4KR6A

Crystal structure of a 4-thiouridine synthetase - rna complex
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
388
structure length
388
Chain Sequence
MEELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/rna
molecule keywords Probable tRNA sulfurtransferase
total genus 132
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr6A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr6A02
1GLNA 3LDGA 1JZQA 3PNYA 1JHDA 2A1UB 4XSVA 1H3NA 4BWVA 1G8HA 1V8FA 3IODA 2XRZA 4PY2A 4MUIA 4YP5A 1EE1A 1QNFA 1SURA 2GOYA 4JZYA 1U3DA 3I05A 3H05A 4ND7A 3TM5A 1F4LA 4HPWA 4YBRA 3ZUGA 4AQ7A 2CSXA 1YI8A 2AG6A 1OBHA 2BTEA 3PNBA 4DDMA 1TYAE 1MAUA 2B7LA 4MVCA 3N9IA 4WNYA 1IQUA 3A04A 5BNZA 5HUJA 4JXXA 5FNZA 1NSYA 4HJRA 3L92A 3MLBA 3A4IA 2DXIA 3KT6A 4NAHA 3COWA 5FO0A 4OJMX 3Q12A 4ARCA 1M8GA 1N2JA 2PZBA 3OP1A 4R2MA 4CQNA 2A7XA 1GAXA 4ZCTA 3HGMA 1JMVA 1M8PA 2QTNA 4QRDA 4KR6A 2Z08A 1MJHA 4P2BA 2DERA 1JEDA 2V0GA 2NZ2A 3HZRA 2CV0A 4EGAA 3FDXA 1O0BA 2QTRA 4G5YA 3IMGA 3Q4GA 5HG0A 4MUGA 2ZUFA 2WQ7A 1R6UA 3P0JA 2DETA 4UZEA 1U3CA 2DUMA 4DJAA 1J20A 4ARIA 2JANA 2Z09A 2ZUEA 4PBSA 1P7PA 1QTQA 1U0BB 4OUDA 1FYDA 2QJFA 1KP3A 2D54A 2A1UA 1OWPA 1O6BA 4AS1A 3IUEA 4NX2A 3ND6A 1X8XA 2X1LA 1JILA 3CR8A 2X0KA 1M1ZA 3IH5A 4YP7A 1NUQA 2QUKA 1K4MA 4MW5A 3FY4A 4MW9A 1K4KA 2A4MA 4J76A 4EG4A 2X1MA 1LI5A 2D13A 3AFHA 4MVWA 4I6JA 1JIIA 3AL0C 3TMAA 3COZA 1JIKA 3CLSC 3V97A 3FG9A 3CLSD 1I6MA 4NAUA 2I1LA 1TQ8A 4J75A 1ZH6A 1M8KA 3INNA 4JYZA 4ZCRA 1QQTA 2E0IA 4EG3A 2E21A 4EG5A 1VBMA 2YWCA 1ZJWA 3TZEA 1WZ2A 1F7UA 1OWMA 2GKSA 1PFVA 3TZLA 3JXEA 3FI0A 4A91A 1IVSA 1QRUA 1WXFA 3E27A 2X3FA 1CT9A 3ZXIA 1KQNA 4L2IA 2J09A 1T6ZA 3H9CA 3D6VA 3ZGZA 3KFLA 1V47A 1H1TA 2EL7A 3COVA 1K92A 4F3RA 3P0HA 1T6XA 1G8FA 3H9BA 1G8GA 1J09A 1MBZA 1U7XA 1VL2A 2JA2A 3ND7A 3CVVA 2BYTA 1MOPA 4NZPA 2QTMA 4MW4A 3FNRA 4MUEA 3ELBA 1N2BA 5H16A 1NYLA 1JGTA 1RQGA 1MRZA 2GM3A 4XFDA 4FZJA 1PFYA 3VGJA 1NUSA 3AIIA 1O95D 4K0RA 1O95C 1N2IA 3GLVA 1O0CA 1Q19A 3U1VA 1IHOA 4MW2A 3IDFA 4ZCSA 3SDBA 5KHAA 3CVXA 3LOQA 3IUBA 3MUEA 3AKZA 1BS2A 1JIJA 1N2HA 5AHWA 3TS1A 3ZJUA 3X1MA 1O94C 3LE8A 4ZT5A 3ND5A 1UFVA 5DASA 4OUDB 3CVUA 3SYTA 4R2LA 3CLRC 2AKEA 1NP7A 1QJCA 3QTBA 2HGZA 1XJQA 3KT3A 4U63A 1ZH0A 1Y42X 1H3EA 1O97C 1O97D 1N78A 2A1TS 4DDKA 4MVXA 2QJOA 1ULHA 3QE4A 1KAMA 2G36A 1IRXA 4QREA 3PXUA 4EG6A 1TEZA 4E1AA 3IVGA 1WXEA 4F4HA 1M8JA 1YIDA 2YWBA 2D5BA 5K0SA 2QUIA 1YULA 2ZP1A 4ZT4A 2R5WA 5IJXA 4MVYA 3AG5A 2HZ7A 3CLUD 3P52A 1N3LA 3PNVA 1NZJA 1WKBA 3RBAA 5TEWA 2HMAA 1WY5A 1MAWA 4MUJA 3H99A 2QUJA 3TLJA 5TEVA 5KWVA 4MAFA 3TNJA 4DNXA 1TYCA 4G5FA 5JBNA 1J1ZA 3RHSA 1O94D 1OWNA 5TGTA 3P0IA 5EKDA 2DPLA 4RPIA 4G6ZA 4R0NA 3KT0A 1G59A 1F7VA 3VRHA 1N2OA 1OBCA 1GZUA 3OTWA 2J07A 2DEUA 1VBKA 1J1UA 3IVXA 1T6YA 1HYBA 1D2RA 3G5AA 1EFPB 4EG1A 3CA8A 3HV0A 1F9AA 1KP2A 4EF6A 1EXDA 1WQ4A 3FWKA 3TM4A 1YUMA 4RUKA 1GPMA 2VTBA 2OV4A 4Q93A 5LLTA 3HFJA 3FOCA 1OWLA 4KR9A 4TS1A 2C5SA 1TFUA 1O96A 1WXGA 2V0CA 4CDNA 3ZJVA 4L2IB 3CLUC 1WQ3A 2JAXA 5IHXA 1GTSA 3ZIUA 3K32A 1I6LA 2WB2A 3SEQA 1X6VA 1VLHA 1I6KA 1N77A 3ZXSA 5HUHA 4H3SA 1LI7A 4EG8A 1M83A 2DLCX 1JZSA 5K0TA 1R6XA 1EUYA 4HK4A 3IMCA 4EFKA 3CVYA 4NDAA 4UZFA 4MWEA 3LDUA 1QRSA 4MULA 4DLPA 1T9GS 1R6TA 3IMEA 3VU8A 3HMQA 3LCJA 4GRIA 2A84A 3UY4A 1NURA 2O8VA 1JEEA 5J5AA 3KT8A 3NBKA 1GN8A 2A88A 4ZT7A 3CVWA 1QU2A 1KH3A 3FIUA 1ILEA 1YUNA 4MQ6A 4ZCPA 2E89A 1B6TA 2VXOA 2XRYA 2CT8A 2YY5A 1Q15A 3TQIA 4XFJA 5F23A 3SEZA 4MW1A 2QUHA 2OQ2A 1VBNA 3DO8A 3N8HA 4MW6A 3ZJTA 3Q10A 2E18A 1O5TA 3MMXA 3A05A 3NV7A 3RK1A 3CLTC 4PBTA 4ZT3A 1WXHA 3QTTA 4JXZA 1I2DA 1T9GR 2CYBA 1MC1A 3CLRD 4KPUB 4X0EA 1EFVA 4WSOA 1H3FA 2J08A 2VTBB 1XNGA 1PG2A 1OD6A 1U7DA 4CT0A 1J21A 1N2GA 4S1OA 3GUZA 1KH2A 1YIAA 3V8VA 1N1DA 3N2YA 4ZCQA 3A2KA 1N75A 2CV2A 1N2EA 1KAQA 1MB2A 2RD2A 1DNPA 4JFAA 4ZT2A 1EJ2A 2PIDA 1NUPA 3MLAA 2IJGX 4YP6A 1NUUA 1S4MA 1OWOA 3FETA 2J5BA 1KKUA 4MWCA 2CV1A 1NUTA 3IOEA 4NATA 5LM3A 1GTRA 1XNHA 3X1KA 5LFAA 3BL5A 4HJXA 4YMIA 1PFUA 3UK2A 2PZAA 5H7XA 4U8HA 4MUKA 5KCMA 4Q16A 3K9WA 3TQOA 1EFPA 2EJCA 3G6KA 4KR7A 4MW7A 2IP1A 4K03A 3SZGA 4MUHA 3PRHA 3L93A 3F3MA 4MWDA 4DE5A 4EG7A 1JECA 3COYA 3SP1A 2PXHA 3FH0A 4GU5A 2H2AA 3N05A 3S3TA 5DB4A 1TYDE 4KKVA 1PFWA 2CYAA 3DPIA 4QBTA 1WOYA 5TS2A 1J70A 1WXIA 1M8FA 5DK4A 2TS1A 1TYBE 2YXNA 3IOBA 2J4DA 2PG3A 2CFOA 2WQ6A 3K0BA 3RJZA 4DDHA 2A1TR 2NSYA 3C8ZA 2RE8A 1Q11A 1KQPA 2QJTA 1KH1A 1QU3A 3CLTD 3X1JA 1COZA 1EUQA 4I6EA 3IVCA 4PBRA 5FO1A 1O96B 4U7JA 2H29A 3M5WA 3UOWA 3AG6A 2PZ8A 2Z3VA 1WJGA 3DV2A 2PFSA 1FFYA 1Q77A 2IELA 3HL4A 3NBAA 4MLPA 5J58A 4MUNA 3ILVA 3DLAA 5DEOA 4MW0A 3H97A 1IQ0A 2CUZA 3FHJA 3G59A 2A86A 1NI5A 1KORA 4KPUA 1LW7A 1EFVB 2WSIA 3MXTA 2AZXA 1XNJA 3IOCA 2DR2A 3ISJA 3UMVA 1KQOA 1IH8A 2CYCA 1MB9A 1IQRA 4I6GA 4ND6A 2O5RA 4ZT6A 1KR2A 1PG0A 3UC5A 1IFXA 4CDMA 3GMIA 1A8HA 5J59A 3RK0A 1QRTA 1ZUNA 3D6UA 1K97A 3SZ3A 4MUFA 3RFFA 4MWBA
chains in the Genus database with same CATH superfamily
2R2GA 2OVFA 2O2HA 1P1BA 1M6VA 2JC3A 1INLA 5EYPB 1I3OA 2C03A 5BUSA 2IX3A 5JNUA 4UHKA 2HLPA 1SHUX 2VK4A 4BMCA 2PNJA 3H5NA 1EUCA 5IM4F 3WKEA 4D98A 4OKIA 4PAOA 1SURA 2G80A 3ZWNA 2W6IA 3L7KA 3OBIA 4H7DA 2OG2A 4LI0A 4G1MB 4F2HA 1F4LA 2UUBB 2JIZD 3DO5A 5IBPA 2WHPB 4LY3A 2PFGA 3NHBA 4RORA 3KJFA 1NU6A 1UEXC 1YI8A 4GYKA 1XXHA 2BTEA 4KRXA 1FLNA 4Z7QB 5TVKA 4E30A 4ZV4A 3AY3A 4IDBA 4LGYA 1SB9A 1TTQB 5LUBA 5HIIA 1YA6A 3B9RA 2FTKE 2JLSA 3LNTA 3Q0IA 3PXAA 3KSMA 4FONA 5I01A 1GY8A 2JI4A 4QFBA 1C1DB 1AKEA 4LWOA 1SBYA 1J2TA 2ZTSA 3LAWA 2PUTA 4IZ6A 5AOCA 4DDVA 4L3WA 1OFVA 4N3AA 4BNDA 2YZNA 5KWJA 3COWA 5JPCA 1MO5A 5DP2A 3ZQKA 3EEFA 5FWXB 3GN2A 4XUCA 4D82A 2IW3A 4HDQB 3UMSA 1K7YA 3NAQA 4YWJA 4NZMA 4R54A 2GCIA 5K3BA 4MQFA 3BIFA 1UCFA 1MJHA 4LZZA 5K8CA 3A11A 4BQOA 2JHCA 2NXNA 5DCWA 1PO7A 2E7ZA 4BFWA 2ZUTA 1GAEO 5EWMA 5IJZA 3HZRA 4Q3CA 4UFPA 2R7AA 1GO2A 2JCGA 3NZEA 1YVDA 4DF3A 3IMGA 4IAOA 2B94A 3MC1A 4O0MA 1ICIA 2VWGA 3V4SA 4PO8A 3QVGA 1A7AA 1TVKA 3PDHA 4MI3A 4PIPA 3R9KA 3JTEA 3V2GA 1J0BA 2MSKA 2IEAA 2VSNA 2Y2VA 3NH9A 4I4LA 4FGWA 4UZEA 4DPLA 2QL6A 3HJGA 3DEKA 1I14A 4L0QA 1ULSA 2P2CA 1I0LA 3I9V6 2C7OA 1DEOA 3QV1A 3TTVA 2AUMA 1P7PA 3LCVB 4TM8A 2AUTA 5LA6F 2V7XA 3BE8A 2WINI 1T9CA 3E5MA 3IAUA 3KAKA 4J6EA 2RHHA 3PFHA 2FUG6 4D46A 3SFVA 1V16B 3ND6A 1UK6A 3ZQUA 2JNWA 2YZ2A 4N49A 2NYUA 1YACA 2MOKA 3NONA 1FFBA 3WOHA 4CQMB 4N5DA 4NOLA 1J1IA 4GMDA 1EVJA 2YUTA 2K7FA 5ED4A 1GKKA 1X77A 2O4CA 5C5IA 3QFRA 1WTCA 1OQAA 3QG5A 3EW9A 5DK6A 3NTXA 3GZNA 1WZNA 1CLUA 5E1MA 2ONKA 1QZZA 1L3IA 2ZSAA 3CEHA 3FSEA 3RTGA 2HCJB 2RI1A 1VE7A 4ECEA 4J0HA 3IIKA 1U8ZA 1E2LA 1Z4KA 3PEEA 2VTEA 1V96A 2CLIB 2GTIA 2B6HA 3K9CA 5KDDA 3AL0C 1QIFA 2E55A 2Z98A 2G9RA 4BNMA 2D59A 2HV9A 3T06B 5FQNA 3LQRA 3TI9A 1YKSA 5GAJA 3DWGA 1Y63A 1IC6A 2H06A 3NC1C 4UU7A 4ICIA 4JSYA 2FP3A 3R7AA 3RUCA 1HWYA 2CL0X 3N1UA 1USUA 2W6OA 1DFHA 3RFVA 1SRQA 3GW8A 2HA0A 4K8RB 2NV6A 3OT1A 5GONA 2AZTA 4P3OA 5F7OA 1W29A 1BSVA 5ALWA 1QPZA 3MJVA 2O2XA 1VRVA 3OUTA 4PQYA 1RYHA 2IZOA 1Z56C 3EGOA 2LCQA 4BASA 3AP1A 4BJ6A 5ALVA 3E27A 3WRVA 2X3FA 1XSEA 3DM9B 5E7JA 5BVHA 1LJ8A 5LNK6 3EGXB 2BM0A 4CMAA 2Q8NA 4ZVLA 1U9JA 4TWJA 4EB8A 1D2MA 1ZXLA 2FN8A 3IPRA 3VPAA 5DF1A 1W9MA 2ZS8A 3K6KA 1GTL1 3DNPA 1DKQA 3IMFA 3RWOA 3EGDA 1L7RA 1TCAA 4MA4A 3SJUA 1LVHA 5AI4A 5K1ZA 5A4DA 2R7LA 2FQWA 2FMIA 1DELA 1QIGA 4GPAA 1YIOA 5IZCC 4CTOA 4FHDA 5EKUA 5HF8A 3ZTYA 1N2BA 2OC4A 4YRAA 4F7DA 3SQXA 1VP9A 5EVCA 2WWVD 2WKQA 4XFDA 4PLZA 4MGYR 5K0ZA 5IT4A 4PV7A 4NENB 1J2YA 3BQNB 4C4AA 3F67A 1NLMA 2CLDX 1B4DA 4LYAA 4BNUA 1NMEA 4OREX 1H65A 4Y0AA 3D6AA 3U1VA 1KK3A 2JB9A 1T3HA 1P2DA 4KXYA 4F71A 4ZCSA 2IHUA 3ZNOA 4I81A 1NKSA 4Q39A 2V4MA 2NU6A 4KIFA 3O2NA 1JDBB 5A7HA 1QX4A 2H2FA 4GBGA 2HMWA 4EO7A 5C8VA 5A4KA 3SS8A 1X9GA 3UPDA 2YJTD 3HR7A 3AYXB 1UPFA 3E4DA 3O1LA 1RRVA 3C6ZA 4FFOA 4N7MA 3L8ZA 5ECDA 2M98A 4YFYA 3QJ5A 3D6HA 3BG5A 3U4CA 3WQQA 5BSGA 4B1FA 1DRVA 3VYRB 3RJ5A 4QC2A 3SSOA 1QRAA 1U0OC 2CLFB 4WJKB 3LXMA 4G97A 1UBRS 1GSIA 1HTTA 1XJQA 3W8RA 3OZIA 5CYOA 2HX1A 3UMMA 1K6EA 2NUPB 2DUUA 2OV6A 1W4LA 5LQJA 3WE7A 1W73A 3A8TA 3ZCXA 4IH4A 1S4QA 1XIVA 4GOMD 2OYCA 1QC5A 2H07A 4C4SA 4AZ3A 3KAJA 3BB3A 2A9PA 2CNDA 3OHSX 3RVOA 2GFIA 3LVRE 1AK1A 2H5LA 2QQEA 2RAPA 3QUCA 4J49A 4LOAA 1UBOS 3SE7A 3X43A 4FR5A 1F5SA 1NVKA 2D5BA 1YULA 3V1TC 1JAYA 4QRIA 4D8VA 2FA9A 5ADUS 4ZYYA 1BYIA 4O2BF 2ZJ5A 3VU9B 1Y5MA 2B21A 3EYAA 3LA8A 4QUEA 4YQZA 5SY9A 1I3NA 2ZSIA 2W00A 1RWOA 1TM5E 4DCJA 2ZZKA 4FW9A 3UMYA 2VNHA 1UBHS 1IBSA 1ZJ6A 3H99A 1D1TA 4G4SP 4HDAA 3ZQ4A 1C4XA 4I55A 2BBWA 1W4ZA 3OZRA 3RTAA 1DKMA 4D4LA 5AW4A 4INPA 1I13A 3HXOA 2XNDA 2ZVJA 3BILA 4OIFA 1JBKA 4DGQA 2H5EA 1EFTA 3GU3A 2WT9A 1GHTA 1WWKA 4RPIA 2QAJA 5B7NA 2J5KA 2OFOA 5CX4A 1ECCA 4R0NA 4C6RA 3VC3A 2VH1A 2IYAA 4EG0A 2BZ0A 3AP3A 4ARZB 1GZUA 2JCBA 2P2YA 2J4CA 2VKTA 4Q34A 4TKVB 3TXYA 4RTPA 2JATA 2WHRA 3MTIA 2QRQA 5DYIA 3VNVA 1NUAA 1UBGA 3P32A 4NV0A 1EJ0A 1YL6A 5DGCA 3UENA 3WIDA 4EGAA 3ZW9A 3KR9A 1ZRNA 4B83A 5ITWA 5JH7F 1KE2A 2Q4RA 4TMVA 3PNPA 2R87A 1T1IA 2IITA 7MDHA 4GOLD 4X90A 3DWIA 3ECSA 4OIMA 2OV4A 3NYRA 4N0PA 4HQ6A 3FOCA 4NCXA 4KBGA 1AHIA 3NEYA 4KAAA 1YQQA 2L69A 2OT3B 4URZR 5DTEA 5A3QA 2FRVA 3F71A 3G1WA 3JPYA 4QDXA 1LRKA 3K6SB 1H2HA 2V9CA 1UKEA 1B16A 2OPBA 4LF7B 3FZYA 2K2WA 5KTOA 5ESRA 4UUPA 3T5CA 4EBFA 4ACAA 4A6XA 1H4VB 1XRQA 4P7FA 3AF0A 1P60A 3T7CA 5AI8A 4M1MA 1HRDA 1PJQA 2XXJA 4Y6SA 1JVBA 4FI3F 4Q9JA 5JT1A 1SB8A 3B6JA 3KZ1E 1E7YA 2XCLA 3AWDA 2CY0A 2FAXA 4RDCA 4E3ZA 5J4KA 3I52A 4UVIA 4YLYA 1TQ2A 3F1KA 3U13A 1OREA 2XVMA 3K09A 4YLGA 5H81A 3OU2A 5ALLA 1U3UA 4RMGA 3D6MA 1Q50A 4EOGA 1BKSB 1QGOA 1U0SY 3URMA 3RYTC 2QM7A 2SNIE 3GRKA 4ZANA 1DOHA 1Z8NA 4TQGA 3KT8A 5CT8A 5GINE 1UAYA 2YOHA 1T36A 1FZQA 2D62A 2GTPA 2LIVA 2XLCA 1GTMA 3O8LA 3G7SA 3QHQA 3ZJ4A 3LF1A 2XECA 4URYR 1FX0A 4CGZA 1EX9A 1J9GA 1Y7IA 2YV4A 3PQ5A 1MQ8B 1HT3A 1VSUA 4BX3A 3SXPA 5HJ5A 1B6TA 2QLMA 4FIZA 1B00A 2B37A 2RIPA 2YY5A 1DAFA 2QIOA 4FMBB 4HXYA 1XDDA 2BMDA 3ST7A 2XVYA 4K40A 1OT5A 5U4QA 1G2QA 1JBEA 4S0ZA 2DAPA 3NHUA 4WNCA 2EFJA 4K9PA 2VWPA 2OBNA 2PM8A 1FQKA 1CLEA 3OLWA 4FC6A 4XZ3A 1THMA 1GQRA 2WU1A 3DOEA 3HKDB 3A05A 1SZPA 3I9JA 3L46A 3NV7A 4KZKA 4RZXA 3DFKA 3AR6A 2C5AA 1D1QA 3IDOA 4JXZA 1WB4A 1I2DA 3ED5A 4B7AA 4XQ9A 1HQCA 3WMFA 3F98A 3CLRD 4BVLA 5LPNA 2C94A 2IEYA 1K2VN 4BX0A 3O2JA 1TTTA 1PG2A 4J4HA 4OBWA 1T13A 5SY4A 4W99A 5DNVA 4CF5A 1N2GA 3X2FA 3QMWA 1KEWA 1X7WB 3V8VA 1HFWA 1TM7E 3AJDA 1ZEJA 3N2YA 1TJPB 5B4TA 3ABQB 1HQDA 2WUGA 4DLKA 2RKWA 5JOQA 3EMVA 1F06A 1U3FA 5BY2A 4TT8A 1EFAA 3VSDA 2YWJA 2D00A 1AV6A 4FPXA 1AURA 4LPKA 3U16A 1EKXA 4DR1B 3N6RA 3VU3A 1HO3A 3HVHA 4GWGA 3JZAA 3HZHA 3N2NA 3EA0A 4J3JA 2B3TA 2VAPA 2XTZA 4EDFA 3C5EA 2A14A 1E0AA 4R3NA 2VZ8A 2CLSA 4EY6A 3JQQA 3MT7A 4AUKA 3G8CA 3FLMA 2FFAA 2FUCA 2HD4A 3D4OA 2ORVA 3GT3A 3LUBA 2Q7DA 3ESDA 4C7VA 3BF7A 3SVLA 4JAVC 3T5DA 2ZBGA 4MR8B 3TVDA 3DDUA 1S8FA 5FL3A 4X7MA 2EOAA 4OU5A 3SMQA 4P5PA 5JS7A 2J31A 5TS3A 4O4HF 1C9MA 1AU9A 3M6FA 4FYMA 1NMSA 1XHFA 2X5XA 3KTFA 3PRHA 5FH9A 1ZKMA 5IK2D 1LZKA 4D2IA 3ZC3A 3BPSA 2N9UA 2Q6OA 6REQA 3R8FA 1YH3A 1KYTA 1QUEA 1PFWA 3BAFA 3CW2A 1CDOA 4A73A 4QBTA 4EQ6A 2NVUB 1HDIA 1WEKA 4BKQA 1M7GA 3WJ2A 4HNAB 4LECA 5AW5A 5EPOA 4R5MA 4HP8A 2VJKA 3E15A 1M2VB 2RGNA 4PLGA 4QIHA 4XIIA 3VQTA 4B32A 4XLZA 1TK9A 3WZMA 1KZ7B 1CF9A 4H9GA 5A0FA 3VX3A 1LPSA 1Q44A 4KWTA 1GU1A 1YZKA 3LVBA 4KXWA 3BH0A 4IX9A 3C8ZA 4O2LA 2XUDA 5JANA 3M9LA 4S1WA 2QJTA 3JWIA 3Q41A 3TYXA 1QU3A 3FYUC 3GUVA 3Q87B 1H69A 2F1RA 3M3PA 1ODIA 1E6MA 3IVCA 4Q1EA 4FCCA 4YR9A 2CBXA 4EGQA 3W0LB 4KNWA 1YR1A 2F2TA 3EXG1 1E63A 2PZ8A 4EPWA 5DM0A 3AY0A 5JAPA 5B1EA 4IEEA 5MN5A 1P45A 16PKA 1OTHA 3R3UA 3JAWB 1E9BA 1T3GA 1QGED 1RM0A 4W63A 3AOEC 1UM9B 2HT6A 1UJNA 3I2JA 3QFCA 4JIMA 1ZGBA 2GYWA 2V6FA 4MUNA 4RVSA 4F2DA 1VHLA 2QRUA 2QRMA 4XWYA 3EQ8A 5AW6A 3JTMA 2EHDA 3EARA 3B9BA 4WLEA 3WGNA 2WFMA 4PICA 4CMKA 4UM9D 4EX6A 2A59A 2ZSHA 1IXKA 1NI5A 2DPMA 3SQNA 1ZC3A 4I9UA 1ZSVA 3TRJA 4C3OB 2HEIA 4I99A 2CLEB 3DZJA 1RFGE 1NDQA 3SBOA 3T7EA 3TNYA 5J4YA 4AM8A 4EI9A 1JJFA 2Q6TA 4C4XA 5DBEX 3VZCA 1Z7WA 1ORRA 1W8IA 4F1WA 2P3SA 1MB9A 4FWBA 3SK0A 5DIFA 2P6RA 3A6FA 3IO3A 5I5EA 2C00A 1KR2A 4BIMA 1SBNE 1S2GA 2WG0A 4X64B 2EKLA 1ISGA 2JBAA 1BHSA 1C1DA 1NONA 4TL7A 3TW0A 3QU2A 1J23A 2GEDA 3M6VA 1D7AA 5J59A 3VVLA 4AMZA 3D54D 1U3TA 2IOQA 2X8LA 2QXUA 3C5VA 5T7BA 3MJEA 5FLKA 5CEJA 3RLFA 3GHHA 5AVTA 1ISSA 2ZR7A 1O5OA 1R64A 5J23A 1TD1A 1U2DC 2PD4A 2VT7A 4WBNB 4HNAA 2X8WA 3VSCA 4G9EA 3HXTA 4G0VA 2XBMA 3L1JA 2XYGA 4CWAA 2JGDA 5CDSA 3UV6A 2REXB 2AUNA 1ZR2A 4UUOA 1JR3D 2OO3A 1IBKB 1U3DA 4IIXA 5JJBA 3S2FA 4P22A 4YBRA 2ZDHA 1M3SA 3HBLA 3NT4A 3C3KA 3D8SA 4M89A 1X7GA 3UXHA 3LH5A 3ACBA 4EVRA 4TRMA 1QQ5A 1EK5A 2BBSA 1E8DA 4GM4A 3D8UA 1E1DA 4HBZA 1A88A 4ZJYA 1VXOA 1LPBB 2QXYA 5TXGA 5D3QA 1Q91A 4IDEA 5AJYA 3NGMA 1MNQA 2C2KA 1CZRA 5JVDF 2L18A 3KPUA 2M1XA 2VF5X 2H65A 4ZPXA 3QNWA 3CH6A 4BY9E 1UPUA 4YDRA 4MVJF 3L92A 2PLNA 4XI9A 5ELLA 3ZHRA 4EFMA 5IC4A 2DXIA 2ZVQX 3PWZA 4M46A 5DT2A 5GV7A 4D0SA 1H5UA 3K9NA 1S01A 4QUGA 1ODLA 1PTKA 5LLSA 1IQPA 3HKCB 1F14A 4KIUA 1JMVA 4NH4A 4PWZA 2G25A 2IEBA 1KFJB 1H6BA 1RHQA 1SGWA 4H77A 2CVHA 3G8YA 2J3HA 3C39A 1VE6A 3GN1A 3QPAA 3DG9A 4P2BA 1YFKA 2GCPA 2VQ6A 4I19A 1TVEA 1QHYA 2MT9A 4JUBA 4RF2A 6NULA 1O7JA 4TTRA 3OO1A 5BV8A 3HFGA 1BTOA 4NOJA 1FMLA 5IAOA 5AM2A 1YRYE 1A9PA 2GA8A 3H2JA 4IIJF 1RJDA 3QPDA 1MJ5A 1PVDA 1L5QA 4PANA 3KJNA 5IG2A 1GQYA 3I6MA 4G5RA 3BMQB 2JF0A 4DOMA 4DJAA 3VU0A 4G84A 4ARIA 4HFNA 2ZUEA 5BOVA 1J0CA 4KRFA 3N0TA 3FHOA 3HKDA 5BN3A 3OZTA 1HFEL 2C31A 1YQEA 4D79A 1HGXA 1P1IA 4JBLA 4E2ZA 4BNHA 4ARAA 4C20A 4OP3A 4MIOA 2I7TA 3WGUA 2RGDA 2I4OA 2XNKA 4QUHA 5KKNB 4RU1A 3M6IA 4URFA 5F9HA 4FCWA 1Y3BE 3OZDA 4ER7A 1M1ZA 4UARA 4HS4A 1NDUA 3O0DA 5F7XA 1TW2A 1WUIS 1IOVA 4KQEA 1BVRA 1JAXA 1PR0A 3S81A 2QG9A 2A92A 4UBJA 4MW9A 5E1BA 5GV8A 3C7DB 1RC0A 2XUIA 5C4MA 4I5EA 5G3ZA 1DTWB 1PKXA 1XHEA 2XUAA 2ZWPA 4JLNA 1D2NA 4MVWA 1YQDA 2PUFA 2GH1A 1BRTA 3HCFA 4I6JA 3Q2KA 1C1HA 5HBRA 3OMLA 3UMJA 5IYZF 2OUIA 2GD2A 2O9JA 3M89A 4Y9SA 3TTTA 1FDUA 1VG9B 2LBPA 1WCYA 4MVJG 4CYMA 3U40A 1JDTA 1K4YA 3THSA 3ZU2A 1GNPA 2QI9C 4D4IA 4DMHA 4LDQA 3UV7A 2COUA 4ZQFA 3WB9A 2D3WA 4RE6A 2HREA 1BX3A 1B8OA 1OTXA 2O5CA 3W8DA 3MQ4A 1ZJWA 1WZ2A 4XYBA 1E0DA 4A2PA 3K4PA 3BMOA 3IB6A 1ARZA 1T1GA 3CO5A 1KPGA 2PGJA 3FCAA 3K0CA 4X54A 4D6PA 3ERCA 2I4RA 3M6UA 4GXRA 2BKUA 3VR4D 3GLGE 1AKWA 2ID7A 2C59A 3IQEA 4FOLA 1HC7A 2OXFA 1KDVA 3DC7A 4QYTA 2Q2QA 3OQ6A 4I5IA 4LQCA 4WBSA 3KB2A 4HAWA 5IH3A 4YV2A 1KQNA 3N6VA 4NYMR 4XX0B 4GPEA 2G08A 3C5HA 4PSKA 5G1OA 4CCYB 2R8PA 2OGWA 1AS0A 1MB3A 3CKMA 4F8JA 4R1PA 2V7QA 4TS9A 1J56A 2HF9A 4MKFA 2R00A 1T4MA 2VDVE 1H6DA 3CNEA 3NR2A 3UV3A 1AHNA 5EJ2A 2XYPA 5C7YA 1HDCA 1TUIA 4HGRA 1T91A 2D06A 1AUQA 2FMFA 4Z9AA 4OMDA 3S7ZA 1V16A 4XVCA 3V32A 1K5HA 2BONA 2GFHA 5C1DA 3VO1A 1I3MA 1X1QA 4R2KA 1LTHR 2FGKA 5ICMA 3FYTA 1AK9A 1NYLA 2F4NA 2GK7A 3WGGA 1YDHA 1E4YA 4HVAA 4TPKA 5BNIA 3UTCA 5HOQA 1D07A 2V7UA 3RS3A 4G5OA 2KB0A 1TVCA 3BXOA 3DDZX 4GH5A 5JXWA 5M29A 3C3EA 3TXXA 3NM5A 3O92A 4RS4A 2CD7A 4EKNB 5KUTA 1Q0ZA 5ISMA 4CCAA 4XJXA 2FUG1 3KLOA 4B3TB 1WW2A 1V4BA 1Z15A 5LQSA 1FLDA 4KB5A 2G70A 1SBCA 2OM2A 1P0MA 4K9QA 3T4PA 1ORDA 5SZKB 3ZKAA 2IOHA 4ZVOA 1VI5A 3RVKA 4DV5B 2CJWA 2P9BA 1FTNA 1Q21A 5JJLA 4Q48A 3CUUA 4QGHA 5BSKA 1E9VA 5KYXA 4AJ1A 3KQQA 2REQB 3G1UA 4J9VA 4P35A 2I4TA 1F9EA 2HW8A 3TK1A 2GLTA 4I46A 4DB2A 4GECA 3JQAB 3E7XA 4LTNA 5DASA 4OUDB 4D9JA 4PYQA 3RRFA 4XWKA 5EJ6A 4BO0A 1ZQ9A 2PMDA 4MO2A 4EDHA 2YRXA 2WF8A 4OM8A 2WUEA 3ES9A 2P9TA 4QQFA 2W0MA 2YHIA 2X0IA 3O47A 4ZI5A 3LYLA 2DHCA 3AXTA 4AFNA 4Z7OB 3VDMA 3ENKA 1JDJA 1SC9A 2FSHA 5K3SA 1H2EA 3SHWA 3ZPXA 2IT1A 2PSJA 3WMWA 2C3MA 1TCBA 2O6HA 5A3SA 3A1DA 4JHLA 3GQBB 1A04A 3MFYA 1KJYA 4A0HA 5DH9A 4DDKA 3D0QA 1ZCZA 4G56A 4C4TA 4A0RA 1FDIA 4GMHA 4QU5A 3S7TA 1ULHA 3VISA 4Y2SA 3NC0C 1XXHB 4FT4A 2VSXA 3RBVA 1Y3FE 1PJCA 1W0CA 1YJBA 5KYGA 1KI6A 1UBMS 2A9RA 3LWZA 4PNZA 4D42A 4C0BA 1WXEA 4FHFA 1ZHVA 4JB2A 1R6DA 4IKOA 4ZCLA 1HUQA 1VE3A 5E1DA 3B5JA 3VMFA 1V9LA 2AFIE 1EJ6A 2C77A 2P2NA 3KHKA 3WK8A 3P52A 1J8QA 1N3LA 1PEKE 4B7UA 3FPFA 2FOLA 1CFJA 3FGPA 3BMNB 1JFFA 4M1YA 1KRWA 2OFPA 4XSHA 4ILKA 4JVSB 3ORQA 4D80A 2FB9A 3FFTA 2H1RA 2AD1A 5K0CA 1THTA 2ZIXA 2RIRA 2P3LA 4ZO7A 1EA5A 3WYFA 2BFWA 2X42A 3NG1A 2WP8J 5A71A 4RJIA 4BBJA 3F5QA 4EENA 1G7SA 2GBPA 3SZMA 1RTKA 2CZQA 2PX6A 3MPOA 1VRCA 3NXKA 4KQ6A 3ZXYA 2W43A 1IMJA 1X74A 4TWIA 3FUXA 1F3LA 3I34X 4ZA2A 4ZAGA 2J48A 4KTTE 3ZK9A 1YR9A 3VZSA 1DWQA 4JYCA 4BN5A 3C98A 4QLBA 5IKEA 2LIPA 3AUYA 1REQA 3I61A 4B2PA 2P6PA 2VJDA 1H94A 1NVMB 1QCYA 1Y4DE 3PQCA 2BGLA 4RNCA 4W1RA 4AJKA 1Z82A 4TVBA 2EBFX 2D4AA 5TPWB 3ZOZA 1D1PA 2Q5QA 4I4TF 4LRSB 4WXHA 3ILYA 3CZAA 1DAGA 4GE3A 1NQOA 3K5PA 1AH2A 2FYTA 2W11A 4GMFA 1DGQA 3DDNA 3I72A 4RUKA 4D9KA 2O07A 3WNCA 2Z6QA 2Y1CA 2XY4A 3RS5A 4D8UA 4Q5IA 2AG1A 2W2MA 1C1XA 3ENNA 4B3IA 1H42A 2ZRCA 1A95A 1QZ3A 3V7NA 4FLEA 5ALXA 2MDTA 2DBVO 1X1EA 2Q6VA 4MI1A 4X91A 3U1BA 4P6VF 5G1NA 3C7CB 4R9VA 4BS9A 1TQ4A 1RRKA 4LGVA 3PNMA 4YRRA 1MV5A 2WFLB 2ISQA 4Y2JA 1IM2A 4KVZA 1DUVG 1PX0A 5LZ4A 1A9XB 1THZA 4ZQGA 1SWVA 4AO8A 4G65A 1WDWB 1VLQA 4PWYA 4Q3DA 4WINA 4YLEA 3LUCA 1C81A 1GSAA 4YXFA 1EUYA 1JB1A 3N74A 4RV5A 1GQOA 2G7MC 3HYLA 5K7SA 1M7BA 4EPYA 1G19A 5GADl 5AFSA 2FMTA 3KQVA 1R6TA 2DT5A 4UM8B 4GUDA 2J6BA 3HRKA 3LCJA 4ENRA 3HVRA 3UJ7A 3I83A 4QAQA 1XCPA 2PH5A 4US2R 1NURA 2Y6UA 4IGIA 4RZSA 1JJIA 1W75A 3ZBPA 1ECGA 2PL9A 4UATA 5FHQA 1KJ9A 3FXAA 3IDAA 3NBKA 4Y2GA 5K01A 2Y1FA 3FYUB 5ELXA 1E0JA 3HMKA 2PTHA 2R25B 1SOVA 2V96A 1OASA 1DOAA 1PUJA 2ZJZA 1OU4A 5ERYA 2XADA 3L43A 3TLBA 4B80A 3TQIA 1CJUC 4XFJA 3DE6X 3FHCB 4MQBA 4D9EA 2WSSA 3V6LA 5F23A 1ZAYA 4WX2B 5G0UA 3R3JA 2BH2A 1FSPA 1RBQA 3MMSA 3A1TA 3QBJA 1OB5A 4JKYA 1N6NA 3F4BA 3GBPA 4P33A 3TD2A 2ONYA 3IAXA 3TUJC 4BO4A 1DXOA 3FTCA 4HDNB 3G89A 3WP1B 3FZEA 3KS9A 3OQPA 1HLFA 3EHEA 3KXPA 4ZT3A 1NVUQ 1Y80A 1UC5B 1S3SA 5KOJB 3OQOA 4R83A 1FNCA 3WRXC 1VKHA 1J33A 2Q6LA 4OHKA 4Q7JB 3SGLA 3V9PA 1VIAA 3BA1A 4BLWA 4OB6A 4D8YA 4C5CA 5JSUA 1W76A 2JARA 3A4LA 3W3ZB 3DO6A 2WD8A 5AM3A 2J9YB 4GXNA 2D0PB 3OA0A 3OU6A 1V48A 2J0SA 3B8EA 3HXKA 3CEPB 3H2GA 4KE9A 2DLDA 4I50A 5KKAA 3RM3A 3U3OA 4UM9B 1N1DA 5BWNA 4N41A 3A2KA 1N75A 1RMQA 2GAFA 2JCYA 3OF3A 2WJ3A 4H2DA 1N2EA 4MP3A 2ZTHA 4DMMA 5CG2A 4UHEA 2H85A 1A69A 4F0JA 1B42A 2FFHA 1NP6A 4MQEA 2PIDA 3OQIA 5EJGA 3EIWA 3EZ2A 2FX5A 3D7MA 1OFUX 5DNAA 5ALRA 3WHKA 2AXPA 1MVLA 4HXGA 2O52A 3K09C 3LUKA 5EWLA 1LK7A 4RENA 4XCQA 5T5QA 3RU3A 4QEZA 3PL5A 3PUYA 4W5HA 4JL6A 4YP6A 3AFGA 1DO2A 5T8KA 1ADJA 2KI5A 2WZQA 1CCWA 1KRHA 1D03A 3L0OA 5H4GA 1IN7A 5IFKA 3VHXA 4NATA 1F3OA 1E32A 3OCVA 5JFGA 2XNCA 2WMDA 4NYJQ 1WLYA 2AFHB 4FHGA 1JHXA 4LZOA 2AOWA 1C8VB 3KJHA 3FSGA 5E4TA 4H7IA 2PRKA 2W0SA 3NOVA 3JQAD 4L16A 3TQOA 4LE1A 5JD6A 2PGNA 4JLSA 1NBMD 4JHXA 1MOQA 1WTAA 2FZCA 3L93A 4IIVA 4MRMB 3UJDA 2YXEA 5CEFA 4V1CA 1OI3A 4D26A 1YZ3A 1X1RA 1V2HE 4RGVA 4P8RA 1XQWA 2YYYA 3D0KA 5E3JA 1JEJA 3VPGA 4W1PA 4ZRDA 4KKVA 4LJ6A 2YIVX 3EC7A 5YASA 1ZNQO 2PKYX 1L5WA 2XIJA 1ISPA 1N7HA 4TV8A 1KJNA 3OPNA 3UBTA 2P9YA 1T2EA 1OFHA 3GCDA 3AR2A 2HY7A 3QENA 4MKXA 1LPPA 1K08A 3KK0A 1TLTA 3RRMA 4LF8B 4JOQA 5K8VA 1R4AA 4PLYA 5EP1A 1PEDA 4XGKA 4QXPA 3TLYA 3ZDZB 1CFZA 4X20B 3MOGA 4MJXA 3LW8A 2W70A 5HZGA 1MT3A 2LUOA 5CFQA 4WH0A 5KIAA 2ZBUA 3FUUA 5L51A 2ZWIA 1WETA 1GYQA 2Q3HA 5CGQB 3EZFA 2ONCA 2TECE 1WXWA 3PENA 4Y2XA 3FLEA 4JGGA 3AG6A 4UNPA 1I33A 2NO5A 4NZOA 5D1NA 4DIFA 2XB9A 1JUDA 2XE7A 5THQA 3JVIA 1P80A 3H4MA 3IP3A 5KTNA 2W2LA 1T10A 3C8HA 1CQIA 1UJCA 1KZ6A 3M6MD 1YQTA 1XLUA 4EO9A 2B4AA 5IF3A 1CBUA 1EUDB 4ID3A 1HSZA 2X7JA 5CXXA 4CLDA 3KKZA 4YJ2F 3UJHA 5G0SA 2G4LA 4UDXX 3CF4G 2JAHA 3ABZA 3SXUA 3B78A 3KOOA 1XEXB 4FZVA 3IIMA 1K66A 5EWJB 1DJNA 3MXTA 3ZS8A 3CNQS 1NP3A 4C29A 1MABA 3DBVO 1WLSA 2NUAA 3GLKA 3RBXA 2YTZA 1MTOA 4CE6A 5D5PA 2I80A 4YO8A 4KDFA 1V35A 1OKKD 3QLUC 2GZRA 4GMGA 1TJ5A 2GPTA 1L6IA 5SZJA 5K03A 2BR5A 1Y0BA 2J0UA 4PTLA 5G2OA 2DZDA 3N0WA 3DZBA 4WUTA 1C50A 1RTTA 5CH8A 3KKOA 2Z1NA 1JZQA 4KACA 4XWOA 2ZSUA 4FBMA 2ZSFA 2IZ1A 5A06A 3S2GA 1XZDA 3WB1A 5AUPB 4A9AA 2W5UA 3LOPA 5JAMA 2YW9A 2W6QA 4FFNA 2IV3A 4UMEA 5DBOA 4ZI3A 2WU3A 5C34B 3E3LA 1QXSA 1GU0A 1AXRA 4ND7A 1FDOA 3T7IA 4PFJA 4X00A 2Y6VA 3I1YA 3ZWYA 4JJ6A 1TUGA 4B9EA 5E4YA 4M9UA 4P3YA 4S12A 2OZLB 2ESRA 3PNBA 4TVOA 3AKCA 3M3DA 3RIYA 3FYSA 1Z18A 3H75A 3HC7A 3PGA1 3TAXA 4B8YA 1FSZA 3A7EA 4YRTA 2V6BA 5ETJA 3S1SA 1OV4A 1JSLA 1VZ2A 4CUKA 1O89A 1XTKA 3JWHA 4B74A 4AZ0A 4MWTA 3V34A 2GHIA 5LMUB 1EVIA 4X6YA 4AYTA 4QBIA 5JIBA 2W7TA 4NAHA 1OYWA 4IG9A 4ANFA 5A6SA 1E89A 4DJEC 3THYB 5I9TA 1DX6A 2YNMC 3Q12A 4W9MC 1LV8A 1KO4A 4Q3AA 1XLTC 3AU8A 4C7JA 3V1LA 1BEUB 3GARA 4E13A 5HGXA 2N1BA 2W8ZA 3P94A 3EWAA 4MROA 3SJAA 4CMEC 4JJ4A 3KSDO 1UKBA 4NWIA 1O9HA 4QX6A 3SHFA 1XNQB 2ZYDA 2BC9A 1WCXA 1ZP6A 3FKQA 4PLCA 4ZFNA 1N4DA 4KK4A 2WTMA 3O4HA 1QZTA 3DEIA 1W4RA 1KI4A 2CNWA 5A9TA 3CFYA 4Z86A 3RYIB 3T9AA 3ZE2B 4M0UA 4ZAYA 2B99A 5FJIA 2QMHA 4L73A 5BMVA 1JFVA 1K7CA 1OW3B 4C9BA 3ESXA 2IYPA 3I53A 2FKNA 3WA7A 1PLKA 1JI0A 1R6UA 2YINC 4KQKA 4YP1A 4QGGA 4EH1A 1PDOA 2DUMA 1QDLB 1HXHA 1ZDMA 2BEVB 3KLPX 3O7MA 4IMPA 3TDMA 3UAYA 4C0QC 1T2CA 2ZB3A 4MRNA 2I2CA 4OLFA 3QEBZ 2X4GA 2Q1YA 4EEKA 1PX2A 1CWUA 3H16A 3LT4A 3RIGA 2ETXA 4OKNA 1OTYA 1P7CA 1SNYA 5HKLA 1DLJA 1CDDA 2J59A 1S8AA 1T35A 2DY1A 1HORA 4FEGA 1Z4LA 1VMAA 5DNCA 4EJSB 2WF5A 1NUQA 3RAGA 1ZCAA 1XYVA 5BRJA 5H9VA 3WQBA 2J0VA 3FGNA 3OQ1A 4DV1B 1P1JA 4L27A 1N5RA 4KDRA 1BH6A 4XM0A 3NWBA 4KKXB 4R2HA 3L7JA 5CK4A 4F7WA 3HG7A 3PWTA 3GFTA 4IDNA 1G5RA 4R41A 1SCAA 2WPNA 3V80A 5IBRA 3PV0A 2VUTA 2DUJA 1WUKS 3BN3A 2GUWA 4TKMA 1UAGA 1UBTS 1M8KA 4F5EA 4MMYB 3AR3A 2PX3A 1R37A 1CY0A 1Y37A 4RDHA 4B31A 2IPMA 4FFBB 4XYLA 5C8YF 3W7AA 3UHOA 2E9SA 2Y3IA 1WY7A 4EZBA 4TQAA 4CL0A 1IEVA 1IB0A 3HCEA 2J30A 3M1YA 1LRLA 3GEHA 1IJBA 3LCMA 3JVUA 1PU2A 4ZEOA 1TXGA 2CJFA 4RL4A 4YJHB 3FI0A 4BL5A 4KIJA 4DA4A 1RWMA 3RVMA 4CMIA 3H3FA 2FPKA 2C04A 1D2AA 1T1JA 3EMBA 4XJSA 3MD0A 2AW5A 1A77A 2GEJA 2VF4X 3BGWA 3HVIA 3VO2A 4CIAA 2Y99A 5EGNA 2X4LA 3IXLA 2I2XB 2Y0DA 2IXGA 1B8UA 1M1UA 3SF8B 3QWBA 1BGWA 1VL2A 5IT0A 1TUEA 3FTPA 4MS1A 1LEHA 4LRYA 4K5QA 2AC2A 5LDHA 1BMDA 1GZ5A 2FPLA 5IASA 3FNRA 2MYUA 4C5BA 1D6JA 1RJ9A 3BGDA 4YV1A 2FKAA 2PCJA 3TRIA 2W37A 4G41A 1J7JA 2V8OA 1BAPA 1KRXA 2OBFA 3VR1A 2W2LD 2GRUA 1OFIA 3EQ2A 5K0LA 3L7BA 3RV3A 4BWFB 4LQ4A 3ND8A 3NHMA 1CRWG 4OQXA 4K0RA 2BM8A 4P4UA 4BZZA 5DJ5A 1JFLA 2HTFA 3QOYA 3OTHA 4S0XA 1ZD3A 1BKYA 5U9CA 2FZ5A 4JA2A 4ZOLF 3GMTA 3IDFA 4JKOA 1P62B 5T3UA 2ZZNA 2VDUE 3KP1A 1BHJA 3R20A 2VZ0A 3IUBA 4FSXA 3LPCA 4F46A 3ZGYA 4QOIA 3QVWA 3JYOA 1K7FB 4L95C 4KI0A 2W6MA 3UNXA 1GWNA 4RFSB 1KIMA 4OXYA 4L5AA 1UBUS 3GRCA 4ES6A 3EWNA 1WMEA 3RDPA 5H4HA 3WGJA 4H08A 3T3DA 1GDTA 1NQVA 3DEYX 1NNUA 4YH1A 2H6EA 1N9ZA 2QYHA 3DEHA 2Q2VA 3QTBA 1MO4A 3CIOA 3RJMA 1XT6A 1SG6A 3UEOA 2XQKA 2ZJ1A 1IM8A 4PG5A 3WQSB 3BXPA 3RSFA 4D3DA 1HOXA 4MDEA 1N78A 3AUTA 2YX1A 2Z95A 4WERA 5CCXA 3KFVA 3I5UA 2AIRA 4UD6A 2ZVDA 3TAUA 3LK6A 4RHFA 1E1NA 2GJ8A 2H59A 1JQBA 4RVCA 1QFMA 5F33A 5DSXA 1SUBA 4LYFA 4G0NA 1KAMA 3GG9A 1R0LA 4HB4A 4OHOA 2X7XA 4MTCA 3RO7A 2VJQA 1MTZA 3STWA 2QW0X 4AW9A 4EG6A 5KX5B 2I6TA 2UZAA 1CUFA 2BGUA 4Q3BA 3FBWA 3OIYA 2HLNA 1KEPA 1A8UA 3IOMA 4M38A 2RHOA 1XL1A 3NQ41 2WWYA 4MJLA 4WI1A 2KLHA 4D74A 1SOMA 3O8QA 4ZT4A 1P31A 3U7RA 4L8YA 3PYLA 4ZVKA 1AQUA 4KAFA 1J07A 1XZ8A 1GTVA 4V38A 3RD5A 3HWSA 3GGDA 3GFGA 1WY5A 2WVAA 2OKCA 3PS9A 4L4XA 4PYKA 2GA9A 3CEJA 4JEMA 5L6MB 3TBKA 1JIXA 5KOHA 2P40A 1TYCA 2JGMA 4YCJA 3T0GA 4F12A 2FLKA 5HIJA 1WZUA 1I3CA 3TPFA 4JODA 4YUYA 2ON6A 5JY1A 4UNQA 1SU7A 1VECA 2J9ZB 4OGLA 4ZKDA 2FQQA 1GXSB 2P5SA 3TTWA 4K9RA 4INAA 3W5BA 4JIGA 2WABA 2JFYA 3MF4A 1LS1A 1KI3A 4JL5A 4JH0A 2VQ3A 1ONSA 4X7RA 4I4IA 3OTQA 3UG7A 4HEA6 2ZT5A 1SCNE 3G2NA 3NTQA 2FEWB 2O3UA 2WYIA 4KBFA 4KUEA 3FB1A 3VKWA 2AJBA 3PFKA 1OFGA 4UHCA 4CR7A 4MDYA 2JAPA 5T4BA 2APJA 1EFPB 4P32A 3FW1A 1V11B 3R1IA 3B9PA 4FDUA 3SM3A 4HH4A 2WNIA 3A32A 1KMHA 1FNSA 3BHMA 3QBDA 4L28A 4RVDA 2WJ6A 4EF6A 4KK3A 5LQUA 1MO3A 1E8MA 1NU8A 3EOBI 4ZEVA 5L9AA 2MU1A 4UFNA 5KYNA 5FI0B 2ZJ3A 4GE0A 4PYOA 5BNTA 1WB9A 1GA6A 2HEGA 4ZVSA 3I0NA 2C7RA 5FCDA 4WZAB 1VE9A 3LWBA 1SM4A 5E1OA 1US8A 5NULA 1EE9A 2IYZA 1EK2A 1EVYA 4L8FA 4ZK2A 4UU1A 3LT1A 4Y2PA 3U26A 2AB0A 2PKWA 2W83A 4LY6A 3F49S 2BHNA 4M53A 4C4PA 1GTSA 3AVTA 3AESA 1T0UA 4BQSA 3A9TA 4XIFA 3FVWA 4QQNA 5JARA 2C92A 2MIIA 1OA1A 2W6ZA 4L74A 2ZT6A 4BN0A 2IVZA 1EFUA 3FPSA 3VPDA 1KMMA 2E4VA 5F1KA 2IPLA 3BL6A 2R84A 3MGGA 4O8ZA 3W3AD 1TRHA 3F96A 5EHQA 5ICFA 3WTCA 5WRFA 1MIOA 1HEYA 1VRWA 1YR6A 1UDWA 3H42B 2RC5A 1KF0A 3HMQA 4NQZA 1FS4A 3K9FC 4I7EA 1X9IA 1IHXA 1V8BA 4YO7A 5K4AA 1XLVA 4HNSA 4CKBB 4F38A 5D3ZA 3W6UA 3NYWA 1KDPA 1XQXA 3M5PA 3NHWA 4UPVA 2YJ6A 3F3KA 2UVPB 3K73O 3H4VA 5K4HA 2IHVA 1KH3A 1ISHA 1RI3A 2FEPA 1GT6A 1NSFA 2WB4A 3BRCA 4INOA 4MQ6A 4O2BB 4YRCA 3TZBA 4UBNA 1QIHA 2VHVA 4C08A 3D3JA 1DQSA 3CH5A 3O75A 3QUBA 2D2IA 1I1HA 3TGLA 3VVBA 1BW9A 4P3XA 1FQJA 3AESB 3QIVA 1SD1A 1LW6E 3JASB 2H1LA 2O8BA 4E6EA 4KFCA 4PX3A 2YMLA 3X44A 3OSZA 1GG9A 2VK2A 3NKFA 3TVIA 2X40A 3T5GA 1KZ9A 1T9GR 2P2LA 2C9MA 1N9KA 2YQ4A 2DKFA 4JJKA 4Z54A 2F62A 1V7CA 2HF2A 3ANXA 2LDBA 4M83A 4WPGA 2E3JA 4P84A 3HUUA 1YRQA 3RUHA 1RQLA 4D96A 1A50B 3MWDA 2ZTUA 4OAPA 4ZGGA 2ZSBA 1JSZA 1UKAA 2D7JA 4Q1CA 5CFPA 2A8YA 3VI4B 3KQYA 1G6Q1 3VC2A 4LHWA 5EZ6B 1PQ4A 4AY5A 1JU9A 1KH2A 2NNLD 3CKKA 3PHBE 1W5EA 4M7WA 4OQPA 3PA6A 3PIIA 4H0FA 3HB1A 4O5AA 1UKCA 5MHTA 2FR0A 1P77A 4NARA 1PI3A 4AY3A 4IGAA 1F0PA 9LDTA 3CXUA 3TQSA 4YRKA 3IEMA 1VCOA 2RH9B 3QVSA 3V1UA 3VU9A 5K0GA 5HUJA 3L4BC 1W47A 3WGMA 5JRJA 5DLPA 2ICAA 4NECA 4AURA 5EPUA 1M1NA 1N6IA 2IYFA 4RPGA 5CNKA 3OE7D 1NA5A 1Z38A 3NPAA 4IUCS 2JI6A 4CIWA 3HJTA 3IQHX 5BXYA 5LM3A 1XB2A 4Y30A 1GTRA 2Z2XA 3IVRA 3O5AA 4XASA 2F3QA 5K3FA 2JJMA 5JQGA 3OSUA 1ND5A 1SUEA 3ZR4B 5JZOA 1ZNWA 5BYKA 3QE2A 5FDFA 3K2QA 2QWXA 4JC0A 1PT6A 4FN4A 1JHYA 2XQJA 5ALQA 3VC1A 2NT4A 4FFVA 4J8PA 5A7FA 3P19A 2FLVA 5EZYF 2E85A 1FDTA 4RK0A 1YS7A 4YUVA 3RLIA 5JXGA 1O1YA 3ANLA 5FORA 3TX6A 2DM6A 1YNSA 5H80A 1KOGA 1J70A 1ZUD1 1CHNA 2X8AA 4X5OA 3AR7A 3UMRA 4HSEA 1WHSB 4C76A 3E61A 3SN6A 4PX5A 4B2IA 2HNAA 4NMXB 3QBEA 1DT3A 2OHJA 3K0BA 4YCBA 3NCTA 3V00A 4YS6A 2B4YA 3Q8WA 4BB9A 3S5JA 1VSTA 1KQPA 1DAPA 1EFKA 1I2AA 2Q3CA 2XSZD 2I2AA 4HLUA 1LA2A 4I1IA 4KQIA 4Y6GB 2UZ0A 4DHWA 5DNUA 1ESNA 2J3LA 3N07A 5F7JA 2Q7OE 3CF6R 4BZQA 5T4EA 4CCYA 3IP6A 3DOUA 4K81B 3U60B 1Y8RA 1MZPA 3AEKA 1DXHA 1COWD 1PTJC 3IEVA 1CUCA 1U2TA 2EC5A 2Q41A 1M6YA 4LDNA 2WHXA 2G1UA 4QBKA 3AEYA 1T4BA 1L8QA 3WLPA 2XMCA 1FFYA 1SA0A 2POQX 1EXNA 3D43A 3DAGA 7MHTA 3AMVA 3PUKA 3B7GA 5LZ5A 4IFEA 4O63O 4B6GA 3WFIA 3EXEA 3MMNA 3NVMB 4P38A 3DLAA 2DTDA 1DVRA 3B3JA 3BULA 1FS6A 4K1LA 3TQCA 4E14A 3COSA 5ER9A 4COKA 1JIUA 3DNFA 4DWOA 3FTEA 2JFWA 4BCDA 3ECCA 3KJGA 5HF5A 2QAGA 3V4LA 3VGPA 2Q6KA 5CA1A 3DF7A 3TOVA 3ROEA 3QF4A 3QOXA 2VUIB 4R2WA 3V7WA 4A10A 5C8DA 2MYPA 4X3OA 1WDMA 3HYCA 2QN1A 4Q1BA 2J9FB 3R4VA 3NTOA 3J7AC 3RB8A 1EUZA 2E87A 2QTCA 2V97A 2GKGA 1IH8A 4QA9A 5DT9A 4US0R 1ICEA 1IQRA 4WESB 3OF2A 3KV1A 1PGJA 5CJ2A 2QLLA 5DM1A 4G1FA 1HTBA 2O8CB 3VUEA 1IFXA 3CT4A 4MQMA 3G23A 4MDHA 4IHJB 3U81A 3D7NA 1DKUA 3OT5A 3BE4A 5I9BA 1CD5A 4N8EA 1NVDA 3N0XA 3FF1A 1QRTA 3HB4X 4IJVA 5B30A 3SZ3A 3OLXA 1JJ7A 2WAMA 1XF9A 3NXSA 3SX0A 5B58T 3RF6A 1JLHA 4MWBA 1JR3E 1QLJA 3KKNA 3LXUX 3PKZA 3HRIA 1ZWKA 2PX2A 3KR0A 4UEQA 4C7OA 4H7HA 3RC9A 5KYUB 3AXSA 2XRZA 5FUYA 2ETVA 3P5SA 1HE2A 5C37A 1CEYA 3STHA 5GOTA 4L7QA 4U7TB 2MSLA 5A05A 1MT0A 2QX7A 4BZXA 2OAP1 3D1LA 4FE3A 2F90A 3OZEA 1NJ8A 4ME6A 5F64A 3QUQA 2G8NA 5FI5A 4IOLA 1QQ6A 4K6FA 1DDGA 1GEGA 2CSXA 2O0KA 4I0WB 2XMPA 4QTTB 1FPQA 4YMTA 3AKDA 4DIOA 1I51A 1R0BA 3SZRA 3OEHA 2I3BA 3N2EA 1ZNYA 3H9GA 2EWMA 5DHRA 3T9FA 3V6MA 1TYAE 3GGGA 1VKZA 3DKIA 2B7LA 2D3TA 3AM5A 3GCGA 4R3UC 3FNQA 4M9RA 2C7QA 4OHBA 3C4QA 4YQEA 1JALA 3W6ZA 2QP9X 5DWQA 1U7PA 5FNZA 5CCDA 2WDPA 4BNFA 1VIDA 2NSDA 4B6SA 3UPUA 2NXCA 2JD0A 2FFQA 4LZAA 5D2CA 2RC6A 4DC0A 1RI1A 5JISA 3BZBA 4OK6A 1Q0SA 4NBNA 1LF0A 5IXSA 1QLWA 1E60A 3M6LA 4DIUA 1OZAA 3EGIA 4ARCA 4G9GA 4CQNA 3TW8A 1R4MB 1RJWA 2FJ0A 1N6PA 1KMCA 1AMOA 1W44A 1VQ1A 1EHYA 1NQ5A 1TC1A 1CY1A 1Q7GA 4JEIA 1YC2A 5HJ2A 3VAYA 1MU0A 2REOA 2V3WA 2ZAOA 1LS6A 2J3KA 3L3BA 2HJ9A 2Q1UA 4G9BA 4OI4A 4GP6A 1U7TA 1H8HD 1S6YA 4N5LA 4TWBA 3MCUA 3IIIA 2QTRA 4YI5A 2AVNA 5I4KA 4NE2A 3O73A 2I2DA 4AQDA 2VHUA 2H0AA 2VT3A 4AJ9A 1EAYA 3T5AA 2LPMA 1KSGA 5JRZA 4C0KA 1K6XA 2DKOA 1KMNA 2QQ0A 2WOJA 1CPYA 3HKBA 4UAVA 3GT7A 3KRTA 3KZKA 3DE0X 4YPOA 1CP2A 1J20A 5B1IA 4I50F 4ZEXA 1L7MA 3DZHA 3D3QA 3EPRA 2ERYA 4X8LA 1N9GB 4L50A 1BXZA 1THGA 2CXQA 5C5EA 4FB4A 3TG8A 3C8MA 2ECKA 4JB0A 2VR1A 3OCUA 4J4BA 5AI0A 3IUEA 4DMGA 3QI2A 3G02A 3L5KA 3PTZA 1WPXA 2QP4A 3GDWA 1SOAA 4FFRA 2JKYA 1JILA 4QTUB 4YJDA 1E0SA 2OZVA 1MO2A 5DISB 2IUYA 2ZIXB 3VHRA 3TEFA 4DJJA 3SIRA 4F3YA 1S2IA 2XYRA 2GNPA 4HDKB 4RTLA 3K0FB 2QUKA 1K4MA 4QPNA 2OB2A 3UIEA 1V7ZA 2TYSB 2VXYA 3PZRA 2XVZA 4J76A 3PTAA 1E3DA 2EFGA 3QEOA 2G72A 1CUVA 2G9UA 2VYVD 4LFBB 4ARBA 4AKHA 2F00A 5CLFA 1JIIA 1OI7A 2QTZA 4F9TA 3COZA 4BV8A 2I4MA 4L3OA 1SN7A 1Y1TA 1MC8A 1V1MB 5FBLB 3U9LA 1QFJA 2EF0A 3KVOA 5EP2A 2MJLA 4FD3A 4EG3A 4REOA 2BMAA 1JHOA 1XMXA 3ZUPA 2YWCA 2QRPA 4AC9A 5KQRA 2G5CA 1GSOA 3THWB 3G85A 2ZRQA 1ZCBA 2JFXA 4JQSA 4P82A 2GCOA 3JD3A 3QKSB 2FF5A 1S3FA 1N2XA 3FA2A 4K6MA 4PO1A 3IBGA 4HPXB 1MH9A 5JSYA 3TOZA 4F4UA 1AN0A 1HV8A 3D1VA 4GI7A 2C5FA 1OBFO 1PBTA 3TW8B 3W1VA 4ASUA 3AEZA 2C2HA 1OAAA 2W4MA 3WYGA 2F59A 2G83A 2JEZA 1RXSA 1SVWA 2OCIA 1MRSA 1FDSA 1WNTA 2HRQA 4JJAA 3D6VA 3PVSA 4IFTA 3K6JA 1P19A 5LXTF 1JZTA 4ETIA 1X14A 1A27A 2QZ4A 5JCOA 3O93A 1X87A 3FAZA 5CXQA 1N1MA 4NV1A 1ADFA 2Z9BA 4ZPJA 3ETLA 1B74A 4B48A 4DV2B 2B0CA 4NBUA 4R1MA 3H9BA 3C6QA 5D7BA 3FPLA 1BX1A 3WHPA 4ND2A 1PLJA 3DTYA 3GXBA 4KN9S 4PONA 1MOPA 1N8KA 3H2IA 3K1AB 1XLTA 2JGEA 4J2OA 4QXQA 3T4EA 5H3HA 1SQGA 1S5PA 3L0BA 3VV2A 2UVDA 2GYYA 1NV8A 4ZALA 4FXPA 1DBQA 5AICA 4XD2A 3LP5A 2PS9A 2JJ1D 3F0TA 1GLVA 4H1HA 3QKTA 3ZVRA 5AJZA 1QS0A 5AK4A 4CMBA 4YBZA 2ONZA 2ZI3A 2QQ5A 1NJSA 3GOHA 3U39A 5L4LA 1M5TA 1U6KA 2X4DA 3SIXA 4UREA 2R5NA 1NG1A 4QVIA 1Y9EA 1AO0A 2D5LA 1DIHA 2BEWA 1E2IA 1I7NA 4JI4B 3R6LA 1ST2A 2Q1XA 3HABA 4TMZA 4YRGA 1C0KA 1PT8A 3OJFA 4LRXA 4M0CA 5ITSA 2JHAA 3BZUA 1KYIA 3OLZA 1BEEA 3B1FA 1OILA 3AKZA 4M8LA 2DFNA 3EPJA 3QLTA 2Z5GA 2P65A 4E7PA 3FFXA 2BZGA 2G0AA 2SKEA 4PGMA 1HDXA 1G38A 2H7VA 4WGFA 3T7SA 4HQLA 1Q3HA 1B3RA 3VR6A 1VKNA 1OBVA 4YI3A 1M75A 1TGVA 1YR7A 2ZGVA 3OZWA 3WLAA 5GIPE 3GEGA 3LS2A 4A0FA 1TU4A 1HEUA 4OKSA 5FULA 4NR0A 3F6EX 4S04A 4Q3OA 3AUKA 4J9UE 4BRUA 1W2HA 2FZ4A 1KOFA 2ZRBA 4LJYA 1U2ZA 3G49A 2XB8A 5C35A 2H4XA 2WWXA 5TQJA 4PM4A 3GNQA 2A78A 2PTGA 1JYFA 2Q5JA 2Y0BA 5ECYA 1CS4C 4JEUA 5DYNA 2J7PD 2OZLA 3MJFA 4ER5A 3PK0A 3QSYA 1TEZA 3RRBA 1UDRA 2G3YA 2P75A 4LBZA 3PE3A 1ADCA 5GOZA 1V9CA 1LPAB 2FDRA 2Y1EA 4JR2A 3CH4B 3GRFA 2EZ4A 3FKSD 1JPUA 1YIDA 3KE8A 4PZ9A 2V98A 3H2SA 3K8QA 3CMMA 3OEYA 1N3IA 3EPHA 1CEEA 2I87A 2JGNA 2FJUA 3BMCB 5DHFA 2I1WA 3K15A 5DMHA 1IONA 4DCMA 3QVVA 4GI3A 4RIIA 3FWPA 4QD3A 2ROQA 1E6KA 2UZ4A 1W0JA 2XQFA 4B6JA 3MIIA 1MAWA 4I1SA 2WLSA 5A1JA 4I1YA 5TEVA 1KI2A 4F9FA 3LMKA 3L0YA 3O9VA 3GJ7A 3IHWA 3QBTA 3NPMA 3PRKE 1K3UB 3BD9A 3Q7EA 4TLDA 5BYAA 4D9BA 1SU8A 2QDXA 4R5HA 3FNBA 1FX0B 2JIQA 1CB0A 2QG4A 3UJAA 5HIMA 1M33A 4TYPA 5LKRA 4YCAA 3LSYA 2PJUA 3IQGX 5FUBA 3ZZ0A 2CHVA 4DUZB 3NT2A 4AY4A 4UD2A 3WK7A 1R0SA 3B6EA 3D7RA 4MO9A 5DNDA 4PC7A 4BZPA 1CQJB 4KSBA 4JYMA 5THKA 3OCJA 3L6DA 1Y34E 2ZJBA 5L3RA 5JRDS 5JSZA 5LC1A 3SXUB 3BWYA 1JQKA 3AVXA 3VOAA 5CA0F 2GZHA 2WJYA 3IKMB 3RKRA 1AMNA 3MBOA 2VAVA 4NYIR 1FPMA 1ZINA 2OV1A 1HYBA 5AVZA 3IRUA 3VH2A 4JLJA 1J6UA 3LLSA 1GNVA 2XNDD 1G3QA 3HV0A 4EJ0A 3OJ0A 1KP2A 2G07A 1NKTA 3FWKA 2FPWA 1NI4A 4GQAA 3T15A 2GCEA 2XMDA 1GJRA 5HMMA 5AKZA 4RZIA 2NSLA 4BB5A 2VZEA 1W0JD 4MYHA 1EFRD 1M2JA 2Z1MA 4YJFA 1GXSA 4JI6B 1Z34A 3S2EA 1FSGA 4FC7A 3DD5A 4BQPA 4DIDA 4JJEA 5G0TA 3DLBA 5JDCC 1F2TB 1GGNA 2VOEA 1NIPA 2VCHA 3NOXA 1E9SA 4E11A 4Q7QA 5C8ZA 3ANNA 4AZWA 2QGZA 2QLBA 5EMKA 1HLDA 3U3MA 1QTNA 3MEQA 1Z0IA 2IHBA 3OE4A 2PUDA 2P7HA 3U09A 1NWCA 3ICCA 4V1CI 1MX9A 3OURA 3LPLA 2XYHA 3QKSA 1ETUA 1G291 1Z0AA 4ZAFA 3UT5A 3WFZA 4GI5A 3EFEA 1R5BA 2JJ2A 1YONA 3IAM6 5FWAA 4DA6A 1DQRA 1QRRA 4LDAA 2XUQA 2WU0A 2Z9DA 3EXG2 3RVQA 5CA1F 1K0UA 4WBXC 3E9MA 1NVTA 5FX2A 2FGJA 4LNAA 1PNOA 1SHJA 2D2EA 4DR7B 5A5GA 5G02A 3VXKA 1AUXA 3DZIA 1P8JA 3LBAA 4YUAA 1OH6A 4LHEA 5I9IA 1Z4OA 5JY6A 1FMFA 2GO1A 1T1SA 4ENTA 1QP0A 3EOZA 2BLNA 3S2YA 2JGRA 2QTLA 1Z5UA 3K1AA 1DFIA 5KVQA 2CCJA 3A1CA 3I9V1 4LXIA 1OFUA 3ONEA 1SIBE 2C3OA 3P9SA 4G25A 4HLUC 4JVMA 3WWPA 1OH8A 2PRJA 2IPAB 2ZWMA 3DHNA 3MSXA 3RKSA 1IZZA 4KDCA 4BUCA 4HZIA 3Q10A 5ADVA 3R9IA 4Y7CA 1EGHA 4BMPB 4PYRA 3N53A 2I2FA 1U4NA 3D59A 2ZRMA 4YN3A 5AOAA 1L5GB 4XRRA 2ZRGA 3C41J 2YWDA 4JVOA 3E0XA 3HCAA 5HS6A 4DCNA 2XQIA 4KPUB 2R1UA 1XD9A 1EFVA 3KYIB 4TWRA 4C22A 2XZLA 1AIPA 4IF4A 2VTBB 1PW7A 3RNOA 5E6RA 1V9SA 5I4BA 4HDSB 4HN4B 3ROTA 4I2NA 2UVQA 5EUQB 4C3VA 1I30A 2PL3A 1PV4A 3NWOA 4GDFA 3HP1A 4H4CA 5F1OA 2W48A 3M1LA 3GFOA 1K88A 1WW3A 1YIAA 3WI7A 5CIWA 4G0MA 3UN1A 1NY5A 3E5HA 3MAAC 3ZYCA 4HEA1 4MQLA 4HOYA 1MIHA 3F5FA 5BWOA 5DXFA 3AX6A 1UM9A 5MDHA 1LSUA 2HRZA 1NUPA 1RKXA 1VE5A 1KWGA 2AF4C 2GZDA 2IFTA 3G2OA 3RT7A 2IJGX 1N92A 2P9GA 1I24A 2O3SA 4OMFG 1X94A 3KZCA 4EHHA 5KTRA 2O1WA 5DRYA 3OD1A 3R9WA 3ITDA 4HDNA 4YCSA 3T38A 2C1EA 4G2NA 2FVYA 1N6OA 3IXMA 1ONPA 4MZXA 4YJGB 3TEMA 1U5CA 2DWOA 2PZAA 2Q4EA 2Z2ZA 3LRPA 4AUNA 1ADBA 3LQQA 3O8OB 1XVIA 2H8KA 3WLJA 3X1DA 1HKUA 2EJCA 2FEAA 3DUFA 3AHIA 3NVDA 2G0TA 2EBWA 4JL8A 3TNDA 3GDGA 1BDBA 1W94A 2IU3A 3VYUB 3FOZA 3ZTWA 4R3WA 3BB1A 3HA5A 3U9SA 2F67A 3L1KA 1ID1A 2HA7A 2ODQA 3I8SA 3WLEA 1RXVA 1P9WA 3S99A 3SHTA 4QJ3A 3QF7A 5F76A 4RH0A 5D6OA 1G5QA 3FVTA 5IANA 2H2HA 4A7PA 2WTUA 3I04A 1K7XB 5JTTA 2UYCA 1FXUA 5JJ5A 1ZGHA 1Z4MA 4JP1A 4DQLA 5LYJB 4IDDA 3ZH9B 4TSFA 3IDQA 3GLFA 4I36A 4DR3B 5KYKA 1Z4QA 3KQHA 4NV3A 4ZOEA 3JAKB 3LC0A 4QEKA 4CETA 3OQHA 3DJFA 2PMWB 3BWMA 1EFCA 3RVJA 4GPTA 4P9NA 4MB2A 2O8CA 3FZNA 4HLQB 4WV3A 5LMCA 4NH0A 1HTWA 1MG5A 2JIPA 1K0FA 2Z8XA 1IZ8A 1NW5A 3NBXX 4K05A 4TGLA 5JAIA 3KEOA 3GA7A 4JP2A 2YNMD 2CMGA 1A5BB 3SS9X 2HNBA 2YFQA 1UZMA 3OEWA 3AP2A 4L5BA 3ZWQA 2VUHB 2ZIGA 5J58A 1Z33A 4K46A 5BUCA 4C14A 3OZBA 1ZJ5A 5DEOA 4X1IA 1IQ0A 2A0WA 2JDIA 2V65A 1DBVO 3Q11A 4UCFA 1FXWF 2PL1A 1ZS9A 121PA 2BWJA 2ATXA 2H51A 3HJHA 1A4UA 3DYVA 3KU1A 1GQFA 1G20A 1UK9A 4B3DA 2HLDD 1FRVA 3IPCA 2XE4A 3VHXB 1Z6TA 2A5LA 3WL6A 1SFRA 1I4LD 2PUWA 3E7FA 4A26A 1G17A 4AWAA 1H2WA 2Y76A 3LLVA 4LHSA 3AYZB 4UAGA 1IJEA 4LXXA 2ZUCA 1C3OA 3PLRA 2BAGA 2FQYA 2BLLA 2WYHA 1YB1A 3R7WB 4B3SB 4LISA 4ZT6A 2H16A 1U2RA 3BF8A 4URWR 3T99A 3JYPA 3TOXA 5HFNA 4O2RA 4RVHA 2JZNA 2MSNA 2HKIA 1KE1A 4KPYA 4REQA 2GJ9A 3R3SA 4KQ2A 2EV9A 4UCQA 2IZ7A 1GVNB 1IHYA 1QBGA 3W5VA 5JXJA 3RFFA 2ZSJA 4PHCA 4UMFA 1IN8A 4OQMA 4PS0A 5IFLA 3NEPX 4BPRA 1HDOA 3PIDA 3OIUA 4HQRA 1UXJA 1H3NA 2CMKA 3PC3A 4H27A 4MUAA 1J22A 3NHKA 4OX9B 2IS6A 4G0ZA 3X1ZA 5ALYA 2PWPA 4RDXA 4EI7A 1KY2A 1TIPA 4UTXA 1T36B 2CXXA 4PO3X 1F2UB 4IDAA 1EE1A 4KQGA 4LZJA 3BE5A 5D6NA 2Q1WA 2I0FA 2N46A 2A6PA 4PSUA 2BFOA 2PZJA 1H66A 5FTWA 3NWEA 1Y9AA 1RZRA 4HPWA 2OLJA 2O8DB 1ZK2A 2EX1A 3KFXA 1ZD4A 2ZQYA 1OYOA 1H0HA 1NBOA 1YKGA 2R8EA 5LP6F 5D01A 5ER6A 1X9HA 2H2WA 4KQJA 1O58A 2ZTLA 2WWTA 3KHTA 5FAXA 2WWFA 4B6RA 1GAXA 1K8ZB 1TLFA 1F4VA 3GFQA 4YJGA 2EIHA 4A6EA 3NBZC 3R0VA 4PW0A 5FFMA 5JDIC 1M10A 3D2CA 3QG1A 4BOYA 3GRRA 4AJ2A 4BRWA 2JKZA 1JH9A 2IS1A 1JU4A 1QHNA 1WDLA 1PF7E 4O4HA 5AVOA 5JYCA 3I6ZA 3IBSA 3NHJA 3S0JA 1Z83A 1Z2AA 3BXXA 4W5NA 3V1YA 5ALIA 4NDNE 2DFDA 4E33A 2YV2A 2EBHX 2VSYA 2BELA 3QLVC 5EFZA 3E2MA 1ORHA 1QB7A 4F5DA 1L1FA 4F5ZA 1PV1A 3BD8A 2VBFA 4ALMA 4C0WA 2BMJA 1J9ZA 4V39A 5G3YA 2FZWA 3DDHA 1KDZA 2QTNA 3W5AA 2VAMA 3RE1A 4K2AA 1CTQA 3HDGA 4QYIB 1JEDA 5AVUA 4D0RA 1WZIA 1EDBA 1SHLA 4KHZA 3MINA 5B3KA 4II3A 4XUGB 2NQTA 4UDNA 4X6LA 3B6KA 3S27A 2VJBA 1A4IA 3I4FA 2MMGA 1DL5A 3O31A 1Z36A 4OXKA 1L5LA 5A4AA 3EFOA 5HG0A 1JR6A 2W6CX 2CVZA 4MWSA 3ROGA 5C81A 2QJWA 2VDLB 3B6IA 3LLMA 4DIMA 3GO4A 1EVQA 3WKBA 4DQVA 3H11B 4PGHA 3EODA 1ZJZA 3H65A 3I9FA 3MM4A 4U2CA 4Q9IA 5FOUA 2GAJA 2Q5LA 2H17A 4AWXA 1YA8A 1Y3AA 4DDUA 4UNSA 4R31A 4OUDA 1GRRA 2JFUA 3L79A 4Y2YA 2PANA 1YJ5A 2AF3C 2A1UA 2D54A 2HM7A 1O6BA 2REBA 3MG9A 4OATA 5HMLA 4JBWA 4AS1A 2BM1A 1X8XA 3T41A 1UKVY 2C2XA 4K9DA 4JKIA 1HE1C 2QRZA 3BGIA 4C5AA 1XTRA 3NTUA 3FJOA 3QMMA 5K3FB 4DMUB 4KLRA 1V1JA 1P2BA 3VR4H 5EJ5A 6ADHA 3F73A 2XCOA 3CVJA 3TDKA 4INJA 4IL5A 5F3WB 3Q0EA 5IAJA 1N1GA 5BSTA 1Y9JA 5TDHA 2W6JA 1GCIA 1Z4PX 5GQSA 5DCUA 4ZXFA 1Z08A 4ZHQA 4QFDA 2OGSA 3BWDD 2G1AA 5EUCA 1MV8A 3V97A 2DPYA 4HAIA 4MV8A 3SNKA 3V2IA 4NS1A 1ZUWA 2Q9AA 1Y4ZA 1CJKC 1XFAA 1YU9A 1ZH6A 3IT1A 3Q5GA 2BGKA 2R0QC 3LG2A 1QQTA 2UAGA 4FFBA 4H0NA 4RJJA 4W9NC 2AI1A 2I34A 5FTKA 3T1QA 5BW4A 3HN2A 2QZSA 2YYSA 4IRXA 1GL9B 1ZO8A 4XLTA 1U65A 1GZVA 4M0DA 3OJXA 1RIIA 1Z68A 1LK5A 4BWYA 2YICA 3RC8A 4AXXA 3AUXA 3G2PA 1PJLA 3QMPA 1XRMA 2C2OA 5KREA 2R2AA 1IVSA 1UBFA 1HQKA 4O4LB 2AE2A 4QRHA 1USIA 5IVPA 1UC8A 6Q21A 1CT9A 2C95A 2J09A 4G5SA 1ZC4A 2FN7A 1FRZA 2FSUA 1G8KA 3ZIAD 1KXZA 2FMUA 2BF7A 2O8BB 2NZXA 2ZYWX 5HM6A 4M99A 3GJ3A 3O9ZA 3WGYA 1EWYA 1E5DA 2BRUC 5EA2A 4FGUA 3CB2A 5BT9A 3D7KA 3G2LA 3N75A 1U7XA 5EKTA 3U3KA 5EQTA 1W93A 4EFNA 3LBFA 2WM3A 5JROA 3AT1A 3Q88A 4GO1A 2FRDC 4P54A 3AW8A 3QA3E 2FEXA 2PYIA 4PZZA 5JNLA 1KEVA 5L53A 4QSMA 2B8NA 3ROXA 2EYUA 3G0OA 2VWQA 1GYPA 1E2HA 3PYXA 3PCRB 4BKOA 3F7OA 1E1YA 1NUSA 1QS0B 3AIIA 3AHGA 2YVAA 1JEQA 4E12A 2DJ5A 2PD3A 2Y1KA 2F6RA 4ZDWA 1E7RA 3W5HA 3ZY6A 5GGYA 3GLVA 4YT8A 1OX4B 3ZI0A 3QUSA 4EY3A 2C20A 2I65A 3P0EA 3WYDA 2IP2A 5TC4A 3QLEA 1PHRA 5KQMA 3K70D 1E79A 1U0TA 1WXXA 5LLDA 3HPQA 4H15A 5L3SB 1YS9A 3VKHA 1IYZA 1JR3A 4B6EA 4QBFA 3S2SA 1HDGO 3A6GA 3HJRA 3K0HA 1BWRA 4FEEA 4I3GA 4QXAA 3ZWMA 3RS4A 1APBA 1BD3A 1A2QA 2ZIUB 4D3ZA 5BPFA 4RTOA 4IILA 3V7YA 2QLJA 3LFTA 1I3LA 2MR5A 1U7OA 4F96A 4NU0A 1PGQA 1P0IA 3F9IA 4I55F 1UMDB 2PGDA 3NYQA 3LUFA 4LYDA 1O2DA 3KTDA 2VHZA 1O87A 1P3Y1 4N7BA 3ZKWB 3EY9A 3UFXA 2IXFA 2BJWA 4YMSA 4NNPA 3SYNA 5C46F 5I51A 2WWHA 1A9YA 3E9EA 3KTAB 3DMTA 1T2NA 1QLHA 4MRPA 2IWHA 4DTCA 5IPFA 3ZBUA 1SAYA 2QGFA 3PHHA 2GVDC 4CUJA 3UJPA 3ROZA 4BCBA 4CV2A 4JX8A 2G36A 5LA6B 1X3SA 3TQTA 4KCGA 5DHAA 4A4DA 1QQAA 4Q9HA 5AKLA 1G5FA 4ALJA 2H7YA 3FPAA 5D5HA 5DN9A 5HZKA 4AQYB 1BVYF 4HRAA 3BBPA 2GF2A 4GC5A 5BQXA 3A70A 3JALB 5CJJA 4MKHA 3CLUD 5CGZA 3CQ9A 1CE8B 3UUGA 3QELA 4ND3A 1NZJA 5DBGA 4HDRA 2A30A 3SKYA 5KVSA 2X0EA 4GKJB 4HNUA 3KYDA 2X9GA 1XMVA 1Z5GA 1NYQA 3DBRB 2CF5A 4BMVA 4UBMA 4JLPA 2P4SA 4AIRA 4NABA 2VDQB 2NSJA 4DNXA 5FBVB 3KPVA 4RSRA 1VGRA 4XVRA 4JQYA 3D3WA 1NN1A 5DYYA 5JBNA 3A3NA 2YQZA 4TN5A 3RHSA 1Z6PA 2JFOA 2QYTA 3HGTA 2R6R1 3OI7A 3T0FA 1EGAA 4JN6B 5EKDA 1XTVA 4J1NA 1OOEA 2G9ZA 1UIMA 2IK8A 3RHFA 1MFZA 3AY7A 3HI6A 3GZJA 2I8CA 2VZ9A 3USZA 1FC0A 1UWLA 4R6XA 4RFLA 2AJDA 3M4YA 3PG5A 2R62A 4TT3A 2C99A 4XDZA 1K75A 1RYZA 1XTPA 2J07A 3LDFA 4OOFA 4CM8B 2AQIA 2AFVA 3WISA 5J4VA 4Q1AA 3VO9A 4ZJZA 1ZVMA 3OJLA 4DLUA 5KI6A 1RPAA 3GA5A 3CRMA 3DNMA 4EA6A 4EG1A 3B85A 2IQIA 1QDUA 2OENG 2BIFA 2V4ZA 3KDPA 4G4SO 1YHYA 4MAFA 3LDHA 4UTNA 4WQMA 1IDN1 1K5DA 3QQ5A 1USGA 2OXIA 3WLRA 2HZBA 4CKCB 5JCZA 2DPXA 4DW8A 2YXBA 1G2OA 2QMYA 2HI0A 3NKLA 3D8NA 1YWGO 2JFZA 3Q85A 1F20A 1DIRA 2E48A 3JVDA 4IKEA 5DRTA 2C9CA 5P8WA 4C6HA 2YN4A 3LWDA 3ZLUA 3D4LA 5KJCA 2PGAA 4S1VA 1GRQA 3LIPA 1C2YA 3K32A 1UPAA 3LT5A 1WUYA 1TCUA 4LJ9A 4DLSA 4H6WA 1V43A 2CCKA 4MK4A 2UUAB 3OEED 1C7ZA 2AQHA 4BX8A 4CRWB 3E23A 1MN6A 1JAZA 2WICA 4M8NE 1GCUA 1ZGZA 4WZZA 1O77A 1SXQA 4WVFA 3VC7A 4WKBA 5JZ9A 2WBLC 1CQXA 4RK6A 1ODKA 1T0PA 1IVNA 5IP5A 2OCDA 2RGAA 3V4OA 1AKMA 4QHYA 1PWHA 3TSZA 2JGJA 2X6TA 3ISVA 3P97A 4M6WA 4BECA 1KI8A 3A27A 2VYNA 5AM1A 3GPDG 3IJ5A 2DX7A 2H9YA 4RSHA 1Q12A 1SUCA 1SCKA 1WV1A 2WD7B 2XAUA 5ALZA 3SJZA 3DQQA 1QG0A 3TXAA 5JCOC 5KYYB 1RBMA 1R5NA 2QYOA 1QP8A 1PJRA 2PDAA 3PXCX 1MCZA 3MK31 2A88A 4IGKA 1CB7A 2HBZA 4MA0A 5FTNA 1R00A 3R2JA 5BSUA 2AN9A 3BB4A 4CKEB 4CR8A 2R85A 1PNVA 5EIWA 4ESVA 2CT8A 1N7IA 2TMKA 3G5LA 3Q3HA 4IJ6A 3WTBA 1U1FA 2EWWA 3H5LA 3RAFC 3SEZA 1LQ2A 1FNDA 2QX8A 4MW1A 3T52A 5AVVA 3DQZA 5FPTA 3EEYA 2EDAA 5EP3A 2CE7A 1EI9A 4QYXA 3VOTA 4RQBA 2BUBA 1LDEA 1P9RA 1ZZEA 3OVMA 3ROPA 4EQ6B 1OXVA 1G21A 3QWHA 1PNTA 2Q1SA 1PYOA 3W4KA 1XDZA 2D8AA 3IHKA 3OF5A 2J3JA 3T0IA 4B81A 1YCHA 1G20B 3JS5A 2RK4A 1T5HX 4LDRA 4WK2B 5EESA 4F3KA 3GCZA 4D6YA 4G8DA 3R6GA 3KWJA 4U9UA 2H2DA 1ZIOA 4RK1A 1U0JA 4A82A 3WO0A 4CT0A 4JA0A 5HZHA 5LA6A 1PFGA 4C43A 1ORVA 1XZAA 5D8DA 5C1OA 1JEYA 1XOIA 1T43A 4OHUA 2OR3A 2YASA 2WVGA 4UE2A 1UQUA 2ZI9A 2YUIA 4NCBA 3BFJA 1FP1D 1KNXA 5CA0B 4ZGBA 4P31A 4AF8A 4F1JA 5IT9A 3I9KA 3CE9A 1E1MA 2P69A 2IH4A 3C85A 1EJ2A