4KRXA

Structure of aes from e. coli
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
316
structure length
316
Chain Sequence
ENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analyses of Aes, an inhibitor of MalT in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Acetyl esterase
total genus 126
structure length 316
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.1.1.-:
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4krxA00
4BAZA 1AQLA 5DTIA 3R0VA 1CUZA 1X70A 2HU8A 2C0QA 1CUEA 4K5QA 3M82A 4PNZA 1MX1A 1VLQA 3P2MA 3O95A 5ALIA 3DS8A 5ALQA 4ZXFA 1EK1A 1WPRA 4WDQA 2PX6A 3G9TA 1G5FA 2VJCA 3IURA 2CB9A 4DMKA 4F0JA 1R9MA 1XZLA 1OCEA 1JJIA 1C7JA 4BVLA 1CRLA 5CURA 2VT6A 1F0NA 2O2HA 1MX9A 3D2BA 3H2JA 5DNUA 5A62A 3WYDA 4CIAA 5CH3A 1XZJA 2ZJ7A 2XUJA 2VAXA 4BE9A 2RIPA 1EH5A 2Y1KA 1AC5A 4AN1A 5AOBA 4UFOA 4DM7A 1UOOA 5JD4A 4UHFA 5ALYA 1JFRA 4X6XA 4CCYB 4Y2RA 2C0PA 3HLKA 3ESDA 4K6KA 1MAHA 4D9JA 2WILA 1TIBA 3FYUC 1IZ8A 2XUQA 3G0IA 1A8QA 1HBJA 1Z68A 1ZIXA 4X85A 1DT5A 2W6CX 3WL5A 3E3AA 2D0DA 4C6HA 4ARBA 1WB5A 1GKKA 2OQIA 2YYSA 5EI5A 4G4IA 1UXOA 1CUVA 4ROTA 4P93A 4CIBA 4H7IA 3BF8A 2JGJA 4OPMA 1UZAA 2GYVA 2XUPA 5JIBA 3PFCA 4EY6A 5EHXA 5ALXA 1GQRA 4BBZA 1THTA 4FFWA 4ZWNA 2WHQA 5CMLA 3WJ2A 2B9VA 4KEAA 5D7BA 1TK3A 3WKAA 2QTBA 3SC2A 1TRHA 2OAEA 1B6GA 1UKCA 4M0FA 3IIIA 3V1MA 1CUUA 2BUCA 1LPPA 3GROA 4HXEB 2PU5A 4FLMA 2PVSA 1XZDA 3I1YA 3WQHA 3LCRA 4Y7DA 3H0CA 2R8BA 5AI8A 2O2GA 5K3EA 3HC7A 3QH4A 3H18A 5AK3A 1GPLA 4G5XA 1H23A 3ESCA 2QKYA 2PUHA 4J0KA 3AZPA 1RWQA 3R3XA 3HEAA 2OG1A 1LPMA 4AN0A 4EB0A 4MYSA 3DLTA 5HCUA 4BRZA 1LBSA 5SYNA 1U2EA 1XRRA 1J07A 3DOHA 4MJ3A 2FUKA 2WM2A 4WCVA 1U4NA 5J3JA 4PW0A 3B5EA 1WOMA 5EIEA 4W1QA 4CCWA 2VEOA 1HLGA 1JU3A 3C8HA 4N8SA 4X71A 5ALFA 4UBOA 3QMWA 3G9XA 3I6YA 2CJPA 3PE6A 3O0DA 5JZBA 5AKEA 1QGED 1MPXA 4PV7A 5D6OA 3W2TA 1W1IA 4DLNA 3ZLVA 5AI4A 4H35A 2XMSA 3OURA 4W1SA 5DJ5A 5IVIA 1YASA 2WU3A 4I3FA 4J0DA 1VZ3A 5HK8A 5C81A 4KJXA 4X92A 1LPAB 3ZI7A 4ZGBA 5AJHA 4FWBA 1VXOA 3H1BA 4G8BA 5CT5A 3U1TA 3WWCA 1Q0RA 2PPLA 2XQKA 4BTLA 5JADA 2BUBA 1BN7A 4ZI5A 1UWCA 5FOQA 1EDDA 3L1HA 1XLVA 1E5TA 2BUAA 3T4UA 2IIVA 4MQLA 1CUHA 4DSZA 4Q1VA 2QOEA 2JIDA 4X94A 2Z3ZA 6YASA 4J7AA 5HF6A 1W75A 1QJ4A 3R3YA 2PSHA 5CH5A 4H7FA 4BZZA 2VJAA 5ALTA 1IZ7A 4E15A 2AJLI 2FJ0A 1ZD3A 3EBLA 4EHBA 2OQVA 2VA9A 4QEKA 1WB4A 4FDMA 5JD5A 4C4XA 2C5GA 5JAOA 5DLPA 5C8ZA 2GYUA 4X91A 1XKLA 4RPCA 1ZIYA 4IH1A 2HRQA 3D7RA 5AM0A 5AOCA 1YR2A 2Y2UA 1LPBB 1QIGA 3AZOA 1DINA 1QTIA 2XMRA 1X2EA 3D5EA 3WIOA 3KWJA 2XUGA 4FBLA 1IMJA 1GXSA 2HFJA 3I2GA 3OTQA 3GUUA 4DNPA 5AM5A 3VXKA 4H7DA 2XMDA 1H2ZA 3FLBA 2VATA 4XIIA 1OXMA 4DGQA 3PUIA 5K3CA 3PFBA 1PJAA 4PSDA 1W6RA 5IVHA 5K3DA 4ZRDA 3F97A 1IUOA 1MU0A 1GPKA 1ZD2P 7YASA 4ZREA 1F8UA 2WU4A 4K2AA 1YCDA 4Q3KA 1Y37A 5ALHA 4FLEA 1MO2A 2DFPA 1MT3A 3NGMA 2QS9A 3W05A 4QLAA 3IUJA 2WG1A 4UBIA 2HA3A 1A88A 4B7ZA 1PV1A 2R11A 5AM1A 5ALZA 2X5XA 3IUQA 1EX9A 5AI6A 4MQMA 1CUSA 1CUAA 3ZLTA 3HJUA 3EQ7A 4GDMA 1Y7IA 2RAUA 1YSCA 1FFEA 1QIKA 3PF8A 4IO0A 5DNWA 2HIHA 5ALKA 3AJAA 1UK9A 1EK2A 4G9EA 4UBMA 5BV7A 5I9IA 5AICA 1E89A 4DYHA 4Y9SA 5A7HA 4B82A 3BWXA 3WA7A 2EEPA 4XJVA 4OYLA 2P8SA 5JASA 5CT9A 2WIFA 3FNBA 4NS4A 4E11A 5JARA 2XQJA 3QMVA 5T4HA 1XZKA 3G9UA 5AH0A 3WK9A 4H7JA 1JI3A 1A8SA 4EY7A 1LPOA 4N8EA 4X00A 5FXMA 3BF7A 2H1IA 4N5HX 2QZPA 2O7RA 3MUOA 1P0IA 4WFIA 1MX5A 1EDEA 3R3VA 4X6UA 3EF3A 1DQYA 5AKKA 4H7KA 1ZICA 1CUBA 5EIAA 1WM1A 2DQZA 4JH0A 2XUIA 3WWOA 4H0CA 2J4FA 5KREA 3RARA 1XQYA 4UHCA 5CXXA 3KXPA 3A70A 2B61A 3D0KA 3G0GA 2WIJA 3NUZA 1JJBA 1N8SA 4J0IA 1KU0A 4OUKX 1QO9A 1P0PA 1VOTA 5E2IA 1ZOIA 2PSDA 3BIXA 4JYMA 4A16A 2ACEA 4KRYA 4JUIA 1MTZA 2G4LA 1BEZA 4HVTA 3VISA 2XMZA 4Y2XA 3C43A 4KACA 2WG2A 5ALEA 4YPVA 2PM8A 3FYUB 4GW3A 5BWBA 5LZ7A 3H04A 1J06A 5AKXA 3IDAA 1AGYA 4QDXA 3GBSA 1BEEA 2AXEA 4P9NA 4C4ZA 2Q0XA 3DJYA 2B4KA 4U2FA 3HYSA 3G0BA 1K6EA 3AZQA 3RM3A 2I3ZA 2HA7A 3NOXA 2QM0A 1YB7A 2XUDA 4Q34A 1CLEA 3V1LA 3C6BA 5AI5A 2JGIA 1YB6A 3WZMA 3M3DA 4MEBA 3NWOA 4I19A 3WZLA 1QOZA 1EI9A 3EQ8A 4GHWA 1NX9A 3C87A 2CMFA 2BJHA 1FFCA 1ZI9A 5IH7A 5FUMA 4IQ4A 1EHYA 1ZJ4A 5ALSA 1XZMA 4CG1A 5DYWA 3PI6A 5E4JA 1UOPA 4NVRA 4KAFA 1G4HA 4HXGA 2QUAA 1ZI6A 1W4LA 1IVYA 5HZGA 4HRXA 2GBIA 5I7UA 2PSEA 2XMGA 2PSJA 3HXKA 5AP9A 3WK6A 2WIDA 3ANTA 4UBNA 4BCBA 2I78A 4AO7A 4AB1A 4BC1A 2QJWA 3I2IA 3GA7A 4KE7A 1L7RA 4BP9A 4N8DA 4FNMA 3O4JA 1SC9A 2QT9A 1EB9A 5ISMA 2BGNA 3SWWA 5T4FA 1M33A 3N2ZB 4DTCA 5JAHA 1RP1A 2HDWA 2RHWA 1ZGCA 4IHAA 3TEJA 3BJMA 1BN6A 4WY5A 2VF2A 5JYCA 3FBWA 5CT4A 1P0QA 2O2IA 1O6FA 2E3JA 1H2XA 2AJDA 2C4HA 1T2NA 1ODCA 1CPYA 3V1KA 4V2IA 3QITA 3UMJA 3ED1A 1NU8A 2ONCA 4HTAA 1O6GA 1R1DA 2WUFA 4UHBA 1QIMA 1UKBA 3H2IA 3O4GA 3WL8A 5LKAA 1CR6A 3LIPA 4UHDA 1XZIA 4M0MA 5ALVA 1XZCA 5JALA 2CKMA 2CEKA 1CUCA 5CT8A 5IKXA 2HA6A 3C70A 1CFJA 5ALDA 1DWOA 2HHAA 4QE3A 1YAJA 2DQYA 4NMWA 2BGRA 3IVMA 3PICA 2EDCA 4Y2UA 5AKIA 4FBMA 3C8DA 3R3UA 2XMQA 2ZJ6A 1VA5A 3I6ZA 1ACLA 4AXBA 1LZKA 4BCDA 3M81A 3VKFA 1XQXA 1X2BA 4UBKA 2YH2A 1QFMA 1XFDA 1ZD4A 3WJ1A 5HQ3B 5A7GA 3I2JA 2WTMA 5JZ9A 5T4EA 5K3BA 4UHHA 3WL6A 5LP1A 3LP5A 3OOSA 5ALRA 3IULA 2JGFA 4BAGA 4AQDA 5LZ2A 1CEXA 4Y2TA 1DT3A 5ALJA 5HFNA 3TRDA 2HA0A 4GBGA 2H9YA 5ALMA 5AO9A 4M0EA 4AX4A 1QZ3A 5CH8A 3I1IA 4AMYA 3DQZA 1DTEA 2DHEA 3DL4A 3VJKA 2W22A 4BAUA 3FVTA 3HSSA 2JEZA 4Y2JA 1UT6A 2AJ8A 4OD0A 4J0CA 1SFRA 1YA4A 3ILSA 2PSFA 1DQZA 1W76A 5YASA 3OPMA 5ALWA 4L72A 4J3JA 5FLKA 3DYVA 2RI6A 5CXUA 3STXA 2CUTA 3HACA 1UK6A 4IH9A 4B80A 3Q8WA 5A2GA 5AK4A 5JAPA 1EVQA 4G4GA 1A7UA 2BCEA 2H7XA 3KD2A 4EY5A 1BS9A 2QR5A 1S8OA 4HXFB 3BDVA 1FSSA 4FTWA 4LXIA 3WWPA 3HRHA 4K6HA 4AO8A 2I3DA 2WUEA 2BKLA 4U2CA 1LBTA 4DNFA 2OAGA 5AI0A 4BC0A 3C6ZA 1THGA 2VT7A 2HADA 4I4CA 2Z8XA 5KWIA 1TCCA 1W52X 4G4JA 5LZ5A 1XRPA 3STTA 1VE7A 1LLFA 1CQWA 3SX4A 4GXNA 4XWGA 1BU8A 5ALGA 4B0OA 4H77A 4JEIA 3FLEA 2VAVA 4H18A 4EUSA 4UBLA 4UUQA 2HFKA 2GZRA 5FRDA 5ALUA 2XUOA 1G66A 2HA5A 4L0CA 5LZ9A 2ZYRA 4LXGA 4IH4A 2WTNA 5IVDA 3MVEA 1XZFA 2V98A 4PSCA 4A23A 3RK4A 4E46A 3A6ZA 3UUFA 1R50A 1EDBA 3CXUA 2QXUA 3AIKA 4W1PA 3STWA 1L7QA 3STUA 1WPXA 5LLSA 5JANA 4GWLA 2ZSHA 2GBGA 2ROQA 1ORVA 5JZSA 2JGLA 3FVRA 4AZ3A 2RHTA 4MEAA 5AM3A 5AKGA 2YXPX 1BRTA 5AHXA 1HQDA 1C4XA 1E8MA 2Y6UA 1KU6A 2WJ6A 1XRNA 2WLSA 2QVBA 3ICVA 3HI4A 2Z3WA 2BAGA 1EINA 4AMZA 2G63A 1CUJA 4BB0A 3A2NA 1XLWA 3D2AA 3E1GA 1XLUA 1J1IA 4C89A 1ZJ5A 3RLIA 1AURA 3A2LA 2HU5A 1QIHA 1LGYA 1T4MA 4HRYA 4JYPA 1WCYA 5CT6A 1K63A 1CUYA 3AFIA 3X3HA 3OC0A 1XRLA 3AILA 2WUDA 5DYYA 2OGTA 1Q84A 3CCCA 3ZWQA 1OILA 5ALLA 1D07A 2QXTA 3I2FA 2WFLA 3AIMA 3LS2A 2DSNA 3KOOA 1E8DA 3DL7A 3V9AA 2VJBA 1R4ZA 3HZOA 4KYVA 1FJ2A 3BDIA 1TQHA 1QO7A 3EQ9A 3GFFA 2J4CA 2OCGA 5HK9A 3V1NA 4J03A 3DNMA 2ZYIA 1YA8A 4L9AA 4XVCA 3W9UA 3IA2A 4ZV7A 3H17A 2V97A 5EFZA 3ESBA 2WIKA 1XRQA 4PO3X 2OPHA 5LIPA 1K5PA 5CBKA 1XZAA 4FFVA 5ALNA 2XT0A 2OCIA 4OB6A 2ZYHA 1QIIA 2WIGA 4EY4A 4X7BA 5BOVA 5LZ8A 3FYUA 3DEAA 1QTRA 3QYJA 4OB7A 4AO6A 1JJFA 3E4DA 1C7IA 5EIHA 3D59A 3WKEA 4RE6A 1N1MA 4OCZA 2PBLA 3IUMA 3YASA 2Y2VA 2FJPA 1B41A 1G42A 3D4LA 4MWSA 1Q83A 1ETHA 5D3KA 3BE8A 3O4IA 5I8PA 1JKMA 3WWEA 3WIBA 1Q0ZA 3IB3A 4C87A 2YASA 4Y2QA 3G7NA 3B3QA 2FX5A 1H2WA 4BRSA 1DX6A 4H7HA 3C6XA 1F6WA 4FLFA 1KEZA 2ECFA 1XROA 4RE5A 1DX4A 1XZHA 2OGZA 1A8UA 2Y6VA 4LKOA 1E8NA 4RGYA 2B20A 4X93A 3QPDA 1BROA 1VE6A 2LIPA 1ODTC 4PQEA 3JW8A 3WKCA 3CN9A 4W1RA 3WK8A 1UOQA 4U2BA 1YS1X 3KSRA 4BDSA 5LKRA 2WUGA 2OCKA 4GEGA 5HKBA 4KE8A 4U2DA 4WDRA 3W9BA 5JD6A 2OGSA 4H7EA 4B85A 1LPNA 1FFBA 3BIWA 1H22A 4HZGA 4B83A 3O4HA 2AJBA 2WJ4A 5EGNA 4XX1A 1USWA 2VSQA 1GQSA 4FOLA 4QDTA 1R9NA 3R3WA 3F67A 4Y2SA 5EHZA 4P92A 4Q82A 2XQFA 4G8CA 4N5IX 2WJ3A 2ACKA 1AKNA 4QA9A 1AMNA 3G02A 4BVJA 2QRUA 4J0HA 2GBCA 1ISPA 2GBFA 1ZD5A 2DCMA 4B9EA 1MJ5A 2PKYX 4LHEA 1DWQA 1DU4A 1VA4A 3ICWA 5AKYA 3ANSA 1ZI8A 5LZ4A 3H2HA 2WSLA 4DMCA 1SCQA 4B6GA 1QONA 2ZYSA 1U8EA 1CUIA 4B84A 2EDAA 5FPPA 4X3CA 4BP8A 2V9ZA 5AK5A 1QIEA 4F21A 4Q3OA 1LPSA 1EA5A 1XZBA 1EB8A 2HU7A 4BDTA 2XI4A 2OLEA 4CG2A 2GZSA 5C8VA 3H1AA 3AIOA 3OG9A 5JATA 2XMBA 3PF9A 1HPLA 3DOIA 3QPAA 4KR0A 3L1IA 3GZJA 1CUGA 4UBJA 5KWJA 3WYNA 2XE4A 4EA6A 4LYDA 3R40A 3BJRA 3U0VA 2WHPB 3FSGA 4FHZA 4YASA 2HM7A 1QE3A 3FCYA 3VJMA 2XQIA 5AKJA 1GGVA 4ZV9A 4QZVA 3I2KA 3QVMA 5LYYA 3DD5A 2H7YA 4YX9A 3WWDA 2OXEA 5AKHA 4CI9A 5K5EA 4PSUA 5FPQA 2D5LA 5KBYA 1CIJA 2I03A 2VQ6A 2ES4A 4QNNA 2PU7A 4ETWA 1Y7HA 4GECA 3V48A 4Y2VA 5BWCA 5HF5A 1SCIA 1XRMA 4OSEA 4W63A 4UFNA 5AI9A 4QDOA 4NZZA 4QWMA 4DSAA 2ZJFA 2BFNA 3C6YA 4LXHA 5E4TA 1VJ5A 3O9VA 1K8QA 3Q0TA 1HDEA 4INZA 3ZLUA 4GI1A 5AKLA 3S8YA 3CCBA 3VVMA 1XZEA 2WFMA 3FCXA 1E3QA 4LYEA 2UZ0A 5HKAA 4OB8A 1GT6A 2Z5GA 1U65A 4BCCA 1QIDA 1ZGBA 4MXDA 5HFAA 4G9GA 1FFAA 4X90A 5DWDA 1H2YA 4F5ZA 3VDXA 3JWEA 4C4YA 1AZWA 1LZLA 3IBTA 5EHNA 3K6KA 5CW2A 3DCNA 5JAUA 4QDUA 3C45A 3DDUA 3G0DA 3WA6A 5HF9A 5A7FA 3QM1A 5D3ZA 1CUFA 1VZ2A 1HKHA 4AZ0A 3K9BA 5K3FB 2G5TA 2RGUA 4WJLA 3B12A 3TGLA 3OM8A 2GYWA 1E66A 5A71A 3PDCA 1YAHA 4WFJA 4DIUA 1XZGA 3L1JA 2J3QA 2J3DA 5FKJA 1RYYA 1QIFA 1I6WA 3H2KA 2C58A 4Y2PA 1BCRA 4KAAA 4BTVA 3C5WP 1YS2X 1CUDA 2WFLB 5FDFA 4OYYA 3M83A 1VXRA 2QUBA 4TVKA 1R3DA 2HA2A 3AINA 4BATA 2JGEA 3N0TA 1TCAA 4UHEA 4EZIA 5AOAA 1XQWA 3BL8A 3H19A 3AUKA 2Z8ZA 5T4BA 4TPKA 1CV2A 4PF1A 4CFSA 5ALPA 3IUNA 4FNGA 4UPDA 2C7BA 3WKDA 2PL5A 1GPNA 5K3FA 3R41A 3GELA 3JYHA 3A2MA 3VJLA 1MNAA 4Q3LA 5AK6A 4F60A 1DWPA 2HL6A 1N5RA 5C7YA 5DNVA 3CN7A 5C8XA 3I2HA 1ORWA 4BZWA 2WG0A 3SK0A 4U2EA 3F8SA 4HS9A 3ESAA 5DTJA 3G9ZA 4QLOA 1MN6A 4DMFA 4QWWA 2JGMA 1GZ7A 1BE0A 4B81A 1F0PA 2XDWA 1TKRA 2X8BA 4ARAA 5HF8A 1NU6A 1SOMA 4QDZA 2V96A 2WFZA 4FMPA 3PUHA 5F4ZA 4J0GA 4UFPA 1FFDA 4X6YA 1CQZA 2X76A 2DHDA 3D3NA 4YK7A 4BVKA 3QMMA 2G5PA 1WHTA 2HA4A 3VVLA 4RNCA 3WMRA 4TGLA 3QBJA 2C5FA 4KE9A 4DNOA 1ACJA 5HQ3A 2JEYA 1IUNA 1CVLA 4S0XA 4A5SA 1K4YA 5CRIA 4MWTA 4JNCA 2XUKA 1UK7A 1EVEA 1UKAA 1AUOA 3D2CA 2IX9A 2K2QB 3FYTA 2XUFA 3F98A 4CG3A 2HRRA 4ITVA 4WY8A 2PUJA 5A6VA 3W04A 3QZUA 3TJMA 2XUHA 3MGAA 1JU4A 1WB6A 2WHPA 3STVA 5AM4A 5IVKA 3FWHA 3STYA 3WI7A 3C5VA 3H2GA 3DYIA 4DNQA 2XLCA 3MUNA 3UUEA 3W06A 2JGKA 1IUPA 3G0CA 1SCKA 3DKKA 2AJCA 1VKHA 2WKWA 4C88A 5AIBA 4P08A 2XLBA 1J2EA 2RONA 3E0XA 3F96A 1XQVA 5ESRA 5DYTA 3ZPXA 4CCYA 2IITA 3KDAA 1PFQA 3G8YA 4E14A 1EXWA 1TCBA 2XQGA 4KRXA 4O08A 4G1FA 1UFOA 3F9CA 4HAIA 1XKTA 2CBGA 4EY8A 1QLWA 1WHSA 5AKZA 3BXPA 1BCSA 4DMHA 3I6MA 3O9MA 5EHQA 1GKLA 2XB6A 4J0JA 2NW6A 3FOBA 4Y2YA 5E4YA 1ODSA 1JMYA 2DR0A 1P0MA 4KE6A 1LNSA 4K6GA 3WK4A 2WQZA 5AIAA 1JMKC 1TAHA 2XUAA 4LIPD 2QMQA 5ALOA 4L3WA 2ZVDA 1MNQA 5H3HA 2ZSIA 3QPCA 3FAKA 3LLCA 2OCLA 3ZV7A 4Q05A 4OU5A 3S2ZA 5FV4A 3WL7A 3WK7A 4WFKA 4EBBA 2DHCA 4W9RA 2XMCA 4FKBA 2VTVA 3WLAA 1R88A 3R3ZA 1MAAA 3HABA 4X97A 1N5MA 3K2IA 4GLBA 3WK5A 2JF0A 3EIOA 1CUXA 1QIJA 3I28A 1JT2A 1QFSA 5SYMA 2O7VA 3FLAA 3LIIA 4C01A 2VJDA 4B0PA 3T52A 4KAJA 4U2GA 4X95A 5CTAA 4MYDA 2ORYA 1HL7A 5FP0A 4Z49A 5K3AA 2WHRA 3DKRA 4G8DA 4BE4A 3KWFA 5AM2A 2QJRA 2CZQA 4BYMA 1UK8A 3WKBA 2H7CA 1CUWA 1AX9A 1L7AA 2JBWA 3FSGD 4B9AA 4OU4A 3RKSA
chains in the Genus database with same CATH superfamily
4BAZA 3S7ZA 3MAJA 1AQLA 2X9NA 3DAOA 3CNEA 4XX0B 3UWKA 4XDGA 3JZDA 2TSYB 4LWPA 4O2BB 1V1MB 1QAQA 1HOTA 1NBWB 1NW7A 2C0QA 1WMDA 3RVQA 3VC1A 3WIUA 1EQUA 2FETA 3RYHB 4BIIA 3L6UA 3BK2A 4HH4A 1NXOA 1MOSA 5CXQA 3AOEC 3GRAA 1BHO1 5LUBA 3P2MA 2Q5LA 4S1PA 4CGZA 2KS6A 2A4MA 1V95A 1ONBA 2AT1A 5AW7A 5K6AA 2CKDA 1Z2NX 3I04A 1N0IA 4HBZA 3L1KA 2WF5A 2C0CA 4ES6A 3RS0A 1RCFA 3G9TA 3WLKX 2CHEA 4UREA 4LFBB 4TTRA 4CEIB 3Q88A 1WP9A 1KVSA 5I7HA 3WOVA 3IERA 5IK2D 3CVVA 1QUFA 4Z4QA 1M75A 1QH1B 1XZLA 3KM0A 3R7DA 4YMHA 1C7JA 2O8VA 1W9HA 1YB2A 2ZBRA 3AR7A 3PWKA 4BVLA 4EG4A 5CFRA 3DHYA 1WY7A 1E1KA 1TEHA 1U2TA 3H5WA 4MUBA 3MCZA 4L4UA 4J75A 5CLGA 3NGXA 3ZQ4A 3DMNA 2GN6A 3PHHA 4XVRA 5E6RB 4COKA 3UJNA 5DRYA 2IYNA 2ZETA 4P5EA 2DQKA 1MX9A 3IVAA 1ESDA 3GJQA 4PLFA 4PFJA 1FTQA 1N9ZA 3PV0A 2CUNA 4PG7A 3IOCA 3GQBA 3PXGA 1QV6A 1T35A 2MU1A 3V4RA 4YEDA 3KSBC 3LUHA 2VO1A 3L4JA 4FQ7A 4NBRA 5CH3A 1EFRD 1T4DA 2IY8A 2J3HA 4OL0A 4EJSB 2VI5A 1MB9A 3NRJA 3OOEA 1CD5A 2XUJA 4QOFA 1L7VC 1ZNWA 2VHXA 2VAXA 3IE2A 1G7TA 1NXWA 1MOPA 2ZJOA 3DEFA 4R8SA 2JFFA 5GM1A 3RE1A 1G8SA 2EWWA 1Z7YA 2WPDA 1TZJA 4WT7A 3SDBA 1ESEA 2WIAA 3N2IA 4CMCA 2X4DA 1BGXT 1EX6A 2X22A 1MB0A 2BEWB 3FUCA 2FG7C 2OO3A 3Q15C 1XTQA 1AC5A 3H9EO 4IJKA 4HVCA 5FEUA 1TO6A 3DULA 5IKMA 5DO9A 2IIBA 3E4CA 3FDZA 2MYTA 1X7ZB 2ZSUA 1M7BA 1SCBA 4H3HB 2PMEA 1NVUQ 1A9QA 3V3KA 3GJ5A 1OZ0A 2G1KA 421PA 4D9NA 4ARIA 1JDVA 2PMBA 3HHPA 3SS9X 9ATCA 3KKKA 1CQIB 2V6GA 2F4NA 3GDFA 4KJZA 3ZJTA 1PZNA 1JFRA 1KR2A 2BM1A 3HFRA 4X6XA 5I4BA 3G8BA 3KKLA 4O4LA 3L8EA 4WKNA 1WDWB 2JH8A 1G18A 4F7DA 2GJSA 2ZTUA 1BMDA 4A8HA 3OEEA 1KAGA 2R8OA 4K6KA 1G8KA 1MAHA 4D9JA 4KI0A 3ZD6A 2O2SA 3B6KA 1NIPA 4G1UC 2EKZA 1UDXA 4KZKA 4JIGA 2Y71A 3P9QA 1SHTX 4RGVA 3TFWA 1A8QA 5FQOA 2R79A 2XE6A 4RAOA 2NSDA 2RI1A 2W90A 2Y8EA 5FUBA 1XO1A 1XPUA 4M89A 1ZIXA 1IN7A 1DT5A 1JPVA 5HE9A 3F8WA 1LVUA 5AD1A 3TTSA 3P32A 4HNQA 4D74A 2AW5A 1M7GA 3L1VA 1V0JA 2C4KA 2BHSA 2EERA 2CFCA 2D0DA 2RGBA 1JSRA 3GAMA 3KB8A 4HBGA 5K0GA 4REMA 1T0PA 4YI3A 4ARBA 2AVDA 4MGYR 4PO1A 4ABYA 4CIBA 1RRKA 2YYSA 1F2TB 1SEVA 4I8XA 5EI5A 4EUEA 3A4TA 2R6HA 3O1IC 1R6AA 1E2UA 1I0IA 4JOBA 4OPMA 2AX4A 4AS3A 3HR8A 2NZYA 2Z30A 1UZAA 1RZRA 3OZBA 5D7NA 3EA0A 3OTIA 2E9SA 1TM1E 4DPMA 3GDWA 3D3WB 4O25A 1GXSB 4BBZA 1C7EA 4Y0NA 4YUVA 4YCAA 2F3SA 5EMJA 1CXZA 3WSTA 2GTHA 1T9GR 2ZBUA 3F2VA 5K8IA 3VDNB 6ADHA 4M8KA 3FY4A 3I72A 5L4LA 5THXA 3WJ2A 4OQXA 3NTOA 4PINA 1TZ2A 1RS0A 1WHSB 2B9VA 1LTQA 2OXFA 4KEAA 3HCWA 3TRJA 4AIRA 5MN5A 4RC9A 4UZEA 4ZCPA 3FMGA 1KKLA 2QTBA 3ZHUA 2CYBA 2ADMA 3CO5A 5IJ0A 5CIQA 3A9WA 4HYQA 1P4RA 2H5LA 2NQ8A 4RF3A 1NM5A 3SC2A 3T34A 4BFXA 3VBEA 2I3BA 1BXZA 1HQYE 2Z2JA 3DFIA 5C3UA 1P9RA 3FHTA 3WYGA 2I9KA 1M54A 2FEMA 3D6MA 4A73A 3MGBA 1CUUA 4WINA 2FZ4A 4UHKA 2JKVA 3ZHQA 2V74B 1DDIA 3IVCA 2BP7B 4F2HA 2JGDB 1Z0IA 4OGKA 3TLMA 3EUAA 4PPGA 3DMRA 1XCOA 3IOEA 4Y1EA 2XVXA 2FSFA 2XDQA 5BRJA 4CLRA 4OF4A 1ZUIA 1CRPA 4WOPA 3GT4A 4KR2A 4FLMA 1TZKA 1LA2A 2PVSA 3AF1A 3K9HA 3B7PA 4MUEA 4EG0A 1C41A 1LV8A 2ZIXA 4GG1A 3WQHA 1I13A 4ENUA 4R81A 1P1KA 4FDAA 5CVJA 1H3NA 1AGXA 1LU9A 1G5QA 1XA0A 1D6NA 2O2GA 4PTYA 5KYUA 4BWVA 3E2IA 1UMCB 1EJ2A 2QD4A 1AT1A 3VPBA 1JJ7A 3AY7A 4X1YA 3GH1A 2C4WA 4G5XA 4DMLA 2YHUA 3ESCA 1SKMA 3DP9A 1HYQA 2OZLA 4EEXA 2Q49A 3ULKA 4J0KA 4WNCA 5EP4A 1EGHA 1DJPA 3ACBA 3R5KA 4KXQA 3THXA 3IVXA 3U3OA 3RIEA 1W8DA 4IEEA 3HTXA 2K87A 2WYIA 4M54A 1JIVA 5DHAA 3SBXA 2BH2A 1P2VA 4RZ2A 8ABPA 1DQSA 1V26A 2J5BA 1NVXQ 4N54A 4X20B 2JHPA 2X0IA 1R4MB 3AQ4A 3E3NA 3IKJA 3GFGA 5CNMA 1R3UA 1R0SA 4MA5A 3OCWA 3I8XA 1U4SA 1EUDA 5CTJA 5DOZA 1SUAA 2I33A 2FHSA 1Y0BA 3L7JA 4J94A 2IA5A 2Z95A 1OW3B 3K0CA 5SYNA 3VOBA 2OEPA 3KXDA 1FFHA 2FQWA 1NR5A 3MWJA 5KTRA 3DOHA 2H9AA 1IK4A 2ID7A 5ECGC 3WHLA 4B6RA 3F46A 5KSZA 2FUKA 3PUXA 3QQPA 1PD0A 5IMBA 2NUBA 3PR3A 2GK6A 3X1XA 3DMTA 4IUDS 2HPAA 2YHIA 5FT9A 3WV5A 5EXXA 3ASVA 3TD9A 1OI4A 7MDHA 4M0UA 4LMAA 1QDLB 4R7TA 4ZZ0A 1I7DA 3AEQA 4BX3A 1SD1A 5IZCC 2ZR7A 3FCCA 3N5KA 1RMQA 4PCAA 1D0SA 3W7BA 3DAYA 2WAYA 1NKVA 1Y8QA 3MOIA 3KR2A 4JQOA 4MINA 4QU0A 1EM8B 3D31A 4OHMA 3U4AA 1FU8A 2BEVB 2VRBA 3GOQA 3QMWA 4FILA 1ZGGA 5AWFC 3P2JA 3FUWA 4YRQA 1N3YA 1TK2A 2PR2A 3I62A 2BI8A 2G40A 2AF3C 4DRXA 5EWMB 3H83A 4QTUB 1WMFA 4TQAA 5EYPA 3RVSA 2H9IA 1AK1A 3ZU5A 2GYYA 3HZHA 2KX7A 4J07A 1PGQA 2Y05A 1KDTA 3KR1A 4JHXA 4BJ1A 3CZ5A 3NVMB 1AN9A 1GZHB 4E6EA 3CVXA 1DDOA 3SHOA 1DO8A 5A5GA 5LJIA 4F1KA 3HKBA 1ZZGA 4ZOEA 1E6UA 1PR1A 2HYDA 2WBLC 3ANLA 4H35A 2XMSA 3OURA 1Q0PA 3CE6A 3LLVA 5DJ5A 5IVIA 4KRFA 3EASA 5CCBA 1GCAA 5K8VA 4X1KA 3OX1A 4Z4GA 4B3SB 1AZSC 1JKJB 3W8NA 1XL0A 3TQRA 1JG7A 1ZH6A 2ZTMA 2OO7A 1EVLA 4BB6A 4WBNB 3KYCB 2KSQA 2AFVA 4EHHA 1I4OA 3C0KA 5HK8A 2R8PA 1LPAB 2JI7A 3G2IA 3KVVA 4B5KA 1OWPA 2AUTA 1KRXA 5KMGA 3LD9A 2B2XA 3OM1A 4WERA 2YS7A 1MC8A 3L7BA 4QXRA 2J9XB 3GGGA 1VPVA 4FWBA 4EHNA 5M7EA 1YIDA 2VHTA 3ZE8A 4A36A 4TS4A 1E6MA 4HDMA 4NSNA 2P0YA 4Q47A 1C2TA 3JZIA 1PUXA 4MRMA 4BNJA 1SOWA 1B8PA 2HGSA 2DFTA 2NO6A 3IH5A 1A82A 2PUEA 4HPXB 1Q0RA 3RFVA 4JI7B 1ND5A 3TWOA 2PPLA 2XQKA 2NV2B 4ZD6A 3AJRA 4MV1A 3WE7A 4D5GA 3WNDA 2ZRLA 3LC0A 4OGGA 3AY6A 2F8LA 3QJ5A 4ZI5A 1IXYA 3VR5D 3WDSA 2H18A 1U0OC 2JS7A 5FOQA 4DUGD 3E7FA 3L1HA 3A1WA 4EFMA 1W85B 4UCXA 4BVFA 5IARA 3SXUB 3ZV5A 1IQRA 3NTRA 2BUAA 5ARCA 2ZTLA 4RABA 2GHTA 3T4UA 5LDHA 1KFEB 2A9FA 2A92A 1UWKA 3CEAA 4ZOAA 5FLXA 1ZO8A 1KZ9A 1MD9A 2QZ9A 3LBHA 1OIWA 4UVDA 3UWPA 2RK3A 2VF5X 4L4XA 1CCWA 1WLSA 3D8HA 3AJDA 1ODFA 1SCUA 1E5DA 3B8EA 4LRXA 3M5PA 4DSZA 1ZOLA 3CTPA 1F5SA 2EIXA 4Q1VA 4IIEA 2HREA 4FYHA 2QOEA 2YVAA 3C7DB 2Q5IA 3CF4G 3O47A 4ZRMA 1L4NA 3DTVD 5FI1B 1P2FA 2CXTA 1XQ9A 3L0OA 1PQWA 1YZLA 2P11A 5H9VA 1IJKA 1AOXA 1NRIA 3SF8A 2Q45A 3LDFA 1Z6QA 1QJ4A 1W59A 2JCXA 2PSHA 4YUXA 3B5IA 3EXHA 4C20A 1J8MF 2NU8B 3V33A 4PC2A 3CNLA 5CH5A 1Z3IX 1Q15A 4H7FA 4ID3A 4HWGA 1SIBE 3IO5A 4JJKA 1X92A 2FJ0A 3U4CA 3FI0A 3U7RA 3W4KA 2AN5A 1ORDA 2QW1A 2Y68A 3EBOA 4GOLD 4EHBA 1FZTA 1DX9A 3G2OA 3IEKA 2VA9A 3R2JA 2QVZX 1ZUNB 3QPUA 2ZCVA 1P2BA 5JD5A 1Q1GA 1RJEA 2C5GA 5LU8A 2WJAA 4M83A 5JAOA 1UBUS 2QYTA 5C8ZA 2GYUA 3MFYA 2OD9A 1EFVB 2Q1UA 1G4AE 2ZITA 1A1SA 2PIAA 1DHRA 4TL6A 4BFZA 4OX9Y 4Z86A 5KIAA 3D7RA 3EVEA 2OBMA 3QVVA 1OKKA 4HYYA 1JE1A 4G6ZA 4NDZA 1QG0A 1O89A 1YUNA 2D2VA 4MKRA 2AGVA 5CJPA 3H9UA 2CJYA 4QJ3A 3VUFA 4E0BA 5CG1A 3A6LA 2XT6A 4LSMA 1X2EA 2H2WA 1HWYA 3D5EA 5AUQA 2JK1A 4I55A 2EOAA 4AU1A 3KWJA 4LF7B 3TINA 1CKEA 3FZQA 3TK1A 3WGUA 4JCCA 4C3ZA 4CLDA 2HD4A 2O05A 4LHWA 1YIAA 2FN3A 3EIUA 5F3RA 5K1ZA 1A9XA 2HSDA 4KWEA 2V0GA 5JJLA 3I2GA 3K9FC 1Q0LA 3M9XA 4DNPA 2NU9A 4NR0A 1E6KA 1L7MA 1PF7E 1ZIPA 2YJZA 4H7DA 1WVMA 2AI1A 4K0RA 4LGCA 4O63O 1L4BA 4RELA 1UFKA 5TT1A 5EESA 4P5DA 1JZSA 4TV9A 4EHIA 4Z1MD 1H2ZA 5BOSB 3FLBA 4FR0A 3HCEA 1Z2PX 3Q87B 4XIIA 5F5XA 3VNBA 4DGQA 1Q2XA 2FPIB 3IAS1 2NTVA 2R8ZA 2V03A 2KLBA 3FNFA 3P19A 4JXKA 5BYAA 1I3MA 3PUIA 5K3CA 1SXJC 1C7ZA 5JZOA 3CQ9A 5IHXA 1CHDA 2PLNA 4ZU6X 4ZI2A 4AM8A 3ZCVA 1V3QE 2F3UA 4RETA 1PBTA 2IWRA 5IVHA 4HCJA 2YHIB 4BNGA 3OQ6A 3J81A 2VDNB 1ZVKA 3ROFA 4C03A 1MU0A 1YZNA 1GSOA 2EGHA 4DIOA 4AQ7A 1JR6A 1A5AB 2ZAMA 3KL4A 3LT1A 2DBYA 1NF3A 4HRVA 5KWSA 1VIAA 1E18A 1II0A 2EGUA 1BC5A 4EUFA 7YASA 4OO3A 3ZWOA 1TM3E 3JATA 2XYGA 5HE8A 1BDJA 4QICA 4MR7A 3WGLA 3C3JA 1KFCB 4RQTA 2ODNA 3MS4A 1EZZA 3GPCA 1FSFA 4B4DA 1L5WA 2CYAA 2OP0A 1YQ9A 4UNSA 2QV7A 4UNIA 3KQQA 3ORSA 4JNKA 5JAMA 2WI8A 1MH9A 3NGMA 4O2AF 4P7GA 3TYXA 4EUHA 4ENSA 1BE8A 4OBEA 1IL0A 4TZKA 3O3MB 4HR7A 5FWXA 3WNZA 4EI9A 1B8OA 4HG2A 1NQTA 3DLCA 2WJJA 3OI7A 1HDCA 1KOJA 1RIIA 3IUJA 2WG1A 1I1NA 1US8B 2HR1A 1E2DA 4PR3A 1P7ZA 1DXHA 3HSYA 2HA3A 2DTEA 1Z4OA 2VUIB 1LK0A 3LPAA 4JX9A 4UNPA 5LYJF 2QTZA 1GR0A 2R11A 2YW9A 1GRCA 3BD8A 2VNJA 3B2EA 5B3AA 4DV5B 1CWUA 1RPTA 3INRA 4MIYA 3Q7QA 3TAXA 1EX9A 5AI6A 2P9BA 5CLIA 2OGWA 3KPWA 3QLEA 4L85A 2B83A 4U0JA 4E5DA 2Y92A 3ZLTA 3S2YA 1RTTA 3CLUC 2ZIXB 1OZGA 3L6RA 4GDMA 4OVKA 1R9GA 2HYIC 2NPFA 5J4HA 2HHHB 3NI2A 4JT4A 2DY0A 2R96A 3D3EA 3QFCA 2XXAA 5BN5B 3WNVA 4V1CA 5G0UA 3F3SA 3QTLA 2QTTA 3LPCA 4Q4DA 1CC1S 2IQ5A 4Q7KA 2OG2A 1P5RA 1QV9A 1UK9A 4K1XA 4EF5A 1W96A 2P2ZA 2PSSA 3V3TA 3H9QA 4G9EA 2DHQA 3USZA 3RKRA 1BW9A 3OO0A 5AICA 4QM6A 3RU9A 4CPDA 4G1CA 5FA6A 3PSHA 4YT8A 2FA9A 1E1NA 2GCGA 4P4SB 4ECEA 2Q27A 1QF6A 2M1ZA 1T6YA 4BFUA 3WA7A 2VQDA 2JLSA 4RCVA 4DPLA 4M1QA 2DJIA 4CYMA 1Y7PA 4Q4AA 1DAOA 3WB2A 5KTPA 4RVNA 4Q3AA 3IQIX 1H8HA 1PHPA 1R4NA 4KKVA 5AH0A 3C3XA 3WK9A 1JI3A 3RIGA 2FRDA 3GX1A 4EY7A 1U1IA 4ZQGA 4R8LA 2CVQA 3E03A 3B89A 4YHBA 4YRTA 1KVUA 3QHAA 3KZ1E 3RIMA 1AF7A 2XUZA 4GO1A 3HU1A 1MW9X 4AYWA 3V8BA 4NBNA 4DAEA 3D8RA 3I53A 4Y0AA 1M0SA 1N5LA 1P5HA 1TUGA 1N3BA 1Z38A 2GN2A 3HDQA 5EXSA 3ZCTA 2OK8A 4IF6A 2CCKA 1GQFA 2HUNA 3IHLA 4IDNA 2JIRA 4M7WA 5LSAA 3EG5A 1EDEA 1GL3A 2CGEA 1FNNA 2B35A 2H0AA 3WNQA 1O9GA 3OUTA 4YR7A 2GZ2A 2E5FA 1AKUA 3EF3A 5DMXA 4LI0A 1EWKA 3SJ7A 1T3SA 1XVAA 4S12A 2JI9A 3NIWA 3H1TA 1ILEA 5FUYA 1N9GA 5BMVA 4OJYA 1DB3A 3WHPA 4BQRA 2QNBA 1NJ1A 4JH0A 3PXCX 5HTKA 3BWCA 1K3UB 4A8JB 5COBA 2QTGA 1YDHA 5IT0A 3THWA 1NXQA 1DPFA 3GLRA 5TQVA 5LQCA 1SOAA 2FOLA 5DK6A 3IE1A 5F7JA 2VWPA 5LXTF 4HQ0A 2PT6A 3D64A 3WBJA 1T1IA 5DLQC 1DRJA 3BYZA 2CNOA 3P9PA 4JB0A 4ND7A 1AA9A 1KYVA 3VH4A 3A1EA 3ZWCA 4F91B 2YXBA 1J5PA 3AEZA 3WLTA 4PGFA 2YZ2A 3A70A 4RACA 4YJ3F 5K2MA 3X0DA 5IYZF 3T8YA 1EK6A 3ER6A 4G5OA 3NUZA 4NYIQ 1NUAA 3JR3A 1N8SA 1URPA 1K98A 2A0UA 2H4HA 3DE4X 1G16A 1COWA 2COKA 2IYTA 4M0DA 1Q1NA 1SVUA 3ODGA 4YQEA 1QO9A 4DJFC 5G02A 4ETIA 2G0TA 1WLYA 3HB9A 4QXMA 4X7RA 1BGVA 1VOTA 2B5VA 1KZGB 1MP0A 3W8RA 4AN4A 1NMQA 4UDXX 5DGIA 1U7WA 3LCVB 2VNSA 2WJGA 3Q9NA 2IPLA 2OFWA 5GGYA 4EBFA 1HE2A 2G77B 1Z25A 3IIKA 5I4CA 3G5LA 1OVMA 4MQ5A 5A0VA 5MGBA 4NU6A 4ON9A 3KAKA 1UFRA 2PUDA 3D8NA 2XMZA 4I08A 4L28A 2GHRA 3C43A 4J1QA 1U7TA 1UMDB 1UEIA 4N82A 4YUZA 1II9A 2CNWA 4WZ6A 3H9JA 3KPYA 4N7RA 1GU0A 3O75A 3TNDA 2IBSA 4ZYLA 4OJMX 4DLZA 1NVWQ 2V7QD 4J7UA 1QH1A 3HLYA 1USGA 4WKOA 3U6BA 1EBBA 2CXRA 3H04A 3CVJA 3IEVA 1NY6A 2PHZA 3MB5A 3MCWA 2IK8A 3CWQA 2GF9A 1G5HA 2XCQA 4EA8A 1GQQA 3C3BA 1E9CA 1DBPA 3K8ZA 3GJSA 3NLLA 3DVRX 4HAOA 2WYWA 3MXOA 4QNMA 4Y6QA 3A4IA 4GPD1 5EKXA 2AD5A 1WSBA 3ILVA 2PD3A 1FS6A 5DV9A 1C2YA 3GFPA 4BX9A 5AHWA 1FYFA 4C0KA 2EQ5A 1EUDB 5T41A 2GUGA 4A0SA 5FOUA 3W3ZB 4EY3A 3AL2A 1H2FA 4MCHA 3DJYA 3MTBA 1N2EA 1Y9JA 3HYSA 3ZN2A 5GJCA 4LDNA 2ZRCA 5DM4A 3HBNA 1K6EA 1T9CA 1L4YA 1JVBA 4R9RA 4HLQB 4Q4CA 5E7MA 4LQLA 2I3ZA 4C0SA 4E15A 3AV3A 2FRVA 4OOFA 1W73A 2QMYA 4XD7A 5AW9A 1GG5A 2XUDA 3AHEA 3KJIA 4Q34A 4QJBA 1DEHA 4LY3A 3V1LA 2IOQA 3C6BA 3DWIA 3V8QA 4B79A 2JGIA 2EATA 4YJ2A 1Z47A 2H59A 1NVVR 3GDGA 3SQXA 3WZMA 4MEBA 4IDQA 2QTCA 1IN1A 3A7EA 4KPYA 1XNQB 4DZRA 2GEVA 4I19A 4IMJB 1Z82A 1QOZA 1UDCA 2PKEA 3EQ8A 1U0GA 3OX4A 1G7CA 4GHWA 3TECE 2XNJA 3FTDA 4XIFA 2N1BA 1NX9A 2E49A 2J45A 1Z06A 5HCNA 1MTOA 1W5FA 2BJHA 4NABA 2UVPB 4EJ6A 3FPGA 4MV5A 3IB6A 4UQOA 4XLLA 3K9WA 4NIMA 3H5TA 4UDYX 2QN8A 3QELA 1JLKA 2B8EA 5FUMA 4RADA 3Q3GE 3UJ9A 3GJRA 3IAS6 2A5DA 4JBGA 3UFBA 3JD0A 1GITA 3Q5EA 1E92A 3GEEA 3N05A 5B1DA 1SB8A 3OZEA 4KAFA 2O8EA 2VPZA 1QGUA 3A1VA 1CDDA 4JASB 3PNBA 2O8EB 1KDOA 2OB2A 4GX1A 4TQ9A 4OP1A 2HNKA 1GUFA 4JI8B 5IJXA 1BOFA 1TVMA 4KLCA 4IY1A 4V0LA 1SC1A 4NMLA 3BHNA 1WU8A 4YDQA 5KTMA 3U3JA 1P31A 3FVWA 5HZGA 2EZ4A 3ILYA 2OGUA 1N2SA 1XGKA 4YT2A 5K9ZA 1LQTA 5KNDD 2GBIA 3NRCA 4PWZA 2FUG6 3TL6A 1G17A 3J80A 5IDYA 7GPBA 4RMIA 2H2GA 3FPKA 3ANTA 1VG0B 1L4HA 2H4XA 2BGJA 2I4NA 3KYDA 4HEJA 4MWEA 3HJNA 1GG2A 2MINA 2PFKA 4REQA 3I2IA 4IWNA 2XCLA 2NTEA 4MKHA 3TVYA 1DTWA 3JPYA 1S3IA 2ZYTX 3CUYA 3L79A 4P36A 3MWEB 4BNLA 4X9XA 4RTKA 2CVHA 1O5TA 1PR4A 3C4JA 1BO6A 1YQQA 2ZRIA 4EYSA 2UUPA 3PQ2A 4LQDA 1YRWA 3RKSA 3LX8A 2B21A 4LYGA 2QT9A 1YVEI 1UPTA 4PAWA 5C2JB 1TT7A 5BPHA 5A5VA 1HDXA 3SWWA 1ZMTA 5ISMA 2OUIA 3AEXA 1JKXA 4LE1A 5T4FA 1GTVA 3LVBA 4H59A 4P38A 5LXTA 2QVYX 2A30A 4IIJA 3U44B 2W0MA 4Q7JB 1F8FA 4QUIA 4IV8A 5DGXA 1WPGA 1UKVY 5CGZA 3LWBA 2HDWA 2AG6A 3A7DA 5ES4B 3IIJA 4JI0B 1ZGCA 2EJWA 4LW8A 3TEJA 4WLVA 3EVCA 4JCOA 1B15A 1BN6A 2MSCB 2VAPA 3NBZC 4WY5A 2JFOA 5DM0A 4N47A 3ROGA 3TFOA 4B3CA 4Q0MA 1W36C 3FBWA 1KSHA 3U40A 1TX4B 3IE0A 1L4KA 3UB3A 3VKHA 2E3JA 1KQ3A 1H94A 1QNFA 3I05A 3N8DA 2ORVA 2C4HA 1T2NA 3DFMA 3D7LA 3PRHA 4W4TA 3R5TA 5CM2Z 3WIEA 8OHMA 3I4CA 2GN4A 1VJTA 3HV2A 4G09A 5H83A 4U63A 1RAFA 2XTJA 3PDIB 3VOTA 1R0LA 1LF5A 1NQAO 1BHJA 1YVUA 1PT5A 4PN7A 1W8IA 3HR4A 3T5TA 3EIWA 3NETA 3NHLA 4BRWA 1O6GA 1Z2DA 4R9VA 3QF4A 1OA0A 4I66A 1UKBA 1MF7A 3PIDA 3O4GA 1X86B 1U6JA 3WL8A 1CR6A 4OOEA 5BN5A 5JR3A 1JEOA 1IVNA 1FCJA 1XZIA 2YQ5A 4OM8A 3ZQ6A 3ZCQA 5F9MA 4CKWB 3K9QO 1QCCA 3BJZA 1UMCA 5IAOA 3E9ZA 1IJFA 3IS3A 4IRUB 4JZYA 2JAHA 1MGOA 4AJOA 1C9NA 2D0IA 2R1UA 4Q4HA 3SKVA 1CJSA 1BQ4A 3F4LA 1NYTA 3KQKA 2IC5A 4FCCA 5LWQA 4KQHA 3EXIA 1Y3IA 3JARA 4BGUA 5D5QA 1RNLA 4B7CA 3N2EA 5FNZA 1PK8A 2HWWA 3QWAA 3IKMB 1IN4A 1FW8A 2QRLA 3IVMA 1FFXA 1MVNA 4REOA 5C5EA 5BSRA 3DAPA 4GLLA 2Y1OA 4XI9A 3GZTB 2A8YA 4ESOA 1OKKD 3CCFA 5CX4A 3C8DA 1LC3A 2HWKA 2XMQA 3HNRA 4J90A 221PA 3FGZA 3OLYA 2WMNB 3TGPA 3M34A 1UINA 1AG9A 1S0UA 3EY4A 4FS8A 1PWXA 1ACLA 3QX9A 4E4RA 4FMDB 1SHKA 2Q41A 4YROA 1XAIA 3KJGA 2E1RA 2IDMA 1ORHA 5KC8A 3RS4A 2B2NA 5MFPA 2GX6A 1NI5A 4BCDA 1RBYA 3QA9A 5KQLA 3ZXYA 1XQXA 3I9JA 1M34E 4Q1DA 2VYVD 4X8OA 5E8RA 3CB2A 5DCWA 4D9IA 4DY4A 2DECA 3TZ6A 2A59A 4C6SA 1P4GA 2WAMA 4EFLA 1SUDA 2BR4A 4TKVB 1GPBA 3Q6IA 3RUIA 2BISA 1FUYB 1XFDA 2Q5OA 1KJJA 4DQUA 4URWR 3N3BC 3EUWA 1HL3A 5HQ3B 1LVHA 1WL8A 2ZRKA 5J58A 4FZVA 1KI2A 3I2JA 2EARA 1QHSA 4GPZA 1JPJA 2CUKA 2NZ2A 3CR7A 4L16A 4Y9DA 5T4EA 4BL5A 4BNWA 4MRRA 5JZ9A 2C04A 4DCUA 5J23A 1QRRA 4OA8A 1NLYA 1KIFA 3O94A 3HDHA 5JECA 2EKBA 1XF9A 4P34A 4Y30A 2I4IA 1YE5A 2PGLA 3CBQA 1LDMA 1RYZA 2MINB 4REQB 4TWAA 5LZ2A 2PUCA 4FE7A 1KF0A 2GBPA 3LUJA 5G4LA 2Y1EA 3VX4A 1KXJA 5HFNA 3EOAI 3TRDA 3PR1A 3CT4A 5IN5A 2HA0A 4QSHA 1LFDB 2O5RA 4NU0A 3A6DA 2C3UA 4O4JF 3R0XA 5F98A 1M2KA 2FSSA 2Z9BA 3VR5A 2CSXA 1XEWX 3BORA 1QZ3A 1FQOA 4GXRA 4CKYA 3EIXA 1OFVA 3AETA 2GR9A 1I4TD 1N0UA 4BS9A 2VHCA 2C7VA 1CRQA 5M29A 4GRAA 2I9PA 1H0HA 2JH9A 3HWX1 2JIQA 4P4SA 2H2AA 4WCFB 5CH8A 2FW9A 1H4SA 4J2OA 3AF3A 1IBMB 1NI4B 1OAAA 2CHVA 2P6OA 3DQZA 3JWGA 3LOPA 4MJ7A 3S8MA 4BKQA 1USVA 2XZPA 3ESYA 1AHPA 1DTEA 4OSPA 1WX1A 4GYWA 3DL4A 4R1LA 3SOZA 1LDNA 3VJKA 4BQNA 1RBQA 4ESVA 1AZTA 4JVMA 5IDQA 2HZ7A 3PPXA 3QV1A 4X7MA 4BAUA 4MH0R 5EIFA 1LFAA 4MKGA 4RV9A 2EJUA 3FTFA 3FDZB 3ROQA 3GC6A 1YQXA 4KO2S 1V2HE 5FUXA 2RJNA 1YBAA 2JEZA 4BECA 3GIDA 1GZDA 1UT6A 2WSSD 3RG2A 1L5HB 4OUDB 2UZ3A 5BSWA 1CK4A 2AJ8A 1L5GB 3LP6A 3P2KA 4ETMA 1HF3A 1R8JA 3HGMA 1SFRA 3ILSA 1G8AA 1YGYA 2IIQA 2DWUA 2H16A 5YASA 1P73A 3OPMA 5EZYB 5FLKA 4BJ6A 5KTTA 1II8A 1K7YA 3PJRA 1AKYA 2DYKA 1IG0A 3A1CA 2W2QA 5F3DA 3SYKA 3H5VA 3ZE7A 4LDQA 3G8AA 2HMAA 1MOZA 1QFZA 2CE2X 3MRXA 5KOJA 2BPOA 4DB2A 1WEHA 1FY2A 3WGGA 1LRJA 4A0QA 1G21B 1IXZA 1AE1A 1J0EA 1YDMA 1VLHA 3AF4A 3EXEB 4LOJA 2AHOA 1YS4A 2D5CA 1YZVA 2FZGA 2QUIA 2WJZB 3KJEA 4MGIR 3I6IA 4TWRA 4XQ0A 5GOTA 3HBMA 4L78A 4BVGA 3UEOA 2GEFA 2IUUA 1A7UA 2H85A 2G25A 2HMSA 4ZYYA 3L18A 1U90A 2JJ1A 4MAMA 2Q29A 3K9LA 2GB4A 2GJ9A 2W8BA 1Q74A 2BBOA 3N7TA 3KD2A 3BXOA 1FLVA 1FLNA 3C48A 3RU2A 2VQSA 1QGYA 4DJTA 1VHDA 4E5UA 1SU6A 3ZCPA 1ML3A 3MINA 4NZYA 4BQIA 2EFGA 2UU9B 3HJRA 3ZCUA 1E59A 2PGIA 1QK5A 3LCCA 1J23A 1GD1O 2ZIEA 5FFMA 4HXFB 5G1NA 4RLFA 5HMLA 1Y1RA 4ARVA 3QBTA 4ZVLA 1ECFA 1FSSA 1H05A 2BMWA 3SHWA 2X5KO 4K2HA 2B25A 3FGPA 2CV0A 2C9YA 4PX5A 5FXMA 3MN1A 3RSSA 5J43A 3F6BX 3GLFA 4JS0A 1WQ1R 2WUEA 4IWXA 4U2CA 4KRGA 4RBNA 2H1LA 4IM7A 1WU7A 1JSLA 1ZVMA 3P52A 4RHTA 3TF5A 4DLTA 2EW1A 3TIFA 5KNCH 3ISTA 3LUAA 4IDBA 1KS9A 4R69A 1SOUA 1XP8A 2GTIA 3CVUA 1K5GA 5A5DA 5GVSA 1SVIA 1H5NA 1UANA 3A0RB 2V65A 2YZ7A 3GO4A 4BC0A 2O8CA 1V7ZA 1ZPDA 1JA1A 5DPMA 3PHCA 4ZI3A 1WF3A 5CCXA 5EP1A 2PS9A 4BFYA 5FBQB 5KWIA 1TCCA 3MERA 1CR4A 2YV3A 3CUWA 4NAHA 3PD1A 4BVHA 5L9AA 2H5IA 1KSFX 1QDUA 1SVLA 4ND6A 3U7IA 1FTSA 1YC2A 2OM2A 3GP5A 3JQEA 3L7NA 3OP4A 4PZUA 5AJUA 2VUTA 1AN0A 1RXEA 1XQ6A 3BB4A 5GJWC 5ULLA 3X1ZA 3V7WA 1IBSA 3O91A 1VE7A 4CMJA 4YHHB 3MTQA 4A4DA 4H7PA 4I1UA 4LF4B 2XHZA 3ND8A 4MQBA 2TMYA 3SX4A 4RFSA 3WBBA 4EQ6A 4OY3A 1K9SA 5CDTA 2Z5LA 3UHPA 2QIPA 3CT6A 3L01A 4JQCA 5E1OA 1Q1EA 2QU8A 4B0OA 3DZBA 1BTOA 3JVIA 5LOVF 4KO8A 2H5JA 3DVQX 4M1TA 4P83A 4IBOA 2VAVA 2Y1XA 4B40A 4RTPA 3C6QA 1RKXA 3IYLW 2NSLA 4HNSA 1RWWA 4R7GA 4DCTA 2IH4A 4I1YA 4UBLA 2ZBEA 4JT8A 2LBPA 3BCSA 4R9SA 3OIFA 1CEEA 1T25A 2J1LA 2D1SA 2HFKA 3GJTA 3MIIA 4MMZB 3VYRB 4ZMBA 5H4HA 1H2HA 1WZ2A 3T7CA 3WWYA 4KKXB 1KPHA 1PP4A 3QV2A 3BHIA 1MRNA 3KC2A 3HDGA 3B9BA 2I22A 3DAFA 2IYXA 3NM5A 3NV9A 4RY9A 4WXYB 3S28A 4UZSA 3TPFA 2WB2A 2CVZA 1SVMA 2CB0A 1XMJA 4L0CA 5LZ9A 2A0WA 2PGAA 2VPPA 2XF2A 5EPEA 2R4TA 4FYXA 2IDJA 3MVEA 4B2LA 2FYTA 3Q72A 4ERXA 4F6CA 5DGDA 2DSTA 3NTQA 4YRBA 3ENNA 4XOIA 2QZJA 2WD8A 2XGMA 3RK4A 4XPIA 1GRVA 3A6ZA 1TAQA 1G9XA 3H97A 2RI0A 4GPIB 4UM5A 1HORA 1E60A 2QRHA 2IHBA 2J48A 5IUKC 3NAQA 3PGMA 1R50A 2PRYA 1D2GA 1GQOA 4MWOA 1YMVA 1D1QA 2P9TA 2IUYA 5AVRA 1MQ9A 5I7OA 2SCUA 2XPCA 5I7VA 1J33A 1ZL2A 4HMOA 2JFWA 5ABPA 1R4NB 2VYNA 3EPJA 1P1JA 1RM0A 5EP2A 3T95A 1WPXA 2BGIA 5LLSA 4MRSA 3GRZA 5DWVA 1ZS9A 3TL3A 3QU5A 5EJAA 1B6TA 2H00A 5HILA 1X42A 1X7WB 5COQA 3RUEA 1SC6A 2ROQA 4N6OA 3PJFA 3PNVA 2IYQA 4YRRA 4WV3A 1E1RA 2RHTA 5HIAA 1LLUA 3SS7X 2XA1A 8ATCA 2NYAA 4EW6A 1NSTA 2JGAA 3NHPA 4ZCMA 5FJIA 1DUVG 3ITNA 5FLEX 4ECAA 2ATXA 5AHXA 1RI1A 3V80A 5I4KA 4RJIA 1M2NA 1VP9A 5G40A 3B3JA 4KYUA 1U80A 4KPFC 2WJ6A 1R74A 1I4WA 4ER3A 4I4IA 5HRUA 4WL0A 3FDIA 2R6AA 5FL7D 1R2QA 5EMMA 3RVOA 2IBTA 1G98A 1C8VB 5K8CA 1W29A 3BT7A 2PZJA 4PO8A 5M3BA 3SC4A 2IVZA 4GBJA 1EINA 4RIFA 3WV4A 5L3SA 1LBIA 1CUJA 2G63A 4M49A 1GYPA 1UBTS 4OLHA 2IY9A 3PCRB 1XLWA 4B3RB 4NYMQ 5CJJA 3D2AA 2Q2OA 1YJQA 1S2LA 3CUTA 5DSZA 4MUKA 4C89A 3IDOA 3QW2A 1G8HA 1SWVA 4RK4A 4NYIR 4QYMA 3AI1A 3A3OA 3LKDA 1MOQA 2WM3A 3ZGVA 3BFVA 3KJXA 1QIHA 1DC8A 4RA6A 2QV0A 2K5UA 4CM9A 3SVLA 3V55A 3Q41A 5J2TB 1N78A 1WCYA 2LNDA 2VDVE 3G2LA 1CUYA 2Q4DA 3MRTA 3PC2A 4KMMA 5KOHB 5CD9A 3OC0A 1XRLA 4K8OA 3RWBA 5EP3A 1QQ5A 1ZH8A 3C4VA 2IU0A 1YVPA 4KQ6A 1YL6A 2ZREA 4XCXA 2JKYA 1Z8HA 3JQAA 2GCNA 4M1KA 1RYBA 4MR8B 3NOOA 3GT3A 2DUJA 4ZT6A 2HQBA 4U02A 2V55B 1QVAA 2QP4A 4L27A 3CCCA 3DD1A 5LYJA 5KHLB 4GRIA 1ARZA 4TLCA 5THKA 1T10A 1D07A 3UV7A 2WJHA 3U4DA 2PUVA 1V11A 3IMGA 4V2UA 1XPJA 3S27A 3UXYA 2F8TA 2C7QA 1FNDA 2XKAA 1U8CB 4PSVA 3AIMA 3L6DA 4KX3A 3CW2A 2ZJ2A 4O2LA 3RBVA 2DQ4A 2MSDB 3C5EA 3HVUA 3PNLA 3GGJA 4URZR 4IGKA 5I9LA 3ENKA 1O5IA 3PEYA 5GY7A 4JL5A 4YBRA 3W5JA 4H4CA 2DPHA 3DMYA 4HLUA 2RK4A 4X0EA 3HZOA 4Y9RA 1KJ8A 3AUYA 1E9RA 2ZTHA 5TMBA 5AMXA 3RSOA 2GAIA 2V4UA 3FW1A 4FYYA 1OYOA 3Q8LA 1PSDA 3EQ9A 3GFFA 3N0RA 1RXWA 3ANYB 1L5VA 3G88A 3JQRA 1TW3A 2J4CA 5E6SA 3A6PC 1B7GO 2QTVA 5FHQA 2BFDA 5D8DA 3LKBA 1N75A 2N9UA 3ZGLA 1SZDA 4DR7B 1HDIA 2AL7A 4A0GA 4N9QA 4CN9A 3QE2A 3ORRA 2EBFX 3DMFA 3IA2A 3P26A 5HKOA 2LCIA 2C96A 3H17A 3SYRA 1RWMA 3I9V1 1D6SA 2WNHA 3LC7O 1AD2A 4WN9B 4ZYTA 1SAYA 2BFCA 3ESBA 1SXIA 1SUIA 3VU0A 4ZANA 2PCLA 1VI6A 3IP9A 4EYQA 4GX5A 3Q7PA 2XRZA 1GA4A 1XZAA 2ID4A 5TGTA 4H0NA 3V8NA 4O6VA 2JIZD 1WBJB 4FX5A 4YAKA 2ZYUX 1EUQA 2F3PA 4HGOA 4KUEA 5FPYA 1QVVA 1L7XA 1OUMA 2R6R1 3DM9B 2OCIA 3MJEA 4E1AA 2ZYHA 1CQPA 2WIGA 5ENZA 4J49A 1LI5A 3NTLA 3KR9A 2HHJA 3GRKA 3VM6A 1LDEA 2X8WA 3MJVA 1Z33A 3BWVA 3DEAA 5LWHA 3OIGA 1C5KA 4X54A 2CLKB 3S1AB 4WESA 1E69A 4AO6A 2FPXA 1ZUNA 1EUCA 1DNPA 4CDRA 2ZT8A 3B3FA 3E4DA 2E4UA 4N5LA 2W71A 3TSYA 3UMCA 1U2RA 2CVPA 3I5UA 2NGRA 3S99A 4QD3A 4P3PA 1G3MA 3G0HA 3ZQUA 1KAQA 3WKEA 2VFAA 1RLJA 4JOSA 4ZCLA 1EVKA 3P5SA 3BCRA 2VS1A 4DQXA 2PZFA 4HS4A 3RS5A 5B6PA 2GOYA 1FTGA 2FJPA 1X7WA 1P44A 3CRMA 1SEPA 3IUSA 5B3LA 1NWCA 2REQA 3MB8A 1KNQA 1DXOA 1I0ZA 4I1IA 4LOKA 2LZ0A 4HQOA 1ETHA 4TWJA 4C76A 2BGUA 2NVWA 1EBUA 1TPZA 3DVAB 4IJQA 2IS1A 1EFKA 2MYUA 3VNVA 2PR7A 3VR3D 1YE8A 4U7GA 5K4AA 1Q0ZA 2R5FA 2WWFA 3V4SA 3ZGZA 1T6ZA 2NPIA 2YASA 3ABIA 3G7NA 4ZIRA 1BYIA 5K0CA 3WYCA 4DIKA 2X9GA 2IYZA 1H2WA 1NMSA 2JFVA 1E9DA 1RJ9B 2GPJA 2IHVA 2OB1A 2XWSA 3H3FA 2O06A 4LOAA 3RBXA 4J8PA 4DILA 1MEOA 1ADFA 1EDZA 3AI7A 1NATA 3KUUA 4O2BF 2Q8NA 1UT8A 3E3OA 3NPMA 3ZKWA 2YOFA 1NN0A 3C6XA 3SDZA 2O8DA 4NDNE 2RJOA 4FLFA 3K6RA 2ECFA 4JZKA 4M21A 1W0KA 1DX4A 4W5WA 4I5GA 1J7KA 2RKWA 5T3UA 4BB5A 4HAUA 4INPA 4LKOA 1QP4A 2WYHA 1HG1A 1P81A 2FPGA 3SG0A 1GAQA 2C5SA 3OZIA 2ISSD 3TJRA 4XR4A 2JFHA 3U7QB 3CH4B 3E27A 4R16A 1BFUA 4F92B 2CL7X 3P27A 3SAJA 4CU2A 1Z2OX 2R2AA 2LV8A 1I2AA 1SURA 3CN9A 3ON5A 3WK8A 1UADA 4O4JA 4XSVA 4J3NA 4DWVA 2QDXA 1YS1X 1VECA 2REBA 1D0VA 1RFGE 4MV0A 2G6TA 3NBFA 4O4LB 2DR2A 5ECDA 1MABB 3W5VA 2WUGA 3C14C 4G5YA 3ZHOA 3MOSA 5DT2A 4KE8A 4U2DA 1Q6ZA 4B6SA 3TNLA 1H4QA 1E2HA 5HQJA 1T2EA 5JD6A 2OHOA 1O4VA 1OX5A 3HRIA 2PK3A 4H7EA 4B85A 5T7BA 3BIWA 4XUEA 1V4VA 1DIGA 3EVDA 4I2NA 3IILA 1T9ZA 2Y99A 4B4OA 2AZXA 1USWA 1H1LA 1VYTA 1E62A 2G28A 2QX4A 3LDHA 1T26A 4FOLA 5DI3A 1XXHA 4BV2A 5BN4A 3HYNA 4XWTA 1G6KA 1S89A 2G1AA 4D45A 1CJUC 2CFRA 3QBDA 2J67A 2I67A 1TIPA 3F67A 4GOXA 2BW0A 7REQA 4Q82A 2XQFA 5IWCA 3OT5A 1X39A 1EG2A 1PS0A 2PRSA 4JBXA 2CSUA 3K2QA 1RRFA 5DCLA 3SGLA 4F96A 4BVJA 1Z39A 2ZT5A 1EFPA 3V1UA 1Y63A 4AJNA 4W5RA 2ZM5A 1ISPA 2F7SA 3PXXA 2G9NA 2EFYA 2NO0A 2AXNA 2DCMA 3EQ2A 3QOXA 4C6TA 1TCUA 2KWIA 2IYYA 4YUAA 1W2HA 2JATA 1MZPA 4PYNA 2ODTX 5B1HA 4G1BA 1TLLA 4LHEA 1ZIOA 1DIAA 2JEOA 1OE0A 2PKXA 2Q46A 4L95C 4DQ0A 1MFPA 4F4HA 4DLLA 3HYRA 4RYLA 4YMTA 2UYQA 4X66B 2XZDA 1GAJA 2AKYA 1L7OA 3U5ZB 4DMCA 4QYIA 5BV8A 4KSBA 5KVVA 1XTJA 4CKBA 1QONA 1FVHA 4X41A 3IL2A 2ZSAA 3R6WA 3HPRA 3F0TA 4ZVKA 2ASVA 4IFEA 1ACMA 1T4GA 3HXTA 4PRYA 2C00A 4UKDA 2B37A 4ZAZA 4B84A 4F5YA 1ZH4A 4RPGA 2O48X 1CF4A 3QK7A 4IVQA 2XJ4A 4J1TA 5FPPA 3VDQA 2X9QA 5FO1A 1ZA1A 1HE3A 3QVGB 2GPAA 2Q2VA 3RNLA 4F4IA 1LPSA 1S2IA 1JWAB 2IXGA 4BNZA 1DKNA 2EL9A 3KKZA 3Q8KA 4HNTA 3ECAA 4K9QA 4GR4A 1FDVA 1EB8A 2HU7A 2IXDA 4QVKA 1JQ5A 4XX0A 3EGCA 5COAA 3SZOA 4BDTA 4E51A 4EGAA 2XIJA 1J2UA 1KDRA 4A2PA 2GRUA 2OLEA 3GCXA 4TTQA 4AKGA 3JQBC 4LKRA 1ST2A 5EE1A 2QD5A 4EGSA 1DPGA 2BRUA 3HCAA 4GF5A 5JATA 4RZIA 3UO8B 4L50A 4RLHA 1T0IA 3QGMA 1J8YF 1NNSA 4DE5A 3PF9A 4KR0A 3TLAA 5EUMA 4F6RB 1T9DA 1T3TA 1WA5A 2QPTA 2RIRA 2OV2A 3GZJA 5EUCA 5G53C 4ITUA 3E7WA 4NPHA 1ZM2A 4ZT2A 4JP8A 4WMLA 4ZOLA 4CIXA 3OQBA 1HSOA 3WYNA 2PQ2A 3SZRA 4YRNA 3KAPA 1E9FA 1MB4A 3OD5A 3I37X 1I2CA 4S2UA 4RH0A 2FUCA 1F2VA 3ZS9A 4CIVA 3M3HA 3PNPA 4FKMA 3UYLA 3ETHA 2Y3IA 5L3ZA 1ABEA 1ANKA 1V9SA 2FWRA 2WHPB 1YZQA 3C3PA 3GGSA 1QB7A 4Q1AA 5BSFA 1JP7A 1QE3A 3L0PA 4UE2A 1UXKA 1LY1A 4ZT4A 1F3OA 4YREA 1MJGA 1SBNE 1W47A 4PBTA 2CLDX 3M6AA 2H0RA 4Z51A 3E1SA 4G5QA 1GGVA 2JZCA 1IE3A 1X80A 2P67A 3CG0A 3FI9A 5TQ2B 2G8NA 4PNHA 2NV6A 2PGXA 4FDUA 1B73A 3F7MA 5HCIA 4GGOA 3KQVA 5CK4A 5LYYA 1SH7A 1XZPA 2AFHE 4H17A 3UXEA 3QELB 5CLFA 4E2ZA 1T3ZA 3ZJYA 3FUTA 1PJTA 3H42B 1RLTA 1IBCA 2YL2A 5ITVA 1JIKA 4CI9A 2XW6A 3DKIA 3INGA 1O95C 4DDVA 1GR1A 3DEZA 3FMFA 3HKDB 3QLUA 1J0DA 1LW6E 1XK6A 4E5VA 2DH6A 1W46A 1IMOA 3A9VA 3CRRA 3R4VA 5E6RA 3K0FB 1C3EA 1DC5A 2V7GA 5A9SA 5C1DA 5KDDA 2VT3A 3MGKA 3R0ZA 3IPAA 4TL9A 4GDFA 3MSXA 5HZMA 4I50F 2ZPTX 3AIIA 4ZO4A 4MULA 3QHQA 1O5OA 3WGYA 1GN8A 4CKEA 1FTYA 1BVUA 3TIXB 2WF9A 4YAGA 5LVAA 1SQ0A 1K4MA 1Y89A 5KYTA 3TI7A 1KIMA 4CUJA 4M22A 4LBVA 3W7VA 1GRQA 4LYHA 3F7OA 3UJPA 1C1YA 1CY1A 1C3JA 2J6CA 2QSJA 4YUYA 4F3RA 2F9FA 5JNWA 4ZGGA 1Y48E 1K0FA 2CMHA 1RWPA 3C6YA 1UBJS 4GPTA 4LXHA 3ED5A 4CW7A 5IC4A 3B82A 3A2KA 4JWKA 1OLUA 5LP6C 5CLQA 5I7SA 2WSSA 3DVAA 1K8QA 2XCOA 3F3KA 4MIKA 1Z4JA 5HPYB 2Q3JA 4IMIB 4F9FA 1U1DA 3NWEA 3S40A 5BV0A 2N0SA 3CCBA 3NHZA 3VVMA 1N8NA 1XZEA 5REQB 4IP0A 3DKPA 4XFDA 4MHTA 2WFMA 1SD5A 2PTGA 4B4KA 3WGVA 5KSYA 1Z4PX 3EZ7A 4LY6A 4ZQFA 3MTGA 1Z6XA 3WO1A 3F4KA 5HKAA 1ZMRA 4CM8B 1Y4AE 2OOKA 1H42A 3GDOA 4M9RA 1L5MA 2PIDA 4JMPA 1GPMA 5HP4A 1SA0B 2ZBQA 4TT8A 3NH6A 3U7EB 1QIDA 1ZGBA 4MXDA 3W77A 1E3MA 4IF4A 3SYLA 3WRYC 2MTBA 4PCUA 3DE1X 1K08A 1YR9A 4NZZA 3H1GA 4NXNB 1FFAA 3LF1A 3R20A 1EESA 1SHJA 3BMOB 4ZCIA 1NOJA 4X3OA 1H2YA 3VDXA 2OCBA 4F85A 1LVGA 3M33A 5DH9A 1AZWA 1DI0A 3UMYA 1KP9A 4XJXA 1LZLA 2GWHA 2G4CA 4L22A 2XSZA 4LRYA 4QGGA 5CW2A 3ZWMA 1NJ6A 4L5IA 3LW8A 1WTCA 2BTQB 2GPYA 3DCNA 4U6SA 5BR7A 1RACA 2BTQA 2J0UB 1CR0A 3BK1A 1ULSA 4B34A 1KEUA 4MVJD 4BVBA 1SBZA 2YZGA 3BWYA 3ZNOA 4EJSA 3W2EA 3IOYA 3DZFA 2IPXA 2F3TA 1N2CE 2VP3A 5A7FA 4YT4A 1TC1A 5FV7A 5C18A 4DM3A 3N87A 3GPLA 1SBTA 4EQZA 3ZE9A 3DUFA 1CIVA 1ZQ1A 3RF6A 3W6OA 3OUUA 5DGHA 2AYXA 3A28A 4E2XA 2GNAA 2EP8A 3UJ7A 1TM2A 3BEOA 1KJIA 4Q9DA 5K3FB 3TM5A 1TTPB 2G5TA 2R7KA 1LSOA 4R2LA 4QGSA 2IYVA 1JAXA 1JB1A 1V7CA 2QUHA 3FWNA 1M3SA 2B4QA 2YVLA 3OM8A 1MABA 3TGLA 3K3PA 3WNBA 4DLPA 1R4AA 5A71A 2OTCA 1BXGA 1ISRA 4BNYA 4FHEA 1PJZA 5AHKA 4CEIA 1JVSA 5GONF 1LK7A 1GV0A 2CN1A 3L1JA 3KP1A 2RFLA 2J3QA 3L7YA 2J3DA 4OI4A 4YCBA 3T5GA 4F38A 1IYZA 4C0HA 1QIFA 5JVDA 2JBAA 2A7QA 2WMDA 5C80A 3QXXA 1KSJA 2FB9A 1RDFA 3OQJA 1S4MA 2WWTA 2ZR8A 5BYJA 3V4ZA 5BQ3A 4B09A 2BGTA 4Z1OA 4LJ9A 5FBZA 1JJAA 1MHPA 4YRLA 2YY5A 2YMMA 3OF2A 4W6QA 4QASA 4XDHA 4OYYA 1VXRA 5JJ5A 4QVIA 3VKWA 1RCUA 1SELA 1ULAA 4V38A 3JV7A 2Q6KA 3DAHA 3M1YA 4AKIA 3JS5A 3R0QA 5A4AA 3NYWA 1QNLA 2CUZA 4RKRA 2BJVA 2Z2IA 2DM6A 2V6BA 3WAJA 2HF9A 5BVHA 4RTLA 4WKGA 4NC9A 2Y77A 2ANCA 2GAJA 2CXPA 2J87A 4QGFA 1YFLA 1TC2A 5A9SB 1OFIA 1P29A 3BL8A 1WR8A 4RL6A 2QRJA 2ZE6A 1AU9A 4FEAA 4AY5A 3H1PA 4JBIA 3FKSD 4QOGA 3AUKA 2ATEA 5LB4A 1Z4LA 2ETVA 2I6XA 2QAJA 1MUUA 1T36B 1TVKA 2YXNA 3AEKB 5T4BA 2V54A 1L4EA 3T0FA 3RSLA 1F9AA 2MIIA 5DYGA 1UPCA 3Q3VA 4C7OB 4FGUA 1NOIA 1G41A 3JQ9C 1CV2A 4RS4A 3LA8A 4TXLA 4KL8S 2FFHA 3VQTA 4ZA2A 5E1BA 2LR0A 2BIFA 4PF1A 3R7SA 1DBSA 1QORA 3IUNA 4FNGA 4BJ5A 5B1IA 3I8SA 3IT3A 1NDHA 4K9MA 5LPNA 5A4MS 3QXJA 4R1UA 3PDWA 1CF2O 2PKWA 2XB9A 1QGUB 3CNNA 3WKDA 1JR3D 1UC9A 2QVCA 1MC4A 3MMZA 3ZHZA 2YINC 2NSJA 5LP6B 5BW8A 1QFJA 4XEHA 3Q9LA 1T3LA 3AXTA 4QBFA 3MCUA 3RTDA 4BLPA 4AICA 4V1CB 3OZGA 2A0YA 1E3TA 4JEMA 1M1XB 1ZXLA 1G9TA 3MK31 5DX8A 4MHSA 5JCZA 4Q3LA 3IT2A 3X2FA 1DWPA 2UV8A 2V7TA 2IZ1A 1O2DA 4RHFA 5DNVA 3CSUA 4XVUA 1ICEA 4TL7A 1S6YA 3PC4A 4WZZA 3F6CA 4KN6A 3I2HA 3A1FA 2HKIA 3CB4A 3M4XA 3H5LA 3AP2A 2C98A 4GSLA 1XCPA 3QWHA 1F2UB 3K1JA 2H51A 4U2EA 3LY8A 1PGPA 5P8WA 2RGRA 4P0PB 1EWYA 3GEHA 4XB6B 4DLBA 4A8TA 1XWWA 1HNWB 1QS0B 4QWWA 2Y1DA 4YPFA 2VHZA 1E0SA 3MYRA 5EPUA 1GZ7A 1KZHA 3SU8A 2FR8C 2ZSEA 4HNVA 1HE1C 4EMSA 4MUHA 4OGFA 3U6KA 4JB2A 2NYUA 3WQBA 4A1OA 4C5AA 4O3FA 1W49A 2X8BA 5JE8A 5KNDA 1MPTA 2P9CA 4ARAA 3JXEA 4B8WA 3BTOA 3AVYA 1VM6A 4M6WB 4EELA 2ZULA 1SOMA 1R5JA 2C8LA 2FY8A 4QDZA 5H3LA 4DEYA 4ZYZA 5C46F 3EFHA 4PZAA 5A3VA 3WFZA 2R00A 3HVHA 3IR7A 3OPYA 5HTOA 3VZSA 4ZEOA 4AZVA 2RE8A 4X3PA 1G6Q1 2LD4A 621PA 3PE3A 1UBOS 1E7SA 1Z73A 2YJ6A 4C9BA 2QBYA 2GO7A 5F4ZA 3G79A 3GVIA 4KK4A 2VN8A 1C1XB 3TTUA 4X6YA 3GMDA 3NBXX 3VTKA 2DHDA 4YK7A 1VYVA 3KZVA 4BVKA 3K16A 5MGNA 3VMFA 4WA7A 5SV2A 3VTFA 1Z5ZA 2QR2A 1KA9H 4AUEA 4L0MA 4D3ZA 1YQUA 5GPBA 4MW2A 2AFHA 2HJ9A 3T7RA 2V8OA 5FFNA 3QBJA 2Z04A 1G7SA 1YS6A 4YJFB 4S3MA 4ALLA 3RD5A 1ACJA 4R2HA 3LCUA 4JELA 1AV6A 2JEYA 1QCZA 4S0XA 2XVYA 1LDGA 2YIMA 1T4BA 1XDSA 2C20A 2P78A 4RKWA 5LQKA 4XARA 1OC2A 2IOFK 4HAVA 4HRAA 3N2KB 3LLUA 4FZ5A 1U81A 4G0YA 4FZ3A 1DKQA 3EAFA 2Y9PB 1KJNA 1UK7A 4LZZA 2GLXA 5JVDF 1GFWA 1UKAA 1OB2A 1JZTA 3ONVA 4P4LA 3K9GA 1YQDA 1KEWA 5JMPA 4CM4B 1XL1A 4NS1A 3RYCA 5DP1A 2GXUA 2B5WA 3BICA 3ENQA 4O33A 1VFNA 5BW4A 1NBOA 2OZEA 2YXLA 2VYCA 2YXEA 2IS4A 3GPIA 2ZI4A 5FR1A 3VVCA 4WY8A 3NAGA 4LX0A 2ZSBA 2PUJA 4CKZA 3ZV4A 1ZN2A 1X8LA 3AM4A 3NFYA 2J33A 3IP8A 3TJMA 2DJ5A 3KEMA 3MGAA 4MVJH 3RVRA 2FFAA 2YZNA 2AIRA 3K1AB 1GG9A 3CZ9A 3DPSA 3THWB 1JE0A 3GZNA 3LWZA 2QLFA 3O31A 2O2YA 5F5NA 2R1ZA 2D5IA 3GLVA 4U5QA 3CZPA 1JZQA 1E3LA 1G3RA 1JIUA 1N2IA 1OROA 1UJCA 4ADSG 4HEHA 4DMUB 1HX7A 4AJ2A 2IV2X 2A0XA 2KMLA 4TVOA 2B7CA 2QYSA 3N76A 4M60A 3TQQA 3DKKA 2VYQA 2CHFA 2A0FA 4OKNA 4AD8A 1VKHA 3ECSA 1W0CA 2WKWA 4NATA 4QBIA 3TW0A 3VYWA 3WSVA 2HX1A 4CT5A 5HNKA 4RAQA 1I4DD 3DV0B 3KUDA 4NEQA 5EWLB 5AW5A 1CDOA 4ND8A 5TX7A 4EKYA 3A9TA 2HSEA 2I2CA 2OLKA 3DZKA 3BM5A 4L76A 3PA6A 2XY4A 3K9NA 5JSKA 5JJIA 4LJKA 1XU9A 4QFBA 2RHOA 4C22A 4KNYA 1XALA 3F5FA 3HUTA 3IRVA 1SVKA 2B2CA 3OTOB 4KO3S 1M2HA 3EXEA 1DOHA 1TCBA 2XQGA 4FEGA 8GPBA 2XBLA 2HJWA 1F4VA 3DHWC 1SC4A 4HAIA 2NN3C 3CEPB 3NAZA 1VLZA 3ZY3A 4ZJZA 1DTSA 1DEOA 1WDKA 3TUZC 4G36A 3VMMA 1V5WA 1LJ8A 1TU4A 1QLWA 2HMYB 3EEQA 3RGWS 1AO0A 3BXPA 4JUDX 4XLZA 2IU3A 4ZQEA 2ACWA 3EISA 3OCUA 3WJ7A 3NMUF 3T41A 3GUVA 4G01B 1K7CA 4M3NA 4KR6A 1MXFA 1JQAA 4PC7A 1H2AS 3ISVA 5FWNA 1TE2A 1KAMA 1OBHA 4TMVA 3MOGA 4FE3A 4M98A 4MA4A 2ZCUA 3U3DA 3DE6X 1YUMA 2C77A 1IU9A 4DDHA 1NVGA 2K4MA 3M70A 4Q7EA 3BG5A 2OHFA 4J0JA 2B3TA 3NM4A 3QOWA 3FOBA 2JJQA 1TGYA 1XEFA 4KXLA 2EX4A 4XJTA 1AIPA 4CIWA 3R23A 1N2HA 1FNSA 2DR0A 2NAFA 4B6FA 5FJJA 3EAQA 3D8SA 2DCUA 3COYA 1SG9A 2Z4SA 3DEKA 2IEZA 3DTTA 4BEJA 5FAKA 4K6CA 1Y80A 3WK4A 5I8WA 1KAOA 2QN6A 1UJMA 3OF5A 2IJGX 4L3OA 5BPFA 2JLZA 4IILA 2JD1A 3EOBI 1VJ1A 3ZHVA 5JEEA 1KL7A 4ND2A 1BCRB 4GX2A 4KC0A 2ODBA 2QMQA 5JRZA 1AQ6A 2DLDA 1NASA 2ZVDA 3AHCA 3ELUA 2AKEA 2QLBA 4EIWA 2VOEA 3TIGA 1BDBA 3R76A 3V5NA 1DRVA 1G4UR 1IOLA 2Q5QA 3L9WA 2D74A 3SEFA 2J3EA 3LLCA 4PRLA 1QMGA 3R8XA 2GJAA 1VPTA 3NTVA 2CXUA 3N2YA 5EZYF 1N5DA 3HN2A 1QRAA 3FPAA 3OQ1A 3VC2A 2G36A 4NH4A 1HLFA 2EF1A 3U4QA 3HCCA 4D44A 5FULA 3TLXA 3KL2A 2DOKA 4XVQA 3N6RA 5ADWA 1GZUA 3DLPX 2YV2A 2DHCA 3IESA 3VOAA 2FSPA 4P6VF 3TZEA 1P18A 5EEGA 4CETA 5K0ZA 1L8QA 5HOEA 5J4KA 4FKBA 4NZOA 2VTVA 4X61A 3RVDA 1BHQ1 3IAHA 4R8KA 1MAAA 2M98A 2X7XA 3AF2A 3HABA 1DAGA 1TM4E 2P27A 1GZ4A 1GILA 1TVCA 2H52A 3LSYA 3SZLA 5EIXA 4FI3F 3IFSA 3L6CA 5JSUA 3VYUB 4UEOA 3FPHA 4GGPA 4YJ3B 3EIOA 1U31A 3R8FA 1EUZA 1PYOA 3FD8A 4JLOA 4PVDA 3RVLA 4QPNA 1TVEA 1PDOA 2W9XA 3OC6A 1P75A 1KMNA 3HVJA 4XCVA