4KSLC

Gumby/fam105b in complex with linear di-ubiquitin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The linear ubiquitin-specific deubiquitinase gumby regulates angiogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Protein FAM105B
total genus 41
structure length 150
sequence length 150
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kslC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kslC01
5D7GA 3KUDB 3VXWA 2IO0B 2KX3A 2NPTB 4OVVA 4CO7A 2K6DB 2MP2B 2V4LA 2Z0EB 2CHWA 2C60A 2YLMA 3EECA 3R66C 3NS8A 4IWOA 1GJZA 1L7YA 4LDTB 3ENEA 2FCQA 4PS7A 3QC8B 4J6IA 2DENB 3QARA 2O6VB 2M8SA 2ZEQA 4HJKA 1WMHA 2KDFB 2RD0A 4K1RB 2IZVB 3IVFA 3U30A 4ANUA 4B9KA 1E90A 2KMCA 3M62B 3VDZA 3DBRI 4GB9A 4IG7B 5JZEB 3X0WA 5DPSA 3AI5A 1OQYA 4JLCA 2LVPA 4KIKA 3ZNHB 2XK5B 4MH0E 5JH5C 2NS5A 4AUQC 5LXHA 1UBQA 3WAOA 3ECIA 3RT3B 1BT0A 3QHTA 3EC8A 3KVFB 3TL5A 3AULA 3ZKJC 1EF1A 1P98A 3SD5A 2LGXA 1WM2A 3VFKA 4WQOB 5CHFA 2LGYA 5GMVA 2ZNVB 2ZVOA 1YX6B 2BGFA 3KUZA 3V61A 1V5TA 2ZPYA 2D11A 2CHXA 2KQ7A 1RRBA 1T0YA 1WMHB 2DZKA 2GBMA 2NBWB 4IM3A 3X23A 3M3JA 2KLGA 4GDLB 4KVGB 3I3TB 4BKTA 2A4ZA 2NBUA 1WGRA 3D32A 4MELA 3A4RA 2GMIC 2BYEA 1JRUA 3T8MA 3ALBA 4E74A 2RPQA 3VTWA 2LRUA 3N3KB 4AJWA 2OJRA 5IA7A 2N9XA 3DDCB 4KIKB 3VVWB 4A20A 1UD7A 2REXA 2ZZPB 4BKSD 2MCNB 4TQ1A 1P3QU 4YL8A 5D2MB 4KDIC 2JPHA 4WJQA 5C1ZA 3N30A 4DBGA 3PRZA 4NNJB 4W9EA 3CSFA 1WJNA 1YQBA 3H7PB 1E8XA 1H4RA 2BKFA 1YJ1A 3DPDA 3PRMB 1KM7A 4G3XB 4G50A 2KD0A 5FR6A 4HLEA 1Y8RC 2RSUA 1XT9B 1OEYJ 2N9EB 3ML9A 4IM0A 1QZEA 3RYTA 5DCNA 2O2VB 3ZIMA 5J2RA 3QJZA 4MGZE 1V9JA 2O2VA 3A9KB 2KWUB 3H9DA 4EKUA 1V5OA 3VUXA 4ZRKA 3VHTC 1P9DU 2KXJA 3QA8A 2C9WB 2CU1A 5G55A 2KDIA 3EHVA 3LJ3A 4DDGD 2B3AA 3VAWA 2IBIB 2A5UA 2IO3B 4NQKE 4E71A 4ZRJA 3APFA 4I6NB 2BYFA 2MA9B 4A3PA 3WAMA 1NBFC 4NAWA 1KJTA 2R2OA 3U8ZA 4NJ6A 3ZNGC 3ZTDA 1WE6A 3IHPC 4W9GA 1OEYA 3DVNU 4LJOB 3OJ4B 5IAAC 2XEWA 2V1YA 1WZ0A 2CS4A 4DK5A 4KDLB 5CHWA 1TTNA 4EZJA 2GBJA 2G4DB 4G0NB 3H1UA 5D94A 1J19A 3ML8A 2HJ8A 1FXTB 4PYZA 3VUYA 2WX1A 2L8JA 1WXMA 4BBNF 2JY6A 4NPNA 1ZKHA 4ANXA 4MJSA 3OJ3A 3A4SC 4F7ZA 1V80A 2LJ5A 1WGGA 2MP2A 4IUMB 2LGDA 4HWIB 1GNUA 1WYWB 4BKSA 3W1SC 2KN5A 3UIOB 3NHEB 3QAQA 4X57B 4AWJA 1UGMA 2IYDB 1TGZB 2NR2A 3PZDA 4DHZE 1C3TA 3ZLZA 3R7QA 4GOCA 1WX7A 1WR6E 2MBBB 3IG3A 3NOBA 2BPSA 2KMAA 3KUCB 4PS3A 5AZGA 1VCBA 1WJ6A 4HPMB 2L0TA 2XK5A 4NY0A 2JZ3B 3N32A 4FA6A 2FAZA 4W9IA 4E3CA 3PSEB 2I1JA 2KLCA 4II2B 2GBNA 3JSVB 3UQAA 4K7UA 3PGEA 4MM3A 3R7RA 3V62A 3ZDMC 2WYQA 4P7IA 1UELA 1V86A 2IY0B 2K8HA 4B95A 2JVCA 2KJRA 5DPTA 1EUVB 3DVNV 3PREA 5CTRC 4F8CB 5E6PA 1WIAA 3NZSA 1RFAA 4KZ0A 2MBOA 2KQSA 1WR1A 2LXAA 3W1SA 2LZ6A 4ANVA 2MQJA 2KFJA 2L7RA 3PV1A 5C23A 1WFYA 2PPHA 4I6LB 3KH0A 1SGHA 2N7EA 3PVLA 4WWNA 4AJYB 4FHKA 3AXCA 3ZVVA 2PEAA 3KW5B 3A9JB 3VTUA 1HE8A 3CMMB 2FNJB 3RULA 2KTRB 2LVOA 3KYDD 4WWOA 5LLIA 3DOWA 2KJ6A 4PYUA 4WAAA 5AZHA 5JHAA 4K81A 2N4FA 4IC7B 1KLVA 3M63B 2KKCA 2MSED 2KDEB 2ZCCA 2KVRA 2K25A 3RUIB 3HHMA 2C7HA 5J18A 2MBEA 3APDA 4II3B 2K1FA 4GDLA 3A1QA 4IM2A 1GUAB 3H7PA 2CHZA 2KWCA 2G4SA 1SE9A 1YD8U 4W9DA 1U4AA 3RZFA 2C5LC 1GC7A 2KDBA 2L76A 5G2NA 3Q3JA 2AYOB 2DYMA 4FJVB 2L05A 3O65B 1LM8B 1VD2A 1EO6A 2V3SA 4RMAA 2M17A 2DX5B 2WDTB 4GDKB 4K7WA 3B0AA 4URKA 1L2NA 3DCGA 2JZZA 4XC2A 3VH3B 3PPAA 2KTFA 2KK8A 4DWFA 1S1QB 2BWES 2LUEA 1IYFA 1LQBA 2D2QA 1OGWA 2DZJA 4CHKA 3ZUNA 4HCPB 3MTNB 4XZ4A 3A1QB 4HK2A 2KZRA 3U7DA 4CYEA 5J17A 1RLFA 2AWTA 1P1AA 3PT2B 1MG8A 5LXIB 1Q0WB 4HXDA 1Q5WB 2NPTA 4PS8A 4RM9A 3WIMA 1C1YB 3A33B 3B1LX 4WJNA 1Q1OA 3JW0X 4RM8A 3ZNZB 1UBIA 2ZNVC 3VQIA 4ICVA 1WZ3A 4NJ7A 3QK0A 3A9JA 4EUTA 2D10A 3B08A 3OLMD 4TUUA 2PJHA 2R2QA 1WGDA 1I42A 3GZNI 3R3MA 2QHOA 4ZDVA 1WXVA 4W9KA 3ZO5B 2DZMA 4G11A 3L16A 3DBSA 3IFWB 1RAXA 4ZYNA 4MGKE 1LFDA 3LDZE 2D3GA 4OVUA 2MW5A 3BINA 4EFOA 3PRPB 4F1SA 2FCNA 1WX8A 4BKGA 4N9F4 3WANA 5CX3A 1E7VA 4GN1A 4LJPB 5BO4B 3WA0A 2L3ZA 4MJSB 5E6NA 4FADA 1WGHA 3DVGX 4FULA 4LDTD 2JWZA 2CKHB 3UINB 3QX1A 4FJYA 3TBLD 3V6EB 2K8CA 1E8ZA 4EOYA 2GOWA 2KANA 2M1MA 2M4NA 4TV3A 3GOEA 4JGHB 1WF9A 2EKEC 1V49A 3PLUA 2KX0A 2BF8B 1WM3A 2FCSA 2L0FA 3HK0A 1V6EA 1WRDB 3VUWA 3WALA 3ONSA 2RGFA 5EDSA 2KOXA 3CSTA 2DHZA 4DHZB 1Z2MA 2FCMA 4AOFA 1E5WA 4DHJD 3L54A 2HD5B 4M8MA 5HKHA 2ZPNA 4FN2A 1XD3B 3DVGY 5L83A 3JSVA 2BYVE 3NZUA 5DPRA 4ZRIA 2WX0A 3HM3A 4IWPA 5JHBA 2NVUI 2LVQA 3DBHI 1R4MI 5AZFA 2WWZA 3BY4B 3SDLC 2MX2A 5AEKB 2NBVB 4FJZA 4AP4C 4GIVA 4LCDE 3P2BA 4FLHA 5TR5A 4BFRA 2JRIB 2KWVB 1K8RB 4EEWA 2MBHA 3M95A 4A3OA 1TZ1A 2IY1B 4TQ0A 2ZJDA 2HTHA 5E6OA 2BKRB 2JF5A 2J0JA 3PTFC 3A9KA 2KFKB 1H8CA 1IPGA 4BOSC 2DYOA 4MEMA 2DAFA 1AARA 2PE9A 2O6VA 3PHXB 1WJUA 2ZVNA 4M0WB 4MSMB 2BWFA 2N7DA 3IBEA 3H6NA 2VRRB 3Q3FA 1WJ4A 1TBEA 4IW0A 1WY8A 3T9LA 1OTRB 1WH3A 3AU5A 2J0MA 2HE7A 2KC1A 2FUHB 1V2YA 3JYUA 4KV2A 1YX5B 4M8NA 4W9LA 2MRPA 1I35A 1UH6A 3L17A 2L00B 3TJPA 1R4NI 2UYZB 4KZCA 2C7NB 2DZIA 2OOBB 4ASWC 1M94A 4MGIE 3ZRCA 2LWPA 1YIWA 2ZCBA 4KSKC 1J8CA 2MWSB 4BVUC 3PHWB 4K7SA 4DDID 1EF5A 3PS6A 3HM6X 4DHJB 2M0XA 2LASA 2O6VD 2LI5A 3L08A 4EZLA 3APCA 2RR9A 3TCAA 3UF8A 2J7QB 2MLBA 4GU2A 2FIFA 1CMXB 3V60A 2XBBC 2K39A 4HCNB 3ZTCA 3W1YA 3QQ8B 3HIZA 1UZXB 1F9JA 3C0RB 2FIDA 3DBLI 1G6JA 4MDKE 3ZW3A 4DXAB 1SIFA 1P0RA 2KTRA 2KC2A 3ZNID 4BOZB 1GG3A 3TIXA 2N9PC 2N1WA 2EMSA 1WXSA 4GDKA 4W9FA 2KNBA 2LXCA 4ANWA 1ZW7A 2GBRA 4FHJA 5KHOA 3ZRFA 1E8WA 2LD9A 2Z59B 1XQQA 2AL3A 1ZGUB 3OAWA 3ZDTA 4JL9A 2W9NA 4TKNA 1E8YA 2CR5A 1WE7A 1IP9A 4W9JA 3L13A 2EMTA 4MSQB 1GC6A 4XX5A 3UIPB 3WAPA 3QIJA 2DYBA 1E7UA 4W9HA 2UWQA 2PE6B 2ASQA 2GBKA 3S2AA 2KHWB 4W9CA 1A5RA 4ICUA 2KO3A 2Z0DB 2AEHA 3K9PB 2IO2B 2AL6A 2KFKA 1PQSA 2K8BA 2K6QA 4NAWB 4GGQA 4B6WA 1NDDA 1NI2A 2C7MB 3L0WB 1LXDA 4NQLB 3VH4B 4EZKA 4WJOA 3QCAA 3MHSD 5L95C 2I1KA 2IO1B 2KJHB 1WXAA 3RD2A 3H7SA 4GXBA 3DQVA 2JT4B 4JQWC 3UQBA 4GMVA 1X1MA 2LRWA 1KOTA 3VTVA 5DPWA 1S3SG 3PLVA 3SHQA 1ISNA 1V81A 3QWZB 3AU4A 3NY5A 3JVZX 2NCNA 5KHQA 3SU8X 4BBNC 2JUOA 2JRHA 2J0KA 4I6PA 3CF6E 2Y5BB 3RZWC 4FBJB 1WGYA 3EFUA 3K9OB 4KSLC 5D6JB 2N1VA 2G3QB 3L10B 4WWPA 2DAJA 3TMPB 3MJWA 4WJPA 4HDOA 2G45B 2YVCA 4IWQA 1WI0A 3V6CB 1Z5SB 1D3ZA 2JXXA 4HVBA 4GSWA 4HPLB 4JIOU 3RCZA 4HDQA 1WX9A 2D07B 5CHVC 2MBQA 1J0GA 4MGYE 3KYCD 3UGBB
chains in the Genus database with same CATH superfamily
1QLBB 2NPTB 4YSZB 3DBHB 2KQ4X 1JWUD 2Z0EB 1E0ZA 2C60A 3EECA 1XCTL 1JALA 1GJZA 5HG2A 4PS7A 1FD6A 1QOFA 3QC8B 4P6VF 4DXGA 4K1RB 2QEJC 3N1ZC 3U30A 2KMCA 5JZEB 3DBRI 4GB9A 3X0WA 3AI5A 2NTTA 3AE3B 4MH0E 5D3IB 5JH5C 1UBQA 3WAOA 2IPKD 3AULA 5G5HA 1WM2A 5CHFA 1N61A 2R61A 1TIFA 1ZUD2 2K9XA 3V61A 1V5TA 2KQ7A 3X23A 1RRBA 4ZRQA 3N1XC 3I3TB 2A4ZA 3D32A 1MI0A 4GLSC 2WLBA 3N3KB 2IGHA 1GB1A 4A20A 1C4AA 2ZZPB 1ENFA 4YL8A 1R7SA 4KDIC 5C1ZA 4NNJB 4W9EA 3CSFA 4LNOA 1QILA 3PO0A 1E8XA 4K3BA 4G3XB 4KX6B 2PTLA 2RSUA 1DGJA 2M0AA 3RYTA 2JQRB 3ZIMA 5J2RA 3P4PB 2KWUB 4JX1C 4ZRKA 2KXJA 3QA8A 2WNMA 3W2DA 4N58A 2A5UA 1VRAB 4I6NB 2MA9B 1KJTA 4NJ6A 3ZTDA 3BIID 3N1YC 1UWMA 3VRBB 1B1ZA 5IP4D 1J7AA 1QF6A 2G4DB 1RM6C 2PVGC 3RNGC 3ZXVA 3OJ3A 3A4SC 4F7ZA 2INNE 1WGGA 1D4BA 2WGSA 1GNUA 4BKSA 3NHEB 2INCC 4X57B 4XE0A 1GAQB 2NR2A 4DHZE 3ZXRA 1AYFA 4NZLB 3NOBA 4CQNA 1VCBA 4NY0A 2JZ3B 4FA6A 4W9IA 4MM3A 4QAYA 2W55A 3C8YA 3EFCA 1UELA 2IY0B 2N0SB 3NS1A 2JVCA 2KJRA 1T0SC 1N5XA 3DVNV 3PREA 5CTRC 1WIAA 1J7BA 4XYCA 4ZHOA 2MBOA 3P4SB 2LXAA 2LZ6A 2MQJA 2L7RA 1WFYA 2RDHA 2L1AA 4KGSA 1SGHA 4AJYB 2PIAA 4JWUC 2PEAA 3VTUA 2KTRB 2VZKB 3DBLB 3NVVA 4PYUA 5JHAA 4K81A 3M63B 2KVRA 5J18A 4II3B 3H7PA 3NVWA 2WXLA 3RZFA 2C5LC 3N9YC 2KDBA 5G2NA 2AYOB 2DYMA 3MC0B 4FJVB 2L05A 2RMMA 1EO6A 2V3SA 4GDKB 4URKA 1L2NA 3DCGA 3VH3B 2KK8A 1IYFA 1TKEA 3Q6BA 3ZUNA 2H89B 3AB5A 1HQRD 5J17A 2AWTA 1P1AA 4PS8A 4HXDA 1Q5WB 4LTUA 3RN9C 1C1YB 3A33B 2JSVX 2WXKA 3BWUD 2I2YA 3JW0X 1UBIA 4NJ7A 1XLQA 2NMQA 4EUTA 1OFFA 2PJHA 2DWQA 2R2QA 1D5XC 3MJ5A 4ZDVA 2QHOA 4G11A 1DYQA 4RGNA 4MGKE 2K0PA 2MW5A 2FCNA 1N63A 1WX8A 3HVDA 4BKGA 4N9F4 2WU5B 4OZBA 5E6NA 4FADA 3TEWA 4O1NA 2D3AA 1E10A 3TBLD 4FJYA 4N59A 3Q3MC 3V6EB 2K8CA 4EOYA 2GOWA 3FAHA 2X8XX 3IXSA 4B0EA 1WM3A 2FCSA 3HK0A 4M01A 1VDVA 1D5ZC 2KOXA 2AQ1B 2DHZA 1CZPA 3FILA 4DHZB 1Z2MA 3IT6B 3Q8FA 1SSNA 2RPVA 3ZJVA 1SJHD 4KGTA 1TJEA 1HZ6A 3R8BA 4IWPA 3DBHI 5AZFA 2WWZA 1SJED 1FNVA 4AP4C 4FLHA 1K8RB 3M95A 1HZ5A 1MJDA 1J7CA 2Z8LA 2JF5A 2J0JA 2DYOA 1MPEA 2PE9A 2ZVNA 3CIRB 4YSXB 1WJ4A 1TBEA 5G5GA 3AU5A 1WH3A 2J0MA 1MVKA 2HE7A 2KC1A 3AE4B 1I35A 2L00B 2UYZB 3SFEB 2C7NB 2OOBB 4ASWC 4MGIE 4RNAA 1ZE3D 2M0XA 2LASA 2WXHA 4NAMA 1FMAD 4GU2A 1YN5A 2XBBC 2K39A 2KAJA 4HCNB 3ZTCA 3QQ8B 1A70A 3MHZA 3DBLI 4MDKE 4DXAB 4OW0A 4BOZB 3U7ZA 2GBRA 2LD9A 2Z59B 1I7HA 3OAWA 1E8YA 5BMGA 1IP9A 2EMTA 1RFKA 1GC6A 2WXRA 4W9HA 3KQ4A 1DOYA 2JYEA 2X38A 5LNK1 3OG5A 2GI9A 1M4VA 1FCLA 4B6WA 1NDDA 2C7MB 4EZKA 1LXDA 3R2TA 4WJOA 1I4GA 2IO1B 2W3RA 4C80A 3GZNB 1WXAA 3RD2A 3H7SA 1NVID 4GXBA 4JQWC 2OHFA 2LRWA 4OHJA 4ARCA 3MFGA 1L6VA 3PLVA 3QWZB 3VRAB 5BMIA 3IT4B 2N1VA 4B0MA 4XDCA 1Y56A 3U2SC 3TMPB 2K22A 4HDOA 1Z5SB 2WXPA 4HVBA 4GSWA 2D07B 5CHVC 2DBYA 4MGYE 3KYCD 3MC8A 1TKGA 3VXWA 2IO0B 4CO7A 2K6DB 2BS4B 4LDTB 3ENEA 2FCQA 4J6IA 3P4RB 2DENB 1V1PB 2O6VB 2M8SA 1RWSA 2IDYA 3RFZB 3IVFA 2ZW0A 1C79A 1E90A 3VDZA 3RMKC 4K3CA 1K53A 4JLCA 1I4HA 4KIKA 2XK5B 5EE1A 2NS5A 1NEKB 3ECIA 2RDBC 1DOXA 3V05A 3SD5A 3I57A 3LXFA 2BGFA 2DZKA 2GBMA 4IM3A 1R4MB 4GDLB 2FUG1 1E7PB 2GMIC 3T8MA 3ALBA 4E74A 2IJ0A 3VTWA 3U4EG 2EKIA 1UD7A 4L1BA 1KH0A 4S17A 3LYYA 5D2MB 2PVOD 3AEBB 4WJQA 2W3SA 3PRZA 2BKFA 1YJ1A 3PRMB 1MG4A 3AE8B 2V3PA 2WHIA 2K5PA 2N9EB 2WDQB 2BT6A 2O2VB 2CJOA 2AX5A 3H9DA 4A9AA 4EKUA 3VUXA 3DHGC 1P9DU 5G55A 4DDGD 3LJ3A 1EU3A 2B3AA 3VAWA 2XN9C 4ZRJA 3APFA 2BYFA 4A3PA 3TSSA 1FNWA 1NBFC 1XCQL 3U8ZA 1NENB 3IHPC 4W9GA 2BS3B 1OEYA 4YTNB 3OJ4B 2V1YA 1WZ0A 2I38A 4DK5A 4KDLB 3ETRA 2MJEA 5CHWA 1TTNA 4G0NB 3H1UA 1JROA 1FXTB 1FXAA 1K51A 4MJSA 2MP2A 1SXTA 4HWIB 2MJDA 3W1SC 2KN5A 3W9CB 3QAQA 4AWJA 1UGMA 1XEEA 2IYDB 3H8HA 3PZDA 3Q8AA 3ZLZA 3R7QA 1WR6E 4L2YA 3IAS1 4PS3A 5D3DA 5AZGA 2V4IB 2L0TA 1VZ6A 1F1HA 3RNCC 2FAZA 3PSEB 3BZDB 2KLCA 4II2B 4RF0A 2INDC 2AQ3B 3Q8BA 2NTSA 3V62A 2WYQA 1V86A 1UF0A 1TS4A 1PUTA 1WR1A 3W1SA 1L0XB 4WWNA 5FR3A 4FHKA 3I5JC 3AH7A 4C7ZA 1HE8A 4MH8A 3KYDD 5LLIA 3DOWA 2KJ6A 1YQ3B 5AZHA 2N4FA 1QT9A 2KKCA 2MSED 2DLBA 3RUIB 2C7HA 2CJNA 2EELA 3A1QA 1WXQA 3DWMA 4N6EB 2JU6X 4W9DA 2KVZA 3SR6A 3T3NA 1F52A 1VD2A 2LGSA 1I4QA 2LJIA 3B0AA 4XC2A 2JZZA 3PPAA 3P1MA 2FE8A 2JYTA 2WXNA 2KN4A 5EE0A 1ROEA 2DZJA 1OGWA 4CHKA 1BMLC 3MTNB 4XZ4A 3A1QB 2KZRA 2WXGA 3U7DA 3PT2B 1PGAA 2TSSA 1F77A 1Q0WB 5LXIB 4LLGM 2WXMA 3B1LX 3ZNZB 4ICVA 2L32A 3QK0A 3RNAC 4J3OD 3OLMD 1N60A 1I42A 4P1BC 1C77A 3AV8A 1NI3A 3EGRA 3TEZA 1ZP0B 4YSYB 4XDDA 1JWSD 2D3GA 3PRPB 4F1SA 1CK1A 3WANA 4LJPB 4KGRA 4MJSB 3WCQA 1WGHA 3PZ7A 4FULA 1JCKB 2N9KA 2CKHB 3UINB 3QX1A 4C4VA 5IKCM 2HDEA 4MT5A 1E8ZA 2KANA 2M4NA 3GOEA 1WF9A 5EE3A 3GE8C 2UU7A 1V6EA 3VUWA 3ONSA 5EDSA 5FK9C 3Q3NC 4FN2A 2GLSA 1XD3B 1HTQA 2LUMA 3ZYYX 3BY4B 4DQOC 2NBVB 4FJZA 2JRIB 2KWVB 4LNNA 4ZYSA 4A3OA 5MPOA 2IY1B 4TQ0A 2HTHA 1JWMD 1P7EA 2V0GA 4C4VB 1FRRA 1SEBD 1ZPSA 3L4PA 1IPGA 1I4XA 2DAFA 1WJUA 4MSMB 2BWFA 3IBEA 1RYJA 3B2FA 4IW0A 1WY8A 2LFIA 2ACZB 1JRPA 1OTRB 1SE3A 1HEZE 1C78A 2BVCA 3JYUA 4RH6A 3AEGB 1UH6A 3L17A 2LEKA 4KZCA 2DZIA 1TS2A 1M94A 4KSKC 1YMHE 2ZCBA 2MWSB 1EF5A 4AS1A 3GP7A 3TCAA 2MLBA 4HPPA 3ZJTA 1FO4A 1FRDA 1F9JA 1UUPA 2KWDA 1G6JA 2INPE 1P0RA 1GG3A 3TIXA 4GDKA 3NRZA 2LXCA 3ZRFA 1XQQA 2H88B 3BVMA 2AL3A 3P4QB 4JL9A 1WRIA 4W9JA 4MSQB 1QOBA 5GXGB 2PE6B 2SAKA 4IOIE 2E3TA 4M0WA 2AEHA 3K9PB 2IO2B 3AECB 3PZ8A 1WWTA 1PGBA 3QCAA 5L95C 1UNSA 1I4RA 4FXCA 5IO9A 1GPXA 2BYTA 4A8XC 5H8YE 4GMVA 1X1MA 3VTVA 1LO5D 2W82A 3SHQA 2IGDA 3RZWC 2WS3B 3EFUA 4KSLC 5D6JB 1QQRA 1KLGD 2DAJA 3MJWA 4JWSC 1WI0A 2JXXA 1C76A 3TEYA 2WDRB 4HDQA 1C4PA 5IOIA 1FCCC 3KUDB 1JMLA 4OVVA 2N9LA 2CHWA 3R66C 2LMCA 3NS8A 4LNKA 1YNTE 1JWAD 3NUHB 3EUB2 1SB3C 2ZEQA 4HJKA 3U52E 2KDFB 2D3CA 5HFYA 4US9A 3M62B 4US8A 1L5PA 1Q10A 5DPSA 5FKAC 1T0QC 1KLUD 2PLPA 1FFUA 3KWLA 3KVFB 3TL5A 1T0RC 2D5GA 3ZKJC 1P98A 1EM7A 4WQOB 2M56B 2ZVOA 3ZQ4A 2ZPYA 2D11A 1T0YA 5I4DA 1YN3A 2KLGA 2QMTA 4KVGB 2NBUA 1WGRA 4MELA 3A4RA 4REZA 2BYEA 3ABVB 4LNIA 1E6EB 2RPQA 4AJWA 3FILB 2N9XA 2REXA 4DXFA 4TQ1A 1P3QU 4RFBA 1VR9A 2JPHA 2FBWB 4DBGA 1YQBA 3H7PB 1H4RA 3DPDA 1KM7A 2KD0A 2LHEA 5FR6A 5BYSA 2JZPA 3BYYB 4IM0A 1MHXA 5DCNA 2SEBD 3QJZA 4MGZE 2OJWA 1JW9D 4PK1A 1V5OA 4C56C 4WQMA 1N5WA 1ZDXA 2C9WB 3DHIC 1L4ZB 2KDIA 4XWWA 3WAMA 3AEDB 1XLOA 2V9HA 3NVZA 3ZNGC 1FEHA 3UI3A 4L23A 2WXIA 5HHDG 5E6JA 2CS4A 3ZGZA 4EZJA 4PYZA 3ML8A 2WX1A 4BBNF 3HUIA 2JY6A 1AWDA 1ZKHA 2LGDA 2W54A 1WYWB 3O13A 3GE3C 4ITKA 2PMVA 2M19A 1IUEA 4GOCA 3VR8B 3IG3A 2BPSA 4IDIA 2XK5A 3N32A 3NVYA 1AW7A 1SE4A 1OQQA 2KACA 3JSVB 3UQAA 1XXGA 3PGEA 3R7RA 1VZ7A 1P7FA 4ZRPA 5AUKA 1F2RI 1EUVB 5E6PA 2N7JA 5H92C 1RFAA 2KQSA 4ZOHC 4ANVA 2KFJA 3AE2B 1PFDA 3PVLA 4YXDB 1ESFA 1MFWA 3CMMB 1CQVA 3RULA 4WWOA 4HEA1 4WAAA 3SFDB 4JE3B 3HRDD 1UWXA 2BB5A 2KDEB 2BQQA 3HHMA 3APDA 5TSSA 4KKJA 4IM2A 1GUAB 2WDVB 3AEAB 2WXOA 4WIPA 2KT7A 2KWCA 2AQ2B 1U4AA 1ZXHA 2L76A 3Q3JA 2WXQA 3O65B 1TKYA 1LM8B 2OEDA 2WDTB 4K7WA 1XO3A 4DWFA 2KTFA 2BWES 2LUEA 3KWVA 3CWIA 2D2QA 2BBCA 3AE1B 4CYEA 1L0YB 1RLFA 1MG8A 3RPFC 2NPTA 2JWUA 1PGXA 1Q1OA 4RM8A 3Q3OC 2QILA 1WZ3A 3A9JA 2D10A 3B08A 4BAXA 2KDMA 5EE9A 3R3MA 1D6EC 2ZW1A 1N6ZA 4W9KA 2DZMA 1BUIC 2QJLA 3DBSA 4EE2A 3IFWB 2RDGA 1RAXA 3C19A 4OZAA 4OVUA 2MH7A 3BINA 4EFOA 4TMAB 1VLBA 3LB8C 1E7VA 4GN1A 5CX3A 5BO4B 1LGRA 3WA0A 2L3ZA 3DVGX 4LDTD 2PKOA 2QDFA 1ACCA 2M1MA 2J42A 3PLUA 3EA6A 2KX0A 2BF8B 2L0FA 1WRDB 3WALA 1IBXB 2FCMA 5BMHA 1E5WA 4DHJD 4MACA 3L54A 5HKHA 3N20C 3DVGY 5L83A 4WWMA 4ZRIA 2LVQA 2V3NA 2WU2B 4WH4A 4LCDE 3P2BA 5TR5A 4EEWA 2MBHA 1TZ1A 3BK1A 2J4XA 1XLNA 1L6UA 3A9KA 2KFKB 1EU4A 4BOSC 4MEMA 1CJEA 1AARA 2N7DA 3H6NA 2VRRB 1FXIA 3Q3FA 3AEEB 5JXVA 3Q8EA 2E6XA 1V2YA 3KLSX 4KV2A 4M8NA 1ET9A 1SBBB 3DBRB 4R3DA 4RGTA 4USAA 1SIJA 3ZRCA 2LWPA 1YIWA 1J8CA 3PHWB 4DDID 3PS6A 4A6QA 3HM6X 4DHJB 2O6VD 4EZLA 2LGIA 3APCA 2RR9A 3UF8A 2FIFA 1CMXB 3TUOA 3V60A 3GB1A 3HIZA 2FIDA 4M02A 1IBXA 3MC9A 3VR9B 2EMSA 1WXSA 4W9FA 2VZKD 4HROA 4ANWA 5KHOA 4FHJA 1B9RA 3FKYA 3TEXA 1NYQA 1N62A 4TKNA 3GS2A 2CR5A 1KF6B 1FPYA 3ZJUA 3UIPB 3QIJA 1E7UA 2ASQA 3S2AA 2KHWB 4W9CA 5C3JB 2KO3A 2AL6A 2KFKA 1PQSA 2K8BA 4ACFA 2K6QA 3BK2A 4H2AA 3E9SA 3MHSD 1JQ4A 3URYA 3RNFC 3DQVA 2JT4B 2Q5WD 1ISNA 3NY5A 3JVZX 2NCNA 3Q14C 2KMMA 2JRHA 3CF6E 1VJKA 1V1PA 2YVCA 4IWQA 2HTME 1F2RC 1PYWD 4JIOU 1WX9A 1BXTA 3AEFB 1J0GA 5D7GA 2KX3A 4M00A 2MP2B 1FNUA 2V4LA 2DNFA 2YLMA 4IWOA 1L7YA 4ARIA 3QARA 4LK0M 1WMHA 2RD0A 2IZVB 2L52A 4C00A 4ANUA 1HXYD 3P63A 4B9KA 2VH2A 3RNEC 1V8CA 4IG7B 2JXTA 1OQYA 2LVPA 3ZNHB 2ONQA 5LXHA 4AUQC 2J52A 3RT3B 2Y3AA 1BT0A 3QHTA 3EC8A 1TS3A 1EF1A 2LGXA 3VFKA 3AE9B 2LGYA 5GMVA 2ZNVB 1YX6B 3KUZA 2CHXA 1WMHB 3I63C 2NBWB 3IAM1 3M3JA 4BKTA 1YOVB 2WXJA 2BB6A 1JRUA 1TS5A 2BW2A 2LRUA 3B2GA 3DHHC 2OJRA 5IA7A 3AMZA 3DDCB 4KIKB 3VVWB 4KKIA 4BKSD 2MCNB 1F0ZA 3BVGA 3SEBA 1C4CA 3N30A 3HVZA 1WJNA 4HLEA 4G50A 1Y8RC 3T3OA 4JPSA 1XT9B 3V3XA 1OEYJ 3ML9A 1QZEA 1YQ4B 1YJJA 2WQYB 1HA5A 1V9JA 2O2VA 3A9KB 3VHTC 1MHHE 2CU1A 3EHVA 2IBIB 2IO3B 4NQKE 4WURA 1WYGA 4E71A 1ZDVA 3NZ3A 4NAWA 1K52A 2R2OA 1TY0A 5IN7A 4S0RA 1WE6A 1KRHA 3DVNU 4LJOB 4HKZE 5IAAC 1FM0D 2XEWA 3RNBC 3P42A 2GBJA 5D94A 1J19A 2HJ8A 1FIQA 3VUYA 2MJ3A 2L8JA 1WXMA 4NPNA 1L0VB 4ANXA 5BYRA 1V80A 2LJ5A 4IUMB 1T3QA 1IGCA 4UDUC 3UIOB 1HTOA 1TGZB 1TT5B 3BYTB 1C3TA 4ZHPA 1WX7A 4OZCA 2MBBB 4RCOA 2KMAA 3KUCB 1WJ6A 4HPMB 2B76B 3Q8CA 4E3CA 2I1JA 2GBNA 5HI1A 4K7UA 4XGAB 3ZDMC 4P7IA 2K8HA 4B95A 3FC4A 5DPTA 3E56A 4F8CB 3R2IA 3NZSA 4KZ0A 4AQ7A 1SE2A 1YN4A 2G9HD 3PV1A 5C23A 2PPHA 1TYGB 1DOIA 4I6LB 3KH0A 2N7EA 3AXCA 3ZVVA 3KW5B 3A9JB 2FNJB 2LVOA 2Y5CA 2Y5PA 2D3BA 4IC7B 1KLVA 2BTEA 2ZCCA 2K25A 2MBEA 2K1FA 4GDLA 2L83A 2CHZA 2G4SA 1SE9A 1YD8U 4TSSA 4RGMA 1WGKA 1GC7A 3NG0A 1QKZA 4RMAA 2M17A 2DX5B 1UGJA 1SF0A 1FFVA 1S1QB 3AM9A 1L4DB 4D2KA 1ZXIA 1LQBA 2MHJA 4HCPB 4HK2A 5C2TB 4RM9A 3WIMA 4WJNA 2HJ1A 2K3UA 2ZNVC 3VQIA 1YJIA 2WXFA 4TUUA 1WGDA 3GZNI 1WXVA 1KTKA 3ZO5B 3L16A 4ZYNA 3B9JA 1LFDA 3LDZE 5BYQA 4Q2JA 1E9MA 1QOGA 4NJCA 2JWZA 3AE7B 2ICIA 4HKQA 3J9CA 1EWCA 1TY2A 4TV3A 4JGHB 2EKEC 2MEKA 1V49A 2QSDA 1IGDA 4HJGE 1TZOA 2RGFA 3CSTA 3BVZA 3W5VB 4AOFA 2GB1A 4M8MA 4P1CC 2HD5B 2ZPNA 1NYRA 3JSVA 2BYVE 3NZUA 5DPRA 2WX0A 3HM3A 5JHBA 2JX5A 2NVUI 1R4MI 3SDLC 1STEA 2MX2A 1JWBD 5AEKB 4C7YA 4GIVA 4BFRA 1ET6A 2ZJDA 4IKGA 2VH1A 5E6OA 2BKRB 1XLPA 3PTFC 1H8CA 1T5XD 1ZOYB 2O6VA 3PHXB 4M0WB 4YTMB 1GB4A 3OWEB 3T9LA 2KYWA 2FUHB 4P16A 4A55A 1YX5B 3DWGC 4W9LA 1OQRA 2MRPA 1T6BX 3AN1A 3TJPA 1R4NI 1WSPA 4BZAA 4BVUC 1K50A 4K7SA 2GRIA 2QIEB 3L08A 2LI5A 4WAFA 2J7QB 2J53A 1AN8A 1R4NB 2CU3A 4OVZA 3W1YA 2YEPB 1UZXB 1KFYB 3C0RB 2PW9A 2G1EA 3ZW3A 1SIFA 2KTRA 2KC2A 3ZNID 2LHDA 2N9PC 2N1WA 2ON8A 1I4PA 2WP9B 2KNBA 4RGOS 1V97A 1ZW7A 1E8WA 1GOZA 4YTPB 2QC8A 1ZGUB 3ZDTA 2W9NA 3NJTA 1WE7A 3MP9A 1EWYC 3L13A 1VZ8A 4XX5A 3WAPA 2DYBA 3AE6B 4LNFA 2UWQA 2GBKA 2YEPF 1A5RA 4ICUA 2XNAC 2Z0DB 4RF1A 3W5UB 4NAWB 4GGQA 1QOAA 4HRSA 1NI2A 3VH4B 3L0WB 4NQLB 1D5MC 3AE5B 1V1OA 2I1KA 2KJHB 3I9V1 3Q69A 5AUIA 1C9FA 3UQBA 1KOTA 1PDXA 1S3SG 5DPWA 1V81A 2BS2B 3AU4A 5KHQA 3SU8X 4MM3B 4A90A 4BBNC 2JUOA 2J0KA 4I6PA 2Y5BB 4XWTA 4FBJB 1WGYA 3K9OB 2G3QB 3L10B 4WWPA 1XF5L 4YT0B 5T8IA 4WJPA 2G45B 4YWGG 2QCZA 3V6CB 1D3ZA 2IGGA 4HPLB 3RI7C 3RCZA 3Q2AC 2MBQA 4PT5A 3UGBB
chains in the Genus database with same CATH topology
5D7GA 3KUDB 3VXWA 2IO0B 2KX3A 2NPTB 4OVVA 4CO7A 2K6DB 2MP2B 2V4LA 2Z0EB 2CHWA 2C60A 2YLMA 3EECA 3R66C 3NS8A 4IWOA 1GJZA 1L7YA 4LDTB 3ENEA 2FCQA 4PS7A 3QC8B 4J6IA 2DENB 3QARA 2O6VB 2M8SA 2ZEQA 4HJKA 1WMHA 2KDFB 2RD0A 4K1RB 2IZVB 3IVFA 3U30A 4ANUA 4B9KA 1E90A 2KMCA 3M62B 3VDZA 3DBRI 4GB9A 4IG7B 5JZEB 3X0WA 5DPSA 3AI5A 1OQYA 4JLCA 2LVPA 4KIKA 3ZNHB 2XK5B 4MH0E 5JH5C 2NS5A 4AUQC 5LXHA 1UBQA 3WAOA 3ECIA 3RT3B 1BT0A 3QHTA 3EC8A 3KVFB 3TL5A 3AULA 3ZKJC 1EF1A 1P98A 3SD5A 2LGXA 1WM2A 3VFKA 4WQOB 5CHFA 2LGYA 5GMVA 2ZNVB 2ZVOA 1YX6B 2BGFA 3KUZA 3V61A 1V5TA 2ZPYA 2D11A 2CHXA 2KQ7A 1RRBA 1T0YA 1WMHB 2DZKA 2GBMA 2NBWB 4IM3A 3X23A 3M3JA 2KLGA 4GDLB 4KVGB 3I3TB 4BKTA 2A4ZA 2NBUA 1WGRA 3D32A 4MELA 3A4RA 2GMIC 2BYEA 1JRUA 3T8MA 3ALBA 4E74A 2RPQA 3VTWA 2LRUA 3N3KB 4AJWA 2OJRA 5IA7A 2N9XA 3DDCB 4KIKB 3VVWB 4A20A 1UD7A 2REXA 2ZZPB 4BKSD 2MCNB 4TQ1A 1P3QU 4YL8A 5D2MB 4KDIC 2JPHA 4WJQA 5C1ZA 3N30A 4DBGA 3PRZA 4NNJB 4W9EA 3CSFA 1WJNA 1YQBA 3H7PB 1E8XA 1H4RA 2BKFA 1YJ1A 3DPDA 3PRMB 1KM7A 4G3XB 4G50A 2KD0A 5FR6A 4HLEA 1Y8RC 2RSUA 1XT9B 1OEYJ 2N9EB 3ML9A 4IM0A 1QZEA 3RYTA 5DCNA 2O2VB 3ZIMA 5J2RA 3QJZA 4MGZE 1V9JA 2O2VA 3A9KB 2KWUB 3H9DA 4EKUA 1V5OA 3VUXA 4ZRKA 3VHTC 1P9DU 2KXJA 3QA8A 2C9WB 2CU1A 5G55A 2KDIA 3EHVA 3LJ3A 4DDGD 2B3AA 3VAWA 2IBIB 2A5UA 2IO3B 4NQKE 4E71A 4ZRJA 3APFA 4I6NB 2BYFA 2MA9B 4A3PA 3WAMA 1NBFC 4NAWA 1KJTA 2R2OA 3U8ZA 4NJ6A 3ZNGC 3ZTDA 1WE6A 3IHPC 4W9GA 1OEYA 3DVNU 4LJOB 3OJ4B 5IAAC 2XEWA 2V1YA 1WZ0A 2CS4A 4DK5A 4KDLB 5CHWA 1TTNA 4EZJA 2GBJA 2G4DB 4G0NB 3H1UA 5D94A 1J19A 3ML8A 2HJ8A 1FXTB 4PYZA 3VUYA 2WX1A 2L8JA 1WXMA 4BBNF 2JY6A 4NPNA 1ZKHA 4ANXA 4MJSA 3OJ3A 3A4SC 4F7ZA 1V80A 2LJ5A 1WGGA 2MP2A 4IUMB 2LGDA 4HWIB 1GNUA 1WYWB 4BKSA 3W1SC 2KN5A 3UIOB 3NHEB 3QAQA 4X57B 4AWJA 1UGMA 2IYDB 1TGZB 2NR2A 3PZDA 4DHZE 1C3TA 3ZLZA 3R7QA 4GOCA 1WX7A 1WR6E 2MBBB 3IG3A 3NOBA 2BPSA 2KMAA 3KUCB 4PS3A 5AZGA 1VCBA 1WJ6A 4HPMB 2L0TA 2XK5A 4NY0A 2JZ3B 3N32A 4FA6A 2FAZA 4W9IA 4E3CA 3PSEB 2I1JA 2KLCA 4II2B 2GBNA 3JSVB 3UQAA 4K7UA 3PGEA 4MM3A 3R7RA 3V62A 3ZDMC 2WYQA 4P7IA 1UELA 1V86A 2IY0B 2K8HA 4B95A 2JVCA 2KJRA 5DPTA 1EUVB 3DVNV 3PREA 5CTRC 4F8CB 5E6PA 1WIAA 3NZSA 1RFAA 4KZ0A 2MBOA 2KQSA 1WR1A 2LXAA 3W1SA 2LZ6A 4ANVA 2MQJA 2KFJA 2L7RA 3PV1A 5C23A 1WFYA 2PPHA 4I6LB 3KH0A 1SGHA 2N7EA 3PVLA 4WWNA 4AJYB 4FHKA 3AXCA 3ZVVA 2PEAA 3KW5B 3A9JB 3VTUA 1HE8A 3CMMB 2FNJB 3RULA 2KTRB 2LVOA 3KYDD 4WWOA 5LLIA 3DOWA 2KJ6A 4PYUA 4WAAA 5AZHA 5JHAA 4K81A 2N4FA 4IC7B 1KLVA 3M63B 2KKCA 2MSED 2KDEB 2ZCCA 2KVRA 2K25A 3RUIB 3HHMA 2C7HA 5J18A 2MBEA 3APDA 4II3B 2K1FA 4GDLA 3A1QA 4IM2A 1GUAB 3H7PA 2CHZA 2KWCA 2G4SA 1SE9A 1YD8U 4W9DA 1U4AA 3RZFA 2C5LC 1GC7A 2KDBA 2L76A 5G2NA 3Q3JA 2AYOB 2DYMA 4FJVB 2L05A 3O65B 1LM8B 1VD2A 1EO6A 2V3SA 4RMAA 2M17A 2DX5B 2WDTB 4GDKB 4K7WA 3B0AA 4URKA 1L2NA 3DCGA 2JZZA 4XC2A 3VH3B 3PPAA 2KTFA 2KK8A 4DWFA 1S1QB 2BWES 2LUEA 1IYFA 1LQBA 2D2QA 1OGWA 2DZJA 4CHKA 3ZUNA 4HCPB 3MTNB 4XZ4A 3A1QB 4HK2A 2KZRA 3U7DA 4CYEA 5J17A 1RLFA 2AWTA 1P1AA 3PT2B 1MG8A 5LXIB 1Q0WB 4HXDA 1Q5WB 2NPTA 4PS8A 4RM9A 3WIMA 1C1YB 3A33B 3B1LX 4WJNA 1Q1OA 3JW0X 4RM8A 3ZNZB 1UBIA 2ZNVC 3VQIA 4ICVA 1WZ3A 4NJ7A 3QK0A 3A9JA 4EUTA 2D10A 3B08A 3OLMD 4TUUA 2PJHA 2R2QA 1WGDA 1I42A 3GZNI 3R3MA 2QHOA 4ZDVA 1WXVA 4W9KA 3ZO5B 2DZMA 4G11A 3L16A 3DBSA 3IFWB 1RAXA 4ZYNA 4MGKE 1LFDA 3LDZE 2D3GA 4OVUA 2MW5A 3BINA 4EFOA 3PRPB 4F1SA 2FCNA 1WX8A 4BKGA 4N9F4 3WANA 5CX3A 1E7VA 4GN1A 4LJPB 5BO4B 3WA0A 2L3ZA 4MJSB 5E6NA 4FADA 1WGHA 3DVGX 4FULA 4LDTD 2JWZA 2CKHB 3UINB 3QX1A 4FJYA 3TBLD 3V6EB 2K8CA 1E8ZA 4EOYA 2GOWA 2KANA 2M1MA 2M4NA 4TV3A 3GOEA 4JGHB 1WF9A 2EKEC 1V49A 3PLUA 2KX0A 2BF8B 1WM3A 2FCSA 2L0FA 3HK0A 1V6EA 1WRDB 3VUWA 3WALA 3ONSA 2RGFA 5EDSA 2KOXA 3CSTA 2DHZA 4DHZB 1Z2MA 2FCMA 4AOFA 1E5WA 4DHJD 3L54A 2HD5B 4M8MA 5HKHA 2ZPNA 4FN2A 1XD3B 3DVGY 5L83A 3JSVA 2BYVE 3NZUA 5DPRA 4ZRIA 2WX0A 3HM3A 4IWPA 5JHBA 2NVUI 2LVQA 3DBHI 1R4MI 5AZFA 2WWZA 3BY4B 3SDLC 2MX2A 5AEKB 2NBVB 4FJZA 4AP4C 4GIVA 4LCDE 3P2BA 4FLHA 5TR5A 4BFRA 2JRIB 2KWVB 1K8RB 4EEWA 2MBHA 3M95A 4A3OA 1TZ1A 2IY1B 4TQ0A 2ZJDA 2HTHA 5E6OA 2BKRB 2JF5A 2J0JA 3PTFC 3A9KA 2KFKB 1H8CA 1IPGA 4BOSC 2DYOA 4MEMA 2DAFA 1AARA 2PE9A 2O6VA 3PHXB 1WJUA 2ZVNA 4M0WB 4MSMB 2BWFA 2N7DA 3IBEA 3H6NA 2VRRB 3Q3FA 1WJ4A 1TBEA 4IW0A 1WY8A 3T9LA 1OTRB 1WH3A 3AU5A 2J0MA 2HE7A 2KC1A 2FUHB 1V2YA 3JYUA 4KV2A 1YX5B 4M8NA 4W9LA 2MRPA 1I35A 1UH6A 3L17A 2L00B 3TJPA 1R4NI 2UYZB 4KZCA 2C7NB 2DZIA 2OOBB 4ASWC 1M94A 4MGIE 3ZRCA 2LWPA 1YIWA 2ZCBA 4KSKC 1J8CA 2MWSB 4BVUC 3PHWB 4K7SA 4DDID 1EF5A 3PS6A 3HM6X 4DHJB 2M0XA 2LASA 2O6VD 2LI5A 3L08A 4EZLA 3APCA 2RR9A 3TCAA 3UF8A 2J7QB 2MLBA 4GU2A 2FIFA 1CMXB 3V60A 2XBBC 2K39A 4HCNB 3ZTCA 3W1YA 3QQ8B 3HIZA 1UZXB 1F9JA 3C0RB 2FIDA 3DBLI 1G6JA 4MDKE 3ZW3A 4DXAB 1SIFA 1P0RA 2KTRA 2KC2A 3ZNID 4BOZB 1GG3A 3TIXA 2N9PC 2N1WA 2EMSA 1WXSA 4GDKA 4W9FA 2KNBA 2LXCA 4ANWA 1ZW7A 2GBRA 4FHJA 5KHOA 3ZRFA 1E8WA 2LD9A 2Z59B 1XQQA 2AL3A 1ZGUB 3OAWA 3ZDTA 4JL9A 2W9NA 4TKNA 1E8YA 2CR5A 1WE7A 1IP9A 4W9JA 3L13A 2EMTA 4MSQB 1GC6A 4XX5A 3UIPB 3WAPA 3QIJA 2DYBA 1E7UA 4W9HA 2UWQA 2PE6B 2ASQA 2GBKA 3S2AA 2KHWB 4W9CA 1A5RA 4ICUA 2KO3A 2Z0DB 2AEHA 3K9PB 2IO2B 2AL6A 2KFKA 1PQSA 2K8BA 2K6QA 4NAWB 4GGQA 4B6WA 1NDDA 1NI2A 2C7MB 3L0WB 1LXDA 4NQLB 3VH4B 4EZKA 4WJOA 3QCAA 3MHSD 5L95C 2I1KA 2IO1B 2KJHB 1WXAA 3RD2A 3H7SA 4GXBA 3DQVA 2JT4B 4JQWC 3UQBA 4GMVA 1X1MA 2LRWA 1KOTA 3VTVA 5DPWA 1S3SG 3PLVA 3SHQA 1ISNA 1V81A 3QWZB 3AU4A 3NY5A 3JVZX 2NCNA 5KHQA 3SU8X 4BBNC 2JUOA 2JRHA 2J0KA 4I6PA 3CF6E 2Y5BB 3RZWC 4FBJB 1WGYA 3EFUA 3K9OB 4KSLC 5D6JB 2N1VA 2G3QB 3L10B 4WWPA 2DAJA 3TMPB 3MJWA 4WJPA 4HDOA 2G45B 2YVCA 4IWQA 1WI0A 3V6CB 1Z5SB 1D3ZA 2JXXA 4HVBA 4GSWA 4HPLB 4JIOU 3RCZA 4HDQA 1WX9A 2D07B 5CHVC 2MBQA 1J0GA 4MGYE 3KYCD 3UGBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7G A;  3KUD B;  3VXW A;  2IO0 B;  2KX3 A;  2NPT B;  4OVV A;  4CO7 A;  2K6D B;  2MP2 B;  2V4L A;  2Z0E B;  2CHW A;  2C60 A;  2YLM A;  3EEC A;  3R66 C;  3NS8 A;  4IWO A;  1GJZ A;  1L7Y A;  4LDT B;  3ENE A;  2FCQ A;  4PS7 A;  3QC8 B;  4J6I A;  2DEN B;  3QAR A;  2O6V B;  2M8S A;  2ZEQ A;  4HJK A;  1WMH A;  2KDF B;  2RD0 A;  4K1R B;  2IZV B;  3IVF A;  3U30 A;  4ANU A;  4B9K A;  1E90 A;  2KMC A;  3M62 B;  3VDZ A;  3DBR I;  4GB9 A;  4IG7 B;  5JZE B;  3X0W A;  5DPS A;  3AI5 A;  1OQY A;  4JLC A;  2LVP A;  4KIK A;  3ZNH B;  2XK5 B;  4MH0 E;  5JH5 C;  2NS5 A;  4AUQ C;  5LXH A;  1UBQ A;  3WAO A;  3ECI A;  3RT3 B;  1BT0 A;  3QHT A;  3EC8 A;  3KVF B;  3TL5 A;  3AUL A;  3ZKJ C;  1EF1 A;  1P98 A;  3SD5 A;  2LGX A;  1WM2 A;  3VFK A;  4WQO B;  5CHF A;  2LGY A;  5GMV A;  2ZNV B;  2ZVO A;  1YX6 B;  2BGF A;  3KUZ A;  3V61 A;  1V5T A;  2ZPY A;  2D11 A;  2CHX A;  2KQ7 A;  1RRB A;  1T0Y A;  1WMH B;  2DZK A;  2GBM A;  2NBW B;  4IM3 A;  3X23 A;  3M3J A;  2KLG A;  4GDL B;  4KVG B;  3I3T B;  4BKT A;  2A4Z A;  2NBU A;  1WGR A;  3D32 A;  4MEL A;  3A4R A;  2GMI C;  2BYE A;  1JRU A;  3T8M A;  3ALB A;  4E74 A;  2RPQ A;  3VTW A;  2LRU A;  3N3K B;  4AJW A;  2OJR A;  5IA7 A;  2N9X A;  3DDC B;  4KIK B;  3VVW B;  4A20 A;  1UD7 A;  2REX A;  2ZZP B;  4BKS D;  2MCN B;  4TQ1 A;  1P3Q U;  4YL8 A;  5D2M B;  4KDI C;  2JPH A;  4WJQ A;  5C1Z A;  3N30 A;  4DBG A;  3PRZ A;  4NNJ B;  4W9E A;  3CSF A;  1WJN A;  1YQB A;  3H7P B;  1E8X A;  1H4R A;  2BKF A;  1YJ1 A;  3DPD A;  3PRM B;  1KM7 A;  4G3X B;  4G50 A;  2KD0 A;  5FR6 A;  4HLE A;  1Y8R C;  2RSU A;  1XT9 B;  1OEY J;  2N9E B;  3ML9 A;  4IM0 A;  1QZE A;  3RYT A;  5DCN A;  2O2V B;  3ZIM A;  5J2R A;  3QJZ A;  4MGZ E;  1V9J A;  2O2V A;  3A9K B;  2KWU B;  3H9D A;  4EKU A;  1V5O A;  3VUX A;  4ZRK A;  3VHT C;  1P9D U;  2KXJ A;  3QA8 A;  2C9W B;  2CU1 A;  5G55 A;  2KDI A;  3EHV A;  3LJ3 A;  4DDG D;  2B3A A;  3VAW A;  2IBI B;  2A5U A;  2IO3 B;  4NQK E;  4E71 A;  4ZRJ A;  3APF A;  4I6N B;  2BYF A;  2MA9 B;  4A3P A;  3WAM A;  1NBF C;  4NAW A;  1KJT A;  2R2O A;  3U8Z A;  4NJ6 A;  3ZNG C;  3ZTD A;  1WE6 A;  3IHP C;  4W9G A;  1OEY A;  3DVN U;  4LJO B;  3OJ4 B;  5IAA C;  2XEW A;  2V1Y A;  1WZ0 A;  2CS4 A;  4DK5 A;  4KDL B;  5CHW A;  1TTN A;  4EZJ A;  2GBJ A;  2G4D B;  4G0N B;  3H1U A;  5D94 A;  1J19 A;  3ML8 A;  2HJ8 A;  1FXT B;  4PYZ A;  3VUY A;  2WX1 A;  2L8J A;  1WXM A;  4BBN F;  2JY6 A;  4NPN A;  1ZKH A;  4ANX A;  4MJS A;  3OJ3 A;  3A4S C;  4F7Z A;  1V80 A;  2LJ5 A;  1WGG A;  2MP2 A;  4IUM B;  2LGD A;  4HWI B;  1GNU A;  1WYW B;  4BKS A;  3W1S C;  2KN5 A;  3UIO B;  3NHE B;  3QAQ A;  4X57 B;  4AWJ A;  1UGM A;  2IYD B;  1TGZ B;  2NR2 A;  3PZD A;  4DHZ E;  1C3T A;  3ZLZ A;  3R7Q A;  4GOC A;  1WX7 A;  1WR6 E;  2MBB B;  3IG3 A;  3NOB A;  2BPS A;  2KMA A;  3KUC B;  4PS3 A;  5AZG A;  1VCB A;  1WJ6 A;  4HPM B;  2L0T A;  2XK5 A;  4NY0 A;  2JZ3 B;  3N32 A;  4FA6 A;  2FAZ A;  4W9I A;  4E3C A;  3PSE B;  2I1J A;  2KLC A;  4II2 B;  2GBN A;  3JSV B;  3UQA A;  4K7U A;  3PGE A;  4MM3 A;  3R7R A;  3V62 A;  3ZDM C;  2WYQ A;  4P7I A;  1UEL A;  1V86 A;  2IY0 B;  2K8H A;  4B95 A;  2JVC A;  2KJR A;  5DPT A;  1EUV B;  3DVN V;  3PRE A;  5CTR C;  4F8C B;  5E6P A;  1WIA A;  3NZS A;  1RFA A;  4KZ0 A;  2MBO A;  2KQS A;  1WR1 A;  2LXA A;  3W1S A;  2LZ6 A;  4ANV A;  2MQJ A;  2KFJ A;  2L7R A;  3PV1 A;  5C23 A;  1WFY A;  2PPH A;  4I6L B;  3KH0 A;  1SGH A;  2N7E A;  3PVL A;  4WWN A;  4AJY B;  4FHK A;  3AXC A;  3ZVV A;  2PEA A;  3KW5 B;  3A9J B;  3VTU A;  1HE8 A;  3CMM B;  2FNJ B;  3RUL A;  2KTR B;  2LVO A;  3KYD D;  4WWO A;  5LLI A;  3DOW A;  2KJ6 A;  4PYU A;  4WAA A;  5AZH A;  5JHA A;  4K81 A;  2N4F A;  4IC7 B;  1KLV A;  3M63 B;  2KKC A;  2MSE D;  2KDE B;  2ZCC A;  2KVR A;  2K25 A;  3RUI B;  3HHM A;  2C7H A;  5J18 A;  2MBE A;  3APD A;  4II3 B;  2K1F A;  4GDL A;  3A1Q A;  4IM2 A;  1GUA B;  3H7P A;  2CHZ A;  2KWC A;  2G4S A;  1SE9 A;  1YD8 U;  4W9D A;  1U4A A;  3RZF A;  2C5L C;  1GC7 A;  2KDB A;  2L76 A;  5G2N A;  3Q3J A;  2AYO B;  2DYM A;  4FJV B;  2L05 A;  3O65 B;  1LM8 B;  1VD2 A;  1EO6 A;  2V3S A;  4RMA A;  2M17 A;  2DX5 B;  2WDT B;  4GDK B;  4K7W A;  3B0A A;  4URK A;  1L2N A;  3DCG A;  2JZZ A;  4XC2 A;  3VH3 B;  3PPA A;  2KTF A;  2KK8 A;  4DWF A;  1S1Q B;  2BWE S;  2LUE A;  1IYF A;  1LQB A;  2D2Q A;  1OGW A;  2DZJ A;  4CHK A;  3ZUN A;  4HCP B;  3MTN B;  4XZ4 A;  3A1Q B;  4HK2 A;  2KZR A;  3U7D A;  4CYE A;  5J17 A;  1RLF A;  2AWT A;  1P1A A;  3PT2 B;  1MG8 A;  5LXI B;  1Q0W B;  4HXD A;  1Q5W B;  2NPT A;  4PS8 A;  4RM9 A;  3WIM A;  1C1Y B;  3A33 B;  3B1L X;  4WJN A;  1Q1O A;  3JW0 X;  4RM8 A;  3ZNZ B;  1UBI A;  2ZNV C;  3VQI A;  4ICV A;  1WZ3 A;  4NJ7 A;  3QK0 A;  3A9J A;  4EUT A;  2D10 A;  3B08 A;  3OLM D;  4TUU A;  2PJH A;  2R2Q A;  1WGD A;  1I42 A;  3GZN I;  3R3M A;  2QHO A;  4ZDV A;  1WXV A;  4W9K A;  3ZO5 B;  2DZM A;  4G11 A;  3L16 A;  3DBS A;  3IFW B;  1RAX A;  4ZYN A;  4MGK E;  1LFD A;  3LDZ E;  2D3G A;  4OVU A;  2MW5 A;  3BIN A;  4EFO A;  3PRP B;  4F1S A;  2FCN A;  1WX8 A;  4BKG A;  4N9F 4;  3WAN A;  5CX3 A;  1E7V A;  4GN1 A;  4LJP B;  5BO4 B;  3WA0 A;  2L3Z A;  4MJS B;  5E6N A;  4FAD A;  1WGH A;  3DVG X;  4FUL A;  4LDT D;  2JWZ A;  2CKH B;  3UIN B;  3QX1 A;  4FJY A;  3TBL D;  3V6E B;  2K8C A;  1E8Z A;  4EOY A;  2GOW A;  2KAN A;  2M1M A;  2M4N A;  4TV3 A;  3GOE A;  4JGH B;  1WF9 A;  2EKE C;  1V49 A;  3PLU A;  2KX0 A;  2BF8 B;  1WM3 A;  2FCS A;  2L0F A;  3HK0 A;  1V6E A;  1WRD B;  3VUW A;  3WAL A;  3ONS A;  2RGF A;  5EDS A;  2KOX A;  3CST A;  2DHZ A;  4DHZ B;  1Z2M A;  2FCM A;  4AOF A;  1E5W A;  4DHJ D;  3L54 A;  2HD5 B;  4M8M A;  5HKH A;  2ZPN A;  4FN2 A;  1XD3 B;  3DVG Y;  5L83 A;  3JSV A;  2BYV E;  3NZU A;  5DPR A;  4ZRI A;  2WX0 A;  3HM3 A;  4IWP A;  5JHB A;  2NVU I;  2LVQ A;  3DBH I;  1R4M I;  5AZF A;  2WWZ A;  3BY4 B;  3SDL C;  2MX2 A;  5AEK B;  2NBV B;  4FJZ A;  4AP4 C;  4GIV A;  4LCD E;  3P2B A;  4FLH A;  5TR5 A;  4BFR A;  2JRI B;  2KWV B;  1K8R B;  4EEW A;  2MBH A;  3M95 A;  4A3O A;  1TZ1 A;  2IY1 B;  4TQ0 A;  2ZJD A;  2HTH A;  5E6O A;  2BKR B;  2JF5 A;  2J0J A;  3PTF C;  3A9K A;  2KFK B;  1H8C A;  1IPG A;  4BOS C;  2DYO A;  4MEM A;  2DAF A;  1AAR A;  2PE9 A;  2O6V A;  3PHX B;  1WJU A;  2ZVN A;  4M0W B;  4MSM B;  2BWF A;  2N7D A;  3IBE A;  3H6N A;  2VRR B;  3Q3F A;  1WJ4 A;  1TBE A;  4IW0 A;  1WY8 A;  3T9L A;  1OTR B;  1WH3 A;  3AU5 A;  2J0M A;  2HE7 A;  2KC1 A;  2FUH B;  1V2Y A;  3JYU A;  4KV2 A;  1YX5 B;  4M8N A;  4W9L A;  2MRP A;  1I35 A;  1UH6 A;  3L17 A;  2L00 B;  3TJP A;  1R4N I;  2UYZ B;  4KZC A;  2C7N B;  2DZI A;  2OOB B;  4ASW C;  1M94 A;  4MGI E;  3ZRC A;  2LWP A;  1YIW A;  2ZCB A;  4KSK C;  1J8C A;  2MWS B;  4BVU C;  3PHW B;  4K7S A;  4DDI D;  1EF5 A;  3PS6 A;  3HM6 X;  4DHJ B;  2M0X A;  2LAS A;  2O6V D;  2LI5 A;  3L08 A;  4EZL A;  3APC A;  2RR9 A;  3TCA A;  3UF8 A;  2J7Q B;  2MLB A;  4GU2 A;  2FIF A;  1CMX B;  3V60 A;  2XBB C;  2K39 A;  4HCN B;  3ZTC A;  3W1Y A;  3QQ8 B;  3HIZ A;  1UZX B;  1F9J A;  3C0R B;  2FID A;  3DBL I;  1G6J A;  4MDK E;  3ZW3 A;  4DXA B;  1SIF A;  1P0R A;  2KTR A;  2KC2 A;  3ZNI D;  4BOZ B;  1GG3 A;  3TIX A;  2N9P C;  2N1W A;  2EMS A;  1WXS A;  4GDK A;  4W9F A;  2KNB A;  2LXC A;  4ANW A;  1ZW7 A;  2GBR A;  4FHJ A;  5KHO A;  3ZRF A;  1E8W A;  2LD9 A;  2Z59 B;  1XQQ A;  2AL3 A;  1ZGU B;  3OAW A;  3ZDT A;  4JL9 A;  2W9N A;  4TKN A;  1E8Y A;  2CR5 A;  1WE7 A;  1IP9 A;  4W9J A;  3L13 A;  2EMT A;  4MSQ B;  1GC6 A;  4XX5 A;  3UIP B;  3WAP A;  3QIJ A;  2DYB A;  1E7U A;  4W9H A;  2UWQ A;  2PE6 B;  2ASQ A;  2GBK A;  3S2A A;  2KHW B;  4W9C A;  1A5R A;  4ICU A;  2KO3 A;  2Z0D B;  2AEH A;  3K9P B;  2IO2 B;  2AL6 A;  2KFK A;  1PQS A;  2K8B A;  2K6Q A;  4NAW B;  4GGQ A;  4B6W A;  1NDD A;  1NI2 A;  2C7M B;  3L0W B;  1LXD A;  4NQL B;  3VH4 B;  4EZK A;  4WJO A;  3QCA A;  3MHS D;  5L95 C;  2I1K A;  2IO1 B;  2KJH B;  1WXA A;  3RD2 A;  3H7S A;  4GXB A;  3DQV A;  2JT4 B;  4JQW C;  3UQB A;  4GMV A;  1X1M A;  2LRW A;  1KOT A;  3VTV A;  5DPW A;  1S3S G;  3PLV A;  3SHQ A;  1ISN A;  1V81 A;  3QWZ B;  3AU4 A;  3NY5 A;  3JVZ X;  2NCN A;  5KHQ A;  3SU8 X;  4BBN C;  2JUO A;  2JRH A;  2J0K A;  4I6P A;  3CF6 E;  2Y5B B;  3RZW C;  4FBJ B;  1WGY A;  3EFU A;  3K9O B;  4KSL C;  5D6J B;  2N1V A;  2G3Q B;  3L10 B;  4WWP A;  2DAJ A;  3TMP B;  3MJW A;  4WJP A;  4HDO A;  2G45 B;  2YVC A;  4IWQ A;  1WI0 A;  3V6C B;  1Z5S B;  1D3Z A;  2JXX A;  4HVB A;  4GSW A;  4HPL B;  4JIO U;  3RCZ A;  4HDQ A;  1WX9 A;  2D07 B;  5CHV C;  2MBQ A;  1J0G A;  4MGY E;  3KYC D;  3UGB B; 
#chains in the Genus database with same CATH topology
 1QLB B;  2NPT B;  4YSZ B;  3DBH B;  2KQ4 X;  1JWU D;  2Z0E B;  1E0Z A;  2C60 A;  3EEC A;  1XCT L;  1JAL A;  1GJZ A;  5HG2 A;  4PS7 A;  1FD6 A;  1QOF A;  3QC8 B;  4P6V F;  4DXG A;  4K1R B;  2QEJ C;  3N1Z C;  3U30 A;  2KMC A;  5JZE B;  3DBR I;  4GB9 A;  3X0W A;  3AI5 A;  2NTT A;  3AE3 B;  4MH0 E;  5D3I B;  5JH5 C;  1UBQ A;  3WAO A;  2IPK D;  3AUL A;  5G5H A;  1WM2 A;  5CHF A;  1N61 A;  2R61 A;  1TIF A;  1ZUD 2;  2K9X A;  3V61 A;  1V5T A;  2KQ7 A;  3X23 A;  1RRB A;  4ZRQ A;  3N1X C;  3I3T B;  2A4Z A;  3D32 A;  1MI0 A;  4GLS C;  2WLB A;  3N3K B;  2IGH A;  1GB1 A;  4A20 A;  1C4A A;  2ZZP B;  1ENF A;  4YL8 A;  1R7S A;  4KDI C;  5C1Z A;  4NNJ B;  4W9E A;  3CSF A;  4LNO A;  1QIL A;  3PO0 A;  1E8X A;  4K3B A;  4G3X B;  4KX6 B;  2PTL A;  2RSU A;  1DGJ A;  2M0A A;  3RYT A;  2JQR B;  3ZIM A;  5J2R A;  3P4P B;  2KWU B;  4JX1 C;  4ZRK A;  2KXJ A;  3QA8 A;  2WNM A;  3W2D A;  4N58 A;  2A5U A;  1VRA B;  4I6N B;  2MA9 B;  1KJT A;  4NJ6 A;  3ZTD A;  3BII D;  3N1Y C;  1UWM A;  3VRB B;  1B1Z A;  5IP4 D;  1J7A A;  1QF6 A;  2G4D B;  1RM6 C;  2PVG C;  3RNG C;  3ZXV A;  3OJ3 A;  3A4S C;  4F7Z A;  2INN E;  1WGG A;  1D4B A;  2WGS A;  1GNU A;  4BKS A;  3NHE B;  2INC C;  4X57 B;  4XE0 A;  1GAQ B;  2NR2 A;  4DHZ E;  3ZXR A;  1AYF A;  4NZL B;  3NOB A;  4CQN A;  1VCB A;  4NY0 A;  2JZ3 B;  4FA6 A;  4W9I A;  4MM3 A;  4QAY A;  2W55 A;  3C8Y A;  3EFC A;  1UEL A;  2IY0 B;  2N0S B;  3NS1 A;  2JVC A;  2KJR A;  1T0S C;  1N5X A;  3DVN V;  3PRE A;  5CTR C;  1WIA A;  1J7B A;  4XYC A;  4ZHO A;  2MBO A;  3P4S B;  2LXA A;  2LZ6 A;  2MQJ A;  2L7R A;  1WFY A;  2RDH A;  2L1A A;  4KGS A;  1SGH A;  4AJY B;  2PIA A;  4JWU C;  2PEA A;  3VTU A;  2KTR B;  2VZK B;  3DBL B;  3NVV A;  4PYU A;  5JHA A;  4K81 A;  3M63 B;  2KVR A;  5J18 A;  4II3 B;  3H7P A;  3NVW A;  2WXL A;  3RZF A;  2C5L C;  3N9Y C;  2KDB A;  5G2N A;  2AYO B;  2DYM A;  3MC0 B;  4FJV B;  2L05 A;  2RMM A;  1EO6 A;  2V3S A;  4GDK B;  4URK A;  1L2N A;  3DCG A;  3VH3 B;  2KK8 A;  1IYF A;  1TKE A;  3Q6B A;  3ZUN A;  2H89 B;  3AB5 A;  1HQR D;  5J17 A;  2AWT A;  1P1A A;  4PS8 A;  4HXD A;  1Q5W B;  4LTU A;  3RN9 C;  1C1Y B;  3A33 B;  2JSV X;  2WXK A;  3BWU D;  2I2Y A;  3JW0 X;  1UBI A;  4NJ7 A;  1XLQ A;  2NMQ A;  4EUT A;  1OFF A;  2PJH A;  2DWQ A;  2R2Q A;  1D5X C;  3MJ5 A;  4ZDV A;  2QHO A;  4G11 A;  1DYQ A;  4RGN A;  4MGK E;  2K0P A;  2MW5 A;  2FCN A;  1N63 A;  1WX8 A;  3HVD A;  4BKG A;  4N9F 4;  2WU5 B;  4OZB A;  5E6N A;  4FAD A;  3TEW A;  4O1N A;  2D3A A;  1E10 A;  3TBL D;  4FJY A;  4N59 A;  3Q3M C;  3V6E B;  2K8C A;  4EOY A;  2GOW A;  3FAH A;  2X8X X;  3IXS A;  4B0E A;  1WM3 A;  2FCS A;  3HK0 A;  4M01 A;  1VDV A;  1D5Z C;  2KOX A;  2AQ1 B;  2DHZ A;  1CZP A;  3FIL A;  4DHZ B;  1Z2M A;  3IT6 B;  3Q8F A;  1SSN A;  2RPV A;  3ZJV A;  1SJH D;  4KGT A;  1TJE A;  1HZ6 A;  3R8B A;  4IWP A;  3DBH I;  5AZF A;  2WWZ A;  1SJE D;  1FNV A;  4AP4 C;  4FLH A;  1K8R B;  3M95 A;  1HZ5 A;  1MJD A;  1J7C A;  2Z8L A;  2JF5 A;  2J0J A;  2DYO A;  1MPE A;  2PE9 A;  2ZVN A;  3CIR B;  4YSX B;  1WJ4 A;  1TBE A;  5G5G A;  3AU5 A;  1WH3 A;  2J0M A;  1MVK A;  2HE7 A;  2KC1 A;  3AE4 B;  1I35 A;  2L00 B;  2UYZ B;  3SFE B;  2C7N B;  2OOB B;  4ASW C;  4MGI E;  4RNA A;  1ZE3 D;  2M0X A;  2LAS A;  2WXH A;  4NAM A;  1FMA D;  4GU2 A;  1YN5 A;  2XBB C;  2K39 A;  2KAJ A;  4HCN B;  3ZTC A;  3QQ8 B;  1A70 A;  3MHZ A;  3DBL I;  4MDK E;  4DXA B;  4OW0 A;  4BOZ B;  3U7Z A;  2GBR A;  2LD9 A;  2Z59 B;  1I7H A;  3OAW A;  1E8Y A;  5BMG A;  1IP9 A;  2EMT A;  1RFK A;  1GC6 A;  2WXR A;  4W9H A;  3KQ4 A;  1DOY A;  2JYE A;  2X38 A;  5LNK 1;  3OG5 A;  2GI9 A;  1M4V A;  1FCL A;  4B6W A;  1NDD A;  2C7M B;  4EZK A;  1LXD A;  3R2T A;  4WJO A;  1I4G A;  2IO1 B;  2W3R A;  4C80 A;  3GZN B;  1WXA A;  3RD2 A;  3H7S A;  1NVI D;  4GXB A;  4JQW C;  2OHF A;  2LRW A;  4OHJ A;  4ARC A;  3MFG A;  1L6V A;  3PLV A;  3QWZ B;  3VRA B;  5BMI A;  3IT4 B;  2N1V A;  4B0M A;  4XDC A;  1Y56 A;  3U2S C;  3TMP B;  2K22 A;  4HDO A;  1Z5S B;  2WXP A;  4HVB A;  4GSW A;  2D07 B;  5CHV C;  2DBY A;  4MGY E;  3KYC D;  3MC8 A;  1TKG A;  3VXW A;  2IO0 B;  4CO7 A;  2K6D B;  2BS4 B;  4LDT B;  3ENE A;  2FCQ A;  4J6I A;  3P4R B;  2DEN B;  1V1P B;  2O6V B;  2M8S A;  1RWS A;  2IDY A;  3RFZ B;  3IVF A;  2ZW0 A;  1C79 A;  1E90 A;  3VDZ A;  3RMK C;  4K3C A;  1K53 A;  4JLC A;  1I4H A;  4KIK A;  2XK5 B;  5EE1 A;  2NS5 A;  1NEK B;  3ECI A;  2RDB C;  1DOX A;  3V05 A;  3SD5 A;  3I57 A;  3LXF A;  2BGF A;  2DZK A;  2GBM A;  4IM3 A;  1R4M B;  4GDL B;  2FUG 1;  1E7P B;  2GMI C;  3T8M A;  3ALB A;  4E74 A;  2IJ0 A;  3VTW A;  3U4E G;  2EKI A;  1UD7 A;  4L1B A;  1KH0 A;  4S17 A;  3LYY A;  5D2M B;  2PVO D;  3AEB B;  4WJQ A;  2W3S A;  3PRZ A;  2BKF A;  1YJ1 A;  3PRM B;  1MG4 A;  3AE8 B;  2V3P A;  2WHI A;  2K5P A;  2N9E B;  2WDQ B;  2BT6 A;  2O2V B;  2CJO A;  2AX5 A;  3H9D A;  4A9A A;  4EKU A;  3VUX A;  3DHG C;  1P9D U;  5G55 A;  4DDG D;  3LJ3 A;  1EU3 A;  2B3A A;  3VAW A;  2XN9 C;  4ZRJ A;  3APF A;  2BYF A;  4A3P A;  3TSS A;  1FNW A;  1NBF C;  1XCQ L;  3U8Z A;  1NEN B;  3IHP C;  4W9G A;  2BS3 B;  1OEY A;  4YTN B;  3OJ4 B;  2V1Y A;  1WZ0 A;  2I38 A;  4DK5 A;  4KDL B;  3ETR A;  2MJE A;  5CHW A;  1TTN A;  4G0N B;  3H1U A;  1JRO A;  1FXT B;  1FXA A;  1K51 A;  4MJS A;  2MP2 A;  1SXT A;  4HWI B;  2MJD A;  3W1S C;  2KN5 A;  3W9C B;  3QAQ A;  4AWJ A;  1UGM A;  1XEE A;  2IYD B;  3H8H A;  3PZD A;  3Q8A A;  3ZLZ A;  3R7Q A;  1WR6 E;  4L2Y A;  3IAS 1;  4PS3 A;  5D3D A;  5AZG A;  2V4I B;  2L0T A;  1VZ6 A;  1F1H A;  3RNC C;  2FAZ A;  3PSE B;  3BZD B;  2KLC A;  4II2 B;  4RF0 A;  2IND C;  2AQ3 B;  3Q8B A;  2NTS A;  3V62 A;  2WYQ A;  1V86 A;  1UF0 A;  1TS4 A;  1PUT A;  1WR1 A;  3W1S A;  1L0X B;  4WWN A;  5FR3 A;  4FHK A;  3I5J C;  3AH7 A;  4C7Z A;  1HE8 A;  4MH8 A;  3KYD D;  5LLI A;  3DOW A;  2KJ6 A;  1YQ3 B;  5AZH A;  2N4F A;  1QT9 A;  2KKC A;  2MSE D;  2DLB A;  3RUI B;  2C7H A;  2CJN A;  2EEL A;  3A1Q A;  1WXQ A;  3DWM A;  4N6E B;  2JU6 X;  4W9D A;  2KVZ A;  3SR6 A;  3T3N A;  1F52 A;  1VD2 A;  2LGS A;  1I4Q A;  2LJI A;  3B0A A;  4XC2 A;  2JZZ A;  3PPA A;  3P1M A;  2FE8 A;  2JYT A;  2WXN A;  2KN4 A;  5EE0 A;  1ROE A;  2DZJ A;  1OGW A;  4CHK A;  1BML C;  3MTN B;  4XZ4 A;  3A1Q B;  2KZR A;  2WXG A;  3U7D A;  3PT2 B;  1PGA A;  2TSS A;  1F77 A;  1Q0W B;  5LXI B;  4LLG M;  2WXM A;  3B1L X;  3ZNZ B;  4ICV A;  2L32 A;  3QK0 A;  3RNA C;  4J3O D;  3OLM D;  1N60 A;  1I42 A;  4P1B C;  1C77 A;  3AV8 A;  1NI3 A;  3EGR A;  3TEZ A;  1ZP0 B;  4YSY B;  4XDD A;  1JWS D;  2D3G A;  3PRP B;  4F1S A;  1CK1 A;  3WAN A;  4LJP B;  4KGR A;  4MJS B;  3WCQ A;  1WGH A;  3PZ7 A;  4FUL A;  1JCK B;  2N9K A;  2CKH B;  3UIN B;  3QX1 A;  4C4V A;  5IKC M;  2HDE A;  4MT5 A;  1E8Z A;  2KAN A;  2M4N A;  3GOE A;  1WF9 A;  5EE3 A;  3GE8 C;  2UU7 A;  1V6E A;  3VUW A;  3ONS A;  5EDS A;  5FK9 C;  3Q3N C;  4FN2 A;  2GLS A;  1XD3 B;  1HTQ A;  2LUM A;  3ZYY X;  3BY4 B;  4DQO C;  2NBV B;  4FJZ A;  2JRI B;  2KWV B;  4LNN A;  4ZYS A;  4A3O A;  5MPO A;  2IY1 B;  4TQ0 A;  2HTH A;  1JWM D;  1P7E A;  2V0G A;  4C4V B;  1FRR A;  1SEB D;  1ZPS A;  3L4P A;  1IPG A;  1I4X A;  2DAF A;  1WJU A;  4MSM B;  2BWF A;  3IBE A;  1RYJ A;  3B2F A;  4IW0 A;  1WY8 A;  2LFI A;  2ACZ B;  1JRP A;  1OTR B;  1SE3 A;  1HEZ E;  1C78 A;  2BVC A;  3JYU A;  4RH6 A;  3AEG B;  1UH6 A;  3L17 A;  2LEK A;  4KZC A;  2DZI A;  1TS2 A;  1M94 A;  4KSK C;  1YMH E;  2ZCB A;  2MWS B;  1EF5 A;  4AS1 A;  3GP7 A;  3TCA A;  2MLB A;  4HPP A;  3ZJT A;  1FO4 A;  1FRD A;  1F9J A;  1UUP A;  2KWD A;  1G6J A;  2INP E;  1P0R A;  1GG3 A;  3TIX A;  4GDK A;  3NRZ A;  2LXC A;  3ZRF A;  1XQQ A;  2H88 B;  3BVM A;  2AL3 A;  3P4Q B;  4JL9 A;  1WRI A;  4W9J A;  4MSQ B;  1QOB A;  5GXG B;  2PE6 B;  2SAK A;  4IOI E;  2E3T A;  4M0W A;  2AEH A;  3K9P B;  2IO2 B;  3AEC B;  3PZ8 A;  1WWT A;  1PGB A;  3QCA A;  5L95 C;  1UNS A;  1I4R A;  4FXC A;  5IO9 A;  1GPX A;  2BYT A;  4A8X C;  5H8Y E;  4GMV A;  1X1M A;  3VTV A;  1LO5 D;  2W82 A;  3SHQ A;  2IGD A;  3RZW C;  2WS3 B;  3EFU A;  4KSL C;  5D6J B;  1QQR A;  1KLG D;  2DAJ A;  3MJW A;  4JWS C;  1WI0 A;  2JXX A;  1C76 A;  3TEY A;  2WDR B;  4HDQ A;  1C4P A;  5IOI A;  1FCC C;  3KUD B;  1JML A;  4OVV A;  2N9L A;  2CHW A;  3R66 C;  2LMC A;  3NS8 A;  4LNK A;  1YNT E;  1JWA D;  3NUH B;  3EUB 2;  1SB3 C;  2ZEQ A;  4HJK A;  3U52 E;  2KDF B;  2D3C A;  5HFY A;  4US9 A;  3M62 B;  4US8 A;  1L5P A;  1Q10 A;  5DPS A;  5FKA C;  1T0Q C;  1KLU D;  2PLP A;  1FFU A;  3KWL A;  3KVF B;  3TL5 A;  1T0R C;  2D5G A;  3ZKJ C;  1P98 A;  1EM7 A;  4WQO B;  2M56 B;  2ZVO A;  3ZQ4 A;  2ZPY A;  2D11 A;  1T0Y A;  5I4D A;  1YN3 A;  2KLG A;  2QMT A;  4KVG B;  2NBU A;  1WGR A;  4MEL A;  3A4R A;  4REZ A;  2BYE A;  3ABV B;  4LNI A;  1E6E B;  2RPQ A;  4AJW A;  3FIL B;  2N9X A;  2REX A;  4DXF A;  4TQ1 A;  1P3Q U;  4RFB A;  1VR9 A;  2JPH A;  2FBW B;  4DBG A;  1YQB A;  3H7P B;  1H4R A;  3DPD A;  1KM7 A;  2KD0 A;  2LHE A;  5FR6 A;  5BYS A;  2JZP A;  3BYY B;  4IM0 A;  1MHX A;  5DCN A;  2SEB D;  3QJZ A;  4MGZ E;  2OJW A;  1JW9 D;  4PK1 A;  1V5O A;  4C56 C;  4WQM A;  1N5W A;  1ZDX A;  2C9W B;  3DHI C;  1L4Z B;  2KDI A;  4XWW A;  3WAM A;  3AED B;  1XLO A;  2V9H A;  3NVZ A;  3ZNG C;  1FEH A;  3UI3 A;  4L23 A;  2WXI A;  5HHD G;  5E6J A;  2CS4 A;  3ZGZ A;  4EZJ A;  4PYZ A;  3ML8 A;  2WX1 A;  4BBN F;  3HUI A;  2JY6 A;  1AWD A;  1ZKH A;  2LGD A;  2W54 A;  1WYW B;  3O13 A;  3GE3 C;  4ITK A;  2PMV A;  2M19 A;  1IUE A;  4GOC A;  3VR8 B;  3IG3 A;  2BPS A;  4IDI A;  2XK5 A;  3N32 A;  3NVY A;  1AW7 A;  1SE4 A;  1OQQ A;  2KAC A;  3JSV B;  3UQA A;  1XXG A;  3PGE A;  3R7R A;  1VZ7 A;  1P7F A;  4ZRP A;  5AUK A;  1F2R I;  1EUV B;  5E6P A;  2N7J A;  5H92 C;  1RFA A;  2KQS A;  4ZOH C;  4ANV A;  2KFJ A;  3AE2 B;  1PFD A;  3PVL A;  4YXD B;  1ESF A;  1MFW A;  3CMM B;  1CQV A;  3RUL A;  4WWO A;  4HEA 1;  4WAA A;  3SFD B;  4JE3 B;  3HRD D;  1UWX A;  2BB5 A;  2KDE B;  2BQQ A;  3HHM A;  3APD A;  5TSS A;  4KKJ A;  4IM2 A;  1GUA B;  2WDV B;  3AEA B;  2WXO A;  4WIP A;  2KT7 A;  2KWC A;  2AQ2 B;  1U4A A;  1ZXH A;  2L76 A;  3Q3J A;  2WXQ A;  3O65 B;  1TKY A;  1LM8 B;  2OED A;  2WDT B;  4K7W A;  1XO3 A;  4DWF A;  2KTF A;  2BWE S;  2LUE A;  3KWV A;  3CWI A;  2D2Q A;  2BBC A;  3AE1 B;  4CYE A;  1L0Y B;  1RLF A;  1MG8 A;  3RPF C;  2NPT A;  2JWU A;  1PGX A;  1Q1O A;  4RM8 A;  3Q3O C;  2QIL A;  1WZ3 A;  3A9J A;  2D10 A;  3B08 A;  4BAX A;  2KDM A;  5EE9 A;  3R3M A;  1D6E C;  2ZW1 A;  1N6Z A;  4W9K A;  2DZM A;  1BUI C;  2QJL A;  3DBS A;  4EE2 A;  3IFW B;  2RDG A;  1RAX A;  3C19 A;  4OZA A;  4OVU A;  2MH7 A;  3BIN A;  4EFO A;  4TMA B;  1VLB A;  3LB8 C;  1E7V A;  4GN1 A;  5CX3 A;  5BO4 B;  1LGR A;  3WA0 A;  2L3Z A;  3DVG X;  4LDT D;  2PKO A;  2QDF A;  1ACC A;  2M1M A;  2J42 A;  3PLU A;  3EA6 A;  2KX0 A;  2BF8 B;  2L0F A;  1WRD B;  3WAL A;  1IBX B;  2FCM A;  5BMH A;  1E5W A;  4DHJ D;  4MAC A;  3L54 A;  5HKH A;  3N20 C;  3DVG Y;  5L83 A;  4WWM A;  4ZRI A;  2LVQ A;  2V3N A;  2WU2 B;  4WH4 A;  4LCD E;  3P2B A;  5TR5 A;  4EEW A;  2MBH A;  1TZ1 A;  3BK1 A;  2J4X A;  1XLN A;  1L6U A;  3A9K A;  2KFK B;  1EU4 A;  4BOS C;  4MEM A;  1CJE A;  1AAR A;  2N7D A;  3H6N A;  2VRR B;  1FXI A;  3Q3F A;  3AEE B;  5JXV A;  3Q8E A;  2E6X A;  1V2Y A;  3KLS X;  4KV2 A;  4M8N A;  1ET9 A;  1SBB B;  3DBR B;  4R3D A;  4RGT A;  4USA A;  1SIJ A;  3ZRC A;  2LWP A;  1YIW A;  1J8C A;  3PHW B;  4DDI D;  3PS6 A;  4A6Q A;  3HM6 X;  4DHJ B;  2O6V D;  4EZL A;  2LGI A;  3APC A;  2RR9 A;  3UF8 A;  2FIF A;  1CMX B;  3TUO A;  3V60 A;  3GB1 A;  3HIZ A;  2FID A;  4M02 A;  1IBX A;  3MC9 A;  3VR9 B;  2EMS A;  1WXS A;  4W9F A;  2VZK D;  4HRO A;  4ANW A;  5KHO A;  4FHJ A;  1B9R A;  3FKY A;  3TEX A;  1NYQ A;  1N62 A;  4TKN A;  3GS2 A;  2CR5 A;  1KF6 B;  1FPY A;  3ZJU A;  3UIP B;  3QIJ A;  1E7U A;  2ASQ A;  3S2A A;  2KHW B;  4W9C A;  5C3J B;  2KO3 A;  2AL6 A;  2KFK A;  1PQS A;  2K8B A;  4ACF A;  2K6Q A;  3BK2 A;  4H2A A;  3E9S A;  3MHS D;  1JQ4 A;  3URY A;  3RNF C;  3DQV A;  2JT4 B;  2Q5W D;  1ISN A;  3NY5 A;  3JVZ X;  2NCN A;  3Q14 C;  2KMM A;  2JRH A;  3CF6 E;  1VJK A;  1V1P A;  2YVC A;  4IWQ A;  2HTM E;  1F2R C;  1PYW D;  4JIO U;  1WX9 A;  1BXT A;  3AEF B;  1J0G A;  5D7G A;  2KX3 A;  4M00 A;  2MP2 B;  1FNU A;  2V4L A;  2DNF A;  2YLM A;  4IWO A;  1L7Y A;  4ARI A;  3QAR A;  4LK0 M;  1WMH A;  2RD0 A;  2IZV B;  2L52 A;  4C00 A;  4ANU A;  1HXY D;  3P63 A;  4B9K A;  2VH2 A;  3RNE C;  1V8C A;  4IG7 B;  2JXT A;  1OQY A;  2LVP A;  3ZNH B;  2ONQ A;  5LXH A;  4AUQ C;  2J52 A;  3RT3 B;  2Y3A A;  1BT0 A;  3QHT A;  3EC8 A;  1TS3 A;  1EF1 A;  2LGX A;  3VFK A;  3AE9 B;  2LGY A;  5GMV A;  2ZNV B;  1YX6 B;  3KUZ A;  2CHX A;  1WMH B;  3I63 C;  2NBW B;  3IAM 1;  3M3J A;  4BKT A;  1YOV B;  2WXJ A;  2BB6 A;  1JRU A;  1TS5 A;  2BW2 A;  2LRU A;  3B2G A;  3DHH C;  2OJR A;  5IA7 A;  3AMZ A;  3DDC B;  4KIK B;  3VVW B;  4KKI A;  4BKS D;  2MCN B;  1F0Z A;  3BVG A;  3SEB A;  1C4C A;  3N30 A;  3HVZ A;  1WJN A;  4HLE A;  4G50 A;  1Y8R C;  3T3O A;  4JPS A;  1XT9 B;  3V3X A;  1OEY J;  3ML9 A;  1QZE A;  1YQ4 B;  1YJJ A;  2WQY B;  1HA5 A;  1V9J A;  2O2V A;  3A9K B;  3VHT C;  1MHH E;  2CU1 A;  3EHV A;  2IBI B;  2IO3 B;  4NQK E;  4WUR A;  1WYG A;  4E71 A;  1ZDV A;  3NZ3 A;  4NAW A;  1K52 A;  2R2O A;  1TY0 A;  5IN7 A;  4S0R A;  1WE6 A;  1KRH A;  3DVN U;  4LJO B;  4HKZ E;  5IAA C;  1FM0 D;  2XEW A;  3RNB C;  3P42 A;  2GBJ A;  5D94 A;  1J19 A;  2HJ8 A;  1FIQ A;  3VUY A;  2MJ3 A;  2L8J A;  1WXM A;  4NPN A;  1L0V B;  4ANX A;  5BYR A;  1V80 A;  2LJ5 A;  4IUM B;  1T3Q A;  1IGC A;  4UDU C;  3UIO B;  1HTO A;  1TGZ B;  1TT5 B;  3BYT B;  1C3T A;  4ZHP A;  1WX7 A;  4OZC A;  2MBB B;  4RCO A;  2KMA A;  3KUC B;  1WJ6 A;  4HPM B;  2B76 B;  3Q8C A;  4E3C A;  2I1J A;  2GBN A;  5HI1 A;  4K7U A;  4XGA B;  3ZDM C;  4P7I A;  2K8H A;  4B95 A;  3FC4 A;  5DPT A;  3E56 A;  4F8C B;  3R2I A;  3NZS A;  4KZ0 A;  4AQ7 A;  1SE2 A;  1YN4 A;  2G9H D;  3PV1 A;  5C23 A;  2PPH A;  1TYG B;  1DOI A;  4I6L B;  3KH0 A;  2N7E A;  3AXC A;  3ZVV A;  3KW5 B;  3A9J B;  2FNJ B;  2LVO A;  2Y5C A;  2Y5P A;  2D3B A;  4IC7 B;  1KLV A;  2BTE A;  2ZCC A;  2K25 A;  2MBE A;  2K1F A;  4GDL A;  2L83 A;  2CHZ A;  2G4S A;  1SE9 A;  1YD8 U;  4TSS A;  4RGM A;  1WGK A;  1GC7 A;  3NG0 A;  1QKZ A;  4RMA A;  2M17 A;  2DX5 B;  1UGJ A;  1SF0 A;  1FFV A;  1S1Q B;  3AM9 A;  1L4D B;  4D2K A;  1ZXI A;  1LQB A;  2MHJ A;  4HCP B;  4HK2 A;  5C2T B;  4RM9 A;  3WIM A;  4WJN A;  2HJ1 A;  2K3U A;  2ZNV C;  3VQI A;  1YJI A;  2WXF A;  4TUU A;  1WGD A;  3GZN I;  1WXV A;  1KTK A;  3ZO5 B;  3L16 A;  4ZYN A;  3B9J A;  1LFD A;  3LDZ E;  5BYQ A;  4Q2J A;  1E9M A;  1QOG A;  4NJC A;  2JWZ A;  3AE7 B;  2ICI A;  4HKQ A;  3J9C A;  1EWC A;  1TY2 A;  4TV3 A;  4JGH B;  2EKE C;  2MEK A;  1V49 A;  2QSD A;  1IGD A;  4HJG E;  1TZO A;  2RGF A;  3CST A;  3BVZ A;  3W5V B;  4AOF A;  2GB1 A;  4M8M A;  4P1C C;  2HD5 B;  2ZPN A;  1NYR A;  3JSV A;  2BYV E;  3NZU A;  5DPR A;  2WX0 A;  3HM3 A;  5JHB A;  2JX5 A;  2NVU I;  1R4M I;  3SDL C;  1STE A;  2MX2 A;  1JWB D;  5AEK B;  4C7Y A;  4GIV A;  4BFR A;  1ET6 A;  2ZJD A;  4IKG A;  2VH1 A;  5E6O A;  2BKR B;  1XLP A;  3PTF C;  1H8C A;  1T5X D;  1ZOY B;  2O6V A;  3PHX B;  4M0W B;  4YTM B;  1GB4 A;  3OWE B;  3T9L A;  2KYW A;  2FUH B;  4P16 A;  4A55 A;  1YX5 B;  3DWG C;  4W9L A;  1OQR A;  2MRP A;  1T6B X;  3AN1 A;  3TJP A;  1R4N I;  1WSP A;  4BZA A;  4BVU C;  1K50 A;  4K7S A;  2GRI A;  2QIE B;  3L08 A;  2LI5 A;  4WAF A;  2J7Q B;  2J53 A;  1AN8 A;  1R4N B;  2CU3 A;  4OVZ A;  3W1Y A;  2YEP B;  1UZX B;  1KFY B;  3C0R B;  2PW9 A;  2G1E A;  3ZW3 A;  1SIF A;  2KTR A;  2KC2 A;  3ZNI D;  2LHD A;  2N9P C;  2N1W A;  2ON8 A;  1I4P A;  2WP9 B;  2KNB A;  4RGO S;  1V97 A;  1ZW7 A;  1E8W A;  1GOZ A;  4YTP B;  2QC8 A;  1ZGU B;  3ZDT A;  2W9N A;  3NJT A;  1WE7 A;  3MP9 A;  1EWY C;  3L13 A;  1VZ8 A;  4XX5 A;  3WAP A;  2DYB A;  3AE6 B;  4LNF A;  2UWQ A;  2GBK A;  2YEP F;  1A5R A;  4ICU A;  2XNA C;  2Z0D B;  4RF1 A;  3W5U B;  4NAW B;  4GGQ A;  1QOA A;  4HRS A;  1NI2 A;  3VH4 B;  3L0W B;  4NQL B;  1D5M C;  3AE5 B;  1V1O A;  2I1K A;  2KJH B;  3I9V 1;  3Q69 A;  5AUI A;  1C9F A;  3UQB A;  1KOT A;  1PDX A;  1S3S G;  5DPW A;  1V81 A;  2BS2 B;  3AU4 A;  5KHQ A;  3SU8 X;  4MM3 B;  4A90 A;  4BBN C;  2JUO A;  2J0K A;  4I6P A;  2Y5B B;  4XWT A;  4FBJ B;  1WGY A;  3K9O B;  2G3Q B;  3L10 B;  4WWP A;  1XF5 L;  4YT0 B;  5T8I A;  4WJP A;  2G45 B;  4YWG G;  2QCZ A;  3V6C B;  1D3Z A;  2IGG A;  4HPL B;  3RI7 C;  3RCZ A;  3Q2A C;  2MBQ A;  4PT5 A;  3UGB B; 
#chains in the Genus database with same CATH homology
 5D7G A;  3KUD B;  3VXW A;  2IO0 B;  2KX3 A;  2NPT B;  4OVV A;  4CO7 A;  2K6D B;  2MP2 B;  2V4L A;  2Z0E B;  2CHW A;  2C60 A;  2YLM A;  3EEC A;  3R66 C;  3NS8 A;  4IWO A;  1GJZ A;  1L7Y A;  4LDT B;  3ENE A;  2FCQ A;  4PS7 A;  3QC8 B;  4J6I A;  2DEN B;  3QAR A;  2O6V B;  2M8S A;  2ZEQ A;  4HJK A;  1WMH A;  2KDF B;  2RD0 A;  4K1R B;  2IZV B;  3IVF A;  3U30 A;  4ANU A;  4B9K A;  1E90 A;  2KMC A;  3M62 B;  3VDZ A;  3DBR I;  4GB9 A;  4IG7 B;  5JZE B;  3X0W A;  5DPS A;  3AI5 A;  1OQY A;  4JLC A;  2LVP A;  4KIK A;  3ZNH B;  2XK5 B;  4MH0 E;  5JH5 C;  2NS5 A;  4AUQ C;  5LXH A;  1UBQ A;  3WAO A;  3ECI A;  3RT3 B;  1BT0 A;  3QHT A;  3EC8 A;  3KVF B;  3TL5 A;  3AUL A;  3ZKJ C;  1EF1 A;  1P98 A;  3SD5 A;  2LGX A;  1WM2 A;  3VFK A;  4WQO B;  5CHF A;  2LGY A;  5GMV A;  2ZNV B;  2ZVO A;  1YX6 B;  2BGF A;  3KUZ A;  3V61 A;  1V5T A;  2ZPY A;  2D11 A;  2CHX A;  2KQ7 A;  1RRB A;  1T0Y A;  1WMH B;  2DZK A;  2GBM A;  2NBW B;  4IM3 A;  3X23 A;  3M3J A;  2KLG A;  4GDL B;  4KVG B;  3I3T B;  4BKT A;  2A4Z A;  2NBU A;  1WGR A;  3D32 A;  4MEL A;  3A4R A;  2GMI C;  2BYE A;  1JRU A;  3T8M A;  3ALB A;  4E74 A;  2RPQ A;  3VTW A;  2LRU A;  3N3K B;  4AJW A;  2OJR A;  5IA7 A;  2N9X A;  3DDC B;  4KIK B;  3VVW B;  4A20 A;  1UD7 A;  2REX A;  2ZZP B;  4BKS D;  2MCN B;  4TQ1 A;  1P3Q U;  4YL8 A;  5D2M B;  4KDI C;  2JPH A;  4WJQ A;  5C1Z A;  3N30 A;  4DBG A;  3PRZ A;  4NNJ B;  4W9E A;  3CSF A;  1WJN A;  1YQB A;  3H7P B;  1E8X A;  1H4R A;  2BKF A;  1YJ1 A;  3DPD A;  3PRM B;  1KM7 A;  4G3X B;  4G50 A;  2KD0 A;  5FR6 A;  4HLE A;  1Y8R C;  2RSU A;  1XT9 B;  1OEY J;  2N9E B;  3ML9 A;  4IM0 A;  1QZE A;  3RYT A;  5DCN A;  2O2V B;  3ZIM A;  5J2R A;  3QJZ A;  4MGZ E;  1V9J A;  2O2V A;  3A9K B;  2KWU B;  3H9D A;  4EKU A;  1V5O A;  3VUX A;  4ZRK A;  3VHT C;  1P9D U;  2KXJ A;  3QA8 A;  2C9W B;  2CU1 A;  5G55 A;  2KDI A;  3EHV A;  3LJ3 A;  4DDG D;  2B3A A;  3VAW A;  2IBI B;  2A5U A;  2IO3 B;  4NQK E;  4E71 A;  4ZRJ A;  3APF A;  4I6N B;  2BYF A;  2MA9 B;  4A3P A;  3WAM A;  1NBF C;  4NAW A;  1KJT A;  2R2O A;  3U8Z A;  4NJ6 A;  3ZNG C;  3ZTD A;  1WE6 A;  3IHP C;  4W9G A;  1OEY A;  3DVN U;  4LJO B;  3OJ4 B;  5IAA C;  2XEW A;  2V1Y A;  1WZ0 A;  2CS4 A;  4DK5 A;  4KDL B;  5CHW A;  1TTN A;  4EZJ A;  2GBJ A;  2G4D B;  4G0N B;  3H1U A;  5D94 A;  1J19 A;  3ML8 A;  2HJ8 A;  1FXT B;  4PYZ A;  3VUY A;  2WX1 A;  2L8J A;  1WXM A;  4BBN F;  2JY6 A;  4NPN A;  1ZKH A;  4ANX A;  4MJS A;  3OJ3 A;  3A4S C;  4F7Z A;  1V80 A;  2LJ5 A;  1WGG A;  2MP2 A;  4IUM B;  2LGD A;  4HWI B;  1GNU A;  1WYW B;  4BKS A;  3W1S C;  2KN5 A;  3UIO B;  3NHE B;  3QAQ A;  4X57 B;  4AWJ A;  1UGM A;  2IYD B;  1TGZ B;  2NR2 A;  3PZD A;  4DHZ E;  1C3T A;  3ZLZ A;  3R7Q A;  4GOC A;  1WX7 A;  1WR6 E;  2MBB B;  3IG3 A;  3NOB A;  2BPS A;  2KMA A;  3KUC B;  4PS3 A;  5AZG A;  1VCB A;  1WJ6 A;  4HPM B;  2L0T A;  2XK5 A;  4NY0 A;  2JZ3 B;  3N32 A;  4FA6 A;  2FAZ A;  4W9I A;  4E3C A;  3PSE B;  2I1J A;  2KLC A;  4II2 B;  2GBN A;  3JSV B;  3UQA A;  4K7U A;  3PGE A;  4MM3 A;  3R7R A;  3V62 A;  3ZDM C;  2WYQ A;  4P7I A;  1UEL A;  1V86 A;  2IY0 B;  2K8H A;  4B95 A;  2JVC A;  2KJR A;  5DPT A;  1EUV B;  3DVN V;  3PRE A;  5CTR C;  4F8C B;  5E6P A;  1WIA A;  3NZS A;  1RFA A;  4KZ0 A;  2MBO A;  2KQS A;  1WR1 A;  2LXA A;  3W1S A;  2LZ6 A;  4ANV A;  2MQJ A;  2KFJ A;  2L7R A;  3PV1 A;  5C23 A;  1WFY A;  2PPH A;  4I6L B;  3KH0 A;  1SGH A;  2N7E A;  3PVL A;  4WWN A;  4AJY B;  4FHK A;  3AXC A;  3ZVV A;  2PEA A;  3KW5 B;  3A9J B;  3VTU A;  1HE8 A;  3CMM B;  2FNJ B;  3RUL A;  2KTR B;  2LVO A;  3KYD D;  4WWO A;  5LLI A;  3DOW A;  2KJ6 A;  4PYU A;  4WAA A;  5AZH A;  5JHA A;  4K81 A;  2N4F A;  4IC7 B;  1KLV A;  3M63 B;  2KKC A;  2MSE D;  2KDE B;  2ZCC A;  2KVR A;  2K25 A;  3RUI B;  3HHM A;  2C7H A;  5J18 A;  2MBE A;  3APD A;  4II3 B;  2K1F A;  4GDL A;  3A1Q A;  4IM2 A;  1GUA B;  3H7P A;  2CHZ A;  2KWC A;  2G4S A;  1SE9 A;  1YD8 U;  4W9D A;  1U4A A;  3RZF A;  2C5L C;  1GC7 A;  2KDB A;  2L76 A;  5G2N A;  3Q3J A;  2AYO B;  2DYM A;  4FJV B;  2L05 A;  3O65 B;  1LM8 B;  1VD2 A;  1EO6 A;  2V3S A;  4RMA A;  2M17 A;  2DX5 B;  2WDT B;  4GDK B;  4K7W A;  3B0A A;  4URK A;  1L2N A;  3DCG A;  2JZZ A;  4XC2 A;  3VH3 B;  3PPA A;  2KTF A;  2KK8 A;  4DWF A;  1S1Q B;  2BWE S;  2LUE A;  1IYF A;  1LQB A;  2D2Q A;  1OGW A;  2DZJ A;  4CHK A;  3ZUN A;  4HCP B;  3MTN B;  4XZ4 A;  3A1Q B;  4HK2 A;  2KZR A;  3U7D A;  4CYE A;  5J17 A;  1RLF A;  2AWT A;  1P1A A;  3PT2 B;  1MG8 A;  5LXI B;  1Q0W B;  4HXD A;  1Q5W B;  2NPT A;  4PS8 A;  4RM9 A;  3WIM A;  1C1Y B;  3A33 B;  3B1L X;  4WJN A;  1Q1O A;  3JW0 X;  4RM8 A;  3ZNZ B;  1UBI A;  2ZNV C;  3VQI A;  4ICV A;  1WZ3 A;  4NJ7 A;  3QK0 A;  3A9J A;  4EUT A;  2D10 A;  3B08 A;  3OLM D;  4TUU A;  2PJH A;  2R2Q A;  1WGD A;  1I42 A;  3GZN I;  3R3M A;  2QHO A;  4ZDV A;  1WXV A;  4W9K A;  3ZO5 B;  2DZM A;  4G11 A;  3L16 A;  3DBS A;  3IFW B;  1RAX A;  4ZYN A;  4MGK E;  1LFD A;  3LDZ E;  2D3G A;  4OVU A;  2MW5 A;  3BIN A;  4EFO A;  3PRP B;  4F1S A;  2FCN A;  1WX8 A;  4BKG A;  4N9F 4;  3WAN A;  5CX3 A;  1E7V A;  4GN1 A;  4LJP B;  5BO4 B;  3WA0 A;  2L3Z A;  4MJS B;  5E6N A;  4FAD A;  1WGH A;  3DVG X;  4FUL A;  4LDT D;  2JWZ A;  2CKH B;  3UIN B;  3QX1 A;  4FJY A;  3TBL D;  3V6E B;  2K8C A;  1E8Z A;  4EOY A;  2GOW A;  2KAN A;  2M1M A;  2M4N A;  4TV3 A;  3GOE A;  4JGH B;  1WF9 A;  2EKE C;  1V49 A;  3PLU A;  2KX0 A;  2BF8 B;  1WM3 A;  2FCS A;  2L0F A;  3HK0 A;  1V6E A;  1WRD B;  3VUW A;  3WAL A;  3ONS A;  2RGF A;  5EDS A;  2KOX A;  3CST A;  2DHZ A;  4DHZ B;  1Z2M A;  2FCM A;  4AOF A;  1E5W A;  4DHJ D;  3L54 A;  2HD5 B;  4M8M A;  5HKH A;  2ZPN A;  4FN2 A;  1XD3 B;  3DVG Y;  5L83 A;  3JSV A;  2BYV E;  3NZU A;  5DPR A;  4ZRI A;  2WX0 A;  3HM3 A;  4IWP A;  5JHB A;  2NVU I;  2LVQ A;  3DBH I;  1R4M I;  5AZF A;  2WWZ A;  3BY4 B;  3SDL C;  2MX2 A;  5AEK B;  2NBV B;  4FJZ A;  4AP4 C;  4GIV A;  4LCD E;  3P2B A;  4FLH A;  5TR5 A;  4BFR A;  2JRI B;  2KWV B;  1K8R B;  4EEW A;  2MBH A;  3M95 A;  4A3O A;  1TZ1 A;  2IY1 B;  4TQ0 A;  2ZJD A;  2HTH A;  5E6O A;  2BKR B;  2JF5 A;  2J0J A;  3PTF C;  3A9K A;  2KFK B;  1H8C A;  1IPG A;  4BOS C;  2DYO A;  4MEM A;  2DAF A;  1AAR A;  2PE9 A;  2O6V A;  3PHX B;  1WJU A;  2ZVN A;  4M0W B;  4MSM B;  2BWF A;  2N7D A;  3IBE A;  3H6N A;  2VRR B;  3Q3F A;  1WJ4 A;  1TBE A;  4IW0 A;  1WY8 A;  3T9L A;  1OTR B;  1WH3 A;  3AU5 A;  2J0M A;  2HE7 A;  2KC1 A;  2FUH B;  1V2Y A;  3JYU A;  4KV2 A;  1YX5 B;  4M8N A;  4W9L A;  2MRP A;  1I35 A;  1UH6 A;  3L17 A;  2L00 B;  3TJP A;  1R4N I;  2UYZ B;  4KZC A;  2C7N B;  2DZI A;  2OOB B;  4ASW C;  1M94 A;  4MGI E;  3ZRC A;  2LWP A;  1YIW A;  2ZCB A;  4KSK C;  1J8C A;  2MWS B;  4BVU C;  3PHW B;  4K7S A;  4DDI D;  1EF5 A;  3PS6 A;  3HM6 X;  4DHJ B;  2M0X A;  2LAS A;  2O6V D;  2LI5 A;  3L08 A;  4EZL A;  3APC A;  2RR9 A;  3TCA A;  3UF8 A;  2J7Q B;  2MLB A;  4GU2 A;  2FIF A;  1CMX B;  3V60 A;  2XBB C;  2K39 A;  4HCN B;  3ZTC A;  3W1Y A;  3QQ8 B;  3HIZ A;  1UZX B;  1F9J A;  3C0R B;  2FID A;  3DBL I;  1G6J A;  4MDK E;  3ZW3 A;  4DXA B;  1SIF A;  1P0R A;  2KTR A;  2KC2 A;  3ZNI D;  4BOZ B;  1GG3 A;  3TIX A;  2N9P C;  2N1W A;  2EMS A;  1WXS A;  4GDK A;  4W9F A;  2KNB A;  2LXC A;  4ANW A;  1ZW7 A;  2GBR A;  4FHJ A;  5KHO A;  3ZRF A;  1E8W A;  2LD9 A;  2Z59 B;  1XQQ A;  2AL3 A;  1ZGU B;  3OAW A;  3ZDT A;  4JL9 A;  2W9N A;  4TKN A;  1E8Y A;  2CR5 A;  1WE7 A;  1IP9 A;  4W9J A;  3L13 A;  2EMT A;  4MSQ B;  1GC6 A;  4XX5 A;  3UIP B;  3WAP A;  3QIJ A;  2DYB A;  1E7U A;  4W9H A;  2UWQ A;  2PE6 B;  2ASQ A;  2GBK A;  3S2A A;  2KHW B;  4W9C A;  1A5R A;  4ICU A;  2KO3 A;  2Z0D B;  2AEH A;  3K9P B;  2IO2 B;  2AL6 A;  2KFK A;  1PQS A;  2K8B A;  2K6Q A;  4NAW B;  4GGQ A;  4B6W A;  1NDD A;  1NI2 A;  2C7M B;  3L0W B;  1LXD A;  4NQL B;  3VH4 B;  4EZK A;  4WJO A;  3QCA A;  3MHS D;  5L95 C;  2I1K A;  2IO1 B;  2KJH B;  1WXA A;  3RD2 A;  3H7S A;  4GXB A;  3DQV A;  2JT4 B;  4JQW C;  3UQB A;  4GMV A;  1X1M A;  2LRW A;  1KOT A;  3VTV A;  5DPW A;  1S3S G;  3PLV A;  3SHQ A;  1ISN A;  1V81 A;  3QWZ B;  3AU4 A;  3NY5 A;  3JVZ X;  2NCN A;  5KHQ A;  3SU8 X;  4BBN C;  2JUO A;  2JRH A;  2J0K A;  4I6P A;  3CF6 E;  2Y5B B;  3RZW C;  4FBJ B;  1WGY A;  3EFU A;  3K9O B;  4KSL C;  5D6J B;  2N1V A;  2G3Q B;  3L10 B;  4WWP A;  2DAJ A;  3TMP B;  3MJW A;  4WJP A;  4HDO A;  2G45 B;  2YVC A;  4IWQ A;  1WI0 A;  3V6C B;  1Z5S B;  1D3Z A;  2JXX A;  4HVB A;  4GSW A;  4HPL B;  4JIO U;  3RCZ A;  4HDQ A;  1WX9 A;  2D07 B;  5CHV C;  2MBQ A;  1J0G A;  4MGY E;  3KYC D;  3UGB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...