4KSLC

Gumby/fam105b in complex with linear di-ubiquitin
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
150
structure length
150
Chain Sequence
GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FAM105B
publication title The linear ubiquitin-specific deubiquitinase gumby regulates angiogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 150
sequence length 150
chains with identical sequence D, F, H, J, L, N, P, R, T, V, X
ec nomenclature
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kslC02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kslC01
4ICUA 2ZJDA 2ZPNA 2HJ8A 1V49A 3NZUA 2R2QA 1R4MI 4ANWA 4DHZB 2HE7A 4DHZE 4XC2A 4MGIE 4W9DA 4GN1A 2G3QB 2XEWA 3ZIMA 2GBKA 3OJ4B 2K39A 4MJSB 2EMTA 3DVNV 4NAWA 3RULA 3IVFA 2DYOA 2AL3A 3LDZE 3EFUA 1OTRB 3VQIA 2FIDA 4WJQA 3V6CB 4KZ0A 3KUCB 3WA0A 2KQSA 2D2QA 3Q3FA 3W1SC 3JSVA 2L8JA 2XK5A 3ENEA 4OVVA 3B08A 3M3JA 4YL8A 3H7PB 1RRBA 3PLUA 3DBSA 3M63B 4KZCA 3R7QA 2MX2A 3P2BA 1D3ZA 3VAWA 1XD3B 2O6VA 2M0XA 2MP2B 1L7YA 2FAZA 1XQQA 3BY4B 5DPTA 3O65B 2IO1B 1F9JA 1J0GA 1I42A 2FIFA 2LXAA 3PRMB 5DPRA 2OJRA 4EKUA 2L05A 3ML8A 4CO7A 3SD5A 3TJPA 4WQOB 1WZ0A 4MSQB 2NR2A 4AOFA 3U7DA 4GOCA 2ZVNA 3RZFA 1PQSA 4XZ4A 2KFKB 1Q0WB 4KSLC 4KV2A 3N30A 2IYDB 1UELA 1J8CA 2PPHA 4TQ1A 2LD9A 4GDKA 2DZKA 1A5RA 1VD2A 2JF5A 3OAWA 4KIKB 2L7RA 2K8CA 4WWNA 2CHWA 5G2NA 1H8CA 4ZRKA 2J0MA 2LJ5A 1EF5A 1AARA 1E8XA 3EHVA 4FJYA 1J19A 1WRDB 2K8BA 2FCQA 2KTRA 3DBLI 1GUAB 3R7RA 2BKFA 1V6EA 2M8SA 1NBFC 2IY1B 3SDLC 3TIXA 4F7ZA 3ALBA 2FCSA 2MBEA 2GMIC 1V86A 1WJUA 4GSWA 1WXVA 2ASQA 4BKSD 3T8MA 4FHJA 4J6IA 3DDCB 4B95A 3AU4A 3VH4B 4BKTA 2BYFA 4DWFA 3CMMB 2IO0B 4FLHA 3UQBA 2C7HA 4IG7B 4ANXA 4FBJB 2KXJA 4A3PA 2MSED 3PS6A 4ZRIA 1Y8RC 3WAOA 1WMHB 4G11A 3ZTDA 1FXTB 1RAXA 3DVNU 4WJOA 3QA8A 3C0RB 2ZCCA 2EMSA 4BBNC 2LVOA 4TQ0A 2DHZA 1E5WA 2LWPA 2IO2B 2MWSB 3A1QB 5DPWA 1WXAA 4ANVA 4ICVA 3D32A 1BT0A 2NBWB 2MLBA 4GDLB 1EO6A 2RR9A 4B9KA 3QIJA 1OEYJ 4OVUA 4AJYB 2JRHA 2WWZA 1RFAA 2NVUI 3DCGA 3UF8A 1TTNA 5CHVC 4K7UA 3MJWA 2KLGA 3R66C 3IBEA 3EC8A 3NZSA 3QC8B 4HDOA 2LRUA 1P9DU 2J7QB 3AULA 1P1AA 4BOZB 2L0FA 4E74A 4AWJA 3VUWA 4FA6A 3V61A 2C7NB 1WIAA 4GMVA 3ZRCA 1WX9A 3HIZA 2KDEB 2MBHA 2ZNVC 4AJWA 3HM3A 4WJNA 4W9EA 2DAFA 3AI5A 2RD0A 3OLMD 4PYUA 4ZRJA 2JRIB 2BYVE 2JY6A 1Z2MA 2R2OA 2KWCA 3WALA 1Q1OA 1V81A 2CU1A 2GBRA 3RZWC 3IFWB 3OJ3A 2KWVB 4NJ6A 1WI0A 2K1FA 4GU2A 1YIWA 2BWES 4WWPA 3S2AA 1UZXB 2FNJB 2V3SA 4PYZA 5KHOA 2D07B 3CSFA 4HVBA 3U8ZA 1CMXB 1UGMA 4URKA 1NI2A 2ZVOA 1WGHA 4MGZE 4FJZA 3KH0A 1WH3A 2JZZA 1WXMA 1QZEA 2MW5A 3JW0X 1I35A 1V5OA 4P7IA 3WAMA 2KFJA 5D6JB 1WR6E 3ZRFA 4BFRA 2KNBA 3L13A 3GOEA 2AEHA 2LGDA 3ECIA 5JH5C 4W9FA 1V2YA 4I6NB 3IHPC 4ZDVA 1S1QB 2N1WA 1UH6A 4MJSA 2MCNB 3PHXB 5AZHA 3NY5A 4W9GA 1WFYA 4HLEA 3QX1A 1SE9A 1UD7A 2EKEC 3HHMA 2BF8B 5J18A 2C5LC 2O2VB 2ZCBA 3A4SC 3ZDTA 3GZNI 4RM8A 2ZZPB 2LI5A 4FN2A 5D2MB 3R3MA 2N7DA 2MRPA 3PV1A 4HDQA 3MTNB 4X57B 1TBEA 3SU8X 2NS5A 3UIPB 4BKSA 2MA9B 2FCNA 3H7PA 4E3CA 2KQ7A 3AU5A 4GB9A 4DBGA 2AYOB 2N1VA 2UYZB 2JPHA 3ZKJC 1M94A 2MP2A 1KJTA 2KX3A 3U30A 4FJVB 2JZ3B 1GNUA 1P0RA 3PSEB 2A4ZA 2D10A 3KYDD 5GMVA 2AL6A 3APDA 3DBHI 4ANUA 5JHAA 4MEMA 4AP4C 2PJHA 4HXDA 1GG3A 2G4DB 4PS8A 2WX0A 4EOYA 2JUOA 5HKHA 4I6LB 1LXDA 3DQVA 2KHWB 3ZNHB 1GJZA 3QARA 1E90A 2MBOA 2KFKA 2ZNVB 1WGGA 4DK5A 2LXCA 2CKHB 5CHWA 4G50A 2PE9A 3UINB 3QAQA 4KIKA 4II2B 4F8CB 4EFOA 1GC7A 4HPLB 4LJOB 3N32A 4JIOU 3VUYA 5LXIB 2YVCA 1WR1A 3PREA 4M8MA 5E6PA 2RPQA 2KZRA 3QWZB 2JXXA 4MH0E 3RCZA 3L16A 3ZDMC 2D3GA 1UBQA 2GBJA 2KWUB 4DDID 2N9XA 1ZKHA 4MSMB 4II3B 3V60A 1TZ1A 3A9KB 2KJHB 1IP9A 2L3ZA 3JVZX 1MG8A 3PPAA 3NOBA 4KVGB 3RYTA 2BKRB 3WIMA 1EF1A 4BKGA 3A9JB 4A3OA 2Z59B 5DCNA 4EEWA 4KDIC 5FR6A 4JGHB 4W9HA 4W9CA 3VTVA 2KANA 3L10B 2YLMA 4A20A 1C1YB 2LZ6A 4MELA 2N4FA 2C9WB 4K81A 4PS3A 1VCBA 2C7MB 2IZVB 1WYWB 3DVGX 1WMHA 2G4SA 4F1SA 5J2RA 1LM8B 2REXA 3EECA 5LLIA 1SGHA 1Q5WB 3A1QA 2PE6B 2MBBB 1E7VA 2K6DB 3ZW3A 4JLCA 2CR5A 4HWIB 4GDLA 2KC1A 1EUVB 2A5UA 1WJ4A 2J0JA 4B6WA 2JVCA 2Z0EB 1WGYA 2HD5B 3QHTA 5IAAC 3ZNGC 3SHQA 1WXSA 2DAJA 3ZUNA 3ZNZB 4EUTA 2DYMA 2KO3A 3PZDA 5LXHA 3L54A 2K8HA 2ZPYA 2L76A 2M1MA 3K9OB 3PT2B 1WZ3A 4DDGD 1WX8A 3ZTCA 2DZMA 5C1ZA 4KSKC 2B3AA 1WJ6A 1YQBA 4MGKE 3N3KB 3ZLZA 2WX1A 3NS8A 2BPSA 4IUMB 2DZIA 3KUZA 4KDLB 4RM9A 2BGFA 3A4RA 2FUHB 2BWFA 4BOSC 4NY0A 2KC2A 3M95A 2I1JA 3NHEB 2N7EA 3VTWA 4IWQA 4K1RB 1IYFA 3CF6E 4DHJB 2IBIB 2V1YA 3IG3A 1ISNA 3VDZA 1V80A 1LQBA 1WX7A 2NPTB 3QK0A 2KJRA 2N9EB 4CHKA 3WANA 2KDBA 3DVGY 2KMAA 2N9PC 4LCDE 2KJ6A 4JQWC 2KMCA 4NNJB 5L83A 2KDFB 2RSUA 2BYEA 3L08A 4M0WB 2NPTA 3HM6X 4W9IA 4IM0A 4BBNF 1JRUA 4FULA 2D11A 1E7UA 4TKNA 4NAWB 1V9JA 2NBUA 3QQ8B 4CYEA 2RGFA 4WJPA 2OOBB 3ML9A 4IM3A 2LUEA 4W9JA 3UIOB 4IC7B 1T0YA 2KLCA 2O2VA 2IY0B 4NPNA 3TCAA 1ZW7A 4PS7A 3JSVB 2XK5B 1WE6A 1WM2A 2G45B 5BO4B 1KLVA 2DZJA 2Z0DB 4GGQA 3VTUA 1S3SG 2LVQA 2XBBC 5KHQA 4WWOA 2KD0A 3KVFB 2DENB 2O6VB 3T9LA 2V4LA 3W1YA 2KK8A 3PHWB 3DBRI 1TGZB 3X0WA 3PGEA 4G3XB 4TV3A 3Q3JA 3MHSD 2WYQA 4W9LA 3V62A 4DXAB 2AWTA 1K8RB 3ONSA 4M8NA 2WDTB 2KOXA 5L95C 4DHJD 1WE7A 2Y5BB 4JL9A 1KOTA 3VFKA 1WJNA 2GBMA 2DYBA 1E8ZA 4IWPA 3X23A 3DPDA 3H7SA 1IPGA 2K25A 1P3QU 4GDKB 4W9KA 3ZVVA 5D94A 3ZNID 2NCNA 1HE8A 3PVLA 1NDDA 2LASA 4LDTB 3VH3B 3B1LX 4E71A 4NJ7A 2MBQA 5D7GA 4WAAA 2KTRB 4FHKA 2ZEQA 2CHXA 1WF9A 3PRZA 4HJKA 4I6PA 2NBVB 3K9PB 3KUDB 3TMPB 2JWZA 2GOWA 3AXCA 4HCPB 2QHOA 3A9KA 3JYUA 2M4NA 4GIVA 3ZO5B 3B0AA 3A9JA 4GXBA 1WGDA 3VUXA 1OEYA 2FCMA 2O6VD 5AZFA 3VVWB 3TBLD 1YD8U 4N9F4 3CSTA 1E8WA 4IW0A 3BINA 1RLFA 3LJ3A 3PRPB 5AEKB 5DPSA 1R4NI 3UQAA 4NQLB 1E8YA 3W1SA 1X1MA 2MQJA 4G0NB 4ASWC 3KYCD 1C3TA 3I3TB 2GBNA 2VRRB 2W9NA 3V6EB 2CS4A 4HCNB 3APFA 3WAPA 1V5TA 1YX6B 2HTHA 3H9DA 1YJ1A 5IA7A 2KKCA 1KM7A 3PTFC 3PLVA 1L2NA 3DOWA 4HPMB 2KVRA 2DX5B 4HK2A 3RT3B 4EZJA 1G6JA 4XX5A 3HK0A 2J0KA 2C60A 3TL5A 2KTFA 2CHZA 4LDTD 4EZKA 1XT9B 1UBIA 4K7WA 5JHBA 2LGYA 3VHTC 5EDSA 1LFDA 4MM3A 4IM2A 4MGYE 1H4RA 2JT4B 3QJZA 5CTRC 3APCA 1ZGUB 1U4AA 2PEAA 3QCAA 4RMAA 3A33B 5C23A 3UGBB 4IWOA 3VXWA 3RUIB 2KN5A 5G55A 1OGWA 5AZGA 5CHFA 4K7SA 2LVPA 2M17A 4LJPB 3L0WB 1YX5B 1GC6A 2IO3B 4ZYNA 1Z5SB 2L00B 1WY8A 1WGRA 2LRWA 3H6NA 5CX3A 3KW5B 4AUQC 4EZLA 1OQYA 4TUUA 4BVUC 2I1KA 2UWQA 1SIFA 4NQKE 4MDKE 5TR5A 2KDIA 1WM3A 5J17A 3H1UA 5E6OA 2K6QA 2LGXA 3M62B 2KX0A 3L17A 5E6NA 3RD2A 4FADA 2L0TA 1P98A 5JZEB
chains in the Genus database with same CATH superfamily
1V1PA 1R4MI 2HE7A 1FD6A 2IJ0A 3NVVA 3OJ4B 1KLGD 2WXMA 4M0WA 1JCKB 3FILA 4YXDB 3DVNV 4NAWA 4JE3B 3LDZE 1RYJA 4WJQA 1GB1A 3V6CB 2K22A 4XGAB 2KQSA 3Q3FA 3ENEA 3AE6B 3PLUA 3M63B 4KZCA 3P2BA 3VAWA 2MP2B 1F52A 1L7YA 1CJEA 3O65B 1WYGA 4LNIA 5DPRA 2OJRA 4DXFA 4EKUA 2L05A 3ML8A 3P42A 1SIJA 1WZ0A 4MSQB 3RNCC 4GOCA 4XZ4A 1Q0WB 4KSLC 1JWAD 3TSSA 2RDBC 1FMAD 1E8XA 4FJYA 1J19A 2FCQA 4WAFA 3U52E 2LUMA 4KX6B 3R7RA 1NBFC 4BAXA 1JROA 3MC8A 4GSWA 1EU4A 3LXFA 2KYWA 4B95A 1N62A 3AU4A 2JZPA 4FLHA 2M19A 3Q3MC 2MSED 3U2SC 4WJOA 2EMSA 4RGMA 2LVOA 1YOVB 1C9FA 5BYRA 2LWPA 4ICVA 1BT0A 2MLBA 1VZ8A 2RR9A 3QIJA 4XDDA 5D3DA 2JRHA 3DCGA 3DHGC 4N6EB 2BS2B 3GP7A 5LNK1 3IBEA 4HDOA 2J7QB 2WXHA 3DHHC 2L0FA 4E74A 3VUWA 4YSZB 2ZNVC 3P4PB 3HM3A 2VZKB 1N5WA 2BYVE 2KMMA 1Z2MA 4WH4A 3WALA 3TEWA 1TS4A 1SE3A 5FKAC 2CU1A 3RZWC 2ACZB 3W5VB 3IFWB 3OJ3A 4KGTA 1L0VB 4GU2A 2SAKA 2FNJB 3U8ZA 1UGMA 2OJWA 1NI2A 2ZVOA 4FJZA 3KH0A 1WH3A 2JZZA 3ZXRA 1QZEA 2MW5A 4O1NA 1V5OA 1GB4A 1HTOA 2AEHA 4OW0A 5JH5C 2WS3B 3IHPC 2N1WA 3PHXB 1WFYA 1F2RC 3ZDTA 1R4MB 4OZBA 2N7DA 4X57B 3UI3A 3SU8X 4BKSA 2MA9B 1ROEA 4GB9A 1KLUD 2PKOA 3ZKJC 2MP2A 3BYTB 3PSEB 2A4ZA 3MHZA 2D10A 5GMVA 3ABVB 4MEMA 4PS8A 2WX0A 5HKHA 2WXQA 4R3DA 2KHWB 1GPXA 2MBOA 3ZJVA 1TT5B 4EFOA 3VUYA 4JIOU 3VR8B 5LXIB 3TEYA 3MC9A 5E6PA 1I7HA 3QWZB 2JXXA 3L16A 1UGJA 2D3GA 1DOXA 4DDID 2N9XA 4MSMB 3V60A 1RFKA 3JVZX 4JPSA 4A6QA 3A9JB 2E6XA 2PVOD 5DCNA 1MPEA 1P7EA 2KANA 3L10B 3W2DA 1L6VA 2C7MB 2H89B 1WYWB 2KACA 1XCTL 2MJEA 1D6EC 1UWMA 2G4SA 1ZDVA 4F1SA 3AEGB 5J2RA 3EECA 1SGHA 2PE6B 1YMHE 2MBBB 1E7VA 3ZW3A 3Q8CA 4JLCA 2WU5B 4MM3B 2J0JA 3MFGA 2Z0EB 3QHTA 2DAJA 1MFWA 2KO3A 2BB6A 1YN3A 4KKJA 1DOYA 1HA5A 4KSKC 4IUMB 2WXRA 2W3SA 3LYYA 1FPYA 4MT5A 1XXGA 4NY0A 3M95A 2KQ4X 2I1JA 1XEEA 4K1RB 1T0QC 2BBCA 1FNWA 1K51A 1V80A 1LQBA 3AB5A 2KDBA 5EE1A 3O13A 4NNJB 2KMCA 2XN9C 1K52A 2YEPF 2MJ3A 1N5XA 2NPTA 5GXGB 1JRUA 2D11A 3EA6A 2LEKA 1TIFA 4WJPA 1QILA 2UU7A 3ML9A 5MPOA 5E6JA 3UIOB 4IC7B 1T0YA 3TCAA 3JSVB 1WE6A 2G45B 4GGQA 3HVDA 3VTUA 2PIAA 3P4QB 2XBBC 3T9LA 1EWYC 3BVMA 1TGZB 1ET6A 3X0WA 3PGEA 4G3XB 2BS4B 1HTQA 4W9LA 4TSSA 5G5GA 4DHJD 2Y5BB 4JL9A 4NZLB 4IWPA 4NAMA 1Q10A 4GDKB 1IPGA 3ETRA 5D94A 3ZNID 1ZP0B 1HE8A 2FBWB 2QMTA 3B1LX 2MBQA 2KTRB 1KTKA 1N61A 2AQ3B 2N9LA 2NBVB 4LNOA 4AS1A 2JWZA 4ARCA 2GOWA 3ZO5B 2M4NA 3NJTA 3A9JA 2L52A 2N9KA 1L6UA 2O6VD 1YD8U 1E8WA 3LJ3A 3BZDB 5DPSA 1R4NI 3R8BA 2MQJA 3I3TB 2GBNA 4YWGG 1ACCA 2PW9A 5C2TB 1FFUA 3RT3B 2J0KA 4EZKA 5JHBA 2LGYA 1L5PA 4MM3A 4IM2A 3QJZA 3QCAA 1U4AA 1XLQA 1K53A 1D4BA 3AE2B 1J7CA 5CHFA 3HRDD 1N60A 1TKGA 4H2AA 1WY8A 1YN5A 2GI9A 3FAHA 3KW5B 2V3PA 4TUUA 3AM9A 3T3OA 1IUEA 1V1OA 1SJED 4MDKE 5TR5A 5J17A 1TKYA 3N1XC 3H1UA 3Q2AC 4DXGA 1XCQL 3RD2A 4IKGA 1TY0A 1KM7A 2ON8A 4MGIE 4W9DA 4C7YA 2K3UA 1ZXIA 2XEWA 3ZIMA 5TSSA 3N1YC 2K39A 2EMTA 2AL3A 1UUPA 2L32A 2FIDA 3Q3OC 3Q14C 3JSVA 3OG5A 4M02A 1ZUD2 2FE8A 3H8HA 4YL8A 1GOZA 3H7PB 3R7QA 1KH0A 5BMGA 1D3ZA 2FAZA 2ZW0A 3NVYA 1J0GA 1I42A 1NENB 4C4VB 4LK0M 1SF0A 4YSYB 3BK1A 1PQSA 2KFKB 3N30A 4GDKA 3OAWA 4KIKB 2IGHA 2K8CA 2CHWA 2LJ5A 1EF5A 1D5MC 2V4IB 3EHVA 1JRPA 2KTRA 3DBLI 2B76B 5HG2A 2BKFA 1V6EA 3J9CA 2IY1B 4IDIA 3ZJUA 3C19A 1ZE3D 5T8IA 4F7ZA 2IGGA 2MBEA 1V86A 1WJUA 2ASQA 4FHJA 1JMLA 4XYCA 4BKTA 2BYFA 2WLBA 1JWBD 4ANXA 2KXJA 3PS6A 1QOBA 3WAOA 4G11A 3ZTDA 1EU3A 3SFDB 3DVNU 1EM7A 3RNFC 3GE3C 4BBNC 4TQ0A 2QCZA 2WQYB 2MWSB 4HKZE 2IO2B 4ANVA 4JWSC 2EELA 1LGRA 2NBWB 1R4NB 1VZ7A 3V3XA 4AJYB 5C3JB 1RFAA 1MVKA 1F77A 4YSXB 4K7UA 3AE9B 2G9HD 3EC8A 3AULA 4BOZB 4AWJA 3RNBC 1BMLC 4GMVA 2WXLA 4AJWA 2J4XA 2NTTA 4NJCA 4W9EA 3OLMD 4PYUA 2RD0A 4ZRJA 4C56C 1I4PA 1Q1OA 3MC0B 2GBRA 2JSVX 4NJ6A 2K1FA 1YIWA 1UZXB 5D3IB 4PYZA 4C7ZA 4HVBA 2D07B 1CMXB 1I35A 3EFCA 4Q2JA 5H8YE 3P4RB 4P7IA 4BFRA 3L13A 3ECIA 4ZDVA 1UH6A 2FUG1 4P1CC 1UD7A 4P6VF 4WQMA 2C5LC 2O2VB 3GZNI 2PLPA 2ZZPB 2LI5A 1J7BA 4OZCA 4HDQA 1B9RA 1C4CA 2NS5A 3H7PA 3AU5A 3AEAB 1M94A 1J7AA 2KX3A 3U30A 2LMCA 2DBYA 3KYDD 4C4VA 1I4RA 2Y3AA 3APDA 3DBHI 4ANUA 4AP4C 2PJHA 2G4DB 1BXTA 2KFKA 2CKHB 2PE9A 3UINB 3QAQA 4KIKA 2Q5WD 4II2B 4LJOB 3N32A 3PREA 3TEXA 2INCC 1VLBA 4M8MA 2RPQA 2KZRA 3GE8C 2R61A 1PUTA 1UBQA 5EE3A 2KWUB 4II3B 4BZAA 3A9KB 1IP9A 2L3ZA 3AEFB 3PPAA 3RYTA 5BMHA 3WIMA 4DQOC 2Z59B 1T6BX 4W9CA 4A8XC 3N1ZC 3DBLB 4MELA 3E9SA 2N4FA 3DVGX 4N58A 3RI7C 4YTPB 1I4XA 2JQRB 5I4DA 2WNMA 1XF5L 2REXA 5HI1A 4AQ7A 2K6DB 3RNGC 4CQNA 2WDVB 2KC1A 3W9CB 3AE3B 3GB1A 4B0EA 1V8CA 1GAQB 4K3CA 2D5GA 4B6WA 3TEZA 3Q8BA 1WGYA 2HD5B 3ZNGC 3TUOA 3L54A 1TY2A 2M1MA 2ZPYA 5IKCM 3ZTCA 2WXKA 2DZMA 2B3AA 4MGKE 3ZLZA 5FR3A 2INDC 3NS8A 2PVGC 2DZIA 4RM9A 2BGFA 1HZ5A 3A4RA 3AE8B 2FUHB 2BWFA 4IWQA 4P1BC 1TS5A 4DHJB 2V1YA 4GLSC 1ISNA 4TMAB 3QK0A 2NPTB 1PFDA 3GS2A 2N9PC 4JQWC 2KDFB 3Q3NC 4BBNF 4W9IA 3HM6X 1T3QA 4FULA 3IT4B 1V9JA 2K0PA 4YTMB 2RGFA 4IM3A 1C4AA 2O2VA 4EE2A 4NPNA 3I57A 5BO4B 2LVQA 3NVZA 3KVFB 2NTSA 2O6VB 2KAJA 3PHWB 3DBRI 3IT6B 1IGCA 3GZNB 3HUIA 4KKIA 3MHSD 3IXSA 1C77A 2KOXA 5EE9A 3X23A 1VZ6A 1DGJA 1AN8A 5FK9C 1QQRA 2K25A 4KGSA 4RFBA 3ZVVA 3PVLA 1NDDA 4M01A 2LASA 3DBHB 3Q69A 4L23A 3VH3B 1FCCC 5HHDG 1SE4A 4FHKA 2CHXA 1MJDA 4I6PA 1ZXHA 5BYQA 2BVCA 2JU6X 3A9KA 3JYUA 4MH8A 1MHXA 3RNEC 1WGDA 1OEYA 1L0XB 3TBLD 4N9F4 4IW0A 3PRPB 1WGKA 5AEKB 3UQAA 1SE2A 3W1SA 4G0NB 4ASWC 1FFVA 2CS4A 4HCNB 3APFA 5IA7A 3PLVA 4HPMB 4RCOA 1N6ZA 4XX5A 3TL5A 2C60A 3DWMA 2GB1A 2CHZA 2KTFA 1XT9B 1UBIA 5EDSA 4MGYE 4WURA 2JT4B 2PEAA 3RUIB 2KN5A 5AZGA 1NI3A 4XWTA 4LJPB 3L0WB 2IO3B 4AUQC 1STEA 1D5ZC 1YQ4B 4BVUC 2I1KA 2UWQA 1WM3A 5E6OA 2K6QA 3L17A 1VR9A 3BYYB 1P98A 4RGOS 2ZPNA 4ANWA 2MHJA 4XC2A 5IOIA 4XDCA 4MJSB 2DYOA 3VQIA 3CWIA 2D2QA 1TS2A 3W1SC 2L8JA 4OVVA 2J53A 2J42A 3NRZA 1RRBA 1FNUA 4S0RA 1XD3B 2O6VA 2M0XA 1XQQA 5DPTA 4C00A 2D3CA 3SR6A 1JWUD 3PRMB 1AYFA 2WXPA 2Y5PA 4CO7A 3SFEB 3SD5A 4AOFA 2NR2A 2VH1A 4USAA 3U7DA 3RZFA 2WXGA 4KV2A 1KF6B 2PPHA 4TQ1A 2LD9A 2DZKA 3DBRB 1A5RA 4D2KA 5G2NA 3AEEB 4ZRKA 2J0MA 4HEA1 1TZOA 3AE1B 2K8BA 1F0ZA 1GUAB 2AX5A 2GRIA 3SDLC 1OQQA 3TIXA 2WDRB 2KVZA 4M00A 2G1EA 1FO4A 3RN9C 2BQQA 3DDCB 3VH4B 1M4VA 2IO0B 3UQBA 2BTEA 1AWDA 2C7HA 2HDEA 1JWSD 1Y8RC 1WMHB 1E5WA 3D32A 3AE7B 4OVUA 3Q6BA 1XLPA 2CJOA 2NVUI 1CQVA 5G5HA 1TTNA 1MHHE 2QEJC 1WXQA 3NZSA 3QC8B 2OEDA 1P9DU 1P1AA 2XNAC 4FA6A 2K5PA 1WX9A 3HIZA 3URYA 1UF0A 4WJNA 2DAFA 1E7PB 2VH2A 2JY6A 2KWCA 4HPPA 1V81A 1C4PA 2KWVB 3Q8EA 1WI0A 2WDQB 3S2AA 1IBXB 5KHOA 3CSFA 1WXMA 3JW0X 3WAMA 5D6JB 3BVZA 1R7SA 3ZQ4A 2L1AA 4JX1C 1V2YA 4I6NB 1S1QB 4MJSA 2MCNB 2M0AA 3NY5A 2D3BA 4W9GA 3QX1A 1SE9A 2EKEC 2YEPB 3IAM1 4HRSA 2ZCBA 4RM8A 4FN2A 3PV1A 3MTNB 2FCNA 4HJGE 2KQ7A 2N1VA 2UYZB 2JPHA 1QKZA 1MG4A 3AEDB 1P0RA 1IGDA 3I9V1 1P7FA 5JHAA 4ITKA 1GG3A 3P4SB 4EOYA 2EKIA 4I6LB 1LXDA 3DQVA 3ZNHB 1GJZA 1RM6C 3QARA 4L2YA 2ZNVB 1WGGA 4HROA 5CHWA 4G50A 3FKYA 2BW2A 4F8CB 1V97A 2YVCA 1WR1A 4N59A 1FXAA 2QIEB 3RFZB 3RCZA 3ZDMC 3ZYYX 2GBJA 1ZKHA 4P16A 4YT0B 1MG8A 2W54A 4KVGB 2BKRB 2L83A 4BKGA 4A3OA 5FR6A 3VTVA 3AMZA 4US9A 1YJIA 2YLMA 4A20A 2LZ6A 1NYRA 4K81A 4IOIE 2W82A 2IZVB 1HZ6A 1WMHA 2PTLA 3LB8C 3PZ7A 4OVZA 4QAYA 1HEZE 1LM8B 3BIID 5LLIA 4ZHOA 4RF1A 2JYTA 1FNVA 1EUVB 1WJ4A 4LNKA 1QOGA 4UDUC 3AECB 3ZUNA 3ZNZB 4EUTA 2BT6A 4ARIA 4ZOHC 2KDMA 2L76A 2GLSA 1QOAA 3L4PA 5BYSA 3PZ8A 1YQBA 1TYGB 2CJNA 2BPSA 2LFIA 1I4HA 4KDLB 1YNTE 1SBBB 2JYEA 1B1ZA 3NHEB 2V0GA 3VTWA 3RPFC 1IYFA 3C8YA 2I2YA 1IBXA 2WXNA 3VDZA 3SEBA 1WX7A 1KRHA 2N9EB 1SB3C 4CHKA 2KMAA 1FXIA 1C76A 1YQ3B 2QDFA 1NEKB 4LCDE 1FM0D 3NUHB 1SEBD 4TKNA 4CYEA 2OOBB 2KLCA 3IAS1 2XK5B 1WM2A 3BK2A 1D5XC 4MACA 5KHQA 4WWOA 3Q8FA 2DENB 2X8XX 3W1YA 2KK8A 3Q3JA 3V62A 4DXAB 3B9JA 2AWTA 3ONSA 2WDTB 2N7JA 3CIRB 4RF0A 1KOTA 4K3BA 1WJNA 2GBMA 3ZXVA 1E8ZA 2IDYA 2LHDA 3DPDA 2NCNA 1FRDA 3N20C 1FRRA 2BS3B 4A9AA 1WF9A 3PRZA 4HJKA 1OFFA 2I38A 4ACFA 3KUDB 1EWCA 2QJLA 4ZRQA 3T3NA 2QHOA 2SEBD 4GIVA 3KQ4A 1PYWD 4GXBA 1T5XD 5AZFA 3VVWB 4RGTA 3CSTA 5IO9A 1RLFA 5H92C 4NQLB 1RWSA 1A70A 3RNAC 3V6EB 2RMMA 2VRRB 3NZ3A 1V5TA 1YX6B 3EGRA 2KKCA 1FCLA 4XWWA 2JX5A 2DX5B 3HK0A 1PDXA 2WU2B 4LDTD 4HKQA 4A55A 1H4RA 4C80A 1ZGUB 5C23A 3UGBB 1ESFA 1OGWA 1HXYD 5AUKA 4K7SA 2LVPA 2M17A 1XLOA 1YX5B 1WGRA 3KWVA 3B2FA 4EZLA 1OQYA 4LTUA 2QSDA 1E0ZA 2TSSA 1SIFA 2KDIA 3WCQA 4WIPA 3DWGC 5E6NA 4JWUC 1QLBB 4WWMA 1QF6A 4ICUA 2ZJDA 2HJ8A 1V49A 2LGIA 3NZUA 2R2QA 4DHZB 4DHZE 1DYQA 2MH7A 4GN1A 2G3QB 4XE0A 2GBKA 3RULA 2RDHA 3IVFA 3EFUA 1OTRB 1WRIA 4KZ0A 3KUCB 3WA0A 2DWQA 3KLSX 2XK5A 3B08A 3M3JA 3NS1A 2WGSA 3DBSA 2MX2A 3BY4B 2INNE 1I4GA 2IO1B 3HVZA 1F9JA 2FIFA 2WHIA 2LXAA 3BVGA 3TJPA 4WQOB 1DOIA 2ZVNA 3DHIC 1L4ZB 2IYDB 1UELA 4B0MA 1J8CA 3NG0A 2ONQA 5IN7A 1OQRA 1VD2A 4PK1A 2JF5A 3U7ZA 2L7RA 4WWNA 1TS3A 4ZRPA 1H8CA 1ET9A 1AARA 1E10A 3PO0A 1WRDB 1I4QA 2KWDA 3BWUD 2M8SA 4REZA 3ALBA 1JQ4A 2FCSA 2GMIC 1WXVA 3U4EG 4BKSD 3T8MA 3AN1A 4J6IA 1VDVA 4L1BA 4DWFA 2DNFA 2WXJA 3CMMB 4RNAA 3AEBB 4IG7B 2KN4A 2AQ2B 4FBJB 1HQRD 2N0SB 4A3PA 4ZRIA 3P1MA 1FXTB 1RAXA 3QA8A 3C0RB 2ZCCA 5AUIA 3R2TA 2DHZA 3A1QB 5DPWA 1WXAA 4S17A 1FIQA 4GDLB 1EO6A 4B9KA 1C78A 1OEYJ 2NMQA 2WWZA 3UF8A 1T0RC 5CHVC 3MJWA 2KLGA 3R66C 2LRUA 1LO5D 5JXVA 3V05A 1PGAA 3V61A 2C7NB 1E6EB 1WIAA 3ZRCA 2KDEB 2MBHA 3AE5B 3OWEB 1UNSA 3AI5A 4YTNB 2JRIB 2R2OA 2INPE 1FEHA 1WWTA 4WWPA 2BWES 2V3SA 4URKA 2K9XA 2BYTA 1WGHA 4MGZE 1JW9D 2E3TA 2KFJA 1WR6E 3ZRFA 2KNBA 4LNNA 3EUB2 3GOEA 2LGDA 4W9FA 2D3AA 5AZHA 2LJIA 4HLEA 3AV8A 1BUIC 3HHMA 2BF8B 5J18A 2M56B 3A4SC 2HTME 5D2MB 3R3MA 2KT7A 2MRPA 2JXTA 1TBEA 3UIPB 3ZGZA 4E3CA 2VZKD 4DBGA 2RPVA 2AYOB 1F1HA 1KJTA 4FJVB 2JZ3B 1GNUA 3VRBB 3P63A 1ZOYB 2AL6A 4J3OD 1CK1A 4HXDA 1PGXA 2JUOA 2X38A 1E90A 1ZDXA 4DK5A 2LXCA 1GC7A 4HPLB 1YJJA 1F2RI 1N63A 4MH0E 1SXTA 4OHJA 1TZ1A 2KJHB 3NOBA 1EF1A 3KWLA 4KDIC 4EEWA 4JGHB 4W9HA 1C1YB 2C9WB 4PS3A 1VCBA 1Q5WB 3A1QA 3R2IA 2CR5A 4HWIB 4GDLA 1L0YB 3E56A 2A5UA 3N9YC 5IP4D 4PT5A 2JVCA 5IAAC 3SHQA 1WXSA 2MEKA 2DYMA 3PZDA 5LXHA 2K8HA 3K9OB 1C79A 3PT2B 1AW7A 1WZ3A 3I63C 4DDGD 1WX8A 5C1ZA 2WXIA 1VJKA 1WJ6A 3N3KB 2WX1A 1UWXA 2BB5A 3MP9A 3KUZA 5BMIA 1SJHD 2HJ1A 4BOSC 2KC2A 2N7EA 1XLNA 2QILA 3CF6E 2CU3A 1NVID 2OHFA 2IBIB 3IG3A 1SSNA 1JALA 1V1PB 2H88B 2KJRA 2WXOA 3WANA 3DVGY 2KJ6A 5L83A 1MI0A 1ENFA 1T0SC 3L08A 2BYEA 2RSUA 4M0WB 4IM0A 3FILB 2V9HA 4OZAA 1QT9A 1E7UA 3I5JC 3VRAB 4US8A 4NAWB 2NBUA 3QQ8B 4FXCA 1PGBA 2LUEA 4W9JA 2Z8LA 3B2GA 2IY0B 1ZW7A 4PS7A 2PMVA 1KLVA 2DZJA 2Z0DB 1S3SG 3AE4B 2KD0A 1QOFA 2LHEA 2V4LA 2RDGA 4TV3A 2IPKD 2WYQA 2MJDA 4M8NA 1K8RB 5L95C 1WE7A 3VFKA 1NYQA 2W55A 2DYBA 3H7SA 1P3QU 4W9KA 3VR9B 5EE0A 2QC8A 4LLGM 1VRAB 2Y5CA 4LDTB 2AQ1B 4E71A 4NJ7A 5D7GA 4WAAA 2ZEQA 2J52A 4RGNA 3K9PB 3TMPB 3AXCA 4HCPB 1L4DB 4RH6A 3B0AA 3VUXA 1YN4A 5HFYA 2DLBA 2FCMA 2WXFA 3BINA 1WSPA 1TKEA 3AH7A 1KFYB 1E8YA 1X1MA 1E9MA 3KYCD 1C3TA 3WAPA 2W9NA 2HTHA 3H9DA 1YJ1A 3PTFC 3MJ5A 1L2NA 3DOWA 4ZYSA 2KVRA 1ZPSA 3ZJTA 1K50A 4HK2A 4EZJA 1G6JA 4K7WA 3VHTC 3FC4A 1LFDA 2IGDA 5CTRC 3APCA 4RMAA 3A33B 2ICIA 3NVWA 1TJEA 4IWOA 3VXWA 2JWUA 1Y56A 5G55A 1XO3A 2LGSA 1GC6A 4A90A 1JWMD 4ZYNA 1Z5SB 2L00B 3H6NA 2LRWA 3RMKC 5CX3A 2ZW1A 3Q8AA 4KGRA 2W3RA 4NQKE 4ZHPA 2V3NA 4LNFA 3W5UB 2WP9B 2LGXA 3M62B 1CZPA 2KX0A 4FADA 2L0TA 5JZEB
chains in the Genus database with same CATH topology
4ICUA 2ZJDA 2ZPNA 2HJ8A 1V49A 3NZUA 2R2QA 1R4MI 4ANWA 4DHZB 2HE7A 4DHZE 4XC2A 4MGIE 4W9DA 4GN1A 2G3QB 2XEWA 3ZIMA 2GBKA 3OJ4B 2K39A 4MJSB 2EMTA 3DVNV 4NAWA 3RULA 3IVFA 2DYOA 2AL3A 3LDZE 3EFUA 1OTRB 3VQIA 2FIDA 4WJQA 3V6CB 4KZ0A 3KUCB 3WA0A 2KQSA 2D2QA 3Q3FA 3W1SC 3JSVA 2L8JA 2XK5A 3ENEA 4OVVA 3B08A 3M3JA 4YL8A 3H7PB 1RRBA 3PLUA 3DBSA 3M63B 4KZCA 3R7QA 2MX2A 3P2BA 1D3ZA 3VAWA 1XD3B 2O6VA 2M0XA 2MP2B 1L7YA 2FAZA 1XQQA 3BY4B 5DPTA 3O65B 2IO1B 1F9JA 1J0GA 1I42A 2FIFA 2LXAA 3PRMB 5DPRA 2OJRA 4EKUA 2L05A 3ML8A 4CO7A 3SD5A 3TJPA 4WQOB 1WZ0A 4MSQB 2NR2A 4AOFA 3U7DA 4GOCA 2ZVNA 3RZFA 1PQSA 4XZ4A 2KFKB 1Q0WB 4KSLC 4KV2A 3N30A 2IYDB 1UELA 1J8CA 2PPHA 4TQ1A 2LD9A 4GDKA 2DZKA 1A5RA 1VD2A 2JF5A 3OAWA 4KIKB 2L7RA 2K8CA 4WWNA 2CHWA 5G2NA 1H8CA 4ZRKA 2J0MA 2LJ5A 1EF5A 1AARA 1E8XA 3EHVA 4FJYA 1J19A 1WRDB 2K8BA 2FCQA 2KTRA 3DBLI 1GUAB 3R7RA 2BKFA 1V6EA 2M8SA 1NBFC 2IY1B 3SDLC 3TIXA 4F7ZA 3ALBA 2FCSA 2MBEA 2GMIC 1V86A 1WJUA 4GSWA 1WXVA 2ASQA 4BKSD 3T8MA 4FHJA 4J6IA 3DDCB 4B95A 3AU4A 3VH4B 4BKTA 2BYFA 4DWFA 3CMMB 2IO0B 4FLHA 3UQBA 2C7HA 4IG7B 4ANXA 4FBJB 2KXJA 4A3PA 2MSED 3PS6A 4ZRIA 1Y8RC 3WAOA 1WMHB 4G11A 3ZTDA 1FXTB 1RAXA 3DVNU 4WJOA 3QA8A 3C0RB 2ZCCA 2EMSA 4BBNC 2LVOA 4TQ0A 2DHZA 1E5WA 2LWPA 2IO2B 2MWSB 3A1QB 5DPWA 1WXAA 4ANVA 4ICVA 3D32A 1BT0A 2NBWB 2MLBA 4GDLB 1EO6A 2RR9A 4B9KA 3QIJA 1OEYJ 4OVUA 4AJYB 2JRHA 2WWZA 1RFAA 2NVUI 3DCGA 3UF8A 1TTNA 5CHVC 4K7UA 3MJWA 2KLGA 3R66C 3IBEA 3EC8A 3NZSA 3QC8B 4HDOA 2LRUA 1P9DU 2J7QB 3AULA 1P1AA 4BOZB 2L0FA 4E74A 4AWJA 3VUWA 4FA6A 3V61A 2C7NB 1WIAA 4GMVA 3ZRCA 1WX9A 3HIZA 2KDEB 2MBHA 2ZNVC 4AJWA 3HM3A 4WJNA 4W9EA 2DAFA 3AI5A 2RD0A 3OLMD 4PYUA 4ZRJA 2JRIB 2BYVE 2JY6A 1Z2MA 2R2OA 2KWCA 3WALA 1Q1OA 1V81A 2CU1A 2GBRA 3RZWC 3IFWB 3OJ3A 2KWVB 4NJ6A 1WI0A 2K1FA 4GU2A 1YIWA 2BWES 4WWPA 3S2AA 1UZXB 2FNJB 2V3SA 4PYZA 5KHOA 2D07B 3CSFA 4HVBA 3U8ZA 1CMXB 1UGMA 4URKA 1NI2A 2ZVOA 1WGHA 4MGZE 4FJZA 3KH0A 1WH3A 2JZZA 1WXMA 1QZEA 2MW5A 3JW0X 1I35A 1V5OA 4P7IA 3WAMA 2KFJA 5D6JB 1WR6E 3ZRFA 4BFRA 2KNBA 3L13A 3GOEA 2AEHA 2LGDA 3ECIA 5JH5C 4W9FA 1V2YA 4I6NB 3IHPC 4ZDVA 1S1QB 2N1WA 1UH6A 4MJSA 2MCNB 3PHXB 5AZHA 3NY5A 4W9GA 1WFYA 4HLEA 3QX1A 1SE9A 1UD7A 2EKEC 3HHMA 2BF8B 5J18A 2C5LC 2O2VB 2ZCBA 3A4SC 3ZDTA 3GZNI 4RM8A 2ZZPB 2LI5A 4FN2A 5D2MB 3R3MA 2N7DA 2MRPA 3PV1A 4HDQA 3MTNB 4X57B 1TBEA 3SU8X 2NS5A 3UIPB 4BKSA 2MA9B 2FCNA 3H7PA 4E3CA 2KQ7A 3AU5A 4GB9A 4DBGA 2AYOB 2N1VA 2UYZB 2JPHA 3ZKJC 1M94A 2MP2A 1KJTA 2KX3A 3U30A 4FJVB 2JZ3B 1GNUA 1P0RA 3PSEB 2A4ZA 2D10A 3KYDD 5GMVA 2AL6A 3APDA 3DBHI 4ANUA 5JHAA 4MEMA 4AP4C 2PJHA 4HXDA 1GG3A 2G4DB 4PS8A 2WX0A 4EOYA 2JUOA 5HKHA 4I6LB 1LXDA 3DQVA 2KHWB 3ZNHB 1GJZA 3QARA 1E90A 2MBOA 2KFKA 2ZNVB 1WGGA 4DK5A 2LXCA 2CKHB 5CHWA 4G50A 2PE9A 3UINB 3QAQA 4KIKA 4II2B 4F8CB 4EFOA 1GC7A 4HPLB 4LJOB 3N32A 4JIOU 3VUYA 5LXIB 2YVCA 1WR1A 3PREA 4M8MA 5E6PA 2RPQA 2KZRA 3QWZB 2JXXA 4MH0E 3RCZA 3L16A 3ZDMC 2D3GA 1UBQA 2GBJA 2KWUB 4DDID 2N9XA 1ZKHA 4MSMB 4II3B 3V60A 1TZ1A 3A9KB 2KJHB 1IP9A 2L3ZA 3JVZX 1MG8A 3PPAA 3NOBA 4KVGB 3RYTA 2BKRB 3WIMA 1EF1A 4BKGA 3A9JB 4A3OA 2Z59B 5DCNA 4EEWA 4KDIC 5FR6A 4JGHB 4W9HA 4W9CA 3VTVA 2KANA 3L10B 2YLMA 4A20A 1C1YB 2LZ6A 4MELA 2N4FA 2C9WB 4K81A 4PS3A 1VCBA 2C7MB 2IZVB 1WYWB 3DVGX 1WMHA 2G4SA 4F1SA 5J2RA 1LM8B 2REXA 3EECA 5LLIA 1SGHA 1Q5WB 3A1QA 2PE6B 2MBBB 1E7VA 2K6DB 3ZW3A 4JLCA 2CR5A 4HWIB 4GDLA 2KC1A 1EUVB 2A5UA 1WJ4A 2J0JA 4B6WA 2JVCA 2Z0EB 1WGYA 2HD5B 3QHTA 5IAAC 3ZNGC 3SHQA 1WXSA 2DAJA 3ZUNA 3ZNZB 4EUTA 2DYMA 2KO3A 3PZDA 5LXHA 3L54A 2K8HA 2ZPYA 2L76A 2M1MA 3K9OB 3PT2B 1WZ3A 4DDGD 1WX8A 3ZTCA 2DZMA 5C1ZA 4KSKC 2B3AA 1WJ6A 1YQBA 4MGKE 3N3KB 3ZLZA 2WX1A 3NS8A 2BPSA 4IUMB 2DZIA 3KUZA 4KDLB 4RM9A 2BGFA 3A4RA 2FUHB 2BWFA 4BOSC 4NY0A 2KC2A 3M95A 2I1JA 3NHEB 2N7EA 3VTWA 4IWQA 4K1RB 1IYFA 3CF6E 4DHJB 2IBIB 2V1YA 3IG3A 1ISNA 3VDZA 1V80A 1LQBA 1WX7A 2NPTB 3QK0A 2KJRA 2N9EB 4CHKA 3WANA 2KDBA 3DVGY 2KMAA 2N9PC 4LCDE 2KJ6A 4JQWC 2KMCA 4NNJB 5L83A 2KDFB 2RSUA 2BYEA 3L08A 4M0WB 2NPTA 3HM6X 4W9IA 4IM0A 4BBNF 1JRUA 4FULA 2D11A 1E7UA 4TKNA 4NAWB 1V9JA 2NBUA 3QQ8B 4CYEA 2RGFA 4WJPA 2OOBB 3ML9A 4IM3A 2LUEA 4W9JA 3UIOB 4IC7B 1T0YA 2KLCA 2O2VA 2IY0B 4NPNA 3TCAA 1ZW7A 4PS7A 3JSVB 2XK5B 1WE6A 1WM2A 2G45B 5BO4B 1KLVA 2DZJA 2Z0DB 4GGQA 3VTUA 1S3SG 2LVQA 2XBBC 5KHQA 4WWOA 2KD0A 3KVFB 2DENB 2O6VB 3T9LA 2V4LA 3W1YA 2KK8A 3PHWB 3DBRI 1TGZB 3X0WA 3PGEA 4G3XB 4TV3A 3Q3JA 3MHSD 2WYQA 4W9LA 3V62A 4DXAB 2AWTA 1K8RB 3ONSA 4M8NA 2WDTB 2KOXA 5L95C 4DHJD 1WE7A 2Y5BB 4JL9A 1KOTA 3VFKA 1WJNA 2GBMA 2DYBA 1E8ZA 4IWPA 3X23A 3DPDA 3H7SA 1IPGA 2K25A 1P3QU 4GDKB 4W9KA 3ZVVA 5D94A 3ZNID 2NCNA 1HE8A 3PVLA 1NDDA 2LASA 4LDTB 3VH3B 3B1LX 4E71A 4NJ7A 2MBQA 5D7GA 4WAAA 2KTRB 4FHKA 2ZEQA 2CHXA 1WF9A 3PRZA 4HJKA 4I6PA 2NBVB 3K9PB 3KUDB 3TMPB 2JWZA 2GOWA 3AXCA 4HCPB 2QHOA 3A9KA 3JYUA 2M4NA 4GIVA 3ZO5B 3B0AA 3A9JA 4GXBA 1WGDA 3VUXA 1OEYA 2FCMA 2O6VD 5AZFA 3VVWB 3TBLD 1YD8U 4N9F4 3CSTA 1E8WA 4IW0A 3BINA 1RLFA 3LJ3A 3PRPB 5AEKB 5DPSA 1R4NI 3UQAA 4NQLB 1E8YA 3W1SA 1X1MA 2MQJA 4G0NB 4ASWC 3KYCD 1C3TA 3I3TB 2GBNA 2VRRB 2W9NA 3V6EB 2CS4A 4HCNB 3APFA 3WAPA 1V5TA 1YX6B 2HTHA 3H9DA 1YJ1A 5IA7A 2KKCA 1KM7A 3PTFC 3PLVA 1L2NA 3DOWA 4HPMB 2KVRA 2DX5B 4HK2A 3RT3B 4EZJA 1G6JA 4XX5A 3HK0A 2J0KA 2C60A 3TL5A 2KTFA 2CHZA 4LDTD 4EZKA 1XT9B 1UBIA 4K7WA 5JHBA 2LGYA 3VHTC 5EDSA 1LFDA 4MM3A 4IM2A 4MGYE 1H4RA 2JT4B 3QJZA 5CTRC 3APCA 1ZGUB 1U4AA 2PEAA 3QCAA 4RMAA 3A33B 5C23A 3UGBB 4IWOA 3VXWA 3RUIB 2KN5A 5G55A 1OGWA 5AZGA 5CHFA 4K7SA 2LVPA 2M17A 4LJPB 3L0WB 1YX5B 1GC6A 2IO3B 4ZYNA 1Z5SB 2L00B 1WY8A 1WGRA 2LRWA 3H6NA 5CX3A 3KW5B 4AUQC 4EZLA 1OQYA 4TUUA 4BVUC 2I1KA 2UWQA 1SIFA 4NQKE 4MDKE 5TR5A 2KDIA 1WM3A 5J17A 3H1UA 5E6OA 2K6QA 2LGXA 3M62B 2KX0A 3L17A 5E6NA 3RD2A 4FADA 2L0TA 1P98A 5JZEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICU A;  2ZJD A;  2ZPN A;  2HJ8 A;  1V49 A;  3NZU A;  2R2Q A;  1R4M I;  4ANW A;  4DHZ B;  2HE7 A;  4DHZ E;  4XC2 A;  4MGI E;  4W9D A;  4GN1 A;  2G3Q B;  2XEW A;  3ZIM A;  2GBK A;  3OJ4 B;  2K39 A;  4MJS B;  2EMT A;  3DVN V;  4NAW A;  3RUL A;  3IVF A;  2DYO A;  2AL3 A;  3LDZ E;  3EFU A;  1OTR B;  3VQI A;  2FID A;  4WJQ A;  3V6C B;  4KZ0 A;  3KUC B;  3WA0 A;  2KQS A;  2D2Q A;  3Q3F A;  3W1S C;  3JSV A;  2L8J A;  2XK5 A;  3ENE A;  4OVV A;  3B08 A;  3M3J A;  4YL8 A;  3H7P B;  1RRB A;  3PLU A;  3DBS A;  3M63 B;  4KZC A;  3R7Q A;  2MX2 A;  3P2B A;  1D3Z A;  3VAW A;  1XD3 B;  2O6V A;  2M0X A;  2MP2 B;  1L7Y A;  2FAZ A;  1XQQ A;  3BY4 B;  5DPT A;  3O65 B;  2IO1 B;  1F9J A;  1J0G A;  1I42 A;  2FIF A;  2LXA A;  3PRM B;  5DPR A;  2OJR A;  4EKU A;  2L05 A;  3ML8 A;  4CO7 A;  3SD5 A;  3TJP A;  4WQO B;  1WZ0 A;  4MSQ B;  2NR2 A;  4AOF A;  3U7D A;  4GOC A;  2ZVN A;  3RZF A;  1PQS A;  4XZ4 A;  2KFK B;  1Q0W B;  4KSL C;  4KV2 A;  3N30 A;  2IYD B;  1UEL A;  1J8C A;  2PPH A;  4TQ1 A;  2LD9 A;  4GDK A;  2DZK A;  1A5R A;  1VD2 A;  2JF5 A;  3OAW A;  4KIK B;  2L7R A;  2K8C A;  4WWN A;  2CHW A;  5G2N A;  1H8C A;  4ZRK A;  2J0M A;  2LJ5 A;  1EF5 A;  1AAR A;  1E8X A;  3EHV A;  4FJY A;  1J19 A;  1WRD B;  2K8B A;  2FCQ A;  2KTR A;  3DBL I;  1GUA B;  3R7R A;  2BKF A;  1V6E A;  2M8S A;  1NBF C;  2IY1 B;  3SDL C;  3TIX A;  4F7Z A;  3ALB A;  2FCS A;  2MBE A;  2GMI C;  1V86 A;  1WJU A;  4GSW A;  1WXV A;  2ASQ A;  4BKS D;  3T8M A;  4FHJ A;  4J6I A;  3DDC B;  4B95 A;  3AU4 A;  3VH4 B;  4BKT A;  2BYF A;  4DWF A;  3CMM B;  2IO0 B;  4FLH A;  3UQB A;  2C7H A;  4IG7 B;  4ANX A;  4FBJ B;  2KXJ A;  4A3P A;  2MSE D;  3PS6 A;  4ZRI A;  1Y8R C;  3WAO A;  1WMH B;  4G11 A;  3ZTD A;  1FXT B;  1RAX A;  3DVN U;  4WJO A;  3QA8 A;  3C0R B;  2ZCC A;  2EMS A;  4BBN C;  2LVO A;  4TQ0 A;  2DHZ A;  1E5W A;  2LWP A;  2IO2 B;  2MWS B;  3A1Q B;  5DPW A;  1WXA A;  4ANV A;  4ICV A;  3D32 A;  1BT0 A;  2NBW B;  2MLB A;  4GDL B;  1EO6 A;  2RR9 A;  4B9K A;  3QIJ A;  1OEY J;  4OVU A;  4AJY B;  2JRH A;  2WWZ A;  1RFA A;  2NVU I;  3DCG A;  3UF8 A;  1TTN A;  5CHV C;  4K7U A;  3MJW A;  2KLG A;  3R66 C;  3IBE A;  3EC8 A;  3NZS A;  3QC8 B;  4HDO A;  2LRU A;  1P9D U;  2J7Q B;  3AUL A;  1P1A A;  4BOZ B;  2L0F A;  4E74 A;  4AWJ A;  3VUW A;  4FA6 A;  3V61 A;  2C7N B;  1WIA A;  4GMV A;  3ZRC A;  1WX9 A;  3HIZ A;  2KDE B;  2MBH A;  2ZNV C;  4AJW A;  3HM3 A;  4WJN A;  4W9E A;  2DAF A;  3AI5 A;  2RD0 A;  3OLM D;  4PYU A;  4ZRJ A;  2JRI B;  2BYV E;  2JY6 A;  1Z2M A;  2R2O A;  2KWC A;  3WAL A;  1Q1O A;  1V81 A;  2CU1 A;  2GBR A;  3RZW C;  3IFW B;  3OJ3 A;  2KWV B;  4NJ6 A;  1WI0 A;  2K1F A;  4GU2 A;  1YIW A;  2BWE S;  4WWP A;  3S2A A;  1UZX B;  2FNJ B;  2V3S A;  4PYZ A;  5KHO A;  2D07 B;  3CSF A;  4HVB A;  3U8Z A;  1CMX B;  1UGM A;  4URK A;  1NI2 A;  2ZVO A;  1WGH A;  4MGZ E;  4FJZ A;  3KH0 A;  1WH3 A;  2JZZ A;  1WXM A;  1QZE A;  2MW5 A;  3JW0 X;  1I35 A;  1V5O A;  4P7I A;  3WAM A;  2KFJ A;  5D6J B;  1WR6 E;  3ZRF A;  4BFR A;  2KNB A;  3L13 A;  3GOE A;  2AEH A;  2LGD A;  3ECI A;  5JH5 C;  4W9F A;  1V2Y A;  4I6N B;  3IHP C;  4ZDV A;  1S1Q B;  2N1W A;  1UH6 A;  4MJS A;  2MCN B;  3PHX B;  5AZH A;  3NY5 A;  4W9G A;  1WFY A;  4HLE A;  3QX1 A;  1SE9 A;  1UD7 A;  2EKE C;  3HHM A;  2BF8 B;  5J18 A;  2C5L C;  2O2V B;  2ZCB A;  3A4S C;  3ZDT A;  3GZN I;  4RM8 A;  2ZZP B;  2LI5 A;  4FN2 A;  5D2M B;  3R3M A;  2N7D A;  2MRP A;  3PV1 A;  4HDQ A;  3MTN B;  4X57 B;  1TBE A;  3SU8 X;  2NS5 A;  3UIP B;  4BKS A;  2MA9 B;  2FCN A;  3H7P A;  4E3C A;  2KQ7 A;  3AU5 A;  4GB9 A;  4DBG A;  2AYO B;  2N1V A;  2UYZ B;  2JPH A;  3ZKJ C;  1M94 A;  2MP2 A;  1KJT A;  2KX3 A;  3U30 A;  4FJV B;  2JZ3 B;  1GNU A;  1P0R A;  3PSE B;  2A4Z A;  2D10 A;  3KYD D;  5GMV A;  2AL6 A;  3APD A;  3DBH I;  4ANU A;  5JHA A;  4MEM A;  4AP4 C;  2PJH A;  4HXD A;  1GG3 A;  2G4D B;  4PS8 A;  2WX0 A;  4EOY A;  2JUO A;  5HKH A;  4I6L B;  1LXD A;  3DQV A;  2KHW B;  3ZNH B;  1GJZ A;  3QAR A;  1E90 A;  2MBO A;  2KFK A;  2ZNV B;  1WGG A;  4DK5 A;  2LXC A;  2CKH B;  5CHW A;  4G50 A;  2PE9 A;  3UIN B;  3QAQ A;  4KIK A;  4II2 B;  4F8C B;  4EFO A;  1GC7 A;  4HPL B;  4LJO B;  3N32 A;  4JIO U;  3VUY A;  5LXI B;  2YVC A;  1WR1 A;  3PRE A;  4M8M A;  5E6P A;  2RPQ A;  2KZR A;  3QWZ B;  2JXX A;  4MH0 E;  3RCZ A;  3L16 A;  3ZDM C;  2D3G A;  1UBQ A;  2GBJ A;  2KWU B;  4DDI D;  2N9X A;  1ZKH A;  4MSM B;  4II3 B;  3V60 A;  1TZ1 A;  3A9K B;  2KJH B;  1IP9 A;  2L3Z A;  3JVZ X;  1MG8 A;  3PPA A;  3NOB A;  4KVG B;  3RYT A;  2BKR B;  3WIM A;  1EF1 A;  4BKG A;  3A9J B;  4A3O A;  2Z59 B;  5DCN A;  4EEW A;  4KDI C;  5FR6 A;  4JGH B;  4W9H A;  4W9C A;  3VTV A;  2KAN A;  3L10 B;  2YLM A;  4A20 A;  1C1Y B;  2LZ6 A;  4MEL A;  2N4F A;  2C9W B;  4K81 A;  4PS3 A;  1VCB A;  2C7M B;  2IZV B;  1WYW B;  3DVG X;  1WMH A;  2G4S A;  4F1S A;  5J2R A;  1LM8 B;  2REX A;  3EEC A;  5LLI A;  1SGH A;  1Q5W B;  3A1Q A;  2PE6 B;  2MBB B;  1E7V A;  2K6D B;  3ZW3 A;  4JLC A;  2CR5 A;  4HWI B;  4GDL A;  2KC1 A;  1EUV B;  2A5U A;  1WJ4 A;  2J0J A;  4B6W A;  2JVC A;  2Z0E B;  1WGY A;  2HD5 B;  3QHT A;  5IAA C;  3ZNG C;  3SHQ A;  1WXS A;  2DAJ A;  3ZUN A;  3ZNZ B;  4EUT A;  2DYM A;  2KO3 A;  3PZD A;  5LXH A;  3L54 A;  2K8H A;  2ZPY A;  2L76 A;  2M1M A;  3K9O B;  3PT2 B;  1WZ3 A;  4DDG D;  1WX8 A;  3ZTC A;  2DZM A;  5C1Z A;  4KSK C;  2B3A A;  1WJ6 A;  1YQB A;  4MGK E;  3N3K B;  3ZLZ A;  2WX1 A;  3NS8 A;  2BPS A;  4IUM B;  2DZI A;  3KUZ A;  4KDL B;  4RM9 A;  2BGF A;  3A4R A;  2FUH B;  2BWF A;  4BOS C;  4NY0 A;  2KC2 A;  3M95 A;  2I1J A;  3NHE B;  2N7E A;  3VTW A;  4IWQ A;  4K1R B;  1IYF A;  3CF6 E;  4DHJ B;  2IBI B;  2V1Y A;  3IG3 A;  1ISN A;  3VDZ A;  1V80 A;  1LQB A;  1WX7 A;  2NPT B;  3QK0 A;  2KJR A;  2N9E B;  4CHK A;  3WAN A;  2KDB A;  3DVG Y;  2KMA A;  2N9P C;  4LCD E;  2KJ6 A;  4JQW C;  2KMC A;  4NNJ B;  5L83 A;  2KDF B;  2RSU A;  2BYE A;  3L08 A;  4M0W B;  2NPT A;  3HM6 X;  4W9I A;  4IM0 A;  4BBN F;  1JRU A;  4FUL A;  2D11 A;  1E7U A;  4TKN A;  4NAW B;  1V9J A;  2NBU A;  3QQ8 B;  4CYE A;  2RGF A;  4WJP A;  2OOB B;  3ML9 A;  4IM3 A;  2LUE A;  4W9J A;  3UIO B;  4IC7 B;  1T0Y A;  2KLC A;  2O2V A;  2IY0 B;  4NPN A;  3TCA A;  1ZW7 A;  4PS7 A;  3JSV B;  2XK5 B;  1WE6 A;  1WM2 A;  2G45 B;  5BO4 B;  1KLV A;  2DZJ A;  2Z0D B;  4GGQ A;  3VTU A;  1S3S G;  2LVQ A;  2XBB C;  5KHQ A;  4WWO A;  2KD0 A;  3KVF B;  2DEN B;  2O6V B;  3T9L A;  2V4L A;  3W1Y A;  2KK8 A;  3PHW B;  3DBR I;  1TGZ B;  3X0W A;  3PGE A;  4G3X B;  4TV3 A;  3Q3J A;  3MHS D;  2WYQ A;  4W9L A;  3V62 A;  4DXA B;  2AWT A;  1K8R B;  3ONS A;  4M8N A;  2WDT B;  2KOX A;  5L95 C;  4DHJ D;  1WE7 A;  2Y5B B;  4JL9 A;  1KOT A;  3VFK A;  1WJN A;  2GBM A;  2DYB A;  1E8Z A;  4IWP A;  3X23 A;  3DPD A;  3H7S A;  1IPG A;  2K25 A;  1P3Q U;  4GDK B;  4W9K A;  3ZVV A;  5D94 A;  3ZNI D;  2NCN A;  1HE8 A;  3PVL A;  1NDD A;  2LAS A;  4LDT B;  3VH3 B;  3B1L X;  4E71 A;  4NJ7 A;  2MBQ A;  5D7G A;  4WAA A;  2KTR B;  4FHK A;  2ZEQ A;  2CHX A;  1WF9 A;  3PRZ A;  4HJK A;  4I6P A;  2NBV B;  3K9P B;  3KUD B;  3TMP B;  2JWZ A;  2GOW A;  3AXC A;  4HCP B;  2QHO A;  3A9K A;  3JYU A;  2M4N A;  4GIV A;  3ZO5 B;  3B0A A;  3A9J A;  4GXB A;  1WGD A;  3VUX A;  1OEY A;  2FCM A;  2O6V D;  5AZF A;  3VVW B;  3TBL D;  1YD8 U;  4N9F 4;  3CST A;  1E8W A;  4IW0 A;  3BIN A;  1RLF A;  3LJ3 A;  3PRP B;  5AEK B;  5DPS A;  1R4N I;  3UQA A;  4NQL B;  1E8Y A;  3W1S A;  1X1M A;  2MQJ A;  4G0N B;  4ASW C;  3KYC D;  1C3T A;  3I3T B;  2GBN A;  2VRR B;  2W9N A;  3V6E B;  2CS4 A;  4HCN B;  3APF A;  3WAP A;  1V5T A;  1YX6 B;  2HTH A;  3H9D A;  1YJ1 A;  5IA7 A;  2KKC A;  1KM7 A;  3PTF C;  3PLV A;  1L2N A;  3DOW A;  4HPM B;  2KVR A;  2DX5 B;  4HK2 A;  3RT3 B;  4EZJ A;  1G6J A;  4XX5 A;  3HK0 A;  2J0K A;  2C60 A;  3TL5 A;  2KTF A;  2CHZ A;  4LDT D;  4EZK A;  1XT9 B;  1UBI A;  4K7W A;  5JHB A;  2LGY A;  3VHT C;  5EDS A;  1LFD A;  4MM3 A;  4IM2 A;  4MGY E;  1H4R A;  2JT4 B;  3QJZ A;  5CTR C;  3APC A;  1ZGU B;  1U4A A;  2PEA A;  3QCA A;  4RMA A;  3A33 B;  5C23 A;  3UGB B;  4IWO A;  3VXW A;  3RUI B;  2KN5 A;  5G55 A;  1OGW A;  5AZG A;  5CHF A;  4K7S A;  2LVP A;  2M17 A;  4LJP B;  3L0W B;  1YX5 B;  1GC6 A;  2IO3 B;  4ZYN A;  1Z5S B;  2L00 B;  1WY8 A;  1WGR A;  2LRW A;  3H6N A;  5CX3 A;  3KW5 B;  4AUQ C;  4EZL A;  1OQY A;  4TUU A;  4BVU C;  2I1K A;  2UWQ A;  1SIF A;  4NQK E;  4MDK E;  5TR5 A;  2KDI A;  1WM3 A;  5J17 A;  3H1U A;  5E6O A;  2K6Q A;  2LGX A;  3M62 B;  2KX0 A;  3L17 A;  5E6N A;  3RD2 A;  4FAD A;  2L0T A;  1P98 A;  5JZE B; 
#chains in the Genus database with same CATH topology
 1V1P A;  1R4M I;  2HE7 A;  1FD6 A;  2IJ0 A;  3NVV A;  3OJ4 B;  1KLG D;  2WXM A;  4M0W A;  1JCK B;  3FIL A;  4YXD B;  3DVN V;  4NAW A;  4JE3 B;  3LDZ E;  1RYJ A;  4WJQ A;  1GB1 A;  3V6C B;  2K22 A;  4XGA B;  2KQS A;  3Q3F A;  3ENE A;  3AE6 B;  3PLU A;  3M63 B;  4KZC A;  3P2B A;  3VAW A;  2MP2 B;  1F52 A;  1L7Y A;  1CJE A;  3O65 B;  1WYG A;  4LNI A;  5DPR A;  2OJR A;  4DXF A;  4EKU A;  2L05 A;  3ML8 A;  3P42 A;  1SIJ A;  1WZ0 A;  4MSQ B;  3RNC C;  4GOC A;  4XZ4 A;  1Q0W B;  4KSL C;  1JWA D;  3TSS A;  2RDB C;  1FMA D;  1E8X A;  4FJY A;  1J19 A;  2FCQ A;  4WAF A;  3U52 E;  2LUM A;  4KX6 B;  3R7R A;  1NBF C;  4BAX A;  1JRO A;  3MC8 A;  4GSW A;  1EU4 A;  3LXF A;  2KYW A;  4B95 A;  1N62 A;  3AU4 A;  2JZP A;  4FLH A;  2M19 A;  3Q3M C;  2MSE D;  3U2S C;  4WJO A;  2EMS A;  4RGM A;  2LVO A;  1YOV B;  1C9F A;  5BYR A;  2LWP A;  4ICV A;  1BT0 A;  2MLB A;  1VZ8 A;  2RR9 A;  3QIJ A;  4XDD A;  5D3D A;  2JRH A;  3DCG A;  3DHG C;  4N6E B;  2BS2 B;  3GP7 A;  5LNK 1;  3IBE A;  4HDO A;  2J7Q B;  2WXH A;  3DHH C;  2L0F A;  4E74 A;  3VUW A;  4YSZ B;  2ZNV C;  3P4P B;  3HM3 A;  2VZK B;  1N5W A;  2BYV E;  2KMM A;  1Z2M A;  4WH4 A;  3WAL A;  3TEW A;  1TS4 A;  1SE3 A;  5FKA C;  2CU1 A;  3RZW C;  2ACZ B;  3W5V B;  3IFW B;  3OJ3 A;  4KGT A;  1L0V B;  4GU2 A;  2SAK A;  2FNJ B;  3U8Z A;  1UGM A;  2OJW A;  1NI2 A;  2ZVO A;  4FJZ A;  3KH0 A;  1WH3 A;  2JZZ A;  3ZXR A;  1QZE A;  2MW5 A;  4O1N A;  1V5O A;  1GB4 A;  1HTO A;  2AEH A;  4OW0 A;  5JH5 C;  2WS3 B;  3IHP C;  2N1W A;  3PHX B;  1WFY A;  1F2R C;  3ZDT A;  1R4M B;  4OZB A;  2N7D A;  4X57 B;  3UI3 A;  3SU8 X;  4BKS A;  2MA9 B;  1ROE A;  4GB9 A;  1KLU D;  2PKO A;  3ZKJ C;  2MP2 A;  3BYT B;  3PSE B;  2A4Z A;  3MHZ A;  2D10 A;  5GMV A;  3ABV B;  4MEM A;  4PS8 A;  2WX0 A;  5HKH A;  2WXQ A;  4R3D A;  2KHW B;  1GPX A;  2MBO A;  3ZJV A;  1TT5 B;  4EFO A;  3VUY A;  4JIO U;  3VR8 B;  5LXI B;  3TEY A;  3MC9 A;  5E6P A;  1I7H A;  3QWZ B;  2JXX A;  3L16 A;  1UGJ A;  2D3G A;  1DOX A;  4DDI D;  2N9X A;  4MSM B;  3V60 A;  1RFK A;  3JVZ X;  4JPS A;  4A6Q A;  3A9J B;  2E6X A;  2PVO D;  5DCN A;  1MPE A;  1P7E A;  2KAN A;  3L10 B;  3W2D A;  1L6V A;  2C7M B;  2H89 B;  1WYW B;  2KAC A;  1XCT L;  2MJE A;  1D6E C;  1UWM A;  2G4S A;  1ZDV A;  4F1S A;  3AEG B;  5J2R A;  3EEC A;  1SGH A;  2PE6 B;  1YMH E;  2MBB B;  1E7V A;  3ZW3 A;  3Q8C A;  4JLC A;  2WU5 B;  4MM3 B;  2J0J A;  3MFG A;  2Z0E B;  3QHT A;  2DAJ A;  1MFW A;  2KO3 A;  2BB6 A;  1YN3 A;  4KKJ A;  1DOY A;  1HA5 A;  4KSK C;  4IUM B;  2WXR A;  2W3S A;  3LYY A;  1FPY A;  4MT5 A;  1XXG A;  4NY0 A;  3M95 A;  2KQ4 X;  2I1J A;  1XEE A;  4K1R B;  1T0Q C;  2BBC A;  1FNW A;  1K51 A;  1V80 A;  1LQB A;  3AB5 A;  2KDB A;  5EE1 A;  3O13 A;  4NNJ B;  2KMC A;  2XN9 C;  1K52 A;  2YEP F;  2MJ3 A;  1N5X A;  2NPT A;  5GXG B;  1JRU A;  2D11 A;  3EA6 A;  2LEK A;  1TIF A;  4WJP A;  1QIL A;  2UU7 A;  3ML9 A;  5MPO A;  5E6J A;  3UIO B;  4IC7 B;  1T0Y A;  3TCA A;  3JSV B;  1WE6 A;  2G45 B;  4GGQ A;  3HVD A;  3VTU A;  2PIA A;  3P4Q B;  2XBB C;  3T9L A;  1EWY C;  3BVM A;  1TGZ B;  1ET6 A;  3X0W A;  3PGE A;  4G3X B;  2BS4 B;  1HTQ A;  4W9L A;  4TSS A;  5G5G A;  4DHJ D;  2Y5B B;  4JL9 A;  4NZL B;  4IWP A;  4NAM A;  1Q10 A;  4GDK B;  1IPG A;  3ETR A;  5D94 A;  3ZNI D;  1ZP0 B;  1HE8 A;  2FBW B;  2QMT A;  3B1L X;  2MBQ A;  2KTR B;  1KTK A;  1N61 A;  2AQ3 B;  2N9L A;  2NBV B;  4LNO A;  4AS1 A;  2JWZ A;  4ARC A;  2GOW A;  3ZO5 B;  2M4N A;  3NJT A;  3A9J A;  2L52 A;  2N9K A;  1L6U A;  2O6V D;  1YD8 U;  1E8W A;  3LJ3 A;  3BZD B;  5DPS A;  1R4N I;  3R8B A;  2MQJ A;  3I3T B;  2GBN A;  4YWG G;  1ACC A;  2PW9 A;  5C2T B;  1FFU A;  3RT3 B;  2J0K A;  4EZK A;  5JHB A;  2LGY A;  1L5P A;  4MM3 A;  4IM2 A;  3QJZ A;  3QCA A;  1U4A A;  1XLQ A;  1K53 A;  1D4B A;  3AE2 B;  1J7C A;  5CHF A;  3HRD D;  1N60 A;  1TKG A;  4H2A A;  1WY8 A;  1YN5 A;  2GI9 A;  3FAH A;  3KW5 B;  2V3P A;  4TUU A;  3AM9 A;  3T3O A;  1IUE A;  1V1O A;  1SJE D;  4MDK E;  5TR5 A;  5J17 A;  1TKY A;  3N1X C;  3H1U A;  3Q2A C;  4DXG A;  1XCQ L;  3RD2 A;  4IKG A;  1TY0 A;  1KM7 A;  2ON8 A;  4MGI E;  4W9D A;  4C7Y A;  2K3U A;  1ZXI A;  2XEW A;  3ZIM A;  5TSS A;  3N1Y C;  2K39 A;  2EMT A;  2AL3 A;  1UUP A;  2L32 A;  2FID A;  3Q3O C;  3Q14 C;  3JSV A;  3OG5 A;  4M02 A;  1ZUD 2;  2FE8 A;  3H8H A;  4YL8 A;  1GOZ A;  3H7P B;  3R7Q A;  1KH0 A;  5BMG A;  1D3Z A;  2FAZ A;  2ZW0 A;  3NVY A;  1J0G A;  1I42 A;  1NEN B;  4C4V B;  4LK0 M;  1SF0 A;  4YSY B;  3BK1 A;  1PQS A;  2KFK B;  3N30 A;  4GDK A;  3OAW A;  4KIK B;  2IGH A;  2K8C A;  2CHW A;  2LJ5 A;  1EF5 A;  1D5M C;  2V4I B;  3EHV A;  1JRP A;  2KTR A;  3DBL I;  2B76 B;  5HG2 A;  2BKF A;  1V6E A;  3J9C A;  2IY1 B;  4IDI A;  3ZJU A;  3C19 A;  1ZE3 D;  5T8I A;  4F7Z A;  2IGG A;  2MBE A;  1V86 A;  1WJU A;  2ASQ A;  4FHJ A;  1JML A;  4XYC A;  4BKT A;  2BYF A;  2WLB A;  1JWB D;  4ANX A;  2KXJ A;  3PS6 A;  1QOB A;  3WAO A;  4G11 A;  3ZTD A;  1EU3 A;  3SFD B;  3DVN U;  1EM7 A;  3RNF C;  3GE3 C;  4BBN C;  4TQ0 A;  2QCZ A;  2WQY B;  2MWS B;  4HKZ E;  2IO2 B;  4ANV A;  4JWS C;  2EEL A;  1LGR A;  2NBW B;  1R4N B;  1VZ7 A;  3V3X A;  4AJY B;  5C3J B;  1RFA A;  1MVK A;  1F77 A;  4YSX B;  4K7U A;  3AE9 B;  2G9H D;  3EC8 A;  3AUL A;  4BOZ B;  4AWJ A;  3RNB C;  1BML C;  4GMV A;  2WXL A;  4AJW A;  2J4X A;  2NTT A;  4NJC A;  4W9E A;  3OLM D;  4PYU A;  2RD0 A;  4ZRJ A;  4C56 C;  1I4P A;  1Q1O A;  3MC0 B;  2GBR A;  2JSV X;  4NJ6 A;  2K1F A;  1YIW A;  1UZX B;  5D3I B;  4PYZ A;  4C7Z A;  4HVB A;  2D07 B;  1CMX B;  1I35 A;  3EFC A;  4Q2J A;  5H8Y E;  3P4R B;  4P7I A;  4BFR A;  3L13 A;  3ECI A;  4ZDV A;  1UH6 A;  2FUG 1;  4P1C C;  1UD7 A;  4P6V F;  4WQM A;  2C5L C;  2O2V B;  3GZN I;  2PLP A;  2ZZP B;  2LI5 A;  1J7B A;  4OZC A;  4HDQ A;  1B9R A;  1C4C A;  2NS5 A;  3H7P A;  3AU5 A;  3AEA B;  1M94 A;  1J7A A;  2KX3 A;  3U30 A;  2LMC A;  2DBY A;  3KYD D;  4C4V A;  1I4R A;  2Y3A A;  3APD A;  3DBH I;  4ANU A;  4AP4 C;  2PJH A;  2G4D B;  1BXT A;  2KFK A;  2CKH B;  2PE9 A;  3UIN B;  3QAQ A;  4KIK A;  2Q5W D;  4II2 B;  4LJO B;  3N32 A;  3PRE A;  3TEX A;  2INC C;  1VLB A;  4M8M A;  2RPQ A;  2KZR A;  3GE8 C;  2R61 A;  1PUT A;  1UBQ A;  5EE3 A;  2KWU B;  4II3 B;  4BZA A;  3A9K B;  1IP9 A;  2L3Z A;  3AEF B;  3PPA A;  3RYT A;  5BMH A;  3WIM A;  4DQO C;  2Z59 B;  1T6B X;  4W9C A;  4A8X C;  3N1Z C;  3DBL B;  4MEL A;  3E9S A;  2N4F A;  3DVG X;  4N58 A;  3RI7 C;  4YTP B;  1I4X A;  2JQR B;  5I4D A;  2WNM A;  1XF5 L;  2REX A;  5HI1 A;  4AQ7 A;  2K6D B;  3RNG C;  4CQN A;  2WDV B;  2KC1 A;  3W9C B;  3AE3 B;  3GB1 A;  4B0E A;  1V8C A;  1GAQ B;  4K3C A;  2D5G A;  4B6W A;  3TEZ A;  3Q8B A;  1WGY A;  2HD5 B;  3ZNG C;  3TUO A;  3L54 A;  1TY2 A;  2M1M A;  2ZPY A;  5IKC M;  3ZTC A;  2WXK A;  2DZM A;  2B3A A;  4MGK E;  3ZLZ A;  5FR3 A;  2IND C;  3NS8 A;  2PVG C;  2DZI A;  4RM9 A;  2BGF A;  1HZ5 A;  3A4R A;  3AE8 B;  2FUH B;  2BWF A;  4IWQ A;  4P1B C;  1TS5 A;  4DHJ B;  2V1Y A;  4GLS C;  1ISN A;  4TMA B;  3QK0 A;  2NPT B;  1PFD A;  3GS2 A;  2N9P C;  4JQW C;  2KDF B;  3Q3N C;  4BBN F;  4W9I A;  3HM6 X;  1T3Q A;  4FUL A;  3IT4 B;  1V9J A;  2K0P A;  4YTM B;  2RGF A;  4IM3 A;  1C4A A;  2O2V A;  4EE2 A;  4NPN A;  3I57 A;  5BO4 B;  2LVQ A;  3NVZ A;  3KVF B;  2NTS A;  2O6V B;  2KAJ A;  3PHW B;  3DBR I;  3IT6 B;  1IGC A;  3GZN B;  3HUI A;  4KKI A;  3MHS D;  3IXS A;  1C77 A;  2KOX A;  5EE9 A;  3X23 A;  1VZ6 A;  1DGJ A;  1AN8 A;  5FK9 C;  1QQR A;  2K25 A;  4KGS A;  4RFB A;  3ZVV A;  3PVL A;  1NDD A;  4M01 A;  2LAS A;  3DBH B;  3Q69 A;  4L23 A;  3VH3 B;  1FCC C;  5HHD G;  1SE4 A;  4FHK A;  2CHX A;  1MJD A;  4I6P A;  1ZXH A;  5BYQ A;  2BVC A;  2JU6 X;  3A9K A;  3JYU A;  4MH8 A;  1MHX A;  3RNE C;  1WGD A;  1OEY A;  1L0X B;  3TBL D;  4N9F 4;  4IW0 A;  3PRP B;  1WGK A;  5AEK B;  3UQA A;  1SE2 A;  3W1S A;  4G0N B;  4ASW C;  1FFV A;  2CS4 A;  4HCN B;  3APF A;  5IA7 A;  3PLV A;  4HPM B;  4RCO A;  1N6Z A;  4XX5 A;  3TL5 A;  2C60 A;  3DWM A;  2GB1 A;  2CHZ A;  2KTF A;  1XT9 B;  1UBI A;  5EDS A;  4MGY E;  4WUR A;  2JT4 B;  2PEA A;  3RUI B;  2KN5 A;  5AZG A;  1NI3 A;  4XWT A;  4LJP B;  3L0W B;  2IO3 B;  4AUQ C;  1STE A;  1D5Z C;  1YQ4 B;  4BVU C;  2I1K A;  2UWQ A;  1WM3 A;  5E6O A;  2K6Q A;  3L17 A;  1VR9 A;  3BYY B;  1P98 A;  4RGO S;  2ZPN A;  4ANW A;  2MHJ A;  4XC2 A;  5IOI A;  4XDC A;  4MJS B;  2DYO A;  3VQI A;  3CWI A;  2D2Q A;  1TS2 A;  3W1S C;  2L8J A;  4OVV A;  2J53 A;  2J42 A;  3NRZ A;  1RRB A;  1FNU A;  4S0R A;  1XD3 B;  2O6V A;  2M0X A;  1XQQ A;  5DPT A;  4C00 A;  2D3C A;  3SR6 A;  1JWU D;  3PRM B;  1AYF A;  2WXP A;  2Y5P A;  4CO7 A;  3SFE B;  3SD5 A;  4AOF A;  2NR2 A;  2VH1 A;  4USA A;  3U7D A;  3RZF A;  2WXG A;  4KV2 A;  1KF6 B;  2PPH A;  4TQ1 A;  2LD9 A;  2DZK A;  3DBR B;  1A5R A;  4D2K A;  5G2N A;  3AEE B;  4ZRK A;  2J0M A;  4HEA 1;  1TZO A;  3AE1 B;  2K8B A;  1F0Z A;  1GUA B;  2AX5 A;  2GRI A;  3SDL C;  1OQQ A;  3TIX A;  2WDR B;  2KVZ A;  4M00 A;  2G1E A;  1FO4 A;  3RN9 C;  2BQQ A;  3DDC B;  3VH4 B;  1M4V A;  2IO0 B;  3UQB A;  2BTE A;  1AWD A;  2C7H A;  2HDE A;  1JWS D;  1Y8R C;  1WMH B;  1E5W A;  3D32 A;  3AE7 B;  4OVU A;  3Q6B A;  1XLP A;  2CJO A;  2NVU I;  1CQV A;  5G5H A;  1TTN A;  1MHH E;  2QEJ C;  1WXQ A;  3NZS A;  3QC8 B;  2OED A;  1P9D U;  1P1A A;  2XNA C;  4FA6 A;  2K5P A;  1WX9 A;  3HIZ A;  3URY A;  1UF0 A;  4WJN A;  2DAF A;  1E7P B;  2VH2 A;  2JY6 A;  2KWC A;  4HPP A;  1V81 A;  1C4P A;  2KWV B;  3Q8E A;  1WI0 A;  2WDQ B;  3S2A A;  1IBX B;  5KHO A;  3CSF A;  1WXM A;  3JW0 X;  3WAM A;  5D6J B;  3BVZ A;  1R7S A;  3ZQ4 A;  2L1A A;  4JX1 C;  1V2Y A;  4I6N B;  1S1Q B;  4MJS A;  2MCN B;  2M0A A;  3NY5 A;  2D3B A;  4W9G A;  3QX1 A;  1SE9 A;  2EKE C;  2YEP B;  3IAM 1;  4HRS A;  2ZCB A;  4RM8 A;  4FN2 A;  3PV1 A;  3MTN B;  2FCN A;  4HJG E;  2KQ7 A;  2N1V A;  2UYZ B;  2JPH A;  1QKZ A;  1MG4 A;  3AED B;  1P0R A;  1IGD A;  3I9V 1;  1P7F A;  5JHA A;  4ITK A;  1GG3 A;  3P4S B;  4EOY A;  2EKI A;  4I6L B;  1LXD A;  3DQV A;  3ZNH B;  1GJZ A;  1RM6 C;  3QAR A;  4L2Y A;  2ZNV B;  1WGG A;  4HRO A;  5CHW A;  4G50 A;  3FKY A;  2BW2 A;  4F8C B;  1V97 A;  2YVC A;  1WR1 A;  4N59 A;  1FXA A;  2QIE B;  3RFZ B;  3RCZ A;  3ZDM C;  3ZYY X;  2GBJ A;  1ZKH A;  4P16 A;  4YT0 B;  1MG8 A;  2W54 A;  4KVG B;  2BKR B;  2L83 A;  4BKG A;  4A3O A;  5FR6 A;  3VTV A;  3AMZ A;  4US9 A;  1YJI A;  2YLM A;  4A20 A;  2LZ6 A;  1NYR A;  4K81 A;  4IOI E;  2W82 A;  2IZV B;  1HZ6 A;  1WMH A;  2PTL A;  3LB8 C;  3PZ7 A;  4OVZ A;  4QAY A;  1HEZ E;  1LM8 B;  3BII D;  5LLI A;  4ZHO A;  4RF1 A;  2JYT A;  1FNV A;  1EUV B;  1WJ4 A;  4LNK A;  1QOG A;  4UDU C;  3AEC B;  3ZUN A;  3ZNZ B;  4EUT A;  2BT6 A;  4ARI A;  4ZOH C;  2KDM A;  2L76 A;  2GLS A;  1QOA A;  3L4P A;  5BYS A;  3PZ8 A;  1YQB A;  1TYG B;  2CJN A;  2BPS A;  2LFI A;  1I4H A;  4KDL B;  1YNT E;  1SBB B;  2JYE A;  1B1Z A;  3NHE B;  2V0G A;  3VTW A;  3RPF C;  1IYF A;  3C8Y A;  2I2Y A;  1IBX A;  2WXN A;  3VDZ A;  3SEB A;  1WX7 A;  1KRH A;  2N9E B;  1SB3 C;  4CHK A;  2KMA A;  1FXI A;  1C76 A;  1YQ3 B;  2QDF A;  1NEK B;  4LCD E;  1FM0 D;  3NUH B;  1SEB D;  4TKN A;  4CYE A;  2OOB B;  2KLC A;  3IAS 1;  2XK5 B;  1WM2 A;  3BK2 A;  1D5X C;  4MAC A;  5KHQ A;  4WWO A;  3Q8F A;  2DEN B;  2X8X X;  3W1Y A;  2KK8 A;  3Q3J A;  3V62 A;  4DXA B;  3B9J A;  2AWT A;  3ONS A;  2WDT B;  2N7J A;  3CIR B;  4RF0 A;  1KOT A;  4K3B A;  1WJN A;  2GBM A;  3ZXV A;  1E8Z A;  2IDY A;  2LHD A;  3DPD A;  2NCN A;  1FRD A;  3N20 C;  1FRR A;  2BS3 B;  4A9A A;  1WF9 A;  3PRZ A;  4HJK A;  1OFF A;  2I38 A;  4ACF A;  3KUD B;  1EWC A;  2QJL A;  4ZRQ A;  3T3N A;  2QHO A;  2SEB D;  4GIV A;  3KQ4 A;  1PYW D;  4GXB A;  1T5X D;  5AZF A;  3VVW B;  4RGT A;  3CST A;  5IO9 A;  1RLF A;  5H92 C;  4NQL B;  1RWS A;  1A70 A;  3RNA C;  3V6E B;  2RMM A;  2VRR B;  3NZ3 A;  1V5T A;  1YX6 B;  3EGR A;  2KKC A;  1FCL A;  4XWW A;  2JX5 A;  2DX5 B;  3HK0 A;  1PDX A;  2WU2 B;  4LDT D;  4HKQ A;  4A55 A;  1H4R A;  4C80 A;  1ZGU B;  5C23 A;  3UGB B;  1ESF A;  1OGW A;  1HXY D;  5AUK A;  4K7S A;  2LVP A;  2M17 A;  1XLO A;  1YX5 B;  1WGR A;  3KWV A;  3B2F A;  4EZL A;  1OQY A;  4LTU A;  2QSD A;  1E0Z A;  2TSS A;  1SIF A;  2KDI A;  3WCQ A;  4WIP A;  3DWG C;  5E6N A;  4JWU C;  1QLB B;  4WWM A;  1QF6 A;  4ICU A;  2ZJD A;  2HJ8 A;  1V49 A;  2LGI A;  3NZU A;  2R2Q A;  4DHZ B;  4DHZ E;  1DYQ A;  2MH7 A;  4GN1 A;  2G3Q B;  4XE0 A;  2GBK A;  3RUL A;  2RDH A;  3IVF A;  3EFU A;  1OTR B;  1WRI A;  4KZ0 A;  3KUC B;  3WA0 A;  2DWQ A;  3KLS X;  2XK5 A;  3B08 A;  3M3J A;  3NS1 A;  2WGS A;  3DBS A;  2MX2 A;  3BY4 B;  2INN E;  1I4G A;  2IO1 B;  3HVZ A;  1F9J A;  2FIF A;  2WHI A;  2LXA A;  3BVG A;  3TJP A;  4WQO B;  1DOI A;  2ZVN A;  3DHI C;  1L4Z B;  2IYD B;  1UEL A;  4B0M A;  1J8C A;  3NG0 A;  2ONQ A;  5IN7 A;  1OQR A;  1VD2 A;  4PK1 A;  2JF5 A;  3U7Z A;  2L7R A;  4WWN A;  1TS3 A;  4ZRP A;  1H8C A;  1ET9 A;  1AAR A;  1E10 A;  3PO0 A;  1WRD B;  1I4Q A;  2KWD A;  3BWU D;  2M8S A;  4REZ A;  3ALB A;  1JQ4 A;  2FCS A;  2GMI C;  1WXV A;  3U4E G;  4BKS D;  3T8M A;  3AN1 A;  4J6I A;  1VDV A;  4L1B A;  4DWF A;  2DNF A;  2WXJ A;  3CMM B;  4RNA A;  3AEB B;  4IG7 B;  2KN4 A;  2AQ2 B;  4FBJ B;  1HQR D;  2N0S B;  4A3P A;  4ZRI A;  3P1M A;  1FXT B;  1RAX A;  3QA8 A;  3C0R B;  2ZCC A;  5AUI A;  3R2T A;  2DHZ A;  3A1Q B;  5DPW A;  1WXA A;  4S17 A;  1FIQ A;  4GDL B;  1EO6 A;  4B9K A;  1C78 A;  1OEY J;  2NMQ A;  2WWZ A;  3UF8 A;  1T0R C;  5CHV C;  3MJW A;  2KLG A;  3R66 C;  2LRU A;  1LO5 D;  5JXV A;  3V05 A;  1PGA A;  3V61 A;  2C7N B;  1E6E B;  1WIA A;  3ZRC A;  2KDE B;  2MBH A;  3AE5 B;  3OWE B;  1UNS A;  3AI5 A;  4YTN B;  2JRI B;  2R2O A;  2INP E;  1FEH A;  1WWT A;  4WWP A;  2BWE S;  2V3S A;  4URK A;  2K9X A;  2BYT A;  1WGH A;  4MGZ E;  1JW9 D;  2E3T A;  2KFJ A;  1WR6 E;  3ZRF A;  2KNB A;  4LNN A;  3EUB 2;  3GOE A;  2LGD A;  4W9F A;  2D3A A;  5AZH A;  2LJI A;  4HLE A;  3AV8 A;  1BUI C;  3HHM A;  2BF8 B;  5J18 A;  2M56 B;  3A4S C;  2HTM E;  5D2M B;  3R3M A;  2KT7 A;  2MRP A;  2JXT A;  1TBE A;  3UIP B;  3ZGZ A;  4E3C A;  2VZK D;  4DBG A;  2RPV A;  2AYO B;  1F1H A;  1KJT A;  4FJV B;  2JZ3 B;  1GNU A;  3VRB B;  3P63 A;  1ZOY B;  2AL6 A;  4J3O D;  1CK1 A;  4HXD A;  1PGX A;  2JUO A;  2X38 A;  1E90 A;  1ZDX A;  4DK5 A;  2LXC A;  1GC7 A;  4HPL B;  1YJJ A;  1F2R I;  1N63 A;  4MH0 E;  1SXT A;  4OHJ A;  1TZ1 A;  2KJH B;  3NOB A;  1EF1 A;  3KWL A;  4KDI C;  4EEW A;  4JGH B;  4W9H A;  1C1Y B;  2C9W B;  4PS3 A;  1VCB A;  1Q5W B;  3A1Q A;  3R2I A;  2CR5 A;  4HWI B;  4GDL A;  1L0Y B;  3E56 A;  2A5U A;  3N9Y C;  5IP4 D;  4PT5 A;  2JVC A;  5IAA C;  3SHQ A;  1WXS A;  2MEK A;  2DYM A;  3PZD A;  5LXH A;  2K8H A;  3K9O B;  1C79 A;  3PT2 B;  1AW7 A;  1WZ3 A;  3I63 C;  4DDG D;  1WX8 A;  5C1Z A;  2WXI A;  1VJK A;  1WJ6 A;  3N3K B;  2WX1 A;  1UWX A;  2BB5 A;  3MP9 A;  3KUZ A;  5BMI A;  1SJH D;  2HJ1 A;  4BOS C;  2KC2 A;  2N7E A;  1XLN A;  2QIL A;  3CF6 E;  2CU3 A;  1NVI D;  2OHF A;  2IBI B;  3IG3 A;  1SSN A;  1JAL A;  1V1P B;  2H88 B;  2KJR A;  2WXO A;  3WAN A;  3DVG Y;  2KJ6 A;  5L83 A;  1MI0 A;  1ENF A;  1T0S C;  3L08 A;  2BYE A;  2RSU A;  4M0W B;  4IM0 A;  3FIL B;  2V9H A;  4OZA A;  1QT9 A;  1E7U A;  3I5J C;  3VRA B;  4US8 A;  4NAW B;  2NBU A;  3QQ8 B;  4FXC A;  1PGB A;  2LUE A;  4W9J A;  2Z8L A;  3B2G A;  2IY0 B;  1ZW7 A;  4PS7 A;  2PMV A;  1KLV A;  2DZJ A;  2Z0D B;  1S3S G;  3AE4 B;  2KD0 A;  1QOF A;  2LHE A;  2V4L A;  2RDG A;  4TV3 A;  2IPK D;  2WYQ A;  2MJD A;  4M8N A;  1K8R B;  5L95 C;  1WE7 A;  3VFK A;  1NYQ A;  2W55 A;  2DYB A;  3H7S A;  1P3Q U;  4W9K A;  3VR9 B;  5EE0 A;  2QC8 A;  4LLG M;  1VRA B;  2Y5C A;  4LDT B;  2AQ1 B;  4E71 A;  4NJ7 A;  5D7G A;  4WAA A;  2ZEQ A;  2J52 A;  4RGN A;  3K9P B;  3TMP B;  3AXC A;  4HCP B;  1L4D B;  4RH6 A;  3B0A A;  3VUX A;  1YN4 A;  5HFY A;  2DLB A;  2FCM A;  2WXF A;  3BIN A;  1WSP A;  1TKE A;  3AH7 A;  1KFY B;  1E8Y A;  1X1M A;  1E9M A;  3KYC D;  1C3T A;  3WAP A;  2W9N A;  2HTH A;  3H9D A;  1YJ1 A;  3PTF C;  3MJ5 A;  1L2N A;  3DOW A;  4ZYS A;  2KVR A;  1ZPS A;  3ZJT A;  1K50 A;  4HK2 A;  4EZJ A;  1G6J A;  4K7W A;  3VHT C;  3FC4 A;  1LFD A;  2IGD A;  5CTR C;  3APC A;  4RMA A;  3A33 B;  2ICI A;  3NVW A;  1TJE A;  4IWO A;  3VXW A;  2JWU A;  1Y56 A;  5G55 A;  1XO3 A;  2LGS A;  1GC6 A;  4A90 A;  1JWM D;  4ZYN A;  1Z5S B;  2L00 B;  3H6N A;  2LRW A;  3RMK C;  5CX3 A;  2ZW1 A;  3Q8A A;  4KGR A;  2W3R A;  4NQK E;  4ZHP A;  2V3N A;  4LNF A;  3W5U B;  2WP9 B;  2LGX A;  3M62 B;  1CZP A;  2KX0 A;  4FAD A;  2L0T A;  5JZE B; 
#chains in the Genus database with same CATH homology
 4ICU A;  2ZJD A;  2ZPN A;  2HJ8 A;  1V49 A;  3NZU A;  2R2Q A;  1R4M I;  4ANW A;  4DHZ B;  2HE7 A;  4DHZ E;  4XC2 A;  4MGI E;  4W9D A;  4GN1 A;  2G3Q B;  2XEW A;  3ZIM A;  2GBK A;  3OJ4 B;  2K39 A;  4MJS B;  2EMT A;  3DVN V;  4NAW A;  3RUL A;  3IVF A;  2DYO A;  2AL3 A;  3LDZ E;  3EFU A;  1OTR B;  3VQI A;  2FID A;  4WJQ A;  3V6C B;  4KZ0 A;  3KUC B;  3WA0 A;  2KQS A;  2D2Q A;  3Q3F A;  3W1S C;  3JSV A;  2L8J A;  2XK5 A;  3ENE A;  4OVV A;  3B08 A;  3M3J A;  4YL8 A;  3H7P B;  1RRB A;  3PLU A;  3DBS A;  3M63 B;  4KZC A;  3R7Q A;  2MX2 A;  3P2B A;  1D3Z A;  3VAW A;  1XD3 B;  2O6V A;  2M0X A;  2MP2 B;  1L7Y A;  2FAZ A;  1XQQ A;  3BY4 B;  5DPT A;  3O65 B;  2IO1 B;  1F9J A;  1J0G A;  1I42 A;  2FIF A;  2LXA A;  3PRM B;  5DPR A;  2OJR A;  4EKU A;  2L05 A;  3ML8 A;  4CO7 A;  3SD5 A;  3TJP A;  4WQO B;  1WZ0 A;  4MSQ B;  2NR2 A;  4AOF A;  3U7D A;  4GOC A;  2ZVN A;  3RZF A;  1PQS A;  4XZ4 A;  2KFK B;  1Q0W B;  4KSL C;  4KV2 A;  3N30 A;  2IYD B;  1UEL A;  1J8C A;  2PPH A;  4TQ1 A;  2LD9 A;  4GDK A;  2DZK A;  1A5R A;  1VD2 A;  2JF5 A;  3OAW A;  4KIK B;  2L7R A;  2K8C A;  4WWN A;  2CHW A;  5G2N A;  1H8C A;  4ZRK A;  2J0M A;  2LJ5 A;  1EF5 A;  1AAR A;  1E8X A;  3EHV A;  4FJY A;  1J19 A;  1WRD B;  2K8B A;  2FCQ A;  2KTR A;  3DBL I;  1GUA B;  3R7R A;  2BKF A;  1V6E A;  2M8S A;  1NBF C;  2IY1 B;  3SDL C;  3TIX A;  4F7Z A;  3ALB A;  2FCS A;  2MBE A;  2GMI C;  1V86 A;  1WJU A;  4GSW A;  1WXV A;  2ASQ A;  4BKS D;  3T8M A;  4FHJ A;  4J6I A;  3DDC B;  4B95 A;  3AU4 A;  3VH4 B;  4BKT A;  2BYF A;  4DWF A;  3CMM B;  2IO0 B;  4FLH A;  3UQB A;  2C7H A;  4IG7 B;  4ANX A;  4FBJ B;  2KXJ A;  4A3P A;  2MSE D;  3PS6 A;  4ZRI A;  1Y8R C;  3WAO A;  1WMH B;  4G11 A;  3ZTD A;  1FXT B;  1RAX A;  3DVN U;  4WJO A;  3QA8 A;  3C0R B;  2ZCC A;  2EMS A;  4BBN C;  2LVO A;  4TQ0 A;  2DHZ A;  1E5W A;  2LWP A;  2IO2 B;  2MWS B;  3A1Q B;  5DPW A;  1WXA A;  4ANV A;  4ICV A;  3D32 A;  1BT0 A;  2NBW B;  2MLB A;  4GDL B;  1EO6 A;  2RR9 A;  4B9K A;  3QIJ A;  1OEY J;  4OVU A;  4AJY B;  2JRH A;  2WWZ A;  1RFA A;  2NVU I;  3DCG A;  3UF8 A;  1TTN A;  5CHV C;  4K7U A;  3MJW A;  2KLG A;  3R66 C;  3IBE A;  3EC8 A;  3NZS A;  3QC8 B;  4HDO A;  2LRU A;  1P9D U;  2J7Q B;  3AUL A;  1P1A A;  4BOZ B;  2L0F A;  4E74 A;  4AWJ A;  3VUW A;  4FA6 A;  3V61 A;  2C7N B;  1WIA A;  4GMV A;  3ZRC A;  1WX9 A;  3HIZ A;  2KDE B;  2MBH A;  2ZNV C;  4AJW A;  3HM3 A;  4WJN A;  4W9E A;  2DAF A;  3AI5 A;  2RD0 A;  3OLM D;  4PYU A;  4ZRJ A;  2JRI B;  2BYV E;  2JY6 A;  1Z2M A;  2R2O A;  2KWC A;  3WAL A;  1Q1O A;  1V81 A;  2CU1 A;  2GBR A;  3RZW C;  3IFW B;  3OJ3 A;  2KWV B;  4NJ6 A;  1WI0 A;  2K1F A;  4GU2 A;  1YIW A;  2BWE S;  4WWP A;  3S2A A;  1UZX B;  2FNJ B;  2V3S A;  4PYZ A;  5KHO A;  2D07 B;  3CSF A;  4HVB A;  3U8Z A;  1CMX B;  1UGM A;  4URK A;  1NI2 A;  2ZVO A;  1WGH A;  4MGZ E;  4FJZ A;  3KH0 A;  1WH3 A;  2JZZ A;  1WXM A;  1QZE A;  2MW5 A;  3JW0 X;  1I35 A;  1V5O A;  4P7I A;  3WAM A;  2KFJ A;  5D6J B;  1WR6 E;  3ZRF A;  4BFR A;  2KNB A;  3L13 A;  3GOE A;  2AEH A;  2LGD A;  3ECI A;  5JH5 C;  4W9F A;  1V2Y A;  4I6N B;  3IHP C;  4ZDV A;  1S1Q B;  2N1W A;  1UH6 A;  4MJS A;  2MCN B;  3PHX B;  5AZH A;  3NY5 A;  4W9G A;  1WFY A;  4HLE A;  3QX1 A;  1SE9 A;  1UD7 A;  2EKE C;  3HHM A;  2BF8 B;  5J18 A;  2C5L C;  2O2V B;  2ZCB A;  3A4S C;  3ZDT A;  3GZN I;  4RM8 A;  2ZZP B;  2LI5 A;  4FN2 A;  5D2M B;  3R3M A;  2N7D A;  2MRP A;  3PV1 A;  4HDQ A;  3MTN B;  4X57 B;  1TBE A;  3SU8 X;  2NS5 A;  3UIP B;  4BKS A;  2MA9 B;  2FCN A;  3H7P A;  4E3C A;  2KQ7 A;  3AU5 A;  4GB9 A;  4DBG A;  2AYO B;  2N1V A;  2UYZ B;  2JPH A;  3ZKJ C;  1M94 A;  2MP2 A;  1KJT A;  2KX3 A;  3U30 A;  4FJV B;  2JZ3 B;  1GNU A;  1P0R A;  3PSE B;  2A4Z A;  2D10 A;  3KYD D;  5GMV A;  2AL6 A;  3APD A;  3DBH I;  4ANU A;  5JHA A;  4MEM A;  4AP4 C;  2PJH A;  4HXD A;  1GG3 A;  2G4D B;  4PS8 A;  2WX0 A;  4EOY A;  2JUO A;  5HKH A;  4I6L B;  1LXD A;  3DQV A;  2KHW B;  3ZNH B;  1GJZ A;  3QAR A;  1E90 A;  2MBO A;  2KFK A;  2ZNV B;  1WGG A;  4DK5 A;  2LXC A;  2CKH B;  5CHW A;  4G50 A;  2PE9 A;  3UIN B;  3QAQ A;  4KIK A;  4II2 B;  4F8C B;  4EFO A;  1GC7 A;  4HPL B;  4LJO B;  3N32 A;  4JIO U;  3VUY A;  5LXI B;  2YVC A;  1WR1 A;  3PRE A;  4M8M A;  5E6P A;  2RPQ A;  2KZR A;  3QWZ B;  2JXX A;  4MH0 E;  3RCZ A;  3L16 A;  3ZDM C;  2D3G A;  1UBQ A;  2GBJ A;  2KWU B;  4DDI D;  2N9X A;  1ZKH A;  4MSM B;  4II3 B;  3V60 A;  1TZ1 A;  3A9K B;  2KJH B;  1IP9 A;  2L3Z A;  3JVZ X;  1MG8 A;  3PPA A;  3NOB A;  4KVG B;  3RYT A;  2BKR B;  3WIM A;  1EF1 A;  4BKG A;  3A9J B;  4A3O A;  2Z59 B;  5DCN A;  4EEW A;  4KDI C;  5FR6 A;  4JGH B;  4W9H A;  4W9C A;  3VTV A;  2KAN A;  3L10 B;  2YLM A;  4A20 A;  1C1Y B;  2LZ6 A;  4MEL A;  2N4F A;  2C9W B;  4K81 A;  4PS3 A;  1VCB A;  2C7M B;  2IZV B;  1WYW B;  3DVG X;  1WMH A;  2G4S A;  4F1S A;  5J2R A;  1LM8 B;  2REX A;  3EEC A;  5LLI A;  1SGH A;  1Q5W B;  3A1Q A;  2PE6 B;  2MBB B;  1E7V A;  2K6D B;  3ZW3 A;  4JLC A;  2CR5 A;  4HWI B;  4GDL A;  2KC1 A;  1EUV B;  2A5U A;  1WJ4 A;  2J0J A;  4B6W A;  2JVC A;  2Z0E B;  1WGY A;  2HD5 B;  3QHT A;  5IAA C;  3ZNG C;  3SHQ A;  1WXS A;  2DAJ A;  3ZUN A;  3ZNZ B;  4EUT A;  2DYM A;  2KO3 A;  3PZD A;  5LXH A;  3L54 A;  2K8H A;  2ZPY A;  2L76 A;  2M1M A;  3K9O B;  3PT2 B;  1WZ3 A;  4DDG D;  1WX8 A;  3ZTC A;  2DZM A;  5C1Z A;  4KSK C;  2B3A A;  1WJ6 A;  1YQB A;  4MGK E;  3N3K B;  3ZLZ A;  2WX1 A;  3NS8 A;  2BPS A;  4IUM B;  2DZI A;  3KUZ A;  4KDL B;  4RM9 A;  2BGF A;  3A4R A;  2FUH B;  2BWF A;  4BOS C;  4NY0 A;  2KC2 A;  3M95 A;  2I1J A;  3NHE B;  2N7E A;  3VTW A;  4IWQ A;  4K1R B;  1IYF A;  3CF6 E;  4DHJ B;  2IBI B;  2V1Y A;  3IG3 A;  1ISN A;  3VDZ A;  1V80 A;  1LQB A;  1WX7 A;  2NPT B;  3QK0 A;  2KJR A;  2N9E B;  4CHK A;  3WAN A;  2KDB A;  3DVG Y;  2KMA A;  2N9P C;  4LCD E;  2KJ6 A;  4JQW C;  2KMC A;  4NNJ B;  5L83 A;  2KDF B;  2RSU A;  2BYE A;  3L08 A;  4M0W B;  2NPT A;  3HM6 X;  4W9I A;  4IM0 A;  4BBN F;  1JRU A;  4FUL A;  2D11 A;  1E7U A;  4TKN A;  4NAW B;  1V9J A;  2NBU A;  3QQ8 B;  4CYE A;  2RGF A;  4WJP A;  2OOB B;  3ML9 A;  4IM3 A;  2LUE A;  4W9J A;  3UIO B;  4IC7 B;  1T0Y A;  2KLC A;  2O2V A;  2IY0 B;  4NPN A;  3TCA A;  1ZW7 A;  4PS7 A;  3JSV B;  2XK5 B;  1WE6 A;  1WM2 A;  2G45 B;  5BO4 B;  1KLV A;  2DZJ A;  2Z0D B;  4GGQ A;  3VTU A;  1S3S G;  2LVQ A;  2XBB C;  5KHQ A;  4WWO A;  2KD0 A;  3KVF B;  2DEN B;  2O6V B;  3T9L A;  2V4L A;  3W1Y A;  2KK8 A;  3PHW B;  3DBR I;  1TGZ B;  3X0W A;  3PGE A;  4G3X B;  4TV3 A;  3Q3J A;  3MHS D;  2WYQ A;  4W9L A;  3V62 A;  4DXA B;  2AWT A;  1K8R B;  3ONS A;  4M8N A;  2WDT B;  2KOX A;  5L95 C;  4DHJ D;  1WE7 A;  2Y5B B;  4JL9 A;  1KOT A;  3VFK A;  1WJN A;  2GBM A;  2DYB A;  1E8Z A;  4IWP A;  3X23 A;  3DPD A;  3H7S A;  1IPG A;  2K25 A;  1P3Q U;  4GDK B;  4W9K A;  3ZVV A;  5D94 A;  3ZNI D;  2NCN A;  1HE8 A;  3PVL A;  1NDD A;  2LAS A;  4LDT B;  3VH3 B;  3B1L X;  4E71 A;  4NJ7 A;  2MBQ A;  5D7G A;  4WAA A;  2KTR B;  4FHK A;  2ZEQ A;  2CHX A;  1WF9 A;  3PRZ A;  4HJK A;  4I6P A;  2NBV B;  3K9P B;  3KUD B;  3TMP B;  2JWZ A;  2GOW A;  3AXC A;  4HCP B;  2QHO A;  3A9K A;  3JYU A;  2M4N A;  4GIV A;  3ZO5 B;  3B0A A;  3A9J A;  4GXB A;  1WGD A;  3VUX A;  1OEY A;  2FCM A;  2O6V D;  5AZF A;  3VVW B;  3TBL D;  1YD8 U;  4N9F 4;  3CST A;  1E8W A;  4IW0 A;  3BIN A;  1RLF A;  3LJ3 A;  3PRP B;  5AEK B;  5DPS A;  1R4N I;  3UQA A;  4NQL B;  1E8Y A;  3W1S A;  1X1M A;  2MQJ A;  4G0N B;  4ASW C;  3KYC D;  1C3T A;  3I3T B;  2GBN A;  2VRR B;  2W9N A;  3V6E B;  2CS4 A;  4HCN B;  3APF A;  3WAP A;  1V5T A;  1YX6 B;  2HTH A;  3H9D A;  1YJ1 A;  5IA7 A;  2KKC A;  1KM7 A;  3PTF C;  3PLV A;  1L2N A;  3DOW A;  4HPM B;  2KVR A;  2DX5 B;  4HK2 A;  3RT3 B;  4EZJ A;  1G6J A;  4XX5 A;  3HK0 A;  2J0K A;  2C60 A;  3TL5 A;  2KTF A;  2CHZ A;  4LDT D;  4EZK A;  1XT9 B;  1UBI A;  4K7W A;  5JHB A;  2LGY A;  3VHT C;  5EDS A;  1LFD A;  4MM3 A;  4IM2 A;  4MGY E;  1H4R A;  2JT4 B;  3QJZ A;  5CTR C;  3APC A;  1ZGU B;  1U4A A;  2PEA A;  3QCA A;  4RMA A;  3A33 B;  5C23 A;  3UGB B;  4IWO A;  3VXW A;  3RUI B;  2KN5 A;  5G55 A;  1OGW A;  5AZG A;  5CHF A;  4K7S A;  2LVP A;  2M17 A;  4LJP B;  3L0W B;  1YX5 B;  1GC6 A;  2IO3 B;  4ZYN A;  1Z5S B;  2L00 B;  1WY8 A;  1WGR A;  2LRW A;  3H6N A;  5CX3 A;  3KW5 B;  4AUQ C;  4EZL A;  1OQY A;  4TUU A;  4BVU C;  2I1K A;  2UWQ A;  1SIF A;  4NQK E;  4MDK E;  5TR5 A;  2KDI A;  1WM3 A;  5J17 A;  3H1U A;  5E6O A;  2K6Q A;  2LGX A;  3M62 B;  2KX0 A;  3L17 A;  5E6N A;  3RD2 A;  4FAD A;  2L0T A;  1P98 A;  5JZE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...