4KRXA

Structure of aes from e. coli
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
316
structure length
316
Chain Sequence
ENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mutational analyses of Aes, an inhibitor of MalT in Escherichia coli.
pubmed doi rcsb
molecule keywords Acetyl esterase
source organism Escherichia coli
molecule tags Hydrolase
total genus 126
structure length 316
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.1.1.-:
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4krxA00
4X91A 4ARBA 3O95A 3BIXA 3WKEA 3ZLVA 1CUWA 5EHNA 3R3XA 1LBSA 3L1IA 3O0DA 1IUOA 3OPMA 2BCEA 5ESRA 4G9EA 3WWPA 1J07A 4DYHA 3WWOA 2DHCA 3DS8A 3G9ZA 1AKNA 5K3EA 2HL6A 1QONA 3QBJA 4H77A 3RLIA 3FLEA 4KE6A 2Y6VA 5FPPA 3STYA 3BDVA 3FBWA 3L1HA 4A23A 1LPPA 3WK9A 5KBYA 1E8NA 2QOEA 5AOBA 4BVJA 5EFZA 4JYMA 5AI4A 3BJRA 2HRQA 2GYVA 1XLWA 1B6GA 1XZJA 1K4YA 2HA0A 4C87A 1Z68A 4Y9SA 1M33A 1PFQA 2WKWA 5LZ2A 5HF6A 1CUFA 2AJBA 3IBTA 4ETWA 3BDIA 5ALKA 3WL8A 3V1NA 1JU3A 1W1IA 3B3QA 4WCVA 4WDRA 4CFSA 4BAZA 4BTVA 4KAAA 3G0BA 2JF0A 4UBMA 3A70A 3QMMA 4CG2A 1UKAA 4MXDA 4H7HA 4CI9A 4Q3LA 5A6VA 5EHZA 4BE4A 3ESBA 2PUHA 1P0IA 1ETHA 2AJLI 3WZLA 3DJYA 4XWGA 3MGAA 1A8SA 1HBJA 5EIHA 2HU8A 1BEEA 2JGJA 3SWWA 2XMCA 1JKMA 2NW6A 3UMJA 1E89A 1EI9A 5JZ9A 4B80A 3MUOA 2R11A 4LXIA 3FLBA 2ZJFA 4MQMA 1AUOA 1H2ZA 4PF1A 1EINA 4J03A 1C4XA 1TKRA 4XJVA 5F4ZA 3PF9A 1CRLA 1O6GA 2XQIA 2HA3A 5AM5A 1WB5A 2OGSA 3DL7A 3LS2A 3W06A 2XUJA 4G1FA 5AI8A 4H7JA 1ACLA 1KU6A 1VA4A 1GKLA 2QJRA 1XLUA 1VXOA 1J2EA 3C8DA 4BVLA 3G7NA 1YR2A 1ZD5A 2VJCA 5J3JA 1N5MA 2HFKA 5CTAA 1AX9A 4J0IA 4F21A 2WLSA 3DOHA 1Q84A 2BUAA 2XUOA 4WFJA 5DTJA 4N5IX 1UT6A 2J4FA 3GBSA 4A5SA 1U2EA 1WHSA 4UHBA 3MVEA 5KWJA 5JAOA 4PSDA 1AURA 4LIPD 3O4JA 1C7IA 1ACJA 1CR6A 1P0PA 2H7XA 1DT3A 3DKKA 2HIHA 5EIEA 1QZ3A 2QVBA 5HQ3A 3D59A 1CUJA 1BROA 4BRSA 5ALQA 2RI6A 1VLQA 5LIPA 4JUIA 5CH8A 2OPHA 3IUMA 2OG1A 1ZOIA 1YAHA 1A8QA 3DL4A 2YASA 4W1SA 3C43A 1QIMA 1TK3A 3E4DA 5AK4A 5JZBA 4I3FA 5HF8A 2XQFA 1QO9A 5ALTA 4GBGA 1H2XA 1XZIA 2WFMA 4BDTA 4KJXA 4UBOA 5CT8A 2AXEA 4G8DA 2ACEA 3TJMA 2JGEA 2GYWA 4CCYA 5HQ3B 5I9IA 4L0CA 2QUAA 4H7KA 2LIPA 4IH9A 3CXUA 1ISPA 4KE9A 3FYUA 3I2HA 3H2JA 5D3KA 1JMYA 5AICA 3EBLA 2YYSA 3DEAA 2WIGA 1CLEA 3RK4A 4C01A 2XDWA 1YA4A 3AFIA 4AX4A 4H7EA 2BKLA 4EA6A 3FSGD 3HYSA 4MJ3A 3HZOA 2CZQA 4QA9A 4BVKA 2Z5GA 1LBTA 1W75A 2HA4A 2FUKA 3H18A 2ZYRA 5ALMA 3AZQA 4I4CA 5FXMA 2E3JA 1J06A 2EDAA 3OOSA 3LIIA 4HXGA 2OQVA 3FVTA 5FV4A 1QIEA 3FNBA 4CG3A 4F60A 1EHYA 4OCZA 4NZZA 1BE0A 4CCYB 4KAJA 4HS9A 4L9AA 1FJ2A 1XQWA 3IUJA 1DX4A 1YS1X 2WUGA 3FYUB 4UBNA 2C0PA 5AI6A 5CW2A 3GFFA 2XT0A 2BGNA 4C4XA 3H0CA 2RONA 1J1IA 1XZFA 5K3CA 4DSZA 4BC1A 1MX1A 4MEAA 3F96A 5LZ4A 4UFOA 1ZGBA 1FFCA 5HKBA 3O9MA 4KEAA 2ONCA 2O7VA 2HRRA 4OB8A 3KWJA 1I6WA 1UFOA 3CCCA 5FRDA 4E15A 4EUSA 1WB6A 2WIDA 3KXPA 5C8XA 4H0CA 5AM2A 5T4BA 4LYDA 3WIOA 1XRMA 2HHAA 5JASA 1X2EA 3WMRA 1LPMA 1PV1A 3AIMA 2ES4A 3EQ9A 5DYYA 3PI6A 4OSEA 5ALYA 4UHEA 4FKBA 3STWA 5ALGA 3LIPA 5A7FA 5LKRA 4UBLA 4H35A 2PM8A 3VVMA 4J3JA 3WL5A 4ARAA 4TGLA 1W6RA 3CN9A 1NU8A 5FOQA 1T4MA 1QIGA 1BS9A 3V1LA 4FFWA 3TGLA 2IITA 3QYJA 4UFNA 4HXFB 5FUMA 1BN7A 2VAVA 1G4HA 2IX9A 4HAIA 4DNOA 1D07A 5CXXA 5I7UA 4BRZA 5C8VA 4EY5A 2XI4A 2UZ0A 3Q8WA 1VE6A 1CUUA 4Y2TA 1JJBA 2BGRA 1H23A 2WHPA 3B5EA 4LHEA 4MWTA 1XLVA 2HA5A 3C6YA 2HA7A 1CVLA 3GA7A 3C87A 3ESCA 3FYUC 3R40A 1MO2A 1U65A 5ALJA 4QWMA 5HK8A 1ORWA 2WIKA 4OYLA 4AO7A 1QIJA 2XUDA 2HADA 1DWQA 3R3VA 3I2GA 3IUNA 1FFBA 2D5LA 4P92A 5EI5A 1R9MA 1N1MA 2WUEA 3H2IA 4BZWA 4IQ4A 4N8DA 5C81A 5BWBA 3R3YA 5K3BA 2Y2VA 3IULA 3I1YA 3WKDA 2C4HA 2V97A 1JI3A 3A2MA 2WHPB 3F67A 3I2JA 1DU4A 4HXEB 3TRDA 3PFBA 5EGNA 5EIAA 2O2GA 1Q0ZA 4G9GA 3W9BA 1UK9A 1UK7A 1EK2A 4FNGA 4E11A 4YX9A 1MAHA 2PPLA 1TCCA 2I03A 4N5HX 4W9RA 1AZWA 2H7YA 2J3QA 5BOVA 2VJBA 1E8DA 3O4HA 4M0MA 5CRIA 1JFRA 4EBBA 4W1QA 2PUJA 1ORVA 5AK3A 3IURA 4IO0A 5LLSA 2VA9A 3BL8A 3BIWA 2PU5A 1UKBA 3K2IA 2CB9A 2WUFA 1H2YA 3P2MA 4H7FA 5AM0A 2H7CA 2XE4A 1XZKA 2PL5A 3AIKA 4J0GA 4BCBA 2B9VA 5AKEA 2AJCA 4UBIA 4FNMA 4JEIA 1HKHA 4K5QA 1DTEA 4KAFA 2JIDA 4C89A 2OAGA 5DWDA 4BDSA 3B12A 2C7BA 2BJHA 6YASA 4G8BA 4HRXA 4DMKA 1GPNA 3I2FA 3WWCA 2Z8ZA 4FLMA 4ZI5A 3HACA 3H17A 2WILA 2ECFA 3EF3A 1L7RA 2V98A 3WK7A 4F0JA 3QPDA 4S0XA 1XQVA 1XQYA 3I6YA 5IVDA 1YA8A 3M82A 3VKFA 3M81A 3KWFA 4DMHA 1KEZA 2JGLA 1IZ8A 4J0CA 5AKYA 2PU7A 4Y2JA 4E14A 2P8SA 5DNWA 4BP8A 3KD2A 5SYNA 3STTA 1WPXA 2ZYHA 3ANTA 5CURA 1UWCA 5ALNA 1QO7A 4X90A 2VATA 2Z3WA 5A7HA 2ACKA 4EY6A 4FHZA 3U1TA 4M0EA 4MQLA 1ZD3A 3WZMA 1S8OA 2PKYX 3JW8A 1EVEA 5LP1A 2FJ0A 3BE8A 2WU3A 2CMFA 4B83A 5HKAA 4B85A 3WWEA 2XUAA 1IZ7A 1BN6A 4MEBA 3WA7A 3CCBA 4AZ3A 4UHCA 1QOZA 5CT6A 3VJLA 3VJKA 3IDAA 2OCKA 4P08A 4PO3X 3D5EA 4K6GA 5LZ5A 1X2BA 5ISMA 4KRYA 3G02A 2VSQA 1CUSA 4JYPA 2OLEA 3R41A 3EQ7A 2QT9A 1G42A 4OPMA 5ALZA 1MX9A 4QDUA 4X95A 4Q34A 2V9ZA 4AZ0A 3D2AA 4LXHA 2Q0XA 1WB4A 1U8EA 1CPYA 1XZLA 4EB0A 2WSLA 4UPDA 1F6WA 1VJ5A 4CIBA 1MPXA 1F0NA 1LPSA 4IHAA 2QKYA 2QR5A 5ALEA 3D0KA 4LXGA 1CUIA 5HF5A 4B81A 2WG0A 3HEAA 4E46A 1FFAA 3HJUA 3OG9A 4KR0A 3W04A 3DYIA 4PV7A 1XZGA 4L3WA 5DJ5A 1Y7IA 5ALRA 4KACA 4L72A 1ZD4A 3IA2A 1YASA 5CH3A 4M0FA 2Y1KA 4X6XA 4KE8A 5AM3A 4BATA 1O6FA 1ZGCA 2DSNA 1UK6A 4FMPA 3R3UA 4X92A 3ILSA 4JH0A 1YB6A 1XZBA 2HA6A 5DYTA 3AZOA 3WK5A 1LLFA 4N8SA 2B61A 4D9JA 2XMDA 2WUDA 4Y2SA 1U4NA 4C4YA 3H2GA 5JZSA 3AIOA 4J0KA 3N0TA 1A88A 1EA5A 3BXPA 4B0OA 1GT6A 2JGKA 3VVLA 2JEYA 2PBLA 4QLOA 4O08A 2QS9A 3F98A 3L1JA 5JARA 2C5FA 3D4LA 5AI0A 2RHTA 3UUEA 2XQJA 2ZJ6A 4C88A 1Q83A 2PSJA 5HFNA 1XFDA 1XRPA 1MU0A 3KDAA 1E66A 3K6KA 3C5VA 3QMWA 4K6HA 1CUEA 1GZ7A 5ALXA 1OILA 2G4LA 2O2HA 3C6BA 2O2IA 3RM3A 1RWQA 2JGFA 5ALIA 3U0VA 2DCMA 4U2GA 2CKMA 1YSCA 3C6ZA 4UHHA 1R3DA 4X97A 5K3FA 4CCWA 2FJPA 2XMQA 3C70A 3IIIA 4DLNA 2PVSA 2FX5A 3V9AA 1ZJ4A 1DWOA 3BWXA 3QPAA 1ODSA 4W1PA 2XUQA 4U2BA 2VT7A 4FWBA 4OB7A 5AOCA 3WL6A 2WM2A 5AOAA 3OURA 3PE6A 1QTIA 1WOMA 5FPQA 1EB8A 5HFAA 4H7IA 1R4ZA 2OCIA 4GEGA 1E5TA 4FTWA 5JAPA 1LPAB 4NMWA 4ZV9A 1CFJA 4AO6A 3WYNA 3E3AA 2HM7A 2WTNA 2XLCA 5A7GA 4X6UA 1CQZA 1K63A 4UUQA 2PSEA 5EHQA 3VJMA 1XZEA 4ROTA 4BCCA 1XZDA 1L7QA 1JU4A 1QIIA 1OCEA 2WHRA 1SC9A 2B4KA 5K3FB 4B84A 4J0HA 4UBJA 1F8UA 1XKLA 5CMLA 2XUHA 5HK9A 1EDBA 2VJAA 2EDCA 3O9VA 2DHEA 2ZYIA 1FFEA 2XQGA 3FAKA 4OU5A 1GKKA 4DNFA 1E3QA 2X76A 1NX9A 1UZAA 2XMGA 3N2ZB 5DTIA 1C7JA 1SFRA 3QZUA 4QEKA 5CT5A 2C0QA 3LP5A 3F8SA 2QJWA 4Q05A 2OGTA 4X93A 5LZ9A 4MWSA 4GLBA 1QIKA 3LLCA 4KRXA 4G5XA 1P0QA 3WLAA 1AC5A 2VF2A 4RNCA 4QNNA 1CV2A 2DQYA 3NOXA 5LZ8A 1MNQA 1TQHA 2I3DA 2XMSA 3WWDA 5JADA 4XVCA 1ZJ5A 3G0GA 1MNAA 3G8YA 2R8BA 1HLGA 1R50A 3C45A 1USWA 1W4LA 1XRRA 3DNMA 5AIBA 5FLKA 4HRYA 2OXEA 1E8MA 1LZLA 1QTRA 3SK0A 1GPKA 5ALLA 1DINA 1EB9A 2XMBA 3FCXA 1THTA 3MUNA 2BAGA 5ALVA 4OU4A 3I6ZA 3WL7A 4A16A 4BB0A 4IH1A 4BE9A 4FBMA 4B6GA 4QE3A 4RE6A 4J7AA 4Y2QA 1JJIA 5CT9A 3A2NA 3IVMA 1ZICA 2CJPA 5C8ZA 5JANA 3DCNA 1H2WA 3S8YA 2RHWA 4DTCA 3VDXA 3ZLUA 3NUZA 3R0VA 5FP0A 1YCDA 4AXBA 4GECA 5JAHA 1CEXA 1SCIA 2OCGA 1UXOA 5C7YA 4GHWA 3R3ZA 5A71A 2BUCA 4KYVA 3H04A 1YB7A 3R3WA 3STVA 5SYMA 3CN7A 5JALA 5DLPA 3ZV7A 2XLBA 1FFDA 5DNVA 1N8SA 4Q3KA 1HDEA 4FFVA 5AKLA 2D0DA 5AM1A 3GUUA 1GQSA 2WG2A 5A62A 2WIFA 1EXWA 3G9UA 4C6HA 1A8UA 1TCAA 3F97A 1A7UA 3FSGA 1UOQA 4BAGA 1DQYA 1B41A 1ZI6A 5BV7A 3WKAA 5JD5A 4AO8A 3KOOA 3ZPXA 3I1IA 4PSUA 5H3HA 4TVKA 1EX9A 1QE3A 1T2NA 3EIOA 3WQHA 3A2LA 5D7BA 2QTBA 1G5FA 5AP9A 2OGZA 1F0PA 5K3DA 1GGVA 4GWLA 1AQLA 1VXRA 3T4UA 4X3CA 3AJAA 5T4HA 3O4IA 4Y2VA 3TEJA 1JT2A 4FBLA 1IUNA 1XROA 3M3DA 3ZWQA 1IUPA 1LPOA 2H9YA 4X71A 3O4GA 5AKKA 5AKXA 3HLKA 5IKXA 4GW3A 1XZHA 3C6XA 2VEOA 3I28A 1ZD2P 4OB6A 3WJ1A 3V1MA 2Y6UA 2WHQA 1MN6A 1XRLA 1W52X 3BJMA 4YK7A 5BWCA 5AHXA 3HRHA 3V1KA 1BCRA 1Y37A 2DFPA 1UK8A 2QXTA 4U2FA 5DNUA 4WFKA 3FOBA 1CIJA 1QFMA 1FSSA 2GYUA 2CUTA 1R1DA 2W22A 4QDZA 4QWWA 1SOMA 2HA2A 3LCRA 4FLFA 2ZSIA 3X3HA 2I78A 1X70A 4Y7DA 5D3ZA 1ODTC 3OC0A 1P0MA 4X85A 4XIIA 2WTMA 1CUBA 1QIFA 4DMFA 3W05A 2QZPA 1XRQA 3DYVA 5AKHA 2XUGA 2QXUA 4WY5A 1QLWA 3H2HA 1WPRA 3W9UA 2OCLA 3WIBA 1CUYA 3AILA 1K6EA 5HCUA 2RGUA 3OTQA 3HI4A 3ZI7A 2HDWA 5AH0A 2VAXA 1PJAA 3WJ2A 1EDDA 2G5PA 4X94A 5CXUA 1XKTA 2GBIA 4Q3OA 2ZVDA 5JD4A 3PF8A 4X7BA 5T4EA 4INZA 1WCYA 5ALOA 5K3AA 4G8CA 4LKOA 3HXKA 4BCDA 1GPLA 4H18A 2DHDA 4Q82A 4RPCA 4PSCA 1TAHA 4ZRDA 7YASA 3G9XA 1DX6A 4BZZA 2WJ4A 3EQ8A 3G0IA 5LKAA 1LNSA 2X8BA 2VJDA 3DKRA 4B7ZA 1BCSA 2RAUA 4DNPA 3AUKA 5I8PA 4PQEA 2C5GA 1GXSA 1IMJA 1Q0RA 4YASA 3D3NA 1DT5A 1LGYA 2YXPX 4P93A 2GBGA 3PUIA 3PICA 3H1BA 1ZI9A 3GROA 4AQDA 1DQZA 3I6MA 5ALSA 2WU4A 3ED1A 1L7AA 1QFSA 4HVTA 3C5WP 3DQZA 5YASA 4UFPA 2OAEA 4G4GA 4OYYA 4U2CA 3H19A 1WHTA 5AIAA 4B82A 1GQRA 4Q1VA 4BTLA 4DGQA 1VZ3A 1CUZA 4GDMA 4ZWNA 2JBWA 2QRUA 4YPVA 2ZJ7A 2WJ6A 5IVIA 2ORYA 1CUVA 5CT4A 4IH4A 2CBGA 3HABA 3AZPA 3FYTA 5IVKA 4CG1A 2BUBA 3YASA 3WK6A 1VKHA 4EY7A 1UOOA 2OQIA 2XUFA 3H1AA 3DOIA 1CUCA 2CEKA 4GI1A 3WYDA 3S2ZA 1XZMA 5E2IA 4BYMA 3DDUA 3G0DA 4GXNA 2AJ8A 2JEZA 1CUGA 4K2AA 3IUQA 1BU8A 2W6CX 2GBCA 5ALHA 3JWEA 1CUXA 4AMZA 2IIVA 4HTAA 3DD5A 1KU0A 4UHDA 3AINA 1SCQA 4WDQA 1VA5A 2VT6A 4BP9A 2HU7A 2GBFA 2DQZA 2ZSHA 1H22A 5FDFA 4X00A 5JYCA 3WA6A 3OM8A 2WG1A 4ITVA 2O7RA 5KREA 4W63A 1CUAA 2XB6A 3QM1A 3WK4A 2WJ3A 4J0JA 4AN1A 4MYSA 4U2EA 5ALDA 2AJDA 1G66A 3UUFA 4ZREA 4FOLA 1AMNA 1XZAA 1AGYA 5JIBA 5AKIA 4DSAA 4EY4A 3QH4A 4F5ZA 1ODCA 1XRNA 1EVQA 2Y2UA 1SCKA 2Z3ZA 4H7DA 4DMCA 3QITA 2Z8XA 4C4ZA 4WFIA 2XMZA 4Y2UA 3FVRA 3ICVA 4KE7A 4QLAA 4DNQA 4B9AA 1QJ4A 3ESDA 1HL7A 1OXMA 4OD0A 4XX1A 3STUA 2X5XA 3WK8A 5D6OA 1LZKA 3K9BA 4N8EA 3QMVA 3HSSA 4EHBA 2RIPA 1K5PA 1MJ5A 2G5TA 3KSRA 2WFZA 3I2KA 3PDCA 5AO9A 1RP1A 2QM0A 1EH5A 1VOTA 2GZSA 4U2DA 1UOPA 4AB1A 3ICWA 4QDOA 4X6YA 5ALUA 3F9CA 4HZGA 1ZIXA 3E0XA 3HC7A 3QPCA 5IH7A 4Y2XA 3I2IA 3V48A 5E4JA 1R9NA 3FLAA 2C58A 5AI9A 3VISA 1TIBA 4RGYA 2PSFA 2XUPA 5AK6A 5AJHA 4QZVA 5ALFA 1EK1A 2XMRA 2QMQA 3NGMA 5E4YA 2HFJA 3G0CA 3M83A 2WQZA 4FDMA 5KWIA 3ANSA 3JYHA 4DIUA 3GZJA 5AM4A 3Q0TA 2PSHA 5CBKA 3WKCA 1XZCA 5IVHA 2WFLA 3RARA 5A2GA 2G63A 5CH5A 2V96A 4OUKX 2I3ZA 1JMKC 5ALPA 5AKZA 1Y7HA 4G4IA 3WI7A 2B20A 4WJLA 4Y2YA 4V2IA 1R88A 1BEZA 3T52A 5EHXA 1YAJA 1LPNA 4ZXFA 5AKJA 1EDEA 2QUBA 5JAUA 3SC2A 4W1RA 1MTZA 5FKJA 4RE5A 1VE7A 3C8HA 4PW0A 1WM1A 2ROQA 4ZGBA 3PUHA 3IB3A 1HPLA 4Z49A 1QIDA 2J4CA 1K8QA 1JJFA 2ZYSA 5E4TA 4UBKA 2YH2A 4QDTA 4CIAA 1TCBA 5LYYA 2WFLB 5HZGA 3ESAA 4MYDA 4FLEA 4ZV7A 1MT3A 3RKSA 3QVMA 2HU5A 4JNCA 5AI5A 3PFCA 3BF8A 1BRTA 5ALWA 4AMYA 3DLTA 2XUIA 1CUHA 2WIJA 5K5EA 1N5RA 4AN0A 3D2BA 1CQWA 3E1GA 5DYWA 2GZRA 4G4JA 4I19A 2J3DA 2VQ6A 3NWOA 2XQKA 1RYYA 1TRHA 4BBZA 4BC0A 1MAAA 3VXKA 1YS2X 5AK5A 4B0PA 5HF9A 2K2QB 2H1IA 4Y2PA 4DM7A 2EEPA 5JATA 1XQXA 2PX6A 4EY8A 3SX4A 1ZIYA 4NVRA 1NU6A 5LZ7A 4NS4A 1UKCA 1CUDA 3BF7A 3D2CA 4WY8A 4P9NA 3GELA 3G9TA 4EZIA 3A6ZA 1DWPA 4K6KA 1THGA 2VTVA 4J0DA 3STXA 3ZLTA 4UHFA 5T4FA 4Y2RA 2JGIA 1MX5A 1IVYA 4TPKA 1ZI8A 3H2KA 3WKBA 5AKGA 1HQDA 5JD6A 4QDXA 3D7RA 1VZ2A 3FCYA 4LYEA 3FWHA 2DR0A 1QGED 1LPBB 2PSDA 1W76A 4BAUA 3W2TA 1QIHA 2BFNA 2JGMA 4B9EA 2XUKA 4PNZA
chains in the Genus database with same CATH superfamily
5IWAB 5D3MA 2NTEA 1GQOA 3OETA 1JDJA 1DFHA 1Y0BA 2WD8A 3DZIA 4A2PA 1CFZA 1E2HA 3CNNA 4J16A 4WRRA 5AVJA 3LVRE 4QU9A 1AQUA 3O8OB 1E4YA 1X1TA 3O0DA 2OBNA 4WV3A 3TDNA 1I13A 1TVCA 4EW6A 2BCEA 4JYZA 3LRPA 3L8MA 3CZQA 1YB1A 3CUUA 3I9FA 4HNSA 5ESRA 5M34A 3FCCA 2QTGA 1J07A 3EQ6A 2VDVE 5IC6A 2C4NA 4M1EA 4NP6A 3NEJA 4V38A 4DYHA 3EMVA 4OJNA 2CDBA 1PKXA 1QDEA 4AF8A 2AE1A 1Q2UA 1Z38A 1UZLA 3PNOA 5E9JA 2R47A 1T2UA 1WR8A 1YOBA 4ZZ0A 4QGAA 5JU6A 3N0RA 1AKNA 3HH8A 5F51A 4EPYA 3E5MA 2REXB 2QEQA 2VJQA 1N9ZA 1QONA 2JFXA 1LSSA 4NHOA 3K5PA 4H77A 3TEFA 1JBEA 2EL9A 5DPMA 3ACCA 1EKXA 3VHQA 2GDJA 4ZHSA 1RHQA 2B7CA 1IRXA 2NVUA 3MCAA 1BVHA 2H1FA 4A23A 2E4XA 2QORA 1DC8A 4YYZA 1DZ3A 5JHGB 1E8NA 1B7GO 5KYKA 4IDNA 4CR8A 3GZNA 2NTYC 3KU1A 3R8CA 3MOSA 2AMJA 1KYWA 1M34A 5KWSA 4FMDB 4RZIA 1YDGA 2ZUUA 4WW0A 2NU8A 5AOBA 1V16B 3K5IA 3HPRA 2BBSA 3NAMA 1SUCA 5JAQA 4TN5A 1O5OA 1CY6A 2M98A 1UM8A 4W7HA 4BLUA 3PNSA 1W5TA 2ZCJA 1JRLA 3ANNA 5JWHA 2HRQA 1TTTA 4NAVA 1B6GA 4TYWA 1WB9A 2X9LA 3HB0A 1LWOA 3CW9A 3F4BA 3NH6A 4Y9SA 1FBNA 1M33A 1PFQA 2WKWA 3E0QA 1AKYA 1CUFA 2XXBA 3CNHA 2AJBA 3QU5A 2PXAA 4R7ZA 2KBEA 4REQB 3RAGA 3VUEA 1L5KA 4BMSA 3WL8A 5IAKA 1J0EA 1VIMA 4OAQA 2D1YA 1W1IA 2R1TB 3L6CA 4RAOA 4LXYA 2DBRA 3DEIA 4WCVA 2HT1A 1ETUA 1R8YA 2BMJA 3HKCB 3ISJA 1ZCJA 1Z2OX 3LPAA 3QU9A 4WNYA 5I7AA 3E9DA 4MV5A 5IBQA 3ZH2A 4CFSA 1A1VA 4BTVA 3PLAE 1HX7A 3B48A 4KAAA 2REQB 4GP9A 3VKUA 4CV1A 1PSWA 2YQ4A 1U0BB 5A0VA 3IDZA 3UJ6A 3F6EX 4Q66C 3JQ9A 3A70A 3IA7A 1KVSA 1ID1A 1MVLA 3DBHA 3F1KA 5TIIA 3UJNA 1NW4A 3KL4A 2Q4DA 4MR9B 4MS4B 4JEUA 2G40A 3RWBA 3SF0A 4F72A 5BWNA 2QAJA 5L4LA 3I6BA 5CLIA 4BFVA 1MA0A 3INRA 5JC8A 4AMUA 3U62A 2Z6QA 2SKEA 3ESBA 5FBKA 1QYWA 1MJFA 4IX1A 5DHFA 2V8OA 2XB2A 1ETHA 3WLHA 2J09A 3PRKE 4TTAA 1ZN9A 2JFFA 2P4SA 2Q99A 5DMHA 4LZZA 1SXQA 1HZZC 3N2GA 4XWGA 4F91B 2KQUA 3G79A 4Q37A 1DWUA 3RJ9A 1BEEA 2NTNA 3DR3A 1Z7GA 4IS3A 1P7WA 4DCGA 1MFPA 5AQEA 4HC4A 4ZEXA 4EW1A 2Y1FA 3K92A 1LH0A 1R8XA 1T35A 2RBGA 1JKMA 3BQMB 3UMJA 4KOAA 4YB8A 2G9VA 5TS2A 3ZZ0A 3N58A 1EI9A 1QV9A 5HOQA 1RC1A 5CFZA 5EKXA 3SC3A 3T0FA 4B80A 1K1EA 1YS4A 3KR9A 3MUOA 3Q5GA 4PC7A 2RHJA 4ZGGA 5JR3A 2V7QA 4R8RA 5I7EA 2WD7A 4HDMB 5LQUA 4FOSA 1Y33E 2CXXA 4MQMA 1H2ZA 3CZ9A 1MV8A 4CUJA 1ZGHA 5T5QA 2YIJA 1XEFA 1PNQA 1P9RA 4RK6A 1TKRA 3QLJA 2P0EA 4XJVA 3PA6A 2FP4A 2GUWA 2OK8A 2NYVA 3A6GA 4OKIA 3S29A 1P19A 1F7VA 1MO4A 1PZNA 4P34A 5D1HA 5F4ZA 4EWLA 4W8HA 1GNPA 1PJ3A 3NJRA 4G0PA 5CLLA 3GLFE 2R79A 5CJ2A 1E1RD 2HA3A 3BK7A 3S55A 1Q57A 3GJXC 4LJ4A 1C0EA 1WB5A 2BL4A 5CBPB 3VAZA 1O8BA 3E03A 3VTFA 2OGSA 1QHFA 3L8HA 4FFDA 2QN3A 1H94A 3E22A 1K89A 3OESA 1ZITA 3S8MA 4PZ0A 3E1SA 1GQFA 2Q41A 4NNPA 4RDCA 2P9YA 4ZCRA 3ADKA 1X1EA 3DTVD 1IU9A 5DLYA 4U7WA 1YJ8A 1PWYE 2CBZA 5AI8A 5JROA 1MRNA 2FK8A 1APBA 4H7JA 3L4EA 4BO5A 3G82C 4GYYA 4RGVA 1FCJA 1K06A 2FGKA 5BN1A 5I7FA 1TVKB 4C0KA 3HN7A 1RM5A 5FTWA 2AUTA 4FFNA 3VOTA 2QJRA 3AR9A 1ZOSA 2G8LA 3FRHA 4ROSA 1QLJA 2WSMA 3JSXA 4B3JA 4S1VA 4DJEC 4J6EA 3C8DA 1FTSA 2AIRA 3QY0A 3IHTA 1F51E 1MR3F 1ZD5A 5CFLA 3B3JA 3C6MA 2BYTA 5JY6A 2HFKA 3E05A 3COVA 4Y1EA 4R1MA 1IEWA 5J63A 2NN3C 4F3TA 2HHJA 1CX9B 3BFJA 1BXZA 4J9UE 1BTOA 4J0IA 2ZW9A 4RJ2A 4YRKA 1I3KA 1UKZA 2IQ5A 2WLSA 3FKSD 3OWHA 3CZPA 5K0FA 5KNDH 5TY0A 1L9KA 7REQA 4LBZA 3DVQX 2P90A 1D2AA 2UAGA 1QHGA 2ID9A 2P4EA 3TZLA 5HCIA 4TWBA 1FZQA 1HE5A 4N5IX 4ALNA 3VVCA 1SQSA 1A5TA 4NU0A 1V7ZA 5LBTA 2ZUEA 5A4JA 4PZUA 1OA1A 1GNTA 3QVXA 4UHBA 3UC5A 5I7OA 5FNZA 3RFVA 3REQA 5K3OA 4PSDA 1N1DA 4LIPD 2Y71A 1HT0A 4DIMA 4PRLA 5TQJA 2HW8A 4KIJA 1CB7A 4B4VA 1RRKA 4G0ZA 3AU8A 4D3ZA 4DDUA 3UJBA 4D56A 3WLTA 2OZKA 1YGYA 1TYEB 2YRWA 1FUUA 5JQGA 4DY6A 4NQZA 1CZUA 4MCAA 1DT3A 3DKKA 2I7XA 3AUXA 1X38A 3D1VA 3BWVA 3I9MA 3L7CA 3QVKA 4ZPXA 1L1FA 5HQ3A 3UB3A 3JAMA 5F5LA 1CUJA 4L4XA 4BRSA 5BN4A 4DLRA 5JVDA 1KQGA 2VYCA 1MAWA 1M2EA 4NDAA 5LIPA 2O3JA 1PG2A 3IRVA 2IBTA 4KN8A 4XQEA 2H1LA 2OPHA 1PJ2A 4L95C 3M2TA 4UXJA 3GLIA 3IUMA 1QWSA 2I33A 1KEUA 2OG1A 5B4TA 3BMCA 3SYMA 4N0QA 2C5BA 1A4IA 3RSOA 2CZGA 2V7WA 1A8QA 4R41A 4WLVA 4XSVA 1W47A 4K0RA 3HUFA 1HI9A 1HKUA 2YASA 4LJ7A 4KNWA 3ZWCA 1D0SA 1JLLA 2HCBA 1UPFA 3GRZA 1G2PA 1SXJD 5TPWB 3L7BA 3VSDA 4LHWA 1E96A 2WINI 3KAPA 4NE9A 4Z2AA 1CZHA 1CSEE 3HY3A 4B32A 2HI0A 1US8A 1IM2A 1QK3A 2C9MA 1Q44A 3USES 10MHA 2WJVA 4FD3A 2GPTA 4GBGA 1QB7A 1XT6A 3DT6A 5E2AA 1R6BX 1XI2A 4ZT5A 3P5SA 1WHSB 1MP0A 1PFVA 1UJ5A 2CXOA 1GVHA 3EYWA 2MYUA 3AKYA 6GPBA 4E4TA 1RXEA 5HJ5A 1ZGAA 4G8DA 4F4UA 1OI4A 2X4LA 4JJKA 2C5EA 2P77A 5EZQA 1CDEA 4OLAA 4UM9B 1E3WB 2ACEA 4YONB 1SVMA 2I4RA 1OZAA 3SR3A 3VHRA 3ZD6A 1U1IA 3OOWA 3FDXA 2GYWA 4RCVA 3WIVA 1FYXA 2BISA 3JVDA 2WDZA 4Q4LA 4UHJA 2FRDA 1BDJA 1U9IC 2BZ1A 2D00A 2VNKA 2QUAA 4J1TC 3VC7A 3RQSA 3W8EA 1EE9A 1OBOA 1OWOA 1WDKA 1GRRA 4NFLA 3CXUA 2GASA 4I08A 1DGQA 2W2KA 1V0JA 1K7SN 3TSZA 1U0FA 5IKMA 1QKKA 4L85A 1LFAA 2WNIA 5D3KA 3QW2A 1U28C 1T3HA 3EBLA 3FZGA 4R0NA 2FYTA 3IDQA 1N1GA 2WIGA 1Z5WA 1CLEA 3RK4A 3F4KA 4RA9A 2BKAA 2JFBA 3Q2IA 3QEMB 4Y6GB 4C01A 1KXJA 3RANA 1N34B 4YRPA 3P9PA 2FVXA 3GI1A 1GN9A 2X4IA 3D7MA 4XTCS 3HHPA 4G1VA 3FSGD 2O0MA 4WK2B 3S4YA 4AJ1A 5JS2A 3IT3A 3WYCA 1P39A 5DN6D 2FKAA 1XPRA 4IJQA 2FZWA 1PR0A 2PUTA 3ON5A 1HE8B 4ZFNA 1P73A 3N6XA 4RXUA 3L8ZA 4RVCA 4MYCA 5L9AA 2FPXA 4B43A 1QSGA 2BONA 5AW8A 3EY4A 2Z5GA 2P2SA 3BD6A 1LBTA 3AERB 3D54D 4QFCA 2CL7X 1GNLA 2G80A 3H18A 3SYTA 1WPGA 2WPNA 2O2EA 3W6NA 3PPWA 4O2RA 2VJLA 2E3JA 5DBOA 5B7PA 4EH1A 4Q24A 3A26A 4INOA 3FNEA 4D3DA 4R81A 3HWX1 4NENA 3CVXA 1XMOB 2PBRA 2QLTA 1YUBA 2V6BA 3IE0A 2PCJA 3T9BA 2Z04A 1G8SA 3VJRA 2WNSA 2ILVA 3V8QA 4DSTA 3AF1A 2BEVA 5CYFA 4G4SP 5T6BA 3V34A 4W5HA 4DWWA 2A5YB 2PDAA 2Q3EA 3WLJA 1BE0A 4MRSA 1JG7A 1M34E 4Y6LA 5ITWA 3THWB 4BNDA 4HS9A 3FPLA 3UNXA 5I4BA 1BJRE 5AUNB 2OGWA 1HM5A 4HEA1 1DX4A 4MKRA 1ULZA 1YS1X 4I6EA 5EXXA 3CLTD 2LCFA 5LL6P 2BFWA 2LKDA 4GOXA 2Q1TA 6REQA 4N9WA 3I01M 5CW2A 2ZVPX 4AL4A 4D9EA 4NCKA 2ATCA 5LNK1 2PO5A 2JRLA 2R6FA 4KWIA 3V2IA 1E2BA 1YACA 1B2LA 2B21A 3H0CA 1N2GA 4D0RA 1M2OB 2RONA 3RUEA 4F93B 1IVSA 3NHBA 1XZFA 3OJFA 5C46F 1XHEA 3FUVA 4DPKA 1RJ9B 4QQ8A 2IGTA 2D1TA 2MSCB 3LZCA 4MEAA 2DWOA 1GZUA 1HK7A 4WN9B 3IAHA 1UDBA 1Y8QA 1JA9A 3F96A 4JT8A 1PTJA 4UFOA 1OH5A 1FFCA 3LO8A 3MWEA 5HKBA 5LQJA 4PHHA 3DE4X 3QPVA 1ZVKA 1RW4A 4NBRA 2ONCA 3RLFA 1X0XA 4ALLA 2O7VA 1X7YB 1M2VB 4KQHA 1G9XA 5CLGA 2PMEA 3V8PA 1LQTA 1E2KA 2P69A 1GOTA 2QK4A 5FRDA 1HYQA 3RVRA 5IN4A 1H0RA 4EUSA 1WB6A 3INYA 2F3SA 2C3YA 3KXPA 4H4CA 3FIJA 4Q39A 4JL5A 3C6QA 5TVGA 4IVNA 1JA0A 4PLGA 5ESXA 2A3RA 4UEJA 4DF3A 2BHSA 3GRYA 5T4BA 3TL6A 2EBHX 3RSGA 4HDOB 1LTHR 1ODLA 1ZGGA 3T1VA 4CL8A 1XRMA 1L4LA 2GF9A 3PFHA 3SC4A 2KE5A 2ZQZA 5C37A 2P30A 1JDNA 4XJXA 1KP2A 5C1BA 4I46A 4Y2GA 3V9PA 1PEDA 3OKPA 1Y9AA 1IY9A 1JHZA 3JQ8A 2FN4A 4YJKA 4AFNA 1F4PA 2BM8A 3DXZA 2A0KA 4R2LA 2FSVA 1KEKA 3NATA 4NLLA 5ITZA 2P11A 1KJJA 3PQFA 4E5UA 2AQHA 4AMGA 2HQ1A 1JZTA 3LV8A 4XWAA 2BP7A 1XHFA 1WD5A 1Y3IA 1A7AA 4JQCA 4XRRA 5ALGA 2A84A 5A4MS 3KXIA 3LIPA 1TJNA 2GK3A 3KOYA 2PTHA 3Q7PA 4U0JA 4ZQGA 5A7FA 4MGZR 2H4ZA 3HB5X 1P44A 4J3JA 3N07A 5FORA 3WL5A 4LBVA 5KNCH 4TLBA 1KYVA 4ZU3A 2VC2B 1RPZA 4JV5B 2H07A 2Y8EA 1GCIA 3PC8C 4P33A 2WR8A 1VCMA 4BMPB 4PG8A 1KI9A 3MWDB 3VDQA 2NVWA 1T4MA 3WP0A 4CLHA 4ZCIA 4JX8A 5EIWA 3DD1A 3R20A 4EFDA 2JJYA 3H2ZA 4NFHA 4OP2A 3CBQA 4ML3A 3V1LA 2PG3A 3K9FC 5EKUA 1CIPA 1IPFA 3MMPA 2ATEA 1K7CA 4JLBA 1G0NA 2XRYA 2AL7A 4MZXA 1A4XA 3RSLA 3LQFA 1T9ZA 2ZR0A 4DZZA 5A5FA 4CTNA 3TGLA 3DBRA 4KPYA 4MDFA 4XX0A 1P62B 3D8RA 2CW5A 5FL7A 1LXCA 3EVNA 4AM8A 1BN7A 1PZEA 3L8CA 1ZZGA 4MPDA 4RJIA 2N46A 3RC3A 3ZWBA 4ZKDA 1RXWA 1SEVA 4BNNA 4EQZA 4ZYXA 2RGNA 4UJ3A 4AKIA 5EIOA 1PV2A 2PS3A 4WESB 2RH4A 2O8CA 2ICAA 5TC4A 3NJ4A 5E8RA 4EELA 3QVJA 1DXHA 2IX9A 3B5JA 2NUTB 3CLUD 5BMVF 2AOWA 3BQ9A 2B7BA 3NVAA 1RJFA 1T3SA 2JFOA 3W2FA 2NACA 3UAZA 3Q9NA 1TQ2A 5I7UA 1OYVA 3N74A 4BRZA 3DDZX 1EBUA 1FP2A 4BB6A 4EATA 1O0SA 3MAJA 1YTUA 5AD1A 4G85A 4LF4B 3GXBA 1VE6A 4J7CA 4Q7EA 5HZHA 1JAHA 5JH7B 3PHJA 1LBEA 5EXSA 3L04A 1FP4B 1LSJA 2HLPA 2XVXA 4MW5A 4ZPJA 4E6PA 4C9BA 3MJEA 4URHA 3JATB 3KV1A 4MWTA 1B2RA 3EZNA 5IJXA 1N6OA 5IFLA 3T5PA 2ZRBA 5CGQB 1JFSA 1S96A 2GRUA 3JZAA 1L4FA 2X0JA 2HA7A 3GRUA 3P0FA 3OQOA 1FDSA 2P4HX 5CCBA 2VRBA 3BMNA 2LCIA 3KM0A 3V8VA 5AHOA 4P1ZA 5LIRA 3W5BA 2XHEA 2FPSA 3E2PA 4MKGA 4KQ1A 4TL6A 1FW6A 1G8YA 4DBLE 3GQVA 1XCPA 2W98A 3KTAA 4QBFA 1KIAA 4HLDA 4Q12A 4E4RA 2Q3LA 2RHGB 2B34A 2XOKA 1QHYA 4BUJA 5IK2A 5EUCA 1U6JA 3GEDA 3GN2A 1N32B 1QHNA 3SSAA 1MW8X 4QWMA 7GPBA 3IV6A 3HCBA 3NBAA 3TXXA 4A0FA 2G9RA 1PL0A 4OTZA 1JHDA 2IYQA 1S01A 4J1NA 1EUYA 1T9GR 3NYQA 3ETNA 2KLBA 2XUDA 4OMCA 4EJ6A 5KNBD 1FRVA 2P35A 5C5DA 1DWQA 1IBCA 3QMPA 2XCOA 4YFVA 4PHCA 3PTLA 5FQOA 4C6SA 4P92A 5LQRA 2DT5A 1Z63A 5JJLA 2DGDA 3GLIE 4YWHA 3CZRA 1FU8A 2QRVB 5CA1F 1TPYA 4G6ZA 1TK9A 2IYOA 1N1MA 5A5VA 2Z2YA 4BZWA 3WMEA 2ZJ0A 4K9MA 3V7UA 4EMUA 3DZBA 4WTOA 3TD6A 4JB0A 2C4VA 3JQFA 2ETVA 2F3TA 1KI8A 3A6FA 4MMXB 5AVSA 5DTEA 3W3AA 1P0FA 3EZ9A 3FTFA 2Y2VA 4ENPA 5LCXA 3DXYA 3I1YA 5CUQA 1D5CA 2ZRCA 4QVKA 3DLAA 2V97A 1R16A 5ED0A 3U9SA 4CFZA 2DWPA 3NDJA 2R25B 5KOHB 4GXTA 3TLXA 4E0BA 1CR2A 3DP7A 1N92A 1NFFA 3KVVA 2KYRA 2AC7A 4W6ZA 1UPCA 3FFBA 1J22A 1Z0DA 4MCHA 4RTOA 5EGNA 3RYTC 4DV7B 4ZAYA 3W9BA 4ETNA 1UK9A 4PYJA 1KY5A 2APJA 2GM9A 3W2IA 3CQ9A 4FKZA 4GX5A 4R3WA 2HF2A 1C4KA 4X45A 2IY9A 2CLMB 3LD9A 5AHWA 5CA1B 4M21A 1A9YA 1EK2A 1HOTA 1O94C 2YOGA 4FR0A 5DLDA 3DTTA 2ZUDA 1KPHA 3GXOA 4Y8VA 4IIXA 4YX9A 1ODKA 1ZHHA 1Z6GA 5K8UA 2AD1A 4LZOA 1TCCA 3LHIA 5NULA 3L7KA 1OVGA 5KQGA 4FHCA 4TRMA 4DV3B 3GY0A 1L1EA 3BFPA 1S9DA 5H1YA 4UCWA 1NVTA 3I64A 3MBIA 4F11A 2Q2NA 3ETHA 4IJVA 3O4FA 4LE2A 2QTTA 2M1XA 2P1RA 1OXKB 1Z2NX 2ZDHA 4KQ2A 1OUMA 5DCUA 4Q47A 4ZOLA 2KHZA 3HCWA 4XR9A 3UC9A 5BSWA 4FJ2A 5DK6A 5C8DA 4OLBA 1DCFA 3DKIA 2CJYA 5AK3A 2VAWA 5KEIA 1X9HA 2VEDA 4L5BA 3T7SA 2YMLA 1HRKA 3H4TA 2NQTA 1X87A 3OCYA 4PWZA 4B3GA 3HDQA 4TYMA 4JBWA 3R5TA 2XE7A 3BIWA 2PU5A 4HBGA 1A7JA 4JQYA 1IOWA 4NFSA 1X9IA 2B1IA 4I4TF 1SZDA 4C76A 2C88A 3SZGA 4BCBA 4HN9A 2B9VA 2I6UA 4NMXB 5IJWA 5EE0A 4P5PA 3HV2A 3KZNA 1FA9A 2AJCA 4ZYZA 2HRCA 4B6JA 3UG7A 3AM4A 4IYJA 4CF7A 4IJWA 3OIUA 3F9IA 3CWQA 3H9CA 1IEVA 1F0YA 1USVA 3N87A 5NLLA 4C0JA 5FTJA 4GU5A 4WNIA 4RD6A 5ELMA 1N7IA 2JIDA 3ER6A 4ZVOA 4C89A 3GH3A 2JIZA 2PMDA 4PWYA 3GMDA 1JEJA 1QQBA 1T5HX 3B12A 5GONB 2HLDD 3ND7A 3ZH9B 2ZQYA 2QD1A 5H02A 3PEYA 4QOSA 4QUIA 5DHSA 2BJHA 3JQDA 3PX2A 4G8BA 2HJVA 1ADBA 1MRZA 4GLFA 3A1UA 2AZDA 2LD4A 4QPPA 2AK2A 2C29D 4L16A 5EYPB 3RKRA 1RRVA 2HSGA 4E22A 2CK3A 4U2KA 5FPKA 3UJDA 2VUSA 2M32A 1XYVA 4LHSA 8ATCA 4WZAE 5ES4B 3PHGA 4TS1A 4BFSA 4I4TB 3TQCA 1DJPA 4JI5B 4C5AA 4HNRA 1GTSA 1WUYA 3P4YA 1MTOA 1ST2A 3ETGA 4BY9E 3O74A 3ZS8A 1VTKA 1GYQA 5TV2A 1N2JA 5BQFA 3NUGA 4EI2A 5L4SA 1WCWA 4F0JA 4D8UA 1CRPA 5ILOA 5CIWA 4JVSB 3E9CA 1WNTA 2RDMA 4ZCQA 4CT4B 5BMVB 4PIPA 1RXVA 2E4VA 4P4UA 2VLBA 1UPTA 4TM8A 4GOKA 1IAVA 3B1XA 3EA5A 3RU3A 5JPCA 3I8OA 3OQMA 1YA8A 1MV5A 1TTPB 2X4GA 3WV4A 1Y5RA 2QQFA 4EPWA 2JGLA 2A0YA 1XF1A 4O4JA 2V6JA 3TZQA 5DW3A 4J90A 2VQFB 4J0CA 2OCPA 1OXBB 3GA5A 5B3AA 4IVRA 1PZGA 1L4YA 4OJYA 1U81A 2GCGA 1RYBA 1ELOA 2NXJA 3N6RA 1QQAA 2WV9A 1OT3A 1W8DA 3KCNA 2JI7A 2ZJ2A 4UOZA 4ID3A 2CJWA 2AF4C 4IGFA 4B35A 4BNIA 4F6RA 3TI7A 1N2SA 4DWVA 4YCBA 3MWYW 2NLOA 3ANTA 4CEHB 5HRCA 3QY9A 3SEAA 1FXSA 3PKZA 4PS0A 3DOCA 3KT6A 4OHUA 5ALNA 1MX3A 4UKDA 3H13A 3W1VA 3PYMA 4GMDA 2VDMB 5LU8A 3ZX5A 2CHQA 2JLUA 1DUVG 4M9CA 2Z3WA 1T3LA 3TD2A 3KDPA 4JLUA 2ACKA 4NG5A 4OOEA 3QEBZ 1U5BA 3BAFA 3NOQA 3C3MA 4FHGA 4LJ6A 4M89A 1RI3A 4PYMA 3FWNA 1VBFA 1DKLA 2ZI4A 3OBBA 3CVWA 3Q3HA 3P9SA 4EZBA 4D81A 2RGDA 2X8LA 3MGCA 2JDID 1S8OA 2PKYX 1W93A 1P74A 3FPSA 1JG4A 3FPEA 1I01A 3PHHA 4XYGA 1SJ9A 1SKBA 2E4ZA 1X14A 1EVEA 5J1SB 1MO5A 2X58A 4MVYA 5LP1A 2WSSA 1NR7A 3FDIA 1GTVA 3WNDA 5CDHA 4IVPA 3E84A 5HKAA 4I9HA 1IJKA 2XUAA 1IPHA 3JQEA 2CVPA 3Q1LA 2WF7A 3UA3A 2VYNA 4DUGA 4IMJB 1DFIA 3I1FA 1A98A 3E6AA 1MOZA 3ZWKA 1H4QA 3FHTA 3STHA 4YJDA 4MGYR 4AZ3A 5B3JA 1AUVA 4FEGA 3T3DA 1J20A 2H59A 4J9VA 4QSMA 4CETA 1OREA 3AR6A 5HM8A 1RHUA 4Q4JB 1TM4E 4FR5A 4K9PA 2PUAA 1BMDA 1Y1LA 4AS1A 3DE7X 2H54A 2L17A 3ZR4B 4R1SA 4BIMA 2AMVA 3DFKA 1YVEI 3OLQA 1ZMTA 2ZUSA 1L6IA 3RS3A 1J2TA 3LY7A 4IQGA 3K0CC 3VKVA 4H16A 1C2YA 4KZKA 3VJLA 5F77A 1XU9A 3IEKA 5IKEA 2C7GA 2OCKA 5CCDA 3HZRA 4RF5A 1R4MA 2BELA 5FO0A 5U4XA 3D5EA 3E81A 1M1NB 3C39A 3KTFA 3PZBA 2FE4A 4K6GA 5LZ5A 1X2BA 5KAMA 4XGIA 3JQPA 4KRYA 2GFHA 1E3DA 2BJWA 2CHEA 3KUCA 4J0FA 3RYHA 5J2UB 4A8JB 4LWOA 2UYGA 4RQBA 5LM3A 4QYIA 4OAPA 3P4UA 2VSQA 3RT1A 1VKZA 3T7AA 3VNBA 2BH2A 4QYMA 1SCBA 4I9UA 4ZU6X 4HJXA 3W2GA 3ZI0A 2ERXA 3R41A 2OE2A 2QGZA 4W5RA 1L5QA 4OPMA 1Y1TA 2JATA 4Q34A 4O4LA 1YZHA 1AM4D 2YW9A 5GVSA 2QD5A 3ZIAA 2HBQA 3FFTA 1ZLXA 4AZ0A 1C3XA 3D2AA 3TZBA 1R15A 5JPIA 4PGAA 1XDZA 1QC5B 4JU8A 3TOCA 3HXLA 4FCCA 4O29A 1ZVJA 1K9SA 2C20A 5KYWA 2Q46A 1QGYA 1RRCA 3JR3A 4O33A 5DZSA 3VTAA 4MV1A 1NKSA 3LBYA 4X3PA 3V55A 2XGJA 3VAYA 5DNAA 3RQIA 1DIHA 2GJSA 2QROA 1HFWA 2WSLA 1F6WA 1QNFA 2JHCA 4XIYA 1V8OA 4HNGA 5EZ5A 5FX2A 5LDHA 4AY6A 2QMEA 1I6LA 1VJ5A 4O2BF 4OQEA 4PGMA 5CFOA 3FMGA 3FZQA 5HOEA 2IE8A 5BMOA 3AUFA 1SKAA 3QW4B 1F0NA 4CMKA 1XPUA 4DDMA 3KJHA 2QKYA 2V7UA 1NLFA 4R4JA 3ZU5A 5CDSA 2EVWX 4D4JA 4EW2A 2OV4A 1C9JA 2WG0A 4XQ9A 5JDCA 1AA9A 3OZAA 2NPFA 4P38A 3U7IA 1Q16A 4JHLA 4US1R 4JMPA 4KR0A 1I51A 3O1LA 1XDGA 4PV7A 4CIYA 5IX8A 5GADl 1FXWA 1STOA 2NUBA 3N8DA 2R6DA 2WHXA 3CONA 2KLHA 4BNLA 4OXQA 1M10A 4EBBA 2IIQA 4KU4A 4R51A 3JQAD 3NRCA 4L72A 1FMCA 2GXAA 5H7XA 1TE2A 4FHEA 1NRWA 4JOBA 5CH3A 5P8WA 2Y1KA 3MHPA 4UMDA 1GTRA 1F2UA 3K96A 1IB0A 4X6XA 5BR1A 3EE6A 5AM3A 1Q1NA 1FFXB 3F2IA 5EC8A 4BATA 3PXCX 1H2BA 4DEXA 4DJDC 4CM8B 2OLKA 1QH1B 3D3WA 1XZBA 1MPTA 3LECA 4BX3A 3CS3A 4N03A 4DEVA 2HA6A 3ZE9A 4WVLA 1Z3IX 3AZOA 2OEPA 2FWAA 3O8QB 3VR2A 5DBFA 5TMBA 1TM3E 1U0SY 2DKFA 1OVMA 1ZN7A 2NV6A 4JXKA 4MUXA 5K0EA 3P9RA 2QMHA 1NXSA 4D9JA 3TUZC 1AH2A 2XMDA 1L5HB 4TV9A 4YRGA 4PTLA 2IPOA 5C8YA 4A03A 1H1DA 1U4NA 1XTBA 4L73A 4YJFB 5JSQA 3PYLA 1D04A 4S0ZA 2D8AA 2PGJA 3L6BA 2GM5A 1EE1A 1NDQA 1SWWA 4U02A 1SVWA 3IELA 4GGPA 5CFNA 1U3DA 3N0TA 4OHKA 1EA5A 1A9QA 3E2IA 4FB5A 2PA3A 1NURA 4KXFB 4EY7A 2JGKA 3W3ZB 2IXTA 1MXFA 1AO3A 4R7TA 1CF2O 3M6XA 1O97D 2KSQA 5TDHA 3FPCA 1XN4A 2CXUA 4JIGA 3ZQUA 2HMWA 1UXKA 4PRZA 5I7WA 1EUQA 1O89A 3D4LA 4NDZA 4BXOB 1CERA 3MB8A 4FDVA 2EFCB 4J6FA 1I3LA 2FGJA 4CIXA 1OH8A 4C88A 2GD1O 2JANA 2PKQO 1S7CA 3SS8A 5AVUA 3TLAA 3LA6A 2IH2A 3P2YA 4E08A 1XRPA 2WUWE 4MQEB 4L2IB 2I6GA 3DF9A 3K6KA 5CLQA 4I0WB 1NNEA 1YL5A 3LSTA 1QPBA 3JZMA 3F1LA 3QMWA 3HCOA 4UE3S 5COBA 2X0DA 2YC4C 2ZRHA 2OAQ1 2X6TA 2Y1DA 1JJAA 3S2IA 4NMLA 4LX0A 4PONA 1T2FA 5ALXA 5LBIA 1OILA 2K87A 3R5FA 2DFNA 2G4LA 3C6BA 4J1SA 3RM3A 2KB0A 1UQRA 3NHYA 3KB6A 5CJPA 4YTEA 4Z7QB 3OEHA 3GX1A 4F6CA 3RBXA 2WU0A 3DE1X 3F3YA 1E1QA 2C03A 2NV2B 1ZK2A 2R1UA 2R7MA 3OZ7A 3IBFA 3ZJTA 2AOUB 5F3RA 1NBAA 4PEVA 3C3AA 5D1NA 4R31A 4YRTA 1G3UA 1VI6A 2CKMA 1RYMA 2NSLA 2QQ0A 4M36A 4A8JC 1ADYA 3D5TA 1W19A 1ZAYA 3TYXA 3HZHA 4PG5A 1J0BA 3C6ZA 1NYLA 3NAZA 4TKUB 3DLHA 3EBPA 1QHIA 3HDHA 3QE4A 4UEKA 1GPMA 4CCWA 2YFHA 5HZKA 3C70A 4C43A 3NALA 2A1IA 4ER7A 1Z83A 3LXRA 4DA0A 2I66A 4MLZA 4DLNA 2H9IA 2PVSA 3T0IA 4RD3A 4UVEA 3NVMB 4JT4A 5HMLA 3R6WA 4BJ3A 3PRJA 3HR7A 3EGWA 4DQKA 5B1SA 1SULA 1PJBA 4YMVA 2XUQA 3QFSA 2VHZA 1MF7A 4U2BA 2VT7A 3W1WA 1XO1A 2OL4A 1WW8A 4YMLA 5J58A 4NOJA 4P0QB 5IKPA 4OB7A 5IDYA 3WL6A 4G81A 1GPDG 2A0FA 3FOWA 4QOHA 1OLUB 1HDOA 1WOMA 5B58C 3EJ6A 4J49A 5FPQA 3EVDA 4MAMA 2YZGA 4XDZA 2E21A 4XRGA 5B2FA 1OT5A 1JWBB 2M6RA 2B1QA 3KBOA 1WKBA 4H7IA 5A5GA 2XNKA 1YWGO 1NL3A 3ZHUA 3GT4A 3QXGA 4XPIB 4Z0PA 1N2XA 1E5TA 1JN0A 1M83A 2IYSA 2QTRA 3KZOA 1G6Q1 4J0EA 4N5NA 4PFSA 5JAPA 2CT8A 3PHIA 3WYNA 4G3XA 3CJQA 1M6EX 3RVKA 3E3AA 4YQFA 4MP8A 4L6AA 2C3OA 1E2NA 5ENDA 3LM8A 4QBGB 2RGAA 3B1VA 3WV5A 1QG2A 1A9OA 1ORDA 2BZSA 4X6UA 1TU4A 1AKMA 1M75A 1A4RA 1CJCA 2XDQA 3N3AC 1TKCA 2PSEA 4DIFA 1XZEA 1Q22A 1XDDA 2B8JA 2PX8A 4LGVA 2X23A 5LBUA 2ZIXA 1EEXB 2OVFA 2QTWB 2QYOA 3BHMA 2YV3A 4JZYA 1KL7A 1YOVA 5BQ5A 4HOYA 3OJCA 3NKLA 1W87A 4AIIA 1JA1A 3DT9A 3PGLA 1F8UA 1L8LA 1WCV1 2E6KA 3IAM6 3K5HA 4YRMA 1TUBB 3LDFA 4WXHA 5M2QA 1O7JA 1EDBA 1FNSA 3N28A 4XWYA 2REBA 1XJQA 1U02A 2VJAA 1ZMBA 3O9VA 4JUFA 1QG6A 4PAQA 4Y6SA 1EFAA 1SCUA 2FTKE 2OBXA 4RKRA 1AZSC 1WRBA 2PCLA 2V5VA 4MYUA 1V35A 4R2XA 3RREA 2YKGA 2ZYIA 2LCQA 1GA4A 1CK4A 4YVFA 1R0XA 2I1WA 2WOOA 4F5YA 3G9QA 4QBHA 2FWNA 4Q7LA 5BYBA 1BGXT 4TT3A 4NEHB 1V8ZA 5B3LA 3WFIA 1E3QA 1IJBA 3RJMA 3UBTA 1XWIA 5CM9C 1H9AA 3P9IA 3K0BA 1C7JA 2PZJA 3AHJA 4KQWA 4MRVA 5DTIA 4II7A 5ECWA 3TLZA 1QM5A 4Z4EA 2XXAB 3K5WA 2Y1OA 5H5JA 2AN3A 1NLMA 5JCOC 4U4AA 1HV8A 3V7NA 2JB9A 5DMXA 2PUFA 1KK0A 1J0AA 3QZUA 4B5LA 3QFCA 4HAYA 4MKIA 1R6VA 3MGGA 5CT5A 4ENRA 3PDJA 3LP5A 4Q1EA 1N0UA 3D31A 4GPBA 4LJSA 1CY7A 5LZ9A 4IX9A 1OYOA 4CODB 4RCYA 3N2KB 1P81A 4F3CA 9LDTA 5JSUA 4GLBA 1YE3A 2O20A 3U3XA 3LOQA 5HKLA 3LLCA 2ZUWA 3DTVA 3FPKA 4NZYA 3RAJA 4TYNA 4AXXA 5P21A 2YVUA 1EHIA 4H59A 4G5XA 4A73A 3I34X 3AMVA 1II0A 1NXWA 3WYBA 3E3NA 4NV0A 3WLAA 4ZYUA 4G26A 1R0BA 3HO8A 3LRXA 1Q1BA 2HMAA 5TXGA 2HLHA 2L2QA 4LX8A 2EL7A 3HB9A 1KIFA 1YDFA 3B3GA 3BFXA 3HYNA 2KW5A 1JIKA 1CV2A 2J9XB 1D1TA 2NZVG 5HXAA 1XNRB 5CPBA 4PO9A 4J75A 4I9NA 1CNFA 4YJ2F 4PLHA 1GYRA 1JXOA 2O0LA 2G08A 4CTKA 1Y6ZA 2IHUA 3B7PA 5JJKA 3RS9A 4RVFA 3MNFA 5SZIA 4AMVA 1NF8A 3LCJA 4FW8A 3H5AA 3H42B 4QODA 1EXVA 4F1WA 3KC2A 4M9RA 2R8BA 3CIOA 4B8ZA 3FKSA 8LDHA 5EXPA 3GN1A 4IXDA 5D85A 3ZXSA 3C45A 3QI2A 4D0NA 1P60A 1TKAA 4KXQA 1MVOA 1ODJA 4F2GA 4ND8A 4WKBA 4BVHA 4PXSA 5CLHA 4U7PB 4Q3EA 1S3SA 1KYYA 5FLKA 2J3KA 3OX3A 1SC1A 4XFDA 3RTBA 4B7AA 3FYHA 3LGAA 3OECA 5EP4A 3ESYA 1YZGA 5KJ1A 1Y42X 1E8MA 3A0RB 3S2FA 4BKMA 5MN5A 3GDFA 4TMFA 2IDKA 3TK1A 4BO6A 1AZLA 1T8UA 4YJ2B 3SK0A 4QPDA 2JJ8A 3W7BA 4G2NA 1Q91A 1ST3A 1VRCA 4QHTA 4HLNA 4CR6A 4AG5A 4B7UA 4HDNA 1EB9A 1U0JA 3CNEA 4A8TA 2H2GA 2JAQA 3DAPA 4NEGA 2Z6UA 3I6ZA 5BSGA 4BO1A 1OBFO 1UOEA 2YJTD 3WL7A 4BJHB 4BV8A 4EG3A 2W6JD 3SHOA 3I4FA 1UH5A 4LJ8A 4QDKA 1IHUA 4D1YA 4MWEA 5EWJB 4WOJA 2VP5A 1BAPA 4QYTA 3K1JA 4MLPA 4FBMA 1WSBA 1KO7A 2W0MA 1SBHA 1U5CA 3ED5A 4MKFA 4MYRA 2XKBA 4RE6A 1JJIA 1FS6A 3FKQA 2Y9PB 5CT9A 1V25A 3IVMA 4RHUA 2RMKA 1SRQA 2X13A 2C54A 2RH5A 2EFJA 3Q0EA 2VP6A 3EVCA 4ZJUA 5C8ZA 5JANA 2OT3B 3CE6A 4KB5A 4PX2A 4QM7A 1SXJA 3QKIA 1G3MA 2I9KA 4PAWA 4ZT2A 2L42A 4AKSA 3SPXA 4NU6A 1N3BA 3H2BA 5FCDA 3Q12A 5L6MB 5A3VA 3VC2A 4PYKA 1X77A 1A9ZA 1FMJA 5FP0A 2CMHA 4X8LA 4B44A 3E48A 4RCZA 5EQTA 5I3CA 1UXIA 1YRLA 4P4LA 2YV2A 4GECA 1SCIA 2ZRDA 4HEHA 2FFQA 1Y5IA 1MW9X 4WH0A 4X1KA 1O8CA 2HPZA 1JSCA 2JFNA 3DBLB 4WGGA 2R84A 3A25A 2J7KA 5C7YA 2O07A 2BUCA 4I14A 4RPHA 4QTTB 4RHCA 2JZNA 2FKNA 3ZHVA 4I3GA 4NK5A 2F8TA 5A5DA 2BR4A 3GT0A 3AFGA 2H2IA 2FUCA 2NU9B 1YB7A 1C9KA 5TNXA 4MHOA 1BE1A 2E49A 4RX1A 3FNIA 2ECQA 3PIIA 2PBFA 2EJUA 5K99A 4DR5B 4KPFC 4N7BA 4ZCLA 2DUMA 3MB5A 3EHEA 1SB8A 1GAJA 3DNPA 4XYMA 4K8RB 4N48A 3OFSA 4FS3A 3KS9A 4N6OA 4OGGA 3X1YA 4HQ0A 4HWTA 4WKOA 5ENZA 4AZVA 5DNVA 1OGJA 2GH1A 1BU5A 3A6PC 4FFVA 5AKLA 4V24A 1NUTA 1U7TA 1ZN8A 1S0UA 3MBOA 4KLNA 1RIIA 2H00A 3GUUA 4NZOA 4AJJA 5HP4A 3BMQA 5DYIA 2GAFA 1EU1A 4DCJA 1UMDB 5DSZA 1CBUA 1GQSA 1I3MA 2OOKA 3VZPA 2WG2A 2RFLA 1AKVA 4RHXA 3G9UA 4C6HA 4O1MA 4QXPA 2B6NA 4UAJA 1L5NA 2EKBA 4YRAA 1S8NA 4MIKA 3R23A 4Q4AB 1RE0A 2BZGA 2XRFA 1A7UA 1EWKA 3CMCO 2J41A 3EARA 3IBCA 4U6QA 3FSGA 4B3XA 1VSUA 1HLFA 4WERA 5I8ZA 1W5AA 4JXJA 1J8QA 3KJZA 1FX0B 1F1BA 1B41A 1VMAA 3LTEA 1TGYA 1ZI6A 1Q21A 1JIIA 2D7CA 2GAJA 4OXIA 3EZGA 4X84A 4M0LA 3D43A 3KYCB 3PEVA 4AO8A 4LVUA 2EKLA 3GJ3A 1EX9A 5COQA 3RKUA 3ANLA 3LQQA 3I12A 3WQHA 1W2WB 1ISIA 1SVNA 3TL2A 4D80A 2QYHA 2EHJA 3NONA 2FPPA 3ESZA 2Z2IA 5AP9A 5C4MA 1EMDA 4NOMA 1F0PA 2G88A 4CXMA 3HFJA 3ESQA 2WP0A 4DLYA 3T95A 1OB5A 3FW1A 4W9MC 2Q4BA 1GZ5A 1ODIA 3OMLA 5TQVA 4X7MA 1DCKA 5BXYA 3QJYA 1Z5VA 3HGQA 1AQLA 3ELWA 3IQHX 3SD7A 5IHXA 1TRKA 1VXRA 2FHPA 5BY2A 1I2CA 1GLVA 3LFUA 2QJTA 4JBNA 3O03A 3TEJA 1QH8B 3RIXA 3W5JA 4KWCA 2WWIA 2P0AA 4FS8A 4UW9A 5D00A 3ZQKA 4BNUA 2QE7A 2PV0A 3K94A 1MUUA 5AKXA 4BASA 5KZMB 3OY2A 1KRWA 1DBVO 3C6XA 2VWQA 4BMNA 3WO1A 1AHPA 2JBHA 3ZOZA 3LKBA 4M1WA 4W8GA 2VNJA 1M5RA 3EFBA 4WA7A 3EXFA 5LUAA 4F9GA 4H17A 2Y6UA 1KAHA 4CM6A 5B5SA 1GU0A 1XRLA 2J9GA 1XTRA 3CSUA 3L5OA 4GM1A 4Q00A 1Z26A 2JKZA 3C3JA 1VCHA 5AHXA 3QBEA 3WSWA 2IHNA 5I9LA 4XM0A 1VHTA 4M3NA 1RXIA 2MSKA 1VG8A 5H8WA 1BCRA 3EOAI 1NP7A 3N8KA 5IM5A 2J5RA 3A58B 3BPSA 3OCUA 2JPDA 4F38A 2P6PA 5ITVA 1WA5A 3O82A 1A5AB 2BV3A 2SCUB 2Y1XA 1I3NA 1O6ZA 5BSTA 4EJ2A 1I7DA 1RHRA 1V2HE 4GR5A 2GJKA 5DHTA 1OX4B 1Y4DE 1JR2A 1PT8A 4LC1A 2KM1A 3TO5A 3ZBQA 2F3QA 4CLEA 1I1NA 2W22A 4RC9A 2C2MA 3T3EA 4TT8A 4QWWA 4IWXA 2DQSA 3OQIA 3P7MA 1HORA 3GLQA 4UTXA 4KMSA 2JVKA 3FM9A 3MJHA 3LCRA 1RU3A 4FLFA 2ZSIA 1O9HA 3BKWA 4N65A 2BFDA 6PFKA 5KYXA 1HYHA 1S7GA 3I04M 4NYJQ 3ZCTA 4MX8A 3D4PA 4Y7DA 2ZB4A 3ZGOA 2EARA 1E5LA 2NWQA 2F64A 3RHZA 4CE6A 4D4KA 1WKCA 5DX0A 1CYEA 1E69A 4L8FA 3L01A 3TSAA 3MAGA 2P3LA 4UDOA 5FWYB 3TW4A 4WOBA 5F1KA 4E31A 1A9TA 3OC0A 1YB2A 2IDJA 4C5CA 3UFXB 3B8EA 1PVDA 3L7DA 3PFNA 1UBCA 1XCMA 3UQYS 3QQPA 1SK9A 5ADWA 5FOXA 3PNBA 4IO1A 3VR4H 4DBZA 3IBSA 3NIWA 2QL6A 1BGVA 4H6PA 2JGNA 5DW0A 3W05A 3WGNA 5T57A 4GVXA 2BHRA 5IBRA 1XRQA 4IV5A 2DU8A 4TL9A 2H1SA 2QXUA 1J9GA 2YJ5A 4WY5A 2ZB2A 3Q85A 1Y3DE 3BWBA 4F9TA 3R6GA 3MIIA 4I8XA 1DIOB 2OB1A 4UD2A 4B48A 1T9AA 2P67A 4L7VA 3VSCA 3RG2A 2JFWA 5INTA 2GZ1A 1SC3A 4RVUA 2ZOSA 3OZRA 2OCLA 1JR3E 3AT1A 1MA3A 1T9CA 1EGVB 4FDAA 1D2HA 2R00C 3NKFA 2IY8A 3MFQA 4HB2A 3OTQA 2Q7OE 1ZKMA 3QVLA 1QORA 2G5PA 1SY7A 2ZROA 1VDZA 4HSEA 4PLVA 4QUGA 1K08A 4U8HA 4X94A 5CXUA 1H3EA 2GBIA 2I80A 1D6MA 4Q1CA 4X41A 2ZVDA 3V2GA 4RKQA 3KR2A 4LTNA 5JD4A 2IBMA 2PMBA 3WLFA 4FGUA 4CLDA 2OHVA 2Y92A 3O8BA 5EEHA 5CD1A 4WNCA 1PFYA 3NANA 5CVDA 5ARCA 3S2YA 2PUBA 3NG1A 3WFJA 2QZSA 4D3XA 5F1YA 1GNVA 3K9WA 4INZA 2PKRA 2GAAA 5ALOA 2XRMA 2Q5FA 3CJTA 5GJWC 4D92A 2PKWA 4J1QA 2HZ7A 3M4NA 3UK0A 3LAWA 4UU1A 1WVMA 4RS3A 3THXA 2EYUA 4B3TB 2P68A 3NFRA 4H18A 3UMFA 1JIXA 2LUOA 3IJEB 2EX1A 3GD5A 3GV0A 2NUPB 4EI7A 3L3BA 4B33A 4V0RA 1RABA 4MNTA 2E4UA 7YASA 1SNYA 3UW1A 4BZZA 4I8IA 1IOVA 3WAKA 8MHTA 1MDFA 3UYLA 1D6JA 1HUQA 4FVTA 5FUBA 4DA8A 5BR8B 2WJAA 5LKAA 2XKKA 1GG9A 1ULUA 2VJDA 3UYKA 1XWWA 2MSDB 3DKRA 4AY4A 1RXYA 4PAOA 3OLCX 3N5KA 3QEJA 3PU6A 1NHGA 3FCEA 4Q93A 2Z56A 1B1AA 1IBKB 4MV8A 4UM7A 1MHPA 4CQLA 5J5CA 2RKWA 4QAQA 3A1DA 3IJPA 1GXSA 1VDMA 4J3NA 3ROQA 3D3NA 5DGHA 1V1MB 2NU7B 2VZLA 3KQQA 4JVMA 4QGBA 3LVQE 2W11A 3ZUGA 4CW7A 2AJTA 2O52A 5L51A 1AV7A 3EC7A 1UKYA 4DBVO 1XD9A 4WEOA 3PICA 1TJYA 2R48A 3H1BA 1YFLA 5MHTA 3T5AA 1DQZA 1E7MA 1SB9A 5KNBA 3ILYA 2OR3A 2XA2A 3CRW1 4EJ0A 1YMUA 2WTXA 1IAQA 3ED1A 3OA2A 4M0UA 3AI1A 1ZMRA 2W4QA 2YWFA 4HVTA 1M8JA 1G7CA 4MV9A 5FT9A 3AESA 1ZHFA 1SIOA 4E5SA 3ZN2A 1UEIA 2MYPA 4IBOA 4LJAA 4G2TA 4XM2A 2LVBA 4Y9TA 3ZD9A 3CSSA 1QPZA 1SRRA 4I2NA 5G0TA 4EUKA 2F3UA 1BYUA 1GGKA 5F5XA 1R6TA 3EG9A 4LXQA 1T25A 4UFPA 2E5LB 1TDJA 4ENUA 4G4GA 4OYYA 2RSLA 4MUYA 1G8AA 2FQ1A 2P3QA 2VKTA 1FNBA 3AEKB 2IH4A 1YRWA 5L4NA 3U1VA 2WIAA 5AIAA 1EFKA 4BX8A 1E2IA 2C96A 4S1OA 4BTLA 4DGQA 2F8MA 2DFLA 1CUZA 3C15C 3IRUA 3KLMX 3WBKA 5JPDA 1SXJE 2PH7A 5FYDA 2B4RO 3LSYA 3ASVA 3GRVA 1DFGA 1JLRA 2Q6TA 2WJ6A 3J81k 2B9EA 1BXRB 1NQXA 3UPUA 2Y3IA 4WK0B 2B3TA 3Q3EA 1MBZA 2AV6A 4LWPA 2QT0A 5JNRA 4LPSA 5DGIA 1BCSB 2ZQ5A 3CT4A 1NYTA 1KZGB 1IHPA 2AGVA 4IJUA 4IIVA 4LZAA 4RLSA 4FYVA 1S1MA 2JEOA 2JK0A 4ZVNA 3P0EA 5EL0A 3KETA 3GLRA 4GLOA 4ODIA 3O6VA 1HL3A 1SA0A 1BA3A 1GV1A 2OKGA 3IGFA 1FVFA 3LBAA 3ZNNA 1H1LA 3O38A 3ZUPA 4FCWA 4KQIA 1IN5A 3GYGA 3EZXA 4ZEMA 3RDPA 3FYTA 3GFPA 1DIBA 3HWRA 1T8RA 1ZIOA 4MW7A 5E38A 5IVKA 2XMPA 4K87A 1UAAA 1RJWA 1BFKA 3G23A 4ZU1X 4JUCA 2ECOA 4BB5A 3ZZNA 2QYSA 4YXWD 3VO8A 3WYAA 3ZWNA 1HWYA 2X5NA 1D1PA 3H1AA 3PWTA 4Y6PA 3GEGA 5E4FA 2OOSA 5TF4A 3UMYA 1VJ0A 2NZUG 4I1SA 1P4RA 1XZMA 2V0GA 4PC6A 2AX3A 3G0DA 1A5SB 2AJ8A 3CISA 3O3OB 4GXNA 2JFGA 1SKUA 4EEXA 5B1YA 1CUGA 1E5DA 4BRUA 2QP4A 1RLOA 2DF8A 1ZM4A 2JC3A 2XZLA 3ISTA 2HNAA 2GBCA 1LWNA 2I87A 4UCQA 1K8RA 2CXPA 3JWEA 5CIYA 1ANKA 3VBEA 4FYXA 5BN3B 1PDOA 4AMZA 3VRHA 2FPLA 2PZFA 3C4JA 3BWDD 2IIVA 3OZVA 1WUIS 4U39A 2HXGA 2J45A 4ZEOA 1JH9A 3C3WA 3QBTA 1ZCAA 1L5LA 3NTRA 3ICEA 4TZ6A 1ZPDA 2MOKA 4WDQA 5BR7A 3JRWA 2HU7A 3PNLA 1TJPB 2DQZA 4P35A 2ZSHA 3NU1A 5CCXA 1KKUA 4DV1B 3KZCA 4BQIA 1C9EA 3NTUA 3M6FA 3PTZA 3BXEA 1N2HA 3VTZA 3AHHA 2JL1A 5DLEA 1E2FA 4GC9A 1I2AA 4IXNA 4RFVA 2DWQA 1GZSA 3HL0A 1VL0A 1M2JA 4GFDA 4M8KA 4TLLB 4W63A 1G5QA 4I55F 3WK4A 1X1DA 3DUFB 3EXG1 3KYJB 3MTQA 4TKVA 5A4DA 2CV2A 1FQJA 1ISRA 1GGFA 4MYSA 4U2EA 3WMGA 2AJDA 1G66A 1Q1EA 2HQBA 4MDEA 1TLLA 1V43A 4G63A 1WIWA 2P6RA 4NCAA 3OT1A 2OSVA 5IF3A 3TMKA 3KYDA 3G8CA 3RFTA 4ZYLA 3N39C 5IXYA 2C7VA 5JWOA 4L8YA 3RVQA 1FLNA 1SIBE 2J6BA 2J9FA 2QRHA 2Y1WA 3D8UA 3VGJA 1JSRA 4E3WA 3KZ1E 1H2EA 4YPOA 3V4ZA 4HZIA 3I0ZA 1XRNA 2Q7XA 4RQAA 5E1DA 1JAZA 1F2TA 3ASUA 1XNQB 1GG5A 4RABA 2CVHA 1NIPA 1M1UA 2OHOA 3T5BA 3MXTA 1HETA 3SZ3A 2YMMA 3A1CA 2G9NA 1BQEA 5IJ0B 4YREA 3ZQJA 4IILA 1EBBA 4R0MA 1EXDA 3VO2A 2XMZA 4JLJA 5FTLA 4FC7A 3B20A 4KE7A 2I99A 3KHSA 3ESDA 2W93A 4OFBA 5H59A 3O4VA 3QELB 2C4MA 3QVGB 3QU7A 4K9QA 3STUA 4YCMA 4JLVA 4EJFA 5AH0A 1OC4A 1M2VA 3MQFA 4PR3A 4MA4A 5IHPA 4ENWA 3P0RA 2QG6A 1ONPA 2XWJI 3ORQA 3WK8A 3KAKA 1IZ0A 2SECE 2Y1GA 4HT3B 2QVCA 2AB0A 3NDPA 4CM1A 4JBXA 1N5JA 1RCFA 1SU7A 1XMSA 3AL2A 4EHBA 2C77A 1D4ZA 3BMXA 4KWHA 2PKCA 1DAHA 1K5PA 2ILTA 2YXBA 4OATA 3TQQA 1T0JB 2HJWA 3S40A 3AQ4A 5ARBA 3PIRA 1T34A 3VQTA 2VQSA 2FSUA 4PZPA 5AVKA 3RS4A 3Q8LA 1RC8A 2QD2A 5AO9A 4YBRA 3GCGA 1ZRNA 3DFZA 1PR5A 3VHLB 4MW6A 4BP3A 4D9BA 3AW9A 3TMAA 3V00A 5E6SA 1VOTA 2VDRB 1E1LA 1JQJC 3JTMA 3QNWA 4XD2A 2BM1A 3A1VA 3KHUA 4C08A 4XZ3A 1XXHB 1UOPA 4HD8A 2AR7A 3OWOA 3S1AA 3VUFA 4DB2A 2B4AA 4G1EB 1JALA 2IEBA 3ICWA 2ZE5A 5FWXB 1OZHA 2IV2X 4DABA 4PX3A 5AVTA 5EA2A 4C7VA 3C85A 1ZIXA 4HZGA 3FTEA 1QE5A 2GZDA 1E0KA 1E6LA 2VYVD 5C2JB 1GTJ1 4IG4A 1H05A 3LCMA 4Y2XA 1S02A 3SFZA 2W9XA 2WWRA 1P29A 2AN1A 5EY5B 3V48A 2V54A 4JNKA 5E4JA 3MMNA 2QE6A 4NBLA 3FLAA 2GCOA 3IQIX 5AUQA 5EJ8A 4W7IA 5BRJA 2AG5A 3ITEA 2VJKA 4BNFA 3JQ6A 5KVQA 4DOMA 3KR0A 1A2BA 2QMYA 2GD6A 1H8HD 4TSRA 1FDUA 3JAWA 3V42A 1G38A 1E3JA 3IAM1 2XUPA 3QF4B 2Q0SA 5K1ZA 2XIQA 4KPGA 3VPSA 3TF5A 1EK1A 3T35A 2YVLA 5J43A 3UKJA 3NGMA 3Q6MA 1T6ZA 3V1YA 2PNFA 1DJOA 3RVJA 4OVKA 4RTQA 3F6PA 4ND6A 4BX9A 3RS5A 1GRQA 1U8UA 1YMVA 3DMYA 3D7LA 3L7YA 3DBIA 1Z8DA 3BEDA 1ZUD1 1G7SA 3DO8A 2GSDA 3JYHA 5EZYF 1XRSB 2Q5CA 3WP1B 3BE6A 2ZTHA 4DAEA 2CV0A 1WSAA 3GZJA 5KDOA 2ZI9A 5CA0A 2PTGA 3SS9X 4DIBA 4KGDA 4Z1MD 1HY3A 1YZLA 1GZVA 3LGSA 4O4HF 4QUDA 4BU1A 4D45A 3OQ1A 5I7HA 3OM0A 4GQAA 1SG9A 2FW8A 2WFLA 2G63A 4I5GA 5CH5A 3RARA 3PT9A 2ZI5A 3CTMA 1JMKC 3DAOA 4GXRA 1OV4A 5KJCA 4XYLA 5TQ0A 1R0LA 4G4IA 4RF2A 1IYZA 4MV4A 1CXZA 1GILA 1S5PA 2VYQA 2PR2A 3GBPA 3IMKA 3WI7A 2VRCA 4EO9A 3CZ5A 4G65A 4QT4A 4QXMA 2NXNA 4GMXA 4G5FA 2PWAA 2G1AA 4R5HA 4V2IA 1KSJA 1R88A 4LDRA 3C7KA 1BEZA 3T52A 1YBMA 1KFCB 1VKOA 3R09A 3T0GA 1E59A 4Y1RA 2WF6A 8GPBA 5KINB 2UVDA 3HJCA 5I9BA 4KHPB 2QX8A 5K0ZA 2GTPA 9ATCA 2J3HA 2GXSA 1OAOC 1MTZA 5FWNA 3AP1A 1GIAA 2DHQA 3DMNA 4RE5A 2IUUA 2R5FA 5IUNC 1FDIA 4LJKA 1WXQA 3BAZA 2ZU0C 3EFEA 3K35A 4L07A 3S2GA 3PUHA 3WLQA 1HPLA 3HN2A 4Z49A 2YJ4A 4BMZA 1RBQA 5FHQA 4AICA 3MMZA 3HCAA 1KMHA 4TTSA 4OJQA 2D2IA 2H4XA 2WJWA 5J4LA 3KE9A 3C7AA 4BFLA 1W85B 3SQDA 5D87A 1USUA 3HR8A 2WKQA 3VU9A 1SCNE 3U4QB 2G0NA 2OXFA 3URKA 2PZKA 2ZYSA 3M6AA 3UGJA 1TJ3A 5E4TA 2V74B 1EIWA 2R9VA 3JQAA 4WKGA 1BOOA 1Y3BE 1T8SA 4B6FA 2ANBA 3WLKX 2GMWA 1K88A 1U2GA 1WXEA 5CGZA 3ND6A 1AIPA 4PGFA 3OZFA 4QU0A 5EINA 4U6NA 4LCBA 3B85A 4JJ4A 1T6YA 3GVHA 3GMTA 2EKQA 2GK6A 3ZVMA 3QXXA 5E1OA 4ZQIA 3ORFA 1V1RA 3TTXA 3ZEIA 5TGTA 2CB0A 2ZJBA 4PC1A 4BNVA 3IOYA 3KPUA 1RI4A 1YBFA 2P5TB 2ZWPA 3I32A 3NBMA 1A50B 1HURA 4QUBA 4HADA 1FYEA 7ABPA 1SBTA 1MT3A 1SVUA 1ZSYA 2CD9A 2JFUA 2F3RA 3D6JA 1XHLA 4AD8A 3HNOA 1UFRA 2CL5A 2CLEB 3CUVA 2HNBA 1JKIA 5DIZA 3C3BA 2FN3A 1JYSA 5ALWA 2G09A 2G82A 5E6RB 3DLTA 1T2AA 2VOEA 2XUIA 1RQNA 5DHRA 3II6X 1CCWA 1GUZA 1QRUA 1R4NA 3FUCA 2C8VA 4TMKA 1C3OA 1K97A 3IE2A 2Q50A 3FD8A 1XC7A 1CQWA 4FYPA 2WYIA 2R3SA 2ORWA 4FFBB 4MRPA 1NZFA 1KO5A 1G6KA 5CG1A 4O3MA 2H52A 3NASA 3AXSA 1KDVA 2AYZA 1KEPA 2CLSA 1RS0A 4QOEA 1TMGE 4E12A 2OY0A 4U9IS 1KRXA 3JQGB 1AN0A 2WTAA 2W70A 1SCJA 4MIEA 3GLFB 4DREA 3WGGA 2G06A 1LY1A 2CNLA 2Z4SA 1TRHA 3RADC 1QYRA 1Z8FA 2AX4A 1Q6YA 2CD7A 4BBZA 1U0HC 1Q0PA 4Q3CA 2FXIA 1SIWA 2NT4A 1Q7RA 3L4BC 4X1IA 4KN6A 1X8JA 3ZE2B 4BC0A 1A8IA 4PO1A 3K72B 1LRLA 4G5YA 4M49A 1VKNA 2OORA 5B58T 4D25A 1AUPA 1C1DA 4G0NA 1KZ6A 1SVOA 1AGRA 3ES9A 4BPBA 2FR1A 1E92A 3QUSA 3PDWA 1V5GA 3QXCA 4Y2PA 3PQEA 4C0WA 2WB4A 5A05A 2D4HA 4YCNA 4NYJR 2BGKA 4FPXA 4ZANA 4LF6B 2EZ8A 4E21A 1T4CA 2EEPA 3M2PA 1NZJA 3EC1A 2QNBA 1NMZA 1J2YA 1VM6A 3B9BA 4M6WA 4RZXA 4X66B 5HKOA 2F3PA 4DKJA 4DRZA 1NU6A 2CYAA 3UPDA 3ZLBA 4PIMA 3FOZA 3MJFA 1QUFA 4NS4A 1XG5A 4YWJA 2AC2A 2J33A 5BSUA 2R2GA 2FH5B 1KDTA 1U7HA 3BWYA 4TXMA 2NUAB 4P9NA 1HDZA 3BH6A 1KVRA 4D46A 1N5IA 2V58A 1JT9A 1NW6A 3G9TA 1BFDA 2ZTUA 1K8YB 3MRSA 4OJTA 3IEXA 3ZXIA 2FXVA 2X0FA 1NR5A 3EPRA 1M8GA 3D6HA 3WAJA 1GITA 1FSGA 4K6KA 2ZS8A 4J0DA 3KVRA 3NKVA 1EQUA 3ENQA 3VHXB 2R4TA 2PUDA 1SUSA 1LSOA 3R8XA 5JWRA 5AVXA 1TECE 1R8SA 1PR6A 3L0PA 2JGIA 3KX2A 4PZLA 2ET6A 2GERA 1GVNB 3GD7A 1ZNZA 2GZ2A 3SDZA 1TM5E 4ADSG 1GKUB 3EDQA 3L77A 1KOGA 1RTKA 3N75A 1YS7A 4D0LB 2X5JO 1FJHA 2VWPA 1WZIA 3OE1A 2UZ3A 3CTPA 2O5CA 4F5DA 3D4IA 1O4WA 4MUMA 4L15A 1HQDA 3O90A 3QKUA 5C7OO 1JNYA 1RKVA 3C8UA 4NE2A 1H0HA 4ZJPA 3EJWA 4LGCA 4EVRA 1VZ2A 4OK3A 4RO0A 2G07A 3DSRA 1MC1A 1W9HA 3I0MA 1RI5A 1ZX1A 4MQUA 2DY1A 3H5TA 1RACA 1QIHA 4C0AC 1JGTA 2BFNA 2WABA 3H8SA