4KRXA

Structure of aes from e. coli
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
316
structure length
316
Chain Sequence
b'ENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl esterase
publication title Structural and mutational analyses of Aes, an inhibitor of MalT in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 126
structure length 316
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.1.1.-:
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4krxA00
1XLWA 4BC1A 2XI4A 3O4JA 2XUAA 1YAHA 4B85A 2YYSA 2VAXA 2WUFA 3TGLA 1H22A 1GGVA 1QOZA 5AIAA 4GW3A 4AO8A 2WUGA 3E4DA 3AIKA 5IKXA 3L1JA 2PSEA 3EIOA 1C4XA 2XB6A 2RAUA 3WKBA 1XZGA 2X8BA 1RWQA 4G9GA 4BRSA 4FLFA 1Q84A 1CIJA 1H2WA 1P0IA 2XUIA 3WKDA 3GFFA 1GKKA 3HYSA 3H2JA 4DNPA 4F21A 2C4HA 3G7NA 2PPLA 1QIGA 3GZJA 3F67A 5K3CA 3LS2A 2Z8XA 2XUOA 5CT4A 2I3ZA 2Y6VA 5HQ3A 1A7UA 1JFRA 3DNMA 3F8SA 2IIVA 1ODTC 4BATA 5DJ5A 5D7BA 1CQZA 3QMVA 4J0HA 4A5SA 4QDZA 4CG3A 3FLBA 1EB9A 2WKWA 2WHQA 3VVLA 5E4TA 1K5PA 3FOBA 4NZZA 5JAHA 1CUDA 5ALTA 4B6GA 2QTBA 1QJ4A 1IUOA 2H7XA 3I2HA 1IUNA 3N0TA 2GYUA 2WJ4A 1X2BA 3DJYA 2O7RA 1XZCA 1XZLA 4OD0A 4MQLA 1N1MA 1IZ7A 2ACKA 1VLQA 2Q0XA 4INZA 4OB7A 1AC5A 3KD2A 3K2IA 4KE9A 3I28A 4X6YA 3PE6A 4EY8A 2DHEA 3WL8A 4H7EA 1XQYA 3B3QA 2AJ8A 4UUQA 3DDUA 1H2YA 3VXKA 2XLCA 3WK7A 5CH5A 4ARBA 2G5PA 2BKLA 4FWBA 2B9VA 1ZD5A 3D2BA 1LZKA 3C87A 3L1HA 4U2EA 5C81A 3ESAA 4MYSA 2ZJ6A 2XUHA 1OILA 5JD6A 3S8YA 4YPVA 2GYWA 1BEEA 1UK6A 5A7FA 2WG0A 5DNUA 3BDIA 4Y2YA 3O9VA 2QXUA 1XROA 2J3QA 4H7FA 1SCQA 3LIIA 1YASA 2PU5A 1CFJA 2XMQA 1VOTA 1LPBB 2C5FA 3R41A 4I3FA 2OQVA 1RP1A 4H0CA 3FLAA 1ZJ4A 3RLIA 4B9EA 1XZDA 1YB6A 1EVQA 5JD5A 3H04A 4WY5A 3IBTA 4BRZA 5A71A 2QMQA 4IHAA 1CUYA 4UFOA 4V2IA 2ACEA 2VT6A 3H2IA 1LGYA 3WIOA 2WFZA 3ICWA 2GBGA 3VJKA 1XKLA 4I4CA 3JW8A 4QWWA 3JYHA 3QH4A 5K3FA 2HA5A 3R0VA 4BP9A 4L72A 1XRPA 5AKZA 5ALHA 3RK4A 1A8QA 1EHYA 3M3DA 2G63A 3FWHA 1TCBA 5KBYA 1DX4A 3O9MA 3IUQA 5LZ8A 4WDRA 1CUVA 1ACJA 4OYYA 1GZ7A 2V96A 4UHFA 1OXMA 4X94A 3AFIA 3TEJA 1TAHA 5E4YA 2Z3WA 5LP1A 1LLFA 1UT6A 1UK7A 3QPAA 4Y2QA 1WPXA 2WILA 3EQ8A 1E8NA 5AI5A 3BWXA 5T4BA 4PQEA 3D59A 1D07A 3EF3A 3HXKA 4RPCA 2QXTA 2GBFA 2JGMA 1CV2A 2CMFA 4L9AA 1Y7IA 5H3HA 4J0JA 4Y7DA 2AJDA 5LKAA 1BN7A 4BE9A 4DIUA 3P2MA 4W1PA 2XMCA 1TCCA 2PU7A 2WUEA 1JJBA 2PL5A 4BAUA 2OXEA 1MN6A 4XX1A 3WMRA 4HVTA 4J0IA 1T2NA 4X71A 3V1KA 1PJAA 3VISA 4GLBA 5JAOA 1TCAA 1GXSA 5LZ4A 3CCBA 4WFJA 2NW6A 2WM2A 3PUIA 4AMZA 1WB4A 1WHSA 3FYUB 2QRUA 5EHXA 3OM8A 2C58A 3MUOA 5A62A 1Y7HA 3QZUA 4XJVA 2ZJ7A 4KE7A 1ZD3A 1QTRA 2XUQA 4FFWA 2V9ZA 1Z68A 1CUJA 1QONA 3OOSA 4X92A 5CW2A 2ZVDA 3D2AA 5DNVA 4KRYA 3Q0TA 3HJUA 3BF8A 5JZBA 2Y1KA 1TRHA 4MJ3A 3QPCA 2X76A 2G5TA 2K2QB 1JI3A 1LPAB 1GPKA 2GYVA 2ZYHA 2WIGA 3MGAA 6YASA 3A2MA 4BBZA 3K6KA 2UZ0A 5LZ2A 5AKXA 3VDXA 5T4FA 5IVHA 3DS8A 4Y2SA 2RONA 4LXHA 5ALNA 3BE8A 3M83A 1MT3A 4BZWA 4NS4A 1QZ3A 3DCNA 1JJFA 4PW0A 1EB8A 5AHXA 3G9ZA 2QUAA 3H1BA 3WK6A 2OG1A 3M82A 5ALMA 4P92A 4TPKA 4CG1A 4ZREA 2WIDA 5HQ3B 1LBSA 2JF0A 2DR0A 3EQ7A 2VSQA 4Q82A 3G0DA 1JU3A 2GBCA 4QDXA 4WY8A 1KU0A 1XZKA 4LKOA 5KREA 5AIBA 2PUJA 1CUUA 2ZYRA 3F96A 4H7HA 4F5ZA 5CT6A 3FSGA 2CZQA 2QR5A 1VA4A 5AI4A 1ZJ5A 3ZPXA 1EVEA 2DSNA 5IVIA 5JAPA 4K2AA 3FAKA 1AUOA 1SOMA 4B9AA 1QLWA 1MNQA 2YXPX 4GBGA 1K8QA 1CUZA 1CUSA 4IH4A 1W1IA 3WWEA 7YASA 1ZICA 3D3NA 2XUFA 4OPMA 2CUTA 5K3DA 3QYJA 1JU4A 3G9UA 5EIAA 1CUCA 5FPQA 5FXMA 3C8DA 5AKHA 1S8OA 1WB6A 2Y6UA 2Z3ZA 2HA0A 3AZPA 4WCVA 3NUZA 5AM0A 1CUIA 3O4HA 1THGA 2RI6A 1DWPA 4UHBA 4FNGA 1XQWA 1LPNA 3ICVA 4FTWA 4UFPA 1CLEA 5AOAA 4CCWA 3IB3A 5AKIA 5LZ5A 3WK9A 1SFRA 4Y2VA 3OG9A 4D9JA 3AJAA 4Y9SA 4X3CA 2OCIA 3R40A 3O95A 5LZ7A 4O08A 1CUFA 1E8MA 2FJPA 4EZIA 2C0PA 2HFKA 4LXIA 3B5EA 4DNFA 1YSCA 3UUFA 4UPDA 1HQDA 2JIDA 5AKGA 4JEIA 4OB8A 1AURA 3FLEA 1E8DA 2XMGA 1IVYA 5JALA 4BB0A 2XQFA 2QS9A 2VJCA 4ZXFA 4X85A 1JT2A 1AX9A 3HLKA 4RGYA 4CI9A 4AN1A 4KE6A 5AM3A 1P0PA 1J1IA 4L0CA 2WG2A 2ZJFA 4KR0A 5ESRA 4P08A 4E46A 3G02A 3L1IA 3GROA 5AKYA 5DTJA 4YASA 1QO9A 5LKRA 3HRHA 4HXFB 5EFZA 3RARA 3BF7A 1K63A 4MWSA 5K3FB 2BAGA 1SCIA 2OCKA 1BRTA 1HLGA 4BVJA 4AB1A 2HM7A 2O2IA 3S2ZA 4G8BA 4XIIA 3IUJA 5CT8A 1P0MA 3IULA 1UKBA 3YASA 5ALRA 4DSAA 4QLAA 3HABA 1EH5A 2OAEA 2WJ3A 3GELA 4J7AA 3WA6A 4DGQA 4FBMA 2HDWA 4CG2A 4CCYA 1G66A 1MTZA 1NX9A 1WM1A 2FJ0A 2AJLI 2WTMA 3ESCA 2OGSA 3V1MA 4OYLA 1W76A 4FNMA 4N5IX 1EK2A 4J0DA 2DCMA 5AK3A 4Q3OA 3FCYA 5IH7A 1R9MA 1BCSA 1JMKC 3ZLVA 1AQLA 2QJWA 1ODCA 3DOIA 2JEYA 3OTQA 5I9IA 3STWA 3PF9A 3WL7A 4Q34A 4LYEA 3KXPA 1VXRA 1LNSA 4I19A 1YS1X 1EINA 3N2ZB 2HADA 2J4CA 2BUBA 4PO3X 4KE8A 4BP8A 1R9NA 2XMZA 1CR6A 1R88A 3ED1A 1BEZA 1E3QA 5BWBA 3ZLTA 3O4GA 2ORYA 5C7YA 3A6ZA 5BV7A 4DLNA 4DNQA 4DTCA 4HS9A 4QDOA 3WI7A 3WKCA 3IVMA 4DMFA 1NU6A 2JBWA 4AQDA 3R3XA 4ETWA 3BIWA 3I2FA 1LPOA 2O2HA 2VJBA 1EX9A 1F6WA 3PDCA 3STXA 3I2KA 2VT7A 1W4LA 2HA3A 3NGMA 4L3WA 2LIPA 2DQYA 5AI6A 4QA9A 4FBLA 5HZGA 1XZHA 2ZSIA 1A8SA 1CUWA 4U2CA 1CQWA 4H7JA 3C43A 2AJBA 2XQKA 4KRXA 1MNAA 2ZYSA 4C4XA 2RIPA 3E0XA 2IX9A 4UHDA 1CPYA 4MXDA 5HK8A 4FLEA 1DT5A 3WWCA 3H1AA 1KU6A 3KOOA 4Z49A 4EUSA 1L7QA 5FP0A 1QGED 1VXOA 1E5TA 2I3DA 1U4NA 1WPRA 2PVSA 3R3YA 2V98A 3H2GA 5ALXA 4K6GA 4J0CA 4J03A 4QE3A 2WG1A 3ZWQA 3A2NA 5JZ9A 5D3KA 1ORWA 1IZ8A 3CXUA 1BCRA 5JD4A 4XWGA 2XDWA 5DNWA 4EY6A 3QMWA 2RHWA 3SK0A 3WZLA 4HRXA 1MAAA 1SC9A 3SC2A 1G5FA 1EDEA 4AZ0A 1E66A 1YA8A 4LYDA 4J3JA 4OU4A 2DHCA 5A6VA 3T4UA 5C8VA 4X6UA 3ESBA 1PFQA 2EDAA 3M81A 5DLPA 4PSUA 1THTA 1R4ZA 1XQVA 3G0GA 2DQZA 3W9BA 1N5MA 3LIPA 2B61A 1UOPA 4DSZA 2BJHA 2VQ6A 4JYPA 3STVA 1P0QA 3I2JA 4PNZA 4TGLA 2DHDA 2QKYA 3ESDA 4H35A 1ZI8A 3F9CA 4N8SA 4C01A 1NU8A 4H18A 4M0FA 3WQHA 1VZ3A 4BCBA 1USWA 1F0NA 3WA7A 3C6YA 1GPLA 4FFVA 4BDTA 1JJIA 4B7ZA 4Q3KA 4KYVA 1U65A 2HL6A 5KWJA 5JASA 4G4JA 1F8UA 1CRLA 2Y2VA 1MPXA 4AMYA 3G8YA 1EDBA 2WU4A 1W6RA 4MWTA 1K6EA 1WHTA 3FCXA 1FSSA 1C7IA 1ZI9A 5LLSA 1VE6A 1WCYA 4ZV9A 5AM1A 5CRIA 5AK6A 4Y2TA 1LBTA 1H2ZA 2H7YA 5YASA 4PSCA 1J06A 5EHZA 3QMMA 1QFSA 4B83A 1QIDA 3VJMA 4KACA 3WWOA 4JH0A 3ZLUA 3AZQA 5D3ZA 2WLSA 3IURA 5AOBA 1UZAA 2WTNA 1QIMA 3WYNA 5HF5A 2VJAA 1DWQA 1CEXA 2PBLA 4DMHA 5EGNA 1QIFA 1W52X 1QIEA 2XLBA 2JEZA 4QDTA 4BAZA 3IA2A 1QO7A 2D5LA 4BCCA 4B81A 2X5XA 3V9AA 4CIAA 5ALKA 3MUNA 1XZAA 3CN9A 3H2KA 2O7VA 4W9RA 4C87A 2HFJA 4C89A 1BU8A 4BZZA 1YCDA 1EK1A 2H1IA 4C4YA 5I7UA 4C88A 2VATA 4X00A 3I2IA 2XMDA 3I6ZA 4KAFA 1R1DA 5BOVA 3TJMA 5HF9A 1R50A 4FOLA 2V97A 2XMRA 5JIBA 1ISPA 3VJLA 1EXWA 3R3WA 2HA2A 2PX6A 3DKKA 1YS2X 1H2XA 5EHQA 3LP5A 5FOQA 1YAJA 4BDSA 5ALSA 2CJPA 1CUEA 3D2CA 5FV4A 5HK9A 3O4IA 2JGIA 4MEAA 2PUHA 5FLKA 1A8UA 4HRYA 5J3JA 3WZMA 1DX6A 4CCYB 4FLMA 3QPDA 2H9YA 4WFIA 1YB7A 5AO9A 1BN6A 1XZIA 2P8SA 4Q1VA 3W05A 1N5RA 3R3UA 4W1QA 1AKNA 4JNCA 4WFKA 3VVMA 5CTAA 3KSRA 2HU8A 3ANTA 3QBJA 3ILSA 3PUHA 1QIHA 2B20A 2XQJA 4FMPA 5EIHA 2WUDA 4GWLA 5EI5A 1MJ5A 1M33A 1CUGA 3AUKA 2PSFA 3WJ2A 5HKAA 2BUAA 4G5XA 4GDMA 3CCCA 3RM3A 4U2DA 1DWOA 3PFCA 5ISMA 3A70A 3WK4A 1ZGBA 1ZIYA 4QNNA 2HU5A 3E1GA 3OC0A 3R3ZA 3HACA 3QITA 5AKKA 1GT6A 2VJDA 1XZJA 3D5EA 1X2EA 5HCUA 3H2HA 3C8HA 1O6GA 1UFOA 4UBOA 4B0PA 1CVLA 3FYUC 5SYMA 1XZFA 3C70A 1QTIA 3HI4A 3O0DA 2Z8ZA 1UWCA 2QM0A 3PICA 5CXXA 3DQZA 2VTVA 2OGTA 2ZSHA 3A2LA 4H77A 4B0OA 4Y2RA 1ZIXA 2XUPA 5ALFA 4C4ZA 4BAGA 1BE0A 4DYHA 1XRLA 1IUPA 1DU4A 4DM7A 1I6WA 3KDAA 3ANSA 4GHWA 1UOOA 4ITVA 3T52A 1ACLA 3GBSA 4QWMA 4H7IA 1DINA 5K3EA 5JARA 3U0VA 2C0QA 3H17A 4S0XA 1MX1A 5FPPA 4F60A 5LIPA 4RE6A 5AKLA 2CEKA 1FFDA 3AZOA 1TKRA 4DMCA 1QIIA 4UFNA 3BJRA 3EBLA 4U2BA 4DMKA 3BIXA 4EB0A 1J07A 1Q83A 3B12A 2OQIA 3WKAA 1XQXA 1XLVA 4BTVA 5C8ZA 3PF8A 4M0EA 4RE5A 4Y2UA 3V1NA 2WFLB 4DNOA 5FKJA 2H7CA 2YASA 3UUEA 5EHNA 1CUAA 3I1YA 2JGJA 2GZRA 1QIKA 2WHPA 4IQ4A 4MEBA 4J0GA 1N8SA 1VE7A 3DEAA 4ZV7A 1XRQA 4X93A 3WK5A 4EY7A 2PKYX 3PI6A 2OLEA 2GBIA 3MVEA 1B6GA 5EIEA 4K6HA 5JADA 5CXUA 1AMNA 5DYWA 5AI8A 1XRRA 1CUBA 1AGYA 3H0CA 3DKRA 2PSDA 5K5EA 3DYVA 2J3DA 3V1LA 4AN0A 4N8DA 2BFNA 2QT9A 4GI1A 3DLTA 4P93A 1YA4A 5HF8A 1CUHA 4YK7A 3FYTA 5ALLA 3C5WP 4UHCA 4EHBA 3V48A 5FDFA 3U1TA 2HRRA 4K5QA 1TK3A 4X90A 1YR2A 1U2EA 5HFNA 4OU5A 5K3AA 1DT3A 2ONCA 4W63A 5ALOA 1O6FA 2WIJA 2YH2A 1R3DA 2BUCA 2DFPA 3AILA 1BS9A 1L7RA 3NWOA 5AK5A 1ZD2P 2OGZA 3WWDA 4E11A 4P9NA 3C6XA 5ALGA 4A23A 1QE3A 2BCEA 3DYIA 3STTA 4B84A 1HKHA 5CT9A 3HC7A 5A7GA 3DL4A 4YX9A 2Y2UA 1LPSA 3G0IA 5HFAA 5AK4A 5C8XA 2XUGA 3BL8A 4HXEB 4GXNA 3IUMA 2FX5A 2RGUA 2B4KA 4B80A 4OB6A 4Q3LA 3W06A 1XZBA 1XZMA 3I6MA 2QVBA 2VA9A 1LZLA 3AIMA 5ALZA 4ZRDA 1TIBA 1UOQA 4K6KA 4EA6A 3K9BA 3D7RA 2VF2A 1ZOIA 1DQYA 1DTEA 5JANA 4JYMA 5ALEA 1ETHA 1GQRA 2EDCA 1HPLA 4BYMA 5AM2A 2HRQA 1LPPA 5DWDA 4OCZA 4ZWNA 5JZSA 2WHRA 1UKAA 2WIFA 1CUXA 5ALUA 1JMYA 4PV7A 5AM4A 3D4LA 3ZV7A 4Q05A 5HKBA 3X3HA 4GEGA 3AINA 4E15A 5T4HA 4NMWA 1IMJA 5AKEA 3ZI7A 2HA4A 1A88A 5LYYA 1JKMA 5KWIA 1E89A 4KEAA 2VAVA 3C5VA 4ZI5A 2GZSA 2WFLA 1KEZA 1MU0A 1ZD4A 1TQHA 4NVRA 1H23A 4PSDA 4X97A 4J0KA 2OCLA 5AI0A 2C5GA 4HXGA 5JYCA 1MO2A 1EDDA 4X95A 3PFBA 1XRMA 3G9XA 1XFDA 5JAUA 2BGNA 4OUKX 2JGKA 2FUKA 2CBGA 3VKFA 2HU7A 4E14A 3HSSA 1UXOA 3R3VA 1C7JA 2W22A 3Q8WA 1SCKA 1F0PA 4U2GA 1B41A 1QIJA 1XZEA 3SWWA 3CN7A 1G4HA 1UK8A 5ALYA 1MX9A 5HF6A 3F98A 3FVTA 4FKBA 4FHZA 3STYA 4G4GA 1DQZA 4BVLA 4OSEA 4QLOA 3WYDA 4CIBA 2E3JA 3BXPA 5ALVA 1VJ5A 3FBWA 5K3BA 2WU3A 5A7HA 1HDEA 3C6BA 1EI9A 4HZGA 4X6XA 2I03A 4TVKA 1MAHA 3W04A 2XMSA 4GECA 3HZOA 5A2GA 1L7AA 3C6ZA 2BGRA 2EEPA 3WL6A 3UMJA 4ROTA 1UK9A 4CFSA 1Y37A 3FSGD 4LHEA 5DYTA 1XRNA 4FDMA 3HEAA 5ALIA 5LZ9A 1PV1A 2ECFA 2OAGA 5FUMA 4N8EA 3G9TA 5AKJA 5F4ZA 1OCEA 3EQ9A 4H7DA 2JGLA 2CKMA 3I1IA 1FFAA 3WWPA 5I8PA 4UBKA 1ZI6A 1X70A 2XT0A 5CH3A 4PF1A 3W9UA 3GA7A 3IUNA 4WJLA 4HAIA 5AICA 1GPNA 4UBLA 1AZWA 5ALPA 4HTAA 2WJ6A 4G4IA 2ZYIA 4BTLA 2HHAA 2QJRA 4G8CA 5IVKA 4G1FA 3LLCA 4IH9A 5CURA 5IVDA 5ALDA 4JUIA 4UBIA 2C7BA 2O2GA 2WHPB 3C45A 4W1SA 1MX5A 2I78A 5T4EA 1WOMA 2XUJA 3BJMA 4AZ3A 2AJCA 4XVCA 3FNBA 5ALJA 1XLUA 2QOEA 2HA7A 3OPMA 5AH0A 1W75A 3W2TA 2XQGA 2HIHA 4UHEA 2PSHA 1ORVA 2HA6A 2XUKA 4LIPD 5DYYA 1VKHA 3IDAA 5AI9A 3D0KA 2XMBA 5FRDA 2OPHA 4IO0A 3DD5A 1FFBA 1QFMA 1FFEA 5CH8A 4A16A 3G0CA 2R8BA 3E3AA 3JWEA 1HBJA 4QZVA 5E4JA 4BE4A 1ZGCA 4QDUA 2CB9A 4Y2PA 1RYYA 1G42A 5JATA 4H7KA 4MQMA 5AP9A 1HL7A 2WSLA 3KWJA 2QZPA 3WK8A 5ALWA 5CBKA 2XE4A 4AO7A 4UHHA 2VEOA 4Y2JA 3TRDA 1J2EA 1BROA 4QEKA 4BCDA 1Q0RA 4MYDA 4N5HX 2PSJA 2ES4A 3WLAA 4ZGBA 1Q0ZA 3BDVA 2JGEA 4C6HA 4AO6A 3WL5A 4KAAA 3DL7A 2J4FA 3H18A 4UBNA 4RNCA 4G8DA 2RHTA 5E2IA 1T4MA 4M0MA 4EBBA 4KJXA 3DOHA 5BWCA 2XQIA 5ALQA 1LPMA 1XKTA 3STUA 4B82A 3I6YA 3QM1A 3WIBA 1K4YA 4X91A 2W6CX 1FJ2A 4IH1A 3LCRA 3I2GA 3SX4A 4UBMA 2WIKA 1VZ2A 1EA5A 3RKSA 5AOCA 4Y2XA 4X7BA 3AIOA 2D0DA 3QVMA 3NOXA 2JGFA 2WQZA 1VA5A 2PM8A 2Z5GA 3FYUA 4G9EA 2G4LA 3H19A 1U8EA 3OURA 4BVKA 3WKEA 4ARAA 3WJ1A 4WDQA 2R11A 4LXGA 3GUUA 2XUDA 4U2FA 4BC0A 1WB5A 2WFMA 4F0JA 4EY4A 2IITA 4AX4A 3KWFA 5SYNA 3G0BA 2AXEA 2OCGA 1ODSA 5D6OA 4EY5A 2ROQA 5AM5A 4W1RA 5CMLA 2QUBA 3FVRA 4AXBA 5AJHA 5CT5A 1GQSA 1UKCA 5DTIA 3F97A 4UBJA 1FFCA 1GKLA 4KAJA 3IIIA
chains in the Genus database with same CATH superfamily
2RJOA 2J59A 3EOBI 3QY0A 5J63A 3WNCA 1UDBA 1ZP6A 1N0IA 2WUVA 4EK9A 3WDKA 1VPWA 2C94A 3AFGA 1VGQA 4O6VA 5SZJA 3TF5A 1X1RA 2RE8A 5A1TA 2CT8A 2PS0A 1HMPA 1NLMA 5HM6A 2HWWA 3P9ZA 4DQXA 1KAOA 2VTEA 4Y7CA 4ABYA 1W0JA 2V7BA 2V3WA 4JWTA 2ZAOA 3UXHA 3ZX5A 5KNBA 1HNWB 2PH5A 3G8DA 2CNNA 5LYJB 4MB0A 5E9AA 3E53A 2EGGA 4AO8A 2DUUA 2WZCA 2W0SA 3P45A 5DX0A 1FNMA 4EYSA 4L8LA 4MTLA 1AXRA 2AHRA 3OKCA 4BNYA 5IKPA 2POCA 4YAWA 1AB6A 4AW9A 3L1JA 4MPJA 2QLFA 2ATCA 2PSEA 1YZYA 3NHMA 1DE0A 1QQ5A 1C4XA 2B2NA 3WKBA 3EPRA 1RE0A 2AOUB 5AVQA 5B3JA 1E1RD 4YRTA 1M2OB 1XO1A 3ADKA 4G9GA 4H7PA 4IOMA 3UMFA 4BRSA 5CIWA 2AYZA 1L4UA 3BKWA 4QU9A 3PC2A 2X23A 1A69A 1ANKA 1USKA 1W35A 2JIBA 2ATVA 2J46A 4YBZA 3SHFA 3UJ6A 3CR8A 3JQ7B 1PEAA 4D0GA 1T4DA 2O3RA 4MQ4A 4QG3A 2IL1A 1DOHA 3H2JA 3INGA 3KVOA 4UZEA 1JJAA 5CD1A 2J6HA 4ZPXA 4D0SA 3MQ4A 1RPZA 4EAQA 3G7NA 3QVOA 1IM8A 4A8HA 1GPAA 1DRVA 2DLDA 2VDUE 2X0RA 3BTSA 3GZJA 5K3CA 2X0JA 5BW6B 4BNFA 2Z8XA 4HWKA 2XUOA 1UMBB 5B3KA 1MDFA 1IBMB 4MUGA 5EQDA 1DJQA 1G8SA 3U3XA 5JI3E 1ZDMA 2GD1O 2JJ8A 3P5SA 3QE4A 4PX2A 5DJ5A 3T54A 3ZE1B 5L40A 3R7SA 4IJUA 3PA8A 1W5SA 2EG9A 1U2QA 3FDIA 1UZMA 3G2JA 4ITUA 4KX3A 1TQ4A 2IZ0A 2XAAA 1IDOA 4L8WB 5KKNB 2ZIVB 4JBHA 1RC0A 4S04A 4OHMA 3OP1A 4OLAA 3PE3A 1NYQA 1P5ZB 2YL2A 3R0JA 1IQPA 2NSJA 3RC3A 3UT6A 1NQXA 2GAFA 3DEKA 3RVBA 3IEMA 2F55A 2C9ZA 4TMKA 2FU5C 3NHKA 1NQ5A 2E4ZA 3FOBA 1Z4OA 3OPQA 2OD9A 1OV6A 1ZONA 2CLSA 3GLUA 3R5SA 4FEAA 4M76B 5JAHA 1CUDA 5KOHA 3SIRA 3IMGA 1XMPA 2CHUA 1N2IA 2NO5A 1M2KA 2OGUA 2W9XA 2ZROA 3ZY2A 4E3WA 1IUOA 3C16C 1F4PA 2H7XA 1P5HA 2ZI6A 3WX0A 4Q4HB 1FFSA 1PYGA 4XR4A 3RTEA 2HF7A 4ZAVA 5TXGA 3FWPA 2GYUA 3LCJA 1X2BA 4Q3AA 4D9IA 1VYVA 3VV2A 2QYTA 1THZA 2FEKA 2OKCA 1VHQA 1G21B 3DJYA 3HBLA 3OSUA 2O7RA 1KSJA 1ZNZA 1EXMA 3EXEA 5KNDA 4XD7D 3U17A 3OUUA 3RIMA 1EFDN 1PNOA 1JV2B 2HAEA 3DZJA 4PSAA 5KMGA 4CQLB 3IAEA 2V7UA 2HRBA 2WV7A 3G13A 1JBEA 1W93A 4Y6OA 1TU3A 4OB7A 4QOEA 5TARA 1C8VB 3KD2A 4UCFA 5E1BA 3I28A 2F43A 4EELA 2RI0A 4WXRA 1JQAA 3PE6A 4HGPA 3WB0A 3QKRA 3BOSA 4EY8A 1ONSA 1J2YA 2DHEA 4NC9A 2QI9F 4H7EA 1XQYA 4QOFA 5EXXA 5HIAA 3DDUA 1EXNA 3UHPA 1KI4A 4Q1EA 2MDTA 2Z4TA 1K8ZB 3N5KA 4EABA 4QVIA 3IEKA 3CR3C 3LDGA 3VXKA 1W47A 2XLCA 3WK7A 3BHMA 5FV7A 5ARDA 1G7TA 5CH5A 1VDMA 1GNSA 3PPWA 1G17A 4BASA 5CYGA 2RJ3A 3AGQA 2VYVD 2FN4A 3PIRA 1OROA 4FWBA 4JP2A 3WY9A 3M4NA 4TXJA 2EC5A 3MTBA 1GN9A 4DAEA 4MH0R 2G0TA 4R9RA 1CVIA 1R4NA 1NFQA 2NZVG 2YCBA 4EHIA 3C87A 1LH0A 1ACMA 3L1HA 2P91A 4U2EA 5ABPA 2RGBA 2VZ9A 3PFIA 4AECA 1V11A 3DTYA 4D3DA 4DQLA 2ZBRA 1ONOA 5CB4F 4I2VA 4F85A 4BE7B 4IFIA 5K8TA 1OXUA 2ZJ6A 5ECYA 1OILA 2ZPAA 3EQ2A 2GERA 2AN9A 5JD6A 2YYYA 1K0FA 4PXYA 4YPVA 1K7FB 1GAEO 5KU1A 2FZVA 2IEIA 5MFPA 1AKEA 3VV3A 3ZY5A 1GSOA 5CDFA 3A05A 3DZFA 5JY1A 4NEHB 1VMEA 1R8QA 1PS0A 1DAEA 1UK6A 3I9V1 2EBWA 4N0DA 5JSZB 2UZ1A 3UJ8A 4FS3A 1NZJA 4IBOA 4MRVA 1SXJA 3R7FA 2QDXA 4CDNA 4ZQIA 4FWIB 1K6IA 2K7ZA 3RG8A 1OAOC 1K7EB 3B2EA 3MS7A 5ITSA 5G2OA 1YMQA 2V65A 4G0NA 1CK4A 3S8MA 4ZDJA 1WPQA 2J3QA 2LCIA 3PR3A 2C5SA 4PG8A 4H7FA 3NKFA 1RRVA 4TVSA 2WE8A 3IHWA 5IXJA 2PU5A 2NZYA 1I0ZA 3NB0A 3SXJA 1T5TA 2CUZA 1G2OA 2YZKA 1DQNA 3EXHA 3F78A 4KXLA 1DQRA 4UTPA 2YRWA 3AEXA 1CJUC 2ZRJA 1ZM2A 4MKGA 2CJFA 3TB6A 2XMQA 3ZHZA 1J9ZA 4F12A 3TFOA 1LPBB 2C5FA 4TKVA 2W2OA 1CF2O 2XR1A 4MPTA 5H82A 3TL6A 2Q1SA 3PVZA 4J7XA 3COSA 3E15A 4AZ3B 4UNSA 1Z6ZA 1B16A 2QQ5A 3EGXB 3NW9A 2EW2A 4M98A 2Y0EA 4KHPB 3GVHA 3RLIA 3UKOA 5KSWB 1ABFA 5E9JA 1CFZA 5LXTB 1RQ2A 3DHYA 3E3LA 1CHNA 1ISIA 1KO5A 1J5PA 3HI6A 3CJRA 4TVBA 4EMTA 5JD5A 5H4GA 4S05A 2FVYA 1D2AA 4GM4A 1F2UB 1G5HA 1GVHA 1OA1A 2WF6A 2X13A 4YMWA 4IHAA 3KXIA 4U5QA 1BX1A 3I4FA 5DN6A 3N2GB 1E3DA 4LHWA 2A7QA 4EHAA 2FY8A 4GO1A 2VT6A 3AKCA 4KU4A 1GQFA 3H2IA 2WF5A 2FF5A 4JYCA 3UH1A 1CY1A 1C5KA 1N2HA 2QYHA 5GP1A 1ZA2A 3ICWA 4ID9A 3CLHA 3VPAA 2VDRB 4KXXA 2J3HA 2B37A 2Y92A 4LWZA 4PNPA 4W99A 3UXEA 1Y9ZA 1CJVC 3DBHA 1WRBA 2Z95A 3MWLA 3SS7X 4WZZA 3SE0A 2B1GA 5AXDA 4BVHA 3JW8A 2GAAA 4QWWA 3ZXIA 1JB9A 3S2YA 4JJ7A 3N8KA 1QGYA 3K7EA 4O4JA 4Z51A 5HWSA 2OV8A 3BORA 3DMPA 4LZAA 1KP2A 1QFZA 4HATA 3UJCA 1PUJA 4YGXB 1F7UA 1YVPA 2WPDA 1T5OA 3I1FA 1SIWA 2UXCB 4I1SA 5IBCA 1P39A 5E1MA 1QE5A 3HNRA 2AFRA 1PHPA 3A27A 3EZFA 3Q2OA 4PXAA 2H5EA 4DJEC 2Q5EA 4H27A 5AKZA 3MC1A 5MHTA 3E9NA 2QU7A 5DT2A 4WECA 4DCOA 3M3DA 5C1BA 4JT8A 5KZMB 4IWXA 5KJCA 3FWHA 2H2AA 4PPYA 4D92A 1JXMA 1DX4A 1UBGA 5KBYA 1PEYA 3MLAA 3O9MA 4KMRA 4KSYA 4ENRA 2CXPA 4Z3DA 5IHPA 3NMUF 4CW7A 1NBOA 2C4MA 1ACJA 1N2ZA 2F6RA 3TOCA 2QM8A 4IQ8A 4OYYA 1X7HA 1YDMA 3DB2A 3L93A 4R5MA 2BBWA 4RL4A 4DYDA 2B34A 3ZVNA 1VGVA 1Q16A 2V96A 2O1SA 2OMKA 1L1EA 3TEJA 1T5BA 1W49A 4QNMA 4YO8A 5KVQA 3D7LA 3QI7A 3NHPA 2ZZMA 3HWRA 5E4YA 4CDGA 3BJZA 5LP1A 2HF8A 1HDZA 4K6CA 3R8CA 3QPAA 1GA1A 5TY0A 1ZYUA 1JA0A 2HCFA 2J3IA 4EX7A 3R9XA 5DHSA 2WILA 4P3XA 1LBQA 4ARSA 3UFBA 4BO1A 1ISFA 3ETLA 1V3VA 2O3SA 3MRTA 1NMQA 5AI5A 2H2GA 4HQKA 4EA9A 5KCZA 1DBQA 1ZRNA 2K5UA 4C0JA 2RHJA 3PDWA 1U3WA 5L8VA 3UH0A 2HMTA 1NF2A 4ROSA 4YRPA 1E3EA 2Z30A 3OHMA 2IP1A 2C3YA 3GHHA 2XRYA 2V5AA 4I8DA 4W5NA 1O96A 1Z4LA 3R5TA 3C3CA 3SSNA 1NUHA 2WC1A 5JMOA 3EDCA 1YVRA 2W6JA 3N05A 2FK7A 4KNWA 2QN8A 4J0JA 1GQ2A 1J8YF 1BXZA 4XQCA 4W7IA 3SF8A 1FDUA 1BN7A 1RQRA 2EFCB 5JMWA 1QP7A 4P0PB 3DDZX 4L5YA 3GLRA 4QUEA 2DWUA 1FL9A 2KI5A 4E5PA 1JJBA 1OFHA 5B37A 3RIYA 2I2WA 2AMFA 2W2KB 1SUAA 3ICOA 3O4RA 3P9XA 3WGMA 4ZT5A 1FE8A 1K4MA 3M5WA 1J24A 1XCOA 1XRSB 4XVHA 4KBYA 1W4ZA 2I5PO 2Y1LA 4TL6A 3SHOA 4BFLA 4XX1A 3WMRA 4EG3A 3EISA 3FTPA 3QU2A 4RACA 1KVTA 5ETJA 3EVNA 4HTFA 5SY6A 2YN2A 1QP8A 4RV4A 4F2WA 1ZIDA 1D2HA 3ED5A 4GX0A 1HLDA 4PHGA 5BQ3A 3GLSA 4OQLA 1TYDE 3EA0A 5GJCA 2PS3A 3H9QA 3HBNA 3K0CA 3G82C 4R2LA 1XNRB 5F3DA 1BMTA 4N54A 1VL0A 5LZ4A 4AKGA 4F9FA 2WVGA 2JPDA 2NWQA 1AS3A 2PLFA 2W6IA 2ZJBA 1LK5A 2I22A 3AUXA 1ZZGA 5EMKA 4TWJA 5FOTA 1KEUA 1Q3KA 3HYNA 3SPXA 4AMZA 4CU2A 3CKYA 3DWFA 3PWSA 3FKSA 1U5CA 4DDWA 1TAUA 2V45A 4XASA 3FI9A 4Q7MB 3FPLA 3IVRA 3LBFA 3B3GA 3QE2A 3Q7PA 4URFA 5KO2A 3ZV5A 3ZJUA 3QZUA 3JQAA 3WGHA 5LQRA 4OXXA 2XVMA 4ZN6A 2PX2A 3I6IA 1ZD3A 1AKRA 1M1YB 2WJPA 5CVEA 2PMKA 1YULA 3AB8A 1U9IC 4OFZA 2RB4A 5HKKA 1L3BA 2V7PA 2W11A 2HBRA 1FDVA 3OWOA 4LYGA 2EKDA 2G1JA 3LQKA 4RF5A 2R4UA 3PITA 2JCXA 1C81A 5CA1B 1SG9A 3WGIA 4XM0A 1QYIA 1ZK1A 4G0PA 1YFJA 4C5AA 3Q0TA 4JC8A 1N77A 1RVV1 5F5LA 1V5WA 1LJLA 3F74A 1C1XB 1J7KA 3O4FA 3X1DA 3HBJA 5KC9A 3MZ0A 1Q57A 1XJ5A 3GJYA 3OM9A 4QPDA 4GI7A 3RIHA 3DT9A 1DC3A 3BJIC 3H4TA 4LOIA 1EPUA 2IYSA 4BJHB 4EFMA 4RNDB 4V1CA 7ADHA 1SB8A 1IHYA 1K88A 1ONNA 3M7IA 4GX5A 5ICGA 3O2QB 4FCWA 1ZCAA 5INTA 4BLOA 1RLOA 4O2BB 4YMGA 1UQRA 4KLZA 4O02B 2ZQZA 2WJWA 4I50B 5FPKA 1LPAB 4PAQA 1AN0A 3IVAA 2PUWA 4RLSA 4YY3B 1C41A 1GFWA 5BSRA 1L5SA 2JHCA 2ZYHA 1Z7BA 3GW8A 4EVRA 1M3SA 3DOFA 6YASA 1E2DA 3GX1A 2GT1A 3H0EA 3ZHOA 4EVIA 1VTKA 1EFCA 3AEUB 1ZH0A 3K9LA 4FKZA 5IAKA 4CF7A 3KQHA 4LFBB 1N0HA 3UCFA 4TL7A 5IVHA 3BXEA 4L74A 5DCUA 1CW2B 1AS0A 4NG5A 4DY6A 3VX4A 4CCAA 3A3KA 4POAA 2C5AA 2YQZA 3M6UA 1N7JA 3EDQA 1U8YA 3JWJA 3BE8A 3P71T 4GP6A 5ALNA 3U31A 5I7VA 1GL3A 4NS4A 4BVFA 1L5OA 4RQTA 2OQ2A 1A2BA 2WU8A 3I8XA 3BC1A 3V4FA 1WVGA 1VPEA 1IEWA 3T34A 4MKRA 2OHIA 3ZDEA 5LM3A 1STOA 1YS6A 1N2OA 3D3KA 4CKZA 1JSRA 4YAKA 3A6GA 3CISA 3L0SA 3OZGA 1QOQB 2R6DA 3PX3A 2H00A 2Z2JA 4AS2A 3D1LA 2Q1YA 3REOA 4P92A 1GV1A 4TPKA 4XB1A 3TR5A 3TTXA 1WDKA 4D5GA 1KQOA 1S2NA 4C21A 3AM5A 4ZREA 4CG1A 3MHTA 3KT8A 1LBSA 2JF0A 1PJ2A 1XTRA 1MEEA 2DR0A 1Z75A 2P79A 1W6UA 5CLIA 4DA7A 4ETNA 3F5DA 5LQKA 1JLRA 3BA6A 1EFVA 3UG6A 2ZBGA 3BH0A 3RRJA 1IJBA 4JP1A 3WC4A 5F3RA 3GUVA 4KQ1A 1NBHA 5FOWA 3A4NA 4MKHA 4OAPA 3HB1A 4HJRA 4Q9HA 2OVFA 1X8JA 3AHCA 3C3KA 3TPZA 3V7NA 4C6TB 1CUUA 1KQ3A 3LX4A 3QG1A 5LNK6 4H16A 1JFLA 1HT0A 2OB1A 3F96A 4R8MA 5G41A 2O2YA 3D4IA 3AHDA 1IJFA 2DY0A 3GEIA 3RK0A 1MBZA 3AU8A 3EJWA 3PQ2A 4LJ8A 3MJTA 2QR5A 4X20B 4Y1FA 3H1GA 3W3AH 4DEYA 2ZRHA 2YMPA 3N8NA 3RJZA 4GMHA 4QTYA 3DW1X 1GG9A 2B82A 4BN4A 2IZ6A 3F6EX 3ZPXA 5ILOA 1Y1TA 4LE0A 4RS4A 5A5DA 1U7PA 2C20A 3PFGA 1OF1A 2C3PA 1SOMA 4G81A 2D5BA 4S1VA 2Q7DA 4B9AA 4LF5B 1HLPA 1YQUA 3HCCA 1YRLA 3HVUA 1XU4A 4CM8B 1JEYB 1QLWA 1NXSA 2FFHA 1NUTA 2HTFA 5CM9C 5EIBC 3RRNA 1DCTA 3P94A 3RFFA 3AF6A 2ZRDA 3EA5A 4AS1A 3ZBUA 4IXTA 4H0NA 1W1IA 4OP2A 2XPCA 4EI8A 1JEJA 3RYCB 2ZOSA 4ER6A 4E7PA 4Z9XA 4JJFA 4UXIA 4ZI2A 1U3TA 3UICA 2NQ8A 4GG1A 1ZICA 3D3NA 4RD1A 4OPMA 1C29B 2RKOA 1UDCA 3L6CA 3KSZO 3JATB 3VYUB 4DS3A 2BE9A 1YI8A 3GUYA 4KO4S 1P5RA 1V48A 3UA4A 1OIXA 3NHBA 4QPJC 3L9WA 4JBWA 3T9DA 3T5DA 1UPCA 2NO6A 4JLUA 1H2HA 4K9NA 5JVDA 2GJSA 1P4SA 3HRIA 5AKHA 2DUNA 2YC2C 4FCTA 5DRTA 4CKEB 1BXGB 1EVLA 2YXEA 3BFKA 1XMJA 5LJLA 5F1KA 1GTMA 2R60A 1OD6A 1IN6A 1UBCA 2GXQA 4J6EA 1P9NA 4WCVA 3B6JA 3BMOB 3QQPA 4KCGA 4KGDA 4R2IA 1OAKA 1RQXA 2Q9CA 2YBEA 3TI9A 1BYUA 1DWPA 4HDSB 5HGJA 4RCVA 3S29A 4NAHA 1XPOA 1T2UA 1XTTA 3U13A 3ICVA 4ES6A 3OF3A 3K05A 1XDUA 3C7DB 2GXUA 5AKIA 3M6MD 4WN9B 1L8QA 4AIRA 1N1GA 1SFRA 2W2VA 2D1TA 4Y2VA 3OG9A 1MENA 3QE0A 1ZCFA 4DABA 1UJMA 1CR2A 4NBRA 2QXYA 4C4AA 2BP7A 3FCCA 4HDNB 4RHCA 1KOLA 4GS5A 5HSGA 2ZQYA 1HURA 3UJPA 1XTBA 2O8NA 1NYRA 3KYBA 3N8IA 1C3XA 3O95A 1C7EA 5EPOA 1WA5A 1G6KA 4B4OA 1CZLA 2QTRA 4CMAA 3A7EA 2J08A 5F2KA 3CW8X 3O2SB 4LDAA 1QS0A 3AYZB 2WD8A 3A9VA 3KKZA 3A26A 2HFKA 3ECCA 4BXOB 3B5EA 4CE6A 4AZVA 3BCUA 1T1JA 1TPZA 3L7BA 4EW3A 4RD6A 5LQUA 1SULA 5C5IA 5KJFA 4V24A 2NAFA 2B4AA 1A27A 4UDNA 1XALA 2ECPA 3AJEA 3FUVA 2R8ZA 3BX1A 3B1FA 4JEIA 1BX0A 5AKGA 1U0NA 3W6PA 4QBHA 1JI0A 3NDJA 4PYOA 4MR9B 3PPYA 3SQMA 4H1WA 3KJZA 2AMJA 1GIAA 4D8YA 2UKDA 4I6JA 1XKXA 1JFVA 4H6PA 4YN3A 3WRXA 1PKXA 1YZKA 2GM9A 3CKLA 1VKOA 2F8TA 1KAEA 1X19A 1ZQ9A 2HK6A 2IIPA 2QS9A 3IVGA 4RIFA 1Y1PA 3C3YA 3EFBA 4YP9A 3WL7A 3ZIAA 1MB0A 3HLKA 2ZZNA 3U37A 2RC6A 2O8VA 1SBIA 5KYNA 4BQPA 1OYWA 2REOA 2ZSBA 4OXIA 5AM3A 2J9FA 5EMHA 1V9CA 3IXQA 4YJ2A 2PVPA 4IIXA 4HDCA 1NNLA 4DIDA 3OIWA 4MV6A 3OU6A 4P08A 3B7GA 2B92A 3LCVB 3LO5A 3O83A 4A0SA 4NBSA 3G7UA 1ZC3A 3MTDA 3UPDA 5K99A 5L7YA 5JCZA 4TTSA 1XNHA 4X61A 4F4UA 1RI3A 1JSCA 1I4OA 3IV6A 3RYFA 5JH7A 1NR1A 3FFTA 4YASA 1G9TA 3OZXA 4ON9A 4Q47A 1V16A 1S3IA 3DLPX 5ICEA 4EDFA 4I1PA 5CGZA 1K0UA 4C2UA 3QXSA 2XV1A 4DT1A 1NSYA 3TIFA 3LPLA 2I7DA 1VFNA 3VI4B 5LR6A 4YJHB 2GTPA 4KLNA 3WHPA 4KDRA 3TSWA 1KNXA 4PAMA 4YT2A 2VKQA 3NIGB 4ZOEA 2NVWA 2HH9A 1Z26A 4LPSA 2C5EA 3IUYA 1QFYA 1UC4B 2DVMA 3WNZA 5SY9A 4CMGA 5C1OA 5M5BA 4NYMQ 4W7SA 2C7OA 5F9HA 4BB9A 1EGVB 2DG2A 2YN4A 4DM4A 3RHSA 1ZOSA 2O2IA 4AMGA 4DLWA 3EZGA 1Q6YA 3B36A 2AEJA 4DR3B 4TUYA 4KRGA 1P0MA 2GK6A 1KPHA 5FUXA 3N58A 4E6PA 4M7PA 1UPUA 4BMNA 1HYHA 1J21A 1FLDA 3QTTA 2JAHA 1KI6A 1V96A 4XIJA 1SVSA 1UKBA 4KPFC 5ALRA 4BZQA 2IYFA 4QUJA 4YCSA 4KWTA 2H85A 1JALA 5DO9A 3QRWA 4BP9A 4JI8B 3FTQA 1GGJA 2CNLA 2RH5A 4F8JA 1CNMA 2WJ3A 5EQFA 3JZIA 1ZN2A 5B7NA 5L3SB 3OIUA 4DJFC 1CTQA 3WA6A 3G6KA 3NUGA 5CVCA 3DMHA 1D2MA 1W2GA 3X2SA 5BW5A 2FJ0A 4MMYB 2WTMA 5EKSA 4KPUB 1O9GA 2PNFA 4FXPA 3OWXA 4LRUA 3C3XA 1VYUA 1W76A 2RBGA 4JK3A 1LTQA 1D6MA 4FNMA 2GFQA 2HCTA 3N0WA 5TGZA 1H93A 1DO2A 2F17A 4ZAZA 3D6MA 4Z4FA 2XRMA 1I32A 3IDOA 4J0DA 3E3OA 2C8VA 2DCMA 3GEHA 1VIVA 2Q3EA 2D1RA 1SG6A 4HFJA 2AV6A 4Q16A 4P80A 5CDGA 2E37A 1A8IA 3HCBA 2VRCA 4EPWA 1ZCJA 3MERA 1C7FA 1T9KA 4TM7A 3FDJA 1I24A 4XQ0A 3T35A 1EM6A 4ZOBA 2LR0A 5IH7A 3FF1A 4KPGA 4MJXA 1G8HA 5DMHA 1SZPA 5T57A 2PTGA 2ZJZA 1BCSA 1Z5UA 2BKXA 2PGDA 2CXRA 3ZLVA 1HZZC 4F97A 4NJOA 4R83A 3R7AA 3CWCA 2P5TB 3GGSA 3HFSA 4R84A 3WLQA 1FFWA 3DOIA 1OH8A 3LYAA 1X9HA 5KYGA 4G56A 3JQPA 2P69A 3KKEA 2C7GA 1E0SA 2YHIB 3R23A 4KNYA 3NOOA 3H9BA 5M04A 1YHYA 4I19A 1NYTA 2VH5R 5E2BA 2I7TA 1J8VA 2J4CA 1QV6A 2PKXA 1Q15A 2PWAA 4ND8B 2F3PA 4PO3X 3HO6A 3WMWA 2PHZA 4KE8A 4LJAA 3F3SA 4FE3A 3GLIA 3OLCX 2XMZA 2H1WA 7AT1A 4WIAA 1JTVA 4LBVA 4M87A 1HK7A 3PDIA 3S1AB 1MVLA 2Z08A 1ORTA 1KY2A 3ED1A 2VOJA 2C9BA 5BWBA 3BK1A 2ONZA 4PLGA 3ZLTA 1CZKA 1FRVA 2E87A 3EFEA 4QVKA 1B0AA 3DE7X 3EAGA 4Q01A 4Q5IA 2O3UA 1N9GB 3FKQA 3RBXA 1CDDA 1SUIA 2OILA 3QBTA 1EFRD 1C1YA 2IOFK 2JAPA 1U90A 5FNVA 3N2KA 1K7SN 2QE6A 1XCJA 3OPNA 4KK3A 1IPHA 4AY3A 3F9IA 4C3VA 1ZK0A 2UVDA 4NENA 4Y98A 3RHFA 4LCJA 5CM2Z 3U39A 4DLNA 3N8HA 1ID8A 4DTCA 2EARA 4GVLA 3KALA 2Q07A 2Y8EA 4S1PA 2D8MA 1ZN7A 4EKIA 2QM3A 1D7OA 4FOSA 4L85A 1N5IA 2GCEA 2ZWAA 2LDXA 4K9MA 4Z2YA 3WKCA 1Y5LA 3BEOA 2GKGA 3FZQA 3CPJB 5EWMA 1Y3HA 2ADOA 4PC6A 1QAOA 4D0RA 1D7AA 5JZMA 2IGTA 3KVYA 3AKDA 3F6SA 3R3XA 1AV7A 1XZPA 5B57C 5CBPB 2BCJQ 1XNQB 2C95A 4OOFA 4FQ7A 4QTXA 1Z0UA 3C3JA 3HZRA 2XDQA 6LDHA 5A6SB 2ST1A 3JASB 1KZGB 3HV2A 2CHFA 4BX0A 4DY4A 3SJAA 5J4VA 3M3PA 4TYYA 1PR0A 2OO7A 3AHFA 3STXA 3QEKA 3TZBA 3N9IA 1GTZA 4HNSA 4CMIB 1T1RA 2FWNA 3E7DA 3N2LA 3H9CA 3DF7A 2XBUA 3PJGA 4LGVA 4MIEA 3BH6A 2GAJA 3EGWA 4PAOA 2QG4A 3GPCA 3QYFA 1WE2A 1NC1A 2VP3A 3HP4A 4K40A 1E63A 2HA3A 5HQJA 4ESEA 1GNPA 4GPEA 3W2FA 1JHQA 4ESOA 5TMDA 1LCIA 2NUTB 3FHJA 1TDJA 1IY0A 1LUAA 2C3UA 1Z73A 2VWGA 3CH4B 1HTBA 4YRKA 1CKEA 4BECA 2GPSA 1NWHA 3PEEA 1RYZA 4O4JF 3E61A 4NZYA 1IM5A 1Q1BA 2Z98A 4BGVA 1E9RA 4DRXA 1A8SA 5KQPA 3LFUA 1XJQA 1U2GC 3C7KA 3OIDA 4O29A 2WWRA 1SBZA 1CQWA 1SN7A 2JS7A 3PHLA 1UC9A 2PT5A 1QAQA 3NOQA 5HFJA 1KH1A 1R4AA 3TTTA 2O5RA 2QZSA 1KFJB 3O1JC 1QYDA 1YCFA 1PJTA 2AJBA 2XQKA 3C43A 4RZ2A 3SYTA 4F2DA 4Z7OB 4Q4AB 2YVKA 3GUZA 1HSZA 1TW2A 2IPXA 4WW0A 4AN4A 1OXSC 2VP4A 4E4TA 3HKDB 3ONDA 4FFBB 4REMA 2G9ZA 5G1NA 1XPUA 1X1CA 2HJHA 1NASA 4BU0A 1RHMA 1XHEA 2Z5VA 4K1LA 2Q4OA 1YZNA 3GD5A 3M4ZA 4MCIA 3E81A 1G5PA 1T0UA 1VG8A 5K8UA 1NFRA 1SCUA 2QWXA 3B6MA 1U0JA 3TECE 3QV2A 3MLBA 3UM9A 2EIXA 5TMPA 4DV1B 1BHJA 3NAMA 3E22A 4EUSA 4J29A 1KQGA 3RO7A 1UJ4A 2VHZA 3E4CA 4N3BA 3DV0A 5ERYA 1J0AA 1L7OA 1MZVA 1TJPB 1VXOA 5E8RA 1KIAA 1QXSA 4Y2GA 3AEKA 3R3YA 1OAOA 4KQJA 3OZ7A 3DMDA 3H2GA 3R24A 1W7AA 2Q5LA 1R0WA 1GTSA 4WBNA 5C2JB 1N4AA 2ASEA 1MO3A 2FP4B 4L6IA 2ZRAA 5JHHB 3QWAA 3EZNA 1X1TA 2AUMA 2E49A 2HV9A 2DFLA 1E18A 1POXA 1DEHA 2AIRA 2IELA 2YWRA 3HJRA 4GOKA 1GM5A 3DC2A 1RADA 1YRYE 1SKUA 2HLNA 2CZCA 1LNQA 1BIFA 2BM1A 5DNWA 1LEHA 1G8JA 2FR0A 2WJZB 2B78A 3C8MA 4ZTZB 1SQGA 2H0RA 3QMWA 4JLWA 2WWIA 2GYYA 4M1MA 2C9MA 1MAAA 3WSWA 1EP3B 3PCTA 1Y3IA 1JEQB 5I3CA 2QN3A 5TEVA 4DLPA 2EFEB 2YWEA 3WJAA 3BMNB 3O8QB 4S12A 1XCGB 1K86A 2ECQA 3DDNA 3CEJA 1ZM3A 3NR2A 4QPZA 1SC1A 1QM5A 3AB3A 4NICA 1E66A 4LYDA 3BGIA 1RU3A 2BJVA 3GEBA 4J3JA 4OUDB 3M5DA 1Q1ZA 1BE1A 1OJ7A 3AFOA 4K9PA 3WOVA 5DSZA 2VHUA 3AW9A 1G16A 3DP7A 5ITZB 2JCGA 3K3PA 4RK4A 4X6UA 4BOYA 2V7WA 2BE7A 3ESBA 3B60A 2BDTA 4X1YA 4YB8A 5K09A 1NN0A 1KIMA 3DEJA 5KTNA 2EDAA 4W8OA 5AJXA 4F3KA 1V45E 6REQB 5BV1A 2QGZA 4GX2A 4JEHA 1NVEA 4PSUA 2VA8A 3DZKA 1THTA 4ASUD 3ABZA 1QHFA 4JQCA 1XQVA 2D2FA 3RJTA 1SQ0A 3HLTA 4HAWA 4Y6SA 1UOPA 2CGEA 4DOMA 3GQBA 4US1R 3V46A 2NIPA 3AESA 2B2CA 1HV8A 1SXIA 2BEVB 2NYUA 1X92A 4QM7A 4IUYA 3IMKA 4MJLA 1Y4UA 3SJ7A 1BDJA 4F9TA 4E32A 2QKYA 3WAJA 1A9YA 3S5JA 4LHZA 3B9PA 5KOIA 2JFOA 3ML1A 3A28A 4PFJA 1AQYA 1Z6XA 3KPYA 2YXLA 4JA2A 2HI0A 4UCWA 2WMYA 1NU8A 1H0KA 3BMQA 3RF7A 2HK9A 1OGIA 4CM4A 5BVHB 4A6EA 1E2JA 4JLOA 3ZWNA 5LMNB 3ZCPA 3EPJA 2ZB4A 4PYRA 4EG1A 3NV9A 4MGYR 3WA7A 2L19A 4E5UA 4NYMR 4QBKA 2BSQA 4IDCA 2MU1A 4QRIA 2DFNA 1LBHA 1KSFX 1X94A 2I4IA 3HJCA 1C3VA 1ZJZA 5ICFA 1UANA 2B6NA 2R97A 3CRRA 4OXKA 2Q6LA 1XA4A 3A9RA 4NOLA 4KVFA 5CK4A 4Q3KA 3GRZA 5JNWA 1WUJS 4PO9A 2HL6A 2OA0A 5C46F 1J8MF 2L17A 5DBOA 1W4RA 3TE6A 3OQHA 3DBRB 2Q5IA 2IX3A 4G4JA 4ZVTA 4B87A 1CRLA 1CE8B 3MTQA 2AZTA 1V1RB 4JB3A 3EULA 4POOA 4IIBA 4YRCA 5EZYA 2VHTA 1KK2A 1MV8A 5FADA 3QUBA 3KPUA 3M2TA 3IQXA 3NDPA 4MWTA 1E6UA 1NPDA 1TADA 3CW2A 3GLHA 4JY7A 1WHTA 3AG5A 3H65A 5FBQB 3UJ7A 2QZZA 3VO9A 4BWFB 4E3ZA 2NU9A 3CMCO 5LLSA 3TB4A 3VO8A 1VLZA 2FG6C 4B6EA 4RZ3A 3TBHA 4PAWA 1E6LA 1S3GA 1ULBA 1WCYA 3C5CA 3OAAD 4NDAA 1DX9A 3NANA 3CLSD 3SD7A 3ZE9A 4BMXA 5K8VA 3D1JA 4BP3A 1SVKA 3KB1A 2ZP1A 1OIWA 3IBFA 4HBGA 2QP4A 3FCUB 1H2ZA 4WK6A 4JJ8A 1YR1A 3TQRA 4MDYA 3FGPA 2XWQA 1E3IA 2RH4A 3HDQA 4XM1A 1NXWA 1PIWA 4KACA 4B8ZA 3OTOB 2BM0A 1OHHA 1NJ8A 4CMEC 1KJZA 3CZCA 3I04A 4FSDA 3V32A 4LY3A 4ZZ1A 3L40A 5F1YA 3BIJA 1PD1A 3ZGNA 3FX2A 3SYNA 2X2FA 5J58A 5IS2A 2XOXA 3NWBA 4LF4B 1CS0B 3P1JA 1Z0ZA 3GZTB 2Q28A 3AUYA 1G7SA 3CSDA 4MICA 1X7WA 1QIMA 4YP1A 3P4YA 5HF5A 4RY0A 2WWVD 3ZOZA 2C2MA 1AHNA 3U3RA 4CLRA 2IK8A 4RJLA 5I7HA 1DAMA 1DWQA 1XLTC 4A8JB 1CEXA 4ZMBA 1SA0B 4MZDA 4AUMA 4CUJA 4H0FA 2WTUA 1P4AA 1PJ3A 2D5CA 3G17A 1OASA 2PV7A 1U5AA 2ZVPX 2BYTA 1SCBA 2HF9A 4YRBA 1QO7A 4BCCA 2X5XA 4DA9A 5ARCA 4M54A 4R0VA 2LTAA 4LRQA 3BYZA 1XCLA 2D59A 2ZCVA 4MS4A 2FPOA 4W5OA 3PNPA 2LV8A 4IDOA 2I3AA 1BX3A 3H2KA 4MR8B 4FB5A 3ODPA 4KQCA 1FVXA 1ZBDA 3N86A 3V3KA 4JN6B 4N5MA 3RIEA 3S7ZA 1KO4A 4PRYA 4C87A 4ZARA 4ZQCB 4XPIA 4E07A 3R6DA 4EZBA 2GNAA 4LF8B 5FNZA 6NULA 3R2JA 1YCDA 2VN8A 1Z9BA 3QBDA 3KQMA 2VATA 1OGJA 3SQNA 4IG4A 4KKXB 2BGTA 5BNFA 4EGQA 3KRTA 5CVDA 3OQ6A 3PGJA 1R1DA 2ACWA 3EAFA 3GG9A 4GYJA 1KEEB 1SB9A 2O8FA 2WD9A 3W34A 1RR6A 3TJMA 3GQVA 1SUFA 5A0TA 1Q12A 3ZE8A 1FDTA 3MCWA 5ECGC 4TZ6A 4LG1A 2AZ4A 1J70A 5F7XA 4DR6B 3PLAE 4P36A 2Z57A 1JDPA 3DOCA 4G1MB 1Z5GA 1SHUX 2AW3A 3IDSA 1W5TA 2B1RA 1NMEA 1TVEA 2YJNA 3QGMA 3VJLA 2X19A 3ZUPA 2D54A 1TJYA 1Q0LA 2PXHA 1EXWA 3JQGA 3OOEA 3G59A 2PX6A 3A1VA 1VQ1A 4CQMD 1YDFA 3CH6A 2B5WA 5EHQA 3VZCA 1YAJA 2XD9A 4RZSA 3O8OB 2MHCA 1GPJA 1YR8A 3LM8A 4LCEA 1D03A 1GILA 4TV8A 3U7IA 4KR7A 1KVQA 5FV4A 1VHDA 3HXLA 3O4IA 1OKKD 2IUEA 1M7HA 3NTXA 5FLKA 4CIWA 4I14A 2ZJ1A 4HRYA 5DBFA 5KDLA 1R5NA 3WZMA 1U8XX 1PZFA 2FEMA 1ZFNA 2FVXA 2UYHA 3BMCA 3CZPA 1UOEA 1Y8ZA 1HTWA 2R5NA 1K92A 2P8SA 2WSSD 1O6BA 2AW5A 2PZLA 4M1SA 3MPOA 1N6RA 4YI5A 2VHEA 1EWYA 1N5RA 3KKMA 4ANFA 2O2JA 3HJAA 3OLQA 3QLVC 1XXHE 2Q4EA 1AKNA 1K8RA 1L5HB 3Q3CA 4JNCA 3TLMA 4LMRA 4MINA 3GLKA 3VVMA 2AWNA 3BAFA 2PWPA 5LDGA 3D5TA 1V0JA 3ANTA 3QBJA 3VC1A 1MB9A 1KBZA 2FEAA 1NLFA 1CRZA 1Q11A 3CHYA 3ND9A 3ABQB 3HYLA 1X38A 3GWZA 1RTTA 2I76A 2XWJI 3HVJA 5FTNA 2HLDA 3L18A 2WUDA 1FQOA 1UMCB 4TT8A 5D87A 4HQNA 3EEYA 3LYUA 1JVBA 1B3BA 1Z6QA 1UUFA 3L5KA 2JZOA 5EI5A 1MJ5A 3TW8A 5HDBB 4JYAB 1FYWA 1W0JD 3DAOA 3O38A 5KNBD 3E23A 2QQGA 1GCUA 2AR0A 2ZPUA 2WMNB 4P4LA 4BVGA 5L7WA 4BNMA 1C7ZA 1F0YA 4Q3EA 2RGCA 4JJEA 2J3MA 4GPBA 1QGAA 4PCVA 5HA5A 4GDMA 5FD8A 4QASA 1LVHA 1ZGHA 4MWOA 3HK2A 3CCCA 4OGLA 2ZIXA 3WYGA 2QT0A 3NTRA 3RYIB 4EGCB 1Z37A 1GYQA 3PFCA 5IP5A 4KUEA 1AMOA 1U2ZA 1NATA 3WLPA 1VSQA 1ZIYA 3BULA 3EUAA 4NAUA 4BQEA 3E1GA 2W6OA 3HU1A 2ZRGA 3WGQA 3VYWA 3J80A 3VNRA 2PO5A 3URKA 1NQAO 3O8DA 3ADBA 2OHOA 1F6BA 1T5SA 2ZR9A 1WSDA 4Z3OA 1L4FA 1Z0DA 3VOSA 2WDPA 1Q91A 4KGZA 2ZJ5A 1IIBA 4B0PA 2ZRMA 1QP4A 2PMFA 4EFDA 1L4MA 3RS8A 1EUCB 2G1KA 3KVVA 3R6TA 1G38A 3L8DA 2IOHA 3C70A 1TTPB 3HL0A 3EXIB 2QD3A 3VSDA 4DPKA 4ZU3A 5A9RA 1ULUA 1IBCA 5EKUA 5FTKA 4BKRA 4MNTA 1TU4A 2QN2A 3S1SA 1I5OA 5J4HA 1DB3A 4HYTA 1RPJA 4NY1A 1OTXA 1Z4PX 2VTVA 3T5AA 3KKKA 4RTJA 2B21A 1ZK3A 1ZNQO 2OGTA 2ZSHA 2AEMA 2NXWA 4H77A 1RWNA 4ZT2A 1JHPA 3DXYA 4Y2RA 2FFBA 1VYHA 3F4LA 4MHOA 2D74A 1OFUX 4P7JA 4EPRA 4PGFA 1BE0A 1V39A 3AUTA 5AJYA 4CKCB 1P44A 3EOAI 3H8JA 4FMCF 4EPVA 1C80A 4OGKA 1A95A 1DU4A 1JFFA 3L7OA 2FMXA 3NGXA 1Z0AA 1PWXA 3R7WA 1EFPB 3BHNA 3Q1LA 4ZANA 5JH7F 1BMQA 1Z36A 3RSGA 1T91A 3MJ4A 2IDJA 2ONKA 1TZBA 5K6TA 4DLUA 1PV2A 4M0KA 3X2FA 3TUZC 3F3MA 3FSRA 3JZFA 2AOVA 2JBAB 4TWRA 2X3UA 2FPUA 4NU6A 4BLUA 1Z47A 4G1CA 2FEXA 1R00A 1Z6GA 3KDAA 5IC6A 3WGVA 4IP0A 4DLBA 1W8DA 2G80A 4EL5A 4YUYA 3ZQ6A 3T52A 3OFVA 2PZGA 3FHOA 1C0LA 2EGUA 2O6HA 4GSYA 3V8VA 2O8DA 1RI2A 1LBEA 1XV5A 1Z16A 3BFVA 4QWMA 1VI5A 3HCWA 3GZ4A 1DINA 1SHJA 1J33A 4L28A 2I8LA 2SBTA 1LI5A 1VJTA 5JARA 4IZOA 1WDMA 3A32A 2BKAA 1ZM7A 2C0QA 2EKQA 1DIAA 1RWBA 2WZBA 4I99A 3CH5A 3ETNA 3QOFA 4S0XA 2VOEA 3ZWCA 3P2YA 4AJOA 2AEFA 4F60A 2Q4TA 1NJ2A 4M8LA 2FWAA 1GY8A 2PXXA 3VR5D 3FROA 2JGDA 1O4WA 2AQIA 2CEKA 4RD3A 1FFDA 1WABA 1X13A 4WPGA 4QJ4A 4C4TA 4L4ZA 4DDKA 2PZFA 3THSA 3DL0A 4DMCA 1JZTA 3IQWA 3EBLA 4XYBA 4EWLA 2YWHA 2WBLC 4D9CA 3A31A 2YYZA 3LH5A 1J07A 4BFCA 5BQFA 5HBRA 1IHPA 1Q83A 4CODB 5AVRA 1GN8A 3AF1A 1JDZA 2O6LA 2QORA 3MT0A 5KNCA 3RH0A 4X62B 2I87A 4CNQA 4WZAA 2FPRA 2ZK7A 3ZGYA 4LCBA 1P5FA 4MQEA 3WLRA 2F7SA 1P1IA 1XVUA 2ONJA 2ORIA 5L51A 4RVDA 3RC1A 4Y2UA 2JA1A 4F71A 3MLEA 2MJLA 1ZINA 3O90A 1HRDA 3TI7A 5JNVA 5EYPB 3NHJA 4V0LA 3O92A 5EIFA 1EM8A 2I9KA 4QHTA 3AR8A 5BWLA 5IM4A 4U00A 2UUAB 4IFBA 2GD2A 5L4SA 2ZR0A 3VNSA 1Z2CA 4JLNA 3QLUA 3MJEA 3L6OO 1LV8A 2CXNA 1JKJB 3BIOA 2CVOA 3QLTA 4FQ8A 4Q9NA 1XYVA 4OY3A 1BCRB 4MEBA 4MRMA 4LHSA 2CYCA 4GYKA 1UFKA 4LC9A 1ITZA 2VDNB 3RU9A 2V3CC 4OL9A 2H9IA 4IDQA 4ED9A 4ZT6A 1EAMA 2KX7A 3RASA 4DUGA 4ZALA 3R4CA 3GNLA 1DC7A 3WK5A 1SXJD 2BWJA 1IONA 2QPAA 2F9LA 3EEOA 1KDYA 3OQIA 3PI6A 2J4DA 2GBIA 1B6GA 1T2VA 4R3WA 2HXYA 3OMLA 5EIEA 2FPIA 2CXQA 1KA9H 2G71A 3MFQA 1AMNA 1IB6A 4EG4A 5CUQA 4IIDA 1W85A 1G64A 5A9SB 1HNNA 3T9EA 5TT0A 2J3LA 2ZT6A 5F51A 3FETA 4Z5XA 1AGYA 1KMHB 2VCYA 1MH1A 1Q22A 4HUTA 1U1IA 1Q74A 4I08A 1PX0A 2BR5A 4M4SA 4NK4A 5HRCA 1NI4A 3S2SA 2PSDA 1OGYA 4RA6B 3TG8A 4AI6A 1ZPDA 1BFKA 2J3DA 4HDKB 5DBHX 3HDJA 4UCXA 3ANLA 5FNVF 2O06A 5TQ2B 3D3JA 4N8DA 3VH1A 4JJKA 2A1TS 1A1VA 1UFVA 1U04A 1RCTE 1NR7A 3SP1A 3C5HA 1IOWA 2IPOA 2IHYA 1RFGE 4P93A 1YA4A 1TCUA 1FRFS 1A0OA 3KE8A 4IOJA 1PVVA 1QDUA 5ALLA 3FMVA 5EHIA 4N9WA 4QTTB 1QHGA 3BRQA 5DN6D 3V48A 1CZUA 1U0SY 4YJKA 5FBRB 3D81A 2OFFA 4OXQA 4ID3A 4MPRA 1H05A 3O8BA 2W6QA 1FNSA 4M22A 4NBNA 2VRBA 3VTFA 3COVA 1L8AA 3U44B 1T4CA 2VJNA 3L7IA 3ZK7A 1A82A 3LPNA 1CYEA 3NHYA 1KMMA 4FNOA 4C06A 2NZXA 3O03A 1REQB 1C9NA 4LRWA 4YREA 8GPBA 1NIPA 1P1RA 3QKSA 4OU5A 5TQ0B 2QX6A 1HM5A 2EAUA 5TQVA 4Q4JB 4NJMB 5FTMA 1F3OA 2EKPA 5EJ6A 3KOYA 1SIUA 2PKQP 2WPDD 3NIWA 3ZHCA 4H60A 2OZLB 2LBPA 1YL7A 1OBOA 1M2VB 1N0VC 3L7YA 4O2AA 1R3DA 1HFWA 2VKTA 2O0MA 4P7KA 1DJNA 2J0EA 4HLQB 3ETHA 4PICA 1QMPA 1J39A 2PV0A 2GPNA 3O91A 3NVMB 2PJRA 5B2ZA 4E11A 3ZQ4A 3CNOA 1FS4A 3A0UA 4GLOA 4Z0NA 3WHIA 3CGWA 3C6XA 3TSYA 4ZZIA 2DEUA 5JAMA 5F3WB 2O8CA 1JRLA 5SZIA 5JQGA 1PI3A 3HXMA 1FSGA 1XFAA 5A7GA 3DL4A 5E7IA 4KLRA 1G8AA 1NY5A 3B5JA 4H1TA 5GMOA 4BKOA 3F0TA 1S8NA 2L69A 3O8LA 4MP6A 4B43A 1F5SA 4IZIA 4FFRA 3G0IA 1LPSA 4C4SA 2Y93A 2AN3A 2MTBA 4Y67A 1QR2A 1HZZA 1XTKA 3H1EA 1MEJA 1M83A 5K8JB 1EEXB 2XUGA 1I7NA 1JKIA 2WUWE 3BL8A 3QBEA 4GXNA 5FBZA 1UBLS 4J90A 1E0JA 2A33A 3P9IA 1WOYA 2XVYA 3QF4B 2NU7B 3VH4A 2FX5A 3KYJB 3IXMA 2AFHE 5BW8A 2ZAIA 2P4EA 3LVFO 2J5RA 1RKVA 1AZLA 3KTAB 1SRRA 521PA 3ZHSA 3VOTA 3W06A 2XWBF 4LNUB 3GAMA 1OLUB 1SGWA 3OM1A 4MLDA 1OXKB 1K97A 3BD6A 3C15C 3V8PA 2VYFA 2IYQA 3OJCA 3AIMA 1GCIA 4UHKA 4V0KA 3USES 1X7YA 4V0NA 1TIBA 4EA6A 4K6KA 5T3YA 1QG2A 2P7HA 4L4UA 3HVKA 3PTLA 1RWXA 3CXRA 5K20A 1KI2A 3OFKA 4TTTS 4GLFA 4N47A 3CGGA 4Q19A 2W6JD 3TQTA 1O54A 1FX1A 1P9OA 4RA9A 5ALEA 4B34A 1YDEA 4IO1A 1GQRA 4IS2A 4L8YA 3KQYA 3QG5A 4P8RA 1TX4B 4IVPA 4L07A 1IQ0A 4NMMA 4ZYXA 1CHDA 1H6BA 3HUTA 1LPPA 4ZEVA 1NG9A 1C9JA 4WCFB 2NNWB 4ZWNA 3OHSX 2OFOA 1P2GA 3NYWA 1B73A 4LVCA 1AVTA 4UTXA 3EXG2 1P60A 1I1NA 2GEJA 4J75A 3RVMA 3LT0A 3PYMA 4WLEA 2QP3A 2WIFA 1EVZA 1U3FA 1JMYA 1FUEA 2RKWA 5DM60 3TMKA 4PV7A 5AM4A 3VNUA 1E5QA 3INNA 4AY2A 3OECA 5BV8A 3ZV7A 4LWOA 1W1UA 1C0PA 3ME5A 4L8GA 1C4OA 2H65A 3ISVA 1Z38A 4Q05A 4EGAA 2JJYA 1N7GA 3RWOA 3IODA 3VZPA 4E2XA 4HNQA 4LVUA 2ZTVA 1L5YA 2WNHA 4G67A 2J0UB 3PNBA 3OEEA 1G8MA 4B35A 1HFEL 4NMWA 1IMJA 4L27A 4B3CA 2WT9A 4EKDA 3ZI7A 4YMVA 3IQGX 5P21A 1DFGA 2HSWA 2ID9A 2OCAA 4YUWA 5LOVA 3OTHA 4YRLA 1VRWA 5HP4A 1JKMA 4HEJA 2FWJA 1N7HA 2W6ID 2AA3A 2Y76A 121PA 2XCIA 4XAQA 2FZLA 3LC7O 3KBBA 3CRNA 2C31A 5IVPA 2VAVA 4PZDA 3FKSD 1N32B 1VJDA 4ZI5A 2FMIA 1JE0A 2GZSA 2C4WA 2D1QA 3DHWC 1KEZA 3IEVA 2KM1A 1N2EA 3HVHA 1VCHA 4XWKA 5CFQA 1E9VA 5I4KA 1JIXA 1RQNA 1ZD4A 2VPIA 1XMXA 1TQHA 3JQAD 4NVRA 1Q3TA 3UATA 1GYRA 4PSDA 2CCGA 1O0SA 2GJAA 3PWTA 4H1HA 2ZJ4A 5DXJA 1NBME 1WTCA 1OXVA 1U2GA 3SZRA 1JHMA 5HKKD 2JRLA 3GGOA 4PG7A 1NRXA 5FBKA 3ZZMA 2DXIA 1EDDA 2BGJA 4HWTA 4ZQGA 2WIBA 1VE3A 3JXEA 1ZC4A 1U2PA 3BA1A 3KLPX 2AC4A 4Z0PA 2ISCA 1DRWA 1ICEA 3A1FA 1Y1RA 2ODPA 3GVIA 3HWWA 3ND6A 5DE3A 3W4JA 5JWRA 4N7RA 5IC5A 1G20E 3GP5A 3H5OA 5LYJA 4AYWA 5TRTA 3BCSA 4HNHA 3PHHA 3T7EA 4HWRA 4RM3A 2WKSA 2W8ZA 4IF6A 1DZIA 2JGKA 2VT3A 2R4TA 2VK4A 2XQVA 5C9ZA 2CV0A 3NOVA 2FP3A 4GPZA 4PM4A 3T4PA 1DNPA 2ZGVA 3WLNA 4D4JA 3GFQA 1ECLA 1WUTA 3M6IA 3ETDA 2AOUA 2C1XA 4ME6A 1PR4A 4PYIA 2I6SA 1M2OA 3R3VA 3H0KA 3HPQA 4DF3A 4Y6RA 3COPA 2ETXA 3PC4A 1RJWA 1ZOOA 2VDOB 1RBQA 4P4SB 1BE6A 2XRZA 4X7RA 3EIEA 3SS9X 3JQ7A 1SCKA 2A9QA 1NUSA 2PH1A 3DEFA 3I76A 3PDHA 3AETB 1EIZA 1GADO 4H17A 3W5UA 5K2OA 2X7XA 4H1VA 1GU0A 1R66A 3BRSA 3SWWA 4YUVA 5EIXA 2DUJA 3KLOA 2D6FA 1CSEE 1RPNA 3CN7A 3HR8A 4EG7A 3DE6X 3LY5A 3P52A 1MQAA 3FGZA 1UK8A 2RH9B 1ZXBA 4GSLA 4P0QB 5KYWB 4HCJA 3AJ9A 1UMBA 2MSDB 4BWYA 5LCXA 5TB5A 4UAGA 5CD9A 4IDNA 3ZYZA 1GGEA 4TXHA 1PRYA 5D85A 2GB4A 3AUJB 1JR6A 4TMXA 1H69A 4FHZA 4E5SA 4NCAA 1ZM4A 2ZTMA 1VP9A 1B74A 4G4GA 1KFBB 3EVEA 2G8NA 4DDTA 3ILVA 3U2QA 4BVLA 3U7GA 5DRYA 5GGYA 4C22A 2RGWA 5SZKB 1L5RA 2E3JA 3KU4A 4KODA 2HSJA 3BXPA 3LXMA 5BUZA 4LK3A 1VI6A 3VR1A 3FBWA 3GT3A 3HA7A 4HP8A 3VDNB 3EXFA 1FXSA 1ENZA 1V8BA 2ZIEA 3G8AA 3H86A 3T5GA 3TD6A 1FFGA 5F4BA 1Z5VA 2VLIA 3PIDA 4ZODA 5J40A 2PUEA 2ADFA 4ALMA 2DU8A 3QPUA 3U4HA 2OHVA 3VNVA 4HZGA 4V39A 4W6ZA 1QQTA 3A6JA 1UBRS 1MAHA 1GTG1 2P9YA 3P7MA 4J7CA 1CF9A 1E3WA 4RHXA 2XMSA 4GI2A 4Q4HA 2CL5A 1G8GA 2BEJA 2FPLA 3NNNA 5IAAA 4QGSA 3HZOA 2JC3A 3SQOA 1YJ8A 3WWZA 1X0VA 2AMYA 2ERXA 1G21A 1QAMA 3RK1A 4A4DA 4D25A 4TLBA 2XXAB 1L5FA 1UP7A 3ZCQA 4RFVA 1PZMA 2PX8A 3HR7A 2ZTLA 1CC1S 4JZYA 3GJRA 4I1IA 4E1VA 1GR0A 1TMKA 2ORVA 4CFSA 2C07A 4YC7A 1SELA 1XRNA 3IHLA 4EI9A 4BKMA 4N76A 4DBZA 3ACBA 1DG1G 2VXYA 4JVMA 2WNSA 3C74A 2GZAA 3CBGA 3OF5A 1XCBA 1C2YA 1PV1A 3UANA 1FU4A 2BGLA 5CAEB 2OAGA 3O26A 2EJVA 2Z58A 4RKWA 1NVGA 1EJ6A 3G9TA 5AKJA 2A88A 2GWRA 1ZVMA 1OCEA 3EQ9A 1BD3A 1OFGA 4H7DA 1EJ2A 3EAQA 2BR3A 3EK2A 5BPHA 1IG3A 2P5SA 4IINA 3U4QB 2V5UA 1HFJA 3CLTD 2BMFA 1T9BA 1SPBS 1I30A 3I58A 3IKJA 3MOSA 2PGXA 2O1EA 3CBQA 1S7CA 5IJ0B 2RAFA 4UBKA 1PF7E 1FPMA 1X70A 3N3BC 4OBWA 2ZUDA 2FW6A 3VR4A 3EFOA 4E94A 3PFNA 3MD9A 5BQPA 2IUSA 1M67A 2PSSA 5L4LA 5E3JA 4JVSB 4PF1A 3W9UA 3SFZA 3UJNA 2WFAA 4LJ4A 1JDVA 4OQFA 4Z9YA 4WJLA 2Y66A 3ENVA 1UC5B 4B1FA 4PNEA 4TV8F 4M1WA 4URHA 1BWPA 1KBOA 3KB6A 4ZMRA 1FBNA 2FSUA 2R1TB 3WGOA 1RLUA 2F2TA 4O3MA 1U7TA 5JSZA 1NXOA 3KQUA 2XCRB 1I33A 1XTQA 4PC7A 1T5IA 3MT8A 2A5JA 1VBKA 2ATXA 3KOWA 5JO0A 4UARA 5FOUA 2HGZA 2YVAA 4YROA 8LDHA 3W4KA 1IMOA 1EWKA 3QJ5A 1DLJA 2VTKA 5BNIA 3U19A 3TTWA 3U4GA 5I4BA 1JDBC 2PEYA 3Q3IA 2YINC 4LQCA 1Z33A 5H9WA 3G2NA 3IBYA 3Q5GA 4E1AA 2YJ6A 3HCRA 1AGXA 2HHHB 4RZHA 4JUIA 4HX5A 4KR3A 3AH8A 2C7BA 4M6WA 1EGQA 1GNVA 4M86A 5HHTA 1MD9A 4BX8A 1KO8A 3IA7A 1KZ9A 4CMEA 1M8GA 3DAPA 3C45A 4UEWA 5K2MA 4BJ3A 2HT1A 2DT5A 3MRVA 1P1KA 3HLYA 1GA6A 2ZBQA 4NMXB 3ZIDA 4W1SA 1U1CA 4N0MA 5IARA 5FIUA 2P9EA 3RUIA 2UUBB 1R6AA 1GPWB 3MSCA 1PUXA 2XUJA 2H06A 2NZJA 4AZ3A 2CC2A 3RF6A 5BWOA 2AJCA 3FSEA 3GVXA 3EGXA 4YJDA 1WXXA 4CV3A 5B6IA 2D7DA 4AP6A 2NX2A 2PKCA 3IFSA 4MA5A 1I36A 1XLTA 4P83A 3HXQA 1AKWA 5LXTA 2EXXA 2YWJA 3UAOA 1XLUA 5G0VA 1JT9A 3SZGA 1I7DA 1W4CA 1LW7A 1P80A 2C96A 4FGLA 1W5AA 5DNCA 5DCLA 4LFAB 3EYAA 5AH0A 1W75A 1ISMA 1U9CA 2XQGA 5DHRA 3N2GA 4YUZA 1U98A 5E3IA 1D0IA 1Z08A 3CQ9A 3NLLA 3NJ4A 1NT4A 4QECA 1H2BA 4PG4A 2W7TA 4D57A 1P18A 4KSBA 1COZA 3UJ9A 4G36A 1UEXC 1Z82A 2HYDA 4YHBA 3RV3A 4RCZA 4LIPD 1HOXA 1E9AA 2PH3A 5JJKA 3T7DA 2PD3A 4YCBA 2FGJA 2CV2A 2GDZA 4GUAA 3FPCA 1TLTA 2H63A 3CUYA 3S8EA 3KTOA 5IJZA 2V6GA 3ZIAD 3W6NA 1CP3A 2RJNA 1YQGA 5EJ2A 5DLYA 4IO0A 2O9JA 5CEJA 5BSUA 1YR3A 3DD5A 4JL5A 2QG6A 4KDEA 1FFBA 2BZGA 1D8AA 2ZB3A 3RUPA 1QFMA 3QTBA 5KTKA 1G5TA 4PX3A 5J1SB 1FS6A 3GR6A 3FNGA 1OC2A 3CPHA 4IR7A 3W5SA 2G28A 4UQLA 4URWR 4LJ9A 3NDRA 5I7WA 1W5BA 4CF4A 3BG5A 3JWEA 1I6MA 4IRMA 2BCGY 3KT6A 3O3OB 1T8RA 3K70D 4RZIA 3PSAA 3HKBB 3RVRA 1KYWA 1TOAA 2JVIA 2Q49A 3B3FA 3PHIA 2NU8B 3KWLA 5GWXA 5KOYA 3DZDA 1RWWA 5EKTA 3FMGA 2DBZA 1PG5A 3F6YA 2R62A 1KRXA 1WZNA 4ZA2A 4DJJA 2O8EB 3TNFA 1M2WA 1GFSA 1OYYA 1RYYA 1VPLA 1S2DA 4MQMA 4MUYA 4OHVA 5KNBH 3I83A 2GBLC 4UATA 1HL7A 1I5RA 3QTLA 2WSLA 4B6JA 5BR1A 4BMZA 5CDUA 5J1TB 2VP5A 5ALWA 2V1XA 4N82A 2XE4A 1XL0A 1DHTA 1KPGA 4TTPA 4UHHA 4Y2JA 4EDHA 4PRLA 3K0HA 5FWYB 2OFWA 3OOHA 3V42A 5KTMA 1BROA 3OJXA 3VA7A 3AM1A 4EO7A 4OHYA 1SHZA 3F2IA 2Q21A 3GEMA 4GBMA 1LK0A 5AUPB 1V8OA 2H1SA 2CL0X 2PSJA 2ES4A 3PQ4A 3QLVA 2Z6AA 1TL7C 3KS9A 4GL2A 3QLEA 1LB1B 4CGZA 1CNEA 4F3TA 4MS1B 3MXTA 2ZSKA 5AW4A 1B15A 3ADDA 4K0KB 3ESRA 2YZGA 4UBNA 4RS3A 4IV0A 5B7GA 2PMWB 4RNCA 3KC2A 1Y5NA 1DS6A 1Y34E 2D0PB 2VHVA 4KNVA 2FPGA 2RHTA 4FJ1A 5E2IA 1SHLA 1T4MA 1ORDA 4P3YA 1NVMB 3BE4A 4C0XA 3NP9A 1JIQA 4PPFA 2Q4DA 3WLLA 4QGAA 4MAFA 3ER8A 2EP8A 4GKJB 3DZIA 5CLGA 4U0JA 4NCKA 5C1DA 1XKTA 2JLYA 4OF4A 1L1FA 4FX5A 4NCXA 4LRSB 4OJMX 3VR2A 1GTRA 3STUA 1YC2A 3E6AA 3S2GA 3BXHA 2W2KA 2XYGA 4HQ0A 1WEKA 2HWUA 3FGOA 4MUAA 2VRCD 4AICA 1PJBA 2WJAA 4UJ3A 3FNHA 2HMUA 1J6UA 1FJ2A 4YP5A 4RC9A 5GJWC 2XY4A 2ZRQA 4HXYA 1R37A 1ULAA 3OTWA 4A8JC 5IM4F 4TWZA 3IV9A 2WIKA 3FZEA 1DXHA 1MG0A 4JOBA 4JUFA 5ESXA 3SVLA 2INGX 1QR6A 3I9MA 3QVSA 2QG9A 10MHA 2GRJA 5AOCA 2DTDA 4AG5A 2DT8A 3T0IA 4U9IS 1MB3A 3NOXA 5EQTA 1SU4A 1JYFA 1WXHA 2UZAA 4QGHA 4MUKA 2WQZA 5SV2A 5IF3A 3W8NA 4ARZB 1AA9A 2LD4A 4A0QA 2A9VA 2IV3A 1H5NA 4LMBA 2NUPB 3G79A 3H19A 1KVUA 1SXJB 3OURA 3WKEA 2XJ9A 3ZNNA 1NV9A 2WAAA 2G09A 3M8KA 4D44A 4N0QA 1WXDA 4LXGA 3VZSA 2NTJA 1TUIA 2VYQA 2W8BA 1ZWKA 4BC0A 1G63A 2PL3A 1QJCA 3M6LA 4JL6A 2V0NA 3BXOA 2J7PA 5I51A 4EY4A 2EWVA 3WGTA 3VR5H 2V1UA 4EGJA 3WIDA 1TKBA 2SKCA 4XYMA 2A0KA 2QTNA 3H4IA 3UJHA 1G1AA 3ADPA 3TINA 4DILA 1U31A 4KB5A 5EIWA 4M3NA 1OFIA 2QTGA 3JWHA 2YIJA 3MMZA 3Q98A 4OYRA 4WBXC 4E5MA 2OSVA 3Q0IA 3ZZ0A 1V4BA 4TSKA 4MWEA 2ROQA 5AM5A 3T0FA 1IRXA 4L1KA 1J22A 4BMSA 4EYKA 2LWIA