4KRXA

Structure of aes from e. coli
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
316
structure length
316
Chain Sequence
ENKLPVLDLISAEMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl esterase
publication title Structural and mutational analyses of Aes, an inhibitor of MalT in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 126
structure length 316
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.1.1.-:
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4krxA00
4B9EA 1EXWA 1K6EA 3FOBA 4U2CA 3G0BA 1PFQA 3I2IA 3IULA 5DNUA 1WOMA 2XMCA 5A71A 3HC7A 1VXOA 3O4IA 3B5EA 1AKNA 1YAJA 1UOOA 1OCEA 3GBSA 3HJUA 5I7UA 1T4MA 3PF9A 5JYCA 4MQLA 3RM3A 3FYUC 2QS9A 3EIOA 1QIKA 2HA5A 2WSLA 3LLCA 3G9TA 1GZ7A 1XZBA 3ESBA 2Z8XA 4UBNA 1MNAA 4PF1A 3C43A 3CN7A 4UHHA 4OU5A 3R3XA 4EY5A 5A2GA 2V98A 5BOVA 2RGUA 4Q3KA 5E4TA 4H7FA 4H7KA 1H2XA 1XLWA 1EB9A 4OYLA 3BIWA 1XQWA 4ZGBA 4EB0A 1VA4A 3QH4A 1CUIA 2DFPA 1X70A 3C70A 4I3FA 3PFBA 4UHCA 5AP9A 2XMRA 5LZ5A 3KWJA 4X95A 5LLSA 1XRLA 2RIPA 5LIPA 1N8SA 4XX1A 4U2BA 1LBTA 2CMFA 4B0OA 4L72A 1Y7HA 3WKAA 4S0XA 1WHTA 4NZZA 3AIKA 5YASA 4YPVA 3EQ9A 3DKRA 2HA3A 2GBIA 3KD2A 3RARA 2XDWA 2PKYX 2Z8ZA 5JADA 4UUQA 1ODTC 4H0CA 1HPLA 1CUXA 3V1NA 1QFMA 1J2EA 2WHPA 4H7JA 5D6OA 3NUZA 2ACEA 1WPRA 4UFPA 2QXTA 4Y2JA 3QPAA 4PNZA 4FLFA 2JEZA 1XKLA 2VJBA 3IVMA 1MN6A 1N5MA 5CW2A 3M3DA 5EIEA 5ALXA 5ALRA 3DYVA 1TIBA 2WU3A 5K3AA 4AO6A 3WYNA 4XIIA 2WIGA 1MPXA 4W1SA 1QO9A 4U2FA 1CUEA 4FLEA 3VVMA 5JARA 1CUAA 4BBZA 1L7RA 3PDCA 1YB6A 3BXPA 3ESCA 3QPDA 4KAFA 3C6XA 1VE6A 1SC9A 1ZGBA 5DNVA 1SFRA 4X3CA 2VEOA 4FBMA 4H77A 5AM1A 2AJDA 3GFFA 3WMRA 3D59A 4QE3A 3DNMA 1J07A 1GKLA 3LCRA 2QVBA 1TCAA 1XQYA 3O9VA 5ALFA 1ZICA 4HRXA 3FVRA 4N5IX 4J0KA 4M0EA 3KWFA 1GPNA 2XQIA 3AUKA 2PU7A 5AI8A 1BRTA 2VA9A 3PICA 5HK9A 5HF9A 4JEIA 3OM8A 5SYNA 4Y2YA 4DSZA 5AOCA 2GBGA 3VJKA 4E15A 4BCCA 7YASA 5HF5A 1LLFA 4A5SA 1MO2A 3NGMA 3L1JA 2WFMA 5JD4A 3IUQA 4FNMA 4YASA 1F8UA 2DR0A 4EA6A 3I2JA 1BS9A 1WB4A 5ALIA 4BP8A 1GPKA 2XUQA 1XRPA 2HL6A 3BE8A 1R1DA 3G9XA 5AM5A 1QIIA 4O08A 2BKLA 2CBGA 4FLMA 4LXIA 5CRIA 3WKDA 5FDFA 2Y2UA 5LZ8A 3G02A 2XUIA 1GPLA 1AMNA 1QIEA 2IIVA 4XVCA 3T52A 2YXPX 2C7BA 5DYWA 4E46A 2H7YA 1BCRA 3DEAA 4Q3OA 2WIKA 1XZLA 4PSDA 1KEZA 2G5TA 1FJ2A 3H2JA 3R3ZA 3C6BA 4GBGA 5JAPA 4KEAA 3G8YA 4Y2UA 4Q34A 2YYSA 2QJRA 4QLAA 1GGVA 2BJHA 3NOXA 3OG9A 4BP9A 4Y2VA 2VATA 3L1HA 1KU0A 4F60A 2H7CA 1CUJA 2DCMA 2C5FA 4B7ZA 1G42A 3STUA 2QT9A 4JYMA 1EINA 2AJLI 3DOIA 5KBYA 3FNBA 1M33A 5ALLA 3Q8WA 3BJRA 2PPLA 4P9NA 5K3BA 3BDIA 3W9UA 4NS4A 3PUIA 1EX9A 5K5EA 3DQZA 2X8BA 3LIIA 4Q82A 1DQYA 3OURA 1YB7A 1WB6A 3B3QA 4DMKA 4FTWA 5JZ9A 1QO7A 2BCEA 4BVLA 4DNPA 3AFIA 2B20A 2DHDA 4J03A 2XQJA 2QZPA 3FVTA 2ZYHA 3R3UA 4G4JA 5C8ZA 2HDWA 4X85A 4HRYA 2C5GA 2PVSA 1XZAA 3TRDA 1NU8A 2RONA 1QIFA 1E66A 2OGTA 2WTNA 1I6WA 4GECA 1CUVA 4AX4A 5EHNA 1A8QA 5IKXA 4UBMA 4J0GA 3EQ8A 5EHQA 4ZRDA 4W1PA 1BN6A 5AM0A 4X71A 3K2IA 4G8DA 1UOQA 3R3VA 3BWXA 2CEKA 2GYVA 2YASA 5AI4A 3VISA 5CT9A 1XLVA 4RE5A 5HQ3A 5DTJA 4IH9A 1BEEA 1QIJA 3WKEA 1TCCA 1UKAA 3HI4A 1BROA 2O2IA 1EVQA 3K6KA 5FLKA 3WKBA 5HK8A 3WL6A 4PO3X 3ZWQA 1QONA 3WA6A 2VAVA 3VKFA 4QZVA 4B80A 3FYUA 1B6GA 3F67A 1QE3A 4FMPA 5ALUA 3W06A 3QVMA 5EIHA 5AIBA 4Q3LA 4K2AA 1SCIA 3WWOA 4X91A 4QA9A 3E1GA 2I3DA 1FFEA 2XQKA 4ARAA 2H9YA 2QRUA 3VJMA 4EY4A 3WK5A 1ISPA 3WL7A 1B41A 1LPOA 5LZ2A 3ZLTA 2FJPA 4MXDA 4PSCA 2J3DA 3WI7A 2G5PA 4QDOA 3FLBA 3E0XA 4L9AA 4WY8A 4DMFA 5JAOA 1VLQA 1UK6A 4RGYA 5AKIA 4P92A 4KR0A 2AJCA 3H17A 1ORWA 1XQXA 5AI5A 4C88A 5C8VA 2W6CX 5CH8A 4H7IA 3P2MA 1CUSA 1XRMA 2NW6A 2I78A 1SCKA 4F21A 2BUCA 5T4FA 3N2ZB 4I4CA 4GI1A 3V1LA 3OTQA 1R9NA 1G66A 1A7UA 4E11A 1BU8A 1QIMA 5KWJA 3AZQA 3WK9A 3YASA 2H7XA 4AO7A 1UK8A 1IUNA 4KE7A 2JGMA 2OAGA 4IO0A 4BVJA 1W52X 1Y7IA 2HFJA 1EK2A 4Y2RA 5LYYA 1VA5A 2CB9A 1GQRA 2VSQA 1F0PA 1O6GA 1A8SA 1XZFA 3H0CA 4EY8A 4YX9A 2OXEA 3HABA 1XROA 3WKCA 3G7NA 5HF6A 2O2GA 3U1TA 1UK7A 3C6ZA 2VT7A 3D4LA 3MUNA 4UBKA 5HZGA 5IVDA 1DX6A 4LIPD 4LYDA 5K3FA 2XLBA 4FHZA 4M0MA 3TEJA 4W1QA 4OB8A 3FSGA 2QXUA 4UFNA 1DWOA 2Y6UA 1CUFA 5LZ7A 1VZ2A 4J0DA 3R3WA 3WK6A 3DL4A 2OLEA 3E4DA 4C4YA 2RHTA 4BRZA 3PI6A 1WPXA 3S8YA 5AK6A 3C5VA 1GXSA 3WIBA 3WL8A 3ICWA 1BCSA 1QGED 1XZDA 4DLNA 5AJHA 1Z68A 4BAGA 1NX9A 1DX4A 2XUHA 4WJLA 2JEYA 1XZKA 3ANTA 5BWBA 4AB1A 1CR6A 1DINA 1QJ4A 3R0VA 1QIDA 2J4FA 4QDUA 2QUBA 1YS1X 3QBJA 1CUGA 4B81A 1ZJ4A 4WY5A 2WJ4A 4BVKA 4CCYA 1IUOA 4FOLA 4C01A 4ZXFA 3I28A 4QDTA 2LIPA 4G1FA 4JYPA 4FWBA 4B6GA 5F4ZA 5AI0A 3H2IA 5EI5A 2HHAA 1P0IA 4DNQA 2QTBA 4GDMA 3WZLA 2ORYA 1MU0A 5FV4A 1S8OA 5FXMA 2PM8A 3O0DA 3AIMA 3CCCA 2CJPA 2I03A 4FFWA 2PX6A 5ALHA 4U2GA 2Q0XA 5EIAA 4TVKA 1MTZA 2BAGA 4C4ZA 3BL8A 3HRHA 5CTAA 4WDQA 1EDEA 5CT8A 3WJ1A 4GLBA 1XRQA 2XUFA 2ZJFA 3B12A 3ZI7A 4AQDA 2XQGA 3BF7A 2WG1A 2XB6A 4X7BA 5AOBA 3H1AA 1DWQA 1CUHA 4FKBA 1EK1A 3H2KA 4Y2XA 2DQZA 5ALZA 3K9BA 1Q0RA 1ZD4A 3STYA 2HU5A 4EUSA 2XUAA 2YH2A 3O4GA 3HEAA 3L1IA 2R8BA 1QFSA 1IUPA 2O2HA 4J7AA 2QKYA 4V2IA 3I6YA 1CVLA 3QYJA 4TGLA 2VJDA 4G4GA 4OU4A 1K5PA 3BF8A 5IH7A 4JNCA 1THTA 1P0PA 4KRYA 3QM1A 1YS2X 4F0JA 1H2WA 2JGFA 2WHPB 2BUBA 3ANSA 1TKRA 4M0FA 5AKKA 2XUGA 4UHBA 2Z3WA 2I3ZA 3W2TA 5FRDA 2WJ3A 5JATA 3RLIA 1UK9A 3W05A 2XLCA 3H19A 1QTRA 2HA4A 3GELA 5AKYA 2WG0A 2HA2A 3DL7A 5K3CA 3ED1A 1X2BA 2OQVA 4X94A 1VXRA 4N5HX 4EBBA 1XLUA 5AKXA 2ONCA 1W6RA 3Q0TA 5A7FA 4IHAA 4CG3A 4CG1A 2OCLA 4UHEA 4RE6A 1K8QA 5J3JA 3ICVA 1CEXA 2WFLA 1Q83A 3LP5A 2ECFA 1EVEA 4JUIA 5CT6A 2HA6A 1G4HA 5DLPA 4W1RA 2OPHA 2BFNA 3STTA 1YASA 2V96A 3F9CA 3CCBA 4G9EA 4DM7A 2FX5A 2RHWA 4RNCA 2J4CA 4ETWA 3WLAA 1JJIA 4BDSA 5JAUA 3H1BA 3BIXA 4AN1A 5AOAA 5CH5A 5KREA 3V1KA 1Y37A 2V9ZA 2D0DA 1ACLA 1H2YA 2VF2A 4KYVA 3BDVA 4C6HA 1N5RA 2HA0A 4KRXA 4OB6A 3M82A 1Q0ZA 5CURA 5HFAA 4OB7A 3OPMA 1F0NA 1XZGA 2FUKA 1E8DA 2RAUA 2B4KA 2WFZA 3ZPXA 2JGLA 1FFDA 1CUCA 1XQVA 2BGNA 5D7BA 3HXKA 2WUFA 3AJAA 3NWOA 2OGSA 5EFZA 1ZD2P 1XZHA 3G0CA 5BV7A 3W04A 3D5EA 4ZV9A 4C89A 4ZWNA 5DNWA 3A2LA 1TQHA 4Y2TA 3M83A 1JKMA 1UZAA 3IBTA 4IH4A 3D0KA 1YSCA 3ZLUA 5AK5A 3G0GA 1N1MA 3H2GA 4UHFA 5D3ZA 2ZYSA 3F97A 3OOSA 5ALMA 5LKAA 2GYWA 4AMZA 4CIAA 4INZA 3VDXA 1EA5A 3DDUA 1EB8A 4KJXA 3C6YA 5C7YA 3PUHA 3O4JA 1DT3A 1LNSA 1W4LA 5ALOA 5IVKA 1JU3A 3G9ZA 3STWA 2XUKA 2J3QA 3UMJA 2ROQA 5ALQA 1VE7A 3D2CA 3H2HA 2WUGA 3EBLA 5CMLA 5CT4A 5AM3A 2CZQA 5CT5A 5C8XA 4BAUA 1WM1A 3IURA 4K5QA 3F96A 3WK4A 3FAKA 1K63A 3WA7A 1IZ7A 2ZYIA 2AJBA 2OG1A 5JAHA 1ZI9A 5EHZA 1L7QA 1U65A 2QJWA 1RP1A 1JFRA 4DIUA 2HRRA 6YASA 4IH1A 4OD0A 4Z49A 5EGNA 4DGQA 4DNOA 2Y6VA 1CRLA 3LIPA 5DJ5A 2PSDA 1ZJ5A 3PFCA 4KE6A 2OCKA 4Y2QA 4DMCA 4WFJA 3VVLA 4DSAA 1JJFA 2PUJA 3ZLVA 2EDAA 2O7RA 1UKCA 3QMMA 4KAJA 5EHXA 4AZ0A 5IVHA 3AILA 2XI4A 2XUDA 3GA7A 3HYSA 5ALKA 1AX9A 1ODSA 4BC0A 4B0PA 2JGEA 4ZREA 1A88A 4DTCA 1UT6A 1R88A 4BCDA 4LXHA 3A6ZA 5FKJA 1THGA 4EY6A 1ODCA 5JD5A 2GBCA 2WIFA 5A6VA 3DCNA 1CUYA 3IUMA 3G0IA 1JT2A 5ALEA 2PL5A 3RK4A 1O6FA 2IX9A 1DWPA 3D3NA 4GHWA 3JWEA 3TJMA 4KE9A 1W75A 3FCYA 5HQ3B 2HFKA 3O4HA 3I6MA 4P93A 1TRHA 5JZSA 3QITA 1R4ZA 4XWGA 4HAIA 5AKGA 2OCIA 3LS2A 4HZGA 4MEAA 5A62A 2WUDA 1HKHA 3FYUB 1CUDA 5E4YA 1ZGCA 4PW0A 2D5LA 5C81A 1ZI8A 2WILA 4AXBA 5K3EA 1EDDA 4OPMA 3C45A 2PUHA 3RKSA 1XZMA 1OXMA 2QOEA 3UUFA 2XQFA 4MYSA 4H7EA 3WK8A 1LBSA 4LXGA 1FFBA 5CBKA 1GQSA 1CIJA 1E3QA 1GKKA 1C7IA 2G63A 4NVRA 1DT5A 5FPQA 5AKLA 4D9JA 4C4XA 5FUMA 1XZIA 1WCYA 3FBWA 1ACJA 1XZCA 2VTVA 1LZKA 1C4XA 1XZEA 2XT0A 3I2HA 3STXA 4UPDA 2ZYRA 4KAAA 2XMQA 5ALYA 4X97A 4J3JA 4QDXA 3V1MA 1K4YA 4WDRA 5FP0A 5T4EA 2DSNA 1MAAA 2DQYA 4G4IA 1AGYA 3KXPA 3AINA 4Q05A 4HVTA 3G0DA 3FLEA 4AZ3A 4LKOA 5AKHA 4H7HA 4Y9SA 5DWDA 2HRQA 2PSHA 3A2NA 2GYUA 3KSRA 1H23A 3AZOA 2BUAA 1AUOA 1UWCA 2VJCA 1MT3A 4Q1VA 2WUEA 1WHSA 2JF0A 3FWHA 2V97A 2HM7A 3IA2A 5AKZA 2JIDA 1FFAA 5AKEA 4ZI5A 1CUWA 2WHQA 2CKMA 1RYYA 4BRSA 2WIJA 4MEBA 1QZ3A 1LPAB 1G5FA 3MUOA 1J1IA 4AMYA 2PBLA 1LPPA 3WWEA 4H18A 4KACA 5ALGA 1U4NA 3SX4A 5ALJA 3DYIA 1W1IA 3ESAA 1LZLA 1MX5A 1H2ZA 3O9MA 5AI9A 2ZSIA 3GZJA 5LKRA 5ALPA 5ALDA 3ILSA 3KOOA 4GW3A 1JMYA 4U2DA 2X5XA 3W9BA 1L7AA 4B9AA 1MAHA 1P0MA 2HU7A 3PE6A 2WLSA 2WHRA 3QMWA 1TK3A 4PV7A 4UBOA 3SC2A 2XE4A 3E3AA 3UUEA 5K3FB 5JZBA 1E8MA 2PU5A 2QUAA 4BC1A 3D2BA 4UHDA 3PF8A 1AZWA 4X00A 4RPCA 4QEKA 5A7HA 2ZJ6A 4IQ4A 4NMWA 4BZZA 3WWCA 1E89A 3M81A 1CUZA 1QTIA 4FNGA 2BGRA 4QLOA 2GBFA 3WL5A 4EHBA 1MX9A 2VT6A 2XMBA 1ZD5A 5AK4A 1QIGA 2WG2A 2OCGA 4PSUA 3HZOA 2JGJA 1CV2A 4J0IA 2XMDA 1AQLA 1LPNA 3I1YA 1P0QA 1IVYA 1MJ5A 5IVIA 3S2ZA 1CFJA 3KDAA 1DQZA 4G5XA 3R41A 2H1IA 4BCBA 1ETHA 4B83A 2Y2VA 2QMQA 4J0HA 4A16A 2IITA 5DYTA 5JASA 4GEGA 5FPPA 1HDEA 3DS8A 1VOTA 3MVEA 2DHEA 3GUUA 3VJLA 2EEPA 4W9RA 2QM0A 3A70A 5JD6A 4AN0A 4CCYB 1QIHA 3DD5A 4QNNA 3DOHA 1CQZA 3R40A 4LHEA 4XJVA 2WU4A 2WM2A 3WWDA 2QR5A 4CG2A 1PJAA 1W76A 4BE9A 1HQDA 2JGKA 3HACA 3DJYA 3F8SA 4UBLA 4A23A 4N8SA 3F98A 4Y2PA 2R11A 2P8SA 5JIBA 2ZSHA 4EZIA 5AKJA 4GXNA 1QLWA 5LZ4A 3TGLA 4MQMA 3R3YA 4HXFB 5AICA 1CUBA 4MJ3A 2G4LA 3FCXA 3I2GA 4U2EA 3D7RA 2XUPA 2AJ8A 2VAXA 2C0QA 5I9IA 4H7DA 2UZ0A 1T2NA 4B84A 3N0TA 1LPSA 4FFVA 4ITVA 5JANA 3U0VA 1U2EA 2W22A 5DTIA 4X92A 1UXOA 2ACKA 2WKWA 3IUNA 4ZV7A 1TCBA 3WJ2A 1JMKC 1WB5A 4X93A 4ROTA 2XMSA 4UBJA 5CXXA 2WIDA 2HADA 2EDCA 4WFKA 3FYTA 2O7VA 5ESRA 4UFOA 2WTMA 3H04A 1LGYA 3CXUA 5HFNA 1ZI6A 1CPYA 2Y1KA 3I2FA 1VJ5A 4N8EA 2B61A 4KE8A 2PSFA 1QOZA 1EI9A 1ORVA 1UOPA 3G9UA 2C0PA 3AZPA 2Z5GA 2DHCA 4MYDA 3H18A 4EY7A 5JALA 1YA8A 4K6KA 3VXKA 2X76A 1XRRA 3SWWA 3I2KA 1BEZA 5CH3A 4OUKX 1NU6A 3IUJA 5ALTA 1BE0A 1E5TA 1IMJA 3IB3A 5D3KA 1J06A 3ESDA 2K2QB 4DMHA 4BE4A 4X90A 1TAHA 1XRNA 2VQ6A 3OC0A 5CXUA 2E3JA 5AM4A 1XFDA 4LYEA 3JYHA 4OCZA 2HIHA 3T4UA 1BN7A 3C5WP 1OILA 3FSGD 3STVA 2WFLB 1SOMA 3EF3A 2B9VA 3WYDA 5LP1A 2FJ0A 4BTVA 4HXGA 5HKAA 5DYYA 3IDAA 4AO8A 4DYHA 4BYMA 3CN9A 4QWWA 5A7GA 1JJBA 4J0JA 5K3DA 4HS9A 5AM2A 1AC5A 5ALWA 5AO9A 5T4BA 1C7JA 1LPMA 1XZJA 3HSSA 4OSEA 4K6HA 1ZIYA 4HXEB 2PSEA 3QZUA 5AK3A 1DU4A 4CFSA 3GROA 5ISMA 2JGIA 3WIOA 3C8HA 5LZ9A 4WFIA 1UFOA 1R9MA 1YCDA 2XUOA 1U8EA 3QPCA 4PQEA 4C87A 2CUTA 4BTLA 1UKBA 4X6UA 1F6WA 4CI9A 5AH0A 4B85A 4WCVA 1RWQA 1MNQA 1DTEA 2HU8A 1R3DA 4J0CA 1YA4A 4CIBA 2HA7A 3X3HA 1IZ8A 4MWTA 3ZV7A 1VKHA 2WQZA 4ARBA 1EDBA 1JU4A 3C8DA 3JW8A 3V9AA 4Y2SA 4B82A 1GT6A 1A8UA 3I1IA 2GZSA 4G9GA 2XUJA 2ZJ7A 4JH0A 1XKTA 4FBLA 1YAHA 2ES4A 1E8NA 5I8PA 3EQ7A 4X6XA 1ZIXA 3V48A 2WJ6A 1JI3A 3DLTA 4YK7A 4E14A 1ZD3A 4BDTA 3DKKA 3C87A 4P08A 2OAEA 4GWLA 4Y7DA 4F5ZA 1EH5A 2OQIA 5ALNA 4QDZA 5HCUA 1USWA 4BATA 5HF8A 4BAZA 2XMGA 3QMVA 3MGAA 1D07A 1CQWA 4CCWA 5AI6A 5ALSA 4W63A 4H35A 4G8CA 5T4HA 4DNFA 5KWIA 3WQHA 3WK7A 4QWMA 1H22A 3I6ZA 3A2MA 4N8DA 1YR2A 4X6YA 2RI6A 1HLGA 3HLKA 1AURA 1CLEA 1MX1A 3AIOA 5E4JA 2OGZA 2XMZA 1CUUA 4TPKA 4L0CA 4OYYA 5SYMA 1SCQA 1ZOIA 4UBIA 2C4HA 5AIAA 3D2AA 1HL7A 2GZRA 2PSJA 1Q84A 2ZVDA 4L3WA 4MWSA 4HTAA 1FSSA 3O95A 3WWPA 2VJAA 2Z3ZA 5E2IA 5HKBA 4BZWA 3IIIA 4FDMA 3WZMA 1KU6A 4BB0A 5BWCA 4I19A 4G8BA 1EHYA 1R50A 3BJMA 1FFCA 3SK0A 1HBJA 1X2EA 2AXEA 1LPBB 1PV1A 2C58A 5AHXA 1VZ3A 2JBWA 4K6GA 5H3HA 5FOQA 5ALVA 3FLAA
chains in the Genus database with same CATH superfamily
2L42A 1K6EA 5DVZA 4L73A 1ADFA 4U2CA 1EGQA 5EJIA 2C61A 3I6BA 4RVOA 4PG8A 1OAKA 3F5DA 1ZQ9A 1SOAA 2H9IA 3GLQA 4X1YB 3SHOA 3RSOA 3IRVA 2NT3A 1GUBA 1DBRA 3Q5DA 4KI0A 2PWPA 4PLPA 2OFOA 3IAUA 4FUTA 4IGKA 3IIJA 4FZVA 4NBVA 4OSOA 4KQ2A 1D09A 2ZB2A 1UQRA 2XMCA 3IKJA 3CRNA 4R1PA 5A71A 5L3QB 2PFKA 2HZ7A 3NM4A 2P8JA 4IDQA 2O54A 3IIKA 1U3WA 3QF4B 2WTBA 4BV9A 4MA0A 4KLRA 3VNQA 2WZQA 2GJSA 3NRBA 5JSHA 5F23A 1O2DA 4B5LA 4AL4A 3QVLA 4BVHA 3D3KA 4INAA 5BSKA 1KYWA 1R9JA 1F1BA 2KBEA 3HJUA 1K7YA 2VLBA 3ROTA 1XTTA 1W1UA 3PF9A 4P2GA 1EUQA 3L6UA 2LZ0A 4RIFA 5DGIA 3OE5A 3RM3A 2HT1A 2Q8NA 3ZV6A 1QIKA 3I76A 3P9YA 4ZQIA 2WSLA 4A36A 3MTAA 5AUOB 4KN5A 4NDNE 1XZBA 1B6TA 2CLDX 1P6QA 3ESBA 4IEIA 1H4TA 2Q5JA 1M5TA 2VHJA 4LSMA 1SUIA 3EMDA 2A9OA 4TKLA 1USKA 2BMDA 1F8YA 2CXPA 4AF8A 3CN7A 5DYGA 2Q5QA 2DU8A 3RHFA 3MAAC 2I4MA 3PEVA 1OPXA 1J42A 2OK7A 2I2WA 3TZBA 1FDIA 3R3XA 4Q7MB 4EY5A 4PPGA 1VGQA 1L4BA 2G3YA 2ZIFA 1ILEA 4JB8A 4BZQA 2REQB 5C1IA 2O7QA 3I32A 1WMAA 3HCDA 5E4TA 1ZXXA 2C8VA 1PJ3A 1AQIA 2WZBA 4I4TA 4R69A 5BQ3A 1Z18A 4KHZA 2V0CA 1C1XB 1H2BA 1KOJA 1Q92A 2MU1A 1H2XA 3JQDA 4BWGA 4FZJA 1KJ8A 4EA8A 1C3XA 4X7PA 1Y0BA 5I9MA 2LPMA 1EB9A 2P40A 4FIDA 4NP6A 5E2AA 3ZHYA 1NNLA 5J1TB 1WXQA 1FJHA 3PNOA 4W5JA 1UZUA 4WK0B 3VYTB 4A73A 2W6NA 3V6LA 2W6MA 4KVZA 1GPJA 1CUIA 3DEFA 3QH4A 3SFZA 4C4TA 3SS9X 3I5YA 1OYOA 2WDZA 2JFXA 4KH0A 4P7KA 4R1UA 5ER6A 1IXKA 4FYWA 1X70A 3C70A 3QUTA 2FEKA 3OT1B 1SUCA 1X13A 4A92A 3DP9A 5LZ5A 4L6CA 4D0GA 5HXAA 3L93A 2EZTA 2FQQA 3P5BA 3S2GA 3HXOA 2NP6A 1JX6A 1XRLA 1XXLA 5FA5A 3FYDA 4CGYA 4UUOA 1N1DA 1TJ4A 4POOA 4OIMA 1SQGA 3OM9A 2LRHA 2HK6A 4XX1A 3HJNA 4U2BA 1HYBA 1HY3A 3FGNA 4JBIA 2WWXA 4EL5A 3FTEA 1OXKB 4K6FA 3HCRA 3BG5A 2J0UB 3JQ7A 3MBOA 4XZ3A 1ISMA 4MQFA 1RP7A 4O4HB 4NAHA 3U3OA 2DWQA 2GLTA 4EKNB 1YZQA 2Q27A 5YASA 1G20B 3FSJX 5E1OA 1FQJA 3TD2A 3CUTA 3NG1A 3EVAA 3ULKA 4MVJI 3EGXB 4OHUA 4BX3A 3KQTA 1X15A 4DEYA 5JD3A 1U3VA 4MV4A 4AU1A 4NI5A 3OT5A 5A6SB 4OI4A 2YMMA 3IE2A 3NDPA 1CUXA 4UTRA 1JILA 1I7PA 1U6JA 4BO8A 2X4DA 2X5JO 3BIJA 4XIFA 3LVFO 4G07A 5LBTA 4XPZA 4YCSA 2JLSA 5KYXA 1QFMA 2DG2A 5IW8A 2H0RA 4N0DA 3HB5X 5EIBD 2HR1A 3RHTA 4J0EA 4ZI3A 4UFPA 3IEXA 4ZO9A 3ZTWA 2DF8A 3HYRA 4QARA 2QXTA 4EHAA 3T7IA 3HP4A 3PC6A 1UPFA 3CE6A 3PSAA 4FLFA 4PZAA 1TYZA 1XKLA 1DJPA 3QLEA 4LS3A 4YCAA 4OA8A 4FM9A 4OJTA 1VSTA 3MJRA 5ELMA 5CW2A 1KI6A 1NC1A 2DUUA 2HEGA 4LHZA 3M3DA 3TLCA 3QUCA 2PX4A 4BWVA 1B7GO 1J25A 2QA5A 4QIHA 3UV3A 5K3AA 3WWZA 2PY6A 5DEIA 1EVIA 1G21A 3K0KA 4XIIA 4KLCA 4OP2A 3WYNA 4ALIA 4QUHA 2C9CA 1N2EA 5ELLA 1FDOA 2ZM5A 4U2FA 1Z4PX 4MTLA 3HXMA 1CUEA 4HNHA 4NCIA 2C07A 2J30A 3O03A 3O82A 4JJIA 1WSDA 3QQPA 4YMVA 1UR5A 1DG1G 2PDAA 2F9LA 2CDRA 1E64A 1P7CA 1HDGO 4V24A 1SQ0A 2QQEA 3RVRA 3DXXA 1CUAA 1EUDA 3QU9A 4ETNA 3CB4A 4UAUA 2IHJA 3RTEA 2COEA 3B9PA 3LP8A 4D3SA 2ODQA 4EMSA 4WXYB 2CHFA 1PAUA 2Q3MA 4I55F 4XLLA 2C29D 3LA6A 2J3HA 1GGMA 1Q74A 3GMTA 4Z9YA 4CVNA 2NT4A 1XVLA 1NLZA 3B7WA 2QLMA 1VIVA 3B8HA 4HAXA 3BWBA 1ZGBA 1IY8A 1JG2A 3NP7A 1K7SN 2VPWA 1SFRA 5HOQA 3ZHXA 4PHCA 2CFSA 5A4DA 5IHPA 5EPEA 1FU7A 1IEXA 1GZ6A 1E9SA 2R5WA 1L4UA 2DJIA 2JJ1A 2OVBA 3Q7TA 1DUSA 1N4AA 1Z8NA 2JGRA 3U3KA 5LA6F 4AUKA 1ZR4A 5JMPA 3NHFA 5BNWA 2YIMA 4PNHA 4QE3A 3ORYA 2EF1A 3JVIA 2XW6A 4ZQGA 1WXFA 1GKLA 5AW0A 1RYEA 2QVBA 4U5XA 1QBKC 4U7HA 2QV0A 1E2LA 1TQ2A 3NPMA 4B8ZA 4N5IX 2OB1A 2GPNA 3U49A 4ZDJA 3G2QA 3JWJA 4G9BA 1YB1A 3OICA 1MF7A 2YZ2A 2Y0DA 1R37A 5AI8A 1MKYA 1BRTA 2VA9A 1U8FO 3FCAA 3M1AA 1FSZA 4KUGA 5FO0A 3FFTA 3CW2A 3PRYA 1OFUX 4RF3A 5HK9A 1V1JA 5HF9A 2R2AA 1SUBA 4RK6A 3SIRA 2R0QC 4PZCA 2W6QA 3WLMA 2I76A 2ID9A 1FVFA 3KR9A 2KPOA 2QP3A 1E18A 5AVOA 3VJKA 3PDIA 2PA0A 2J6BA 3WGUA 1I10A 7YASA 1MMFB 1OI3A 3C5CA 3SOPA 3VU1A 4BKQA 2IW1A 1I4DD 3L1JA 4TLCA 3RG2A 2IP1A 4IZOA 1CQPA 3DL0A 2AFIE 3BQMB 3MGCA 4ZGGA 1KFCB 1J2UA 5M34A 4YXWD 4EFMA 1YB2A 1MOPA 1ZLXA 2WVAA 4FNMA 5GVSA 2MMGA 4RVUA 2WOOA 2EG5A 2M6KA 4ZMSA 5CFMA 2YJ3A 3FFBA 3H16A 5KNCA 3T3NA 3L9WA 2JFUA 1XHLA 4I55A 2FDCA 3I2JA 3A6HA 4I9NA 1SXJA 1CP2A 4PSAA 4HY3A 5HKKA 4BP8A 2XUQA 4FEGA 4BNLA 1CJKC 3LKZA 4X1IB 3MHTA 1Z4OA 4RTJA 1QP4A 3AYXB 3BE8A 5AM5A 1JEQA 1QIIA 2VYFA 4MV3A 8MHTA 3L0OA 4RIIA 4D6YA 5DM60 4HB0A 2CBGA 2GD2A 1N6HA 2DUJA 3B7PA 3K1AB 4FLMA 1XR3A 2V9PA 221PA 4LXIA 4GI2A 1U8UA 3QVGB 3SR0A 4NBTA 1E6UA 1FP1D 2WTEA 4JLAA 4A9AA 1REQB 3R09A 2Y2UA 1J6UA 5FDFA 4URXR 3E1SA 1C50A 2C5BA 3AVTA 5LA6A 3E22A 3MWDA 4TUYB 3RV3A 4FGKA 1AMNA 1U2TA 5MHTA 3EXG2 4XCQA 4BKRA 4EW1A 2COUA 3T52A 4GQBA 2YXPX 1TU4A 2VBIA 1KMMA 4XIJA 4XQ9A 1FDRA 1T0UA 2X8AA 3DZJA 3KALA 1Z8FA 1AA9A 2H7YA 3EIWA 4AVYA 5DNYB 4ZANA 4ENUA 2MIIA 3P0RA 2GJKA 3L79A 1BCRA 3HJGA 5JY6A 4CEIB 1Z6GA 2WIKA 4P0QB 4R7ZA 1W48A 2JI9A 5IT9A 4WIAA 1XZLA 1H9CA 5AW4A 1HLDA 2QUKA 2B3TA 5FNVF 1YS9A 2N9UA 5M5BA 2G5TA 4LQLA 2YNMC 1QCDA 2ZVQX 4KMRA 2JVKA 3AUTA 1JWAB 9GPBA 1JLKA 2JAUA 3MWEB 3ONNA 3MZ0A 1MGOA 4UREA 3TH5A 3R3ZA 4UVDA 1A2BA 3REFA 3C6BA 3LKDA 1VIMA 2NU9A 4KEAA 4D74A 1N6IA 3NEJA 4JAVC 1USVA 2IXGA 4W5HA 2J4DA 1XE3A 3EIXA 3IMEA 1W36C 3J81k 1ZX1A 3ESQA 3TLGB 3G13A 3KXLA 5JNLA 1C3LA 1G5HA 2O0MA 3HXTA 4OFXA 4DJAA 2ZE6A 3N2EA 3UH1A 4COOA 5I45A 1B8UA 1O9GA 2EG9A 2Z09A 1YV9A 4NH0A 2VATA 2YXEA 4U9HS 3UV7A 1E1KA 2XE6A 5BSFA 4BFZA 2JJ2A 3IAHA 4DWWA 4F4CA 3EUAA 2GR9A 4CKEA 3GRAA 4Q3BA 4BB6A 1VLHA 1JEYB 2PRYA 2O0KA 3VMFA 2H29A 4ESEA 1W5TA 3U2QA 3D54D 1BOFA 1T1EA 2YS6A 4KN8A 4U8HA 2DERA 3P9CA 3ZWYA 1ZUD1 1CG6A 2AYYA 1ODLA 4KXYA 4LGYA 3SYRA 2CBZA 4DIBA 2XB2A 4PONA 2WR8A 1DC8A 3B78A 3STUA 2E18A 5IABA 3FD8A 1A9ZA 3QFRA 2G9UA 4X61A 3ZWPA 1U3FA 4L5YA 4ADSG 2ZS8A 4UTVA 2GEFA 4MKIA 2NO9A 1CQXA 1H9AA 1TUIA 4OQ4A 5ADVA 2QD5A 2ZIEA 5FB3A 3R7SA 1XQ6A 2GAIA 2H1CA 2I6UA 1RWMA 3H9CA 5ALLA 1QG4A 2A8YA 3PNBA 5I47A 5FNVA 5G40A 3TTUA 1E2EA 4NOMA 2PPLA 1QHHB 1W88B 1PDOA 3UTDA 5JCXA 5K3BA 3BDIA 1AO0A 4CM9D 3FHJA 4OMDA 2RD2A 2HTFA 3G5LA 1QR2A 1B2LA 4OQMA 3RG8A 3T5BA 2J9FB 4EUNA 2VK4A 2PMDA 4NS4A 4TKZA 1K27A 1CRWG 3PUIA 4LQ4A 3DKIA 3ZCVA 3X0DA 2PZLA 1GCAA 1I32A 3K5PA 4W9NA 5KJ1A 2X8BA 5JBQA 2NSDA 4QTUB 4FYHA 4E5KA 4YACA 2OCDA 1DQYA 3FTPA 3OURA 1YB7A 1WB6A 1PFYA 5JYDA 1TE2A 3DFUA 1QO7A 2LBPA 3H8VA 2BCEA 3OTIA 4UAJA 1HTTA 1E60A 1UMDA 4J03A 2V5UA 2C1ZA 2GN9A 5FNZA 2XQJA 3R9XB 4KB5A 3AEZA 3E53A 2ZXUA 3OZIA 1VBMA 4G4JA 4P31A 5C8ZA 4Z3KA 3TRFA 2HDWA 1R0LA 3L4KA 2FOIA 5DHPA 3ZV5A 3R5JA 4DABA 1T3GA 1XZAA 4H3HB 3RIMA 1TC1A 4DA9A 2IZ5A 4K03A 2RONA 4TYNA 1QIFA 1E66A 1JYEA 1FDSA 4LDRA 1ATZA 1TA4A 1C8VB 2D06A 1JDVA 4N39A 4OY3A 3GVPA 2ZZNA 4FS3A 2GI4A 2DWCA 1W8IA 4JGIA 4IMIB 2AZDA 3W4IA 4XSGA 4CFZA 4UBMA 4HAYA 1KXJA 3THOA 1QJCA 2HMVA 3U4IA 3BXHA 5E38A 5BYAA 3JYOA 3TZLA 2FN4A 2IHVA 2W2VA 3NP9A 3ENWA 1PR9A 2QVGA 3TDKA 1KY3A 1UUFA 2FVYA 3ODPA 1AGXA 2FAXA 4BFYA 1C30B 3CPJB 1JZSA 2WK1A 1EA7A 2F7SA 4TRRA 4ZCQA 4FYPA 4KR6A 1SVIA 3C3WA 1QHEA 2POCA 2JAWA 3JYPA 3L02A 5D01A 1XLVA 4RE5A 1KS9A 4DOMA 4V3BA 1JQKA 1STOA 2DY1A 5IS2A 2LKDA 3BZWA 3K53A 3VV3A 1RFLA 3QE9Y 2OBFA 1TCCA 1LW6E 1UKAA 3HI4A 4XM2A 5EMJA 3T3IA 2RARA 1Q16A 1BXGA 4X1KB 1ZUHA 2Y68A 3E2MA 1P2VA 1MDFA 2QHXA 1VRVA 2W0SA 4E6EA 2ECQA 5ARBA 3WL6A 2VTEA 2G07A 4H1UA 4PO3X 4EHHA 3KQOA 4HFRA 3PD1A 5AJYA 4ZU6X 1I2DA 4QZVA 1IHOA 2RCNA 1WR8A 1T15A 1OC4A 2QPLA 4FFRA 1B6GA 4FMPA 2G40A 2ACVA 3K0BA 4F4FA 5DN6D 1HF3A 4NCBA 4KLNA 3DZCA 2JFHA 2Q1SA 2JJQA 1X0XA 2RG1A 3HU2A 2RCYA 2ZT7A 1H8ED 3LLUA 3I39X 4TQAA 3WGMA 4EFKA 2VQEB 4H3SA 3RUCA 1FZTA 1LD3A 1I33A 1U7WA 3BD9A 1MHTA 3ROMA 3BAFA 4PU0A 3HDGA 2DUWA 3LUKA 4N7MA 3WWOA 2YYZA 4N48A 2Q5EA 1IXYA 3FB4A 4QA9A 3MQ2A 4XUDA 1NE7A 4DIFA 1S6YA 3GLFE 3FOCA 3H9QA 1QYDA 2BTQB 3KEFA 3A3KA 1JKXA 3L6CA 1Z06A 3THWA 1G59A 3PLAE 1XTUA 1HZJA 1DBVO 1O97C 4B6RA 2ZDHA 3VJMA 5BN3B 3KHTA 4LWPA 3NGLA 5B6JA 3AF0A 1ISPA 1OXVA 4LGCA 1B41A 3PGA1 1LPOA 4DKJA 4RVHA 3EXHA 2VHYA 1E2UA 5A4JA 4GPD1 4MV6A 2FJPA 3RRMA 1FUUA 1CQJB 1CZUA 1RM0A 2H5LA 2FSVC 4RXTA 3HR4A 3WI7A 2SKDA 1V3UA 5CDYA 2JGAA 3FLBA 4PQRA 3E0XA 2HXGA 1E3JA 4URVR 2R8XA 4IJ6A 2ISSD 4L9AA 2XQVA 1IOWA 4ZQHA 4ED9A 3OX2A 3HY4A 1IN6A 4JBGA 5F52A 1RJGA 2PS0A 4DMFA 2EGGA 3EZ7A 4TVOA 1GYPA 1ZJJA 3R6TA 1VLQA 4AY4A 5AKIA 1ISHA 1F8XA 2KHZA 3OECA 3B6IA 4KR0A 5FQOA 1T26A 2XSZD 1BQ4A 3HA2A 1HDOA 3EIQA 4G23A 4H6XA 4F9TA 2BR4A 3U56A 5AI5A 3U3MA 5EIXA 4TT3A 5CA1B 2X5NA 2J31A 4LJLA 4XR9A 3KJIA 2OY0A 4ER5A 1Q3HA 3BICA 2F8TA 1Z0ZA 3WLHA 1NQ5A 1XRMA 2HQOA 4FSDA 2EERA 4BFSA 4IMJB 4OHVA 2G25A 1VL6A 3FMIA 1KJZA 2I78A 4Q0MA 3OCYA 5KCMA 5AWFC 3RRXA 4QVIA 2QZZA 2GEVA 2VJNA 3PZBA 4F21A 1L5SA 3GEPA 5T4FA 3W5CA 4LHXA 3GFOA 3W77A 4I4CA 4UATA 2IPMA 1NFRA 4DFDA 3VKGA 1VBNA 4GI1A 4RMJA 4OI1A 4B2YA 1I3NA 1Y6ZA 1ESEA 1L5ZA 1MQAA 1YR1A 2ON6A 3EVEA 4H6PA 2B4YA 2JHFA 4N12A 4RHTA 1OXXK 1MX3A 2CXQA 1P5JA 2TSYB 3PQEA 1A7UA 1JFSA 3FWNA 2XZLA 2HT6A 5KWJA 3VM6A 1R5NA 3I9MA 4BLWA 5KVVA 3SHFA 2FXIA 2FPIA 4L9SA 3CLTD 3DB2A 5L3RA 3QMPA 1UT5A 2H7XA 4B4UA 1ITZA 4LF5B 5KQLA 3IPAA 2IGTA 5H16A 4IMPA 4C7JA 2JGMA 4MKXA 3VR1A 4F4JA 4IJVA 5C3UA 2XITA 3OFKA 3IPXA 5IARA 5GZ3A 1W52X 4W9MC 1Y7IA 1ZGAA 2W83A 1GKIA 3QW2A 5H02A 2HFJA 4DIOA 1UBMS 1EK2A 5DBFA 4PGMA 4R2XA 1N9ZA 2B7CA 3TECE 2O57A 4Q4JB 1ODJA 1DEAA 1TEVA 3PXBA 1NI3A 3MWKA 4NBSA 4CGZA 4Y2RA 4ALKA 2FPPB 4Y30A 2VP5A 3BCHA 4C22A 1LQ2A 1SNYA 1TJPB 2VVTA 3BOSA 3IOEA 1UC9A 2G36A 5KQSA 4JUBA 2I4TA 3JQ8A 3E5RA 4UARA 1NXTA 4D9BA 2LWIA 1SGWA 2DH6A 3ZJUA 3GPCA 4XASA 2Q5CA 3ZCXA 4YR7A 1EIZA 1E1DA 3DJFA 3BB1A 5A4FS 1XZFA 3EJ6A 1V5GA 4TN5A 5C1DA 2PV0A 2NU6A 4MWEA 4U0KA 1DGQA 2GETA 1OC2A 2R85A 1F2UA 2CUNA 3GB9A 4G5QA 3ZIAA 1QQBA 1YDEA 1JG7A 1PFGA 3MTQA 5EYPB 4YX9A 1M2OB 5L6MB 1PVVA 3RTCA 5M2QA 1U1IA 1E5XA 3IJPA 1Z5ZA 2ZB3A 1CRZA 1ESNA 3L7KA 4UXHA 1JIXA 3WKCA 3T1YB 1XJ5A 3FVVA 3G7NA 3PKIA 5HF6A 1U2SA 2JJMA 4Z4FA 2Y1XA 2WTXA 3IAAA 1BVHA 3DO5A 1GL3A 5AVUA 4GKKB 1AHNA 2FPLA 2G1AA 3QLJA 1GTSA 3MTGA 3U61B 3NBQA 4P0PB 1S2GA 2IIBA 2B1IA 2IXTA 1Y6GA 1JQEA 1OPRA 4KW7A 4UBKA 3P94A 2QU8A 2Z6VA 1PF7E 1QV9A 2YYAA 3E9EA 4OQEA 1W0JD 5IVDA 4LIPD 2AC2A 1BQ3A 4X20B 5DN9A 5BW6B 2NM0A 3O92A 4OL9A 4DIKA 3FYHA 4HGOA 1JH9A 4Q19A 3GH3A 3AY3A 4NEQA 2BT4A 2CXSA 2QXUA 4MS1A 5EWJA 2BKEA 5TGDA 3TINA 3W2GA 1DWOA 5C52B 1CUFA 1RKUA 4CF6A 3V80A 1L4HA 1KSHA 2KLHA 4LYHA 5F64A 1KZ7B 5CDGA 3D3WA 4R8SA 4GKJB 5EESA 4MUMA 3FPCA 4TQGA 1YIDA 3O2SB 1HEIA 4EVSA 5TDHA 4ZYWA 3E4DA 3DE0X 1DCTA 3IQFA 4NH4A 3B20A 2NYUA 4JKYA 4F5EA 3BMNA 4GPZA 3U60B 4R84A 3K70B 1OGJA 3PI6A 1U3TA 3S8YA 3SQXA 3WAJA 1LLDA 5A3RA 2BHNA 3IERA 4JEUA 1V25A 4DS3A 1G3MA 3QNMA 4E33A 3WL8A 3L4SO 3EYAA 4DCPA 2DLNA 2EJBA 3ICWA 4I9FA 1KBZA 1X3SA 4LJ6A 4EI9A 1D2NA 1BMQA 2Q0HA 4RTQA 4L2IB 1XZDA 3ZWAA 4DLNA 2R1TA 3MWLA 2PRIA 1HG0A 2B4TO 2AFHB 1QO0D 3TNJA 3UGKA 1Y6RA 1XOIA 2QTWB 3PKJA 2BH9A 2WU0A 2XUHA 4O5OA 4B4DA 4ZZ1A 4HRAA 3NCTA 4JJEA 1ZJYA 2QRJA 3EMBA 3P2IA 4FNOA 3ANTA 4D6XA 5BWBA 5TMEA 2P3QA 5E7JA 4AB1A 5L7TA 3ZDDA 1RZVA 3TQIA 1N3BA 3FB1A 3H2ZA 3DWGA 1QJ4A 1UKYA 1FJGB 3RJMA 16PKA 1GKYA 4OFBA 4NYJQ 4QBGB 4XX0A 2VF4X 1ZRMA 4KIGA 4YJFB 3ZQ6A 3A1DA 5J4LA 4QDUA 2QUBA 1T9BA 1TYBE 3VZCA 1KXZA 1XDWA 2ZI5A 4XIYA 3VV2A 3KLNA 4B3BA 1NWCA 1E2PA 5IJXA 1HTWA 1YRLA 1I1QB 4EA9A 5LMZA 3HCFA 2NP7A 1Z25A 4TROA 1XSEA 3U6KA 1GL7A 2GEDA 4WY5A 1G18A 3II6X 4CCYA 4JC0A 3GDGA 3CTPA 4AXXA 3WJAA 1KZ1A 2QN2A 4RKQA 3R3SA 3BH7A 2YNMA 4M9RA 3AR5A 2LIPA 4KQMA 1P19A 1YQEA 1U80A 4IYRA 2PCJA 2YJ4A 4FWBA 4NHOA 4UEOA 3UCXA 3DPSA 4EFDA 3T7DA 1OBVA 1JJVA 1UP4A 4WEOA 5HE9A 4J6EA 4N5NA 3QWIA 3UC5A 3U39A 2A0WA 2NV2B 2WF7A 1JFTA 2ZI3A 2E4ZA 4LYYA 3IV6A 3GCZA 1A27A 4JI4B 1O6BA 5INTA 1KQNA 1DIHA 2HQSA 3ZGLA 5FV4A 3ED5A 4PS0A 4WXEA 3E3LA 4EGQA 1EDZA 3BEOA 4R9SA 5DHFA 4AZTA 5IN4A 1XMXA 3BD8A 5AW1A 1A2KC 1CFZA 1T2UA 3H83A 4FHEA 4G41A 1HZZC 4FR0A 3JR3A 3LX6A 1AJEA 2YVLA 1DVRA 4HKTA 1F17A 1G98A 3D2LA 3SF0A 2FI1A 2PLWA 1JDTA 2XD4A 1U2DC 3U1VA 3CCCA 1XELA 1TKCA 2PJRA 2GPAA 4PIVA 3BXGA 1X1SA 1LK0A 1B42A 3Q9LA 1U4SA 4E5PA 4A2QA 4IGFA 1EGVB 1NMSA 2DQ4A 3EDCA 1Y7LA 1LBEA 1SC1A 1TU3A 1WXWA 2XEDA 1BX1A 3OMLA 3PPIA 3TYXA 4ZCRA 2BAGA 3ZWMA 4C4ZA 3H5NA 5JSYA 4LZLA 5CTAA 3RU3A 4C9BA 4WDQA 4UTPA 1EDEA 2QPTA 1J56A 1YQUA 3WGQA 1DIRA 1U81A 2DETA 4KHPB 2VTDA 3QLUC 5CA0F 4I4TB 1RMYA 3IKVA 1O8BA 2ZJFA 3FCCA 1FIUA 1O8CA 4KXWA 3B12A 4GC5A 1CY2A 4L4SA 4YRDA 1NUHA 1XJ0A 4E2ZA 4R6WA 1JE0A 2X8LA 1O77A 3TTVA 4AJEA 1JEEA 1D6MA 5DMXA 4CMHA 3ER9A 4BQFA 1PVOA 4A6DA 2AOWA 4ZJZA 9LDTA 4TS9A 2VF7A 4L22A 5CEFA 1EK1A 4Y2XA 3D4NA 3KIPA 3QHAA 5IDQA 1TF7A 1TXGA 2H1LA 1A9YA 3U19A 1TVMA 1HLPA 3UJPA 3KSUA 4OX9Y 3STYA 4OAQA 4M36A 2HU5A 4BLOA 1ZGGA 1I0IA 1SUFA 2ZIWB 4L8GA 3RVOA 2R48A 4I9GA 3VFDA 4K1XA 3ZHVA 2IU0A 1SXPA 1BD3A 1IBCA 3HEAA 3O4GA 3GGCA 4R68A 3L0BA 4CQMD 2R8BA 1KK2A 4PINA 4GPAA 4Z99A 2Z8YA 3KQNA 1JDBC 2BIFA 2A0YA 1ZU4A 2O2HA 3CIFA 3FMFA 2GCEA 3K8ZA 5CLHA 4BUCA 2VRCD 3JQ7B 3I9LA 1E4VA 2YJ5A 3R5XA 4MQFB 4B8WA 2GTPA 1XKXA 3RNLA 3H6GA 1FTSA 3GO4A 2FMFA 3H5AA 1RQXA 3A4VA 5F2EA 5IKMA 1VLJA 3ZCRA 1O1YA 2SHKA 3PUZA 4M0UA 4CQLA 5JWHA 3STHA 4OP3A 4TGLA 5CHEA 2CMDA 1MO3A 3Q1LA 5AW7A 1USUA 2P5TB 2RGBA 3ISVA 4KXNA 5KMGA 3V8NA 3LQ4A 1K5PA 2D00A 1YA6A 3AP2A 3IHLA 3BF8A 3KHUA 1QB8A 2IPOA 4KRFA 4D9EA 4JNCA 1P0PA 5EL0A 3H9EO 4E03A 4IVNA 1OX4A 1FXSA 1TVCA 3PX7A 1TX4B 2PX2A 3FPAA 1G8SA 2AN3A 2OFPA 3LKVA 1H2WA 5KYXB 2JGFA 3SR4A 3UGJA 5CA0A 2CV2A 1LI4A 4XARA 3U7QA 4DLTA 4C5AA 4M0FA 3P9IA 4AMGA 3QIAA 2XUGA 1OR8A 3RTGA 4UHBA 1RXEA 2I3ZA 4YRRA 1N9GA 5L4LA 2FP3A 1LDMA 1JHQA 1T9GR 4TTIA 1MEOA 3T3PB 2FFAA 1XA3A 2GHQA 1SU4A 1XCJA 2MSCB 1KI6B 2RK3A 4HC4A 5IC6A 2NO7A 3BSSA 5IJZA 3RJTA 3X1JA 1SCAA 1Z5NA 3A6GA 3GELA 2O7NA 5CJ2A 1LA2A 4ZPJA 7MHTA 1RRFA 2HRBA 1G21B 1QYCA 2GRAA 5KINB 5IDYA 1U2QA 3JRXA 1M2NA 4FE3A 4TSFA 1Y9AA 1IQUA 1OAOC 2OCPA 3DL7A 1PFVA 5K3CA 3ED1A 2B7LA 2RHOA 2OQVA 4IF6A 1KPGA 1VXRA 2VLIA 3BFXA 3GEHA 2QLNA 4RZUA 1PT5A 1NQOA 5A3JA 2JZOA 2WWFA 1HSOA 4F1WA 3HDTA 4KFRA 3OPNA 3A4LA 4URYR 4BMVA 1KZHA 1EUDB 4HUTA 1EUYA 1FCJA 2C83A 4IDFA 4DGSA 1V1RA 3A10A 3E0QA 3I83A 1RRGA 2H5EA 4AJPA 3BA1A 2CFOA 4CG1A 2VHUA 5DBOA 5KVAA 3X1YA 4O02B 4IOMA 2J6HA 1ZMTA 2BGKA 2C4MA 1NG1A 1PJBA 2AK2A 1GA4A 1VPLA 3ZDYB 1NUPA 2F8LA 1VI6A 1N25A 3BCRA 2VDRB 4KKVA 4ZVNA 2Z9CA 2RBEA 1JSLA 3WRXA 1ADCA 1UOEA 3G0OA 3WGZA 3ZE7A 2BFPA 4M1QA 4GPTA 5EQJB 3LP5A 5KTTA 2Q6TA 5KTPA 3SKYA 4FSHA 5KVSA 1E92A 1Z0SA 1PYOA 2V4ZA 3LBNA 3IS3A 5FWAA 4I5DA 1L5VA 5LWHA 1MJNA 3KG2A 1QX3A 2D7JA 2Q49A 1PYGA 5CLIA 1KEEA 3G2HA 5KAMA 2OPHA 2SBTA 3T95A 2V96A 4HAUA 1XTJA 5F77A 5JAMA 3FI9A 1C3JA 3ITKA 4GMXA 2JHAA 1PNVA 1XFAA 2UVDA 3HHPA 1KQFA 3MJSA 5ITVA 5AXAA 4GOJA 4IGEA 4Z3OA 4RNCA 3LY8A 2H1VA 1RCFA 1D2EA 2D7CA 1F9AA 3K9LA 1Q0UA 1G3UA 1JJIA 4BDSA 2QG4A 1SU7A 2ZTVA 2AEEA 3KM0A 2IUSA 4AP6A 1M6VA 1C0IA 3LY9A 3BIXA 3I3SR 4D4HA 4I4IA 2Q2OA 3WMGA 1EEXB 5CH5A 4KNWA 5ESXA 1I1NA 5FULA 1FTQA 3LC2O 3S5JA 4EAAA 3K20A 2JATA 3I4CA 3AUAA 2A67A 1DJMA 1T4GA 3PRJA 1EWVA 3R74A 4QGSA 1ACLA 2GAAA 1FW8A 4JHLA 4YP5A 1EP2B 4DEVA 2FF5A 5KSZA 3PDIB 4YAFA 5FBKA 1UXIA 3BDVA 4X8MA 3VA7A 2HBRA 1GYQA 1ABFA 5FBRB 4OB6A 4YQEA 4L02A 4DV6B 2B78A 1JG3A 1QYWA 4JODA 5CFLA 2WQ6A 3U7FB 3CG0A 4Q9DA 1W46A 4B6JA 3AEQA 3FPEA 5CURA 4J75A 5DX8A 5HFAA 3SQDA 3Q8LA 1AGPA 4K9PA 2X4IA 1L5HA 4NC9A 3MT0A 2X19A 1SG9A 1XZGA 2FUKA 2ZPAA 3G2NA 2B5OA 4I55B 3F3KA 1SXJB 1ZESA 1OLXA 1T2CA 2RAUA 4HPWA 2B4KA 3R7AA 2H4HA 3D6HA 3NDJA 3IUBA 4HN4B 3ZPXA 3RKRA 5CB6A 3FDIA 4OH7A 1A82A 1ZK4A 3O8QA 2VDJA 1JEQB 2YINC 1KVRA 2YBEA 1OKKD 3FBTA 4LISA 4QYSA 5D7BA 2WUFA 4XM1A 5D7NA 5L4NA 1TUBA 1AS2A 1SIBE 3ILHA 2DGDA 4UM8B 3UWKA 3O84A 2GZ1A 1VYHA 1O0CA 1AKMA 5A1JA 1R64A 3D5EA 3FZQA 3MCAA 3R4VA 4M9UA 3E22B 3MWDB 4WCFC 5LA6B 2BM0A 5DZSA 2H52A 3O0TA 4L50A 5JT1A 1G60A 1IC6A 1VHWA 1YZTA 2WSMA 4ZWNA 3UT0A 1WXHA 4LOIA 3KQWA 3EIEA 1TQHA 2G17A 1AK2A 1P62B 2DT8A 1LRJA 3GQBA 2SICE 1DKRA 3BORA 5E1DA 2YRFA 3A3OA 3AGQA 3GDWA 1P5ZB 3IBTA 1Z17A 2F3TA 2CXNA 3OCXA 5B64A 4IH4A 4MO2A 3D0KA 4ND4A 5ERGB 4MGZR 1BCRB 3B1WA 2A1TS 4G5FA 1RPTA 1PK7A 5AK5A 3PDUA 4AY2A 1J1UA 2CMHA 4UHFA 3T7JA 2M6RA 2AN1A 5TS3A 3EXIA 4GGOA 4D4MA 4TMZA 4YLGA 2GHTA 5TB5A 3ZGYA 1XA4A 3MB5A 2GZHA 2CNKA 1I7DA 5HMMA 4INZA 1L4YA 2HRDA 2R4QA 3I01M 1IHYA 2XOKD 2GOYA 4Y8VA 5BMOA 1RXYA 1TF2A 3DDUA 1L3IA 5F2NA 3M9LA 2AHOA 3A04A 1QRRA 5HNKA 2FMIA 3DBVO 3Q9NA 1DT3A 3GAFA 4ND7A 2NU9B 4CLRB 4LFBB 4LHYA 2QX4A 4OXQA 1H0HA 1MXHA 3F4KA 3ZCTA 5ALOA 1OASA 5FA8A 1GVHA 5EJ6A 1JU3A 1KMQA 3AETA 4LWOA 1RJ9A 1B15A 2IYQA 2ROQA 5JS2A 1A9OA 2WICA 2X3FA 5KO2A 1NVKA 1O4WA 3ZY5A 1SOVA 2BSAA 2ZIVB 4DDTA 4ZI2A 1T0IA 3LKBA 3UHOA 1KYZA 2CJYA 1E0DA 1XPJA 3DMRA 3AEKA 5D86A 5GM2A 5TGZA 2CZGA 1LI5A 4ZDKA 7ABPA 3OQNA 4J16C 4NCXA 5HPYB 2MR6A 4L75A 2ZQZA 1DNPA 3EBLA 5AVKA 3OMXA 4CKEB 3BTSA 2BMEA 3EF1A 2VZ8A 4Y6PA 3C0KA 4ZYTA 3KR1A 3WLEA 3F96A 4BGIA 4DREA 3LBYA 3N2LA 2ODWA 2JHGA 5HOEA 1ZBQA 3GLSA 3LPCA 1W0KD 1NMEA 1N32B 1RADA 2C2YA 2BD0A 1WXEA 3PHHA 1YIAA 2ZYIA 1TDJA 2R6DA 1SU8A 4LI3X 1K8ZB 3HV2A 1EWTA 2VDUE 3FN4A 4NONA 3FR7A 3GARA 4D9IA 1YKFA 1RHMA 4IIYA 2EKZA 1Z2DA 5REQA 3QA3E 3CUYA 2FKAA 5HS6A 3PX2A 4GP6A 2J6CA 2ZJ3A 4OD0A 4C78A 2IF2A 4NZOA 2V5AA 4ZJYA 1E9RA 5F35A 3SDZA 2QLLA 2FWNA 3OZSA 5KYYA 3C8ZA 4Q3NA 5FNVB 4X9XA 5BQPA 2Y6VA 1HR0B 2HYIC 3A6FA 2PSDA 2OZLA 3G8CA 5CP8A 2FRVA 4ALMA 2A86A 2WJAA 4LHSA 4RYLA 5DE3A 5HRCA 3BKWA 5HYVA 1VJCA 1ZJ5A 1BEUB 1UBGA 4Q47A 3NMUF 3KAQA 4JLBA 3E6AA 1FMLA 5ECYA 1ZW6A 4W7SA 5BWMA 4DLPA 3VSAA 1NF2A 4J7XA 3VVLA 2DPMA 1GLGA 2P9ZA 1JJFA 1OV4A 2BDTA 2YHIA 4YALA 3LLMA 2GDZA 3SY8A 1RHJA 4CI0B 4KQEA 1VSBA 3AQ4A 2QT0A 3ZLVA 2HBYA 3QE2A 5A06A 2R751 5KJCA 2I87A 1WL8A 2DBVO 4JJAA 5JAZA 3GA5A 5E95A 4RKFA 1UKCA 3QMMA 2HJGA 3MJEA 4TX1A 1UMDB 4ZVLA 2VK8A 3RFXA 1CERA 4AZ0A 5IVHA 2LNDA 3N8IA 2WT8A 1LTKA 5EEHA 3VPSA 1GLVA 1LDBA 1C5KA 1DBPA 4BQQA 5I9NA 3UJ9A 1JW9B 4BP3A 1G7CA 3CVVA 1W5EA 3HWWA 3IAM6 4U9UA 1VMAA 3O8DA 1SCDA 3BE6A 4QULA 4DLKA 4JIGA 2JI7A 1JPVA 1Q7RA 4B0PA 1GUAA 1NE2A 1J8MF 4JXJA 4PM4A 5JBIA 4PR0A 1PZXA 4MDHA 2W70A 4JOBA 3RC1A 2CDAA 4RADA 4WINA 2QEQA 4ZREA 2H1SA 2QAGC 2V54A 1Y4SA 5SZJA 1UT6A 1UJ6A 1R88A 4YMWA 4BO4A 2QX6A 3CRRA 4IIEA 2K2WA 3D02A 3KKLA 3L43A 1Q0QA 4JL6A 4EY6A 1E5QA 3QXHA 3OCZA 2DE0X 1Q12A 3V97A 5LDDC 3GGPA 2VF5X 4NCHA 5FEUA 5HIJA 3PFNA 4RGBA 3EGWA 1RVDA 3AK4A 2HLHA 3FA2A 4HLCA 4IYJA 1Y48E 2GO7A 2Y8EA 3AJ8A 3LCCA 5SYAA 4D3DA 3IUYA 2I3BA 4WY2A 4DIDA 5JMTA 3DCNA 3PPXA 4BZXA 3G0IA 1I3LA 1FRZA 4RTPA 3WO0A 4ZYUA 1CZNA 2NQ2C 3RK4A 4D99A 3D8SA 4F2HA 2L18A 3KE9A 4H59A 1EFPA 3GUYA 2JLUA 1WRBA 2C7GA 1ZEJA 2G1PA 1DWPA 3PRKE 3DSRA 1VSVA 1HURA 2AMLA 4S35A 4EEZA 4UD6A 1KKUA 2P11A 1YR3A 4ZTBA 1E6WA 1KDYA 2XCOA 4RANA 2H65A 3GLVA 4K05A 4BRUA 1U8TA 4PLFA 3OEWA 4Y6GB 5DTEA 4KX3A 3O4HA 4MVJM 4ZK6A 4L7VA 3KOMA 4C5BA 4MVJF 1LCIA 5CCDA 5K7SA 4P93A 5AHRA 4EQ6A 2ZB8A 3LWZA 2JD0A 2VRNA 3NWJA 3AMVA 4FWTA 5LFAA 1RAEA 1L6IA 2IHYA 1BXGB 2ABWA 2BTOA 3L7IA 1FF9A 3VX3A 4EGCB 3N5KA 4HAIA 1F9EA 1OFHA 1HZZA 2DFKB 4AG3A 1LRLA 2QTCA 3W5SA 1T9ZA 3OU6A 3U7IA 4AY5A 2WUDA 3HKEA 4RH0A 3NH6A 5DTMA 1U2DA 1ZGCA 2JD2A 3ASUA 3KQSA 5TRTA 4LECA 2ZBVA 3RJZA 3ENZA 3Q5EA 2WABA 3RQIA 4BGDA 4O0MA 4CF5A 1OA1A 4KUEA 2ZI9A 4ACAA 3LVBA 1U2PA 1PT9A 3FE2A 4AXBA 2GMWA 1ZJWA 1O94D 1EDDA 3KDPA 2LCFA 1RHQA 4WRRA 4BO9A 1E4OA 1T5TA 1RLOA 4TYYA 4OBBA 3LC7O 2R60A 3FETA 4JB3A 5IBQA 2CD9A 3WDLA 4RD6A 4WJKB 2PANA 4L78A 2WKPA 3THWB 1W2HA 4XQ0A 2QTMA 3VSBA 1TZBA 1W47A 3ZU6A 5U9CA 3UUFA 1XCPA 2JIQA 4MYSA 5F7JA 5LQSA 1N0IA 3KQPA 1OAAA 4BPBA 3GRVA 4D6PA 1BJRE 4IIFA 1EFRD 2ET6A 3GN1A 1A5AB 2ZYWX 3KTFA 3EXHB 3LPDA 5EJ2A 3AB7A 5CBKA 2C7VA 3MWGA 4I1SA 3PHLA 1AHPA 4E0BA 4EDFA 2A9KA 2XWBF 3T6KA 2WWYA 3V8BA 4DR3B 2G63A 4EHJA 2XT9A 2J7PD 4TTJA 1A3CA 3RSFA 4D9JA 1ZK3A 5JEDA 5FUMA 1XZIA 2VDKB 5KUTA 3L7DA 3EJWA 2G9VA 2WAXA 1P7YA 1OXSC 2SKEA 4M3NA 1LZKA 1M6EX 4Q00A 3BS4A 4EW2A 1WBBA 1NUUA 1PE0A 2GN1A 3ABZA 3LV8A 3NIFB 4NARA 4YQZA 2GD1O 4MVWA 1XNGA 5G4LA 4MVJA 4MTCA 2J6IA 4G6ZA 4YQFA 4UTZA 4GBMA 5ALYA 3WTBA 1PN3A 4XTRA 4CIVA 4UE3S 5U4XA 4J3JA 1KMNA 1U9IC 1X7YA 4WDRA 1YVDA 2LCIA 4QT4A 1DJQA 2ARKA 1V26A 2DWUA 4XWTA 1CZOA 3VPCA 3ST7A 3AF2A 5H8WA 1FFSA 4M4SA 1O9BA 4HH4A 4NV1A 4ZQEA 1AGYA 1ZH0A 3CISA 2RB5A 4JROA 3DE4X 1F6DA 3KXPA 3MJCA 3NYQA 2WYOA 2IS4A 3DUFA 3O94A 4Q05A 5F1YA 4AZ3A 4Z7NB 1O95D 4IIJF 1IYZA 5IT4A 3S2SA 4MPJA 1UEIA 3LT2A 1Q14A 5AKHA 4JJ8A 4TRNA 5DWDA 3DZGA 3EZ9A 1SBIA 3FFXA 5KDLA 4FS8A 3WGJA 4OHXA 1ABBA 2PSHA 3B3AA 3INTA 4N47A 2VF8A 1T6BY 3A2NA 4ZEXA 3IXMA 3PJRA 4X1OA 5GGYA 3HM9A 3KLOA 4ITUA 2B8EA 2HXYA 1JHAA 1IOVA 4WASA 2XEXA 3CZCA 2G7ZA 4CLXA 2QN7A 5A9TA 4F4HA 3Q11A 3N6VA 2WV9A 3KPVA 3LP6A 2JLVA 1Z6QA 1PGNA 4KRGA 2FPIB 1FYFA 1WHSA 3CVWA 1FX1A 3B6KA 1XHEA 3E84A 4D5EA 1RM5A 1FDUA 2N3ZA 2V97A 3EZXA 2VPZA 4YAJA 3D1JA 4RA6A 3TAHA 3WNDA 2Y1CA 3REQA 1WG8A 5CFNA 2XVMA 4N3AA 3IA2A 3TI7A 3HN7A 2QWXA 3R0JA 4V39A 3UHPA 1XVVA 1IATA 1LC3A 2VR1A 4F93B 1UINA 2GSDA 4DR1B 3U4GA 1VGRA 4E4YA 3TOSA 4GQAA 5AKEA 1CUWA 3T34A 2WHQA 4LDZA 4XUEA 1IK4A 5F78A 4F6RA 1RYYA 1OAOA 2NIPA 5CVDA 1QH0A 3D7MA 4DPMA 4LJ5A 1P80A 2HYDA 3KR0A 1SBCA 4NL4H 3T99A 1AE1A 2QL9A 3JQ8B 1UPTA 3KYBA 2G9QA 2DTEA 4IXNA 3W5JA 1JZTA 3WMWA 3SZRA 2BEVA 2EKBA 3MUOA 1BFKA 1JXMA 1T8WA 3EVFA 3HR7A 3KL4A 4G67A 1GUYA 5CW1A 3ADOA 1IXRC 1D3AA 5I9LA 2PVCA 4ID9A 5KVQA 2IYYA 2NU6B 2V74B 2W48A 4E3WA 4KACA 5E9QA 1T4CA 4H3KB 1YS6A 2OWEA 1F2UB 3RC3A 1TJYA 2PPVA 3OHMA 4JB2A 5ALJA 1V8FA 3DYIA 1VP3A 3ESAA 1ONPA 1JLSA 1YQ9A 5EA2A 1ZJZA 1R0YA 3CUSA 3THSA 3ZQKA 4IIJA 5EUQB 2ZS7A 1W0KA 3KJQA 4H1TA 3L84A 1FRFS 4M9CA 3UCFA 2CLCX 4DJEC 2AXPA 3GJRA 3W6NA 2VP4A 3GMDA 4OQYA 3LUBA 3DE3X 1A9QA 1Z26A 1PEDA 2H17A 3GZJA 3QBTA 5LKRA 4CLEA 3CR3C 1XMSA 2F3RA 4DADA 1EK5A 3MB8A 4GXRA 1YUNA 4N3GA 3U31A 3CG4A 3SZ3A 4FEYA 3OPQA 5C34B 1L7AA 2PQMA 3V8RA 1GTRA 5IXSA 2IW3A 3GLRA 4L27A 4D57A 4D8WA 2XGJA 2A9VA 1X80A 4TN1A 5AQEA 1Y8AA 2WHRA 1EHCA 2WLSA 3IH5A 2ZCUA 4HGNA 4QRDA 2D5IA 3SC6A 4AMVA 4C4SA 1WXXA 1TT5A 1GZVA 2QTTA 3GDHA 3U4DA 3KKEA 1E8MA 1VB5A 3PC2A 2QX7A 3VTZA 5BUSA 3M6VA 2YWRA 3GJTA 2PU5A 1WX1A 2QUAA 2V5VA 2Z08A 1X86B 3N58A 4BC1A 2KSQA 3NNSA 4EJFA 2DPXA 3PF8A 3UMYA 3K4QA 4MS1B 5EWJB 2FPXA 1DHTA 4C21A 2M2IA 5D5QA 1KY2A 2X9LA 2C4WA 1G7RA 5A7HA 2XRMA 3CR7A 1XEWX 2PHZA 3G1WA 4IQ4A 3NHZA 2I2CA 4XAQA 3WWCA 2BELA 1C8LA 1X1RA 2I67A 3QPWA 3OOWA 1CUZA 3BMNB 3CH7A 2I9KA 5FPYA 4FNGA 1V43A 1XDDA 1D0VA 3EUEA 3EY9A 1J97A 4MYHA 4R2IA 3RSZA 2D3TA 5EQDA 4E4TA 2J0QA 4JV5B 1SEPA 4Z2AA 4FR2A 3P9RA 3OZFA 3THXA 1CT9A 2AHRA 3KYJB 4NF2A 2XMPA 3IPLA 4KKXB 2JDID 1MA0A 2GAJA 2ZUTA 5AK4A 1QIGA 4EI8A 3GT0A 2YFKA 2WG2A 3W3AA 2OCGA 3E7WA 2ENUA 1NPTO 1V9CA 2R1TB 4FW9A 4PSUA 4UQLA 2JFPA 3Q8MA 3HKDA 4V2UA 4KXFB 4P4SA 4MB6A 4PTYA 1BOOA 3WTCA 2O2JA 4HS4A 5AW9A 4JMPA 3WHLA 3OX3A 1MJ5A 4L76A 4ZA2A 5IVIA 3RK0A 4AJLA 4B87A 1CFJA 5E3HA 4FPXA 4JBHA 3CJTA 5BR7A 1DQZA 3QJYA 4LTNA 1ZPDA 2ZBUA 3BFVA 5EMHA 3UB3A 5E3IA 2H1IA 1R0WA 1YMUA 3M0EA 1NVAA 4P7GA 4BCBA 1DEXA 3SSMA 3VNSA 4J0HA 1UWLA 3R5TA 4XX0B 5I6DA 1Q6ZA 1R6XA 3ORRA 4YECA 3OZGA 1LJLA 5G0TA 3ZZUA 4Z4HA 2V59A 3WZ2A 3FNQA 2ONKA 1VOTA 3ETDA 4W5TA 1F60A 4DG9A 3EVZA 4HH3C 3LQKA 4BKUA 1F5NA 2GHRA 2XXJA 3LHFA 2QM0A 4DCNA 1N2GA 3QENA 2ZS9A 1N2XA 3OU2A 4LF4B 4CCYB 3IAEA 4MUKA 1VKZA 3Q6MA 2P69A 1VJ1A 2PBFA 2WZDA 2CGEA 3GUVA 4F6CA 2XBUA 1X92A 3D5TA 1OWLA 4RMIA 4Q9JA 4U7WA 3WBBA 3D6UA 1Z6ZA 3DD5A 3LQQA 5NULA 1Z63A 3SQWA 4J4TA 4EYEA 1JIVA 1C0KA 3FWYA 4TVSA 4KTVE 4L8VA 4WZBA 5AJVB 1SIWA 4LHEA 1WS6A 4IIGA 2O3SA 4ARZA 1OTHA 1JEDA 3DT6A 4HLQB 1P73A 4GKVA 3W7BA 2WU4A 4D3XA 1OY1A 2DWPA 5EE3A 3DDCA 3T94A 1W36B 3P0EA 2W5UA 1CJMA 1DC3A 4IQFA 3I61A 2GN0A 1EE2A 2O07A 2JFNA 1UBLS 1XP8A 2ZAIA 4LPSA 3SHWA 1G9XA 3VO2A 1TB4A 1W4RA 3GRZA 2GYYA 1XCBA 1G1MA 1Z16A 1F48A 4RNDB 3BHMA 4DLLA 4KMOA 4IQ0A 1DHRA 2AG6A 3GG2A 4GPBA 2W71A 2XB9A 4E07A 1F0YA 4J16A 3TL2A 4KDEA 4IWYA 3HBMA 5HIIA 1JQ3A 3NBYC 4Z54A 2XNDA 1YNOA 1JWLA 4H60A 4N8SA 1T5OA 4CE6A 4MI9A 4C7KA 2PS1A 4UNNA 2CEAA 4OQNA 2VJQA 3F98A 1U1CA 4EW3A 1ESMA 3WQBA 5K0BA 5DV9A 2JFFA 4Y2PA 4YRQA 3LFTA 2P8SA 1OIVA 2H63A 3V7UA 3RADC 2QPAA 4DN6A 2CLMB 1M34E 2ZJ5A 1C0PA 4PY2A 5AKJA 4GXNA 1IJKA 4YRKA 5B2FA 1KIMA 4IXTA 5KNBH 4LC0A 3ZZTA 1I94B 2BBTA 4HMPA 4HXFB 3UKOA 1A50B 1CJUC 1ESCA 1S89A 2PEZA 1DAGA 3ASVA 4CM4A 1CUBA 1DXYA 1MB2A 3ABRB 3DZBA 3GNLA 3OAAD 3GCWA 3P2JA 4FP9A 4KGVA 4OF4A 2XODA 2V0GA 5JHGB 2XUPA 2AJ8A 2XYVA 2DR3A 2VAXA 1JQ5A 2C0QA 4CIDA 5JR3A 1JHVA 1NP7A 2M98A 2Q4BA 5AOVA 5I9IA 4H7DA 2QMOA 4P4GA 1VSQA 1VYVA 4G25A 1UXJA 1E6MA 4LSZA 1GFWA 2WNIA 1I5OA 1SULA 1PJZA 5BW4A 4U8GA 1U5AA 2XRFA 4KPUA 4ZD6A 1EG7A 1XNHA 2FPKA 1NRJB 1OW3B 2HI0A 4GVXA 5GOTA 4C4RA 5DHRA 4AJIA 1T8YA 4YT2A 2O8BA 5JANA 4CG0A 4WUTA 2TYSB 2W22A 1GU7A 4PAWA 5JWRA 2YXBA 4X92A 2G80A 5KYNA 3GOHA 1T10A 3JD1A 4KZPA 1PJ8A 1I4OA 1PGJA 1TJNA 1S96A 4K88A 4AD8A 3I3OA 2RI1A 2FX3A 1A4XA 4UOQA 1C4OA 4HI0E 1WB5A 1JTFA 4DA8A 3W5IA 4F4UA 4HB3A 3M5DA 1I0ZA 4UBJA 1GDHA 5CXXA 3V8QA 3G17A 2JAPA 1J0DA 2ZGVA 3F49S 1LH0A 2EDCA 2FWMX 4IXDA 5TR9A 3WX0A 2QL6A 3V5NA 2Y0CA 4WW0A 3BDAA 2R44A 3S3TA 4Y1FA 1KFEB 1SAYA 3W5VA 2D2FA 4PO1A 1TM3E 1ZJ6A 2A9PA 3DKPA 4CQLB 4DM4A 4EYGA 1JTVA 2ZREA 4RHEA 4B6OA 4PLVA 3ZD8A 4ZVUA 1NP6A 2P2NA 2PJZA 1XTZA 3A11A 4BB5A 2ATVA 2PL3A 3AR6A 3WYCA 2Y1KA 1EXMA 8LDHA 5KMGB 4ID3A 4U9IS 1T6XA 4BECA 3TOZA 4ES6A 4LXUA 5J1SB 1P3DA 1BVYF 1K8XB 1J8YF 2Y92A 1LBQA 3N7UA 3CRMA 4P3PA 3WBFA 5TQ2A 3JVDA 5ICMA 1ZAYA 4KE8A 3FNEA 5TVGA 4QHSA 3W7AA 4B09A 4NZMA 1QOZA 1OX4B 3PYLA 4W7IA 4F2GA 1Y9ZA 1D2GA 3G9UA 1YDWA 3CO5A 5HBGA 1M6WA 1NZJA 1C29B 4G84A 1U2GA 1TEXA 3K09C 4I36A 3U7QB 4DWVA 5CA0B 1G41A 3KLBA 5KPDA 2Z5GA 3NNDA 2PT9A 3C1AA 2DHCA 3OCUA 4LMAA 4BXOA 2BI7A 2QD3A 3AERA 1WZ2A 1YA8A 2BW0A 3I5UA 2IHKA 3L8MA 1COZA 1N9GB 4FJ1A 3E5NA 4IZIA 2VWQA 5KDDA 3S1SA 2H9AA 1GSIA 1W85A 1Y81A 3LL4A 4Q16A 2MCFA 3VXKA 4FEAA 4CU2A 5AVQA 3HDVA 4ZAZA 2DY0A 3MN1A 3VH2A 2VIIA 2VSFA 1E9BA 3IPCA 1ZSVA 1T8SA 2AN5A 5EZSA 2FK8A 5IAJA 2J3JA 1G8KA 5ALTA 1Q22A 4YJKA 5GAJA 4EO7A 3IO5A 4HH1A 5JXIA 4QRHA 3I4FA 1XZNA 1E2FA 4M8KA 4MW0A 4CV2A 5FL7D 2WTUA 2IS6A 3BGDA 2X9QA 1T3SA 4FXOA 3A1SA 1E9EA 3SSNA 3KKKA 3EEOA 5EJEA 4MUJA 1TAHA 4X62B 1Q21A 2VQ6A 4M7RA 4QUKA 4N7RA 1V4VA 1GPBA 4LYEA 1XDGA 4AS2A 4JP1A 3DQPA 4NESA 3PZRA 3BBLA 2J0EA 3JYHA 3T4UA 1ZM3A 2J9GA 4COKA 1V1RB 1FY2A 3BSFA 3CVXA 1EZZA 3ER6A 5KCZA 1CHDA 5B1YA 1NR1A 3KC2A 4AKIA 3CZPA 4DCVA 4A6PA 3L6DA 3SJZA 3U62A 2C8JA 3WYBA 1KVQA 1QHFA 4RS3A 1N78A 2ZBEA 2N42A 4OLBA 1P5FA 2AW5A 1FDTA 1SOMA 2GLUA 4C1NA 4YDRA 2DULA 1EQUA 1SQ5A 4Z0PA 2WAAA 3HB0A 5FTLA 3ACCA 1DZ3A 1Y8RA 1JDSA 3UJDA 1YK0A 1KAEA 1BGVA 2I6SA 2WMDA 1TKBA 2IPAB 3L18A 2D1TA 1SBYA 1SKQA 3ETCA 1WMEA 3NM6B 3KOYA 5HKOA 5KHLB 2D8AA 4X8LA 1F5SA 1KEEB 1LXCA 4PGGA 4QWWA 3AKEA 1XDZA 3MYRA 4XFKA 1RXUA 2ZIAA 3TS1A 1I4LD 3FKSA 3N6XA 4HS9A 5AM2A 4WNIA 4D8UA 3BREA 5ALWA 1Y5IA 3UMFA 2Z2ZA 3H84A 4B44A 3IUSA 1TGYA 4RDCA 5AO9A 5LL6P 3NOOA 1SHLA 2XTMA 2QLBA 1C7JA 1LPMA 2QD2A 3NTRA 4KVFA 4UU8A 1B8PA 3F6PA 5ERYA 4ZYVA 4HNAA 4LY0A 1VHTA 4HXEB 3NO4A 4CETA 2PSEA 1M6VB 1YBAA 3BWYA 3T4XA 5LJIA 5JU6A 3TZEA 4BMNA 5ISMA 5F51A 1FPMA 5G41A 3KKOA 1J9ZA 2JGIA 1MAVA 2NXEA 1T2AA 2QNIA 2NU8A 3QY9A 4GZLA 2Q41A 4DLZA 4RDHA 4EWLA 2H0AA 1LFAA 1BC5A 2XX3A 2IODA 3RFCA 4YUWA 3K9WA 4P3NA 1U0GA 3DHEA 3I9JA 4BQOA 4CCSA 2RGXA 1U8EA 1U9IA 4MGEA 4B2PA 4R2KA 1NNEA 4LPKA 1MEJA 3V32A 2GTIA 1U9ZA 3QPCA 4GOKA 2AR7A 4QFCA 2FZGA 5DM2A 4BTLA 2QXYA 4DCOA 3AEQB 1JA1A 1K92A 4DY6A 1KJWA 4GOLD 1L5HB 4MPPA 5JRZA 4P86A 2J0SA 3QXCA 2G6TA 2WINI 3Q3VA 3ELYA 3GJ5A 2O3UA 3IJEB 4BX9A 2F1IA 3MSXA 1W35A 2GH1A 3N75A 5JYEA 1MNQA 1SO8A 1EMDA 2C5HA 3WGHA 3EZYA 3O8QB 1KH1A 4L8FA 4J0CA 1SHKA 2LTAA 3C3JA 3CLVA 4NPHA 1R00A 1EM8A 3OD5A 2E49A 4PC3A 2HA7A 3MWFA 3OUTA 1TUBB 4Q02A 3TMYA 4DBLE 4YV1A 2I3GA 2OK8A 2WQZA 5D84A 2G1UA 2D1RA 3JW8A 4DAEA 4Y2SA 1PL8A 2SKCA 1GT6A 1NHGA 1T1SA 1P4GA 3HO8A 4RD1A 4R8LA 3I34X 5J40A 1JR6A 1L5WA 1S01A 2TS1A 3IOYA 1Z5PA 2XUJA 4RZ3A 4RD2A 3GQBB 2EX0A 1GTMA 3QFTA 2ZVJA 1TNDA 3B52X 3K2QA 3X1KA 5I8PA 1I0LA 3EQ7A 4S0ZA 4G0VA 1CNEA 3GVXA 1ZIXA 2ILVA 4PQGA 3RTBA 4BJ3A 1QP8A 3QF7A 4BLQA 5DX1A 1FFXA 4FMCB 3VPDA 3CXRA 4G26A 4P0TA 3DLTA 3HFSA 4YK7A 1VKOA 3EXIB 1RQGA 1BW9A 4JYBA 4BDTA 1GQFA 3S2EA 3VU0A 4YONB 2JLBA 4E51A 3NBUA 4D1YA 3A26A 3E7PA 1RWVA 2IEYA 2AEFA 1G8YA 4WL0A 2LV8A 5D51S 5F5NA 3UK1A 5JJBA 1ADJA 1AZSC 4F5ZA 1UFRA 1E3EA 2Y1EA 2EAUA 5A9RA 2AN4A 6NULA 1I1OA 2FVXA 3NBZC 1K6IA 5HCUA 1XZPA 1U0TA 2WC1A 3KQQA 4RK4A 1RACA 1TTPB 1X1AA 3I6IA 1XF1A 3PWZA 3NIWA 2CCKA 2BHLA 4OL0A 2XMGA 3QMVA 2L82A 3GJ4A 2FEOA 3KZCA 4LNUA 4RMNA 3TJRA 2Q8QA 1BXZA 2I6TA 1AHHA 5IRCD 1W7AA 4C7MA 1DS6A 3DFFA 3AETB 3KCNA 3DLPX 3BXEA 3JVUA 3LRTA 2F4VB 1RJ9B 1EJ0A 2XYHA 5AI6A 5JZVA 5ALSA 1MORA 4HX5A 4GX5A 4N82A 4MPTA 5TQ0A 4H35A 1X7WA 3D43A 4PYIA 4RF4A 5CK4A 1QQ5A 4CQJA 3AEKB 3GLHA 3DC7A 3TLXA 3JARA 3H1FA 1V8DA 1WW3A 3G2PA 1GOTA 3UJCA 3VDNB 4G1BA 4IDBA 4Z86A 3VSDA 4DMGA 5KWIA 1H22A 3O74A 1G20E 3EH2A 1JZQA 4F46A 4XPIA 2ZSKA 5J2UF 3A2MA 1SY7A 4LRXA 2HSJA 3HCWA 4D97A 2OENG 2YV2A 3V1UA 2QMYA 1TZJA 3L5OA 1QQTA 2CVFA 4FKMA 2ZRCA 4RXMA 3CX7A 2R6ZA 4X6YA 4RSRA 2RI6A 3C3KA 2DPYA 1HLGA 2EFHB 3EBPA 2R65A 4NJMA 1A8IA 1KGSA 1AURA 1CLEA 1E2NA 3BRQA 3IKLA 3RBXA 4E7PA 4Z1OA 5JSZA 1HQCA 1T4BA 2O0HA 1T5DX 4BO2A 5JW6A 2O6HA 4GWGA 2IBTA 3NDBB 4R9RA 1JEAA 5FTWA 3PGLA 4NMMA 5E4JA 4D8VA 3AVQA 1RZ3A 1O4VA 2VHTA 2OHVA 2VXOA 5REQB 2VDOB 4PFKA 3F78A 3RLFA 4HDAA 4PHGA 4D3ZA 4DZZA 2LXNA 1CUUA 3NVAA 4XB2A 2BGGA 4TPKA 4S05A 3I8OA 3O4FA 2YUIA 3KR2A 5KZMB 1QHNA 3VR4A 2H1OA 3P71T 4MEJA 3KTOA 1B8VA 2FK7A 5MFPA 3L8FA 2OZLB 4J2TA 5KI6A 1Z34A 2IEIA 2RJOA 1U8AA 4E1BA 5BWLA 4AP5A 1KEVA 2CXRA 2I7DA 3DWIA 2PZMA 4MR8A 4RSMA 5HGJA 3NM5A 2R6R1 3HCPA 1C8BA 1KTIA 2PSJA 3EG9A 1M5RA 1Q84A 1D9ZA 3V4PB 4D4GA 4NLLA 2AG8A 2VPPA 3GEBA 2CNNA 5KKNB 4V0MA 1V2GA 2YHIB 2PLFA 4HTAA 3T9FA 1FSSA 4OHYA 2XAAA