4KRXA

Structure of aes from e. coli
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
316
structure length
316
Chain Sequence
ENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analyses of Aes, an inhibitor of MalT in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Acetyl esterase
total genus 126
structure length 316
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.1.1.-:
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4krxA00
1NU6A 4AMYA 1GPNA 4U2BA 3RKSA 4X00A 1ZIXA 4EA6A 1DX6A 3HACA 5JIBA 1C7JA 1R3DA 1YSCA 3WK9A 1XKTA 4GECA 1T4MA 2B4KA 1VKHA 4B6GA 3O0DA 1CUIA 2VSQA 4MYDA 2Z3WA 4RNCA 2ZSIA 3MVEA 2WLSA 4RPCA 3UMJA 1C4XA 1QIHA 3O4JA 2HFKA 2WTMA 2CJPA 2QTBA 2XE4A 4GDMA 5FOQA 1ZJ4A 4XIIA 3CN7A 2VJBA 2CB9A 5HFNA 2QKYA 1H2ZA 3RM3A 2WU4A 4ZV9A 3H04A 2HA2A 3PE6A 4KE6A 4AO8A 1AGYA 4DM7A 1EINA 2H7CA 3R3WA 5FKJA 1JU3A 2PPLA 5AM2A 3N2ZB 1XZEA 2VF2A 2VATA 4KE7A 5C8ZA 2VAXA 4U2GA 2XQJA 2JGEA 4LKOA 4BTVA 4RGYA 4QDOA 4U2FA 4DMCA 2VEOA 2YYSA 1ISPA 5ALSA 2ONCA 5HQ3B 2WHPA 3HRHA 2DQYA 5JARA 2NW6A 4UPDA 2HFJA 2XUKA 4ITVA 2RONA 2HM7A 2RHTA 5CXUA 2HU7A 3H19A 1GQSA 2CKMA 1A7UA 4KAAA 5CXXA 4Q34A 1A8QA 4ARAA 3DJYA 1H2WA 3IULA 5I7UA 4B82A 1X2EA 5DYWA 1ORWA 3R3XA 4H7JA 1LGYA 5JASA 2JGIA 2AJDA 1ZI8A 3G0DA 1XQVA 3ICWA 4WDRA 2FUKA 2DR0A 4Y2QA 5IVDA 3B5EA 1QIJA 1WHTA 2O2HA 1UOPA 5AKGA 2OQVA 1QIGA 5AM1A 4WCVA 2QUBA 3I28A 1M33A 1ZD3A 4GW3A 5T4BA 3AIKA 4AMZA 2WTNA 5ALEA 2QUAA 1JU4A 1FFBA 5BV7A 5C8XA 4PF1A 5CBKA 4Y2UA 5JAOA 3QBJA 1QIIA 2PSDA 3HXKA 1T2NA 3FNBA 2ZYSA 2XMSA 1BS9A 3VXKA 5K5EA 1EX9A 5AKZA 3WL7A 2HA5A 3K2IA 3ZI7A 4QDXA 5SYMA 1IUPA 1LNSA 3BE8A 3CN9A 2ROQA 3IUJA 3BIWA 4BCDA 2HRQA 4GLBA 1MX9A 2XUHA 1XQYA 4X3CA 3OG9A 2RI6A 2QRUA 5LZ5A 1AMNA 5K3DA 1XZCA 4X91A 4ARBA 1H2XA 4H35A 4N8DA 4C89A 1WB5A 3S8YA 2AJCA 4FMPA 5AKJA 5DYYA 1IZ8A 3O4GA 3EQ8A 4CCYB 4N5HX 3HJUA 4B0PA 4K6GA 3GFFA 1ACLA 3L1JA 4P9NA 2Y6VA 3G9XA 2XUJA 3WKAA 3NWOA 2GBFA 4X7BA 5AOBA 4QEKA 3RLIA 5CMLA 4J0JA 1KEZA 2BGRA 2FX5A 3U1TA 2IX9A 2VTVA 4PSDA 5JD5A 2H1IA 4P08A 2ORYA 3VVLA 2WUDA 1JT2A 3V48A 5AM0A 4RE6A 3EQ9A 1K8QA 1Q84A 2J4CA 1TKRA 2OGSA 3H2GA 4ZRDA 2D0DA 3G0CA 4GI1A 5A7GA 1CUWA 1JKMA 5AI8A 3EBLA 5LYYA 5LZ2A 4UHBA 1H22A 4HXEB 4UFNA 1NU8A 1RWQA 3WZMA 4FWBA 4HRYA 5IVIA 1R9MA 1DU4A 2BUBA 3D0KA 3C45A 3LCRA 3OOSA 2JGKA 5JAUA 5T4EA 4BC0A 1FJ2A 4B83A 3WA7A 2DHDA 1VXRA 2RGUA 4H7EA 1W1IA 4EUSA 5AI5A 1DT3A 1OXMA 3PUHA 2QXUA 2Y1KA 2WIDA 2XMQA 3T52A 4X94A 1AQLA 1LLFA 1HBJA 4X97A 4ZI5A 5FXMA 3WIBA 3LP5A 1DX4A 3V1MA 4BBZA 5DLPA 2JEZA 4AX4A 3I1YA 5HFAA 1HKHA 3AUKA 2QVBA 3QYJA 4J0CA 3W04A 4AN1A 3FLBA 5JD4A 4Q3LA 2OGTA 2OQIA 4FBLA 1AKNA 4HXFB 4UBJA 4EB0A 1XZKA 1K6EA 5AM5A 1G5FA 2WJ3A 1I6WA 2P8SA 4OB7A 3IVMA 3HLKA 3G0BA 1W52X 1ZD5A 4HXGA 1GGVA 3PF8A 5BOVA 1XKLA 4A16A 5ALQA 4KEAA 4L9AA 1ORVA 2C4HA 1JJFA 4UBLA 4W1SA 3HYSA 3OPMA 1BROA 1BN6A 3FYUC 1ZGCA 5ALHA 2O7VA 4I19A 1QE3A 3STWA 4C01A 4W63A 4OPMA 1O6GA 1CPYA 4X6YA 1R50A 4QZVA 4BP8A 1XLUA 4BDTA 2GYUA 4XVCA 1IUNA 1TCBA 3WKEA 4CCYA 4BAGA 2Y2UA 3BF8A 1YASA 3C8HA 4BAZA 3I6MA 4BE9A 4F5ZA 2W22A 4B80A 4H77A 1EDBA 2W6CX 1CLEA 5H3HA 2E3JA 2XMGA 5CH8A 3OC0A 1W6RA 4BATA 4IO0A 3H18A 3R3VA 2GBIA 1EI9A 3H2IA 1ZOIA 1F8UA 2BKLA 5AI9A 3NOXA 1MAAA 1J06A 4MYSA 5ALLA 4FNGA 5JADA 2FJ0A 2XUQA 3M81A 4ZREA 4N5IX 2XB6A 4XWGA 3R40A 1KU6A 2V96A 2D5LA 3HABA 1EXWA 4IHAA 2HA7A 1VA4A 2EDAA 1DTEA 4AZ0A 4OYLA 4KE9A 1CUCA 2HA6A 1MN6A 4WFIA 5A7HA 6YASA 4HRXA 1UFOA 5AICA 2B61A 3KWFA 5DNUA 4ZXFA 3O95A 2OCGA 5ALPA 3BF7A 5AI0A 1CQZA 1CR6A 1BRTA 4WFKA 5AKEA 5JZ9A 2WUFA 4N8EA 1QFMA 4AO6A 4EY5A 1JFRA 3R0VA 1CUXA 3FCXA 3FLEA 3H1AA 5BWCA 1CV2A 3QMMA 3DDUA 5ALVA 1Q0RA 2HHAA 4YASA 1A8SA 4P93A 5HF9A 4CIBA 1GPLA 3PUIA 1XRNA 5ALNA 3D3NA 3X3HA 1NX9A 3AZOA 2DFPA 3SWWA 2DSNA 5AIAA 5LZ4A 2WFLA 4H7HA 4TPKA 1Q0ZA 2Z5GA 3G02A 1HLGA 4W1QA 2GZRA 4GEGA 3STYA 3WJ1A 4PSUA 1Z68A 2Z8ZA 1IVYA 5AM3A 3HC7A 1TCAA 3I1IA 1SFRA 1EH5A 3KDAA 3EF3A 4G9EA 1MX1A 3KWJA 4K2AA 4Q3OA 1DQYA 3R3YA 1U2EA 3C8DA 4IH4A 4B9EA 3TEJA 4A23A 5I8PA 4BDSA 1AURA 4MQMA 1F0PA 5ALOA 2XUGA 5CTAA 1EHYA 2O2GA 3A2LA 1XRLA 2B9VA 4E11A 3FVRA 4B7ZA 3TJMA 1CUAA 3E1GA 1MNAA 4AQDA 5K3CA 5DWDA 1MO2A 2CBGA 2WUEA 1BU8A 4JYMA 5J3JA 3VVMA 4Y2PA 4F0JA 2BFNA 2QS9A 1JJIA 5CT8A 4CG3A 2GBGA 1LPPA 4F21A 4J7AA 3IUQA 1XQWA 1CUGA 4K6KA 4X92A 5BWBA 2PU5A 3I2HA 1EK1A 1D07A 1OILA 2ES4A 5IH7A 2XDWA 2C5GA 3ANSA 1WB6A 4L3WA 3FBWA 4OUKX 3M82A 4TGLA 5AKYA 1WOMA 1ZGBA 2IIVA 3LIPA 2QXTA 3IBTA 4UHHA 1FFCA 5EHXA 2QR5A 4QWMA 3QITA 2XUIA 4FLEA 4OB8A 4DTCA 1XRQA 2OAGA 2O7RA 4N8SA 4JH0A 4WY8A 1WPRA 3D59A 2EDCA 4I3FA 2JGMA 2PM8A 1XLWA 5EFZA 2VQ6A 4Y9SA 5A6VA 3WYNA 3I6YA 5ALMA 3C87A 1TCCA 5AKLA 3DLTA 4NMWA 2QM0A 3WIOA 2R11A 3WKBA 4QDUA 3GBSA 4Y7DA 1MPXA 2X76A 1P0PA 2AJLI 5KWJA 1F0NA 3C70A 3B3QA 3D5EA 2ZYIA 2C7BA 3VJLA 4H7IA 4F60A 5D3ZA 1EA5A 4FNMA 4HS9A 3I2JA 4KE8A 1XRRA 3BDIA 1GKKA 1QOZA 4IH9A 3VJKA 4J0GA 1AZWA 7YASA 4D9JA 4JEIA 4BZZA 4HTAA 5JAHA 5DTJA 4NVRA 3YASA 3WWCA 3A2NA 1FFDA 3H17A 1TIBA 4DSAA 4MEBA 3Q0TA 5AOAA 3BIXA 3MGAA 5AK5A 3STTA 2BGNA 1XFDA 4U2DA 4UBMA 4TVKA 4KAFA 3D2AA 5A2GA 3F9CA 4BZWA 1LPMA 1UK8A 4K5QA 3AILA 2WG2A 1UKCA 1LPAB 1MU0A 5DNVA 2WJ4A 4H7FA 2H9YA 1UK7A 5HK8A 4DYHA 2XQKA 4UHDA 1YS1X 2ZYRA 2J3DA 3R3UA 5LZ7A 2YXPX 1VOTA 1HQDA 4X85A 4CFSA 2VT7A 4BC1A 1AUOA 3H2KA 5AK4A 3WZLA 1UKBA 4JNCA 3DD5A 4EZIA 5AHXA 4MXDA 4XJVA 4MWSA 1O6FA 3DEAA 3RARA 2PSFA 2BCEA 1USWA 3T4UA 4G8BA 4GXNA 3GZJA 5AIBA 3QMWA 1FSSA 2WIJA 4W1RA 3G9TA 3FYTA 4OU5A 2WHQA 1RP1A 4UBIA 2C58A 5HKAA 2JGFA 5LZ9A 4X6UA 1R1DA 4G9GA 5LKRA 5CURA 3H2JA 2I3DA 5IKXA 1N8SA 2RIPA 2WKWA 2GYWA 2OPHA 1MAHA 3ESAA 3W9BA 1QTRA 3DL7A 2PU7A 4V2IA 3VKFA 5E4JA 2C5FA 3P2MA 4QDZA 3DYIA 1W4LA 4BAUA 4WDQA 2PX6A 4FTWA 3WWPA 5AKIA 1UK9A 3AFIA 4KRYA 1EVEA 4P92A 3GELA 2BUAA 3GUUA 1J07A 2VA9A 4FLFA 4Q3KA 3QPAA 1IUOA 4GBGA 1H2YA 2DQZA 1BCSA 3N0TA 1ETHA 3JW8A 5A62A 3W2TA 4PO3X 1AC5A 1CQWA 1W76A 1W75A 4Y2TA 2QOEA 1CUDA 2HDWA 1Y7IA 4BYMA 2I78A 5DNWA 2J4FA 1PV1A 4O08A 3DL4A 2I3ZA 1JI3A 2AJBA 3PFBA 4UFPA 4DNFA 2XLBA 4FHZA 4PW0A 2HA4A 2BJHA 4LHEA 3WWEA 1Y37A 4AXBA 1FFEA 3V1KA 4S0XA 1ZI9A 3LIIA 2O2IA 5IVHA 4FFVA 2ZJ7A 4OD0A 3QVMA 5AOCA 3ESDA 3A70A 5FUMA 1MX5A 1XZFA 4DGQA 5AM4A 3F67A 4BTLA 4Y2SA 4EY7A 5DYTA 1TAHA 3OM8A 3FYUB 1UZAA 2WFMA 5AP9A 3QPDA 1VZ2A 2ZYHA 4KAJA 4M0EA 2G4LA 2JIDA 3GROA 1U4NA 1SCKA 3QM1A 5JANA 4B81A 1XQXA 1RYYA 1HPLA 1SCIA 2ZSHA 1XLVA 1VLQA 5FPPA 1YB6A 3I6ZA 1E3QA 3DKKA 4MEAA 1MT3A 4H18A 3C6YA 1ZIYA 4EY4A 5C7YA 1Q83A 3S2ZA 2CZQA 3U0VA 4DNPA 2OAEA 2JGLA 4G1FA 1CVLA 3IB3A 1EDDA 5KWIA 1GKLA 3BL8A 5E4TA 2PSEA 4UBNA 3UUFA 4LXGA 1C7IA 1DINA 1ZJ5A 3AIMA 2BAGA 5I9IA 3V1NA 1XZBA 3WK5A 1LZKA 4B85A 5EGNA 1CUFA 3RK4A 4AZ3A 4Q1VA 3IIIA 1THTA 3KXPA 4G8CA 3DS8A 3E4DA 3QMVA 3D2CA 5FLKA 1GZ7A 2XMCA 4G8DA 3D4LA 5CT9A 2R8BA 2Y6UA 3QH4A 1WPXA 3ICVA 4E15A 2XMDA 3UUEA 3WA6A 5T4HA 4DMKA 3I2FA 1XZHA 3SX4A 4CI9A 3M83A 3O4HA 4PNZA 5ALUA 5K3FB 3O9MA 2PUJA 5KREA 2QMQA 3G9UA 4X6XA 5JYCA 1G42A 3KOOA 3G0IA 4UFOA 2VJAA 1S8OA 4ZV7A 3WL5A 5AH0A 1QO9A 1BEZA 1ODTC 4Y2RA 5EHZA 1QIFA 2HU8A 1UKAA 1CEXA 5AJHA 5E2IA 2H7XA 4B84A 4DIUA 4G4JA 1CUEA 4PV7A 5CT6A 5ALFA 2WILA 4INZA 3QZUA 1IMJA 2XUAA 1N5MA 1EDEA 4BCCA 2G5PA 1QIDA 1E8NA 5AI4A 1GXSA 3G8YA 2XUOA 3WK4A 3FYUA 1QZ3A 2CEKA 2VAVA 5CT4A 3WYDA 5LKAA 3STXA 2XQGA 1R9NA 4H7DA 3BJRA 3HSSA 2JEYA 1WB4A 4QWWA 1YA4A 3O4IA 2CMFA 3W05A 3FOBA 3Q8WA 4J0DA 1ODSA 4BRSA 2VJDA 1CUBA 4W9RA 3AINA 5C8VA 3C5WP 1P0IA 3I2GA 3DOHA 5D6OA 2WFZA 4KR0A 3BXPA 4G5XA 4UUQA 1CFJA 3K9BA 4IH1A 3FSGA 3IURA 4ETWA 3L1HA 2XMRA 2PVSA 3KD2A 1VZ3A 5C81A 1XZAA 5ALXA 3G9ZA 5AKKA 5FDFA 1UOQA 3WWOA 2XMZA 4GHWA 1DWOA 4LYEA 5FV4A 4FBMA 5JZSA 4DLNA 4C4YA 5AKXA 4A5SA 3PF9A 1X70A 4OU4A 1WCYA 2DHEA 5ALYA 2Z8XA 1JMKC 2PBLA 5ALJA 1ZD2P 5K3BA 1JJBA 1BN7A 1B6GA 5ALIA 1XZLA 3H2HA 3V9AA 1VA5A 4OB6A 3CCBA 1L7RA 4FDMA 2C0QA 4M0FA 4HZGA 2G5TA 2ACEA 2QZPA 1DWQA 1R88A 2PSHA 5FRDA 5AK6A 4FKBA 1U8EA 1CUSA 3WWDA 3WKDA 1TK3A 3C6XA 3DOIA 4WJLA 5A71A 3G7NA 1YCDA 3C6ZA 3KSRA 1QONA 5ISMA 4NZZA 4BE4A 3PFCA 2HRRA 5CW2A 1ACJA 4EY8A 4C87A 1CUYA 2XT0A 4ROTA 4JUIA 1LPSA 2GZSA 3DYVA 4ZWNA 2QJWA 4EHBA 3QPCA 3W9UA 3BWXA 2WHPB 4BB0A 5JAPA 1QIMA 5CH3A 1MTZA 2JF0A 1TRHA 5CRIA 4RE5A 5E4YA 1BE0A 4C6HA 5HF6A 3AJAA 3IUMA 4LXHA 5K3EA 1VJ5A 1ODCA 3IDAA 5AKHA 5FPQA 1YAJA 2V98A 3F8SA 1E5TA 1P0QA 4UHEA 5KBYA 1QIKA 3FCYA 1ZI6A 3ANTA 3ZV7A 5SYNA 3L1IA 2AXEA 4QLOA 3CCCA 5K3FA 4H7KA 1DWPA 1F6WA 3A2MA 1K63A 2XUFA 4C4ZA 5AK3A 2YH2A 2IITA 3ILSA 3F97A 4AO7A 4BRZA 1WHSA 2XLCA 1E8MA 1GPKA 4DMHA 3IA2A 3FVTA 1OCEA 2V97A 4MQLA 4CG1A 2ZJ6A 4OCZA 3WLAA 2BUCA 5ALTA 2WG1A 2GYVA 5LLSA 1EB8A 4AB1A 3C6BA 4OYYA 2WM2A 1KU0A 2OCLA 4AN0A 4LIPD 1G4HA 1PJAA 4Y2YA 4X95A 3WQHA 1QO7A 1SCQA 2XQIA 2Z3ZA 4G4IA 5EHQA 1R4ZA 4PQEA 3I2IA 2HL6A 2OLEA 4J3JA 1CUJA 3DCNA 4X93A 3D2BA 4M0MA 4U2CA 3WI7A 3IUNA 3MUNA 2EEPA 4QE3A 1XROA 2OCKA 4PSCA 3LLCA 5ALRA 1UT6A 1YB7A 1ZD4A 3R41A 2XUPA 4G4GA 5AI6A 2B20A 5EHNA 1LPBB 1BEEA 2QJRA 2ZJFA 4KRXA 4FLMA 1VE7A 3WL8A 1FFAA 3VJMA 5IVKA 4QLAA 4U2EA 1SOMA 1N1MA 3MUOA 5JALA 3O9VA 1QIEA 4L0CA 2FJPA 1CUUA 2J3QA 1Y7HA 5ALDA 4YX9A 4JYPA 3STUA 3TRDA 2WQZA 1E8DA 5A7FA 4C4XA 4C88A 2GBCA 3DKRA 1P0MA 1QJ4A 1CUHA 5HF5A 1UK6A 4UBOA 1AX9A 5ALKA 5EIAA 2I03A 5ALGA 3ESBA 4DMFA 3EIOA 2X8BA 3ZLVA 5AO9A 4J0IA 1UWCA 1CUVA 2WJ6A 5YASA 2PKYX 4BVLA 4I4CA 3DNMA 4Q05A 2WHRA 2K2QB 4X90A 3ED1A 1XZJA 5FP0A 2WFLB 4LXIA 4K6HA 3C43A 4FFWA 5DJ5A 2XQFA 4ZGBA 4BVKA 4IQ4A 4DSZA 4Y2VA 1LPOA 5CH5A 2Y2VA 2XUDA 1DQZA 1SC9A 2UZ0A 1TQHA 1J1IA 2PUHA 1K4YA 4E46A 2JBWA 4H0CA 2DCMA 1LPNA 5LIPA 1L7QA 1HDEA 1THGA 2XMBA 5EI5A 5HCUA 3STVA 1UOOA 1JMYA 4L72A 1A8UA 3TGLA 3G0GA 2ACKA 2HADA 1MNQA 4Y2JA 3PICA 1MJ5A 3FAKA 5CT5A 3V1LA 1E66A 3ZLUA 1N5RA 1U65A 1X2BA 3EQ7A 1WM1A 3R3ZA 2X5XA 4EY6A 5JZBA 1QTIA 3NGMA 2V9ZA 1XRPA 3ESCA 1EB9A 4QA9A 1ZICA 4UBKA 3PI6A 3NUZA 2ECFA 4EBBA 5EIEA 3PDCA 4QDTA 4CG2A 1B41A 1BCRA 4NS4A 2WIGA 2OGZA 4WY5A 1XRMA 1H23A 2DHCA 2OG1A 3OURA 3GA7A 2CUTA 3HEAA 1VXOA 5LP1A 3D7RA 1A88A 1CIJA 2C0PA 3W06A 4YPVA 4E14A 3H0CA 3VISA 4FOLA 3HZOA 4W1PA 3WK6A 2QT9A 4J0HA 4MWTA 2VT6A 2HIHA 2RHWA 4J03A 3H1BA 1UXOA 5HK9A 3WJ2A 4LYDA 3SC2A 2VJCA 3FWHA 1E89A 4KACA 4KYVA 2WSLA 1L7AA 3BJMA 4UHCA 5T4FA 4MJ3A 5D7BA 1YA8A 2AJ8A 1YS2X 2G63A 3K6KA 1PFQA 2WU3A 3ZLTA 1LBSA 3AZQA 5DTIA 1XZIA 4X71A 5ALWA 1EVQA 5EIHA 3DQZA 4CCWA 4B0OA 3OTQA 1G66A 4DNOA 4BCBA 2Q0XA 5F4ZA 4HVTA 4XX1A 4HAIA 5HZGA 2YASA 1YAHA 3SK0A 4GWLA 4J0KA 1QLWA 4KJXA 2PL5A 3FLAA 5JD6A 1XZGA 3LS2A 2OCIA 3WKCA 4WFJA 1YR2A 2HA0A 5ALZA 3WL6A 2WIKA 3CXUA 1K5PA 1CRLA 4Z49A 4Y2XA 3E3AA 1DT5A 3ZWQA 1CUZA 4QNNA 2LIPA 5HQ3A 4DNQA 3JYHA 3AZPA 3F96A 4Q82A 5HKBA 4UHFA 3B12A 5K3AA 2JGJA 2XI4A 4OSEA 4CIAA 5JATA 3F98A 3I2KA 1VE6A 3JWEA 2OXEA 2WUGA 1EK2A 3WK7A 1LZLA 1QGED 1GT6A 3VDXA 3BDVA 2HA3A 2ZVDA 3AIOA 2H7YA 3HI4A 5ESRA 1LBTA 3A6ZA 2WIFA 3FSGD 1XZMA 2HU5A 3WMRA 3ZPXA 3WK8A 3E0XA 2PSJA 5LZ8A 1IZ7A 2RAUA 1J2EA 1HL7A 4YK7A 3C5VA 1XZDA 3M3DA 4BP9A 4BVJA 1GQRA 5HF8A 5D3KA 1QFSA 2WG0A 4B9AA
chains in the Genus database with same CATH superfamily
3G23A 3HJCA 4KOAA 2Z6UA 1TADA 4KI7A 3CH7A 4NG5A 3JALA 1NU6A 3SJZA 4M0UA 4NZNA 3U3KA 4C04A 3RKSA 1ZIXA 4WOJA 1D5CA 1O8CA 3ZOKA 4F2PA 5LA6F 4XQCA 2VL7A 3DVAA 3ME5A 3N59A 4E2FA 1QQTA 1R3DA 1YSCA 1XKTA 4IFIA 1QFXA 4TMVA 5KQPA 1BS2A 1KI7A 1VHJA 2O2XA 4Q47A 4E88A 1DV1A 2IU3A 2OK7A 4CKBB 4L51A 2LNDA 4M7PA 4B3IA 1L7DA 3OLXA 5KX5F 1RI2A 1RMTA 2B4KA 1Y6FA 3GGPA 4HR7A 5F33A 4NNOA 4C5AA 4BNNA 3PHHA 4EK9A 2J45A 2FU5C 4BNVA 5BXYA 2OXTA 1PJ8A 3GAZA 3MM4A 3DT8A 2I1WA 4H0NA 2AMLA 4MYDA 4P4NA 2Z3WA 2V0GA 4EHLA 1QTQA 2O5CA 2BHRA 2R6JA 2WLSA 4FZRA 4AWBA 3TGPA 2HSJA 3HFSA 3O4JA 1IOVA 2CJPA 5ECDA 3FGOA 1IY0A 1JV2B 1ZJ4A 5ARDA 2I3BA 3N2EA 4X1IB 1V43A 1ESZA 1ZM3A 5J4VA 3DOCA 3NTRA 1G41A 3BSYA 1JZTA 1TJNA 2WU4A 2XR1A 2YW2A 4BFVA 3N76A 3DO8A 4L16A 3NYQA 5KJEA 4DCOA 2WJAA 1NRXA 3QX8A 5FAKA 1DFHA 2CV0A 4LBWA 2ZS8A 4FCCA 5CYFA 1XCOA 2R8EA 4L9SA 4BNGA 3CR3C 4KZPA 4EA7A 2JLZA 2HD4A 1IQ0A 2AZDA 2C2XA 2DAPA 1RPZA 4UVEA 3HY4A 4U7TB 2FMFA 4AUEA 3JSXA 1EGQA 2D5CA 4AMBA 5IJZA 4DIBA 1JG6A 4NBLA 1ST2A 3QE3A 2AWNA 4FYKA 3VPXA 2NZUG 3EDQA 3O1JC 2EARA 4D9HA 4AQYB 3GLSA 1XZEA 1THZA 4QKQA 2X0IA 2PA0A 3EGIA 4KE7A 5TX7A 4UE2A 3PLNA 5LIRA 1KEPA 4U2GA 3QFHA 4H3HB 5JVDA 2XQJA 3MBIA 1AZLA 3Q6NA 4JQZA 3B36A 4BTVA 4YRIA 4KFUA 4P58A 5JSUA 3U0BA 2W58A 4TLMB 3V80A 3AUSA 1R6XA 3D6UA 2FUEA 2OHGA 2Z4TA 3QPUA 2WHPA 3EIUA 4M0LA 2GR9A 2EGUA 2ZYWX 4V3CA 2JCBA 3F7TA 4WN3A 4BMNA 4MZXA 4M55A 4N65A 2XCUA 3LT0A 2E49A 2A3NA 3IDZA 3DFMA 4ETWA 1L0BA 1S3GA 2B82A 2RHTA 2IY7A 2VZEA 3G85A 3N8DA 3DMHA 3ZTYA 2HU7A 4P3YA 4JWKA 4MCHA 1KF0A 4I99A 3H19A 1WU7A 1GQSA 1MC1A 3DVRX 4D4LA 4C0XA 4E4TA 1WEHA 1L7OA 3RSFA 3PEEA 2WJJA 1G7CA 1KOGA 4FJ1A 3VZPA 1NXOA 2JFYA 3T5MA 1FFSA 2GZ2A 4EDFA 3IEVA 2G70A 4R3NA 4Q7KA 4J6EA 2IU6A 1QK5A 2AJDA 3O8QB 3C1UA 3P2OA 1KYIA 1XQVA 3G49A 4II3A 1ZA1A 4QGHA 5D86A 5JJKA 1JFFA 3Q2IA 4G5GA 4G65A 5BWLA 5KWVA 2FUG6 3LAWA 5F64A 3NGXA 3VZRA 4KAXA 3B5EA 3FTQA 3BCUA 1C81A 3GUZA 3HYTA 4ZI7B 1Q0LA 1IN1A 3T5PA 5L8VA 3BC1A 3DC2A 1SVLA 3QF7A 5CNIA 1CZLA 3E22A 2HLDA 2IT1A 2Q5EA 1SGWA 3I3SR 4TQGA 3ZEAA 4LMPA 5L7TA 3CW8X 3KCNA 1VKJA 2FQYA 2ZRBA 3GLHE 3KQSA 3RVMA 1VIMA 1EVIA 2HN9A 3ND8A 2FF5A 4C7KA 2YQZA 2GHTA 3I62A 4F6CA 3AIKA 2DFLA 4IOMA 5BRNA 1ZM2A 2G25A 5DNYB 1MQAA 3F6SA 4AJKA 4ETMA 2RC5A 1MH9A 5C8XA 2X86A 3FNIA 2R6DA 5HCNA 1FMLA 5JI2E 1OKKD 2Q3HA 1V5IA 4PG8A 4EARA 4GP6A 2O8CA 3IEKA 2QE7A 2W2LD 5TPWB 3PKJA 3SXUA 3T1HB 3L1VA 2DUMA 4N0QA 1UM8A 5K51A 3FVVA 2PX3A 1RI1A 3N2IA 4UNNA 2A67A 2D2XA 4O59O 1QM5A 5DK4A 3ZU3A 2XMSA 4YT8A 3I32A 3I4FA 1R6AA 2WP0A 1BS9A 1WU8A 2PMDA 2XE7A 3BA1A 4JB0A 2JZOA 4BX3A 3GVPA 4ERXA 2QL6A 1RLOA 2QMUA 4IDQA 2HA5A 3IXMA 4OVKA 3VRHA 2NACA 2PKEA 3C8MA 4B45A 3VU1A 5LP6B 2SKEA 2XYHA 5IANA 5IBPA 1E7SA 4JBYA 2WM8A 4QDXA 1GG2A 1A95A 1IUPA 3ZZTA 3BE8A 2ZAGA 3CN9A 5D7NA 5I5EA 2RHCA 2ROQA 3PNVA 2ZK7A 4X8MA 3IUJA 5IAJA 5LD2C 4LK2A 4I9HA 4V0KA 4MR8A 1YBVA 2ZI3A 1JDBC 1MX9A 3BH7A 1JHDA 4Z2AA 1XC7A 4NCJA 1C4KA 3MWEB 3T9FA 4TLEA 1XQYA 4KMRA 1M2OB 1XEXA 2F1OA 2GHRA 4H0FA 3PXEA 2W2VA 2Z2KA 3IOYA 3HVHA 2VH2A 2FZLA 4LJSA 2R1ZA 2RI6A 2PS1A 3OZXA 1RKQA 3P97A 5H9VA 1GG9A 1LSSA 2QRUA 1A5SB 1OFUA 2PX4A 3P96A 3MTQA 4PRYA 2A6PA 4UTRA 5KU1A 4EPTA 1FX1A 1QYWA 2ZT7A 2P4QA 3KZKA 1IULA 1E3IA 3GFSA 3UJ8A 1ORDA 4FYPA 4ARBA 1Q1EA 1NFFA 4N8DA 4QUAA 2E48A 1SUWA 3D6JA 3HP4A 4ASUD 3ON5A 4KL8S 1L7BA 3N53A 3S8YA 3SZRA 1DBIA 2JIBA 4JC4A 3RYFA 1VCMA 5CDUA 5K8VA 1UPFA 3OIVA 1GPWB 2AJCA 4FMPA 5AKJA 3EXG2 5DYYA 2CK3A 1TZBA 3D5TA 3SOPA 1GQOA 3CLTD 5DCWA 1MC4A 4ITRC 4WZAA 4B0PA 4K6GA 3NATA 2A9OA 1ABBA 4X0EA 4E5UA 2FMTA 4DQDA 2WG0A 4WNYA 3K30A 1XDWA 3OQMA 3EYWA 4XLTA 2NZYA 2JLWA 3L1JA 4JFAA 3T3MB 4LC9A 4P9NA 3EA5A 3IMEA 3ZI0A 2NVUB 2XUJA 2SKCA 1CQXA 1P45A 5DMHA 3BIOA 3KHTA 4GPIB 3T0FA 4F5EA 3IT2A 3AI2A 2I62A 1FNMA 2HNKA 4LSMA 4RVOA 5T8KA 1E96A 2W98A 2X22A 3RYIA 4EFDA 5T6MA 4O2RA 2IDKA 5A05A 3RLIA 3ZXIA 1M5RA 4GI5A 1R8JA 4ZAXA 4R2XA 2HLDD 1DAKA 1U3FA 3MWYW 5C7LO 4HEJA 2C7GA 3TSCA 1QGYA 3QWAA 3OFVA 3ITKA 2M1XA 3LA6A 5F2NA 2H1IA 1DQRA 4FT4A 4RPKA 4JT8A 1QVWA 2VP0A 4CIXA 3NDPA 4P08A 5HILA 3JAWA 5CM2Z 4I2VA 1QQAA 4PR0A 3AESA 3IERA 3IQEA 2ZTLA 3QYFA 4UTZA 4ENUA 5BUSA 2EATA 2AFIE 2WUDA 2ZR8A 3PEWA 3EISA 2FGKA 4ZQIA 2OZLA 4P3PA 1JT2A 3KYCB 1N5LA 1A8PA 4RE6A 4MVWA 3RIMA 2QLTA 4DWJA 3CIOA 4YBZA 4QICA 2QRVB 4LWZA 3SN6A 1C2YA 1ZQ1A 4LY9A 4IYRA 3IVXA 5IM4A 2Q5OA 1TKRA 2UKDA 2REBA 1GARA 1O8BA 3HR8A 2VK4A 3QI7A 4ZRDA 5TT1A 1OBVA 3ZWVA 5LQDA 1Z35A 4Q4HA 1N6PA 1NDUA 4Y0VA 4CTKA 1UFVA 4PQRA 2Q2VA 1JKMA 4HDCA 3WISA 4YAGA 9ABPA 5JNLA 2Z56A 3ZYZA 8GPBA 1PWZA 4HEA1 4REMA 3TFQA 2ZXUA 2KE5A 2C1XA 2VQSA 3G8BA 3L40A 4ZK2A 1XWIA 3MGBA 3C1AA 4RQTA 4UHBA 4WXRA 3EUWA 2P35A 3ZH9B 3UYKA 2OMKA 3WGLA 4AS2A 4UFNA 3NFRA 4GH5A 1UODA 2QQFA 2B4AA 4TTAA 4HH4A 3P0RA 1MG5A 5TJ9A 5IMSA 3ELYA 1A9TA 1ICIA 5DHPA 5IVIA 4PGMA 2E4UA 4HWSA 2HMUA 5JQWA 4PGAA 4HZIA 1RYMA 3D0KA 2Q45A 3HJBA 2D7DA 4K9MA 3NTXA 3S99A 5BPHA 1EFCA 1SBQA 2P5UA 1PSDA 1E2PA 4JC5A 2C8LA 4EMTA 1UOEA 4DQLA 5EQDA 1FJ2A 4CIVA 4B83A 1KI9A 2O06A 3WA7A 1FXUA 4KR2A 3MWFA 1JFFB 2CEAA 1VXRA 2DHDA 2LDXA 3WLLA 5K8UA 2NNWB 1JQBA 4H7EA 4NENB 3UMGA 1PZGA 5JXGA 1KH3A 1IK6A 2GETA 1MDBA 4OKNA 4EUSA 3K9CA 1TQ4A 2PKRA 1JEQA 3Q0EA 5I01A 4RJIA 3ZJUA 1GPAA 2NO6A 5TS2A 3ROXA 3UVEA 4RZ3A 3MRVA 4AVYA 4BVEA 2DF8A 3R7DA 5ICCA 3NWPA 1K7CA 4P7BA 4TXJA 2WIDA 1CP3A 3LECA 2QENA 3RV4A 4I55A 4CGZA 4GX5A 4C4RA 4CWAA 1KDPA 1X92A 4JEUA 3HRIA 3DO6A 5BWOA 1P2TA 1YQGA 1HBJA 1Y5LA 4R9VA 3RS5A 4X97A 3IKVA 1V48A 2ZE8A 2FSUA 3WDMA 1J9GA 2PX2A 2JD1A 3JD3A 1H2EA 3FUUA 4BBZA 1NM5C 4QUEA 2IUTA 1TF2A 1WHSB 1C3VA 2IZ7A 3JV7A 1PG2A 5HFAA 5FTMA 1LI5A 1TCVA 3FHCB 1GRVA 1IM8A 4WCFC 5J2UB 3PK0A 5IAAA 3OA2A 3MT7A 4GX2A 1W6UA 3IP1A 3TB6A 2DCUA 1C9NA 2G06A 3WQBA 1L4BA 4XM1A 3FLBA 4I1RA 3H9GA 2RIRA 4IV5A 2QRQA 4WGGA 3A9WA 3V55A 1GQQA 1S1CA 4YHHB 3B1FA 5FYQA 2OGTA 2JKYA 1HV8A 2OQIA 3CZ5A 3KZXA 1CY7A 2XTNA 4FBLA 1YZHA 2HJ9A 4IGKA 3MJCA 1JHXA 1W88A 4KN8A 2OY0A 3QI2A 5AM5A 4J29A 1G5FA 5CX1B 3CO5A 2FJUA 4OGKA 2GEFA 1S2GA 1I6WA 1VIDA 1AIPA 3L7LA 3IVMA 1Z5OA 2XIQA 2R6FA 2PGNA 1KRHA 3RJ5A 1NUPA 3G0BA 4HNGA 1W52X 4R9NA 3SD7A 1NPDA 1ZD5A 2AJTA 1B6RA 4KGXA 1GGVA 2HSEA 4MRVA 1VL0A 5CVJA 1UINA 3UJ9A 2R5NA 3R4CA 5ERYA 2NTJA 3SM9A 5J1TB 3VHLB 3HP1A 1SQGA 3T3OA 1GPYA 4FKZA 3BGIA 5CNJA 5ALQA 2SBTA 2NXNA 1D0IA 1E3LA 4KEAA 4YY3B 1R0XA 2F9LA 2KBEA 4C0AC 4TSRA 5KJ6A 3EWSA 5T3UA 3KXIA 4K9LA 1WY5A 2WMNB 5BSVA 4URYR 5DU2A 4URXR 4L9AA 1G1MA 3DTTA 2JS7A 1PS9A 2EAUA 2P67A 4KH0A 1SVIA 1P4AA 2YNMA 1JHOA 3HDHA 1NNEA 2FH5B 3OKFA 2EYQA 3A8TA 4IIJF 4MS3B 3HCWA 2ID8A 3DOEA 3HSKA 5EXSA 5JY1A 3CURA 4DC0A 2CSXA 4O5AA 4A7PA 2IOHA 1WMBA 3CLUD 2BGIA 4YAFA 2VJYA 5JSZA 5KC8A 1FVFA 2O7VA 2C7PA 4QNRA 3WGIA 2YHUA 4I19A 1WA5A 4Q0MA 3IKTA 3R9XB 5LQMA 3PUKA 5HA5A 1FBNA 1NM5A 1LK7A 3LF1A 4BIIA 5CB4A 2QLNA 3OY2A 5JBQA 2WAOA 1DOAA 5TF4A 2O2SA 1D6MA 4B2IA 3TIFA 2O4UX 4QVKA 2NVUA 2J0UB 4M8LA 2BKUA 4GPTA 5HYVA 4TLLB 1XLUA 1HLFA 4AY6A 1V11B 2GYUA 1P1FA 2ZB2A 2PUAA 5DXAA 2HHHB 2GJ9A 2VHQA 1EVYA 3WADA 1HKUA 2B1RA 1QFZA 2LRHA 1IUNA 2O7QA 3FBTA 1TCBA 4ZT6A 5FPYA 4UOEA 2BKXA 2QUKA 2WB4A 4NAUA 1GZVA 2LE0A 2W2TA 3NHAA 3VVBA 3BMNB 1GKYA 3PEFA 2RI0A 3K09A 5E6RB 5K3SA 4BAZA 1A2KC 4FEYA 2C2OA 4QOIA 4F45A 4ZEMA 4TXLA 3FW1A 3C7DB 3GHYA 4ERNA 2NQ2C 2PMWB 4H77A 4B47A 3SC6A 2ECPA 1BXKA 4B3SB 1CLEA 1IB6A 1X42A 1T5OA 3HADA 3NB0A 3MHTA 2IDMA 1MRZA 3AESB 1XD9A 2AZTA 3B78A 4RCZA 1U28A 3EGXB 5CH8A 1UP7A 2OYRA 1P5RA 3WVNA 5LD2B 1GRRA 1KOJA 2WUWE 4MRPA 4DCTA 2IODA 5BSKA 4GMKA 1G19A 1D4ZA 4IO0A 1W9MA 3V6LA 1QTNA 4MV7A 3WS7A 3UG7A 1YDHA 2OC4A 3EXEB 4IOJA 1TF5A 3UT5A 1I1QB 5KYKA 3IR6A 2UXDB 1ZAKA 2G9RA 2E4VA 4QTTB 3BQ9A 1RD4A 1WZ2A 4LPKA 1X7HA 5IT0A 3CX4A 5KEIA 3FWPA 1RZ3A 1BD3A 2Q3DA 3R0ZA 4FE3A 4FNGA 5JZVA 2FJ0A 2XUQA 1NIJA 3OJWA 4LJ7A 4MWOA 3TQIA 2PKQP 3T06B 3PT9A 4CIDA 3MTGA 4N5IX 2QSZA 2ZQZA 4LYYA 3I34X 4TZTA 5D1HA 3UF0A 1G59A 1EAYA 3V3TA 1GNPA 3CE9A 3SHVA 3GJ7A 5A3SA 2YXBA 5KO2A 3LV8A 3OLQA 1NA5A 2HA7A 4G5QA 1Y1RA 2EDAA 3N8KA 3BMOB 2M6RA 2ZVQX 2WYVA 1KP3A 3EMKA 3ZBQA 4RDCA 4AECA 5A0VA 2JI7A 2OR3A 2Q6KA 4MB6A 5TSDA 5JFTA 4R7GA 3VSCA 5LQCA 2AN3A 1ECBA 3IGFA 4I9UA 1MN6A 2D8MA 3PFKA 5KTPA 1TAGA 4N01A 4Y6QA 3UA3A 4MUFA 5EZYF 1G20B 4NJOA 3SR0A 2IYSA 1RVV1 3KU4A 3FXAA 2PAFA 4TKVA 1B6SA 2X8WA 3TI9A 2YHIB 3EXHB 3B51X 3BXZA 2OORC 3ZDRA 4BMZA 4X64B 4ER0A 1HURA 4WZBA 1I9CA 1NLUA 5K8CA 4GGPA 3OKAA 3QWBA 4IGEA 4UM7A 4WPGA 4YACA 5EKUA 3B1XA 2I7XA 2OWEA 4I9NA 4PZAA 4B4OA 2M6KA 1GPUA 2VOJA 1Q0HA 3OJEA 4NYJR 3AF4A 2AZMA 4O2AB 3FDZB 2IQIA 2VYVD 2XNSA 4HO1X 4PS0A 1L5RA 1T4DA 3OUTA 4XUDA 1DKRA 4GAEA 1CQZA 4PZPA 1P31A 4YRZA 2VWQA 4CZ2A 1NJFA 1BRTA 4U7JA 1X7ZA 1CEQA 4HNAA 3TEMA 1Y7TA 1HI9A 5DLQC 2WUFA 3W5HA 2PMCA 4N8EA 1VCIA 1QFMA 1ZQ9A 1JPVA 1RSZA 4PHTA 2ZWAA 1QMPA 4A8JC 3FLEA 4L0DA 2EBHX 3ZE8A 3N86A 4FCWA 4IR7A 4WERA 3EIWA 1KKUA 1AK2A 3KSMA 5IEJA 2DR2A 4O25A 4YASA 3AG5A 3ZVKA 3L0OA 4C0HA 3J81A 4RPIA 1Z8FA 1L5HA 1JHVA 4FQ5A 1V35A 2QI9C 2VYVA 4NMLA 5JD3A 4CIBA 3NC4A 4JJ6A 5KNCH 3HGTA 4PG5A 3O8CA 1IRIA 3PUIA 4TTSA 1XRNA 1M54A 2PFSA 2RAFA 1BIFA 5DHQA 3D3NA 1MC5A 5D3MB 2G71A 2LGJA 2VK2A 2GKOA 2V6GA 2WYIA 3IX7A 2AHRA 1ULHA 2YDYA 4LZNA 3ROMA 5IYZF 2I3GA 4WMLA 1QX4A 5LZ4A 1H8EA 4KW7A 4H7HA 4FZJA 4EHBA 2Z5GA 3G02A 2QMYA 1MXFA 1RXSA 3W34A 2YC2C 1ST3A 2EJBA 4CKWA 1VHQA 1Z68A 2QK4A 1YUBA 3F8TA 1JDUA 3L43A 5EVCA 5KHAA 4A0GA 4G0VA 2HMVA 1NKTA 3A1SA 1TCAA 2R7LA 3EEYA 3HC7A 2LV8A 1TK2A 4N7JA 1PN3A 1SFRA 1I33A 1QWSA 4NQZA 3F3KA 5CGQB 1U2DA 1XA4A 3G79A 1PFUA 4G9EA 4CQMA 2GWRA 3T7AA 4ONEA 3BJIC 1M6HA 3INRA 3LWBA 4K2AA 3TNFA 4HB2A 2V9PA 3IDQA 5B7NA 1WMEA 4UTVA 4DHWA 2GA8A 2LDBA 1IN8A 2ZBEA 1DQYA 3MILA 3QENA 3EX7C 3R0QA 4L07A 4PZUA 3KTDA 2IEGA 2WLTA 3FB1A 3NNNA 1G2PA 2BM9A 2PAAA 3BHIA 3PGJA 2CMKA 4LF4B 3B82A 3EBPA 4WX2B 4YRDA 4YMSA 3RK0A 1Q11A 1U5CA 1AT1A 2AOWA 4B9EA 3PWTA 4NYIQ 1KZHA 1I2ZA 4RSMA 3BTVA 3I53A 5KYGA 3LUFA 3BGDA 2Y68A 1XD2A 1HLPA 4YUVA 5CDSA 1MAWA 4BDSA 3PPXA 1RRVA 2O3UA 3PD1A 2XKBA 1SKAA 4M9QA 2CNLA 3PHLA 5EG5A 3O9ZA 5L3QB 4DV0B 2ALJA 4GGOA 4OP2A 3OHPA 3DL2A 4OBBA 2QROA 5DBOA 1QXSA 2O2GA 1CDDA 4C6SA 4E11A 2QUHA 3CMCO 3P27A 1W29A 5BV0A 4XWAA 1NJ6A 4D0SA 4DILA 3AEUB 2AD5A 4RH0A 3HA5A 3VUFA 2ZBFA 4B7ZA 3GRAA 3CLRD 4RXMA 1GDDA 1OMOA 3HWX1 3FKJA 3WJAA 3N07A 2O2JA 3U9LA 4O8CA 3EIHA 1SIWA 5FR1A 2DY0A 4AQDA 5KKNB 1G60A 3JR7A 1H69A 2A5JA 4K8OA 3WAJA 1M66A 2A0UA 4OKSA 3MINB 2ZB4A 3D6MA 2JB9A 1AQIA 3GGCA 2YJTD 3R0JA 3C14C 1QGDA 2NXWA 3E1SA 3IQXA 1TMGE 2AK3A 3ESRA 4DCMA 2AE2A 5FLYA 1K8YB 3GLRA 2C3OA 5FNVA 5DN6A 3VVMA 1E3WB 1Z2EA 1N75A 1HSOA 1JMVA 1RWMA 3JQGA 3MW8A 4H15A 2C4TA 4QOFA 3N7UA 4F0JA 5BYAA 2Q6VA 2D3WA 1KDOA 3IQDB 2WOOA 3UTCA 2X7XA 4CG3A 2MINB 3AI1A 4GC5A 4HAWA 5CCXA 2WA1A 4RVHA 1IHUA 1U9IC 1KJNA 3O8OA 5DHRA 5KINB 2VHCA 4F21A 3GWGA 1CX9B 2EU8A 2N3ZA 3FFWA 1XCBA 3RAGA 2NYUA 3IVCA 4AJHA 3QXHA 1T3GA 3S1AA 2PU5A 3I2HA 1EK1A 4M1SA 1AS2A 1WW8A 4E5DA 1DQNA 1RLTA 4MAAA 4OLJA 4LBYA 2G9NA 3W1EA 3GIWA 2A9FA 5H9WA 1A50B 1G291 5T5QA 2C5GA 1Y6ZA 4HB3A 4XLLA 3IUSA 1NQXA 1PK8A 4X45A 2J0QA 3EFBA 3LDAA 2GCOA 3NONA 1TQ6A 4POAA 1OAOC 4DA7A 4ZN6A 3UT6A 4O2BB 2IIVA 3LL7A 1RQNA 3RH0A 2AFHB 1UBCA 4D3XA 1E3MA 1BXGA 4JNKA 1WTCA 4XYBA 2ZJ4A 1YMQA 3CX7A 2HTFA 1PWHA 1NI4B 3WQSB 3AVTA 1YZYA 5FUQA 1V5EA 1P62B 3FZQA 2PLRA 4YVFA 3OFNA 4ZJYA 4FLEA 4OB8A 4DQUA 1VSBA 2HCRA 2Q5JA 2IHVA 1L8QA 5ILOA 4N03A 4XEUA 2D62A 1BFDA 3HUUA 5KUTA 4A92A 1GL6A 2BELA 3M3HA 2JGMA 4RHFA 3PDUA 3HBLA 5HMLA 3RVJA 2ZU6A 4F7WA 1VPWA 3N3AC 2FEOA 3I8OA 3FPJA 2ORWA 1IONA 4UHJA 4D3DA 4EMBA 1FP1D 1QBKC 3K8QA 3QXGA 1NMQA 3C8ZA 1JBKA 3CRW1 3QU2A 3I6YA 5KYYB 4GX1A 5ALMA 2KSQA 3V8BA 4DIFA 4YT4A 2I55A 1TZJA 4ALIA 3HO1A 1C9EA 3GCDA 3QLUC 3C3YA 1K66A 1P5JA 2X2EA 4R2WA 2C77A 5BQOA 3IBCA 2QM0A 1RWKA 2WEKA 1PFGA 2RBKA 3IHLA 5FBLB 5EEHA 5LBUA 2FN4A 5KVVA 3ZJYA 2R11A 5EEGA 1G21A 1L5LA 4S1NA 4CYMA 5A4KA 1C1YA 2L2QA 1KI8A 1X39A 4QDUA 1ZCAA 4XJTA 1T9GR 3KQYA 4N0DA 1F51E 1V71A 4Y7DA 4ZHQA 2HK8A 2EX1A 4V02A 3S1AB 4J7XA 2EOAA 1JQEA 1A4UA 1PNVA 2WZCA 4IQ8A 5L3ZA 1CHDA 3TXYA 3KV3O 5CEEA 3JQEA 1CZKA 1UM9A 1Z5GA 2W8BB 2ZKIA 3BB4A 4YMTA 1YC5A 1E5LA 3HWSA 2WWVD 3DUFA 4HDQB 3A4LA 4N40A 3PPIA 4QYTA 2QD1A 3E0QA 4H7IA 5KNBH 4JXZA 4F4UA 3ILHA 1UMCA 3WNZA 2PIDA 3TVYA 5D3ZA 5AW8A 3CLKA 4AN4A 2INGX 2EJUA 2FEPA 1DO2A 1KAHA 2J9YB 2X0NA 3IAS6 1EGMB 3K94A 4UULA 2PPVA 2QRGA 1NQ5A 1WMAA 2W6NA 3HA7A 3OT5A 4TXHA 4UJ3A 3K0HA 2PJDA 5JAZA 3X1MA 4ZMRA 4YJ3B 4NH4A 2ZRJA 3BDIA 1ZGZA 4WTOA 2GASA 1T26A 1C0EA 2QP4A 3OHMA 4ML3A 3RWBA 2GDZA 5JLAA 4Q7QA 3A1UA 3V00A 2AMFA 1AZWA 3PP8A 4HWKA 2F7SA 2JLCA 4OTZA 3MTBA 1V6SA 4G0PA 2F4NA 1YIDA 3IQWA 1P80A 4JEIA 4ZCMA 2CYBA 4BZZA 3CT4A 2DGDA 5JAHA 2G82A 4RWZA 5KSYA 4H31A 3K1AB 3LQ4A 2RGXA 1ZK4A 5DTJA 3AF5A 3AEUA 2WVJA 4LMBA 4Q3DA 4GLOA 4EW6A 1HORA 1NG9A 3WLQA 1GKIA 2CBXA 1TQDA 1DUVG 4TYNA 4HK4A 4I08A 2OBLA 4P7KA 2VQDA 1LF5A 1J00A 1YR1A 1HYEA 4TZKA 4RTLA 3U7GA 1ML4A 3BJEA 2V7QA 1XHEA 2W6JA 3F5QA 3TFOA 4DV5B 2ZKLA 3ZI4A 2D00A 4ALKA 3EQZA 1EX1A 3P7MA 3QXXA 5EXTA 2FSPA 2IUSA 1R10A 3LY8A 1NXVA 3D0RA 1N3BA 3W2IA 1JA1A 5LLTA 3UJ6A 2JVJA 2VHTA 3E3LA 3O3OB 3FTNA 3QXCA 4L0MA 1PLJA 1VLLA 3WGOA 1K92A 2GN9A 2AQKA 4CQLA 2VWGA 4LY3A 3IEMA 3ZW8A 1HDIA 1K3TA 2PDAA 4ENWA 3LLVA 3F9CA 1DIBA 1E2DA 3OIWA 4EJSB 1LC0A 4J1TA 4W5TA 3K1YA 4KQ1A 3TW8A 2WG2A 1KIAA 3THXA 2XZDA 1MU0A 3DBIA 3JZAA 2QRNA 3KJGA 4OMCA 1LRKA 1M2KA 1RJ9B 2WJ4A 3BXFA 3AL3A 3ZNNA 1HF3A 4QBFA 5DHFA 4HN9A 3IT0A 3CNOA 1SG9A 1UK7A 3WYBA 1UKVY 1IZZA 2C20A 2AF3C 3KKZA 3GVIA 2DBQA 4J2TA 3PQ8A 3SC2B 2OGWA 2ZYUX 3EF0A 3U6KA 3R5JA 2ON6A 4UUMA 4Z9XA 4XUEA 2EBWA 1IQUA 1JJVA 4BQNA 2DFVA 2NQTA 1I80A 5HIJA 1DAIA 1I4TD 2J3DA 1VG0B 2IPAB 3LHDA 2HPHA 4D0GA 4NFHA 1KO7A 4RUKA 1HDYA 2VT7A 4IF6A 4INJA 3OQOA 4FZ3A 1AUOA 3TUJC 3KYDA 2BGGA 5CCDA 3H2KA 4GLLA 3IMFA 5AK4A 3A3OA 2YN4A 2Q50A 1ZVMA 1PNTA 2XA2A 5DM60 4JLAA 3WZLA 4ZGWA 3JQAA 3B70A 2AD1A 2W6ZA 4HPWA 4LAFA 1N2XA 4GG1A 2OB1A 3LUDA 4WZAE 3VBCA 1Q1ZA 1R64A 1S89A 1ZUNB 1JG2A 4PLVA 4B43A 2GDJA 4MWSA 5HGXA 1NAHA 3VDQA 1O6CA 2DBVO 1FW6A 3M49A 3DEAA 2TMKA 1E4VA 3RG2A 5LQRA 3ZR4B 1JYFA 1VBKA 2F1HA 2NT3A 3HA3A 1X8JA 1ORHA 1OIVA 1RKXA 1XJCA 2QX9A 3BK1A 5DLEA 1QRTA 1E2GA 3G8DA 3HSYA 2HK9A 3MWDA 1V95A 1JH8A 1NATA 2R6AA 4KH1A 4RZIA 2DWOA 4CKBA 4CW7A 4F5WA 2FPMA 5CYOA 1BKYA 5AIBA 1QOPB 3IJPA 4WOPA 2QM3A 2A8YA 4LPSA 3SJUA 4B74A 5F7OA 3DVAB 1Z22A 5KOJA 4M8KA 3JQ8B 4MNTA 2V6IA 3N2KB 2VP3A 4WI1A 1GYPA 3DLCA 4I50B 2FRVA 2QTGA 2IYUA 3F5FA 4D6PA 1AKMA 1H42A 1WDLA 3KT8A 4UBIA 5HQTA 3I1FA 2PHZA 5J5CA 3CPSA 2GK6A 2JGFA 5LZ9A 3JYLA 4ZCQA 3CEHA 4IEEA 2PGIA 4G9GA 4MAMA 2GS9A 2H5IA 3N58A 4RORA 4QYIB 4PZCA 1D0SA 3SFVA 1MGPA 5FNVF 5IC6A 2HT1A 2OHFA 2PTGA 2I3DA 3W5UA 4CTNA 3QNUA 1PEKE 1X7WB 2X5OA 4HQRA 1HT2E 4WZBE 4CF3A 4JLSA 5LQNA 2OO3A 3F9RA 2CMDA 1TM3E 3KAKA 1AK9A 2Y77A 4G6ZA 1XYYA 5J9FA 4JFRA 2ZTSA 4PLYA 1M3SA 3JD1A 2EKBA 4JEHA 2GZHA 3TTTA 2YV1A 3BGVA 4R01A 4XW2A 4URHA 4QFDA 4MKFA 4YNBA 5E4JA 2I91A 2C5FA 2YR0A 3DYIA 5EUBA 4AZ0B 1PCXA 1Q0UA 2MYTA 2ZE6A 4RZXA 4P4UA 4WDQA 3TCNA 5B7PA 3KQMA 5DZSA 5LYJA 1EVEA 2QM8A 1FSPA 1RKUA 2NZJA 2BM0A 3COYA 3SX2A 5IU6A 1RXEA 1KJIA 5KJCA 4ZIRB 1TUIA 3C85A 1PBTA 1WQ1R 2Q07A 1S01A 4L4SA 1J07A 4MW2A 4Q3BA 4Q3KA 3KQUA 1JH9A 3Q2OA 4Q37A 3UY4A 3QUQA 5AW0A 3B1WA 3GJ6A 2ZTUA 5HGJA 1DG9A 2OPBA 3I2YX 2NT4A 1SEPA 1CVRA 3UJAA 3BBLA 4D4HA 2CKDA 1EVKA 2QD5A 4RGVA 5ITSA 1XMOB 4EG7A 1DTWA 1L4EA 2C9DA 2FCRA 2JC3A 1ETHA 4JJ8A 5EA2A 2IYRA 4NCHA 4EB0A 3RHSA 1N7JA 3ASVA 4PNHA 4ZQHA 3CTMA 1AC5A 1UBEA 1W76A 5EZ5A 5I7VA 1WV1A 2HRDA 3E03A 4LWOA 3ZD8A 4BYGA 4M0PA 4TL8A 2CLOB 4C06A 3P9IA 5F9HA 4MMZB 1N5OX 5BN4A 1QV9A 3HP7A 2LVBA 3H13A 4IDEA 2JL1A 3ZK7A 4CPDA 1VL5A 1NBMD 3RYCB 1OI4A 2HQRA 1C80A 3AHIA 2ZLBA 5E8JA 1KJWA 1ZLXA 1WNTA 2WABA 2J3MA 2WINI 1NHGA 3ABIA 3K09C 3LX4A 1RAEA 4XUGB 1G2QA 4FMBB 4JB8A 1R7RA 3OAAD 3WMWA 4C4SA 2DU8A 3FMOB 2VUTA 3OF2A 4Q9NA 1PD0A 3PFBA 5E3JA 1EFRA 3Q8MA 1J49A 2J5RA 4UFPA 4DNFA 2JFVA 2WZBA 5E1BA 2XLBA 3JAKB 4BNTA 4G1CA 1ORTA 3BRCA 3GA0A 2AQIA 3DXXA 1YGPA 1TA4A 4OI4A 5AW5A 3G0HA 1SUAA 4QFMA 4HKTA 1ZN9A 4F1WA 1WCV1 1KYTA 1F20A 1RAAA 3O91A 1R15A 4LHEA 2R5WA 3RC3A 3WWEA 1Y4SA 4FXPA 2HO4A 3FNEA 3OEHA 4ILEA 2DUNA 4Y0NA 1CU1A 2WWHA 2WJYA 4H60A 2CNBA 3KKPA 1PU2A 1XIVA 2NO4A 4R31A 1UBGA 3A6EA 3G82C 5I45A 4KIGA 4KV9A 3GGGA 3C8UA 2IZZA 3QVGB 5AOCA 1T9CA 3ESDA 3PB3A 2NO7A 3H8WA 2PL9A 1LQ2A 1T3ZA 1U80A 1UJNA 3DUWA 2OOSA 3AY0A 1JQAA 4LDRA 4MYUA 4R84A 5K6AA 4DDUA 3LYHA 5J5AA 5GJBA 4BTLA 2XWSA 1REQB 4ZO7A 2VP5A 5DCUA 3TNLA 5LL6P 5KNCD 1Z8HA 2P0AA 3EVGA 4ETNA 3OM8A 3FYUB 2HRZA 2EG5A 2PMEA 1OBCA 5KYWA 2X19A 2R7NA 4B09A 1LBQA 4TYMA 4Y2GA 2EQAA 4P4SB 2CY0A 2ZRCA 2FP4B 3H2SA 1FP4B 2G0AA 2V59A 1T4CB 3O47A 3QKRA 4M0EA 3SQWA 3GROA 3R3HA 1NVFA 1SCKA 3A4MA 2XZTA 4U0KA 1OWPA 2YMLA 5DW3A 3PD0A 1QHHB 1ILEA 4GPZA 3M4XA 5A0FA 1ZD1A 1GTG1 1RYYA 2GN8A 2NV2B 3DG9A 3E8XA 2QN6A 3OCWA 2BTEA 4HNAB 5KDOA 3OTIA 1GV0A 4FE4A 4MS1A 5H70A 4W5QA 1U28C 1J90A 1C5KA 2FWIA 4O4IB 1TIKA 4O4HB 3H05A 3HZZA 3I6ZA 4EUEA 3PTLA 3HXQA 4RYDA 4JOBA 4L28A 3DBOB 3MEQA 3BXOA 3DCJA 4H18A 1ZIYA 2V6JA 1QGOA 1ECCA 3FSEA 4NFLA 3ZVLA 5K0EA 2FDXA 4WKOA 3PPYA 5AVKA 1PNRA 4L1KA 3EGEA 1DGQA 3S2ZA 3LT4A 4GL4A 2EBUA 3E27A 5JH7B 1PVDA 1B8NA 4M22A 2G76A 4YJ3F 4LDNA 3Q0IA 4G1FA 5BSMA 3TD6A 4BNDA 4NF2A 3IB3A 3R5TA 4J7UA 4URVR 4EKGA 2XYRA 1RJFA 2ZRHA 4J9UE 4X20A 3ZWOA 2AUMA 3SEQA 3T9BA 5BUQA 4Q12A 2O0MA 4DV4B 1PEDA 1GKLA 3DR5A 4JZYA 1SBZA 4L22A 4OG2A 4TMZA 5AQEA 3U1VA 3UWOA 4Z4EA 4CHTA 1XEWY 2H52A 4BNUA 3RSHA 5BVGB 3GCWA 5SZKB 2PT9A 4H1HA 1JYSA 5ECGC 3NYWA 1V1RB 2ZSUA 3FFBA 1ESCA 3TDKA 3T0IA 4UVHA 1NUHA 3UMSA 1XTRA 3B7GA 1VBNA 4LK3A 4C0SA 4XGQA 3CMMA 4HZUA 4F6RA 3R8FA 4GPBA 1NVVR 3E53A 3ENNA 4FSHA 4QQRA 2Z9CA 5KB3A 3N2KA 4R2KA 1DINA 2YIJA 3UJ3X 2YVLA 4KFTA 2AKEA 4C7OA 4GPEA 5I9IA 4B44A 1L2TA 3OLVA 3TKAA 4EJMA 4DUZB 1I6KA 4X8HA 5B58T 4MR7B 3K4QA 3KJZA 4JL5A 4LHZA 4WBNF 1BYUA 1MV8A 2RC6A 5DM0A 5TPWA 1AK1A 4LZLA 1GU0A 4IILA 4V24A 2GM9A 1X14A 1E60A 3UMCA 5TGZA 3A31A 2I66A 4DSTA 3EIQA 6CHYA 1Y5IA 4ALJA 4W9NC 4D4IA 2EGHA 1I2AA 3A05A 5EE9A 3F1LA 1THTA 1IWBB 2OHXA 1Y6GA 2RGYA 1YMVA 3ZOZA 2ZZKA 1C9YA 1YRAA 3H3JA 1GR1A 3WV4A 4M86A 2EIHA 3MTIA 4GOXA 4UUBA 1YS6A 1VPLA 1Z15A 4LY0A 4QSHA 2B36A 1NYLA 1Y8RA 4OIFA 3DS8A 2I8CA 4Q00A 4OI1A 1LUAA 4BO3A 6LDHA 5G0WA 2OB2A 4R1NA 3C3JA 2DG2A 3UWDA 3EVDA 1S3FA 1GZ7A 1VL2A 1JAZA 2XMCA 1FTYA 3HMQA 5H82A 3EMDA 3INYA 2KJQA 3AUFA 4MYTA 2BVNA 3K6SB 3JX9A 3AWDA 1NE2A 1UJBA 3IL2A 1BGXT 3LVFO 4DCCA 4XOUA 3QH4A 1PJTA 2RHHA 3U16A 3MCAA 4JOSA 4YUZA 4F72A 1OIWA 1WPXA 3ICVA 4E15A 2I2AA 2L0XA 3UUEA 4EZBA 2HMYB 4O4LB 2AUNA 4DMKA 4TMTA 1Z7EA 3SX4A 3RADC 5HZHA 3K1ZA 2RH4A 3UKJA 3O4HA 5KVQA 5G0UA 1I7SB 5AHRA 3ADPA 3T7TA 3LFTA 3RS9A 4EX6A 1FIUA 2O19A 5F35A 2ONYA 1TFUA 1ZHOA 1J8YF 3G0IA 2YQ4A 1S8OA 4LS3A 3A04A 4MARA 4QGBA 3BICA 1GGKA 4XPZA 3CRVA 1UF9A 4UATA 4ZV7A 3T6KA 1X19A 1Y6QA 5AH0A 5F76A 1QO9A 2RHJA 2X13A 4JJEA 2O8DA 1P91A 2DY1A 4TOIA 1DBPA 1IY9A 2OO5A 3VPCA 2I87A 3ZH2A 3L0YA 4CIYA 2PWAA 1J0XO 1WSAA 2HU8A 3BD7A 2HCJB 1UKAA 3SKYA 4CMJA 4LWQA 4BGDA 3NJRA 3KQKA 5E38A 3HCOA 4FFLA 3HWRA 2O23A 2HBZA 3JQFA 3HGQA 1FEZA 1A7JA 3T4PA 3ZK8A 1OGIA 4CKYA 5IUJC 2IHUA 2GJ4A 1N6RA 2H7XA 2MMCA 2X5KO 3KQTA 1GUZA 2PS9A 5EPEA 2NZVG 4G4JA 3OM9A 3ZCRA 4DIUA 3K8ZA 2X42A 1Q14A 4OBXA 2JH8A 1PR1A 1OZAA 3MT0A 3AUYA 2Z95A 3LPDA 4R81A 3RO7A 1P4JA 3MD9A 3EARA 3V34A 1KMCA 5EWLB 5B6IA 1GLVA 1P7VA 4D3ZA 1E6CA 1JDVA 3F3YA 3FOAA 4PLZA 4BGIA 2R48A 4Y9UA 4DV6B 1H6BA 1SU6A 4M21A 4CLHA 2SHKA 3KFXA 4B1FA 1BHO1 5K05A 1KYYA 2VDKB 3NPMA 4TL9A 4B32A 4F3YA 3BD9A 4BCCA 3H9QA 3UJPA 1LBHA 3LT1A 2G5PA 5KVSA 4X44A 2B1QA 1D2NA 4OHWA 1I8TA 4C20A 3IAUA 1D04A 4ZANA 3N0XA 2IXAA 4TXNA 4TV9F 3UAWA 4KXVA 4E31A 4M8SA 1PUJA 5LDHA 2W42A 1RC8A 1MO3A 3FYUA 1QZ3A 1VRCA 2Q4TA 4V3BA 5JDIA 2VAVA 1KK0A 4TMKA 4BQSA 1KGSA 4OHUA 3WYDA 4QXOA 1E2LA 4B3XA 2XOXA 4JSTA 1KZYC 1B74A 3H11A 3PGLA 2FE4A 4OQYA 1K6IA 1Q1BA 2QN1A 5NULA 3W2GA 2RGWA 1HLDA 2P8JA 4KDRA 3W7BA 4D6YA 3H83A 5FADA 1S2OA 4C22A 3B6KA 2FR8C 2WF7A 1HDOA 5KQSA 2Q1TA 3ZHTA 2D59A 1VSUA 3VKWA 4DV1B 2B2XA 1WB4A 3D6AA 1N4DA 1JEOA 1YA4A 3IUBA 3RJZA 2YWBA 2PRYA 1PTKA 3Q8WA 4C3VA 4F11A 1U2GC 2XXAA 4K28A 4W9RA 4FW8A 4DTIA 2GN6A 4E30A 4OHCA 1RQGA 5HJ7A 1P0IA 3SCZA 1U3VA 3NDIA 4YYEA 2XB4A 1MO5A 1KPHA 1WZEA 4QU8A 4BEVA 4CKCB 4YB8A 4A0FA 2CNNA 1MW9X 4LRWA 4Y1RA 5CDGA 1RPAA 1AF4A 2WFZA 2CXSA 4HWTA 2OP1A 1UBOS 5TGDA 1GTZA 2DOKA 5BWMA 3KETA 3THXB 5H80A 3RREA 5TXGA 4WZZA 3TBKA 2EBFX 2Y0BA 3NM6B 3OQIB 1CFJA 2JKVA 4OM7A 2P1DA 3K9BA 5AYVA 4O3FA 4C14A 2PWPA 4A1FA 2ZSBA 1O0SA 1J0AA 3OU6A 1D0VA 1VJGA 2R87A 3D1JA 3FSGA 3IURA 3KB1A 2EC5A 4MP3A 4OMFG 3JYQA 1ZFNA 3SX0A 3EOZA 4WBNA 3ZTTA 1YB1A 1EFPA 3EZ2A 3NJ8A 4TXMA 4Y18A 1L5KA 4D98A 5A4IS 2VP2A 4ND1A 3L7BA 2CXHA 1TGVA 2HUPA 2V7UA 3RUDA 4BWYA 3KD2A 1BU5A 4MV3A 4Q9AA 2EZTA 3X1YA 1KMHA 1M2GA 3NBXX 5DX8A 1HG0A 4HNTA 3BERA 3PIIA 5EJGA 5ALXA 1Y8RB 4MR9B 4UNIA 3J7TA 3CNQS 3DP7A 5JCZA 4KI0A 5CLJA 1HUQA 1CRQA 3TDNA 1UOQA 4N3GA 5E6UA 1RWPA 3PDWA 5TGTA 3A9TA 2H4XA 4OQQA 4URWR 4UXHA 1PW5A 3DVQX 1DCKA 3RU7A 1B15A 1AXRA 2AZ4A 3OOWA 1LSJA 2O05A 3C3AA 2QY6A 3U37A 4NOMA 1EG7A 2ZTVA 4C4YA 1CW2B 2D0OB 1X8LA 2H92A 1L4MA 2C4UA 2G17A 2Z0MA 4JX8A 1DXHA 2IOFA 4QBIA 5M29A 3IR5A 1QVRA 3LP6A 1QHFA 2BL4A 3DWFA 2NPIA 3AF2A 1WCYA 4I8IA 3W7VA 1P1JA 4C0QC 3RNOA 5CNKA 2PBLA 4B73A 2NUBA 1A4IA 3PQ5A 1SBIA 4OJTA 4ZRMA 5ALJA 4ID9A 5HNKA 1JJBA 4XFKA 4NAHA 3UXHA 5DWVA 2GPBA 5GJWC 3TTYA 2Q49A 3GRRA 1B6GA 2ACWA 3R7BA 3K0SA 4KK4A 4I4TB 2GPWA 5IJXA 3TPZA 1VA5A 4FN5A 5FI5A 3CCBA 1CB7A 1M83A 2DWUA 1PP4A 2B98A 3ZCPA 3CNEA 5IJ0A 2Q4RA 1A27A 1FQWA 3BSWA 4N1AA 3VKUA 4D57A 3CVVA 1ZK2A 4JBHA 3NIBA 1S3IA 3JR3A 2M98A 2IEYA 1UZLA 2QZPA 3ONNA 4IMIB 3L84A 3TQTA 1BMTA 2WSSD 4QUHA 5FRDA 1A2QA 3RD5A 5E3IA 2FEMA 1J8VA 2MJLA 3CH6A 3T7RA 1AS3A 4QO8A 4C0LA 3RC8A 1ZW1A 5KWIA 1XPUA 1ZRSA 4RV4A 4DC1A 2Y0EA 3NLLA 1OH7A 1U2PA 2QG9A 4ZYZA 3KJXA 4P1ZA 2WTAA 4MUYA 5IFKA 1WW3A 1PQWA 2CFRA 3AVOA 3L93A 2J9XB 3KQQA 5LC1A 4DA4A 4HRVA 4ALLA 5EJAA 1YCDA 1S9DA 2CHUA 3KSRA 3R3JA 1BJRE 1SIBE 3M2TA 3TOCA 5ISMA 2B35A 3BTUA 5DDIP 3RIEA 2JFWA 3DHNA 3VZCA 3VR3A 2I0FA 2O8CB 2PQ2A 4G89A 2Q5LA 3ZGLA 3ZWNA 1UQUA 2CVQA 1Q6ZA 3FGNA 4LI0A 4ZKEA 1BMQA 1DZ3A 4K9DA 1C8KA 1N9GB 2MSCB 4C87A 4AY2A 3G1WA 3WG9A 1CQJB 2XT0A 1PDOA 2RBEA 2IYNA 2Q2WA 2QYSA 3CR8A 2YFYA 3TX2A 4L8GA 2NZWA 2V0CA 2VJNA 3K4PA 2Z98A 3THYA 2WM9B 3DP9A 4XCVA 1U0EA 4DXAA 2GOYA 4EGSA 3PJRA 2WHPB 1EGVB 3T4EA 5ITVA 1Z37A 3PUJA 4RANA 5JAPA 1JDNA 4Q02A 5KVCA 2FWMX 2JF0A 1LQTA 3E7WA 5E4YA 2ZT5A 4C6HA 2X8JB 3E5RA 5I9SA 1E64A 5LB4A 3VHXA 4CEIB 4JROA 3DAFA 4B6JA 1GNVA 1LWOA 4EQ6B 4RZHA 3AJAA 2FSHA 3JPYA 2IW1A 1V41E 1M2NA 3MXTA 3WNCA 4BLPA 3UA4A 5J4LA 5FPQA 1G8YA 4DCUA 4ZKDA 3DLIA 3PR3A 4TN5A 3ZE2B 5F3DA 4OV6B 2D5BA 2FR8A 4LHXA 4AJEA 2CNDA 1YRYE 4A0RA 4KQCA 1JNYA 2DTEA 3P19A 5THQA 3TR0A 4OQXA 2FSFA 1F9AA 1ZSNA 2O0LA 2FRDA 4FGZA 2V6BA 3PX3A 4LRXA 1ZO8A 2GM5A 2PKXA 2Y66A 1IG3A 2WPNA 2F9FA 4XUCA 3RABA 3GDFA 3U7QA 4MK4A 1I51A 3E05A 1P0CA 2G7ZA 2AV6A 2FWPA 3IP7A 4QLOA 4PN7A 1PO7A 3EK2A 3FUVA 4FFOA 4H7KA 2K7ZA 3GYGA 1IQPA 1IIRA 1K63A 3VR1A 4P0TA 2BFAA 4JYCA 3KM0A 1H8HA 2K4MA 3AR6A 4BJ5A 3BMOA 1ZCFA 4CKCA 3PZBA 1V8ZA 3HJRA 1LDBA 4KPYA 2GKGA 1X7YA 3I39X 1H3EA 4GGMX 3IFSA 3THSA 2JGDA 1ZGHA 5BMVA 3AVYA 4EGCB 1IUKA 1E8MA 2CCJA 3OA0A 2ZUTA 3ICEA 4DMHA 5L3RA 1RM3A 2NVWA 4QVGA 5FULA 4AU1A 5IS2A 1ACMA 5JU6A 2E55A 2P9QA 4X5OA 5DYNA 2GMWA 3GLGB 3UQZA 1CNEA 1QK3A 4MWGA 4D3FA 3MFYA 2W6ID 3ZHUA 4LNUA 3SHFA 1TW3A 5FBVB 5ALTA 1NXTA 2C3YA 3RKUA 1Q57A 3Q15C 3E4CA 3VNRA 3SZGA 1I3NA 4AULA 2DX7A 4J16A 4YPOA 4QUKA 1Y98A 4W7IA 5KNBD 2OCLA 3AEKA 3H87A 1L3CA 1TA9A 4E1BA 5BRAA 1ZM9A 4XIJA 4LIPD 5IJWA 2AFIA 1G4HA 5JJLA 3PBKA 1MB2A 1ZDMA 2A9KA 3H6KA 4BV3A 4EELA 3G5AA 4IIFA 2IUFA 3M89A 3A1EA 5K0FA 4O3MA 5IUKC 4GI3A 1ZZGA 5KNCA 3OE7D 2K87A 4OAOA 5IWAB 4X3PA 2P9CA 5JJIA 3IAHA 3KR2A 4O4JA 1RE1A 3CEJA 3QX9A 3B7WA 3MRSA 1PX0A 2CDAA 4RC9A 1U9YA 5CFPA 2HL6A 5IAKA 3IT3A 2RCNA 4KODA 4M99A 1Q44A 1VI6A 3SF8B 5B12A 1CUJA 4LDQA 3I52A 4RLHA 1YGYA 1YDGA 1CERA 3FH0A 3SE0A 4RKRA 5IK2D 3R7NA 3OZUA 3QSGA 2JA2A 3BXXA 2OZLB 4G1VA 1II8B 4QX6A 4C7XA 1NT4A 2C4MA 2WHXA 3IP8A 3MUNA 4RKWA 5LQSA 2R00A 2YQ5A 1FVXA 5T57A 3TLCA 4EG0A 4DDWA 3L0BA 3PWZA 3BK7A 3KJNA 3LLCA 5ALRA 5JSHA 4W99A 1YB7A 1KQNA 3LXXA 1Y9JA 4G4GA 4CM3A 4DGSA 3W9YA 1UJMA 2C54A 2ZJYA 4GM4A 2WJVA 1KE1A 4GUDA 3GXOA 3DE0X 1R0KA 1KAEA 1E3EA 3U9TA 1BEEA 5GY7A 3OMWA 1RPTA 3Q3HA 1S8AA 5BV1A 4E08A 4C08A 2ORED 3Q3GE 1K0FA 4KWIA 3KCQA 1VE7A 3D8SA 1B3BA 1A76A 1A0OA 4I6JA 5JW6A 2VPTA 1KFKB 4OHMA 2YCLA 1S2IA 1TCUA 3H6GA 4GP7A 1QIEA 5JALA 1J2UA 2G28A 3LGAA 4G97A 1OH8A 3JQRA 1AQNA 1AA6A 5BSRA 4X62B 3MTJA 1AB5A 4A4DA 1N9GA 1R4MA 4U3JA 4U8GA 3KDSE 4JYPA 3SQDA 1GUFA 3M7IA 2WQZA 2AE1A 2WV9A 3CPHA 4MW6A 3V7FA 3JYOA 2P5YA 3A06A 2BBWA 4WOCA 3DKRA 3OX4A 4XX0B 4F86A 1QJ4A 2BP7A 3KEMA 4QPCA 1WXWA 1SMKA 2LZ0A 4UARA 4IIHA 4JY7A 3OFJA 4LXQA 1FS4A 5ALKA 5EIAA 3OX3A 4BNFA 4RGQA 3VM6A 3RAFC 4HFRA 3ESBA 1NBWB 2ONZA 4WCDA 4H4EA 5FNZA 1XXHB 5FUBA 4BUJA 1SVWA 3ZLVA 3E82A 4Q1FA 5AO9A 1E7MA 5BN5B 3VNUA 2ECKA 4MGEA 4EDHA 3WRYC 2P5SA 2EP7A 4MROA 1CUVA 5TMPA 1JDSA 1U8XX 3JRNA 2WJ6A 3FF4A 3L01A 5TQVA 3VR4D 4AIRA 3GFRA 1IBLB 1A97A 3HZHA 2Q3CA 4U6SA 4BVLA 1VP3A 4HH1A 3T54A 1MHTA 4AQ7A 2WZQA 3DFKA 1W581 3IJRA 3BKWA 4I4TF 3NANA 3WYAA 3V2HA 3KC2A 2YUIA 4I0WB 3OJ0A 1GL3A 4MWEA 4AIIA 2QLJA 3SIXA 3EAFA 3RTDA 3AX6A 1C30A 4K6HA 2N9UA 3E5MA 4XARA 2C3UA 4FXOA 2E7ZA 2ISCA 5DJ5A 3U4QA 3FNFA 1EFLA 2ZUFA 3OIGA 4BVKA 1EXVA 4URFA 1LPOA 4TWIA 1AUQA 2HQOA 1P4HA 4FD3A 1DQZA 1SC9A 3GUYA 4WV3A 4Y98A 3N6XA 4DJ5X 3AERB 3BRWD 2C8VA 5CK4A 1J1IA 1OY1A 2PUHA 3IEIA 2VF7A 5KHLB 1K4YA 3FCAA 2Y4OA 2YCBA 3UC9A 1H4VB 5BR4A 4A73A 1ZMRA 1NVBA 3H9JA 5C4GB 1TU3A 3S7ZA 3AJ8A 4Q1EA 3ZHXA 4Q18A 4R98A 1U0BB 3STVA 3H5OA 2M1ZA 3MQFA 2Z2XA 1UOOA 3WGVA 2OKCA 3M1AA 2CD9A 2G6BA 4QD3A 3NDBB 3OKCA 1FC0A 4EI8A 1T43A 4MVCA 2C5HA 3HLYA 3TTUA 3GRKA 3JATB 4JP2A 4KQMA 2NXEA 1MJ5A 1VMDA 2OZVA 4BNKA 2PG3A 3I72A 3SBXA 3Q7QA 2P30A 3P5SA 1OVMA 4PAOA 4I6EA 5LSAA 2FR1A 3MA0A 2AYYA 3LBYA 3T5AA 1QWOA 4U6QA 3W5IA 1N5RA 2Z4RA 3MGKA 3E18A 3OCXA 4JENA 3UCXA 4F2GA 1JN0A 4IVRA 2COUA 1WM1A 4HBZA 4HGZA 2M2IA 2X5XA 1L5WA 4EY6A 2FW6A 3U61B 3QVXA 1KYWA 1ENOA 2V9ZA 3NGMA 5C46F 4BBAA 2P1ZA 1X7DA 2AFIB 3P20A 1ZICA 1H93A 1ZIOA 1EUYA 2QG6A 5IP5A 3ENQA 1ITZA 1SZJG 3PI6A 1X1BA 1SU7A 5B4UA 1BXGB 4CN8A 2PGAA 3I30X 3G59A 1RQXA 2VRBA 2R68A 3A9UA 4QM7A 3E9EA 3JQCA 2PMKA 4GNKA 5HIAA 3Q8LA 1M1ZA 3FNHA 2TYSB 4J1NA 3QWIA 2PRJA 4QDTA 5HCIA 5T64A 3W2FA 1BCRA 1W34A 3RSCA 1XTIA 1JEJA 3GLGA 5KYVA 4WKCA 1VM6A 5HW0A 3P9KA 2WIGA 4GMHA 3D0QA 2FMKA 3DL0A 2ZRLA 2OGZA 5JMPA 1CS0A 3RHFA 3U09A 1QGUA 3GG9A 1GFWA 4G0NA 5IC4A 3AO0B 1XPOA 2OG1A 4NU5A 5HTOA 3UTDA 4FC6A 3ZDBA 1QV7A 2RHRA 3RSGA 1BS1A 1MUUA 1VXOA 2FZ4A 5KYYA 4GOJA 2HV9A 2XVZA 4ZTBA 2GXAA 1IN6A 5BW5A 2XYGA 1CIJA 4FJ2A 4P54A 5CXSA 2FVYA 2O3JA 4OQPA 4ZC8A 3S3TA 5IKMA 3W5SA 4FGSA 1VHLA 2ZEJA 4G1BA 1FB5A 4YPVA 3ZDCA 5CEJA 2PL1A 4C2BA 1JR4A 4FOLA 5AUOB 3HI6A 3QFSA 3EXEA 4BNJA 2PUBA 4J0HA 4ES6A 1TF7A 3M33A 1P8JA 4B35A 2PCJA 1O5TA 2HIHA 3OF5A 3DZHA 2RHWA 4J03A 1C3OB 1UXOA 1P1RA 3UFXA 3T3EA 2GB4A 3WJ2A 2YWJA 3PLRA 1U31A 4JIGA 4LVCA 4OJNA 4INOA 1FJXA 2VLIA 2WKSA 1D7AA 3KZ1E 1II8A 2VBFA 2PGDA 1HSZA 5IBQA 5JCJD 3HKEB 4HBGA 3WFIA 1DVRA 1IIBA 3FJYA 1K3FA 2ZRKA 3I9OA 3P9YA 3PXBA 1YZGA 4P7FA 4WNAB 3CZRA 1N0IA 2WHYA 4JLMA 1TYBE 5JUWA 1BQ3A 3QE2A 4HX9A 4UHCA 1J5XA 1BXRA 4QT0A 4L5AA 1YA8A 5TDHA 5LYJB 2XV1A 4Q4JB 2GBLA 1NGSA 1YS2X 2VAPA 1OXUA 2A92A 2AEMA 3DEFA 1EZ1A 3GIDA 3EGWA 1F38A 3K6KA 4FBGA 4JQOA 4Z0NA 5B30A 1GPJA 5B64A 2QLBA 1U2TA 2PRIA 5CA0B 4IPTA 4P53A 3PGA1 1I2CA 4CMAA 4ZYWA 5H81A 3CVYA 1EGAA 1EXMA 1V1JA 1TT7A 1LBSA 1T0JB 2VXYA 4UW9A 1GNTA 1W87A 5KS2A 3AZQA 1RI3A 2X1VA 5CXQA 3RF6A 1HT3A 1XZIA 3L7KA 3QHQA 1GVNB 3ZC3A 4B8YA 3ZKWA 2Q8NA 2BEUB 2DKNA 5H4HA 1G3UA 3K72B 4LSZA 1BWQA 2HEIA 1X7XA 2BKAA 2GJAA 1G66A 2ATCA 2XKJE 2QNIA 3AUJB 3BZUA 3I83A 4DJJA 3TUZC 4OA8A 4N47A 5JRDS 3VJRA 2V7TA 5ILGA 2PUGA 2NTVA 4R1UA 5E8RA 2CJFA 4HPJB 1ZL0A 3KUKA 3UO8B 1DAEA 5CFRA 2LTAA 3QVWA 3BMNA 3UH0A 4QGAA 4CM8A 1LH0A 2I6FA 4GWLA 5DN9A 2CF5A 3ANLA 1XELA 2IEBA 5ALZA 3TX6A 2FMUA 4EFMA 4F06A 2ID9A 4Y1RB 4EG3A 5K45A 4IDNA 4O0MA 4RHEA 2IVZA 2PL5A 5JD6A 2APJA 1BWSA 3BG5A 3P0FA 3QLEA 4G0WA 3QA9A 1E2BA 1QKIA 3GMSA 1Z0IA 3IHTA 3FSJX 5D85A 1URPA 3O8QA 1EFVB 1IBKB 3RWMB 4F3TA 2BE7A 2G36A 3NTOA 4RD1A 5ELXA 3G5UA 4KSCA 1TEZA 1QQ5A 2V55B 3GFVA 1RYHA 5EE5B 2HA0A 4RNDB 4KK3A 3RGGA 2AR0A 2R7AA 1N8TA 3L7DA 3IO3A 1E0JA 4K9RA 4F97A 3WL6A 5IULC 2VHEA 2ZW9A 4Z1MA 1AY0A 4IDHA 3BE5A 2WIKA 3PD7A 1IN5A 4HY3A 3JVUA 4PXYA 3QIAA 4R8VA 4IJWA 3HL0A 3Q40A 1CRLA 2ZJBA 4Y6OA 4GFDA 1KPIA 5JFOA 4DBLC 1M75A 4Y2XA 3A4TA 4J8PA 2CXXA 1XU9A 1JTVA 1GSOA 3NO4A 1Q12A 5CU7A 1H4SA 1DT5A 4S1PA 1XAIA 2CL6X 1HE1C 3SYMA 5HQ3A 1YCGA 3AZPA 2ZSEA 4N48A 3USCS 1RRKA 2OV6A 4IDGA 5ELMA 2ARKA 3VYVA 3C39A 2VYCA 3I12A 3LA8A 4DKJA 2JGJA 3RUAA 1G6HA 1NIPA 2ZB8A 3PXAA 1IU9A 4IWNA 2VHVA 3TI7A 4XWTA 3EPJA 3KEQA 4OSEA 1WUHS 3T8YA 1N77A 1FDTA 4IJVA 1FP4A 1PZEA 2WK1A 2O9JA 3BBPA 3PC8A 3UK1A 1XU4A 3TXAA 2WTXA 3AY7A 2ZB7A 5EVJA 4HB4A 3W4JA 1GADO 4NHEA 4Q39A 2OXEA 3M34A 4IKOA 3UXEA 4BHTA 4B3RB 2WUGA 4G5FA 1JGTA 5SY6A 4FPXA 5TQ2B 4D02A 5C4IA 1K2VN 3C74A 3LUCA 5E6SB 4CQMB 3BWMA 2F3SA 1Y33E 2MINA 3BRQA 4KWHA 4M4SA 3J80A 2P9EA 2BMAA 2B21A 3NT2A 1WXHA 1U8YA 4UQLA 4NI5A 2JJ1A 3S5UA 3KD3A 4LC0A 3MJVA 3KR0A 3OQ1A 3SJAA 3SM3A 3CLUC 2HIMA 3K0CA 3LUAA 1GL7A 1XTQA 3UMMA 5HQJA 4L8YA 3OZVA 2H7YA 2QZSA 4OK3A 1C4WA 2Y9MB 3IUEA 4LX0A 4YHBA 2FV8A 1NN5A 1J2RA 3GZ4A