4KRUA

X-ray structure of catalytic domain of endolysin from clostridium perfringens phage phism101
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
b'VHHHHHHMQSRNNNNLKGIDVSNWKGNINFESVKNDGVEVVYIKATEGNYFKDKYAKQNYEGAKEQGLSVGFYHFFRANKGAKDQANFFIDYLNEIGAVNYDCKLALDIETTEGVGVRDLTSMCIEFLEEVKRLTGKEVVVYTYTSFANNNLDSRLGNYPVWIAHYGVNTPGANNIWSSWVGFQYSENGSVAGVNGGCDMNEFTEEIFIDSSNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a novel endolysin encoded by episomal phage phiSM101 of Clostridium perfringens
doi rcsb
molecule keywords Autolytic lysozyme
source organism Clostridium phage phism101
molecule tags Hydrolase
total genus 75
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4kruA00
3OBAA 2YJQA 1CGXA 3QHNA 2OWXA 2BXZA 2Z1SA 1FFRA 4QCFA 2VURA 5CLTA 1E4IA 2EBNA 1ZJAA 1GOIA 2X05A 2WMIB 3GM8A 1V3JA 1ECEA 2EXOA 2XIIA 4LYRA 2WBGA 1BYAA 1KB3A 5LA0A 1CXIA 3W38A 2J62A 1X1NA 1R8LA 1H0GA 4MPKA 1X6LA 1GPFA 3ARWA 3CHFA 3THCA 4QDMA 3L4WA 1RP9A 2VC9A 2WHMA 5D4YA 2BVTA 3IJ7A 2FH8A 2FHBA 3AYSA 4P7LA 3F5KA 1US2A 1CYGA 2FH6A 2FHFA 4H7VA 2JIWA 2J74A 3U7VA 1U30A 2XGBA 3WENA 1XCWA 4BZYA 3K8LA 1VEPA 4JFTA 3W28A 3SCTA 2F61A 1R7OA 1HP5A 2J79A 3WMSA 2Y8KA 4WK9A 2BVDA 1B3YA 1R87A 1WCGA 5CPTA 2WYSA 1JF6A 5ABHA 3UESA 5A6AA 1WAWA 4ACZA 4R27A 1CGYA 1NM9A 2XM1A 3VOCA 2RGLA 1YQ2A 5IDIA 2ZIDA 3OLEA 3PZNA 1UD5A 2WZEA 3NSNA 3AICA 1JFXA 4PTWA 1NP0A 1UQZA 2VR5A 1KWGA 3N13A 3VIIA 2G3MA 3ZOAA 4MDPA 1E71M 4RE3A 3WUBA 3ZSSA 2E9LA 4UFHA 4JIEA 3WQ5A 3SUVA 5EBAA 1CXKA 2X0YA 1KGUA 4XX6A 3NCOA 1DWHM 1BTCA 1SMAA 1MXGA 2YL6A 4F9JA 2WK2A 5BYWA 1E0VA 4ZEPA 3VD9A 3APGA 4CU6A 4BS0A 4D71A 1V3LA 2EJ1A 3CZ8A 2TAAA 4MB5A 1B1YA 4BA0A 1QI5A 3KL3A 3AIWA 1BG9A 3WUEA 1WKYA 5E6YA 4L4PA 1KXTA 1C8YA 2E4TA 3BLPX 1QI0A 3EDKA 5LA1A 1BLIA 4AZ5A 1E3ZA 1KCLA 1EHAA 4AD0A 8A3HA 3LPOA 3OA5A 3A4WA 4MADA 1C91A 2XTKA 4CVUA 3FHAA 1JIBA 1ZJBA 1H0IA 4M29A 1QNSA 5I79A 1FP8A 3A4XA 5ABFB 4LPCA 3VGEA 1WZAA 2PB1A 3SEPA 3AS1A 1WPCA 3AXIA 3GNOA 3BAIA 1HP4A 3PTQA 1C93A 1J0YA 3ARZA 1WDSA 2QHAA 4ATWA 1LL7A 3CLWA 5A6MA 2Y4SA 2BHYA 4X9YA 1SR0A 4FLOA 5IHRA 1H41A 5DF0A 4ACZB 5I23A 1VJSA 3PTMA 1W3HA 1K9DA 3WD0A 3KL0A 2ZUWA 3WDIA 2J7BA 5A1AA 2AOSA 2CXGA 3M07A 1B3VA 1GORA 4AIOA 1UHVA 4MTVA 1WDQA 3B9AA 2MANA 2VCAA 5FL1A 3RPMA 4LQ1A 4BQ2A 3II1A 3AIRA 1G9HA 1KGWA 1MFVA 2VUYA 3VPLA 3MMDA 2D0GA 4CD6A 3M46A 1ZBVA 4WJXA 1FH7A 3THDA 1XH0A 1ZBWA 3WH8A 2CPUA 4ZXOA 3WUGA 3NIYA 2ZX9A 5ECUA 3WH6A 1UWRA 3GTNA 5E70A 4Z2KA 3WDRA 7CGTA 2VVNA 3IAPA 4AISA 1CEOA 2YDRA 1UD3A 3KZSA 3VO0A 3WMCA 1UR8A 5D9NA 3AI0A 2ZICA 1UYQA 1E0WA 3MU7A 1JDAA 3F4VA 4E8CA 4LX4A 3BSGA 2YL9A 4JFWA 5HBFA 1XH1A 4MNKA 2Z1KA 2EPNA 1GOKA 4AZHA 2OYMA 3VM7A 4ML4A 4OOZA 1TVPA 2WZHA 3MUY1 3EMCA 4YHGA 1XH2A 3ZJKA 5A95A 5IHSA 2FGLA 3BMWA 1JZ4A 2E40A 1V3IA 1UG6A 4U3AA 4WSKA 1O7AA 1W9VA 3ZJ8A 3OIHA 4PYSA 3U7BA 3S2CA 1C8XA 2WXDM 1BHGA 1OGBA 2E3ZA 2XVKA 4DWSB 3WF4A 1E43A 4KRUA 1G5AA 5CGMA 3VGHA 4AY1A 2EPLX 1PX8A 2PWHA 3VGFA 1F4AA 1NWUA 4GKLA 2PBOA 1XGZA 3WBAA 7TAAA 1RD6A 2ZUVA 2X0HA 1E9LA 1HJWA 2OWCA 2YOCA 4QFUA 1PX4A 3DYPA 4CD4A 4ACYA 2F2HA 1JYNA 1UUQA 1W3KA 2Y8VA 2CKSA 3L4YA 2VJXA 4C7DA 1EQCA 3VD7A 4PMVA 1KQYA 2BY0A 2BNJA 4HOZA 4QAWA 2UY2A 4IPNB 1JI2A 3DYOA 5I77A 3CZKA 1EH9A 3EYPA 1VFFA 1W1TA 1K9EA 5I24A 2QLYA 1H5VA 4MAVA 3AHZA 3GH7A 3W25A 1WE5A 1VRXA 3AOFA 1E1EA 4AD2A 2OYLA 2DEPA 1BG4A 2BHZA 2DGAA 1FH8A 4AZCA 1V0LA 4M80A 3WF3A 4HA3A 1EQPA 5CPQA 2EPKX 1XSIA 1W9BM 4HMEA 3PZMA 4LXFA 1KBBA 3NJ3A 4JCMA 1FP9A 4D1JA 1W3JA 1PAMA 2DSZA 4AC1X 4HA1A 1V02A 1JYWA 3FNDA 2WCAA 1X6NA 3LPGA 1ITXA 5DFAA 3VNZA 2W62A 2UY3A 2E8ZA 2A3HA 3WD4A 1PPIA 2CHOA 2WC3A 1UA7A 3GBDA 4W93A 2WWCA 2WB5A 2W91A 3CBWA 4HA4A 3WFZA 2XJ7A 4AYSA 1LF1A 4Q22A 1NWTA 2C8NA 2GSJA 2PC8A 1CTNA 1VENA 4HZ6A 4OOUA 4DWSC 1QNOA 3WEZA 2YL5A 3OGSA 5D9MA 3CZGA 3D5HA 3E1F1 3AMCA 1GHRA 5C8BB 2IXVA 4B15A 1HJUA 4QCEA 4UOZA 3TP4A 3O6AA 3KL5A 3N1AA 3SCVA 3PHAA 3TTQA 1TZ7A 3K4AA 1NWRA 2D2OA 4M56A 4PRWA 4P7RA 4GZIA 2O9TA 3WBEA 2J4GA 4JFVA 1I1XA 1NARA 1KCKA 1CGWA 5I78A 4GIAA 3UG5A 5IXEA 1XSKA 1ISVA 1RPKA 3BGAA 4JHOA 1GOQA 1RP8A 4UNIA 1LG1A 4J3VA 2WLZA 5AY7A 5FCZA 3ALFA 2OWWA 3WKZA 3MO4A 4UQEA 3AIBA 4PMNA 4U3CA 1K9FA 3IAQA 4AZBA 5E0CA 1FH9A 1KR0A 1MW1A 1WDPA 8CGTA 2GVYA 2QMKA 4PBGA 5A8OA 4E8DA 1Q6CA 1FFQA 2YDQA 3RIKA 1M04A 1EO5A 4U2YA 3T0DA 4M81A 3GH5A 3U5YA 4WKHA 2PF0A 1H3GA 3ZIZA 3AMDA 3RJXA 1HKKA 3CGTA 4JZ5A 1CGUA 2E9BA 1B30A 3WNLA 3CZEA 3UERA 3UG3A 4JL1A 1JZ2A 1ISZA 3BAJA 5GNXA 4PUDA 2WMGA 1HF6A 3WH7A 3AROA 1JXKA 1GQIA 5CXPA 4M1RA 4OIFA 4OZOA 3GYCA 2G3JA 3N04A 1XV8A 2WSKA 1PIGA 2JEQA 2QF8A 3ARVA 1LL4A 3F5LA 4D72A 4W88A 4HOXA 1UD8A 4AD4A 4MAZA 5FD0A 1V0MA 1VFUA 4UQCA 4W8AA 3WDQA 3PZ9A 4W8LA 5BRQA 1JGIA 4AD3A 1WZLA 2XFFA 2CBVA 1HJQA 1A47A 4AEFA 1YHTA 3MSDA 2OLHA 2VQTA 2GFTA 5A6LA 3OB8A 2X09A 5KEZA 1TCMA 1J11A 4D6GA 3UR7A 2DH3A 1WZMA 2XVNA 2XWDA 1M7XA 5BWFA 4UFMA 2GDVA 1V3HA 1P6WA 4PMXA 3VMPA 3VD4A 1V6UA 4N0RA 1CPUA 3VGBA 4CVWA 1DWFM 1XYFA 3OLDA 4GQQA 3K1DA 3WDJA 1UZ1A 3WUFA 2E0PA 3VD5A 1VJZA 5ABFA 1QI2A 3FAWA 1S46A 1E73M 1B2YA 1BFNA 2E9MA 1C3FA 4S3KA 1PIFA 1IT0A 2WHKA 5I0DA 2WHLA 2ZUNA 2WC4A 4UTFA 1C92A 2JALA 1H4PA 1XCXA 4BQ5A 2IUZA 3N11A 3T0BA 4ATDA 4L4OA 1GOMA 1W3LA 5A2BA 1CXFA 1HIZA 3UEQA 1JF5A 5A3HA 4N42A 5D8WA 5I6SA 2WMFA 2D20A 2JFEX 2X8RA 3WDPP 2DT3A 1OB0A 3VIOA 3WD1A 1ZU8A 5EFFA 2HVMA 1JD7A 4EANA 4KGJA 4W5ZA 5HXMA 1IV8A 3W29A 2B31A 3MANA 2VMFA 1HN1A 2AMGA 3FY1A 3SCRA 3QOMA 3CUHA 3L4TA 1H09A 1EO7A 1VEMA 3PZUA 1HVXA 3RM4A 1NWSA 3OGVA 2VZUA 4TXEA 3AMLA 2V3DA 1V03A 2VZSA 1J18A 3ZM8A 1ZB5A 2UWFA 1JZ8A 3T2PA 1JZ6A 1MYRA 4NZCA 3J7HA 3SCPA 3EDDA 2ZE0A 3QOKA 3TTSA 4GZEA 2J47A 1GVIA 2WKGA 5JIPA 4W85A 1W32A 1XRVA 2XHYA 1OWQA 4PCSA 3WMBA 1ISYA 4M82A 1OT2A 2XPKA 4W7UA 3CTTA 4HZ8A 3SURA 2WHJA 2BY3A 3PTKA 4UFKA 2D0FA 4CD7A 4HMCA 4GXPA 1E4LA 4UCFA 2J8GA 3QHOA 1GCYA 1HKJA 3HN3A 2V5DA 1C8QA 2Y24A 1LG2A 1NOWA 2VVSA 2BXYA 1UR9A 4GO8A 4DWSD 2CIPA 1OIMA 2DPEA 1MW3A 4IM4A 1TE1A 3GXFA 4DWSA 4J3TA 5A6JA 4AZ6A 1E4MM 4JKLA 1GQKA 2ZWYA 2ZX6A 2NW0A 4FLSA 3RM8A 1BYCA 1EDGA 3NSMA 2C7FA 4B16A 5AYBA 5D9PA 1UWSA 5HPOA 1E6QM 3WNMA 1UD6A 4HPGA 5JBDA 4HU0A 4TVDA 4CCEA 2PWGA 2D24A 2BS9A 4J3SA 4FK9A 1QVBA 2PI6A 3RJYA 2YA2A 1PX3A 3ZR5A 1VB9A 1AMYA 3W6LA 1ZS2A 4XUYA 1OINA 4D6DA 4UFIA 3ARTA 2DIJA 1HJVA 3W37A 2VQUA 3MV01 3QGVA 3HMCA 3VVGA 5M3WA 3T08A 3AIVA 1GONA 1OD8A 1GVYA 1B3XA 5A8NA 5C70A 4PSRA 1Q6DA 5E09A 2Y2WA 2V5CA 2VO5A 1QHOA 1CBGA 1M53A 1V3KA 3BH4A 3VIPA 1JYXA 1HNYA 1C90A 4XV0A 3CMJA 3VIJA 1DWAM 3CMGA 3L2MA 5FKYA 3OZPA 5A69A 3WELA 2NT1A 4UZUA 4TVUA 3VGGA 1JFHA 2UY4A 4U31A 1JZ3A 2J25A 2DT1A 2WWDA 1JDDA 3ARSA 4PMRA 1CIUA 2ZXAA 1OBAA 5ABEA 1FHLA 3W6MA 5FOOA 3CZLA 1MXDA 1E72M 4M24A 3ALGA 4J3WA 5D8ZA 3BMVA 1E70M 2WSPA 4PUEA 2WMKA 2RGMA 2ZXQA 1GHSA 2D3NA 4P7NA 4WSJA 5EFDA 1KXVA 2VTFA 1KFWA 4LGXA 4CGTA 2J7FA 4DUXA 4LYQA 2CKRA 3IJ9A 2J7EA 5E9AA 2OSYA 1QHZA 4TVCA 1JZ5A 4AIEA 4NI3A 3RMEA 1R7AA 1WZKA 2JIEA 1TMQA 2OYKA 1PBGA 1H11A 1DEDA 3M6DA 2VL4A 4XB3A 1C7SA 1CDGA 2W4XA 3F5JA 3CPUA 5HNNA 2A3EA 2Q8XA 3FXYA 2O9PA 3ARXA 4RL3A 1BF2A 3T2QA 1UR4A 1BVZA 1E3XA 3RCNA 5DEZA 3I3EA 3WD3A 1OGGA 3KEHA 2J7DA 4NRRA 3PBGA 2DDXA 2UY5A 2W63A 1UKTA 3MS8A 2WKLA 5FL0A 4P8UA 1HT6A 1I75A 2J78A 2YA0A 4W87A 1EOKA 5I2UA 4HPHA 5E0FA 2XM2A 1UR2A 1V0KA 3CIVA 5M5DA 2XSBA 4MB1A 4B3LA 4IPLA 4EK7A 1US3A 2WZIA 4KMQA 3WNOA 2D23A 3AS0A 4AZGA 4GI6A 1CXEA 2ZUTA 1U2YA 3AS2A 1JAEA 1TR1A 3DECA 3ZR6A 3MUZ1 3M7SA 3ZJ6A 1V6VA 4S3JA 4AW7A 3MSGA 2J7GA 2VZTA 4YPJA 5BXRA 2Y5EA 4TUFA 3SCSA 1AVAA 1EDTA 2D3LA 3G6MA 3AMKA 4HZ7A 4HMDA 2ZOXA 4HP5A 2XVPA 2ZX7A 3OLIA 3PZGA 1UWIA 2NT0A 9CGTA 3VNYA 3A6OA 4P7QA 1A3HA 3IANA 1CXLA 1CGTA 4MNLA 5BROA 1B3WA 3WF2A 3K8KA 1JI1A 4J7RA 2VRQA 4QLKA 2X1IA 3VMNA 2CESA 2XGIA 1HKMA 1VFMA 2WPGA 2IXUA 3A4AA 3I3DA 4V28A 1Z32X 3ZT5A 5CPSA 4K68A 4UQAA 2ZUUA 4QP0A 1BGAA 3W82A 2CERA 4H04A 4MJ4A 3ZSTA 4CUCA 1XD0A 1VFOA 4E2OA 2XG9A 3CUJA 2CNCA 1QW9A 3BAXA 3AQUA 2CETA 1AQHA 1LQ0A 5A2CA 3W27A 4AZIA 3AXHA 4ZFMA 1PZ2A 1BQCA 5CSUA 2YLAA 4UZSA 2V3EA 1CGVA 2YKKA 3RDKA 3W26A 2VX7A 1QPKA 3B9EA 1B90A 2OSXA 1F4HA 3G6LA 4KH2A 5A6SA 1B31A 2V3FA 5GQBA 1KGXA 2VCCA 1QNRA 2W5FA 1AQMA 3GXDA 2JE8A 3AIUA 3AXXA 3AZSA 1KXQA 1V3MA 1XSJA 4TX8A 2DIEA 2O9RA 1OT1A 2XFYA 1PZ3A 2JF6A 3L4ZA 1GW1A 4BQ4A 3VIFA 4D6EA 2GJPA 1NOFA 4AEEA 3PZVA 5FIPA 4W84A 3GNPA 5CLWA 2J75A 4YHEA 4WKAA 4A4AA 3O9NA 1B3ZA 1TVNA 5JBEA 1UKPA 2VRKA 2FHCA 4NF7A 1J10A 1W9DM 3UR8A 1Q4NX 1K6AA 2WAGA 4JKMA 5AC5A 4EAMA 2VZVA 3VINA 1ZL1A 1UKQA 4HTYA 4DM1A 4HU8A 4A3HA 4AD5A 2AAAA 2J77A 4B9ZA 2WNWA 5TD4A 4H2CA 1RH9A 4MNJA 2XVGA 3ZJ7A 3FHQA 2WMJA 4KRTA 1KXHA 1ZBKA 1K9TA 1LWHA 3I3BA 4EE9A 2D22A 4PTXA 3WF0A 1B9ZA 4OKDA 2W66A 4U33A 4V2XA 2CEQA 2QMJA 3CUIA 2WCSA 3CO4A 3GXMA 3SIMA 4GI8A 5CGTA 2VX5A 5JBFA 3EMZA 1MQPA 4W86A 3WL0A 1DWGM 4J3XA 5AYIA 2YL8A 3GDBA 1CLXA 2HISA 3UCQA 2DT0A 3AIQA 4AZ7A 3L2LA 3WDHA 4ZENA 2DT2A 3VDHA 2XFRA 1W1PA 2GK1A 1MQRA 1TA3B 2ESCA 2CITA 3LPFA 3WH5A 3MV11 2W92A 2G3IA 1QBAA 1QHPA 1SMDA 2CCRA 6CGTA 3WEOA 3BCDA 2W67A 1UQYA 4Y7EA 2G3NA 3IJ8A 3MUIA 2ZUMA 2WVVA 1HL9A 4P7OA 1J01A 4JAWA 1MW0A 3WFLA 4CD8A 2G41A 1EOMA 2PWFA 3SCUA 4CN4A 4X0VA 1VAHA 1DHKA 2GJXA 3BCFA 3FW6A 4OBRA 4PCTA 4TOQA 4C7GA 2YBTA 1UH2A 3BSHA 4UQ9A 5C71A 3W24A 4OUEA 5M03A 1JXJA 1E6PA 1UA3A 4MB4A 4V27A 1N82A 4Q7NA 4W5UA 2WLYA 1KBKA 1V02E 2ZX5A 4AMCA 4MDOA 1VBUA 1E6XM 2F8QA 2VT0A 4IUGA 4PN2A 2ZXDA 4Z2GA 1EGZA 1ISXA 4UR9A 3VGDA 1I1WA 4D6JA 3T09A 2PWDA 1CZ1A 3N17A 1E4NA 4F66A 1GQJA 1BYBA 1E56A 2EO7A 1M03A 2CBUA 1KWKA 1QNPA 2YLLA 5BXSA 1OM0A 4FLRA 3EDJA 2VI0A 1QW8A 3D3AA 3VILA 3TTYA 1LWJA 3WN6A 4W7WA 4KWUA 3CUGA 1CWYA 2YIHA 3DYMA 2WC7A 4JCLA 3AZTA 1HXJA 1MFUA 2X2YA 5F7UA 1L8NA 1WDRA 3GZAA 2CHNA 2FDMA 3L4XA 3DC0A 1WO2A 3RM9A 3DHPA 4W89A 3OLGA 3AHXA 4PMUA 3SUTA 3SCOA 1TG7A 2JF7A 1CXHA 5EMYA 2CBJA 1D7FA 2ZX8A 3VDCA 4D6HA 3T0AA 3KE0A 4P8WA 1TFVA 4GI9A 2BY1A 2GK1B 3FN9A 3W4RA 4ZE4A 4PMZA 4Z2IA 1JL8A 1PEZA 5I5RA 2J7HA 4DUVA 5BRPA 4M8UA 4PSPA 3SCWA 2PBGA 4UOQA 7A3HA 3VIGA 4CU8A 1Q6EA 3VMOA 3AZRA 3B9DA 3AHTA 3CZJA 5ABGA 4GZJA 4GINA 5DT7A 3K8MA 2WVVB 2WMHA 3EMQA 1E6NA 3PN8A 1CECA 1J12A 2BVYA 1JAKA 3NUKA 1HVQA 1SYTA 1UR1A 1W2VA 4JKKA 2XVLA 1XD1A 1H1NA 3L4UA 2GJXB 4CU7A 3QHMA 1VEOA 4WKFA 1MVYA 2O92A 2EQDA 4F8XA 4Z2JA 1ISWA 1R86A 1V6WA 1UKSA 1UH4A 4UFJA 2A3AA 5IFPA 4QLJA 3UETA 5LA2A 1DTUA 2FGZA 2WCGA 4A3YA 1W9PA 3WQ8A 4XZBA 3BAKA 1J0KA 3WNKA 2CBIA 2D0HA 3WNNA 1FHDA 4B9YA 1JNDA 1IZJA 2V38A 4Z2HA 2NSXA 3O2LA 1BGGA 2GUYA 3ARRA 2WVTA 4U2ZA 3WEMA 3CUFA 4YN5A 3SUSA 3ZMRA 1U33A 1UD4A 4MJ2A 4FMVA 4JHZA 1WNOA 4P8XA 5HOSA 1CENA 1UR0A 1E40A 1H2JA 1UKOA 5A94A 1Q6GA 5GPRA 4AXNA 5GNZA 4GQRA 5DMYA 4MNMA 1FA2A 1IZKA 1MQQA 3AHYA 2QV4A 1ESWA 3WQ6A 2A3BA 4X0NA 2W61A 5JIWA 1G01A 5CG0A 5A8MA 4H41A 3AIEA 1SFSA 3ZO9A 4OJYA 3WD2A 2C0HA 4WF7A 1UH3A 1W2PA 1QI4A 4PMYA 2O9OA 3CH9A 2ZUSA 4B3KA 1L0PA 3SCNA 3W81A 3VKKA 1MWOA 1LL6A 3WH9A 3VDAA 3BC9A 3GBEA 1QNQA 1UWTA 3KWXA 1OD0A 5BXPA 1JZ7A 3ECQA 1W1YA 1HJXA 3OZOA 3N15A 4J3UA 1VBRA 1GNXA 3VU2A 1D2KA 3WY1A 2CYGA 3K46A 4D1IA 4HOWA 3NYDA 3BLKA 4CN1A 1LJYA 3DHUA 3VX1A 1E0XA 2BFGA 3U57A 3WL1A 3LMYA 3K4DA 3CHCA 5I3DA 1WB0A 1GQLA 1TUXA 3VD3A 4QLLA 3B8SA 4R5EA 3VX0A 1V0NA 3WNPA 4J28A 3EBVA 4XZWA 1W1VA 1M01A 4RE2A 4JFSA 1GZJA 3CHDA 2DSKA 1LLOA 1O6IA 1NQ6A 1BYDA 5A6KA 1CLVA 3POCA 1QOXA 3TTOA 1QBBA 1DWIM 5CQ1A 1E5NA 2WM0A 2VNCA 4AWEA 4TTUA 1EXPA 3ARPA 1WP6A 1JD9A 2G4FA 4GPNA 4P8VA 2BHUA 5LYRA 5A8QA 4OBSA 2WANA 2D1ZA 3W53A 4NRSA 2PWEA 4DM2A 4C7FA 3WQ4A 3FAXA 2QPSA 4H8HA 4PTVA 3W0KA 2DSWA 1ITCA 1UD2A 3UG4A 3PZTA 3RILA 2YBUA 1C7TA 5M17A 1DP0A 3WIJA 3N9KA 4F9DA 2JEPA 5CZKA 3WQWA 5JUVA 4ATLA 1HX0A 1B0IA 1W9UA 3VTRA 3ARUA 1JG9A 5E6ZA 3HU7A 3AS3A 1E15A 1CNVA 5DT5A 1E6RA 5EB8A 1BPLB 4JFUA 4UFLA 3EDFA 1OSEA 2QPUA 3VIKA 1W91A 1J9YA 3JUGA 1JNEA 4AIUA 1JDCA 1G1YA 2GJRA 4MB3A 1VF8A 4D6IA 1UOKA 3MMWA 1GUVA 4DUWA 3NDYA 3VM5A 1V6XA 2V3GA 3AYRA 3MKKA 3ZQ9A 1AQ0A 1XC6A 3PZQA 5A2AA 1H49A 3WQVA 1OGSA 2VX6A 1GOWA 1MW2A 1ODUA 3VIHA 2BY2A 1XYZA 3PZOA 4PMQA 2BV9A 1NH6A 3NDZA 3TA9A 5CSYA 2DSVA 1V6YA 1E55A 4F79A 4BCEA 1HJSA 4UQDA 3AHVA 1NOUA 4WLCA 1GJWA 4D6FA 1KR1A 6TAAA 1TA3A 1UZ4A 1HL8A 5BCAA 3TONA 2VRJA 1XHGA 1BVNP 4U5IA 2YA1A 1DWJM 4CKQA 3TOPA 3HJEA 4CD5A 3SCQA 4U5KA 3ZT6A 1EIBA 3WF1A 1Y7VA 2G8ZA 1D3CA 1R85A 4NSBA 1V08A 2J7CA 5HDRA 3SUUA 5BXTA 2WMIA 3NSXA 1UWQA 2WW5A 4H8VA 4LYPA 1KQZA 3AFBA 2WBKA 3PZIA 2XYLA 3QR3A 3LPPA 4BF7A 4FLQA 1OCQA 3BAYA 4W8BA 1NP2A 1J0HA 4BQ3A 1HKIA 4E4PA 5IFTA 3U5UA 4UOJA 4D6CA 3A3HA 3ARYA 2OSWA 1VIWA 4TTGA 3VDBA 4UQBA 4TX6A 2DH2A 1GOOA 4JL2A 3ZT7A 3GNRA 3IK2A 4EKJA 4ZXLA 1E5JA 2VR4A 3RO8A 1ODZA 1PJ9A 3S6TA 3BAWA 5D9OA 2DSUA 1Q6FA 4URIA 3WSUA 4ZE5A 3OGRA 3OG2A 1ZBCA 2E8YA 4W7VA 3AJ7A 1J0IA 1J0JA 1EA9C 3GXIA 2VCBA 2ZXBA 5A6BD 3GH4A 4AD1A 4GO9A 4PEEA 1G94A 4AZCB 3N12A 3N18A 5A6BA 2WVSA 1UWUA 4PTMA 2VZOA 4FF5A 3T2OA 3AISA 4PMOA 3VIMA 4J27A 3CHEA 1EHNA 3POHA 4H8UA 3VUPA 3EDEA 1JYVA 4KGLA 3SUWA 3MUAA 5AC4A 5A8PA 2XSAA 2XUCA 4Z2LA 2WVUA 2ZWZA 2J8FA 4CCCA 4RE4A 1EDQA 4CN6A 2XWEA 4WIWA 1BSIA 1QI3A 6A3HA 1E6ZA 3AMGA 2VX4A 3BXWA 1E1FA 1OIFA 2EPOA 1W9XA 2XIBA 3A47A 1BAGA 2DQXA 5CJ5A 1FOBA 3MMUA 2YDSA 2A3CA 4IISA 2EEXA 4PMDA 1G0CA 5HPCA 5KZ6A 3L4VA 2EPMX 2VOTA 1E6SM 2GDUA 1J0ZA 1GJUA 3ARQA 5GNYA 5DO8A 4CCDA
chains in the Genus database with same CATH superfamily
3OBAA 1QO2A 1IGWA 3IJQA 2OWXA 4Q4RA 4RDWA 1ZJAA 4QSFA 3NPWA 2WMIB 3BARA 1XCFA 1KRMA 4KCWA 2XIIA 4LYRA 2WBGA 4BEUA 4GYJA 4JN7A 3KRZA 2J8TA 1X1NA 4MPKA 2CLHA 1GPFA 3ARWA 3KBMA 4ZQCA 4IXXA 3NZ1A 5JXQA 3IJ7A 1H1YA 2FHBA 3GTXA 3WJSA 4P7LA 1NF7A 1US2A 1CYGA 4H7VA 2FHFA 2HROA 2J74A 3U7VA 1YBQB 4BZYA 3WQDA 1ONWA 4MPQA 1LWIA 3IGHX 4KBXA 3WMSA 1R87A 4OFCA 1SJAA 1TJRA 4BF9A 3C2RA 3KVLA 2XM1A 4L9YA 1I2RA 4DAIA 4KFNA 4LUJA 4KETA 3W2MA 2WZEA 3B8TA 1TPEA 1JFXA 2VR5A 3P93A 4IP7A 1Z6KA 2X1TA 3NQBA 1S38A 3VIIA 4G6CA 2G3MA 4IPJA 1E71M 4RE3A 4JTDA 3TCSA 5F1UA 3SUVA 1RK5A 2X0YA 1A3WA 4YS1A 4P2VA 1JPHA 1DWHM 1SMAA 1W3NA 1LQ2A 2VFHA 4G7EA 1GGOA 1XFCA 2Z4GA 1E0VA 3DFYA 1VGAA 3MI3A 3G18A 3AU6A 1GVQA 4PRRA 4MHBA 2NZLA 3UG8A 3UPBA 4NL1A 4CQ9A 2ZRXA 3IIVA 3U2ZA 3JR2A 4ZOBA 3W7QA 3CZ8A 3CUXA 1NFBA 1R6WA 2AGKA 3AIWA 4DO6A 4LWWA 1M7JA 5T91A 7TIMA 1C8YA 1OK4A 1QI0A 3EDKA 4JHMA 1BLIA 3ITXA 4GNVA 1KCLA 4LBRA 8A3HA 1EFZA 3LPOA 3OA5A 2XTKA 3FHAA 4GVIA 5DLCA 1B4KA 3LNPA 4M29A 5I79A 3A4XA 1MEHA 4O52A 2OU4A 2Z0IA 4LEFA 1J6OA 3AXIA 3BAIA 4ZO7A 3PTQA 4L9XA 1EZWA 3ME3A 3ARZA 2NXGA 2RDTA 3AU2A 1FWTA 2ACQA 2BHYA 3BLDA 5IHRA 2BTMA 3PWGA 3TQPA 4EF9A 5DF0A 1S5TA 4QJ1A 3PTMA 3I6RA 3NO3A 1LRNA 2PS2A 4PUKA 3IWPA 2ZUWA 5PTDA 4DJEC 1O1HA 1QWGA 3TC3A 3TQKA 5D02A 1A5CA 1OG6A 2BWGA 5TBOA 1G6CA 2BB0A 3ID7A 2ZZ1A 1ONEA 1B3VA 1Q66A 3OPSA 3RPMA 4LQ1A 3JW7A 4BQ2A 2PGWA 3II1A 3AIRA 4R9XA 2VUYA 3MMDA 3VKDA 1OEPA 3BMXA 3M46A 2BBFA 3WH8A 1AJ2A 1JPIA 3NIYA 5D2YA 4C5YA 1V5XA 4Z2KA 5FJPA 1Q6RA 5HQMA 4WJ8A 4GQ0A 5CJNA 7CGTA 2C13A 3GUWA 2YDRA 1K4HA 1UD3A 3VO0A 1CI1A 3GFYA 3DUGA 5D9NA 1UYQA 5HWNA 5AN7A 1JDAA 4ZBCA 3F4VA 1H63A 4HYVA 3BV4A 4HD5A 2PDHA 5G4EA 3CQHA 5HBFA 3I6TA 4MNKA 2EPNA 2VDIA 2CU0A 2OYMA 3UR5A 4WJEA 4Y8FA 2BVWA 1TVPA 4OOZA 1OX6A 4CLMA 3MUY1 1QTWA 4V1XA 1XH2A 3ZJKA 5A95A 9XIMA 2GPTA 1JZ4A 1O7AA 4O15A 3OIHA 2B7NA 1EC7A 5DY3A 3S2CA 1PWLA 1EZ2A 1AFSA 1WBJA 4NAEB 1MZRA 1E43A 2G0WA 1EC9A 3QN3A 1G5AA 3SY8A 3EPNA 4UMBA 4AY1A 1PX8A 2PWHA 1LRTA 3UWQA 3WBAA 3MCNA 4O11A 1DJIA 1KM6A 1HJWA 3B05A 4UMCA 4QFUA 8XIAA 1PX4A 1A0CA 3LEPA 4ZB0A 2QVHA 4YTSA 5F2IA 3SY5A 2H8XA 4CD4A 4DJDC 3VNDA 4ENLA 1UUQA 2Y8VA 2CKSA 2HEJA 3L4YA 2VJXA 4DVOA 3CYVA 2HDJA 4C7DA 2FKPA 1KM3A 3A5FA 3DERA 4IPNB 4QAWA 3DYOA 3VAVA 1REQB 4GMEA 1FWBC 4N2YA 3H2MA 3HV8A 2F2KA 4O13A 4PCPA 3I4KA 3H7RA 1GVOA 2V8ZA 2PC4A 4EXAA 3AHZA 1FKWA 1LBLA 5K2ZA 3LRMA 2C71A 5G4WA 3PVFA 2YXOA 5D09A 4M80A 5BW6A 4HA3A 5LZLA 1KA9F 3NQ6A 1XSIA 3PZMA 1FDJA 1N8FA 4KWWA 4FR1A 5TF0A 4MUPA 3NJ3A 2YFOA 4R88A 4H19A 2DSZA 3TZNA 3TSDA 2DORA 2WCAA 1ITXA 3LPGA 2FB3A 2BXVA 2ZA1A 4K6AA 1VFSA 2XIQA 4MVAA 5LIKX 4MYXA 4XZNX 3CBWA 4HA4A 2QJJA 4QEEA 4MMWA 4XZMX 4GX9A 2R1KA 1CTNA 1VENA 4MUZA 3URNA 2A3LA 4OOUA 1W3TA 2OB3A 3OGSA 1B3OA 3D5HA 1J6PA 3EWBX 3BICA 3PG8A 4AAJA 3BV7A 4ZO9A 4RNFA 1LOSA 4K1WA 1LQAA 2IXVA 4B15A 1HJUA 3TP4A 1DYSA 2FZDA 2Y70A 3KL5A 4QTGA 3O0KA 4LBSA 3TTQA 1Y8BA 4IIGA 7PTDA 3SECA 4PFHA 3WBEA 3NQFA 1DJQA 2HCVA 3UZ5A 3W1XA 4JFVA 3W2KA 1I1XA 4ZR8A 1KCKA 4GQBA 3TYDA 5JU6A 1DQWA 3P2VA 1W5MA 1YLVA 1XSKA 3G3MA 1ISVA 3MJMA 3W71A 1YTKA 3CPGA 2NLIA 4J3VA 3K13A 3XISA 3G22A 2TODA 4BJHA 5EA9A 3MO4A 4UQEA 4L4MA 2CXEA 2OLAA 3DFPA 2G50A 1K9FA 4AZBA 4N9BA 4Z1YA 4E2VA 3LA4A 3QMSA 5CGQA 3KBVA 1FH9A 3CL8A 3W07A 4PBGA 4KEMA 4E8DA 4K8HA 3ZLHA 1WX0A 3UZZA 1M04A 4M81A 1XIBA 3CUZA 1RVGA 5I09A 4KCTA 5DRCA 4C6MA 1D3HA 1HKKA 5KSWA 4DZIA 2FTWA 1AODA 1B30A 5D2VA 3WNLA 3EWXA 3UERA 2E5DA 4JL1A 4FNUA 1JZ2A 3LCIA 3L5AA 2WV8A 4OU1A 2WMGA 1HF6A 3AROA 1GQIA 4KQNA 3M47A 5AVNA 1X8CA 4LCRA 1PIGA 4D72A 1UD8A 1KCXA 4JEQA 3SZ8A 2E68A 1V0MA 1BF6A 4A8RA 3UY7A 1VBJA 1J2BA 4YTTA 3PZ9A 4AD3A 2CBVA 1X38A 3MSDA 4F0SA 2OLHA 2GFTA 5BMWA 1POKA 3OB8A 2X09A 3AJXA 4NX5A 3UR7A 1J5TA 3W85A 1WZMA 3DKLA 2ZDRA 1XBZA 3V75A 4UFMA 4PMXA 4NI8A 3GU9A 3S9YA 1GZ1A 1SU5A 3HPFA 1SJDA 1MXSA 3W76A 4DJFD 1OZQA 3OLDA 3TX9A 3TE9A 1MEIA 1SJBA 3K1DA 3V1HA 1UZ1A 2CFFA 5EGRA 2B7QA 3ZWSA 3FAWA 1S46A 1XLDA 1E73M 4S3KA 4XAPA 2DZWA 1EBHA 4UTJA 1X1ZA 2VYOA 3N6HA 2WHLA 2ZUNA 3UA3A 4I9JA 4ZB5A 3VK5A 3L66A 4LY4A 1SW7A 3ABZA 1H4PA 3BANA 3N11A 1NQKA 2V0TA 4C6FA 4GJ1A 1W1B1 4K39A 2PDGA 1HIZA 1O5XA 3N2TA 4LUTB 1K8CA 2WJEA 1WUEA 2WQPA 2JFEX 2WMFA 3WDPP 5I6SA 1ADOA 2DT3A 3QKEA 3U4FA 1K70A 3FV9A 2PDJA 3KTCA 4BFAA 4HCDA 5MF5A 2GJLA 3QM3A 5AECA 3FX4A 1U22A 4L80A 5HXMA 1LORA 1H1ZA 4MFDA 4H9VA 2GQ9A 3FY1A 3GAYA 4QGCA 3QOMA 3LM3A 3KS6A 3SFKA 1H09A 1EO7A 4H8NA 4UCGA 3RM4A 1NWSA 2DP3A 3QLLA 4XAGA 3T8QA 2VEGA 3HQPA 3MKCA 4TXEA 1XDMA 3S1XA 4GOAA 1J18A 3ZM8A 2UWFA 1JZ8A 4QG6A 4ZSTA 3T2PA 1JZ6A 3PWIA 3VNIA 3SCPA 1QW7A 2PP3A 2ZE0A 3QOKA 4WCJA 4YLWA 2A5HA 4GZEA 3WLNA 3GKFA 4IGMA 3G2GA 4XO6A 1GVIA 1A5KC 4D8ZA 3L9CA 5JIPA 3NQVA 4W85A 1BSLA 2PGRA 1XRVA 1FWGC 2XHYA 1FWWA 3MC5A 3WMBA 2PRMA 4N02A 1G69A 2XPKA 3SURA 2WHJA 4UFKA 2D0FA 4Y9AA 1E4LA 3P3BA 2FJUB 3BDKA 3ITLA 5LIUX 2NUXA 4LALA 3QHOA 1HKJA 5CZ0A 3A9BA 4AQLA 1IWPA 2V5DA 3RITA 1TX0A 3DGRA 4DXVA 1C8QA 3L0KA 2VVSA 2BXYA 4GO8A 1MUCA 3GW3A 3EOEA 1K1DA 1GYNA 2A4AA 3PSWA 1E4MM 1RBOB 3HZ3A 2XGZA 2ZX6A 2NW0A 4E38A 4ES4A 4HT3A 2INZA 1P4CA 1EDGA 3NSMA 3NO5A 2PWVA 4ERAA 4HU0A 2PI6A 2PDMA 1VB9A 3MKVA 1DIKA 3LI1A 4UFIA 1XDJA 1X98A 4LS2A 3MV01 3T08A 1A3XA 1GVYA 4IIDA 1OFPA 4YCOA 4H9ZA 5A8NA 4PSRA 1P0NA 4YWIA 1VPYA 5AHFA 1CBGA 1A0EA 1M53A 1W54A 5FA5A 3PNZA 1QAPA 3BH4A 3RX3A 4GHRA 2PDCA 1NF0A 1HNYA 3S1VA 4XV0A 3VIJA 5HJYA 1PIIA 4WY0A 3TDFA 3L2MA 5A69A 6ENLA 3R43A 4PL2A 3XIMA 1H7XA 2YCKX 1R2SA 3VGGA 2J25A 2DT1A 2WWDA 4JTJA 1JDDA 1MRAA 3TMLA 1CIUA 3SJ3A 3MMTA 1R3TA 1OBAA 3CK5A 3S5NA 5LHEA 1FHLA 1MDLA 1E72M 5CPLA 1KFCA 3ALGA 4F2BA 1K7XA 1FWEC 3MY9A 1YX1A 2VD8A 2D3NA 4P7NA 3SQLA 2VTFA 4LGXA 4JTAA 3R5EA 2C19A 3IJ9A 1OZMA 2HK1A 5E9AA 1T5AA 3OVRA 1JZ5A 3BLOA 3RMEA 2QCNA 2JIEA 1S1RA 3OBEA 4E4UA 1H11A 4NJHA 3AYVA 3M6DA 2X1RA 4ML9A 4Q8QA 5CC7A 3TIMA 1FVPA 3L21A 4H9YA 4ZOEA 3VNKA 4RL3A 1BVZA 1E3XA 3RCNA 3PBWA 2J7DA 2NSOA 1JUKA 2AGTA 4M7SA 2WKLA 4P8UA 1EOKA 1GZGA 1KLYA 5E0FA 2XM2A 1V0KA 3CIVA 5M5DA 2PPGA 4B3LA 3STGA 1F74A 4KMQA 1GTHA 3AS0A 3AXKA 4GI6A 4RNJA 3AS2A 5HQLA 3LRLA 2V9DA 3M7SA 4S3JA 3BG9A 3MSGA 3FGCB 4GXWA 2VZTA 2Q71A 3V5OA 1EDTA 3GVQA 3AMKA 4HZ7A 4HMDA 4HP5A 2ZX7A 2E09A 3U2EA 2GGHA 3HM7A 4X3ZA 4BI5A 3IANA 4MNLA 3ABQA 3R94A 3W1AA 4J7RA 2PLKA 3OU8A 1QOPA 3NL2A 1KM4A 3VMNA 1SPQA 4IFKB 4LCSA 2CESA 2INEA 3VXGA 1VFMA 3SN4A 1FQ0A 2P76A 1Z32X 3NM1A 2HSAA 3E9AA 1XKYA 4B5TA 3S83A 3W82A 4BI6A 3BLEA 2CERA 3G8RA 5IM51 1M5WA 4ZMGA 5DBTA 3UVIA 1SSDA 4NAFB 5KZMA 4OUIA 3VNJA 1TX2A 4BKNA 1HKVA 1FTXA 2DJXA 2XG9A 4TR9A 2DY3A 3F2BA 2VEIA 2DW6A 1LQ0A 5A2CA 4JIPA 3PK7A 3AXHA 5HUPA 2YLAA 1CGVA 2YKKA 4LRSA 4NVTA 3RDKA 1HL2A 3W26A 5LGXA 1WV2A 1ZP3A 3P5ZA 2I7GA 4GJJA 4O0KA 1DQUA 3REQA 4H6QA 3B9EA 1F4HA 3G6LA 4KH2A 3INPA 3C4UA 3P80A 1KGXA 1IE7C 1L6YA 3NXFA 4IUOA 2JE8A 4XBJA 1S39A 5FJOA 4TX8A 3Q2DA 4X22A 1P0BA 4F0HA 4L6DA 4WXZA 3SJNA 1H51A 3VIFA 4D6EA 3U0HA 1VR6A 1NOFA 2O7QA 3LM7A 3GNPA 5CLWA 4Q8PA 5F2LA 4FHAA 2OX1A 2VENA 1DVJA 3DOPA 3RMJA 4FI4A 1EX5A 2VRKA 2FIQA 3RLVA 1FHVA 2E1DA 1Q63A 1W9DM 3EB3A 1TTPA 1R0MA 1TIWA 1KBLA 1XIFA 2Y6ZA 4H2CA 1VCVA 2BMBA 4IX2A 4REQB 2IW0A 1BRLA 3WF0A 2HXTA 2R14A 4QITA 4OKDA 2W66A 4U33A 4HJWA 3GXMA 3SIMA 3UF9A 3RR1A 3L7RA 4GI8A 5CGTA 1YDOA 3A24A 4S3EA 3TYBA 4LAUA 2YL8A 2Q6ZA 2HISA 1FDZA 4YYFA 2DT0A 1KKRA 2QGHA 1PO9A 2Z25A 3RR4A 3VDHA 3S2LA 2GK1A 4RJEA 1MQRA 1TA3B 3THUA 4M7TA 5DN1A 3WH5A 4QG8A 3QW4B 4AX6A 1SW3A 6CGTA 2CCRA 3VE9A 2W67A 3R2GA 7ODCA 4OV9A 1UQYA 4Y7EA 1E9ZB 4ORIA 4O1EA 1J01A 3BJSA 4JAWA 1MW0A 5AC8A 5HWJA 1EOMA 3SCUA 4DUOA 4CN4A 1AL8A 3FW6A 3G1SA 4TOQA 4C7GA 4EAYA 1UH2A 4RE0A 3BSHA 4GH3A 4UQ9A 5C71A 3VNLA 1UA3A 3U3HA 4V27A 1OFBA 3WCZA 1TTQA 4EOUA 2WLYA 2X40A 3F4NA 2ZX5A 4B2DD 2IPGA 4IPIA 3PUDA 4QXIA 2ZXDA 4GI4A 4GA8A 4O1DA 2W3ZA 3ES8A 1S2VA 3W22A 3VGDA 3AAMA 5C9XA 1CZ1A 3GIYA 5C9WA 4F2TA 3CV7A 1UOZA 4RV3A 1M03A 4NZ5A 4Q6XA 8RUCA 3UBPC 1KTNA 4JYDA 2YLLA 5DBUA 3CASA 6TIMA 3D3AA 3NQEA 1KM5A 1RALA 1QWKA 3TTYA 1G67A 4W7WA 4ZVJA 4KWUA 1TE6A 1Q7QA 2YIHA 2PODA 1UW9A 3AZTA 1HXJA 1MFUA 5F7UA 3SAZA 3M5XA 3HGRA 4DBEA 1L8NA 5HUOA 5KMYA 3ZLFA 3OYXA 3DC0A 3GR8A 2X1UA 3T81A 3OLGA 2QS8A 3SCOA 3T42A 1DKWA 5KZDA 3TOYA 1UPMB 5EMYA 4DEFA 4Y9NA 3A13A 3TH6A 3VDCA 4D6HA 2OCZA 4FA3A 4P8WA 1HO1A 1TFVA 1U5JA 2BY1A 3GDKA 4KIEA 1K6WA 1UROA 3CAWA 1PEZA 4DUVA 3W7PA 3B0UX 1IR1A 2Z00A 5F4XA 4FNRA 2PBGA 4H3DA 4UOQA 2OEJA 1JRCA 4CU8A 2WSQA 4DI8A 2OKOA 3VMOA 5I3GA 3AZRA 3B9DA 3MCMA 2D2HA 3O3RA 4E4FA 4JX4A 4GINA 2WMHA 2OXNA 1OFEA 3PN8A 3TSBA 1CECA 1S5MA 3TKFA 1PVNA 3U2OA 1HVQA 4ZTYA 3RN6A 2OO6A 1Q8JA 2NQLA 5HWMA 2VELA 1S2UA 3L4UA 5K4XA 3BCJA 3GY1A 3BZJA 2O92A 3A3XA 4Z2JA 3T0TA 1ISWA 1V6WA 4UFJA 5HNTA 3PPCA 2FZ8A 3UETA 4L5ZA 4HTBA 5LA2A 4WD0A 1DJWA 3DC8A 4B4HA 2CBIA 1H50A 5CC3A 4A6GA 5AZ0A 2J27A 2IPWA 2NSXA 3PUEA 1Y0EA 3O2LA 4U2ZA 4ROQA 2QJHA 3W2UA 3SUSA 1R9XA 1U33A 1ZNNA 4FMVA 2XIMA 1CENA 4K8GA 1UR0A 4NY2A 1H2JA 2OGYA 5GPRA 1MZHA 2YW4A 3B3DA 4XG1A 2VFIA 2UV8G 2G5WA 3EA1A 3TK7A 1FA2A 4HPXA 1IZKA 2QV4A 2I14A 4V15A 2W61A 5JIWA 4C6DA 2NXIA 2XSXA 3ITTA 3GO2A 3FGCA 1FWRA 4GK8A 4WF7A 3WLQA 4C90A 5ABTA 3GDRA 4S23A 4B3KA 1L0PA 3GX9A 5D33A 3W81A 1AJZA 1YMYA 1MWOA 3K4WA 2IQDA 1QNQA 1V93A 5EPDA 1VC4A 5F1VA 3IS4A 1ZCCA 4IFKA 5GJMA 3VU2A 1D2KA 1S2TA 3BLKA 1LJYA 1O5RA 4HA0A 4JDYA 3U57A 3A3WA 4K37A 3O05A 5G1YA 5C9RA 2QJGA 5CZJA 5I3DA 3WK2A 4Y96A 1GQLA 3B8SA 1WDDA 1JCXA 4X63A 2ZYFA 3WNPA 4CNOA 4LSBA 4LT9A 4J28A 1ZHAA 1WKEA 1W5PA 4RE2A 4XD6A 3CHDA 4XKYA 4QHRA 3BLLA 1AK5A 1FWHC 5A6KA 1CLVA 1VYRA 3POCA 1IGSA 2NV1A 2VGBA 1Y5VA 3R8GA 3F7JA 3ABOA 3W1MA 1IIHA 1FWFC 2G4FA 3BLFA 1X1OA 4J4KA 4GPNA 4P8VA 2BHUA 5A8QA 3W02A 2WANA 2PWEA 4DM2A 4C7FA 4BWLC 2QPSA 2XH4A 2DSWA 4C6BA 3PB2A 2I57A 3PZTA 1UMLA 3RILA 2YBUA 5J5DA 1F3WA 3W01A 3N9KA 3WQWA 5JUVA 2NLYA 1F8MA 1JG9A 2BASA 1OF6A 1CNVA 2YCEA 4BR1A 2NVDA 1H7OA 1QMLA 4NHVA 1FCBA 1SFLA 1GT8A 2OELA 1G1YA 5C54A 3MMWA 1GUVA 3NDYA 3VM5A 2V3GA 3AYRA 1F76A 1QJWA 3PZQA 4YTQA 1H49A 2VDHA 4PULA 5FSDC 1KFKA 3TYUA 3TFCA 4JQ4A 3VIHA 2VEFA 3UXIA 3PZOA 4PMQA 1EYEA 3PBYA 3PJUA 2DSVA 4QBXA 2Z6IA 3FSUA 4JX5A 1HJSA 3QY7A 2CLLA 3AHVA 1NOUA 5I02A 1QPRA 2QJMA 1KTCA 4D6FA 3QV8A 2REQB 1KR1A 1IR2A 1R30A 2NX9A 6TAAA 2OJPA 1TA3A 2BX7A 2RUSA 3A64A 5HMSA 3E0WA 3C2YA 2EJAA 3NQDA 3NFUA 1XHGA 4MYAA 3RX2A 2YA1A 3KVMA 4CKQA 3SCQA 3ZT6A 5FF3A 1Y7VA 1S5WA 1TMHA 1R85A 2O56A 3A23A 2AAMA 5EMLA 4NXSA 5CPMA 5BOEA 2J7CA 2YYUA 1MO0A 3S1GA 5BXTA 3NSXA 1UWQA 3DBPA 4LYPA 3W2JA 3I7QA 5CJMA 3O63A 1UJPA 3LPPA 4BF7A 5CPOA 4FLQA 4IMGA 3EX1A 1PV8A 4I6VA 4PUNA 4O8AA 4E4PA 2R8WA 4JTSA 3ZS4A 3FYOA 2JBMA 4LU0A 1VIWA 1TV5A 4JL2A 3ZT7A 3V3WA 3GNRA 3EX2A 4IOTA 3OIXA 4OV4A 5F2MA 1XR2A 2VR4A 3E2VA 4XO7A 4URIA 4EPKA 4IICA 3OG2A 3GG0A 2E8YA 4W7VA 3KRUA 3NOYA 2DU2A 1KM0A 4AD1A 5LXEA 1YXYA 4AMAA 1XYAA 3N12A 3NZQA 1H7PA 5A6BA 3MVTA 4PTMA 1H60A 3H2FA 5E1QA 1YE4A 4LS0A 4J27A 4PEKA 3CHEA 1O68A 1XUUA 1JULA 4KGLA 3SUWA 3TC6A 4NX0A 4KW2A 3LCGA 3B8UA 1RHCA 5A8PA 3EWYA 4XZLX 2G37A 4Z2LA 2J24A 4DJEA 1H5YA 5C9ZA 3GAKA 3ITVA 4KESA 2GSEA 2XWEA 3NA8A 4WIWA 6A3HA 1E6ZA 2FB2A 3BXWA 2XIBA 3A47A 4NQ1A 2DQXA 5E9XA 3MMUA 2YDSA 4FZIA 2CLMA 3CV6A 2OQHA 3QQ0A 1U1HA 1K8YA 3TYZA 1VH7A 3ARQA 2R1LA 4Q8NA 3QSTA 2OR2A 5H8PA 3W23A 1DJGA 3QHNA 3PSVA 3S5ZA 5D05A 1NDWA 1DXEA 2X05A 2CZVA 4FS9A 1ECEA 2I5GA 2EXOA 2QJIA 4Z1DA 5LA0A 4JTRA 3TU9A 3W38A 1XIIA 3P8IA 5MHBA 3MDUA 1TRIA 1DOSA 2RHGA 4L9ZA 1D9EA 2G96A 2Q01A 3THCA 5LGZA 4C6KA 1UZDA 4CQAA 2Y5SA 2RDUA 1RP9A 4UTKA 5D4YA 2BVTA 1YNYA 4UXDA 3AYSA 1Q2SA 3APTA 3UP8A 3LCHA 2FH6A 3U8GA 2JIWA 1U30A 3WENA 1XCWA 2FTPA 3K8LA 1UZHA 4JFTA 4LUYA 3W28A 3SCTA 3EKZA 2F61A 3W72A 5D37A 4LH8A 4QR6A 4LFYA 1YKWA 2BVDA 3MQTA 2WYSA 2PU0A 1JF6A 4M5PA 5ABHA 5A6AA 4ACZA 5EKYA 4M51A 5EMMA 5AC6A 1QPOA 3FVMA 4HN8A 1NM9A 3NOEA 2ZIDA 3OLEA 2B81A 3PZNA 1JQXA 2F6XA 1UIPA 3STEA 1JGMA 4PTWA 5DMNA 4POCA 4A3UA 3LMZA 1JPDX 2VM8A 3N13A 4LAKA 4DYJA 3ZOAA 3WUBA 4HNUA 2IPFA 1TWDA 1DJXA 2VUNA 3WQ5A 5EBAA 1CXKA 2VWSA 4G7FA 4XX6A 3MI2A 3FOKA 2GGIA 3DG7A 1UUMA 1J96A 2GGGA 1KO0A 3TSMA 2V63A 4CU6A 4BS0A 1TV4A 1V3LA 3EWDA 1F61A 2JGQA 2EGZA 1B1YA 3IV3A 1PCWA 3KUMA 3KL3A 5C9UA 1W56A 1XIEA 1WKYA 5E6YA 4L4PA 1XP3A 4Y9MA 4ORMA 3KCLA 4KKXA 1E3ZA 4AD0A 3CB8A 4MADA 4CVUA 1JIBA 3NR0A 1ZJBA 1TJ2A 1H0IA 1FP8A 5ABFB 2FVKA 4HK6A 3VGEA 1XINA 4JGDA 3GHUA 3ITCA 5LNVA 1QT1A 5EMUA 3GNOA 1C93A 3PULA 4H1ZA 1VD6A 3BLIA 4ATWA 3CLWA 5A6MA 1DHPA 2QDGA 4FLOA 3UYCA 3EEZA 2V68A 3LI0A 2CLOA 1ZALA 2OEKA 1YPIA 4C1NA 1SSGA 2J7BA 2AOSA 4F0MA 1TYGA 1XLHA 3H2NA 3QPYA 3FA4A 4MTVA 2BOEX 5CAHA 1T7LA 1KGWA 4E2DA 5ENLA 1EUNA 1PCKA 1A5AA 2D0GA 4IFOA 4WJXA 5BRBA 4M3PA 4GVHA 1ZBWA 3UWZA 4ZXOA 3WH6A 5E70A 3G77A 4YTUA 2PFHA 3IAPA 4AISA 3FYYA 1CEOA 4GFIA 3GDTA 3R13A 3TYAA 4DI9A 3WMCA 1GEQA 3AI0A 2ZICA 3LHUA 1E0WA 1EJXC 4RCXA 4HVXA 4AF0B 1A80A 1OX4B 4JFWA 3LV6A 4LF1A 4K7YA 4HB7A 3IARA 1GOKA 3M16A 4GNJA 4FEZA 4RW5A 1T40A 5D32A 5MKGA 1QPQA 4CNPA 4YHGA 4GXMA 4RNHA 5IHSA 2FGLA 3N73A 2E40A 3ELFA 1UG6A 4WSKA 4DF2A 1W9VA 4PYSA 3QQWA 3U7BA 5K9DA 4C1LA 2WXDM 1OGBA 1XDLA 2XVKA 4DWSB 4PB4A 3CEUA 2DZSA 4MM1A 1Q7ZA 4WDXA 2EPLX 4O50A 3WQGA 4WZHA 4NYUA 2PBOA 3AUJA 1UB3A 1W17A 2ZADA 7TAAA 2X0HA 3PPHA 1FHUA 1LLWA 1M6JA 3H2AA 3LHTA 3WJWA 1R9YA 3LX9A 3THQA 2YGYA 4ACYA 3K2GA 4L1GA 5H8UA 2VD9A 1AJ0A 4JDBA 3WLOA 2IMRA 3W70A 3SFWA 5KINA 1EJUC 1K8XA 2BY0A 2BNJA 3PUOA 4ZQPA 1JI2A 5BWAA 3O07A 4FB7A 2QIWA 3WQPA 3CPRA 3EYPA 1K9EA 3HOJA 1WA3A 2QLYA 1PYFA 1H5VA 1I0DA 5FEPA 5DCDA 3GH7A 3W25A 3AOFA 1VRXA 1I2PA 2ODOA 1BG4A 2BHZA 3DFTA 3PPFA 2V5LA 1FH8A 2WJFA 3V16A 2PLJA 2PTZA 5CPQA 1KD0A 2EPKX 1KBBA 3NZRA 4JCMA 1TKKA 2GWGA 2VOMA 2VC7A 5LNUA 4EIVA 3WD4A 2WC3A 3G0UA 1UA7A 3GBDA 4W93A 1B9BA 3G1AA 4YVVA 1XLLA 2WWCA 3TWAA 1WKDA 2GYIA 4DZ5A 4DZHA 4AYSA 3LLFA 2Q02A 3V35A 1LF1A 4JYEA 3P62A 4NZ3A 4B91A 4G5DA 2PC8A 4E5TA 1EPXA 2Y88A 3WEZA 2KZHA 1PYMA 3E1F1 3R6IA 3GR4A 4JTGA 3L12A 3ABRA 2GLKA 7REQB 4M0XA 3R7MA 4QCEA 4UOZA 3O6AA 3TW7A 3NURA 4O16A 2O7SA 3N1AA 2EHHA 2XH7A 1TZ7A 1B4EA 3EXTA 1NFGA 3LGGA 5J04A 1JPKA 2VR2A 3VFCA 2J4GA 3O7UA 2R6OA 1NARA 1ADDA 1CGWA 3F03K 1IZCA 5IXEA 1VYSX 5CKSA 3PJXA 5LHFA 3VOJA 1GOQA 1RV8A 1RP8A 3LENA 3GTFA 3LQLA 4RXGA 4YU1A 2O0TA 4UNIA 1LG1A 1GG1A 2ABAA 3URBA 1G7VA 3QV6A 5AY7A 5FCZA 2IPJA 4WGXA 1PKLA 3M0VA 2A21A 2OQYA 3AIBA 3BW4A 1NU5A 4PMNA 2HXUA 3BL3A 3IUIA 2NV2A 1EJTC 4R33A 1ME7A 1MW1A 1O94A 3D6NA 1WDPA 3H6OA 3OYZA 1HTIA 1OC7A 1SO5A 1QUMA 2G95A 1Q6CA 2OZTA 3RIKA 1EO5A 2PDBA 4U2YA 1TV7A 3GH5A 2VHLA 3PG9A 1E9IA 2PF0A 1P5BA 4H9MA 3JU2A 1ZAJA 3H4XA 1P48A 4JZ5A 4GJIA 4IX0A 5JVLA 3CZEA 3UG3A 1K02A 2X30A 1XM3A 3TQ0A 1TMLA 4LVBA 1Z8AA 4DBDA 3ZLGA 1KM1A 2WSKA 2JEQA 1LL4A 4W88A 4AD4A 1J5SA 3E5PA 4MAZA 1VFUA 2VKZG 2ICSA 2PSNA 4WRHA 3N29A 4GGBA 5BRQA 3M0LA 1JGIA 3CNYA 3TVAA 2XFFA 2Z6JA 1A47A 1YHTA 3ABSA 4GABA 2VQTA 5A6LA 3H7VA 4AVFA 2Z1XA 1KRBC 3LERA 3LN3A 5FEZA 3W87A 2XWDA 2XVNA 4ZO8A 1M68A 5C0QA 5LSMA 3VD4A 4GCXA 2CC0A 1EXBA 1UCWA 2GGJA 4S3DA 1CPUA 2FZNA 3KHJA 4AG0A 4CVWA 3BG3A 1XYFA 1P6CA 4LEQA 4YVXA 1ZZMA 4GQQA 2QPXA 1OFDA 4Z42C 3WUFA 3NDOA 1VJZA 5ABFA 3CV2A 5FEXA 5BZAA 4CNSA 3RCMA 3IV8A 3BTNA 2WC4A 3QYQA 1C92A 3LQGA 4O57A 3WLJA 3IRDA 4PTDA 4WEVX 3UEQA 2J9YA 3VCRA 1UBPC 4GACA 2ISVA 3KX6A 3SGUA 5D8WA 3WG6A 3R10A 5LKYA 4XD5A 3B8DA 4DJDD 3IVTA 3VIOA 2LLEA 2HBXA 3L67A 4XZHA 3EZ4A 4EANA 1LZOA 1WAUA 2R9RA 4TMBA 3W7KA 2VMFA 4Y9OA 4L4LA 1PZ1A 1VEMA 1HVXA 1DIEA 3OGVA 1AD4A 2VZUA 1P1XA 4XWUA 2V3DA 1V03A 3ITYA 2DIKA 3S5YA 2VZSA 4F40A 3CT2A 3NVTA 4JTCA 3W1PA 1MYRA 5HA7A 3TMQA 4UMAA 1XIDA 1GWJA 3TTSA 4NJKA 1DXFA 4AF0A 1W32A 4OGZA 3KM8A 4PCSA 4QE4A 1ISYA 3GB6A 4M82A 1OT2A 3M5VA 4R9OA 4HZ8A 2BY3A 3PC0A 3IIOA 3N2OA 1OFAA 2X1SA 2GL5A 1GCYA 3BVJA 3HN3A 3VOGA 4O17A 2EPHA 2Y24A 4N6EA 1SW0A 3R0KA 2PLMA 3NPUA 2CIPA 1OIMA 5AKQA 4M6VA 4A35A 1NTHA 4KEZA 5CCZA 3WQCA 1TE1A 5C55A 1SFTA 4DWSA 4J3TA 2PDYA 1EX1A 1GQKA 4I5UA 4DYKA 1IF2A 3M0MA 2FMNA 3LGEA 3RM8A 4DLFA 5C7HA 4B16A 2GUUA 1IIGA 1XGEA 3LCWA 1UWSA 1O66A 3E3HA 3WNMA 4G8TA 4HPGA 2C15A 3S6DA 4TVDA 2PWGA 2D24A 2BS9A 4X9SA 4FK9A 2ZC1A 1WUFA 2QDEA 1CCWB 1PX3A 1O4UA 2A7NA 3DFSA 1TPFA 3W6LA 5BNKA 1PZ0A 3ARTA 2BOFX 4N9EA 1X7FA 3V0TA 4HSHA 4JPGA 2QCHA 1QPNA 4LTSA 1QHOA 1VZWA 2HWGA 4WQ6A 3W9ZA 1TB3A 2OODA 1BXNA 1UPPA 5AHNA 5CAKA 4FXRA 1KKOA 2FZBA 4MSSA 4HHHA 1JFHA 2ANUA 1JZ3A 3W1RA 2F7FA 2NQZA 3ARSA 4RV8A 4PMRA 1JDFA 3W6MA 2AMXA 3UFYA 2OZ8A 5D8ZA 4DJFC 4WSJA 2DVXA 2J13A 3AWOA 1WYIA 1KFWA 4DUXA 2J7FA 3GHRA 4LYQA 1HZYA 3TW9A 2CKRA 3QR1A 2OSYA 4NI3A 1LUCA 3G1VA 1R7AA 1TMQA 3B0XA 3CQIA 1PBGA 1Z3NA 1IXNA 1DEDA 1TREA 3QPZA 3VI2A 4KEUA 2VL4A 3GSMA 4KWSA 4PUUA 3CPUA 4NUWA 2D2JA 3FXYA 4UB9A 2MUCA 3KEHA 3W83A 4EF8A 4DLMA 4U28A 1JDEA 1LTDA 1R9ZA 1HT6A 1I75A 4W87A 3DENA 2Y61A 3R8HA 4OECA 1SJCA 3EX3A 4HPHA 1UWAA 3GG1A 2XSBA 2XN0A 1EA0A 1US3A 3G0SA 4HNVA 5ECVA 3ZVIA 2D23A 2GUBA 4AZGA 2E1WA 4BHYA 1U2YA 4FSAA 1JAEA 3R11A 1TR1A 3DECA 3G8EA 3MUZ1 2GQ8A 4FOKA 3UPMA 3T07A 4G2DA 3FA3A 4DHGA 3C56A 4GLEA 4ONVA 2Y0FA 1VP5A 2Y5EA 3C2EA 8XIMA 4QJ4B 2ZOXA 2DVUA 1BXBA 2XVPA 3OLIA 2PGEA 2NT0A 1VRDA 3VNYA 1YTEA 3A6OA 3NPVA 4P7QA 5KTLA 3RG6A 1T41A 1JUBA 2ATMA 3PS7A 4NNBA 4S3BA 1CGTA 1RJRA 1B3WA 3WF2A 4BY3A 3K8KA 1JI1A 4LW7A 2VRQA 4QLKA 2X1IA 3VYLA 1H61A 1HKMA 2WPGA 3LSCA 4WXYA 5CPSA 3W75A 4UQAA 2ZUUA 3FJ4A 3H26A 1EGVA 3ZSTA 4CUCA 1XD0A 4JR5A 1VFOA 4E2OA 1WXYA 2CNCA 4DWDA 4GY1A 3S2MA 3DFNA 4AZIA 2P0IA 2NQHA 2QIIA 4QSHA 4ZFMA 2JK2A 3WQOA 3N19B 3GZ3A 5CSUA 4AWTA 1XLGA 3ISIX 3LUTA 4ALDA 5G2HA 2VX7A 4H83A 4AX7A 3KVKA 2A7PA 1G4TA 3K5XA 3FEQA 2CLIA 4LUIA 4OHQA 3W7MA 3IGXA 1QNRA 2W5FA 3DIPA 3EX6A 5FJUA 3AIUA 1Q7MA 3W7OA 2ZZ2A 2C16A 2O9RA 3IVUA 2XFYA 2JF6A 4LUSB 1XBYA 1GW1A 4JQ1A 4PZVA 5HJXA 1DJNA 3RF9A 3EWUA 1K03A 3RGTA 2YCLA 3B0PA 4AEEA 3RK8A 1VIZA 3W2LA 3GHTA 3MUCA 4IQDA 4UTWA 3SRFA 5JBEA 2E67A 1UKPA 3GHSA 2FHCA 1TVLA 3UR8A 5TNVA 3BE7A 3CO8A 4JKMA 1S1PA 2VZVA 3H55A 1WXZA 4HHMA 4HTYA 4DM1A 4HU8A 1XIJA 1W5QA 4A3HA 3ICJA 3GG8A 3OG3A 4GISA 1PKYA 1RH9A 2E28A 4C6IA 2WMJA 4KRTA 3E2RA 1XG4A 4PTXA 1E1CA 3YPIA 4XD4A 4V2XA 1AH0A 2QMJA 2P8BA 3CUIA 3CO4A 1W5NA 3C8FA 3NZGA 5JBFA 3PFRA 1DTNA 4I9MA 1KFBA 1MQPA 4FAMA 1DWGM 4MJMA 1NSJA 2JKPA 4B5XA 3S9IA 4AZ7A 3L2LA 3ATZA 4JTEA 3OZMA 3WDHA 2XFRA 3SI9A 4E3VA 1W1PA 5K7JA 3MSYA 3T8LA 1EGMA 2CITA 3STPA 4CNTA 4Q4MA 3MUXA 4ECLA 1RLCL 5E5CA 1QBAA 1QHPA 1SMDA 2H9AB 4S38A 1SZRA 3BQ5A 3FFSA 1ELSA 3ENLA 2G3NA 3LG3A 1PHQA 1T8QA 1HL9A 4ZO6A 1L8PA 2XDFA 1C29A 3WFLA 2A7RA 1XQLA 3ES7A 1DHKA 5CH9A 2I5IA 1SGJA 2GJXA 3STFA 3BCFA 1RQBA 1OYAA 4PCTA 3GR7A 1XJBA 3PJWA 5M03A 3W24A 4OUEA 4IMFA 4MB4A 4Q7NA 1V02E 2E25A 4AMCA 2POZA 4MDOA 1Y5XA 3ZVHB 2F8QA 1LT8A 4IUGA 4PN2A 2B7OA 3EA3A 1I1WA 3CB3A 4PUWA 1OFOA 3N17A 1E4NA 5I3KA 4C6NA 4F66A 2EO7A 4UC5A 1XBVA 2VC6A 1KWKA 3UWUA 1NEYA 1OM0A 1TUFA 1XIMA 2VI0A 1QW8A 3U6WA 3WN6A 1ONRA 1JR1A 6REQB 3W6YA 5EMJA 1PB0A 2OOGA 4JCLA 2X2YA 1K77A 2V30A 3WLLA 3PBVA 4XD3A 2CHNA 4BWLA 3LOTA 3DHPA 3N2XA 2GJNA 3AHXA 4DPQA 2BP1A 1TG7A 1YW1A 3N34A 1POJA 4Y8EA 2ZKMX 1OCBA 1FWCC 2CBJA 1D7FA 3C0JA 3O0FA 3LCFA 1JCNA 3KE0A 3USZA 1LDCA 4XVDA 3Q94A 3FN9A 3W4RA 4PR4A 4LRTA 4K2SA 3L5MA 4Z2IA 4UTIA 2J7HA 2XZ9A 4RZ5A 1XLAA 3G5EA 1F6KA 3S47A 1R3SA 4R7WA 4C65A 1NY1A 2KAUC 3G1HA 4UR7A 3UJFA 7A3HA 3VIGA 1Q6EA 1AUSL 3BWWA 3LTPA 4PE8A 2XH0A 1AW2A 4L6OA 3AHTA 4H00A 2YB1A 5ABGA 4RX0A 5DT7A 3K8MA 2WVVB 4GYKA 3EMQA 7ENLA 3N14A 2AL2B 1UR1A 4GIEA 4JKKA 2XVLA 3OP2A 1H1NA 2FGBA 1FXQA 4CU7A 1GVFA 3QHMA 3I65A 2Y7FA 5DCEA 2EQDA 4JX6A 4KWOA 1BKHA 1P0KA 1UKSA 1P7TA 1UC5A 1ML1A 3P5YA 3L5LA 2G4JA 5IFPA 4QLJA 3BPWA 3MWAA 4DBUA 3WQ8A 3N25A 4W4QA 4XZBA 3WNKA 1KTBA 2R1NA 3TLLA 1FHDA 4F48A 2WNNA 1IZJA 1HW6A 4YWSA 3V36A 1BGGA 3NQCA 3CUFA 2FQIA 5G1TA 4MJ2A 5HOSA 4LF2A 1E40A 1Q4WA 1QR7A 1Q6GA 4PGLA 3DFOA 4AXNA 4PB3A 1EJ7L 1YNQA 5CC6A 3AHYA 4OBTA 4NKCA 3GUGA 1ESWA 5G5IA 1GOXA 3OBKA 4X0NA 4JS3A 5CG0A 4KWVA 5A8MA 4H41A 3QH2A 1W2PA 2IQTA 4IL2A 3UVAA 3AALA 2O9OA 1EBGA 2Q8LA 1TELA 4ERIA 5HMDA 1AMKA 3SCNA 3VKKA 3WH9A 3MPGA 3SGGA 2P88A 3GBEA 4AHPA 2V2CA 1YEYA 3QZAA 4FXFA 3T55A 3BJFA 4US5A 5BXPA 4ZOCA 3ECQA 1W1YA 4NILA 3WY1A 3T0CA 2WZMA 3K46A 4FF7A 5K3VA 4HOWA 2X41A 1R47A 4NP7A 3LMYA 3PR2A 3BOXA 4GYFA 4HPJA 3T4CA 3K4DA 1OY0A 4MWAD 3UJ2A 2DW7A 4H01A 4O14A 1TTJA 1TUXA 4UWMA 1GVSA 2WJDA 1XICA 2QCMA 4XZWA 3D0CA 4JTFA 1W1VA 1M01A 5JQ9A 3LU2A 2A6LA 4FX8A 4JFSA 1UP0A 5BU6A 2QCGA 2CZEA 1LLOA 1QOXA 1PKMA 2C91A 2Y85A 4XUGA 2ZZ6A 4TV6A 5CQ1A 5JH2A 2VNCA 2FPTA 3CWHA 1PL9A 1EXPA 4PCFA 2Y62A 1EF2A 1FWDC 4XIAA 2AKZA 4LBUA 3W53A 1LLZA 3SQMA 4PTVA 3W0KA 3QFEA 3AUOA 1UD2A 4ICNA 3FJLA 2PCEA 2HVNA 4LNCA 5M17A 1XRSA 3ATYA 1DP0A 3GG7A 4PTNA 2JEPA 5CZKA 2O55A 4ATLA 1W9UA 4IMAA 3ARUA 1PKNA 3WLIA 4C1KA 3TA6A 4A2SA 1E15A 1E6RA 5EB8A 1KLZA 3DKJA 4J40A 1MI3A 4AIUA 4IQEA 1VBHA 4GNKB 4RDVA 2ACSA 2WPBA 1VF8A 4D6IA 1OFQA 4IG2B 3NTYA 2CLFA 4DUWA 1BXCA 2C3ZA 1V6XA 3MKKA 3ZQ9A 1PUDA 1XC6A 3GK0A 1BWKA 3WQVA 4O4WA 2VX6A 1GOWA 2VEPA 1MW2A 3UA4A 4E2BA 5EL1A 1NH6A 3NDZA 3GC5A 5CSYA 4R7JA 1TIMA 1V6YA 3UWWA 4F79A 4ZGYA 4BCEA 3B8WA 2H8ZA 3O1NA 3URQA 2FMOA 3EPOA 3DI1A 3VCNA 2QCDB 1LROA 1GJWA 4J5NA 2GDQA 3FJNA 4H7CA 4RW3A 3GVRA 3KDNA 4MWAB 1UZ4A 4BK9A 4JTTA 5BCAA 3TONA 3N4AA 4NNCA 4DO5A 3UCCA 6XIAA 1ITQA 1XX1A 3T7VA 1RUSA 1JCLA 3FA5A 3HJEA 4TQTA 5AYZA 1GKRA 1DJZA 2E7FA 4GE8A 2G8ZA 4IQLA 4NSBA 2QKFA 2KX9A 2PTDA 1N2VA 1V08A 5DCBA 1GEHA 1P0EA 2WMIA 2WJZA 1U5HA 3AFBA 2WBKA 4NG3A 1OYCA 3RPTA 4PMJA 3FLUA 5GVJA 3QR3A 4Q3MA 4QNEA 3BAYA 3G24A 4W8BA 1Y65A 3UQNA 5IFTA 3U5UA 4GD0A 2DZVA 4O19A 4D6CA 2FVLA 3UW6A 3UZWA 3GVVA 5LIXX 2OSWA 2QDDA 2DUXA 2OT0A 5FACA 2OEMA 1XLFA 1KFEA 3IK2A 2ISWA 4ZXLA 1YBQA 2INFA 3S6TA 1RK6A 3UXLA 4KS0A 1Q6FA 3WSUA 1ZBCA 3GXIA 2R91A 4AWUA 2OOFA 3QC0A 1DQXA 4HCLA 1N7KA 4Q4OA 3NQGA 4J9JA 4TV5A 5I3HA 4H8UA 2Z7GA 1TV2A 3MUAA 5H6HA 1PDZA 2QF7A 4OQVA 3VKCA 4ZQRA 3S0CA 3VC6A 1EIXA 3TUUA 3KFTA 4RE4A 1VQTA 1ZTVA 1BSIA 3QW3A 5DELA 2VX4A 4J2PA 1ENUA 1QK2A 3ORWA 1W9XA 1PTGA 2HQAA 5CPNA 4WHBA 1TWWA 4I90A 1X8FA 4JN6A 1E6SM 3JVAA 4PBFA 1C9DA 3O8AA 3OEXA 5DO8A 4FIQA 5H8MA 1G4SA 2Q3RA 1CGXA 3TAKA 2BXZA 5DQPA 2Z1SA 1FFRA 2VURA 5CLTA 3E0IA 3GM8A 1V3JA 3A12A 1Q6QA 1W1IE 1NVMA 3N6QA 1CXIA 2J62A 1JCTA 1R8LA 3G1FA 3E49A 3O06A 1X6LA 1ZAHA 3DHDA 2ZRWA 2XZ7A 3L4WA 5HANA 1KRCC 2WHMA 3L68A 2FH8A 3GYEA 3F5KA 4ADUA 4Y9PA 2XGBA 2PP0A 1ZJHA 1VEPA 2CZ5A 2QEZA 1R7OA 3GFXA 1HP5A 3HV9A 3BOFA 2I9UA 2BG5A 2Y8KA 4WK9A 3H8AA 1B3YA 4UR8A 2P50A 4NXKA 3DESA 3JZUA 3UESA 1WAWA 9RUBA 4R27A 3K30A 1CGYA 4JTLA 3GVWA 3VOCA 3COTA 5IDIA 3P0XA 1AG1O 2QULA 1RCQA 1NP0A 1UQZA 1KWGA 2EAWA 4MDPA 5M2FX 3ZSSA 4GC3A 4UFHA 2Z26A 4JIEA 4BEQA 2HZGA 1KGUA 4KRZA 1BTCA 3FDGA 1V77A 4FNPA 2YL6A 3CAVA 3MP5A 3DG3A 2MNRA 1Z69A 3APGA 4EX4A 1TPC1 2GOKA 3W7HA 4PA8A 3MCOA 2EJ1A 4DNMA 2TAAA 1P6BA 2VC5A 1RA0A 5LIYX 4L61A 1QI5A 5AZ1A 4FXJA 1ME9A 3UJRA 4LV4A 3VC5A 4KERA 3KAOA 1TTIA 3BLPX 3S1WA 1YPXA 5LA1A 4B5NA 1EHAA 3HGJA 4INFA 1IHIA 1C91A 4LPCA 4JTQA 1TPH1 4K3ZA 5I3FA 1K4GA 1WZAA 2PB1A 3SEPA 3AS1A 1WPCA 3E0VA 2DQWA 3I6EA 3WLMA 1US0A 4NAEA 2P8CA 1J0YA 1UR3M 3EGJA 4Q8UA 1WDSA 2ZRUA 3Q65A 2QHAA 2OZ3A 2F84A 1A0DA 2Y4SA 1YADA 4X9YA 1SR0A 1H41A 5I23A 3WYZA 3KWSA 1W3HA 2VFFA 3W1TA 2WSYA 2XH2A 3UYIA 2YZRA 3KDOA 5A1AA 3GU2A 1U5VA 1QATA 4MY1A 4J35A 5FF4A 4AIOA 1UHVA 1WDQA 4DYEA 2VCAA 4NJJA 5FL1A 3KOYA 3DG6A 2W27A 1G9HA 1REQA 1MFVA 4AXKA 2ZDSA 1TPUA 3DN5A 4NZ1A 3TJXA 2CPUA 3WUGA 4G7EB 1W1A1 2ZX9A 3EA2A 4US5D 1UWRA 2GZXA 3S5OA 1DPMA 3W7DA 1QOQA 2R1MA 3N9RA 3OJGA 1X97A 2PMQA 3KZSA 3L23A 1I45A 4C60A 3TN4A 3CLMA 3H4WA 1E51A 4E8CA 2DZPA 3BSGA 3A21A 2YL9A 5F4WA 5GJPA 3D3FA 3RLHA 1SZFA 1XH1A 2QUTA 3WMLA 2X16A 3RRXA 2GOUA 3HGSA 4F0RA 2PTYA 4E0CA 2WZHA 1R2TA 5XIAA 4XKMA 3BMWA 5CBBA 1V3IA 3ZJ8A 4U3AA 1K3UA 1RCXB 1C8XA 1BTMA 1F3TA 1BHGA 2A1YA 2E3ZA 4EXQA 3WF4A 4DNHA 5CGMA 3VGHA 1SFJA 4N6FA 3QVQA 3VGFA 3EOLA 4GKLA 4B5WA 1Z9AA 2BSLA 1KFLA 1E9LA 4QQUA 2OWCA 2YOCA 3BG5A 3KHDA 3DYPA 1AZ1A 1T0OA 3LLXA 3I10A 2F2HA 1G7UA 2X42A 3KTSA 1W3KA 4O1CA 3S9ZA 3VD7A 1W31A 4PMVA 1KQYA 4YVPA 3WLHA 4HOZA 4CQBA 2UY2A 1A5OC 3KP1A 1EH9A 3CU2A 1VFFA 3T44A 3IIXA 5I24A 1Q2RA 3H53A 1ZAIA 3CYJA 1LM1A 1WE5A 4IPPA 1L6FA 2DEPA 2ON3A 2DGAA 4XZ9A 1V0LA 2SFPA 1X7IA 5B80A 3WF3A 1EQPA 2GWNA 1S5NA 2XFWA 3NZPA 4EWJA 4HMEA 1OCJA 1TJ1A 3GDLA 2V67A 3BURA 2PCQA 3C2FA 4RUBA 4HYWA 3GTIA 1FP9A 4D1JA 3BUVA 1PAMA 1WOAA 4AC1X 4HA1A 1JYWA 4QQ3A 3VNZA 3LNMA 2W62A 2E8ZA 2A3HA 2X0SA 3AXMA 1PPIA 1H7NA 2ZRYA 2Y8UA 3WBXA 3OOQA 5AHLA 3VZXA 3Q67A 1XRFA 2WB5A 2Z24A 1PE1A 2W91A 1NWTA 2GSJA 4QS6A 1AW5A 2FFIA 3B03A 4DWSC 5M1TA 1QNOA 4HGXA 4AY7A 3CZGA 3K1GA 4A22A 1XW8A 3MSRA 1W1ZA 3GNNA 1OF8A 4L6HA 5C8BB 1KM2A 1HGWA 2WOQA 1U1UA 1FX6A 3PHAA 4H4IA 1IWAA 1NWRA 3K4AA 4IIFA 2D2OA 4M56A 4PRWA 3WBWA 4GZIA 4IL0A 3VE7A 1VFHA 3SM0A 2EG7A 1Z89A 4GIAA 3W7GA 3UG5A 3IJDA 5D04C 3EKLA 3B06A 1RPKA 3W1UA 1SO6A 1RCOB 2ALRA 1U83A 2Q3OA 1DL3A 2NQ9A 3QR0A 2OWWA 3UWYA 1TPWA 3WLPA 1D3GA 4ERGA 3VDGA 3QC3A 4U3CA 3FSTA 3QGAC 3E38A 5E0CA 8CGTA 2GVYA 1VYPX 4MWAE 1VS1A 3RU6A 3M0YA 2YDQA 3F4WA 4WKHA 1KW1A 4Q7IA 1H3GA 3IIPA 3AMDA 3TR2A 4LUTA 4EPDC 3CGTA 4MY9A 1CGUA 2E9BA 1ZSXA 3KOZA 4WR3A 4U4MA 4JQ2A 2Y1HA 1ISZA 3BAJA 2PURA 1W8SA 5D2XA 5GNXA 4IQJA 2G3FA 1FRBA 1JXKA 1JCJA 4M1RA 4Q8WA 4OIFA 2DZTA 4OZOA 2G3JA 3EPMA 1ZJIA 2VWTA 1GPWA 2NQ5A 3F5LA 4HOXA 4QRNA 1AZ2A 5FD0A 1IXPA 4W8AA 1MDRA 3WDQA 1EL3A 4NZJA 2E6FA 2NVCA 4AC7C 1WZLA 3GNXA 2W9MA 4AEFA 3PY2A 2ZQ0A 3M0JA 2ATSA 1L6GA 5I07A 3PJTA 5KEZA 1TCMA 1J11A 5CBJA 3ONCA 1M7XA 1NFPA 3DU0A 3GS6A 2GDVA 1V3HA 3PB0A 1P6WA 3H54A 3GKAA 4N0RA 3H2OA 1DWFM 2FZ9A 2CWXA 2FZMA 1ALDA 1LP6A 1XL9A 1LOQA 3WDJA 4DJFA 3VD5A 4WDUA 3W7CA 1R5YA 1DJYA 3APYA 1SZEA 1EF3A 2L5HA 1B2YA 3WK1A 4FOJA 4JEJA 5G1MA 3M0ZA 2WHKA 3ZZ1A 5I0DA 2DJLA 3HQOA 2P5NA 3IGSA 4JBRA 4O1BA 1VLWA 2POTA 3PAJA 3T0BA 2ZC8A 3C3NA 4ICCX 5CEWA 2PUZA 2OG9A 3BGGA 4L64A 1JEZA 3NL6A 4OVXA 2XN2A 4FXSA 1JF5A 3VUSA 4N42A 2QQ6A 2D20A 2X8RA 3HA1A 1OB0A 1SUXA 2CW6A 4Q6JA 3CXOA 4WOQA 1ZU8A 5EFFA 4P61A 1NDVA 1JD7A 3W86A 4S3CA 3M4HA 4KGJA 4W5ZA 1IV8A 1A5BA 1F6PA 3OODA 2AMGA 3SCRA 3CV1A 3F2CA 3CUHA 3KBSA 4IP4A 3PZUA 4RXFA 2NQJA 4JTIA 3S46A 2V5JA 2YYTA 1R3QA 3CAKA 3V18A 2TMDA 2GVJA 3EDDA 3V5FA 1EJVC 2RDXA 2WKGA 2Q09A 4HSNA 2V6AA 1OWQA 4W7UA 3ITOA 3CTTA 3F4DA 2X7WA 3KS5A 3PTKA 4CD7A 4HMCA 3HJZA 4NYYA 3SQSA 3UNDA 1LCOA 3MWCA 2J8GA 1MNSA 2GVEA 3EEGA 3HURA 1UIOA 4XSLA 2V2HA 1DORA 2BGSA 5FJIA 1LG2A 1T6MA 1UR9A 4CQ8A 4Q4PA 2A6NA 4UTWC 1ZGDA 2DPEA 2J6XA 2PTWA 4IM4A 3W7NA 3GXFA 3MZ2A 2I56A 4KFPA 3HFTA 3S2JA 2RJGA 3T40A 4ADSA 4FLSA 4PCNA 1BYCA 3U4AA 2C7FA 1XLEA 5AYBA 5D9PA 3LRKA 1XG3A 1E6QM 1UD6A 3C86A 4IIBA 5JBDA 2CLEA 3QPEA 4J3SA 2OX4A 3HBLA 1F05A 3WK0A 3ZR5A 4XUYA 3TN5A 2I16A 1ZENA 2V81A 3VNMA 3W7RA 1OINA 4D6DA 1I2OA 3CT7A 1HJVA 3FJ6A 5H2ZA 3HMCA 5M3WA 3AIVA 1OD8A 1B3XA 2C1GA 5C70A 3EWZA 2QZRA 5E09A 1IYXA 2VO5A 2BOGX 4QIUA 4PUJA 3GLCA 3ZWTA 3EB2A 1DE5A 2RKXA 1TZZA 2PD9A 3UU0A 3CMJA 3QV7A 1X96A 3HQ1A 3CMGA 2Z2AA 2QUNA 2NX1A 2NT1A 5HR6A 1RY8A 4TVUA 2UY4A 1K7EA 3SO7A 3W2NA 4IP5A 3KP0A 5FAGA 4O1FA 3M7WA 5I00A 1UMYA 5AHMA 1NELA 5AHIA 3M5ZA 4AY8A 5ABEA 2AKMA 3TAOA 1O5QA 1EP3A 1YRRA 4J3WA 4X2PA 2OO0A 3P61A 3BMVA 3O6CA 3W1QA 3QGKC 2WSPA 4PUEA 2RGMA 5EFDA 1E9YB 1GHSA 2ZXQA 3M0KA 1KXVA 3LBMA 5K4ZA 4HHPA 3L65A 2J7EA 3EB4A 2DV0A 5CZTA 1QHZA 2I1OA 4TVCA 4AIEA 3NQ2A 4NAFA 1M41A 4YNGA 1WZKA 3UCDA 4Z1AA 4M1BA 5CSRA 1W3IA 4XB3A 1C7SA 2AL1A 4GFSA 2P53A 3IACA 5HNNA 2A3EA 2Q8XA 2TSYA 2WQDA 1OJXA 1BF2A 5FF0A 3DBNA 3DZ1A 3MVIA 3WD3A 4XIMA 1Q85A 1Z42A 2Z28A 3PBGA 2DDXA 1NJJA 2IKHA 1UKTA 5FL0A 1RSCA 1GVRA 1EB3A 1CT5A 3GXTA 5I7GA 4OTKA 1XYBA 4MB1A 3QZ6A 4N4PA 1D8CA 2WZIA