3CPSA 2EFEB 1UMDB 4NZZA 4ZZ0A 2CLFB 2PZMA 3HBNA 4QVGA 2QU8A 4RV5A 3DDUA 3ZG6A 4UATA 1VB3A 3RIXA 2VP6A 1EYZA 1J0CA 4ZK2A 5I7RA 1QP0A 2ZREA 3B1XA 4X41A 2HF2A 2V6MA 1RRGA 1JU3A 3EYWA 4CPDA 4WZBA 5ALYA 2IYAA 2ACWA 1ZNZA 2PXCA 1ECPA 5JAZA 3RIMA 2WZBA 1SKUA 1SQFA 2EEPA 5CFZA 1YFKA 2REQA 2XVMA 3ZZUA 2PKEA 2Z95A 4QUBA 2AOWA 2JVKA 2FYTA 4RY8A 2ZS8A 4YI3A 2PJUA 2ZTSA 3REFA 4LW8A 4WBNF 3CPJB 3RNLA 1XDDA 3OLXA 4CM5A 5B53A 1KZGB 4LRYA 4YASA 5L4NA 4EL0A 3K70D 1PK7A 2ZBUA 1U2DA 2YTZA 1RE0A 3HLTA 4RNCA 1I4TD 3NM4A 1Z38A 4OB8A 1CZRA 2JLVA 3AIOA 2V03A 1E3LA 4RPKA 4PE5B 4PX5A 3RC3A 3K94A 1G60A 1GKUB 4X7BA 5TS3A 2RH4A 3TAHA 2WHXA 4RHTA 4F84A 5EHXA 3VJKA 4ZANA 1QG6A 1NNSA 1SUEA 2JHCA 1RYNA 1X1EA 2XNJA 1M2WA 4DZRA 3DHEA 4OXNA 3MS2A 3NTRA 5LA6B 5F5LA 4CLOA 4W5QA 3EVTA 1F6WA 4PIMA 1K75A 4PQEA 3ZWVA 1CYEA 1SZPA 3HVJA 4LZWA 2D2IA 5ETJA 3LRXA 3A28A 4KUHA 1HT3A 4XYBA 5FTMA 3SU8A 2VTVA 4WOJA 1K6MA 2QX9A 3CUKA 2GHRA 4X95A 2XKJE 1DXHA 1BQ3A 1PZHA 4B85A 4P4TA 1L0BA 2BTQA 1UKVY 5EIBC 4RM3A 1PGOA 3RRFA 1EMDA 4JI5B 1U7XA 1IN1A 4MUHA 5JAQA 4MYHA 4US2R 3EVAA 1C3EA 3CXRA 2C9ZA 5CU7A 3PGKA 1CUZA 2H0RA 1NQTA 2WAAA 5AOCA 5GGXA 4Q66C 5T3UA 3EZGA 4DLKA 2D1QA 5JJ5A 5DBEX 1IQ0A 1FDIA 2JD0A 4KWIA 2AL7A 5FBLB 1JHAA 3L3BA 1MW9X 4UFOA 1Z7EA 4HGYA 4JOBA 5DRTA 3O6VA 4HGPA 1SKBA 2E5LB 2Q4RA 4FLEA 3OPVA 1K8ZB 4NCAA 2Q07A 1LF0A 3AOGA 5B37A 2OVFA 1M34A 3QVKA 2YN0A 2W5UA 4JOSA 4V38A 3CH4B 3STHA 3BTVA 2X2FA 3DE5X 3ITEA 4EFKA 4H7EA 2CF6A 4QYIB 1VM6A 2FUEA 3D3EA 5B1EA 3DVQX 2OOSA 4DSTA 2BEUA 2VHUA 1I7QB 3WIBA 3B3JA 5LOVB 4IEFB 4X66B 3TQCA 4E0BA 1Z5NA 3W90A 1RLTA 2RGNA 3ZVKA 2YJZA 1TGYA 4FIZA 2ZXUA 1E3MA 4DLPA 2H1FA 5EWJA 1UH5A 3PVZA 1MJGM 5FL3A 1TYBE 4E12A 4BATA 2ZDQA 1XL1A 4FBMA 4Y2RA 3QA9A 1G19A 4L4SA 4LEIA 4ZZ2A 4D0SA 1STOA 2ZDHA 5C8VA 1GP2A 4FM9A 4XWTA 4K0KB 4QG3A 2JARA 3I53A 1OGJA 1CQWA 3AESA 3ZGLA 2C5EA 2ZITA 3CZCA 4A0SA 1TA9A 4BPRA 2WINI 4UQLA 1YL5A 1NMYA 3OY2A 4PXSA 4JBWA 5E95A 2A9QA 4OEHA 4D9HA 4P3NA 3WYGA 4LMPA 4HQNA 3TSYA 1CY7A 2P3QA 5JU6A 2OQRA 4C0AC 4TYWA 3R6TA 1HBJA 4O0MA 2BN4A 1P0PA 4O4HF 4XUCA 3OZIA 4XDHA 3FF1A 4QBGB 3TGLA 1L4EA 1XYYA 1PDWA 2E2WA 3QI7A 4G5SA 1UJ6A 3OT4A 1RC1A 1U9CA 3AI3A 2DFDA 4NONA 3D8UA 5FADA 2VOEA 4AM8A 1GA4A 2GPAA 3N7TA 4MDFA 4TZ0A 2WNHA 3KKZA 5SY6A 2VLIA 3ZV7A 7REQA 5BR7A 4RM2A 4CMIB 1JE1A 1YOVB 2CHGA 2WYVA 3F0TA 3CE6A 3QOYA 3DOJA 3Q3VA 1GUAA 1ZUIA 1FYWA 4RXUA 3B13B 2YRWA 3CPHA 1N6RA 1P7PA 2QD1A 3Q88A 3HR4A 3QXJA 5E7MA 1XKQA 3OZDA 4AG6A 4C6HA 3RSGA 2XCRB 1BSVA 2I8AA 4CTOA 2OP0A 3MOSA 4DQVA 4RGVA 2LNDA 4HFMA 1LV7A 1I9GA 1UBLS 3W3ZB 1WVIA 4PPNA 2IZ1A 4A92A 2MYUA 1X7XA 4RGBA 3WYDA 2TECE 3KR1A 2ZCVA 4DLRA 2XGGA 3UAXA 3LW8A 2QG6A 1L5OA 1CS0A 5HEKA 1Z6AA 5C4GB 4EPRA 1JAZA 3HDHA 1DGQA 1JIXA 4CMBA 4ZHQB 1WW3A 4IIBA 2JH8A 4ZQBA 2XAUA 1F7VA 4JENA 3ABQB 2OHVA 2V4MA 3VZBA 3DLTA 3K32A 4PTZA 2CVOA 4HNGA 4D4LA 2HJ9A 5LP6B 2RCNA 1W5AA 2JI7A 3DMNA 1MZVA 4JUCA 5GV8A 3WYFA 2PJRA 4D9KA 4ZMRA 3STYA 3T9FA 5TIIA 3TJZA 1R9JA 4LRQA 4ENWA 4RTKA 1CUJA 1KZ9A 3DJFA 4ZMBA 4TMKA 5ALOA 1MEJA 3FOZA 4R4JA 4ODIA 4FR0A 2XYGA 1HYBA 2R8BA 3NOXA 4ZTZB 3MMPA 3C48A 5KU1A 2FPWA 3E5HA 1P6QA 2GD2A 2R7KA 1M2OB 3VU9B 1XO1A 1LU9A 1VSQA 1YNOA 3OE7A 4QQ8A 4YGXB 5LB2A 3LUGA 3QEMB 2FVXA 1IAVA 1TUGA 4IJ6A 4LF9B 4EYOA 3W5DA 3DDNA 1YTUA 3PC8C 3RREA 3WB0A 2VTEA 3PQ3A 1G8FA 3TL6A 3K0FB 1UJ2A 5C51B 2YC4C 2GASA 1L6IA 3JTMA 2O3UA 4IZOA 4XUEA 2GGSA 3MINB 2WWVD 1MZPA 4WIAA 4TYPA 1BCRA 1JQLB 3VR3D 2EKLA 3OTOB 3C5CA 1NRIA 3Q3HA 2FP4B 1AM4D 4UZSA 4B3SB 3FFXA 3SZRA 1JA0A 1XU9A 3FWNA 2F9FA 4UBLA 3HJBA 3L77A 5C7YA 4YJGA 3EXFA 5MF6A 3N8IA 5CLLA 5K3EA 1Y1QA 3FLBA 1ADJA 3JWJA 3CF4G 4YUAA 1EX6A 1YU6A 4EMSA 3C14C 2VJMA 3R5JA 4P2GA 2VA8A 1LRKA 4IDQA 3UT6A 5CA1B 5EC8A 1CJCA 4JBLA 4L1KA 4RPCA 3VX4A 4RYDA 1Z3CA 4FQ5A 3RFXA 2V9ZA 3LGXA 2OENG 3TO5A 2FZVA 3O0TA 3U4CA 4C5BA 3IT0A 2PZKA 3U3JA 5BWCA 2FN3A 3WWDA 4UXIA 1IU9A 3B36A 3T15A 3HXLA 4JYPA 3DWIA 4NH4A 4A2PA 1AHHA 1GSAA 4C7OA 2PBFA 3NIFB 3X1JA 3E7WA 3LRPA 4ZAZA 2W22A 3DQQA 3IOEA 1FYVA 4RJTA 2O8EB 1N5JA 1YRWA 3PPIA 5T6MA 1Z6YA 3RWBA 1T5HX 4LNUA 1P6XA 2JATA 3WLMA 4KJZA 3EEOA 1J5EB 3FZGA 5KVQA 1S2OA 5AESA 1B23P 1YJQA 2PUFA 3CW2A 4TVKA 5JYBA 5L51A 3FFWA 3QFCA 4LDJA 2GBGA 1P7WA 1WB4A 1L6RA 1TIKA 3HWWA 5KWVA 3DVAB 4NHOA 1OWNA 2OCGA 1Z22A 1YSCA 4JP1A 3ISJA 5EPOA 1NNLA 4GSYA 4UE2A 1Q20A 3LZDA 3W5VA 5AXAA 4RC9A 4P35A 3GJQA 2R9VA 1NQXA 2PX5A 2DTDA 2QUBA 3ORYA 3DOUA 3ETDA 4GGMX 2ZUSA 4KQXA 3T38A 3UK0A 2VSFA 1VPTA 3QBVA 2A5YB 1LDYA 1HDGO 1ODTC 2C83A 3ENVA 1U02A 4JJ4A 5HS4A 5DHRA 4BKOA 3DLCA 4ITVA 5MFZA 1UR5A 1PD1A 3GPCA 5LYJA 3M3PA 4HVLA 4RF5A 4GKVA 4PQRA 3SHVA 3T7SA 4BNFA 2IHYA 1GLVA 4OQDA 3O7WA 1G8HA 2HBQA 1UKAA 3ABIA 2B4QA 3HYTA 1KEEB 4BNJA 2A6PA 3C1AA 3C1NA 2JJMA 3K1ZA 2X8JB 2IPXA 4AJJA 2P5SA 2O2CA 3PPXA 1NI4B 3IDOA 4JBIA 2JHAA 4KYIB 2X7XA 2D2VA 1M72A 1EDBA 1Y9ZA 3JAKB 4L5BA 4WJZA 3WNQA 1PV1A 2OB2A 1DPGA 1ZAKA 2JFZA 3TZKA 1N2CB 2QTVA 4EJSB 1WRBA 3ILYA 2JGEA 4I1IA 2Y27A 1A50B 1WBDA 3ELWA 1TKRA 4FTWA 2V0CA 4FMBB 1JR4A 2IYLD 3EXEA 2WDZA 5HUJA 2B20A 3TRDA 5AK5A 5ALWA 3ZZ0A 2YHSA 3IUJA 1EINA 2JIBA 3IERA 2BEWB 4M36A 4HB0A 4NOKA 5DHFA 5HK8A 5KYWB 2VNHA 1INLA 4WVLA 4C08A 4L4RA 1DKQA 1UJ5A 3HKEB 5FYQA 2NZ2A 5ALSA 3HI4A 2PZJA 3FAKA 1R4NA 4ND8B 1DLJA 4P4SB 3VOSA 2E9SA 1A9OA 2FQ1A 1CUVA 4I08A 2AJCA 3GJRA 6ABPA 2B82A 4K6MA 3B5IA 2NSDA 4EX6A 1QMGA 1T5LA 1MABA 4IILA 4UUQA 1GFIA 1RWNA 3OIUA 2B3TA 4TOIA 2ZRFA 5C31A 3UKOA 1KF0A 1ZMRA 1IY0A 2ORWA 3P7MA 4OREX 1N7GA 3AY0A 5C34B 3NTQA 3CEMA 1KVRA 1YI8A 2F17A 3A4NA 5GZ6A 1JQ5A 3VX3A 4RY0A 2FUG1 3A9WA 3NAMA 4JLNA 1FDTA 4RTNA 3LBHA 1PGQA 1U0OC 3TLGB 3BXOA 4M8NE 4MITA 2QROA 1PGNA 1PG0A 4HD8A 3TDMA 5FWYA 3AVYA 1O96A 1AKEA 5JWRA 2E3JA 2RGEA 1W88B 3BL5A 4Q0MA 3BG5A 1WSWA 4X0EA 3RPEA 2O3JA 3BREA 1L8OA 1N8KA 1LBHA 2YBDA 4O1IA 4Q9AA 2IOQA 3JYOA 2WWGA 5ESWA 3J80A 4FXOA 2R5NA 3L7MA 2B7BA 3LFHA 4RD1A 3Q8LA 3ER8A 5P8WA 2J0UA 5EMNA 3IUBA 3NC1C 2RB4A 4OMDA 3OLVA 2VXOA 4UULA 5HNKA 1RWMA 1TEVA 5JTUA 4Z53A 4TX1A 1KKLA 1T6XA 2W6JD 1C9DB 1NBAA 2YWFA 4EECA 4R1TA 4KQHA 1ATIA 3MLAA 4TKMA 1JH9A 1ISFA 3L04A 1VECA 2WVJA 3HJRA 4MKFA 4E21A 2ZZMA 2DX7A 1SUCA 3PHIA 5BUSA 3EDYA 4PAMA 1HDYA 4RD2A 4WLFA 1IMOA 2N1BA 4PSCA 5C4MA 3ROMA 3A06A 4RY9A 5AHXA 1U0HC 4C4ZA 3BWBA 1A4UA 3T9EA 1XR3A 3I28A 4LOLA 5HXAA 3C3JA 3F90A 3ZQKA 1LF5A 1QVZA 1UAYA 1QG4A 1X7YA 1ZJ5A 1SBHA 2E49A 2QKYA 3AF2A 3DCIA 1WHTB 1PF7E 3FYHA 3OC0A 2P6MA 3PE6A 3SD7A 3SE0A 4D4KA 1P1CA 3TBHA 4IDEA 4E15A 1L5GB 2JIPA 3G7SA 3HE3A 4KR6A 3QITA 4OFZA 3AEZA 4H16A 1GYQA 1EVYA 3NP7A 1L1FA 2EL9A 4JLSA 2P30A 5CJPA 5THXA 2YMPA 4U2FA 3SMQA 3DLAA 1N6OA 4CNQA 2DE0X 3GCXA 1NNUA 4L3OA 1QIIA 4LJRA 4KFCA 4B3BA 4B2IA 4BZWA 3LPDA 2ZUFA 3RADC 1G0NA 2WM2A 4G5FA 3AEQA 4J1NA 5A6SA 4XQEA 1CRWG 1IM8A 4B73A 4XR4A 3V4RA 2OK8A 5JBIA 2ES4A 4QFDA 4RLQA 3GRYA 4BWYA 4R1MA 4C2BA 2D0DA 3TNFA 1G1AA 3THSA 1NJ6A 3H8SA 4GIBA 3Q5DA 1IK6A 5THKA 4DQDA 3NHYA 3PEEA 4P7GA 4YJFA 4AN4A 4F2PA 1XQXA 1NVKA 3ZU6A 5AVRA 4HQLA 3WGYA 2QNIA 2QSJA 2AOTB 1IXKA 3DOEA 4JGBA 5CB4B 1BOFA 1RIIA 4DM3A 2CV2A 1HL7A 1L7AA 1Y1PA 2WHRA 3PB3A 4D4MA 2R1TB 1YR1A 1TL7C 4FMDF 1OGIA 2L82A 2CUTA 3FIJA 3EMBA 4Q1DA 4R8SA 4RK7A 3F67A 4WFJA 1Y42X 4MHTA 1HE5A 4M46A 2GPWA 4M7RA 2ATIA 1X70A 1ZGZA 4ZAFA 3FNHA 3MLEA 5E38A 1P80A 4EFNA 4V1CA 4MI6A 4YK7A 4G1CA 5I7FA 4ZOLF 4EGJA 3K72B 4I3FA 1WSAA 5DV9A 4MWOA 3DNPA 5A3VA 1QQAA 4BBJA 2FH5B 3EGDB 1Q84A 1UMKA 3FROA 3HADA 3AGQA 4CN9A 1CZHA 3FMPB 3BL8A 3V7YA 1QYVA 1MV8A 3IE2A 4JZYA 4GU5A 3TZLA 3PXUA 5LDDC 2O8DB 3UQZA 2AEMA 4JI4B 1SGWA 1WXWA 3MAAC 2O3QA 1B16A 3GRAA 1L7NA 4W7SA 3WJ7A 1A9XA 2OCDA 3I01A 4DWJA 1XDSA 5BUCA 3W8DA 5IYZA 4X54A 2HCBA 4IDPA 4IDHA 5E9AA 4DLUA 3ZS9A 5G4LA 4QU0A 5FI3A 5TF4A 1JXOA 3HKCB 4F71A 2VXYA 1AZWA 3VPSA 2V96A 4J1SA 2QT9A 2HHAA 1WXEA 2V9PA 2VJPA 3JZFA 1V5GA 1COZA 5CRIA 4RDIA 4AZ0A 1EFUA 3FNIA 1B3BA 1I3OA 4YAOA 4Z9BA 5I3CA 4BE7B 3VSCA 5FPQA 2FPPB 2BEKA 5JAOA 3TMKA 1SD1A 4IQGA 1FLVA 1PEKE 3DTVB 1NOIA 3W6UA 4ZO7A 2YHIB 4AJIA 5JANA 1X74A 4DUYB 1XQWA 4BGVA 3I1FA 4FILA 4V3BA 3GRKA 3T1VA 4ECEA 2RB5A 1II9A 5G4KA 16PKA 4DZTA 5BSKA 3I62A 1V11B 2AC7A 2JFOA 3OQIB 3WDKA 4A6DA 2ZRMA 3Q72A 4PX3A 2EWVA 3HSSA 4HTAA 4U7TB 3KTDA 1Z13A 4EKIA 4QAJA 2OXRA 1PL8A 2I8CA 3JAWA 3L8ZA 4QOHA 4RK4A 2XRYA 1S3GA 1HG0A 3WKCA 2PX0A 3E9ZA 4V0RA 3MHTA 1G64A 5KMGA 1Z25A 5HM8A 5G53C 4U3JA 2I6UA 1C1HA 3ENKA 1TYZA 2C5GA 5AJUA 3U3MA 1GG2A 2Q3EA 2O1SA 4PQGA 4JBNA 2E7ZA 1RM5A 2BGLA 3ZXYA 1FS4A 2Y1EA 3NWEA 2GBCA 4INOA 3TSCA 5C5CA 3UJAA 5I4CA 3A37A 4OJTA 1L5LA 5IP5A 5LYYA 1UINA 4ZWNA 3DEAA 4J7AA 4DDTA 4OP1A 1LKZA 3IPCA 1YQGA 1YQQA 2WIKA 1QQ5A 2NX2A 3MJVA 2P3OA 1DKMA 1UPFA 3CNHA 5GM1A 4DLAA 2QPTA 4MYUA 4PWZA 4IS2A 5A3SA 3SY8A 1RLOA 3DE7X 4QZVA 4AJLA 2A7QA 1L1QA 2DHQA 3RKUA 1SZCA 1ID1A 2ZUDA 3O3MB 3WYNA 2H00A 3KUKA 4TXJA 3SC4A 5EIAA 4TSKA 4K9DA 2YMMA 3IDFA 3SCZA 1CUXA 3LT2A 4PTLA 2ZI4A 4RF4A 1VCIA 5F7OA 3OE7D 3PC8A 1HK7A 5IJ9B 1KEZA 1PJCA 2WAMA 4EYGA 1EUCB 3KYCB 1ZLXA 4YMVA 1CHNA 5FTLA 1A76A 1XBTA 1RE1A 4I46A 1Z34A 1ILEA 4GF5A 3U5TA 2O9JA 3KO8A 4YI5A 1XTBA 3F5FA 2BCJQ 2IUYA 4I55B 1Z6ZA 4MQ4A 4S24A 2WF6A 3E3MA 4ZVUA 4BKPA 4DANA 1QK3A 1DC6A 1VKRA 2ZTLA 4WDQA 3RU9A 2PJDA 4RJIA 1CUGA 1ZIPA 3CX3A 3KOUA 3EE6A 3KETA 1SIOA 4GLBA 1UPUA 4B4VA 2PFGA 3GEHA 1UDAA 2R84A 2RHDA 4WBSA 4Y9SA 3SC2A 3USZA 2P4SA 3HG7A 1E3QA 1QHHB 2FSSA 1N2CE 2ORVA 5DWVA 4FZ3A 4ZJUA 1EEHA 3ONEA 3MWDB 3QE9Y 2BWJA 3I34X 1Z7WA 3KXLA 4W7IA 4WCFC 4AJ1A 3TI9A 4QSMA 3KQVA 3FCEA 2K2QB 3K8ZA 2X3FA 4EPWA 2I6FA 1SPBS 1LXCA 1P0IA 2RH9B 1Q77A 5HPYB 1M5RA 1V48A 2J30A 4YJ3F 5G0VA 4WBNB 4F6RA 4CV2A 5EUMA 5HA5A 3I6MA 4JC0A 1GTJ1 4N0DA 3SZUA 2QJWA 1G38A 1D3AA 4ES6A 2UUPA 3KEQA 4MYCA 1OXUA 3ZQ6A 2EZ8A 1LBSA 1SXJC 3SQDA 1E7MA 3N70A 1J09A 3BIXA 5F23A 1QBGA 5DE3A 3HBLA 1KJIA 1ZINA 6AT1A 2FUCA 4QEKA 5IARA 2P5YA 1NF9A 4B6QA 1W36B 2JLQA 4IKEA 3HCOA 3OZRA 1D5CA 2FFAA 4BAGA 3WY9A 8GPBA 3AHFA 2JEOA 3L49A 5LKRA 3IQDB 1XZDA 2AK3A 3C3YA 1HNWB 1FNSA 5CG1A 2ZEJA 5AQEA 1EVQA 1QJ4A 3PCRB 1C3XA 4XIYA 1U94A 4LTMA 3T5CA 3V6LA 4CMGA 1UFVA 4YWHA 3K5IA 5ES4B 3BHJA 2HBYA 3NGLA 5BN4A 1NVEA 3SR3A 2VPYA 4V3CA 2GYYA 1XPOA 3HY6A 1QH1A 1HZZC 3WL4A 4ZYUA 2GNOA 2WQ7A 2FUG6 1C7QA 1U31A 1ODFA 1NUUA 4YP6A 2IHZA 4ZD6A 1KSJA 4EG0A 1VL5A 1E32A 3BMCB 1NRJB 4EF4A 1ISHA 5KYYB 3ICWA 4EOGA 5JYDA 1AB6A 1AK2A 1DBSA 1GPLA 1W1UA 3P9ZA 2YWCA 5K4GA 4GNKA 2UUBB 1QIDA 1JV2B 2FW8A 4KZKA 4CIBA 3THXB 3PIIA 2WYUA 3IP9A 1F38A 3WLNA 1E0KA 3GMDA 4UZEA 3WWPA 3WSTA 1XALA 3T94A 2ZYRA 4UUMA 2VTKA 1DAFA 1KSHA 2CKDA 3GJ8A 1NQVA 2YXPX 3PWSA 4OL9A 3L6UA 1QS0A 4OCZA 3GMTA 2CJPA 2GEUA 2HUPA 3SX0A 1Z82A 2VFAA 1PFKA 3CB2A 5EJ5A 1KERA 4HBZA 1E2DA 4J49A 1BU8A 2OAGA 3LPNA 4O33A 1J2EA 2XBUA 3B5JA 2DY0A 4IGAA 3MCWA 3R40A 3TKLA 3SYRA 4DIFA 1U6JA 3NFYA 1E6LA 2W6CX 3JVUA 4RKRA 3SAJA 1P4GA 1XZBA 1M2VA 4P54A 2NTJA 1EFKA 2H06A 1TFRA 3VNAA 5JR3A 1YJCA 4KLAA 4I66A 4O2BA 1GZ5A 1W9HA 5DLEA 5SZJA 3RKSA 5B3JC 4Q9KA 1I4DD 3VJRA 2AYZA 4WY5A 5IN4A 3NG1A 3K1YA 4QDKA 4X44A 4EITA 5K0EA 1E6KA 1KEPA 1SC6A 3AF6A 1RI4A 4YAKA 3U0VA 5BURA 1WG8A 3HBJA 3LMKA 1JHVA 2PMEA 4C78A 2JGRA 3PWTA 4MR7B 4ZCPA 5FI5A 4D98A 4DAEA 2V7GA 2XYVA 4GUAA 3HU1A 4RFVA 2RI6A 4WZ6A 4F04A 1BGVA 4KRXA 3R7DA 3H9CA 1VZ2A 5LMNB 1SM4A 2XCOA 1OX6A 4FSHA 4O4HB 1TT5A 3CUWA 3SX4A 3DJYA 3QVLA 2R6HA 5BN5B 1RJDA 5D3QA 1SU8A 4WFQA 2Q4OA 1Z73A 2CXNA 5AW1A 1ZOOA 1P4RA 2GAFA 4HEA6 1N78A 4BN0A 2QLTA 1ABBA 3C4VA 4M1QA 1IB0A 2GARA 1KSGA 3ZWNA 4CR8A 5BR4A 4OI0A 3BT7A 1QJCA 2BH9A 3M1YA 2I2XB 3QKRB 5I7UA 2ZRAA 2O14A 4HDNA 3PHLA 4MGEA 1FNDA 5E9WA 4YQEA 5BSUA 4EDHA 1EQ2A 1LLFA 3G2QA 5L45A 1HTTA 3BMQA 4WZBB 1AZTA 3CLVA 2IIPA 4QXAA 4Q4CA 5K5EA 1CY2A 3KYDB 4MKIA 2WTMA 3AJ8A 3H1AA 2Q3DA 4WZZA 3GZTB 1OFHA 1O95C 1UBRS 2REQB 1XTQA 2NPFA 3VPGA 2JJ1A 2IDZA 3STTA 4A1OA 1JQAA 3ZLUA 2XPCA 3KTFA 2CD9A 1L5SA 1Z33A 5CYOA 3NEYA 3QFHA 5BRAA 1ZHHA 2CLDX 3TLMA 3I5XA 4UM8B 3UW1A 3WBKA 1BEUB 3EARA 3KXKA 4WLUA 5KTNA 1IMJA 1EBBA 2OMKA 1V6SA 1YKSA 4DM7A 1JHYA 3LY9A 5DVZA 2WSLA 1K5GA 2XX3A 4HWTA 3RVMA 4IHAA 5KKAA 3RYHB 2I6TA 4H6VA 3O82A 1OIVA 4UBNA 1O58A 3ZN2A 3DEYX 1IEWA 1KQ3A 2WTNA 1OWOA 1UBKS 1B1AA 1C9NA 1XKXA 1J2JA 1RP7A 1WNTA 1M8JA 1U6KA 3EBLA 3ZBPA 3TGWA 4HV4A 1L4UA 3OPXA 4P7KA 4H7DA 2HY7A 1M1XB 2OESA 4UE6A 5DGTA 2RSLA 4XX0A 1UPCA 2ZZNA 5MN5A 1HDEA 3NVDA 4PZ9A 4GC9A 3G5LA 4F6CA 5ICGA 1KRWA 4DV5B 1CY8A 1MTZA 2HD4A 4EBBA 2ZUBA 2Q28A 4HRXA 1PK8A 1OZHA 3GFRA 3F47A 1ACLA 1TCVA 3B78A 2AEFA 3T0FA 4HN9A 5D87A 1GRVA 5KJCA 4M0LA 1PG2A 3O8LA 3DOHA 1ZHVA 2O0LA 2W2XA 3GUYA 1YMUA 4PV7A 3KKQA 4DLNA 3S1SA 4RJKA 5F98A 2XI4A 1K89A 3OJEA 2O07A 4KQKA 2OGUA 2YS6A 3BRQA 4YRAA 1THMA 4CIWA 4M1YA 4KQGA 5ALXA 5HUQA 3F6EX 2QDXA 2V54A 3D5TA 1KDZA 3WHIA 3WMGA 1C7JA 4CFYA 3SF0A 4F8EA 1S3FA 2CZQA 3UA4A 1LA2A 4E4RA 5HIIA 3SS9X 3KR0A 4MYDA 1BROA 1LWNA 2DUUA 4IH1A 3RT9A 4D9EA 4LPKA 3N7AA 2UZ0A 2E0IA 2GJ9A 4TXHA 4X7PA 4R2XA 1TM1E 4L4ZA 4GKAA 5BV0A 4JLAA 4OXKA 1UL1X 4MPPA 5TPWA 2VAPA 2ZZKA 4BEVA 1R0BA 1MQ9A 5J4HA 3ANNA 3KLPX 2BEUB 5JTTA 1WDMA 2BGRA 2N42A 3IESA 4JI1B 2O0HA 1Z5PA 2XA9A 3U1TA 4EI9A 4Q3CA 3A6PC 1I2AA 5CH3A 4YCDA 3IP5A 4LFCB 5I47A 1ONBA 4DCSA 4AKSA 1ZHOA 2EBHX 3CFYA 1ZG3A 3A0RB 5AKGA 4DEVA 2DLDA 3QUSA 2AS0A 3SSMA 1DO2A 2BR4A 2XZOA 5D8DA 1LEHA 3I6BA 3P0IA 2VN8A 2EF0A 1AVTA 3IR7A 4IMRA 3BOSA 4YO8A 2QMUA 1MB4A 4UNPA 2Y1WA 4MVCA 4FDVA 3C7AA 2JJYA 4IV5A 4FD2A 1G5FA 4FJ0A 4LK2A 4QHYA 1B74A 4ER7A 1TD9A 3CT4A 3FPGA 1JYFA 1PCXA 4CTKA 1N5RA 1JMKC 1UJNA 2OC4A 3G89A 3NDPA 4LN1A 4M37A 4Y6LA 2ZJBA 3BAFA 3EPJA 1T2VA 4H6WA 1MAAA 1C50A 4K9OA 4IX9A 2C5LA 2EFJA 2DUJA 4YV1A 1CY0A 2YOGA 1X9GA 1SIBE 4EH1A 3M1LA 4F9FA 3OM9A 3MWFA 2IBTA 4CKCB 3RVQA 3VDNB 3GNSA 2IH2A 1VL8A 4J29A 7REQB 5HQTA 1KRHA 3P45A 1I2CA 2FX5A 3QNMA 4G0WA 3ABZA 3N0RA 3OT5A 3VJLA 3K20A 2HEGA 4TS9A 3RE1A 4FKMA 3SXPA 1ACJA 1Z5OA 4W8HA 4G86A 1S3SA 1E2NA 1ESMA 2AXNA 4HN4B 4JLWA 5A7HA 5LZ8A 2ZCJA 2YFQA 3TDNA 2ERCA 1IY2A 4R9RA 2Z2JA 5K7SA 4LGCA 2JHFA 4OQPA 1ODIA 1BVYF 1LDNA 2AW5A 3CRMA 2WY2D 4C2TA 1FZQA 1ML3A 1P33A 5L3VA 4ZA2A 1K0FA 1T36B 3DMHA 5HF9A 1AV7A 2IEYA 3A1FA 4DSOA 3ZHOA 3OPYA 1P17A 4G9EA 4TS4A 1ZNXA 2XGMA 2V5AA 3ND9A 5DLYA 3RVJA 1XPJA 5IHPA 1LI5A 4GL4A 2D00A 3O83A 2R8EA 3N9IA 1CQIA 1JWAB 4INPA 3E0QA 5FOQA 3C39A 5T4FA 1PT9A 4ACAA 4RA6A 1BD3A 3G2MA 3H16A 4XYLA 1N2XA 1J8VA 3V34A 4RKFA 5A9TA 1X42A 1FOEB 3EQ9A 4KITB 3E4CA 4EVQA 5HOEA 3MG9A 1JSXA 4I1RA 4HTFB 4INJA 1YJ5A 4LTDA 1WXFA 4UEKA 2B1GA 2VKTA 2R47A 4MLPA 1GCOA 5HRUA 2FW9A 2Q8NA 3TQRA 1NX6A 4I4TA 2ZI5A 1TJPB 2F55A 3KYJB 2VDKB 1GZ7A 2ZU6A 2WA2A 3OKCA 3LJKA 5ECYA 1M2HA 3GCDA 2AD5A 3BC1A 4HDMA 2VF2A 2VJCA 3NOOA 4QOEA 5DTMA 3PE4A 5FR2A 2Q50A 1SKAA 2GCOB 4LXGA 1VJGA 3FHCB 1HSZA 4G4IA 4KSYA 3JZAA 4FZJA 5G0TA 2W11A 4NOJA 5DN6A 1R00A 4OK3A 4F93B 3U80A 2LBPA 1DFHA 1BCRB 2QDKA 3TEJA 1WBBA 2PV7A 3MQ4A 1OWLA 4G4SP 1EBUA 1HYEA 3CNEA 4LXTA 4MWGA 1UFRA 2O8BA 4WCFA 4X90A 2GK4A 3BS4A 2ASEA 4C0HA 5A3JA 4MP8A 5BR1A 1H4VB 2VBFA 4MB0A 4YJGB 1L4YA 4Z9FA 2HIGA 1P75A 5JYEA 2NXCA 4CEIA 3D4BA 1XC7A 2DP4E 3G9UA 4CDMA 1IJKA 4JR2A 1C0KA 4XR9A 1I6KA 2FHPA 1SXJA 3SJZA 5HHTA 1P3JA 1SZDA 1Y80A 1QNFA 2GPJA 1Y4AE 3FGZA 3KUDA 4JQZA 1BMFA 2O6LA 4W5HA 1ODKA 3E84A 2UZIR 4B4UA 5JFGA 3B70A 4YH1A 4YCSA 1A9RA 3DMDA 1T3SA 4GGPA 4L7QA 2G07A 3ER9A 2A33A 5IVKA 2Z9DA 4HDSA 2WTEA 3MCTA 4B1FA 4BO1A 4C7OB 4IDFA 4KACA 4MV3A 1ZOIA 2QVYX 2XZPA 1MNQA 3O73A 1ZH4A 3TDKA 2P2LA 3ZXSA 1SEPA 2JAXA 2HQOA 1JEOA 1U1FA 3HL4A 4DQ0A 4ESOA 3OICA 1UDWA 4O63O 4TLEA 3HGMA 3GGDA 3BZBA 1JH8A 3CLTC 3IMEA 5AUQA 4N48A 1DMSA 1HZZA 3L9WA 3RUEA 3PEFA 2HF7A 4XWGA 4KK3A 3OLQA 4IS3A 4EG4A 4JKIA 4M49A 5JY1A 1Q0ZA 4X8OA 1OAOC 2FPIA 4QPDA 3U6BA 3EGEA 1FDVA 3HJGA 2XIQA 5JAUA 5E3HA 4X61A 1JLMA 5GADl 1DWQA 1X92A 3FWKA 3DZHA 2OM6A 1DCKA 1KO4A 5K2OA 1P9LA 4WZBE 1QP8A 3HY4A 3VVLA 5DI9A 3JQRA 2YJ5A 5EWMA 2X6RA 1ZESA 3RD5A 1W52X 2YW2A 3VBEA 1FP2A 4OLFA 3CR8A 7MHTA 2JW5A 2MSDB 3P2MA 4NFHA 2H9IA 2QTWB 5CW2A 4EB3A 2YWJA 1YR9A 2MYTA 2WNSA 2WV9A 4GVXA 2FK7A 4MW5A 3IDZA 4MS3A 2QL5A 5T57A 4FMCF 1A2OA 1RJWA 4TWRA 1J0AA 1Y98A 3ORHA 5ITZA 1REQB 4PR0A 1SU6A 1LPPA 1Y48E 3PL1A 1E62A 4ID3A 1GJRA 1V5FA 3CGGA 2H2DA 2ZB4A 2QTVB 4HYEA 5EZQA 1RMYA 1RS0A 5J9FA 4ZRNA 4A2CA 4AMUA 5BMVB 3OD1A 3QUQA 5TEWA 3GHYA 1HEIA 1C1YA 3BCRA 4D0NA 4ZOLB 3RIHA 3WKDA 1F2UB 1RRFA 5DJ5A 2QIPA 4MV7A 4QQKA 4M0UA 1R0CA 2XVZA 4JLBA 1UCFA 1VHWA 1W6UA 4MO2A 3FD8A 4OA8A 1O7JA 1QTQA 1LW6E 3O2JA 2GM5A 2A5FA 4Q9DA 4JWKA 4EY6A 3HB1A 1TW2A 4QECA 1PFVA 4R5HA 3Q8KA 2F7SA 1KH1A 2ODTX 5FOXA 4BNKA 2FV8A 3NRJA 2H1LA 2GTIA 2WTBA 1XN4A 2W6ZA 1EP1B 1G6HA 3QPUA 3IAS6 4I4TF 3RS0A 1RKXA 1XZCA 4K9SA 1Y8CA 3NM6B 1RPAA 2ECKA 4FE3A 4PG5A 2PSSA 4YUZA 1MABB 2OP1A 1XQ1A 5DHUA 4CT0A 2W2KA 1KO8A 3USCS 4A4DA 3UMVA 3NV9A 5E7IA 2M6LA 4EKYA 2QTFA 1RQPA 1MOQA 5KC8A 2R7AA 2RHHA 1HFWA 4IWNA 3G88A 3LUDA 3UAGA 1BE1A 2PR7A 2ZSHA 3C3PA 1ORTA 1XRPA 5C18A 5FLEX 1BZYA 1VP9A 5JSKA 1JHQA 1X6VA 3QXCA 2P4QA 1FUKA 4PEVA 5FWYB 3K8QA 3NC4A 4FCTA 4KFSA 1T4CB 1SG6A 1W0KA 1HG1A 2ZIAA 1E2FA 1O95A 5CNMA 4DJJA 5FPKA 1D8AA 4EI8A 1G0OA 2XXJA 3A1WA 2V1XA 3B9PA 5LZ7A 5BSHA 4HDKB 3GFFA 3LOQA 5LMUB 2C95A 2F43A 1WNFA 2JJ1D 1V1RB 1WTCA 3EW7A 4PCVA 5FUMA 5K8VA 1VLMA 2OHOA 2I66A 3AIKA 4B48A 2ZK7A 4QFMA 4Y30A 1PG5A 2J0UB 1ABFA 3TAUA 4QPCA 3RSSA 2HW8A 1E94E 1UUFA 1XZNA 2HBRA 3IT3A 3AEUA 4DCVA 5KNBH 1K6XA 3OQPA 2JBWA 4XA8A 5FA8A 2VTDA 1GD1O 4J0DA 5EXEA 1W7AA 1U9IA 1W35A 4NICA 2AOVA 2OBYA 4JIGA 4ALNA 2AJTA 2O59A 5GINE 1JL3A 2YWHA 5AKKA 2O8FA 5DWQA 1ZH8A 3UHOA 1TK9A 3P26A 2WB2A 4MV5A 1ZOLA 1L7OA 1L7VC 2ZANA 2HZ7A 5DNVA 1B6RA 3COWA 4LZJA 2FI1A 3KZXA 4PAGA 3UMCA 1CQJB 2BBSA 2BM0A 1PIWA 1N0WA 2KLHA 4ZVKA 1G8GA 1I5OA 3QX7A 1RAAA 4NDNE 1ABEA 1DUVG 3VH4A 5JZSA 4UC0A 1QE5A 1DT5A 1YE5A 1G63A 2XMBA 1PYDA 2AWNA 2PGJA 3D5EA 4FN5A 3F96A 3LQFA 4NCXA 1SMKA 1MG0A 1XRJA 3QEJA 1L8XA 2P3LA 2G08A 4O29A 4I5IA 3OTQA 4Z8XA 3VKFA 1ZS9A 3NUGA 1FYFA 1XL0A 3K4PA 1AZLA 2G4VA 2PQ6A 1Q0PA 3RFFA 3JS5A 2F8TA 2NU7B 2GNPA 3U4QA 2A92A 3BZWA 1FUIA 1SUBA 1L7EA 3DAYA 3F46A 3WLJA 1IJBA 4KO4S 5AM3A 4M0PA 1H2EA 1P5HA 4V03A 1W4ZA 1DMRA 5AK3A 4RCVA 1BJTA 1RQGA 2C4MA 3JRXA 4WINA 4DQUA 4F60A 2OR3A 5KYNA 4UTPA 4ZZ3A 4IYRA 1TM3E 4WA7A 3UH0A 4DHWA 2FN7A 3G5AA 2C7OA 3KOXA 1G20B 3KQHA 1T0JB 4L9AA 3V4LA 5LWHA 2QY6A 1ZP6A 2C9OA 2CVZA 3IBGA 3OQBA 4QYSA 2HA2A 3K73O 1ZNQO 4J4HA 1WCIA 4R1OA 5KJ1A 5KO2A 4YJ3B 4F3RA 3Q3EA 4G07A 2XDQA 3ODPA 4NBTA 1QRTA 3FF4A 4E2XA 4G1BA 3ZE9A 1EFTA 4FWTA 3HACA 2DPYA 5H1YA 3RHSA 3T4PA 3S55A 2B2CA 5BYBA 2AMJA 4XWYA 1U2GC 3AEYA 4IVQA 4EVRA 1KI2A 1D07A 1SUSA 3OWXA 4P9NA 3OTIA 3ILHA 1O6ZA 4HC4A 2Q3HA 4PR3A 4YLYA 221PA 4ZC8A 5I48A 1ZBQA 5L3SA 1L7PA 3MF4A 5KB3A 3T3OA 1R9GA 4HATA 5B7NA 3DPSA 2YYAA 3PZRA 1KVTA 1PP4A 1LFDB 2QENA 1OX4A 2JBAA 4PYRA 2HN9A 4M99A 1JLRA 1P5FA 2PGNA 1U7UA 5KTKA 4AZ0B 1U0FA 4HI0E 4MS1A 3OVMA 2W2OA 1OREA 2NZUG 3IE0A 3L1IA 3L0IB 3IXMA 1HM5A 4FNAA 4YIHA 1KFJB 3BFKA 5JBNA 2PKWA 5AWFC 5F76A 1NW4A 2JFYA 4II3A 2ZBEA 5G4KB 5FBHA 1NQ5A 1V8ZA 1OKKA 2X5NA 1TW3A 2E4WA 1Y6JA 2H85A 5JWHA 3TNDA 2I2AA 4FJ2A 2XOEA 1KZ1A 1WCXA 3FDZB 3V00A 3H0EA 4YWJA 2JCVA 1ECGA 2HQRA 1XRMA 2OQ2A 3QH4A 1JT2A 4TKZA 3OHMA 3ONNA 4QDJA 5HJEA 5JJBA 4X85A 4JVNA 4KC0A 1ZC3A 2AUMA 2VJAA 2YICA 4IDGA 4LNHA 4DIOA 3ASZA 4U3JB 3W78A 1U4SA 1XFDA 3K16A 2G9RA 1E0SA 3P32A 4GMGA 4ROTA 2IV2X 1ZUHA 3BXXA 3Q7TA 3A11A 3FKJA 3O8DA 1DB3A 2LW7A 2XMZA 1T3ZA 2I91A 3D59A 1IUPA 4HDRB 3LF1A 1NXPA 3P9PA 4Z1MA 3OCZA 3DE3X 3SZMA 2BEVA 3V8BA 1FA9A 4G85A 1M8GA 4QBTA 4HCJA 4MKHA 4E3ZA 4A10A 4HLDA 3DSRA 1HE8B 5DP2A 3LG2A 1HRKA 3SFVA 2D1SA 2PBLA 2A57A 3VA7A 1YIOA 1KZ4A 3EIQA 2I87A 3CH5A 4BVEA 3WQHA 3L8EA 5CDHA 4B43A 2J8ZA 4LYGA 3CIOA 3IVAA 5JI3E 2GF2A 3EX7C 1R27A 1IFXA 2QHXA 1M6EX 4PLTA 4IG9A 5HUHA 1OH6A 1IIBA 3Q8WA 3RVSA 2RE8A 4HQRA 5IUJC 3MXTA 5IKOA 4UOQA 2J9FB 4NU8X 3NHKA 4ZVLA 5MDHA 2RGYA 5DN6D 3LAWA 1W5BA 4I1VA 1TTQB 3IXQA 3HCWA 3AFGA 1JDZA 4EHBA 4QUGA 2SCUA 4ZALA 4Y2UA 1VBKA 3BZUA 3MCAA 3OZXA 1XPRA 4EWLA 3HDYA 1OYOA 5EWLA 1EAYA 2Z2IA 3E82A 2PX6A 1R8YA 3HI6A 3ZBTA 3ZPXA 2VHTA 3I0MA 1I80A 2W2NA 3RJZA 4BLVA 4V0SA 1DC5A 2JB9A 4JEIA 1NP7A 4YJDA 1SPXA 4G6ZA 2V4ZA 4ZO4A 1T6BY 1T6ZA 1Q6ZA 1TU3A 4S1VA 3WGZA 4LISA 2FPGB 1KYXA 2WG1A 3AM5A 3JQ9C 4KR0A 1BMFD 1MXFA 4EDFA 4LQLA 1U7WA 1F2TA 1NT2A 1PKXA 4F6RB 2PMKA 4JYZA 1QZXA 1U2RA 3RAGA 1P7YA 5BV2P 1XZJA 2C4KA 1TYDE 4DARA 2UDPA 1OTHA 1TQ2A 3ORRA 4TLLB 5LDGA 1Z6QA 3GNTA 4DXHA 2CXRA 4AAYA 1BMDA 1ICIA 3TWOA 3U7RA 2HAEA 2DKFA 3GEDA 3GVPA 4TVSA 3HN6A 5THQA 3EAFA 1DSSG 4ND7A 2C88A 1YBMA 1KY3A 2BF4A 1LSOA 2GFQA 1CJMA 2WSIA 3T1NA 1D5WA 3DBIA 3FUTA 3H04A 5K3DA 1NC1A 1UDBA 1Z39A 2Q5QA 5DH9A 1OAOA 3ZDCA 4L5JA 2QRJA 1GXSA 3HCPA 2F4NA 3QOXA 4U7PB 3KT8A 2B61A 5T67A 2V6IA 2I55A 4OQQA 1H4SA 4CLDA 4QVIA 3AZPA 3FE2A 2ZI7A 4IIJB 5L7YA 4CI9A 1GU1A 2O5EA 1Z2EA 1QH1B 1U9ZA 2CWDA 4WV3A 4AO8A 5KYTA 4AJOA 2PZAA 1B26A 4E5PA 2IXFA 1GRQA 3A9SA 1D4AA 2X40A 1TT7A 3AHDA 1T5OA 2YWGA 4EQ6B 2WYHA 1L8LA 1M8PA 1O0BA 1BDMA 3TKYA 3AHIA 3PIDA 3U9SA 2AKYA 4RY2A 1BMTA 3TN7A 2VTBA 3JQQA 2HGZA 4WEOA 1F4LA 2P4UA 3NOVA 3FB4A 3ADKA 4IQFA 2RJOA 2H5LA 1JNYA 4WCDA 4MIEA 1H1LA 1QS0B 3AJAA 4TUYF 2XJ4A 4UJ3A 3ZZTA 2F48A 1YV9A 5B6IA 3OTWA 4MA4A 3GF4A 4OIMA 1W0JD 4IJ5A 2C2XA 2FWJA 4JGGA 3ZHRA 3RSCA 2QW1A 4L57A 4AX4A 4KAAA 1D4ZA 4LRWA 1F0YA 4MGZR 4F2HA 4U0KA 2HXSA 4BKMA 3ESQA 4C07A 5IULC 5LVAA 3PPYA 3TGPA 2PS3A 1E6EA 2XCSB 4I14A 1PS0A 1U5CA 4M1WA 1EZ1A 1H94A 2FEOA 2X4IA 2OZPA 3C3EA 3OM1A 4FGKA 5E7JA 1U8FO 2I71A 2YXNA 3L7AA 3D6JA 4YP9A 3X2SA 1T35A 3TLY