4KRUA

X-ray structure of catalytic domain of endolysin from clostridium perfringens phage phism101
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
214
Chain Sequence
VHHHHHHMQSRNNNNLKGIDVSNWKGNINFESVKNDGVEVVYIKATEGNYFKDKYAKQNYEGAKEQGLSVGFYHFFRANKGAKDQANFFIDYLNEIGAVNYDCKLALDIETTEGVGVRDLTSMCIEFLEEVKRLTGKEVVVYTYTSFANNNLDSRLGNYPVWIAHYGVNTPGANNIWSSWVGFQYSENGSVAGVNGGCDMNEFTEEIFIDSSNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autolytic lysozyme
publication title X-ray structure of a novel endolysin encoded by episomal phage phiSM101 of Clostridium perfringens
doi rcsb
source organism Clostridium phage phism101
molecule tags Hydrolase
total genus 75
structure length 214
sequence length 214
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4kruA00
1WPCA 4A3HA 1W9PA 2XGBA 3U5YA 3PTQA 4DWSA 3FY1A 4F66A 1BYBA 1O6IA 4HZ8A 3BAIA 2WYSA 1J9YA 2WKGA 5CQ1A 1JYXA 3EMCA 3DHPA 4HPGA 3QOMA 1GQKA 3RIKA 3W24A 2E9MA 1W2PA 2WHLA 3K8MA 5I79A 1CLVA 4UOQA 4GKLA 2Y24A 1WO2A 1C91A 4H8UA 4KRUA 3M46A 1UD4A 2BY3A 3CZLA 2XPKA 4V28A 4CVUA 4CUCA 2DIJA 3WDIA 4TVUA 1PPIA 3SUUA 3MKKA 4KH2A 2A3AA 5CGTA 2XHYA 4UFLA 3SUWA 4URIA 5CSUA 1J01A 3WF3A 2OWXA 3ZIZA 3WEZA 3N13A 2WCAA 3CO4A 1BAGA 1B3VA 3MUY1 4PCTA 1XC6A 4WSKA 4W85A 4W8BA 3QOKA 3W53A 1WB0A 1TUXA 4AD4A 1EO7A 2QV4A 1MQQA 4UFKA 4KGJA 2QPSA 1GVYA 3W27A 3MANA 3WF4A 2ZUWA 5E9AA 1GOOA 1UKOA 3W4RA 5CGMA 4AZBA 3CGTA 1FH8A 2WVVB 3EMQA 1NP2A 3KE0A 2CNCA 4LPCA 2J7CA 1KBBA 5IXEA 5JIPA 4L4PA 4J3UA 3WFLA 4JFVA 1NOFA 2DH3A 1VFFA 1E70M 3U5UA 2Y4SA 5I6SA 4PSRA 3F5JA 1E40A 4ZFMA 1IV8A 4Z2HA 1E55A 4AXNA 4B9YA 3KZSA 5EFFA 3BLKA 3VO0A 4PMRA 3AISA 3PZMA 4W89A 3PZIA 1MXGA 3SIMA 1H5VA 1ESWA 2GDUA 3GXMA 1EDTA 2A3HA 1EA9C 2CKSA 2XVKA 1UR2A 3VX0A 1CDGA 4W7WA 2A3CA 5I2UA 5JBEA 2EPLX 3EDFA 1KXVA 1E4IA 2VR4A 1AQHA 1E6PA 3I3EA 4UQBA 1Q6CA 5FL0A 1DWIM 2VX4A 1A47A 1CXIA 1Q6DA 1W9DM 2WMJA 3ZSTA 1BF2A 5DEZA 5E70A 1MWOA 2JALA 2XVNA 1B0IA 2G4FA 1CGWA 2WVSA 5I5RA 1NWTA 3WN6A 3WBEA 3NCOA 1VFUA 5CLWA 1BSIA 1GNXA 1UZ1A 2NSXA 1NWUA 2YDQA 2EO7A 3M6DA 2CBIA 5A95A 3SCOA 1C93A 3N1AA 2BVTA 3OGSA 3IK2A 1KQZA 2WANA 2BHYA 4NZCA 3FNDA 3WDQA 4U3AA 1JZ4A 1XYFA 2D23A 3OG2A 3TP4A 4R5EA 2JEQA 1MQRA 3WH8A 3AHXA 3FN9A 3VIIA 2NT0A 2FHBA 1TVPA 2CEQA 4MADA 3VMNA 1FOBA 4AD1A 2VTFA 2J78A 3VD9A 1H1NA 1K9FA 4KRTA 2J7HA 4NRRA 1JYWA 4DUWA 4BQ5A 1FHLA 1C8QA 1QPKA 1V6YA 1ZBVA 4JZ5A 1TVNA 2V3DA 2VZUA 3K8LA 3VGEA 3ZQ9A 3ZO9A 4X0NA 4F79A 3BSGA 3GTNA 4PYSA 3DHUA 5A69A 1WDRA 3OLIA 4AIUA 3ARYA 3AS0A 2J25A 1HKKA 4ZENA 3N17A 3S6TA 2Z1SA 2WVTA 4GPNA 2XWDA 3ZOAA 2ZUNA 3HJEA 1WDSA 2J74A 5D9NA 1V6VA 1L0PA 2XWEA 1LWHA 4JKMA 1EDGA 4PMQA 3ZM8A 5JBDA 3TTSA 3A3HA 1H0GA 3T0AA 5D4YA 3BMVA 4R27A 1WAWA 5GNXA 1F4AA 3WNNA 2CBJA 4UZSA 4J3XA 1C8YA 1CXFA 2X2YA 5FL1A 1H11A 1SR0A 3AS3A 1WP6A 3EDEA 1JG9A 1TG7A 1V3JA 1EO5A 4UFIA 4ZXOA 4MNMA 1J0IA 4RL3A 3AIUA 3SCTA 1VEPA 4DUVA 3AIEA 2OSWA 3WL1A 1PAMA 4CN6A 1JAKA 2IXUA 2CHNA 2J77A 1OB0A 4PSPA 1R8LA 1G0CA 2X09A 1H4PA 4BCEA 1B3ZA 5M3WA 2PWEA 4CU6A 3VUPA 1KGXA 1W9BM 3GNPA 2XG9A 3VMOA 5A2BA 1J0KA 2WSKA 1UH4A 3BAXA 4PMDA 3NJ3A 1LG2A 1TFVA 1NP0A 5E6ZA 4OUEA 2J75A 4KMQA 2PBGA 2GUYA 3W28A 3CLWA 4FMVA 2J7EA 4UFMA 1UQYA 4XV0A 2D24A 3ARVA 2VCBA 4W84A 3WD3A 1UKSA 2WZIA 3KL3A 3WDJA 1VJZA 3FXYA 2WKLA 1YQ2A 4S3JA 5D8ZA 2WHJA 4QCFA 3AFBA 2JIWA 1MW1A 2VT0A 1OINA 3CUHA 2E8ZA 1NH6A 4W93A 3SUVA 4DWSD 1OCQA 3POHA 1OD0A 4A3YA 5F7UA 1DP0A 2WC3A 3L4UA 3MO4A 1VAHA 3ECQA 1JXKA 3ARXA 5E0CA 1OGSA 1GHRA 4ZXLA 1U33A 2A3BA 3WY1A 1A3HA 4DWSB 2WZHA 3VDAA 4JCLA 2WNWA 1VEOA 4MNJA 4KGLA 3W0KA 4U31A 1ISWA 4D1JA 2OWWA 2YA1A 3PZVA 4LXFA 3OGVA 5A8OA 2WMIA 3VD5A 1CXLA 4GQQA 3ZJKA 8A3HA 4AIEA 1UR0A 5A2CA 2MANA 1V0MA 2A3EA 1UHVA 5CZKA 5DO8A 2BVDA 3B8SA 4FK9A 3HMCA 3CTTA 1GOIA 4Q22A 3RO8A 1TA3A 3ALGA 3RM8A 3BAYA 3WNLA 3VIHA 4WKFA 1E3XA 5A6LA 2JIEA 3BCDA 2DSWA 1NQ6A 5IDIA 3GBDA 4GO9A 1W2VA 3WF1A 2W61A 1C3FA 1GCYA 2PWDA 2XM1A 1FFQA 7TAAA 4GIAA 3FHAA 3CH9A 3W25A 1JYVA 4GQRA 2EEXA 1PX8A 1J12A 1VENA 4XUYA 3MS8A 1ZJAA 3AIRA 1OT2A 2VCCA 4C7FA 4JKKA 3BAWA 3WDRA 4CGTA 2VRKA 4CD8A 5CPTA 5ABFA 4D6JA 2G8ZA 2V3GA 3CZGA 1WZKA 4OBSA 4UNIA 3N18A 3MUAA 4TUFA 3VU2A 1XSIA 1C7SA 3CHFA 1GOKA 1KXQA 3VIOA 1RP8A 1HT6A 2NT1A 3TTQA 5M17A 5CPSA 1E6SM 2F8QA 2Y8VA 1QI0A 5A6JA 1CWYA 4D6HA 2OYLA 1BFNA 3EDDA 7CGTA 3OA5A 2VQTA 4J3TA 5M5DA 4OBRA 2EPOA 4J28A 4AEEA 1XH0A 4JKLA 3A4XA 1CBGA 4UQEA 2YBUA 1KFWA 4PUEA 4AZIA 1JIBA 3T09A 1MYRA 3II1A 2VZVA 2VQUA 4CCEA 2ZUSA 4W5ZA 1UG6A 2W66A 5EBAA 2V5CA 2BFGA 2CBUA 5LA2A 3F5LA 2PWFA 3WQ5A 4PTVA 5LA0A 1NOWA 1WZMA 2VURA 4K68A 1FP9A 2WMFA 3WUBA 3VM7A 1PEZA 3UCQA 2D3NA 4M29A 1ODUA 3CZ8A 3J7HA 3K8KA 1U2YA 3WF0A 5IHSA 2QHAA 2X0HA 3L4WA 1CZ1A 4ML4A 2VOTA 1EHAA 4AIOA 2UY4A 2EPKX 2FH6A 3MV11 4CN1A 1HJWA 3GM8A 5IHRA 5HNNA 2V5DA 2DSZA 4AC1X 1QHOA 4AWEA 2CKRA 3WMCA 2Y2WA 3ARPA 4BQ2A 3T0BA 5CLTA 2J7BA 4CKQA 3PZQA 1DWGM 3BC9A 2XFYA 4AEFA 4LX4A 3VNYA 3VPLA 5BXTA 2VX6A 1JZ8A 1W1PA 3EDKA 2D20A 1H3GA 2WCGA 3N04A 4MAZA 2PB1A 1VB9A 3WQWA 1ECEA 1LQ0A 3KL5A 1YHTA 4LGXA 1S46A 1VJSA 3VTRA 3N15A 1BQCA 1JI1A 4QLLA 1XYZA 2VI0A 2YLLA 1GJWA 3OZOA 2OYKA 1CLXA 2CXGA 2X0YA 1H2JA 1UR9A 2GVYA 2CIPA 2J47A 2YJQA 5DT5A 1X1NA 3A4WA 2VVNA 1Q6EA 2YL9A 4EE9A 5LYRA 2BY1A 4IUGA 3VD7A 1VEMA 2DIEA 4GZJA 4TOQA 2CERA 1CGYA 3LPFA 4WLCA 3BH4A 4IPLA 4MJ4A 1KXTA 4A4AA 4M24A 4JFTA 4AZ5A 4F9DA 4M82A 3SUSA 3ARUA 4PTMA 1E0WA 1UKQA 2ZWYA 1G01A 1PX4A 2BY2A 3MUZ1 3RM9A 1M03A 3LPGA 3FAWA 1V03A 4P8VA 1JDCA 4CVWA 4QAWA 1BYDA 1GW1A 4D1IA 3EYPA 2UWFA 3SURA 1AQ0A 2JFEX 2ZUMA 4D6CA 1I75A 2EPNA 1GPFA 1SMDA 3ZJ6A 3NYDA 4HMEA 4AZGA 2BNJA 1LL7A 5A6BA 2F2HA 2AOSA 2PF0A 2PWHA 2VJXA 1GUVA 3ARZA 3M07A 4PRWA 4IPNB 1B3XA 1IZKA 3ALFA 4ATLA 4W7UA 3PHAA 2ZX7A 3GH7A 1HP5A 4PMOA 3MMUA 3WD1A 2ESCA 3WD4A 3GH4A 3NSXA 3SCPA 3WUGA 4UQDA 3N11A 3WNOA 1W3HA 2X05A 1UH2A 5A6SA 2NW0A 2O9RA 2BXYA 3QHMA 1UD5A 2Q8XA 1QI2A 1ZBKA 1FH9A 1SFSA 1B1YA 1H09A 3VGDA 4MTVA 2VRJA 4PMNA 3TTOA 5A8QA 1HJUA 1GQLA 1KB3A 2ZXDA 2FGZA 3OLDA 4UR9A 4B9ZA 3KWXA 1JF5A 1E6NA 3WD0A 2O92A 4UOJA 2WWCA 3WNPA 2WMIB 1OM0A 4AZCA 2G3MA 2E0PA 1HJXA 1UWTA 4WSJA 1LLOA 1FHDA 3AXIA 3ZR6A 4W8LA 5FKYA 3CHDA 3WQ6A 1EDQA 4M80A 4P7RA 4PMVA 1TA3B 3U7BA 1HL9A 5BXSA 2EPMX 3A47A 1CGVA 2GFTA 2AMGA 3BXWA 1JF6A 4HZ7A 1E3ZA 3O9NA 1UWRA 2QMKA 3RPMA 3UR8A 3WIJA 5HDRA 3IAQA 1EIBA 4HA1A 3K4AA 2F61A 5EMYA 3L4TA 4EAMA 3CZEA 1G1YA 3ZT7A 1E6XM 1PZ3A 1WDQA 3POCA 3RM4A 1R87A 1WDPA 3GXDA 3L4XA 1MFUA 2PI6A 1W3JA 3WH6A 4B16A 2VX7A 1TMQA 1XSJA 1TR1A 3ZSSA 3BLPX 4QP0A 3EDJA 1KR0A 1OD8A 5I23A 1ODZA 1E6RA 1BLIA 1KGUA 2GK1A 4AY1A 4E4PA 4P7LA 3UEQA 1W9UA 2CPUA 1LWJA 3PZNA 4DM1A 5ABFB 1LG1A 1D2KA 5BCAA 1XRVA 1GJUA 4HU0A 5FCZA 1BYAA 3B9EA 4M1RA 4BQ3A 2JE8A 4JAWA 1HJQA 3VM5A 2CETA 4UZUA 1W1YA 4CU8A 4HTYA 3KL0A 4P7NA 1CNVA 1KXHA 3DYMA 1DWJM 3AJ7A 4MAVA 1UWSA 4OOUA 1V0KA 3I3BA 1FP8A 5KEZA 2XSAA 1B31A 1MW0A 2CESA 4NSBA 2D0HA 3WENA 1MFVA 1J0HA 5CJ5A 2EXOA 3PZTA 3F4VA 3CPUA 4MB4A 1EXPA 1WNOA 1J0ZA 1JAEA 1M01A 4PUDA 1UUQA 1QW8A 5A1AA 2E9BA 3GBEA 1HP4A 2DDXA 5BROA 2WM0A 3AMDA 4HA3A 1VRXA 1QBAA 4H7VA 3W82A 4LYRA 4OIFA 4WF7A 4EKJA 3L4VA 6TAAA 1KQYA 4WK9A 5JBFA 3TOPA 2GSJA 1PJ9A 3EBVA 3L2LA 3B9DA 4BQ4A 4ZE4A 4QFUA 2J7FA 5IFTA 3B9AA 3VIKA 3AIVA 2WVUA 4TTGA 4AMCA 5ABGA 1J0YA 1UD2A 2AAAA 5A8NA 3VD4A 1Y7VA 2D0GA 3U57A 1JZ7A 1JD7A 2VMFA 4AD3A 1C90A 2OYMA 5I3DA 3BAKA 1AMYA 1CGTA 4MPKA 3PBGA 5AC5A 1V0NA 2YL6A 2GDVA 3AHVA 1ISVA 2JF6A 3K1DA 2D2OA 1JFXA 4UTFA 2EBNA 4DM2A 2J8GA 1VIWA 1ZL1A 4B3KA 4RE2A 4AD5A 1JZ2A 1HKJA 3PN8A 4HP5A 1K9EA 1QHPA 2BXZA 1B9ZA 1V0LA 5A6MA 2Z1KA 2IXVA 2OSXA 3OB8A 1C7TA 5C8BB 2WAGA 3RMEA 4H2CA 4GI8A 3SCRA 2G41A 1SYTA 2WW5A 4ZE5A 3WQ8A 4N42A 2ZUTA 2FHCA 1UWIA 3WDHA 1BHGA 4N0RA 4GZIA 1DWAM 1QBBA 1WCGA 1WE5A 2E40A 3WFZA 1B3YA 1V02E 1NARA 4X9YA 3DECA 1RPKA 1E6QM 1XH2A 3SCSA 5KZ6A 2OSYA 3OLEA 1Z32X 2CCRA 3CUIA 1ZS2A 4CD6A 1O7AA 4W87A 2G3JA 3E1F1 2VO5A 3L2MA 3VINA 2J7GA 4B3LA 5A6AA 1GVIA 1CXKA 3ARRA 3CBWA 4OJYA 1D3CA 4ACZA 4GI6A 1QI5A 1UZ4A 3WQ4A 2ZOXA 3MMDA 5C71A 5DFAA 3NSNA 5ABEA 5A6BD 1LF1A 1J0JA 4J3WA 1MVYA 4J3VA 2E8YA 4H04A 2YL8A 3CUJA 3MSDA 1G9HA 3RILA 3VD3A 3IJ9A 2BHZA 3CUGA 3SCNA 1H0IA 1JGIA 1EGZA 4JFWA 2YLAA 5EFDA 3UETA 1QNRA 1E1EA 3AOFA 4HMCA 2YBTA 2YDRA 1KWKA 2FGLA 3ZJ8A 1CGUA 4XZBA 3ARSA 3WELA 3VGFA 4H41A 1XD1A 4D6GA 1U30A 2VR5A 2WPGA 3VDBA 4AW7A 2D0FA 5TD4A 2YKKA 4TTUA 1DHKA 4H8HA 2ZUUA 4XX6A 3AZSA 2E3ZA 1XSKA 3U7VA 4D6DA 3SCVA 1E9LA 3ZJ7A 4BS0A 1M53A 1UR4A 1W91A 4CCCA 2VL4A 3IANA 2VZSA 3OIHA 4EK7A 3T0DA 5E0FA 1B3WA 3QHOA 2OLHA 4Y7EA 4BA0A 4AZCB 4PTXA 6A3HA 1W3KA 9CGTA 2VNCA 4JL1A 2DSVA 2WHMA 2WBKA 3L4YA 1BTCA 3AIQA 1GHSA 3AZTA 3WUFA 3GXIA 3AMKA 1HX0A 4GI9A 1TZ7A 3NIYA 1HIZA 2QLYA 4CU7A 2GJXA 3VIPA 2J79A 2EJ1A 2WB5A 3AI0A 1OBAA 4PTWA 4Q7NA 3EMZA 1E15A 3SUTA 1JZ3A 4L4OA 2YOCA 1E5NA 1CXEA 3PZOA 3AZRA 4HZ6A 1HVXA 3QR3A 3N12A 4PMYA 4UQAA 2E4TA 5HXMA 4WKHA 4OOZA 4NF7A 1F4HA 1CECA 4RE4A 1KBKA 5C70A 2W67A 5E09A 3O2LA 3W6LA 3QHNA 4JFUA 3WKZA 4HMDA 2GK1B 1XH1A 4M56A 4NI3A 4D6EA 2W63A 1GQIA 1AVAA 1EQPA 3TTYA 3GNOA 3AHYA 3CHEA 4U5KA 4UQCA 1NWRA 1HKMA 2G3IA 1HKIA 2CBVA 2FDMA 2IUZA 1XCXA 3WQVA 1N82A 4WKAA 1J10A 1QW9A 1R85A 1JYNA 1B2YA 2XM2A 2C0HA 1MW2A 1ISYA 1B90A 2BV9A 1H49A 2XVGA 1G94A 5LA1A 3AS1A 3FHQA 4P7QA 4YN5A 5AY7A 4HU8A 4MDOA 2DPEA 4Z2GA 5HOSA 2WSPA 1PIGA 3AMLA 1K9TA 5HPCA 3BSHA 2O9TA 4FLOA 1WKYA 1R7AA 3WH5A 3LMYA 1BVNP 1E71M 1XD0A 4DWSC 1E6ZA 1PZ2A 2DT0A 5GPRA 4AZ6A 1V3HA 1QNPA 2W5FA 1UKPA 5CXPA 1UD6A 1JDAA 1LL6A 3W29A 2DSKA 2ZX6A 1OIFA 5AYIA 3WF2A 3VIFA 3VVGA 5BRPA 3VOCA 1ISXA 4IISA 2E9LA 3AIWA 3WEOA 2DSUA 3MMWA 3TA9A 1HJVA 2W4XA 1OIMA 1UD8A 3AIBA 5M03A 3UERA 2PBOA 3VIJA 1ZBCA 4TXEA 1W32A 3PTKA 4J7RA 1JZ6A 3ARWA 3VDCA 4QLJA 5GQBA 4FLRA 1E56A 2GJPA 1GONA 2XGIA 1JXJA 4FLQA 1BGAA 1QOXA 2WMKA 1V3IA 1HJSA 3A6OA 1KGWA 1UA7A 2QF8A 3MUIA 1SMAA 2ZICA 3K46A 1VF8A 4D6IA 4HPHA 2UY2A 4UFJA 3UG4A 2ZE0A 4JCMA 4Z2IA 4UQ9A 1UR8A 2TAAA 4W8AA 1B30A 1LJYA 2D1ZA 2XIIA 4BF7A 1FH7A 2VZOA 1M7XA 2RGLA 1ITCA 4JFSA 1X6LA 2DGAA 5BRQA 4LYPA 4EANA 4HOWA 4XZWA 3THCA 1MW3A 1RH9A 2W92A 3SCQA 4MB1A 5JUVA 4TVDA 2WMHA 1VBRA 3ZMRA 3RJYA 1C92A 1QNSA 3VDHA 3WDPP 5FOOA 1OWQA 1WZAA 3OLGA 4GXPA 2YIHA 1HL8A 5A6KA 4E8CA 3W37A 4CD5A 1RD6A 4B15A 3ARQA 3CIVA 3L4ZA 1P6WA 6CGTA 2EQDA 2OWCA 1E72M 1CYGA 1E0VA 3WL0A 3HU7A 1J18A 5FIPA 4PN2A 3W26A 5I0DA 2J62A 1V6XA 3GYCA 4ACZB 3AXHA 1JDDA 1CIUA 5ECUA 4AD0A 2ZXBA 5IFPA 2BVYA 1UR1A 4UOZA 1GQJA 1E73M 1EHNA 1R86A 3AHTA 4YPJA 4AZ7A 3N9KA 1VBUA 3NDZA 1JD9A 1CEOA 3WH7A 1UWQA 4Z2LA 4PBGA 3G6LA 4YHGA 4M8UA 1UH3A 2C8NA 1FA2A 1G5AA 3GDBA 5GNYA 4NRSA 4CD7A 4TVCA 1UWUA 3S2CA 1MQPA 4RE3A 3AS2A 4DUXA 2VVSA 4U2ZA 3ZT5A 4FLSA 3DYOA 2O9PA 2Y5EA 2DT3A 4E8DA 4GINA 4CN4A 2RGMA 5D9OA 1BVZA 1RP9A 4WJXA 4JL2A 1Q6GA 4LQ1A 1OGBA 1ISZA 3GNRA 2PC8A 3BAJA 3WUEA 1EOMA 1UKTA 2FH8A 1CPUA 1E4NA 3UESA 1E5JA 1QI3A 3GZAA 1ZBWA 4JHZA 4D72A 1UA3A 2JF7A 2V3EA 5CG0A 5BWFA 3WEMA 3LPOA 2QMJA 3FAXA 1DEDA 1ZU8A 4W7VA 1XGZA 2ZX9A 2O9OA 2ZIDA 4ACYA 5AYBA 3IAPA 2WXDM 5AC4A 3DC0A 4C7GA 1HXJA 2V3FA 3IJ7A 2DT2A 3AXXA 2WCSA 1X6NA 1TE1A 1JZ5A 1ZB5A 1UYQA 4U2YA 5EB8A 1QNQA 3AQUA 2ZX5A 3GH5A 5CSYA 2D22A 3O6AA 3W81A 1KR1A 1PX3A 1VFOA 4HOZA 4TX8A 3AYRA 4J27A 1W3LA 3VILA 3VMPA 2J8FA 2XJ7A 4PMXA 1UOKA 2BS9A 1M04A 3VNZA 1BYCA 2GJXB 2UY5A 1Q6FA 4J3SA 1K9DA 3IJ8A 4P7OA 3CMGA 5A8PA 3VX1A 2W91A 3HN3A 1CXHA 1PIFA 3A4AA 2XYLA 3W38A 3WMBA 2Y8KA 1V3KA 2W62A 1EOKA 1TCMA 1US3A 5I78A 3D3AA 3WBAA 1LL4A 8CGTA 3APGA 4HOXA 1HF6A 1DWHM 3CUFA 4YHEA 4CD4A 1BGGA 1VFMA 4U3CA 3WNKA 3D5HA 1MXDA 4V2XA 1GZJA 3T2PA 4W5UA 3FW6A 4WIWA 4CCDA 2WVVA 4F8XA 2WWDA 3CZJA 2ZWZA 4QDMA 3NSMA 4LYQA 3AYSA 3ARTA 3AMGA 1DWFM 1K6AA 2FHFA 5DMYA 2BY0A 1ZJBA 4MNKA 3M7SA 3ZT6A 4JHOA 1V6WA 4UCFA 2XFRA 4S3KA 3OZPA 4D6FA 2XVPA 5GNZA 1EH9A 1I1XA 2WLYA 1QVBA 3T2OA 3AICA 4FF5A 7A3HA 4MNLA 2WLZA 3WH9A 2WMGA 4PMUA 2CITA 1JI2A 1KCKA 3T2QA 1JFHA 2GJRA 2DT1A 1V6UA 2VCAA 2X8RA 2ZUVA 4AZHA 3ZR5A 2VUYA 1E4MM 3VGBA 5A3HA 4OZOA 4D71A 5I24A 5D9PA 4F9JA 4UFHA 2ZXQA 4OKDA 5I77A 1JNEA 1L8NA 3VIGA 4QLKA 1UD3A 1GORA 4XB3A 3I3DA 1NWSA 2YA2A 4GO8A 5DT7A 1HN1A 2XVLA 4TX6A 1QI4A 2DEPA 1NOUA 1J11A 1E43A 1US2A 5FD0A 1V3MA 1XV8A 4M81A 1W1TA 3W6MA 1Q4NX 3BCFA 2WC4A 3DYPA 3RDKA 1V3LA 3PZ9A 3VKKA 3CHCA 4PEEA 2CHOA 3TONA 4AD2A 4KWUA 3THDA 1XHGA 2CYGA 1W9XA 1BG4A 5BXPA 4AYSA 1OT1A 1WZLA 5E6YA 3F5KA 3RJXA 4GZEA 1HNYA 4MJ2A 2B31A 3WSUA 5HBFA 3CZKA 4ATWA 1QNOA 2WHKA 1XCWA 4H8VA 3PZUA 1W9VA 2V38A 2WK2A 1CGXA 4MB5A 2X1IA 1IZJA 3AROA 3NUKA 2VZTA 1R7OA 1EQCA 1ITXA 1FFRA 5D9MA 4IM4A 1KCLA 1UQZA 1QHZA 3JUGA 2JEPA 1V02A 1W1VA 3BMWA 1JNDA 3AMCA 2YA0A 3OGRA 1PBGA 4Z2KA 3UR7A 5DF0A 2VC9A 2WZEA 3CMJA 3LPPA 5A94A 1GOWA 5HPOA 1BPLB 2ZXAA 1CTNA 5CPQA 2G3NA 3SCUA 5BXRA 4W88A 1JL8A 5BYWA 4ZEPA 3OBAA 1NM9A 2XIBA 1E1FA 2ZX8A 5D8WA 5JIWA 4PMZA 3MU7A 3WMSA 2XTKA 1OGGA 3MV01 4W86A 2YL5A 1C8XA 5A2AA 1KWGA 1I1WA 1BG9A 1GOMA 4MDPA 2DQXA 3GXFA 2J7DA 4U33A 2J4GA 3T08A 5ABHA 2WBGA 3UG5A 2YDSA 4U5IA 2QPUA 3BGAA 1AQMA 2D3LA 1HVQA 1CENA 3PTMA 3UG3A 3RCNA 2XUCA 4E2OA 4HA4A 4X0VA 3K4DA 3PZGA 4JIEA 2WC7A 3SEPA 3WNMA 3MSGA 1E4LA 4AISA 4MB3A 1V08A 2VX5A 1OSEA 2XFFA 2BHUA 1GOQA 3KEHA 4BZYA 3G6MA 1D7FA 4PCSA 3WD2A 4P8XA 4P8WA 3VGHA 2HVMA 3NDYA 4P8UA 1IT0A 3QGVA 4Z2JA 3VGGA 2UY3A 4C7DA 2HISA 3AHZA 5A8MA 1DTUA 2VRQA 4ATDA 2PWGA 2XSBA 4QCEA 2C7FA 4V27A 3SCWA 1E0XA 1H41A 2DH2A 3VIMA
chains in the Genus database with same CATH superfamily
3HG5A 3ZLGA 1CT5A 4JTGA 2CLOA 4DWSA 4F66A 1BYBA 1O6IA 2NVCA 1TYGA 2WYSA 1J9YA 5CQ1A 4HVXA 4HNCA 4L6DA 4GK8A 1QUMA 4QITA 4HPGA 4XIAA 3W24A 3LGDA 4UMCA 1W2PA 3K8MA 5I79A 2O55A 5G2WA 3M46A 2H9AB 1R46A 4QG6A 4CVUA 3GU2A 4JEQA 4HB7A 4IJRA 4C6PA 1P5BA 3B4YA 2BOEX 4TVUA 1PPIA 3ABQA 4KH2A 4XZ9A 2A3AA 2IMRA 4Y96A 1Z48A 1TJPA 1TB3A 4NAFA 2AQWA 3MHUA 3C6CA 1TZZA 3N4AA 1R3RA 4HCLA 4JDYA 1ZRQA 3WK1A 4JY8A 3WEZA 1HGWA 3CO4A 3LEPA 1B3VA 4PFHA 3EX2A 2NV9A 2XIMA 4WSKA 4W85A 3QOKA 3AJXA 1WB0A 1TUXA 3ZVHA 3QN3A 3AWNA 1QDSA 1M7PA 4UFKA 1TPFA 4K1GA 1RY0A 3DHFA 2ZUWA 1UKOA 3W4RA 3LU2A 5CGMA 2BTMA 3MJMA 1PTDA 3KE0A 2CNCA 1O12A 4LPCA 5FA5A 1KBBA 5JIPA 4L4PA 3ZFHA 3ZYZA 1NOFA 3LCGA 2X1UA 2B4GA 3LMZA 2P0IA 5I6SA 4ZFMA 1IV8A 4Z2HA 5EMLA 3HGSA 5AVHA 4UTIA 3DXIA 5EFFA 3BLKA 3K13A 1H7PA 4O4WA 4PMRA 1RJQA 2V2CA 4DZ5A 1H5VA 2GDUA 3GXMA 1EDTA 2Z00A 5K4XA 1EA9C 4XSMA 1FVPA 2XVKA 2FFCA 1BXNA 1UR2A 3LZ3A 1U83A 2QGYA 3UYIA 1QO2A 5I2UA 5JBEA 2EPLX 1DWIM 5A5WA 1PE1A 1CXIA 4WQ6A 1BF2A 2O56A 5DEZA 1DJYA 2XVNA 3MI2A 4C6QA 1NWTA 3VKCA 3CUZA 3OPSA 2NSXA 4XBSA 1A5MC 4JQ2A 3SCOA 3B06A 3QQ1A 3OGSA 1C8VA 1H62A 2GSHA 1OF6A 2Q09A 4NZCA 3O6YX 3BLDA 4U3AA 4O12A 1JZ4A 3VYLA 3NQBA 3VABA 4LCRA 1RA5A 1MQRA 4DX3A 1L9WA 3AHXA 3FN9A 2NT0A 2GSEA 2CEQA 5FJPA 1L6YA 4POCA 3RLUA 2J78A 5I07A 2VDIA 2ZA2A 4NRRA 1JYWA 4DPQA 4LUSA 3RPDA 1V6YA 2DW6A 3LCHA 1EF3A 2P53A 3WQPA 3OA3A 3VGEA 3PWAA 2R14A 3VA8A 4F79A 3FFSA 4AIUA 5LHEA 1YDVA 1HKKA 3S6TA 2PMQA 3CC1A 1OADA 3NVDA 4A3RA 3WG6A 3N29A 2QCDB 3K1GA 5D9NA 1L0PA 3OODA 1LWHA 5JBDA 3GLCA 1NDVA 1H0GA 3BMVA 4NG3A 1YTKA 1X1ZA 1WAWA 4J3XA 2POZA 1C8YA 1CXFA 3H2MA 3KBJA 1WP6A 3JZUA 2YDAA 2PSNA 3MT1A 3G8EA 4NYYA 1G6CA 1GVRA 3I68A 3TMQA 4DWDA 2R9RA 1J0IA 4EVZA 4DF1A 5C2CA 3AIUA 3DFOA 1J2BA 4DUVA 4ICMA 3IJDA 3CEPA 3WL1A 3E0FA 4CN6A 2IXUA 1OFPA 5EBUA 3O1NA 1G0CA 3MI6A 4U28A 3W7MA 1H4PA 4BCEA 5M3WA 4NZJA 3UXDA 5K4ZA 2XG9A 1TWIA 1DOSA 1Q85A 5A2BA 4IP7A 1J0KA 4RPQA 2WSKA 3NJ3A 1TFVA 2PBGA 3MHFA 4D8AA 4AWSA 4XV0A 1JCLA 2FTYA 1DQWA 3NO1A 4W84A 4L4MA 5J5RA 2QDDA 4HNVA 3AU2A 1UP3A 4MSSA 3BG5A 3QJAA 5D8ZA 1Z9AA 4LY4A 3EWXA 2TMDA 3AFBA 3LHZA 3BG3A 3E5BA 5M2FX 1F2JA 2PGEA 4DWSD 2PLJA 3POHA 4L65A 1XLKA 2CLHA 1P0NA 2G5WA 3H4WA 1RHCA 2F38A 1Q63A 2BXVA 5DLCA 4Q8NA 3BUVA 3AUJA 1H7XA 2QCEA 4MFDA 1ISWA 4PCNA 2GOKA 3PZVA 1JQXA 3T4WA 1M5WA 1WAUA 4K2SA 1Y8BA 4GQQA 4E3VA 3VKDA 4G9PA 4AIEA 1EL3A 1HKWA 1V0MA 2A3EA 3NA8A 3PBMA 3VUSA 3G3MA 2OEJA 4GVIA 2HDJA 3RO8A 1AD1A 1TA3A 1OFEA 3BAYA 3EKZA 4WKFA 3HQNA 1HO4A 4MOZA 5IDIA 3I7RA 4DBSA 2W61A 3NOYA 2PWDA 3TTEA 4GIAA 3W25A 2OZTA 4O17A 3N2OA 1J12A 5HMEA 3JVAA 3MWCA 3TKFA 4XUYA 1FWHC 1ZJAA 4LB3A 1S2VA 4C7FA 1JQVA 5CZSA 2PZ0A 3E38A 1AZ2A 3A9BA 2BG5A 4Q4QA 3G8RA 1QPQA 1Q8JA 4Q4SA 2XIQA 4HNOA 4GVHA 1WZKA 2GDQA 5K9CA 1RJRA 3F4WA 4IMCA 5AC6A 2I57A 1XSIA 4O4VA 1KXQA 4ROPA 3OVPA 1OYCA 2NT1A 1MZRA 4M6UA 3T4CA 5CPSA 2Y8VA 1QASA 2PP3A 4RZ4A 5A6JA 4OV9A 1CWYA 1XLHA 1BFNA 7CGTA 4HNLA 2DV0A 4NZ4A 3GXNA 3H2OA 3QPEA 1KFWA 4AZIA 1X7IA 1MYRA 1R2SA 3II1A 1YPIA 4Q4OA 4W5ZA 1UG6A 2W66A 3LN3A 1TPVA 4UIOA 2A6LA 3SQSA 2DZAA 3W7HA 3Q4DA 2BFGA 4DO4A 3L5AA 2OQHA 4UMAA 2CBUA 4YCPA 5LA2A 1PSCA 4PTVA 4LVAA 1NOWA 4V15A 3P7YA 1DXIA 3B0PA 4AC7C 4K68A 5IOBA 2NXHA 1FP9A 1JUKA 4I7VA 3TOYA 1ME7A 1PEZA 3BE7A 1ODUA 3J7HA 2HROA 2QHAA 1CZ1A 2VOTA 1XX1A 3MSRA 5F1VA 3NPWA 2UY4A 1QCWA 3TYEA 3W2NA 1OEPA 2FZ9A 3LI0A 1HJWA 1XW8A 3MSYA 3WLPA 2V5DA 2DSZA 4B5UA 3SAZA 3M47A 2CKRA 3WMCA 2VEPA 4ZO7A 3GDRA 4TO8A 4AVFA 5G4HC 3GTHA 2YFNA 1DWGM 3BC9A 1F76A 3LCLA 3GG8A 1JZ8A 3HG2A 2XZ9A 1FX6A 2ACUA 2D20A 2WCGA 1VB9A 1ECEA 2QDGA 3M7WA 1YHTA 4LGXA 1OVDA 1S46A 1YYAA 3VTRA 3H24A 3UCCA 1BQCA 1Y5WA 1XYZA 2YLLA 3A5FA 2FB3A 4A8LA 1A4MA 1GJWA 2XU2A 3K5XA 2CXGA 3MB9A 3HGJA 2J47A 1OJXA 4FX7A 1FWDC 1X1NA 3A4WA 4I9TA 1I2QA 4A6GA 3ITGA 4Q8QA 4MGGA 3C56A 2DIEA 3QQ0A 1CGYA 4RXGA 3KZPA 1IXQA 4IPLA 2ISFA 4MJ4A 2ZFAA 1KXTA 3V7PA 5FSEC 2W6RA 3WQDA 3RU8X 1WXJA 3C4UA 1HW6A 1VIZA 1DJIA 3H2FA 5DMMA 4YMZA 1MDLA 3KTCA 4JIPA 1JPMA 1VBHA 3KDNA 5J5DA 1JRCA 3QBUA 3QLLA 1EJWC 3FVMA 1X98A 1QMLA 4BEUA 3GC5A 4D6CA 1ME9A 1LWIA 1EBGA 4HNNA 1V51A 3RYSA 3ZJ6A 4AZGA 4N6FA 4ADUA 1LL7A 5A6BA 1DVJA 1IR1A 2YPIA 4KEMA 2V2HA 3W75A 3HV9A 4IH3A 3W7RA 2AOSA 2B7OA 2PF0A 2VJXA 3M64A 3ZS4A 4DPPA 5AB3A 4IPNB 3LNPA 4Q6XA 3NR0A 3GH7A 1HP5A 3MMUA 3WD1A 3DFTA 3TA6A 2NZLA 5H8MA 4AF0B 4RV3A 4R3UA 2ICSA 3N11A 4C90A 1K70A 4S39A 5A6SA 1V5XA 1UD5A 5JMUA 1S3TC 1ZBKA 1FH9A 4CQ9A 1SFSA 1B1YA 1OX4B 3DZ1A 3TW9A 4MTVA 3N3MA 2VRJA 3H6OA 3WYZA 3HFYA 2DY3A 1SZRA 3RHGA 3OLDA 1AH4A 3S3GA 3KWXA 4L9YA 4HZMA 3LCXA 1SO3A 3WD0A 2O92A 2WWCA 1W37A 1DYSA 1OX5A 3Q58A 3TEVA 4H00A 2JGYA 4WSJA 1TJ0A 1NSJA 4A3QA 4DXVA 5CEWA 1TMLA 5CPOA 4KQNA 4FS9A 5FJOA 3UZZA 5BXSA 3UXLA 1OFAA 1K02A 2AMGA 5E0KA 1VC4A 1P48A 1UWRA 2Z24A 2QMKA 1DPMA 3IAQA 3GRIA 3GYEA 3K4AA 4CNPA 1E6XM 1PZ3A 3FOKA 1MFUA 1TMQA 3DHDA 3M0ZA 2QYGA 4IMAA 1KGUA 1RPXA 1A53A 1M3UA 2GK1A 5C9XA 4DM1A 5ABFB 1LWJA 1LG1A 1QTWA 5BCAA 1FWEC 4HU0A 1P7TB 4F2TA 2JE8A 1MSSA 3G1AA 4UZUA 3CXOA 1BKSA 4X2RA 1GYNA 3ABZA 4FP1A 3AJ7A 4OOUA 4PZVA 1V0KA 1EP1A 1XLCA 4AQLA 4N02A 4QROA 3NL2A 4Y9NA 3KVMA 4HPNA 3UYCA 1RD5A 2FPVA 3CPUA 1VHNA 1J0ZA 3USBA 3QSTA 1REQA 1UUQA 1YDOA 1K7XA 2OXNA 2X2GA 2DDXA 4HNUA 3KBMA 1QBAA 4H7VA 4M3PA 4LYRA 4WF7A 5CSSA 5I03A 2GPTA 1DJQA 2DVTA 2FMNA 2GUUA 3L2LA 2P76A 2YXGA 3IJLA 4BQ4A 2AQOA 3SO7A 2HXUA 1Q7QA 3VC6A 1XLEA 3VIKA 1R47A 3E0LA 1GYLA 1F7BA 3AIVA 1PVNA 3LK6A 4TTGA 1M9HA 4C91A 1YXYA 1UP0A 2GOUA 1PHWA 2AL2B 2AAAA 5A8NA 3VD4A 3DBPA 4NASA 7ODCA 2REQA 4AD3A 2EHHA 3N2CA 3GTXA 4Q33A 3BAKA 3CPRA 3KTSA 1TWZA 4RDZA 1NELA 1CGTA 4JY9A 4MHBA 1V0NA 3LM7A 2Q3RA 2YL6A 3WK3A 4NILA 4S3AA 3FIGA 1W3NA 4YWSA 3LM3A 5D2WA 2X16A 2EBNA 3TLQA 4R34A 1VIWA 1ZL1A 1XBVA 4B3KA 3DG6A 3ENLA 5AHEA 3O0KA 2GQ9A 1SZGA 1XBXA 5FJJA 1S39A 2G37A 1B9ZA 3N6QA 5A6MA 1G4EA 3GVGA 2Z1KA 2IXVA 3LRLA 1VKFA 4LNCA 3MWAA 1LBMA 3OB8A 3E0VA 4REQA 2ISVA 3RMEA 4H2CA 3SCRA 2DZSA 2WW5A 3WQ8A 1J79A 4N42A 2FHCA 1BHGA 4N0RA 3W3OA 1WE5A 3GR4A 1B3YA 3DG7A 4H9XA 4X9YA 1YE4A 1E6QM 1TWDA 3SCSA 1FQ0A 2CCRA 4WJEA 3M0JA 2G3JA 5K2ZA 4B3LA 5REQA 1CXKA 3ARRA 3CBWA 2YCEA 4FX6M 3ZLHA 1VPYA 4GI6A 5XIAA 1QI5A 4JN6A 1KFKA 3WQ4A 2GLKA 3NSNA 4IQEA 3NQ6A 4DEFA 4AY7A 2Q3OA 5A6BD 3B3DA 3C3UA 2VYOA 4J3WA 4AHOA 1MVYA 1RALA 2GVEA 4O57A 3USZA 2YL8A 3MSDA 3NVTA 2A7PA 3QMTA 2BHZA 4JFWA 1HG3A 2FB2A 4HCDA 4G7FA 3C2FA 1DV7A 4FIRA 3FYPA 3P8JA 1B4KA 4OT7A 1WV2A 2D0FA 5TD4A 2YKKA 2P8CA 3TROA 3O06A 4W9TA 5C0QA 1DHKA 1EC8A 3AZSA 3FXGA 1E9LA 8RUCA 3GG0A 1UR4A 4CCCA 3PY2A 3OIHA 1XIHA 3RLGA 4EK7A 2IS7A 3T0TA 2CZVA 4GUFA 3LENA 1L6GA 3QHOA 4Y7EA 1MEHA 4O1FA 2J8TA 4X2PA 2HSAA 1P0BA 3TR2A 9CGTA 4JL1A 2WHMA 3L4YA 4NY2A 1OQFA 4DJFC 3AZTA 5K7JA 3GXIA 4R7JA 3ITCA 4LAZA 3PAJA 1HX0A 1TZ7A 2F84A 1HIZA 4C6EA 4PUMA 4GZ7A 4XUGA 1MXSA 1GZGA 2R94A 2GJXA 2WJFA 1XQKA 4X9SA 3LGEA 4ZOCA 3SUTA 2OKOA 1E5NA 3N12A 1KKOA 2J24A 3ATZA 1DORA 2VR2A 4WKHA 4NF7A 3MUCA 4IJCA 5I3HA 3VNDA 1BWLA 1XLIA 1KBKA 4S3DA 2PDWA 2A1YA 2PEVA 5E09A 2Y0FA 3LCFA 2OELA 4R9XA 1Q4WA 3NGJA 1QR7A 2OQYA 3R11A 3TTYA 5AHFA 3IV3A 1KFEA 3W7NA 3WBWA 2G3IA 2IUZA 3IGXA 3WQVA 4WOZA 3H7UA 3NL6A 4UTWC 7XIMA 3OZYA 1R85A 3O8AA 1MW2A 1OZQA 2DW7A 4GFSA 4P7QA 3D0CA 1BKHA 4HU8A 4DNHA 4I9JA 4YTUA 4FO4A 4NJJA 3BSHA 3CHVA 4FLOA 1QNVA 3WH5A 2CZEA 2IKGA 1BD0A 1IT8A 1E71M 1XD0A 4BY3A 3AU6A 4EF9A 4NZFA 4AZ6A 4R85A 1AMKA 5FAGA 2OVLA 3B0YA 4EWJA 1E9ZB 3VVGA 3B40A 1LM1A 4AEOA 3M6YA 2YCJA 1YNYA 4EOUA 1ZUAX 3MMWA 3TA9A 5H2ZA 1DIDA 2Q8LA 3VIJA 1ZBCA 4L6HA 4PUNA 1W32A 4J7RA 1JZ6A 3VDCA 4QLJA 5GQBA 2W0UA 2PTDA 3WJXA 1IF2A 2DUZA 2B7PA 3M5VA 5AOUA 1VP5A 2V69A 1R38A 3TW7A 4V33A 1KGWA 1E51A 1RVKA 2UY2A 4UFJA 3H12A 3UG4A 2ZE0A 3KS6A 4GBDA 3S1XA 4XWUA 1LJYA 2C3ZA 1LUCB 3RU6A 1NDZA 2AGKA 1FH7A 3S5ZA 1ITCA 1X6LA 4G56A 3DFYA 4LYPA 1W5NA 4H19A 3TVAA 1MEIA 3O6DA 1VBRA 4FOUA 2VKZG 3ONBA 5FOOA 1QNSA 3WDPP 1K8YA 1XLBA 4JNYA 1XDLA 1XPYA 4GYJA 4QE5A 3P5ZA 3BJTA 3BARA 5A6KA 4UNLA 4E8CA 3W37A 1J5TA 4CD5A 1EJ7L 3L4ZA 1WOBA 1ZFJA 4HN4A 5LSMA 1SO6A 1IEXA 5KETA 5FIPA 4B4HA 3W26A 2J62A 3LRKA 4O13A 4DYKA 3ABSA 4MKNA 1GEHA 4EIVA 2C1GA 3GC2A 2WJZA 3B8VA 4QSFA 2JK2A 3T07A 1R86A 4ZSUA 2DFAA 4AX7A 3UXAA 5E9XA 2CWNA 3A3XA 4RCXA 1UH3A 2C8NA 1FA2A 2FZ8A 3GDBA 4OHQA 5GNYA 3REQB 4CD7A 4TVCA 3R5EA 2Y7EA 1EP3A 2ACQA 4QISA 3KVKA 3GS6A 5T9CE 2J9ZA 2O9PA 3LGGA 4HYRA 5HK4A 4GINA 4JHMA 2NUWA 2RGMA 5D9OA 1G69A 4UWMA 3PM6A 4ZQRA 5F1UA 1RP9A 1Q6GA 4PB4A 3B9OA 1ISZA 4D8LA 2PC8A 2F6XA 3H4XA 1EFZA 5EGRA 3BAJA 2HK0A 1A4LA 3VOGA 1NY1A 4BI6A 3UESA 1KTCA 4Q6JA 1ML1A 2BMBA 1RCXB 2V3EA 4LVGA 4O1BA 3N2MA 4M7TA 1GTEA 3FAXA 5CBJA 3TC3A 3S2MA 1DKWA 5AC4A 2HXTA 3OVQA 1JCNA 2PDJA 3AXXA 4KF1A 4LRSA 1TE1A 2FJUB 4KESA 3TUUA 2ZX5A 2D22A 4AIBA 1KR1A 4HOZA 4J27A 7PTDA 2PDUA 1O1ZA 4LV4A 2PS2A 2J8FA 5M1TA 2BS9A 1M04A 1BYCA 5E93A 5GJMA 3JZEA 1H7WA 4DF0A 2HE8A 1Q6FA 1S2UA 1RR2A 1VGAA 3IJ8A 1ITUA 3LV5A 5A8PA 3BDKA 2W3ZA 4RE0A 4NT0A 4XIMA 2P5NA 1PDYA 2E6FA 3TR9A 1F73A 3NZGA 1TCMA 1US3A 3LRMA 3D3AA 3WBAA 8CGTA 3APGA 1SFJA 1Q13A 1DWHM 1W54A 5I3IA 3QY6A 1EX5A 2NUXA 1KM0A 3QM3A 4CD4A 4GHRA 2PPGA 3HG3A 2V30A 4LFYA 3LQLA 3P0XA 4F3HA 5KZEA 4WIWA 2G0WA 2ON3A 1UPMB 3M9YA 3GTFA 4LYQA 3QMRA 4HPXA 3NGFA 1LOSA 3G24A 1X97A 3MI3A 4GNJA 1FKXA 4PR4A 3F2DA 3T6CA 4UCFA 3TWAA 4S3KA 3B8WA 3IK4A 3MY9A 1RZMA 2E6YA 2XVPA 1X8CA 3V18A 2YCLB 3BW3A 2WLYA 5F4SA 3LLDA 3T8QA 2YBVA 1F6PA 3KVJA 4CNNA 3W9ZA 3WH9A 5GVJA 4PB3A 1IXPA 1JFHA 1Q3NA 1QO5A 4H9UA 2ZZ7A 3MPGA 2VCAA 4AZHA 3ZR5A 2VUYA 4C6NA 2XGZA 4GQGA 3JS3A 5A3HA 2FKPA 4D71A 5D9PA 4RZ5A 4F9JA 4LOCA 4UFHA 2INEA 6TIMA 3GSMA 4ML9A 2ZXQA 3HQPA 3W7LA 4GCXA 4GGBA 1Z44A 4QLKA 1UD3A 4WJ8A 3I3DA 4PE8A 6REQA 3VFLA 3GUGA 1VJIA 3HG4A 2PDLA 4NP7A 2DEPA 3C3NA 1E43A 3R0KA 3N4FA 3BQ6A 2WC4A 3W74A 1BXBA 3DYPA 3QY7A 2HK1A 2Z6JA 5CPLA 3CHCA 1K77A 2CHOA 1JCJA 2NXGA 1KTBA 4AWUA 1XHGA 2CYGA 1NAL1 3KCLA 5IDZA 2ZDRA 2RUSA 2PD5A 1LBFA 1OT1A 1WZLA 2PDMA 5E6YA 1JDFA 3RJXA 3DENA 4XBKA 3F03K 3QTGA 2F2KA 4ZVJA 4WXZA 4MZYA 3EOOA 3P82A 5LIXX 3BSMA 2WK2A 3UVIA 1IZJA 4R7WA 3NUKA 3FJNA 1MNZA 4O50A 5LGXA 3DU0A 5HUOA 1F6KA 5D32A 4IM4A 1SZFA 1KC7A 5ECVA 4DJFA 2JEPA 4KCVA 3AMCA 2GYIA 2QUTA 3N4EA 3LBMA 3PS7A 3EKLA 4QR6A 3UW6A 3CMJA 2WZEA 3NL3A 1GOWA 2PDGA 1V93A 3SCUA 3PB2A 5BYWA 1PIIA 1NM9A 4JTKA 1VLWA 3VOFA 2ZTKA 5FSDC 4AFYA 3H7RA 5KSWA 2YL5A 1LCOA 5AHIA 4JN8A 5FESA 3LSBA 1BG9A 5HJXA 3GXFA 2ZADA 2J7DA 2J4GA 2WBGA 4XZMX 2ADAA 2YDSA 1XFCA 2QJMA 1FWFC 2DVXA 1HKVA 2RDTA 3UG3A 5HJLA 3P67A 1IEVA 4HA4A 1GGOA 3K4DA 1UZDA 1P43A 3SEPA 4AISA 4I6KA 1F3WA 2ACRA 1EUNA 3BJSA 4M6VA 1V08A 4GOAA 5EA9A 3QV7A 3TYBA 4DXXA 4PH6A 4UTWA 4H9ZA 3PWGA 3G6MA 2VDHA 3VGHA 3NDYA 2QUVA 4GYPC 3FGCA 4K1WA 3W1QA 4C6LA 4K37A 1EP2A 4OBTA 4AUBA 1W8SA 4IXXA 2D2GA 3BLFA 3P61A 3W1NA 5D09A 1BWVA 2F6KA 4LTSA 1HZYA 3QV9A 3OQ8A 1RBOB 1VPXA 1Z8AA 1UUOA 4IMEA 3U5YA 3PBUA 2BBFA 2G95A 3BAIA 4JXCA 2WKGA 3EMCA 1MUWA 3QOMA 3E0IA 5C55A 2XDFA 4OGZA 1CLVA 4UOQA 2PA6A 4GJJA 3LQGA 1XI3A 3WJZA 1PXGA 3CZLA 2XPKA 4V28A 4IIDA 3QFWA 3IIXA 4O16A 7REQA 3OQEA 4GYKA 3MKKA 3SUWA 5SWUA 4Q32A 3S9YA 4URIA 1I2RA 3VOJA 4JX6A 1J01A 4D2JA 1GT8A 2OWXA 1FXQA 4QRNA 2AL1A 3N9SA 3PWIA 1XIGA 4EPDC 3MUY1 4GD0A 4YYFA 5F2LA 4Y6GA 3R94A 1GWJA 3W53A 3A3WA 4WGXA 5LIYX 1EO7A 1J93A 1MQQA 3ZR4A 1R9YA 3L2IA 4GFIA 4I5UA 4KGJA 3WFAA 1XLAA 2QPSA 1GVYA 1TPB1 1ZCOA 3WF4A 1XQLA 2RHGA 2V63A 1YLVA 1FH8A 3RR1A 4H2HA 3DKJA 1NP2A 2PTZA 5IXEA 4J3UA 5BRBA 4H3DA 3EX3A 2DH3A 2UV8G 4HU3A 1RBLA 1VFFA 3U5UA 1EGMA 3N19B 2Y4SA 4GX8A 4PSRA 3F5JA 1E40A 3H2AA 1R5YA 4AXNA 4B9YA 1J8VA 2ANUA 5F4WA 1TV4A 4PFMA 4L5ZA 1FCVA 4A21A 1MXGA 3SIMA 2WJDA 3LBOA 1AW1A 2PTWA 4AHPA 1A0CA 2CKSA 3LX9A 1N7KA 2Y63A 4HBKA 4NJGA 1SW3A 1XKJA 3VX0A 4CQAA 3LV6A 5JXQA 2X30A 1G67A 3EDFA 1FWWA 1E4IA 1AQHA 3CNYA 1E6PA 2RAGA 2HTMA 3C5QA 3I3EA 5FL0A 3EPOA 1W9DM 3RCYA 2WMJA 3FDKA 2OFJA 1FUYA 4EX4A 5DBUA 2WVSA 5I5RA 1US0A 3V3WA 1W0MA 3S5SA 3NCOA 3SSZA 5AKQA 1IWAA 4X61A 3KP1A 1NWUA 2YDQA 1KV5A 3M6DA 4ZQPA 3PFMA 3IK2A 2DZUA 2BHYA 3WDQA 5TAOA 3QGKC 3RN6A 3VNIA 3CV7A 3KRUA 3VIIA 1TVPA 2WPBA 3VMNA 2PTYA 2BX7A 1FOBA 2VTFA 5JH1A 3T44A 1K9FA 3LD5A 2J7HA 1EBHA 4NJHA 4DUWA 3PVFA 1C8QA 4JZ5A 1TVNA 4JQAA 3ZO9A 4NIRA 2ZZ2A 2ZRVA 3TIMA 4YLWA 3QR0A 4PYSA 1PZ1A 3DHUA 5A69A 1WDRA 4PGLA 2VEMA 3DFSA 3HJEA 3EPNA 2FMOA 5DRIA 4WY0A 3KBVA 3L9CA 1XJBA 4PMQA 3ZM8A 1W1IE 3A3HA 2OZ0A 4S3CA 4IGHA 3T0AA 4R27A 3VK5A 3LHWA 5GNXA 1F4AA 3WNNA 3SRHA 4LANA 4DJDC 3AS3A 1JPHA 2Z2BA 3B8DA 3T81A 1JG9A 1TG7A 3IVSA 4JQ1A 2VGIA 2ZCGA 1VEPA 4NXKA 4ECLA 5EMKA 1PO9A 3EWZA 1OB0A 1WUFA 1EX1A 1R8LA 4H9VA 3GXPA 1RY8A 2X09A 1JPDX 4IWWA 1XUUA 3RAOA 1B3ZA 2PWEA 4HK7A 3VUPA 1KGXA 1W9BM 2OZ8A 1KRMA 3DBNA 3E02A 4PMDA 1A5LC 2P50A 5E6ZA 3LBCA 4E0CA 2PLCA 2GUYA 2RFGA 2PDBA 4FMVA 3TV8A 1UQYA 4I7WA 4F0RA 2PP1A 2VCBA 2Y7DA 1OK6A 3WD3A 5I3KA 3KL3A 1OFRA 1UP2A 2WKLA 3PUGA 4DJEC 3P3BA 1EJUC 5LIWX 3A12A 4QCFA 3PTDA 5EMMA 3SJNA 1MW1A 4QJ1A 2VT0A 3COTA 4J2PA 3I4KA 1OD0A 4A3YA 3B05A 5AN7A 4GABA 3GDMA 3U4FA 1SO4A 3ECQA 3OW1A 3GHTA 1RQHA 4PTDA 2Y85A 1A80A 2YYUA 3C2EA 4ZXLA 2A3BA 4RXFA 3RCMA 2WZHA 3DGBA 1UJPA 4MNJA 2OTDA 3BPWA 4K8HA 2FPYA 2VWTA 4E38A 4U31A 3APTA 2XN0A 2OWWA 1XLMA 1FCUA 1U22A 4LXFA 3OGVA 1TPEA 1WA3A 1EEXA 2IQDA 4GY1A 2WMIA 4R53A 2NX1A 1IEQA 1CXLA 4EPEC 5A2CA 3GG7A 5DO8A 4FK9A 1SZNA 1GOIA 3PG8A 4M51A 3KFTA 2F7FA 1LBLA 5HATA 1F6YA 4AHQA 3CAWA 3W1XA 4MKSA 4GO9A 4US5A 2C0AA 1EC9A 1GCYA 4CQ8A 3LSCA 3EOEA 3TJ4A 2GWGA 3TFXA 1X8FA 2EEXA 1Z89A 1VENA 2UBPC 2QEZA 3WQEA 4RNFA 3BV4A 1R9ZA 4HD5A 3T40A 3AIRA 1OT2A 2VCCA 5HMDA 2FLIA 3N73A 1XIBA 3LDVA 4RKAA 4CGTA 2VRKA 2VC7A 3JR2A 4CD8A 1K6WA 3GE7A 5CPTA 1ZJIA 3DEQA 1C9WA 1I9CB 4QM1A 1KBJA 3ISIX 4QTGA 3TJLA 4XAFA 1RQEA 3P8IA 3GU9A 3N18A 3HPAA 9XIAA 1TQJA 3IGHX 4Q7BA 3HMJG 4MWAE 3SQLA 4LALA 4I9AA 3RX3A 1HT6A 3TTQA 5CBBA 3CTLA 3KBSA 3GY1A 4B5VA 3TXVA 3IPWA 1I60A 3SY8A 3OA5A 3W7PA 2FFIA 1LP6A 4OBRA 3VOIA 1O68A 3A4XA 1UUMA 1JIBA 3T09A 5HWJA 2VQUA 1X39A 2ZUSA 3KDOA 5EBAA 3M1ZA 2ISDA 2V5CA 5AHLA 2I56A 1BXCA 2ZTJA 4C5YA 2VEGA 3F5LA 2PWFA 3WQ5A 3UVAA 2PRMA 4LB4A 1PZ0A 2NVAA 2VURA 1U5VA 4O0QA 3WUBA 5DY2A 3CZ8A 4XO7A 2CHRA 1TTPA 1U2YA 4QQ3A 3WF0A 3R79A 5IHSA 2X0HA 3L4WA 3MP5A 2EKCA 1LRNA 1S5MA 4AIOA 2GWNA 1Z41A 5FJUA 2EPKX 1LT8A 2FYMA 3Q45A 4GYPA 3GM8A 5IHRA 5HNNA 4A29A 4AWEA 2VGGA 1EJTC 1NTHA 1ZAIA 3T0BA 4IT1A 5CLTA 4CKQA 4LBRA 1ONXA 1YX1A 3F2BA 3CLMA 2P88A 2F6UA 3KW3A 1W3IA 1MZHA 3EDKA 3WQWA 4MAZA 4IMFA 3KL5A 2X0SA 1EPVA 4S1FA 1EZ2A 2VI0A 2WQDA 3W1LA 4MWAC 1CLXA 1IHIA 1CI1A 1H2JA 4L80A 1O4UA 1KD0A 3WCZA 2VVNA 2YL9A 2R1NA 3ANVA 4EE9A 3G77A 5LYRA 4E4UA 1FRBA 2VGBA 4TOQA 3WZ0E 1S2TA 4M19A 3QPYA 4LF1A 3LY0A 2QJHA 5HA7A 4JTCA 4F9DA 4M82A 3M0MA 4J35A 4PTMA 4WSHA 4B5XA 1ZSXA 4FNPA 3G2GA 1G01A 1Q66A 3RM9A 1ELSA 3F4CA 3LPGA 1SO5A 3QKEA 2DJLA 1MNSA 3IACA 1O60A 1RK5A 4O54A 4P8VA 4BI5A 4KS0A 3AAMA 1JDCA 3BVJA 1BYDA 3F1QA 2HZGA 3LCIA 2QIWA 1TV7A 2UWFA 4C1KA 2AAMA 3SURA 4QNEA 5K9DA 1AQ0A 2JFEX 1IQ8A 1F61A 4DYEA 4UTTA 5JU6A 5CBIA 1GPFA 1W5MA 3NM3A 4F4RA 3RO6A 4ZTXA 4F0MA 1VD6A 1ENUA 1XKYA 1Y65A 2F2HA 2J9YA 2Z1VA 1SQ7A 4H01A 1IZKA 3I6TA 3DAQA 1N8IA 5T9BG 4ATLA 4W7UA 3QFEA 3PHAA 4N9EA 2QCLA 2D73A 1W56A 3NSXA 5C7HA 1SJCA 1SGJA 3B8UA 5H1WA 5DCDA 4F0HA 1H5YA 3WNOA 1W3HA 3FLUA 5LGZA 2O9RA 2BXYA 2ZQ0A 3QHMA 1PYMA 4FNTA 1H09A 3W6YA 2PGFA 4HSHA 4PMNA 3TTOA 1KB3A 1O5XA 4B9ZA 3VFCA 1TPDA 1E6NA 2GGIA 3V0UA 4FXRA 2J13A 1AD4A 1OM0A 3U8GA 4Z08A 2HEJA 1OC6A 4OQVA 1HJXA 3HPXA 1A5BA 1FHDA 3PSWA 1MEWA 5MF5A 5FKYA 3S1UA 5B7ZA 1EDQA 1M7JA 3W7DA 3OG3A 1B4EA 3XIMA 1XLJA 3QSRA 5EU9A 5D33A 3W2UA 5DCEA 3NZQA 3ITOA 3URQA 4RZ6A 1H63A 3TYUA 1W5PA 3WIJA 3GWQA 1MDRA 3ZT7A 3TFCA 4DLMA 5KITA 4HT3A 3RM4A 3POCA 1R87A 3L4XA 4A2SA 4B5NA 2VP8A 4GMEA 2NX3A 3M0YA 3OEXA 1KR0A 1OD8A 1ODZA 3SZ8A 2OMAA 4FNRA 1RQBA 2CPUA 4NQ1A 2A4AA 3BANA 3HA1A 1XRVA 4DZHA 1SUXA 5FCZA 2DVUA 1BYAA 3B9EA 1YIXA 1UBSA 4NVTA 3VKAA 2GZXA 3G1XA 4JAWA 3UWVA 4DO7A 2FVLA 1KTNA 1HJQA 1W1YA 1SW7A 2ZBTA 5B80A 5LNUA 3TYDA 2PP0A 2WOQA 2HBVA 1UWSA 4MAVA 5LXEA 4L6OA 1FP8A 2QGHA 1JGMA 3QH2A 4DJDA 2KAUC 2CESA 4DI8A 1I8JA 4N2YA 2D0HA 2V68A 2QQ6A 3UQNA 5CJ5A 3PZTA 4MB4A 1JAEA 2EF9A 1QW8A 1RK6A 2E9BA 2Q02A 3TX9A 3AMDA 1VZWA 4H7CA 3TH6A 2X7VA 4L61A 6TAAA 5JBFA 1B9BA 4RDVA 3MP3A 6ALDA 1DL3A 3B9DA 2J7FA 3R2GA 3EX6A 1WXZA 2E67A 2H8XA 5BOOA 2WVUA 5J04A 3NQAA 3VOHA 4DJEA 3LI1A 1UD2A 5FEZA 3V0TA 3U57A 4JTRA 1JZ7A 4TQTA 5CCZA 2PU1A 1R3TA 2OYMA 2POTA 1ADDA 5HUPA 1KLYA 3STCA 1YKWA 1AMYA 4JTLA 3PJUA 1IR2A 3MKVA 4XD5A 2YZ5A 4ASTA 2E77A 1ISVA 3K1DA 1EJVC 4MWAB 1X6UA 1OYBA 2J8GA 3SQMA 5I09A 3PPCA 2G50A 1Q6LA 3ONCA 3ITTA 3PN8A 1QHPA 1U1UA 2DU2A 1S2AA 1WX0A 1V0LA 1M41A 2ZC8A 4LAUA 2OSXA 4KIRA 4QDWA 3GQYA 1C7TA 3BWWA 3DDMA 2WAGA 4LAMA 1UW9A 3MJYA 3B8TA 4XKYA 1SYTA 2XH7A 4JYFA 3TNBA 1UWIA 1IZCA 3WDHA 3RXZA 4GZIA 5HQMA 1DWAM 3WFZA 1V02E 2BOGX 3GR8A 5KZ6A 4PUUA 3ZWTA 2Y62A 5MKGA 4HIBA 3CUIA 1ZS2A 4ZOBA 3MBFA 4Z1DA 1O7AA 4DO6A 3L2MA 3VINA 5LKYA 1EGVA 3KS5A 5G2IA 2VOMA 3U48A 4OJYA 1D3CA 4ACZA 4N6EA 5LIKX 4O8RA 1T99A 5DFAA 2VM8A 1GZ1A 2QAPA 4J40A 2A6NA 2IPJA 3VZXA 1J0JA 3CUXA 2HRWA 4IGSA 2Y61A 5TBOA 3T42A 2E8YA 3SI9A 3UT0A 3TN4A 5BZAA 1D3HA 3FYOA 2ABAA 2HPMA 3IJ9A 4FSAA 3HBLA 1Q7ZA 3CUGA 1AL7A 3SCNA 1H0IA 3UG8A 1JGIA 1QPOA 2E25A 1TJ1A 1AG1O 4ZQCA 4B2DD 1KV8A 5IBXC 2I9UA 3I10A 4OTKA 1U5HA 3QW3A 2YDRA 4PB5A 4EAYA 2FGLA 3I65A 3ZJ8A 3E0WA 4IG2A 4LWWA 3NZRA 4JX5A 4GG9A 3VGFA 3MKCA 3W86A 2H3BA 4D6GA 2Z6IA 2VR5A 4D8ZA 3DG3A 4RDWA 4KFPA 1OG6A 2QXWA 5T91A 2GJNA 4YU1A 3U7VA 2INZA 1MUCA 2XH4A 1GOXA 4BS0A 5FACA 1W91A 2VUNA 3A9IA 3N9RA 1B3WA 3NZ1A 2OLHA 3GHUA 4AZCB 4PTXA 1W3KA 3NDOA 2FQIA 5CSRA 2WBKA 4LC6A 4ADTA 1BTCA 3AIQA 1GHSA 4GXWA 1TWSA 1YPFA 3AMKA 3BLOA 3E12A 4NHVA 1BQGA 1E1CB 3GXTA 2QLYA 2ZDSA 3DX5A 4CU7A 2C6QA 5AHMA 1L6WA 1G7VA 3AI0A 1E9YB 2P3ZA 1OBAA 3CQ0A 4PTWA 4AB4A 3EMZA 1W5QA 4L4OA 1XFBA 4IFKB 1CXEA 3AZRA 4HZ6A 2EPHA 4PMYA 4O1AA 4UQAA 2V5BA 5DELA 4O0KA 1QAPA 3VZYA 2HMCA 4Q8MA 4LC8A 1KM3A 3C2VA 3NWRA 3O2LA 3QHNA 4JFUA 1M65A 3PJXA 4M56A 4NI3A 4D6EA 6XIMA 1GQIA 4MWAA 1AVAA 1EQPA 5KZDA 3AHYA 3CHEA 1ALDA 4DBWA 2FGBA 1FY6A 4DJDD 4UQCA 4G2DA 3ITXA 4F2BA 2GGJA 4XAPA 4C1NB 4HTBA 4AH7A 4WKAA 1QW9A 4Q8TA 1T8XA 1JYNA 3SRFA 1B2YA 2XM2A 1PKMA 4IL2A 2J6VA 4IX2A 1ISYA 1H49A 2V67A 5LA1A 4GI4A 4L1GA 1J4EA 3H23A 4YN5A 3KVLA 3QZEA 5AY7A 4ES4A 2DPEA 1RBAA 1HO1A 4Z2GA 3GVWA 7ENLA 3AMLA 1EJSC 3W1TA 1AODA 3ATYA 4LV9A 3DN5A 3VCRA 3UZYA 1A5CA 4KCTA 3V5FA 1BVNP 1K4GA 4JYEA 4YJ5A 3BOXA 3W7IA 1PL9A 4LUIA 3RG6A 2W5FA 1UKPA 4DJED 1LL6A 3W29A 1KO0A 1W5OA 3LZ5A 1ISXA 4NX5A 4PMJA 4IISA 3AIWA 4R7OA 3IIZA 2TODA 4X63A 3SN4A 1DIEA 2ISWA 1TKKA 1UD8A 3AIBA 5M03A 4TXEA 3NURA 4Z1YA 1JULA 1F8IA 2XH0A 2VWSA 1F3EA 1E56A 4O1CA 2GJPA 3C2RA 1GONA 3QLDA 2R1PA 2PWVA 5I3FA 3NG3A 3H55A 2J27A 4BR1A 3TAOA 3UZJA 4H4IA 1BGAA 2WMKA 2PU0A 5D38A 1V3IA 1VBGA 4S3BA 4NAEB 4HPHA 1VF8A 4D6IA 4J5NA 4Y8FA 2PDCA 4PBEA 4UQ9A 1QOPA 2TAAA 2JKAA 2DQWA 4W8AA 3XISA 1DJZA 3GC4A 4Q8UA 3EWBX 1BRLA 2D1ZA 1XYMA 2VZOA 2RJHA 1SJBA 1OY0A 2DGAA 3IS4A 5BRQA 4EANA 3W76A 4HOWA 4DF2A 1LT7A 4HKPA 4MB1A 2DZWA 5JUVA 3VZZA 2Q8ZA 4AMAA 4CNSA 4P61A 1C92A 3VDHA 1UIPA 1WZAA 3OLGA 2PDXA 1RXOB 1I2OA 1HL8A 3PBWA 1XICA 3ARQA 3CIVA 4WUIA 3WLTA 1JR1A 2VFFA 4BJHA 3VI2A 1PS9A 2PDNA 1TTQA 1CYGA 4JTHA 3AXHA 4NNAA 1CIUA 1FDZA 4IFRA 5AYYA 1QW7A 1W1ZA 1UR1A 2TRSA 1GQJA 1PYFA 4JTTA 4YPJA 1OFDA 3LTYA 1TPC1 3N9KA 4TMBA 3S46A 1JD9A 3WH7A 1UWQA 4Z2LA 3G6LA 4YHGA 4M8UA 4NRSA 1M6JA 3G1VA 4RE3A 4DUXA 4U2ZA 3ZT5A 3PSVA 1N2VA 4S3EA 1E0UA 1GK8A 1ZHAA 4G7EB 2Y5EA 5HMSA 2FZMA 4MJZA 1XUZA 2J6XA 1KBLA 3NTYA 4DBUA 3OO2A 1OGBA 4GC3A 3IJIA 5TQLA 1KCZA 4JOMA 3WUEA 4Y9MA 1E4NA 1L6FA 3GZAA 4D72A 3ZVIA 4ENLA 5BWFA 3T8LA 3LPOA 3BURA 4DVOA 2C14A 5BOEA 1XRSA 2ZX9A 2O9OA 3NQCA 4L9ZA 3R13A 3HV8A 5AYBA 3DC0A 4Z0SA 4C7GA 4NUWA 2DT2A 4IPPA 4A8RA 1ZB5A 2R8WA 5EB8A 4E3TA 3GH5A 4K36A 1PX3A 1D7KA 3AYRA 3R6IA 3VILA 2H9AA 3VNZA 1VLIA 1PWMA 2XIJA 3MVIA 3WBXA 3W7KA 3CQIA 2EG6A 2UY5A 2O7QA 1ZP4A 4J3SA 2Z25A 4KRZA 2W91A 4ZA0A 2DIKA 3TC7A 1IWBA 2XYLA 3W38A 4WVXA 3TZFA 3WMBA 2DP3A 2VD8A 3HPFA 2W62A 1XRFA 1Y5VA 3BO9A 3CV1A 4CEXC 4MY8A 4IP5A 1L6SA 4HOXA 1I0DA 3R58A 3CUFA 3TSBA 3EB2A 3N6HA 3WBYA 2Z1WA 5CC7A 4OWGA 4FA3A 1XBZA 4NAEA 3CAKA 3UA3A 3FW6A 3W84A 3CZJA 3G18A 2ZWZA 3NSMA 4ZO6A 3W71A 1DJNA 3ARTA 3F4DA 3G1HA 4AAJA 1ZJBA 4F2UA 3RPTA 4B5SA 1V6WA 1TV2A 4ZQMA 3OZPA 1Y5XA 4J3ZA 1I1XA 4Q4PA 4NZ1A 1QVBA 3AICA 4FF5A 5D37A 7A3HA 2FPTA 4MNLA 3NPUA 2WMGA 3FJLA 2PURA 1XIIA 3NQ2A 3CIWA 5G4EA 1R9XA 1BVWA 1IXOA 2X8RA 2ZUVA 3KOZA 3VGBA 3S2NA 2HVNA 5I24A 1NF7A 2CZFA 3T0CA 4EPKA 1NWSA 2QJNA 2YA2A 3GG1A 2G3FA 6ENLA 2V0TA 4JDBA 5IBXA 3QV8A 1J11A 2OODA 9RUBA 4M81A 5C9WA 3H2NA 2FZNA 3UXKA 1SSGA 3S1GA 3E74A 4ZTYA 4PEEA 1O5QA 4CNTA 3R25A 4QDPA 4IIFA 2NLYA 4C1LA 4S3GA 2OG9A 4JEJA 4AYSA 3F5KA 3LXAA 4Q4MA 2XN1A 4ATWA 1EUAA 2O0TA 5U7SA 2BASA 3DFNA 1XCWA 3OJGA 3GVVA 2V38A 1CGXA 5HANA 3WLQA 3IARA 3CASA 1CCWB 3WLJA 1ITXA 2XISA 3ZLFA 4EXAA 5D9MA 2X1RA 1V79A 4ERIA 4ALDA 4I8YA 2ZZ5A 3WJWA 1V02A 2QJIA 5LNRA 4B4FA 3UFYA 1PBGA 3UR7A 1YW1A 5LIUX 2QCDA 1EWDA 4XISA 1M7OA 1I45A 5BXRA 1OHLA 3E2RA 5BMWA 4N9CA 3UF9A 3VE9A 1T6MA 3S47A 1YXCA 1WXYA 1UR3M 1OGGA 4IQLA 5DQPA 1TREA 3BTNA 1C8XA 3KLKA 5A2AA 3CAVA 5FJTA 1JDEA 2F9RA 4FHAA 2I7GA 5ABHA 4HPJA 1A0EA 2P0OA 3EZ4A 3AYVA 2P3EA 1HVQA 3IIVA 3RCNA 3IIPA 3W1UA 3S2JA 3PZGA 2WC7A 3MSGA 1E4LA 4I90A 4MB3A 4Z1AA 4FI4A 2TYSA 1DXFA 2VX5A 5G1TA 2BHUA 4XKMA 1GOQA 3KEHA 3MBDA 1NJJA 3WD2A 4P8WA 2HVMA 3O05A 1IT0A 3QGVA 2I17A 3PAOA 2UY3A 2GJLA 5AC8A 3OBEA 1FWAC 4GACA 1IIHA 4KBXA 5A8MA 1DTUA 5DX7A 1UMYA 2VRQA 4ATDA 4QCEA 1W31A 1R30A 2C7FA 4WY0F 4V27A 2OB3A 1E0XA 1H41A 2DH2A 4XBJA 1EWEA 1WPCA 4A3HA 1Z69A 3BICA 3OP2A 6XIAA 2XGBA 5JQ9A 1TO3A 4LUTB 4HZ8A 1XLLA 3C52A 3LCWA 3DHPA 4MY9A 1N55A 1ONEA 2Z1XA 2YGYA 1UMLA 1TTIA 4D9PA 3E3HA 2E9MA 3K2GA 1P6BA 2RKXA 1WUEA 4GKLA 1WO2A 1C91A 1R3YA 4KRUA 4WHBA 4YVPA 1UD4A 3D3FA 3FKKA 4MLJA 4ZB2A 3M43A 4LY8A 4N9BA 5FF4A 3GKAA 2NVDA 4IPJA 3W1PA 4ZGYA 1ME8A 2R24A 2PDHA 3ID7A 4UFLA 2OX4A 3CH0A 3ZIZA 3B0UX 3FYYA 3N13A 3QC3A 3QF0A 2WCAA 3QZ6A 4PCTA 2GVJA 1XRTA 2BODX 1KFCA 4BKNA 3UNTA 4W8BA 4LSBA 4AD4A 2VFHA 1JCTA 1V7AA 4GRSA 2PE4A 2QS8A 3MQTA 2JGQA 5E9AA 1S1RA 4AZBA 4E5TA 3UJSA 3QVQA 2WVVB 3IVUA 3EMQA 2E7FA 3B8IA 4YTRA 4XAZA 3WFLA 4JFVA 4H83A 2MNRA 4GLEA 1CB7B 4RUBA 4V1XA 4L64A 1E55A 3GO2A 1FWBC 1T0OA 4KCUA 3KZSA 2QJJA 4PULA 5CJNA 4AY8A 3B04A 3M5XA 3AISA 4W89A 2EJAA 1CX9A 1YBQB 1UCWA 1NFGA 3L5LA 4LBSA 3W2LA 3R10A 3B9NA 3KOFA 3CEUA 2Y7GA 1CDGA 4HJFA 3SFKA 4GH3A 4FX8A 2OT0A 1OYAA 1YMYA 3NFUA 4M6PA 5FI8A 1Q6CA 4WR3A 2QIIA 5CAHA 3ZSTA 1MWOA 3HURA 2VELA 5BU6A 1H61A 1IGWA 2JALA 2G4FA 3H4GA 3WN6A 2R91A 1VFUA 1BSIA 1GNXA 1UZ1A 3NQMA 1SPQA 1R0MA 4PBFA 2EO7A 2CBIA 5A95A 1A5KC 3N1AA 2BVTA 2WANA 1S2CA 5E5CA 3FNDA 3WX7A 4C6JA 1IEWA 3RF9A 1QFEA 2C15A 2D23A 3OG2A 4R5EA 3TDFA 3WH8A 3ABXA 4FOKA 3Q2DA 2FHBA 3EOUA 1FWNA 3YPIA 1WKEA 2I5IA 4AD1A 1X96A 1TTJA 3G1RA 3HB9A 5TF0A 5C54A 1H1NA 3W00A 4KRTA 5DXYA 1H51A 1XLFA 3BZGA 1FHLA 1ZBVA 1YADA 1Q5MA 3WLLA 2VZUA 2SFPA 3K8LA 4X0NA 1R3SA 3GTNA 1NIUA 3OLIA 3ARYA 3AS0A 4K7YA 5K3VA 3B97A 2ZZ4A 1KBIA 2WVTA 4WZHA 4GPNA 3BLEA 2IQTA 2ZUNA 3ZOAA 2HBXA 1AJZA 1H7NA 1V6VA 3BOFA 4O10A 2XWEA 3UPBA 1A5SA 2X40A 4JICA 4QEEA 5D4YA 4NL1A 1GKQA 4NNCA 1TX0A 2CBJA 4UZSA 4PUJA 1QK0A 3UU0A 3GDLA 4E2VA 3QYQA 3MCOA 1Q6QA 1FDJA 1TPWA 3U2ZA 3LERA 4XQ6A 3MYPA 1OFQA 4MNMA 4ZXOA 4RL3A 1XYCA 3MTWA 3SCTA 3GW0A 1VCVA 5F2MA 2OSWA 2Y89A 4M0XA 2YR1A 4FB7A 4MIMA 1PAMA 1JAKA 3PC0A 2J77A 5C9RA 4PSPA 1PKYA 3EOLA 3WJYA 4GQBA 1TSIA 4IF2A 1LG2A 2CLKA 2E5CA 3BG9A 2J75A 4KMQA 5AZ1A 3W28A 1DQUA 5AZ0A 4XVEA 2J7EA 3ARVA 3WK2A 1UC5A 4XTIA 4AWTA 1UKSA 2FTWA 2WZIA 3FXYA 3RRXA 1O95A 1XIDA 1XDJA 3GTIA 1UB3A 1YQ2A 4S3JA 3TQ0A 2WKJA 4J1OA 4Y9AA 2VHLA 2JIWA 4S2BA 3F2CA 4PTNA 3SUVA 3QGAC 4TR9A 4AF0A 3STFA 3L4UA 1XGEA 3MO4A 2ONEA 3PANA 1BSLA 1UC4A 3P84A 5E0CA 1GHRA 1U33A 4H9MA 5D2TA 4DWSB 4U4MA 4BEQA 3VDAA 4JCLA 1OX4A 2WNWA 6PTDA 4KGLA 1Q2SA 5U4NA 4QXIA 3EWCA 1PKNA 2YA1A 2QNEA 4GCAA 2AMXA 5A8OA 1IIGA 4R33A 3VD5A 4W4QA 5BMXA 3ZZ1A 3WMLA 4NI8A 4MUZA 1UR0A 2X41A 3BLIA 5CZKA 4HQVA 2BVDA 3B8SA 2WO5A 3SB0A 3HMCA 2I14A 1SR9A 4GUGA 4DI9A 1XF0A 3R8RA 4Q22A 5I02A 3LLXA 3RM8A 4NAFB 3WNLA 1ZP3A 3GD6A 1E3XA 4JBRA 2NSOA 2JIEA 4GNKB 1NQ6A 3TK7A 3GBDA 1X38A 1W2VA 3SFWA 3WF1A 1C3FA 1B5TA 3FHAA 1JYVA 3R8HA 3KRZA 1VFSA 3G22A 2NV2A 1JUBA 2WV8A 3ZVHB 4X22A 3H22A 1M68A 3CT2A 4LVFA 3BAWA 2XN2A 2RJGA 2YB4A 3BV7A 2BVWA 4UCGA 1QJWA 1A5OC 1R3WA 1AW5A 5ABFA 3CZGA 4NU7A 2AKMA 3P80A 1SFTA 1KM5A 4OBSA 1LLWA 4IIBA 1P7TA 1EYEA 1KM1A 3MUAA 1T40A 4XD3A 1MMFA 1C7SA 3GZ3A 2PDPA 3GX9A 1GOKA 3VIOA 1RP8A 1AL8A 2Z27A 1W17A 3B4UA 1TIWA 4NX0A 1O66A 5LNWA 3EDDA 4FR1A 3STGA 2VQTA 2QCHA 4H6KA 1E0TA 4J28A 1XH0A 4JKLA 4UQEA 1CBGA 1KRAC 1KFJA 4IFOA 4PUEA 1F5ZA 4GJIA 3L21A 1Q6OA 2EG7A 4CCEA 1FCQA 3GIPA 2Z28A 4JR5A 4C6DA 3FA3A 2V5KA 3E49A 1ECQA 1FWTA 1WZMA 5CPNA 3OVGA 5CG7A 4O1DA 2WMFA 3VM7A 3UCQA 4M29A 2YSWA 3K8KA 3KX6A 3ITLA 4HK6A 4ML4A 4FR6A 2C71A 1EHAA 4XAYA 2AL2A 2FH6A 3HM7A 3THUA 4AC1X 1QHOA 2Y2WA 4RLIA 1F05A 2NV1A 3OYZA 4BQ2A 4HJWA 3QC0A 4AEFA 1TRDA 4JIIX 4LX4A 3VNYA 3Q94A 1ZENA 4LUSB 5BXTA 2ACSA 1O5RA 3N04A 1RCQA 2PB1A 3M0XA 1FCBA 1VJSA 3N15A 2VFIA 4QLLA 2G97A 1ZY9A 1I0BA 1NF0A 4AVNA 2VC6A 2X0YA 5C9UA 1UR9A 2Q01A 3GHSA 3CO8A 2MUCA 5DT5A 4JTDA 2D2JA 2A21A 3IUHA 1VEMA 2QDHA 1I2PA 2CERA 3LPFA 4WLCA 4FPSA 2Z7KA 1SSDA 4GBUA 4M24A 1VYSX 2ATMA 4JFTA 3OTRA 3CQHA 1ZLPA 2Y5JA 1FHVA 3ARUA 4RPPA 3KCJA 1E0WA 1UKQA 3DESA 1PX4A 3FV9A 5FAJA 3RLHA 3FAWA 2IKJA 1V03A 1B3OA 4O52A 3GNXA 4CVWA 4QAWA 2GGGA 4JQ4A 2XH2A 4IJBA 2Z2AA 1I6NA 3ITVA 2EPNA 4JX4A 1SMDA 3NYDA 4HMEA 2QZRA 3GW3A 3ARZA 4PRWA 4DUOA 5DCBA 1B3XA 3ALFA 4XTDA 2ZX7A 1I4NA 4PMOA 3LA4A 3ERPA 4QQUA 3GH4A 4DHGA 2CLFA 2CLLA 2XSXA 2Z4GA 3L0GA 2OPJA 1EF2A 1GPWA 2JKPA 2X05A 1UH2A 1ZZMA 2Q8XA 1XISA 1TPH1 2CWXA 4PRTA 1MI3A 2ZRZA 3VGDA 1QOQA 5EL1A 4AX6A 1GQLA 4IX0A 1W6TA 2FGZA 1OCJA 4L1XA 3STEA 4JPGA 3P81A 1AA1B 3WNPA 3VDGA 1KNWA 3V5OA 5IM51 2G3MA 2E0PA 3ABOA 3BL3A 3URNA 1YE6A 1FKWA 4JD4A 3P60A 3UXIA 1XIJA 3ZR6A 4W8LA 4B5WA 1P6CA 3CHDA 3WQ6A 4ZL1A 2E68A 1X1OA 3EX4A 4M80A 3ES7A 3GAKA 2PAJA 4K39A 1TA3B 3U7BA 4B92A 2Z26A 3DFPA 3LTPA 2EPMX 3GU1A 3GFYA 2Y70A 1CGVA 1EKOA 1XG3A 3WLNA 2CZDA 4M5PA 1E3ZA 3H53A 3R4IA 4EF8A 2P10A 3RPMA 3UR8A 4HA1A 4UNKA 5EMYA 2ZRWA 3L4TA 4J2MA 1G1YA 3CZEA 2BOFX 3NAVA 3PPHA 1WDPA 2ATSA 2ZZ6A 3GXDA 2PI6A 1W1A1 3LS9A 1XSJA 3EB3A 1TR1A 1FWCC 3EDJA 4O1EA 5I23A 4K6AA 1E6RA 1BLIA 3M0VA 3STPA 4AY1A 4E4PA 1FTXA 4KIEA 1D2KA 1VR6A 3R8GA 3VCCA 4JIQA 1UJQA 4M1RA 3FVDA 4HA0A 3CV2A 3SJ3A 4QS6A 3HGRA 3VM5A 4LRTA 3PJTA 4P7NA 4WDWA 1CNVA 3L7RA 3LLFA 1KXHA 3DYMA 1Q2RA 4QNWA 3I3BA 5KEZA 3KBNA 1MW0A 3FA5A 4NSBA 4HNTA 3WENA 1D8CA 4GE8A 1J0HA 4NYUA 2EXOA 4ZQOA 3F4VA 1OK4A 2OT1A 1EXPA 1M01A 4LYKA 4LCSA 4PUDA 5A1AA 4IUOA 3GBEA 4N7QA 1HP4A 1WDWA 2WSRA 4JIRA 1FWGC 5G1YA 3V36A 3M0IA 2R1LA 1IYXA 3GR7A 4UXDA 1OC7A 1R2RA 3W02A 1KQYA 4CCZA 3EBVA 3ES8A 2FDSA 5C7VA 4MF4A 2VFEA 2BWGA 2E6AA 2AQVA 2OKTA 4GNVA 3CAQA 3V5CA 3LHUA 4ERGA 5IFTA 1VYPX 3CIXA 4S38A 3PR2A 4GA8A 5ABGA 1NU5A 1PUDA 4JGDA 3TMLA 2D0GA 1JD7A 1SM9A 2VMFA 4XZHA 1C90A 4F48A 4C5ZA 2CFFA 1W3TA 4Y9OA 4MPKA 4HSOA 1RVGA 5FEXA 5LHFA 2I5GA 2L5HA 1GTHA 3AHVA 2JF6A 2GVGA 5DXXA 5I3JA 4NNBA 1JFXA 3MZ2A 2R82A 1NDYA 2IPGA 4RZBA 4RE2A 5GJNA 1ADOA 4AD5A 2E1WA 4FAMA 2A3LA 1JZ2A 4HP5A 2Z2UA 4LH8A 1LUCA 2BXZA 2OLAA 3T7VA 1RJPA 5F2GA 1TZ9A 3L65A 3V1PA 4JTEA 3SGUA 4GI8A 2W9MA 4H6RA 4ZE5A 1YRRA 1ICQA 2ZUTA 1D8WA 2X7WA 4E6MA 3UY8A 2E40A 2VGFA 1NARA 1RPKA 4ERAA 3G1DA 4IQDA 1QRQA