4KT0E

Crystal structure of a virus like photosystem i from the cyanobacterium synechocystis pcc 6803
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
68
structure length
68
Chain Sequence
b'ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Crystal structures of virus-like photosystem I complexes from the mesophilic cyanobacterium Synechocystis PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Electron transport
total genus 11
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kt0E00
3QZ9B 3X26B 2PUOB 2PVOB 2PUKB 2ZPHB 1PSEA 4XK8E 2PVGB 2WSEE 1IREB 2WSFE 4RKUE 2CYZB 3WVDB 3QXEB 2DD5A 4KT0E 2ZPBB 3VYHB 4ZGDB 2DXCA 1AHJB 3VYGA 2D0QB 5L8RE 3A8OB 2ZZDA 4ZGEB 4FM4B 1UGPB 2CZ6B 2O01E 2DPPB 2DXBA 2AHJB 1QP3A 3LW5E 1GXIE 3X25B 4OB1B 2PU9B 2ZPGB 3A8MB 1PSFA 2PVDB 2ZCFB 2WSCE 4ZGJB 3WVEB 2CZ1B 1JB0E 2ZPIB 4L6V5 1UGSB 4OB2B 2ZPFB 4OB0B 3X20B 2CZ7B 3X28B 3A8HB 4Y28E 4OB3B 1UGRB 1V29B 2QDYB 3A8GB 1UGQB 1DJ7B 3A8LB 2ZPEB 3X24B 1QP2A 3QZ5B 3QYGB 2CZ0B 3QYHB 2DD4A 3HHTB
chains in the Genus database with same CATH superfamily
4QKUA 4FW2A 3TEEA 2EQUA 4HCBA 3OS1A 2MF2A 3JB9J 2HAXA 1OU8A 4BE1A 2NWMA 3I35A 3S6WA 1X6BA 3QBYA 1KC8U 2NUTB 2EKOA 4PJOC 1M90U 2RHZA 4LE9A 1S1NA 2V8IA 2MOXA 2JVVA 5HY6A 4P5NA 1M9SA 2P4RA 4J9IA 4M75E 2ROLA 2ZGWA 3CMEQ 4DBFA 4A63B 3EFOA 1Y7XA 2QASA 1WQ7A 2RNAA 4JJNK 2LMJA 1G8XA 2EQIA 4KUIA 4PJOG 3QJYA 1N8RR 1PWTA 2PZ1A 1M3AA 1WYXA 4RG8A 5GAMg 5M9OA 2PU9B 5GAOp 1KD1C 2M16A 3EG0A 2WSCE 4J9HA 4NL2A 2CSIA 2JZ2A 1YJ9T 2KRMA 2FB7A 1VQ6Q 2BKDN 3J80E 1YJ9A 2L8DA 4E6RA 1M4ZA 2EIFA 1LNXA 3X28B 4C8QG 1U3OA 3CCMQ 3OYGA 3M59A 1M1FA 1UHCA 4BY6B 5LJ3h 2JXBA 4E7SA 4OMMA 1ZQ1A 5I2SA 3TQ7P 1VQ8T 1ABOA 3JB9H 1RI0A 4LDWA 3CC7T 1VQ8A 3E9GA 1YCYA 4AT1B 3CC7A 3RESA 4OP0A 3A98A 3QZ5B 4FCYA 4BACA 4RTTA 5AYFA 3CC4T 2VWFA 2COYA 4BUGA 3CC4A 3SB2A 1VYUA 2WSEE 2RO0A 1IB8A 2DKGA 1Q81U 5GMKm 3FLGA 1Q86C 5LJ5j 3NGPA 3HFNA 5CAIA 4RTVA 1ZA1B 3EHQA 2R57A 1X69A 2KE9A 3OS0A 2DMOA 1QQJA 1TUCA 2V1RA 4XU1A 5LJ3f 1NLPC 4FSSA 3H41A 2DFUA 2D0QB 2OAUA 2J05A 2O9VA 4JPBW 4K11A 2LCLA 4F7UA 4ZGEB 1W70A 5FW9A 4C92D 1IZ6A 3F70A 1OX8A 2QDLA 4J8OA 1YITQ 2LX7A 3KFVA 4OMLA 1HYOA 1I4K1 1SG5A 1SHGA 3D7SB 4C0FA 1NJIC 2PQWA 1KQSP 3JCMh 4HVVA 2KT8A 4X9CA 5A0DA 5A2QE 3A8MB 2K2VA 5GAOn 2K57A 3V7RA 3WVEB 4DOVA 1N8RU 1A0NB 2W10A 1AWXA 5CCAA 1LPLA 2OTLQ 4E7KA 3IQLA 2RF0A 4JJBA 1NG2A 4M7DD 5C6SA 2RB6A 4HT9A 2DAQA 1UEBA 2FPEA 2BZ8A 3DB3A 3GLXA 3EG2A 3HKSA 1TTHB 1VQ5Q 2F2WA 3NTKA 3L2UA 1OZ2A 4FIBA 4ZNXA 1EIFA 5IXFA 2KK4A 2FVUA 4E7IA 1ZBXA 3X24B 1CKBA 2E64A 4C92A 1NEBA 1NJIR 3LLRA 1N9SA 4XTWA 2K3YA 1PD1A 1D09B 4A4HA 3JCMd 3EG9B 5LJ3e 2KROA 4OMFB 2A08A 3V8JA 5KYWA 2YUPA 2GGRA 1OU9A 4BDZA 2DL3A 3EG1A 1KD1U 2CYZB 1QVGP 1QLYA 3PMIA 1NPPA 3CC2A 2BTTA 3WVDB 1IXDA 4HXJA 2YSQA 3UDCA 2K2MA 1WIEA 5GAOr 2DYIA 2LQNA 2FL7A 3ZEHA 2ZAEA 4PJOB 2JM9A 2CREA 2LJ0A 4CRIA 4F7UG 1NM7A 3RMQA 4M7DA 5KYNA 2ZZDA 2D8HA 1RI9A 2VGMA 2K5LA 5GMKe 2CP6A 1UUEA 1MNDA 4F04B 2EJFA 2X4WA 3LW5E 3CCST 4OB1B 3M0TA 4II1A 5HK0A 1O9SA 1TOVA 3CCSA 4C8QB 2ZPGB 4MDWA 3CCQT 3GBQA 4IUTA 1IHVA 3CCQA 3M4YA 1LCKA 1VYTA 2V8KA 4KBMB 4C92C 2MCNA 1YN8A 3OQ5A 5GAOm 2F1LA 3DLMA 1BCMA 3VJPA 2JJ9A 3MP8A 2I0NA 4LDYA 2A28A 3E2UA 3A8GB 4A54A 3PVLA 4GBQA 3EGXB 1WXBA 1LVKA 3PNWC 3JCMg 1MMAA 2RI5A 3CXCA 3JB9D 2O88A 1KHIA 3OS2A 3OYLA 2CUBA 3SHWA 4C92G 1QKWA 1PRMC 3MJXA 5FLXE 1S72T 1K0SA 4R0KA 2DL7A 4JJDA 1S72A 2IPOB 5GMKl 4M7DC 2EPDA 2LZ6B 1WZOA 4M78F 4OF1A 1NJIU 3PIOA 3NTIA 2CT4A 4M78A 2YDLA 1AWJA 3VS4A 2HDAA 2WSFE 2OJ2A 2XK0A 5CKFA 1Y71A 4PJJA 2VASA 2H3JA 2JNGA 2X3XD 1P92A 4OVAA 2SRCA 3CCRQ 4BE0A 5L8RE 1G3TA 1N6AA 1R77A 3CPFA 4M7DG 1BU1A 1MUZA 4JUVA 2VUBA 1VQKQ 2A7YA 2QG9B 2VC8A 3UA7A 5EG2A 3JB9F 2H8HA 1VOMA 2KQWA 3UPUA 3URGA 3EH1A 1QCNA 1UB4A 1GBRA 2F5KA 4FL6A 1NE8A 3CCLT 3KUFA 4J9FA 1ZA2B 1K9MR 4M77F 2OTJA 3CCLA 3TU4K 5CQXA 1VQPQ 1UDLA 3P8DA 1RAAB 2X4XA 4D8DA 2F2VA 5GANf 1K8AC 3MEUA 3OA6A 1D0YA 1TS9A 1PM3A 3ZFJA 1OZ3A 3KXTA 4Z89A 2PNIA 5CKBA 3RR6A 1IHWA 3QIIA 5GAN8 2P84A 1UGQB 1KC8C 1OV3A 2RQVA 4XTZA 3M56A 4M78C 3P8HA 1M90C 2EGCA 3G6ET 4RCCA 3CXCS 1KSWA 2CP5A 2KEAA 2K9GA 2QK0A 3G6EA 1ZBJA 2MK5A 4M75F 1YP5A 3TREA 2AKKA 4DOWA 2KGTA 2PUKB 4M75A 1I81A 2GTJA 2FPFA 1IGQA 4F7UB 3REAB 4J7FA 4M7AB 3BFMA 5CQYA 1GCQA 3TVTA 2L3PA 5LJ5g 1O75A 1Y96B 4KRTA 3FJ5A 4J6XA 2D8JA 2C06A 3CEYA 1QWEA 2D0NA 2KT1A 1VQNT 4JRQA 4RUGA 2DRKA 3DLLA 1VQNA 3L2ZA 4JRPA 4HA8A 2R58A 3I9QA 5EC7A 5LJ3j 1AVZC 1OOTA 1M1GA 5D6YA 1M2VA 4DEYA 3QO3A 3C0CA 2HKNA 4OMNA 4Z8AA 1UE9A 5GANe 5CKHA 2J06A 1SF9A 3HPWA 2GFAA 1JB0E 2LQ8A 5IN1A 1WHLA 2CKKA 5DLOA 1M1KR 5GJVB 2ED0A 2CGHA 3MEWA 5IHIA 2DVJA 1M30A 1K9MU 4C92B 1SHFA 5CR2A 1T3LA 2FHDA 1M5Q1 1Q81C 2RM4A 3L2RA 2KI7A 1ABQA 3CCEQ 3RKXA 3OW2P 3I5RA 3A8LB 3OYMA 2DO3A 3LWHA 1YWPA 1KJWA 2JW4A 4CI0C 2P0QA 1GCQC 5KYWB 1X75C 2L89A 5IAYA 1T0HA 3OYAA 2Y90A 2CZ0B 1VA7A 3CCJT 1JJ2A 2OX7A 1WLPB 2FRWA 5IHNA 4EIKA 3CCJA 4PFZA 2X3WD 2VYTA 3QJ6A 3MPUB 3BE3A 2D1XA 1Q7YR 5A0LA 1M2OA 4M7DB 3M9QA 2DZ9A 4BD3A 3OYYA 2KDSA 4XTYA 2KRNA 2XIDA 1D3BA 5L23A 2EFIA 3PIPA 1WJRA 3I5SA 4M77E 4HKEA 2XDBA 9ATCB 1AT1B 2KXDA 3EAEA 4L59A 3CCUT 4Z88A 3VYGA 1JU5C 2EYXA 2VXFA 3RNJA 3CCUA 5GMKi 2DYBA 4A53A 1YI2Q 3ULRB 1VQ4T 4A4FA 5KCOA 1VQ4A 1W2BA 3CPWP 4FSXA 3CMAT 1ARKA 1E6GA 3CMAA 4HCCA 3M0PA 3SWNA 4FU6A 4ZTFA 4EDUA 3OS5A 2K6DA 2RA2A 2CP0A 3LH5A 2LDMA 1K4US 2QTXA 2LJ3A 1C0MA 3OB9A 3HRSA 1RLQC 4BB7A 2DRMA 2ZPFB 1VQOT 1U1SA 1QVFP 2J6KA 2IIMA 1MV3A 2F69A 4IUQA 1VQOA 2X4YA 3HSBA 1Y57A 1M1KU 3VS5A 3QPHA 1MMGA 4KH0B 3T9NA 2KBTA 1AEYA 2F2XA 4NL3A 5IHKA 2LQWA 1OI1A 2MI6A 3JRZA 5GAMe 2KRSA 4TVRA 1PD0A 4DBHA 2DD4A 5ECAA 2DBKA 1JJ2S 1VQKT 2KAFA 1VQKA 2DF6A 3QWXX 1TWBA 3RIRA 2L0AA 5GAN3 3LYIA 1XQHA 3MKDA 3I56T 1WHGA 4O6JA 1TSFA 2QXFA 3JV3A 2DJQA 4AG2C 3I56A 3SDZA 1AOJA 4KT0E 1Q7YU 1SKUB 2XU8A 3SWNC 2RJEA 1X27A 4FT4A 3FRNA 2O9SA 4J9BA 3VRZA 2QEXQ 3QDRB 2CP3A 3O5ZA 5GMKh 2YRDA 2ABLA 1AZGB 3JB9I 3OYJA 1R0CB 3MEAA 2VXEA 3NFCA 1W2BS 2K7AA 2W0ZA 3I55T 4PJOE 3NTHA 2O4XA 2LRQA 1YIJT 3KBGA 2LNHB 4C0DC 1WHKA 3I55A 3M0QA 3N5BB 1YIJA 2ZCFB 3CD6Q 3GNFB 2CZ1B 5LJ3d 2AK5A 3NPFA 1T0JA 4OB0B 1N27A 3RMSA 3CBMA 4BI8B 1BI3A 1RAFB 2M0YA 2L2PA 1NZ9A 3HL8A 1BBZA 1MV0B 2V26A 4MZPA 4C8QE 1JQQA 4HCZA 2RJCA 2Y4YA 2JUFA 2L3RA 4ZN1A 1VQMQ 4XQ3A 4J6WA 2CH4W 4GY5A 5J39A 4E7JA 4XAXB 3C12A 4R56A 1JRIA 5GAOq 4BDYA 2IG0A 3E19A 2XICA 1UFFA 4LDVA 2XD0A 1WGSA 2DZCA 3S3NA 1U06A 2SEMA 1T3SA 5HK3A 4EMKA 1I5LA 1GL5A 5FU6C 3INZA 4C0GA 1FWZA 2HSPA 2E12A 1NPRA 3VS7A 5GAN2 4NS5A 2JMAA 4FW1A 4HVUA 1BK2A 4Y92A 3M55A 6AT1B 1VQ7Q 3NMZC 3BW1A 1FX7A 1M2VB 2X51A 3OYNA 4HCKA 2MAMA 1YJNQ 1TUGB 1D0XA 2PTKA 2RHYA 2YUNA 5FRNA 3VRYA 2CT3A 4QQDA 1YJWQ 5LJ3g 1N9RA 3MHXA 4Z02A 1MGQA 3V7SA 2E3HA 2QGGA 3G4SQ 1SSFA 2RQWA 1IO6A 4WTOB 3X25B 4JLIA 3V8KA 1FMKA 1WI7A 1QWFA 2RI2A 4IUUA 5C0MA 5KYYA 2A3LA 5AT1B 1PNJA 2DLPA 2DNUA 4MZTA 5FU7C 1I0CA 1ZLMA 2QQSA 2LX9A 4KGVB 5FROA 5KH6A 1MMDA 2DA9A 2QA4T 3TSZA 1WX6A 1HJDA 2QA4A 1RACB 1YNZA 4C5HA 4LDUA 3G71T 1KQ2A 2AKLA 1UGRB 4OGCA 1V29B 3G71A 4M78D 3V7CA 1CSKA 4E7HA 1YHQT 5D7UA 1SSHA 1YHQA 1Q82R 3PT9A 2R5MA 2R5AA 2KYMA 3G7ZA 5GAN4 2AZSA 1K0XA 2Y4XA 4ORZA 1D3BB 2JTEA 2EBPA 2MWOA 3LH0A 4GLKA 3CCVT 1D1BA 5CO7A 3CCVA 2EYZA 4RCBA 3RUXA 2GF7A 4AFSC 4PFOA 3QSUA 2JT4A 1AD5A 3FEOA 1K76A 2FPDA 2GNCA 3A5ZB 3L42A 2KR3A 2KNBB 3M58A 2O2OA 4MMLA 3MP6A 3THKA 4DQ2A 2DXCA 4KGZB 1AHJB 2RK1A 1LOJA 1W6XA 1BKBA 5DM7R 1PC0A 4PJNA 4M77D 1LJOA 3JAME 3CMET 1K9MC 4BI3A 4M7AE 2CZ6B 3CMEA 2MWPA 1G3SA 5CVIA 1JXMA 1V76A 3JSCA 3EFOB 1KK7A 4N0AA 4IUPA 5GANh 1H92A 2X9HA 4PKCC 1RAEB 2QQ9A 2PVDB 1WQWA 4C0DB 2LQKA 1VQ6T 1YJ9Q 1UGSB 1WA7A 1VQ6A 4JZ4A 2CS7A 3CCMT 4QQ6A 4M75D 2EQKA 4OB3B 3CCMA 5LJ5f 1NEGA 4ATOA 1D0ZA 2P4TA 1VQ8Q 4YTLA 2NLUA 2YT6A 3CC7Q 1K9AA 4J6YA 4AFZC 4M77A 2JS2A 4C92E 4KULA 5IXBA 2HEQA 1UJYA 2JM8A 1OX9A 1AWWA 3L2WA 4RMOA 2QEXT 3CC4Q 2DEUA 4OMQA 3ZL7C 3PVQA 5GANd 2QEXA 1UG1A 3OYFA 2CSQA 2MMPA 2RMOA 5CIUA 1TXQA 3M4GA 2RI3A 2E5KA 1G5VA 2HQEA 1VUBA 5FU6B 2ECZA 2YLCA 4XTVA 4WF2A 1Y07A 4PK4A 2K3XA 4FYWB 3EHRA 5FWBA 4N0AC 4J9GA 1B07A 4MZMA 2EYQA 4XU2A 3M0RA 1K73R 1JXOA 2J6FA 3OSSC 2VGNA 3S3MA 2LVMA 2O4XB 2HQXA 1WFWA 3FB9A 2DJZA 1YITT 2LNVA 1OPKA 2Z0WA 4M78G 1YITA 2DBMA 2K5FA 1M3BA 2G6FX 1M1KC 2E65A 3CBOA 1B7TA 2K3BA 2B86A 1XOVA 2E6NA 1SRMA 2C0TA 1PRLC 1WHJA 3RKYA 4AMCA 4ZGJB 1W1FA 1RAIB 3J7AF 5LJ5e 3H6ZA 4LUEA 2NYSA 2OTLT 5FU7B 2BZYA 4M77C 3VKIA 1U1TA 2OTLA 3JCMP 4B9WA 5I21A 2K4YA 3HP9A 1D1CA 3JCMJ 4X34A 1N5ZA 3RBBB 2A0FB 2HSEB 3JB9G 2DL4A 3TSWA 2CDTA 2NUPA 1D1AA 1QMCA 2QDYB 4N4IA 1G2BA 1VQ5T 1PKSA 1RAHB 1ZHIA 5CKEA 3CPWS 1AZEA 2RHIA 3A1PA 3PE0A 4B9XA 4C8QD 1VQ5A 4J83A 1Q7YC 1RADB 1W4SA 2HBPA 4JS4A 5GAMh 1RL2A 3MEVA 1R0BG 4M77G 5GMKj 4A4GA 4WCIA 4OMPA 3WXMB 2E5QA 2XHCA 2QI2A 3M5AA 2QQRA 2AT1B 1X43A 4PL6A 2LCSA 2PUOB 1OYXA 1MNEA 2LC4A 4M75C 4BI4A 2RJFA 2B8AA 1YJWT 3META 2ENMA 3M53A 1FYNA 1KQSA 4ELYC 4PJOF 1YJWA 1YFNA 1SEMA 3CC2Q 2M51A 4MDXA 3QXEB 1R8OB 3SD4A 1U8RA 3CXCP 3JCMW 2HZYA 3NHNA 2O31A 5I2MA 3AHUA 2ROTA 1GRIA 4CC4B 3JCMQ 4CC2A 4RTYA 4M75G 1YBYA 1WXUA 5KCHA 1BIAA 5GAMf 1FMVA 1Z9ZA 4J7IA 4C8QF 1ZSGA 4HVWA 1J3TA 4LD6A 1UJ0A 3RERA 4AFQC 2RHUA 1ZX6A 4C8QA 3ZBDA 1AWOA 1KFZA 3U23A 2DIQA 2HNIA 4KGXB 3MP1A 3CCSQ 1QW1A 4F16A 1RABB 3UATA 4LDXA 1GFDA 3HRUA 2BE9B 3CCQQ 3ER0A 3UT1A 4ZN3A 2RHXA 4F17A 4OB2B 2OI3A 3VS3A 1CKAA 5HKCA 4KUDK 2CZ7B 2LTOA 4QVZA 2K5IA 2M02A 8AT1B 3LGLA 1X01A 2HKQB 3M0SA 2L5QA 2KSSA 1QVGA 1YWOA 2L3QA 2VVKA 1F1BB 2ZPEB 4X1VA 1JEGA 1QCFA 2YWWA 2DXTA 3EGDA 3SEMA 2NUZA 2AIRB 1S72Q 2GCXA 1WNLA 2D6FA 2J6OA 2V8JA 1WPYA 1PG5B 1GBQA 4UC4A 1PCXA 1IREB 2HL5C 4XU0A 1KQSS 1ZUKA 2DERA 5KYXA 2KXCA 4M78B 1MHNA 4C8QC 1WDXA 4AG1C 2DD5A 1H3ZA 5J26A 3VYHB 3CCRT 2HCKA 3MO8A 3CCRA 1H641 3L2QA 2DM1A 2DK3A 2E10A 2E3IA 4E47A 1X2KA 1ZUYA 2FZKB 2FZGB 3Q1JA 3HRTA 4M7AD 3QHSA 2MIOA 1WJSA 3R6NA 4CC7A 1ZUUA 1GFCA 4X9DA 5FWCA 2OTJQ 3CCLQ 1VIEA 2AZVA 1VQPT 3BDLA 3OYHA 3VS1A 1FMWA 2V1QA 4L6V5 3V8LA 4GLMA 1VQPA 1VQ9Q 3FDRA 4ELZC 3OBWA 3M54A 1M27C 3JCMX 3UF4A 2JMCA 4M77B 2E41A 4O5VA 5KYUA 3G1JA 2ED1A 3RDVA 4IUVA 1KD1R 1UGVA 1FXXA 5I11A 3GNGA 4J9CA 3SFMA 2M0OA 2C0OA 1QVGS 4DEXA 2YXYA 4D8KA 4DBQA 3G6EQ 4VUBA 2COZA 1QP2A 2GQIA 4EPCA 4F7UF 4N4HA 2YRVA 1C1AA 1SRLA 2COWA 2HBWA 4M7AF 2DX1A 4J5YA 2EWNA 4D6WA 1Q95G 3QZ9B 3PGGA 2PVOB 4PJMA 4RTXA 5GANj 4M7AA 3L2VA 4LUDA 4XK8E 3CQTA 2QQAA 3VV0A 2RPNA 1Y96A 4M75B 3RKWA 2FEIA 4JS5A 1B34A 1SPKA 3JCMb 2M9UA 1VQNQ 4DA4A 5CKDA 2LP5A 2BZXA 2E1HA 2RQUA 1JJ2P 4E7ZA 3TCJA 3FIFA 1Q86R 1OPLA 4AFUC 2DEQA 3EG3A 2RH2A 1VQLQ 2AHJB 1JO8A 1E6HA 4LD9K 5KE2A 5IT9E 2C0IA 3QKJA 1PSFA 1PHTA 2EQJA 5IH2A 1RAGB 3S3OA 2NUPB 2QGFB 4C92F 1OULA 2QTVA 3UA6A 2DTOA 4LN2A 1Q82C 3H0IA 1BI0A 1NLOC 1NYFA 4R55A 3A8HB 2MPXC 3JCMf 5GAN7 4A4EA 2KYBA 4Y28E 3GPLA 3CCET 3OY9A 1W2BP 1I1JA 4PNOA 4ME7A 2FRYA 2P0KA 3CCEA 1H8KA 3GIBA 4PLIA 1DJ7B 4OGEA 4M7AC 1TH7A 1KG1A 1KHCA 2K79A 2JOYA 4C5EA 3OBYA 3QUIA 3CC2T 3H8ZA 2HL3A 3OYIA 5HCKA 3FC3A 3QYGB 4M7DF 4B6MA 1BYMA 3CCJQ 2GQVA 2LJ1A 4IKFA 1ZSZA 2VB6A 3LWIA 4EMKC 3E1SA 1YCSB 5LL6S 3VS0A 1PSEA 4C5GA 4M7AG 3GF5A 3VS6A 3PTAA 2LT1A 3CBPA 4JLGA 4E7LA 4JJCA 2QAZA 2EKHA 3LGFA 2OAWA 4FYVB 5D6WA 3VUBA 2D9TA 4ZGDB 3CCUQ 1TU0B 2XDDA 1WJQA 1G3WA 1UTIA 1X2QA 2KVQG 3A8OB 2XDPA 2YLBA 1YI2T 4V2SA 1I8FA 4RTWA 2FYKA 1YI2A 1VQ4Q 2NUTA 2O01E 1MMNA 3H0FA 5CK9A 1G3YA 1XNIA 2DL5A 3OW2A 3CMAQ 2EYWA 4FYYB 2M1HA 1VYVA 1GXIE 2HMAA 4LXCA 1Y0MA 5GAMj 1HD3A 3LX7A 2DETA 1Q86U 5DY9A 3JCMe 1K1ZA 3SWNB 5LJ5h 4F7UE 3EH2A 1EFNA 1HSQA 5I22A 3OYCA 1QVPA 2DTHA 1NBEB 1I5OB 3C95A 1X6OA 3X20B 2EAYA 1UECA 1RUWA 2ESWA 3EGDB 2YUOA 1VQOQ 1ZSZC 1JBMA 3BY7A 4RG2A 3HTRA 3OYBA 3ASKA 3OSVA 1I07A 2J7IA 3PMTA 1M8VA 1EX4A 2EW3A 3AT1B 2F5TX 2KY9A 4C5IA 2DILA 2DXUA 2FO0A 3E9FA 2XMFA 1BIBA 5KYXB 3C94A 1U5SA 2CUDA 3P8BB 3C4SA 2A36A 2E70A 1G83A 1K73C 2XKOC 3CPWA 4PLLA 2X35A 3JCMc 3OYDA 2PVGB 1GCPA 3GOXA 1QKXA 1HXDA 5LJ5d 3QDFA 4RKUE 2EJGA 3I56Q 1BI1A 2DVEA 1Z9QA 2IVWA 1XJWB 2X4JA 4Q5WA 4EMGA 4F14A 1KQ1A 4L5GA 1Q82U 2OTJT 1M8MA 2VKNA 3JCMV 4RTUA 2QQBA 1QVFA 1VQ9T 4FM4B 3OYEA 1BCOA 2E6ZA 2RQTA 2CP7A 2DXBA 2JTMA 1VQ9A 2YHTA 1EZZB 5DLQE 3M57A 4HT8A 2EYYA 3OW2S 3I55Q 4QVCA 3O8VA 2EJ9A 1VIFA 3REBB 5KYUB 1YIJQ 2DL8A 2RK2A 4QVDA 3H0HA 5D6XA 3CD6T 2VV5A 1ACMB 4JZ3A 2DE0X 2GFUA 4IIOA 2BIVA 3DKMA 4M7DE 2H3EB 3CD6A 4ZTJA 3GP8A 2KMTA 2ZPIB 5GAN5 4FYXB 5GJWB 2HQHA 2RJDA 2RQRA 5A0GA 1B3QA 4BY6C 1WXTA 3OMGA 3J81E 2EQMA 4MMKA 4C0ZA 5FRMA 1VQMT 1QCOA 2BUDA 4J9DA 1VQMA 3EFRA 4NOYA 3L1AA 2JN0A 8ATCB 4QW2A 4PJOD 2G3RA 3EGUA 1K8AR 2JS0A 4ANJA 2LCCA 2CH4A 2L3SA 4JRKA 4IIMA 1M3CA 3BDUA 1OQKA 1B34B 2GBQA 1KC8R 2HD0A 3X26B 2RD1A 3OYKA 2ZPHB 1M90R 3MCAB 2P0PA 5GANg 4EMKB 1KIKA 1PKTA 7AT1B 3EFSA 2YUQA 1VQLT 4PFPA 3PFSA 2FG0A 2EVRA 1VQ7T 1VQLA 2E4HA 1NYGA 4N4GA 1VQ7A 2ZPBB 3DB4A 1E7OA 3H9NA 3EG9A 5GAOl 1YJNT 5J3BA 2QYZA 3UWNA 4XU3A 1YJNA 3VU3C 4DBRA 1C6VX 3M0UA 3FJPA 1UGPB 2XI9A 1XTDA 4Y91A 2DPPB 1QVFS 4LNPA 3G4ST 4M78E 4XTXA 1H3HA 1QP3A 3G4SA 4OMOA 1TG0A 4PJOA 2EGEA 3VUZA 2MYSA 4JDSA 1WHHA 2EGAA 1TUDA 4QT7A 4J9EA 1HK9A 4E2FB 1WHMA 3HFOA 5KE3A 5KYYB 2BE7D 4KH1B 1BB9A 2DTIA 1K73U 2LT4A 2XG8D 4IURA 2QA4Q 3QG1A 4A4KA 4CC3A 5GAMd 4QQGA 4PJLA 3G71Q 1UHFA 4XTUA 2CP2A 2WACA 1V1CA 2I2LA 1X6GA 1ZSZB 2ATCB 3QWYA 4RTZA 1YHQQ 3R6OA 1BI2A 1RLPC 2YRCA 4EMHA 1OEBA 2A37A 5GAN6 3VS2A 2JTFA 2GTOA 1IGUA 2FZCB 4FT2A 4BE2A 4M4ZA 2RN8A 3QYHB 2DIGA 3ME9A 4JRIA 1Q81R 1N8RC 3HHTB 3EGXA 3OMCA 1K8AU 1IRXA 3CCVQ 4ESRA
chains in the Genus database with same CATH topology
3QZ9B 4DOWA 3PGGA 5CO7A 3CCVA 2PVOB 2PUKB 3TEEA 4M75A 2EQUA 4RCBA 1I81A 5GANj 3RUXA 2GF7A 4F7UB 4HCBA 3L2VA 3OS1A 4XK8E 4M7AA 2MF2A 3JB9J 2HAXA 4BE1A 4J7FA 2QQAA 3S6WA 3VV0A 3QSUA 1Y96A 4M75B 3RKWA 4M7AB 3BFMA 3FEOA 3QBYA 5CQYA 4JS5A 1KC8U 5LJ5g 2EKOA 1O75A 3A5ZB 1Y96B 3L42A 4PJOC 3M58A 1M90U 2RHZA 4J6XA 1B34A 4MMLA 3MP6A 3CEYA 2C06A 2V8IA 2DXCA 4DQ2A 1AHJB 1VQNT 4JRQA 2RK1A 3JCMb 2M9UA 1LOJA 1BKBA 5DM7R 4DA4A 3DLLA 5CKDA 1VQNA 2E1HA 4M77D 2JVVA 3L2ZA 5HY6A 4JRPA 4P5NA 1M9SA 3TCJA 1LJOA 3JAME 4HA8A 4M75E 3CMET 1K9MC 2ZGWA 4BI3A 2R58A 5LJ3j 4M7AE 2CZ6B 3FIFA 3CMEA 1M1GA 2MWPA 1G3SA 1Y7XA 2DEQA 5CVIA 2RH2A 1WQ7A 5D6YA 4JJNK 2AHJB 3QO3A 3JSCA 4KUIA 4PJOG 3QJYA 4LD9K 4N0AA 4IUPA 5KE2A 5GANh 4RG8A 5GAMg 5GANe 5CKHA 5M9OA 5IT9E 3QKJA 2PU9B 5GAOp 1PSFA 4PKCC 2EQJA 2QQ9A 3S3OA 2M16A 1KD1C 2PVDB 2WSCE 4NL2A 1WQWA 4C0DB 3HPWA 2LQKA 4C92F 2GFAA 2JZ2A 1YJ9T 1JB0E 1VQ6T 2LQ8A 2DTOA 5IN1A 2FB7A 1UGSB 2BKDN 2CKKA 3J80E 1YJ9A 1Q82C 5DLOA 1VQ6A 2L8DA 2CS7A 1M4ZA 1BI0A 4R55A 2CGHA 2EIFA 1LNXA 3X28B 3A8HB 3MEWA 3JCMf 3CCMT 5GAN7 4A4EA 1K9MU 4C8QG 4Y28E 4C92B 3OYGA 4QQ6A 3M59A 1M1FA 4M75D 2EQKA 4OB3B 3GPLA 3CCMA 5CR2A 2FHDA 3CCET 1M5Q1 5LJ3h 4BY6B 5LJ5f 3OY9A 2RM4A 3L2RA 1Q81C 4PNOA 4ME7A 2P0KA 3CCEA 3RKXA 3GIBA 4PLIA 1DJ7B 4OGEA 1ZQ1A 5I2SA 1VQ8T 4ATOA 4M7AC 1TH7A 2P4TA 3A8LB 3JB9H 1KG1A 1KHCA 4YTLA 1RI0A 2DO3A 2NLUA 3OYMA 3LWHA 2JOYA 4LDWA 3CC7T 1VQ8A 4C5EA 3OBYA 3QUIA 3E9GA 4CI0C 3CC2T 4J6YA 2P0QA 1YCYA 3H8ZA 3CC7A 3OYIA 4M77A 3RESA 1X75C 2L89A 4OP0A 3FC3A 3QZ5B 5IAYA 4C92E 4KULA 3QYGB 3OYAA 4BACA 4M7DF 2Y90A 2CZ0B 3CCJT 3L2WA 1JJ2A 1BYMA 2GQVA 5AYFA 3CC4T 4RMOA 4IKFA 2QEXT 3CCJA 2VYTA 4BUGA 3LWIA 3CC4A 3SB2A 3E1SA 3QJ6A 4EMKC 5GANd 2QEXA 5LL6S 3OYFA 2MMPA 5CIUA 1PSEA 4C5GA 4M7AG 3M4GA 5A0LA 2RI3A 4M7DB 3GF5A 3M9QA 2WSEE 3PTAA 2DZ9A 2RO0A 4BD3A 2HQEA 2LT1A 2KDSA 1VUBA 3CBPA 2DKGA 3OYYA 5FU6B 4XTYA 4JLGA 1Q81U 2XIDA 5GMKm 1D3BA 2YLCA 4E7LA 3FLGA 4XTVA 1Q86C 5LJ5j 1G5VA 4WF2A 2EFIA 1Y07A 3PIPA 3HFNA 3LGFA 2K3XA 5CAIA 1WJRA 4M77E 2R57A 4HKEA 5D6WA 3VUBA 4N0AC 2XDBA 3OS0A 2D9TA 4ZGDB 3EAEA 4L59A 4XU1A 5LJ3f 4MZMA 3CCUT 2EYQA 3VYGA 4XU2A 2VGNA 3OSSC 2XDDA 1WJQA 2D0QB 2OAUA 1G3WA 2VXFA 3A8OB 2KVQG 2LCLA 2XDPA 2LVMA 2YLBA 4F7UA 2O4XB 4A53A 5GMKi 3S3MA 4ZGEB 1YI2T 4V2SA 1I8FA 2HQXA 4C92D 2FYKA 1IZ6A 3F70A 2DJZA 3FB9A 4J8OA 1VQ4T 1YI2A 1YITT 4A4FA 2LNVA 5KCOA 2O01E 4M78G 1VQ4A 1YITA 5CK9A 1W2BA 4FSXA 2K5FA 1G3YA 1I4K1 3CMAT 1XNIA 4C0FA 1M1KC 2E65A 3OW2A 1NJIC 2M1HA 1GXIE 3CBOA 2PQWA 3CMAA 4HCCA 3SWNA 3JCMh 5GAMj 3LX7A 4FU6A 1XOVA 4X9CA 4EDUA 4ZTFA 1Q86U 2E6NA 3OS5A 5DY9A 5A0DA 3JCMe 3A8MB 5A2QE 2RA2A 3RKYA 2K2VA 3SWNB 5LJ5h 5GAOn 4ZGJB 4F7UE 2K57A 2LDMA 3V7RA 3WVEB 2QTXA 4DOVA 3OYCA 3J7AF 5LJ5e 1QVPA 3H6ZA 2DTHA 1N8RU 2OTLT 5FU7B 3OB9A 3HRSA 5CCAA 4BB7A 4M77C 3VKIA 1U1TA 2OTLA 3C95A 2ZPFB 4E7KA 3JCMP 1X6OA 4B9WA 5I21A 2K4YA 3HP9A 3X20B 2EAYA 3JCMJ 4M7DD 4X34A 5C6SA 2RB6A 4HT9A 1VQOT 1U1SA 2DAQA 3JB9G 2F69A 4IUQA 1JBMA 1UEBA 2X4YA 3BY7A 1VQOA 4RG2A 3HSBA 3DB3A 3GLXA 1M1KU 2QDYB 3HKSA 4N4IA 3ASKA 3OYBA 1VQ5T 3QPHA 3OSVA 1ZHIA 5CKEA 3T9NA 3CPWS 2RHIA 3NTKA 4B9XA 3L2UA 1OZ2A 4C8QD 4FIBA 1VQ5A 4J83A 1Q7YC 1EIFA 3PMTA 2KK4A 4NL3A 1M8VA 1W4SA 2HBPA 4JS4A 2FVUA 5GAMh 1RL2A 1OI1A 1ZBXA 3MEVA 4E7IA 4M77G 2F5TX 2E64A 2MI6A 2KY9A 3JRZA 3X24B 4A4GA 4C92A 5GMKj 5GAMe 4C5IA 3LLRA 2DXUA 2E5QA 3WXMB 1N9SA 2XHCA 2QI2A 3E9FA 4TVRA 4XTWA 2K3YA 1BIBA 3C94A 2DD4A 3P8BB 3C4SA 3M5AA 2E70A 2QQRA 1JJ2S 1VQKT 4PL6A 1K73C 2XKOC 4A4HA 3JCMd 3CPWA 2PUOB 4PLLA 5LJ3e 2KAFA 1OYXA 2LC4A 2X35A 4M75C 1VQKA 3JCMc 2RJFA 4BI4A 2B8AA 3RIRA 3OYDA 3META 1YJWT 2PVGB 4OMFB 5GAN3 3GOXA 3LYIA 1XQHA 3M53A 1HXDA 3V8JA 1KQSA 4ELYC 5LJ5d 4PJOF 4BDZA 1YJWA 3I56T 4RKUE 4O6JA 2CYZB 2EJGA 3PMIA 1BI1A 2QXFA 1NPPA 1KD1U 2DVEA 4MDXA 3I56A 2IVWA 3CC2A 3WVDB 3SDZA 2X4JA 3QXEB 3UDCA 1R8OB 3SD4A 4KT0E 4Q5WA 4EMGA 1U8RA 2XU8A 3JCMW 3SWNC 5GAOr 1Q7YU 2RJEA 2FL7A 4FT4A 5I2MA 1KQ1A 3ZEHA 3AHUA 4L5GA 3FRNA 4PJOB 1Q82U 4CRIA 4F7UG 2OTJT 3JCMQ 3RMQA 4M7DA 3QDRB 2ZZDA 3JCMV 5GMKh 2VGMA 4M75G 1YBYA 2K5LA 5GMKe 2QQBA 5KCHA 1QVFA 1BIAA 5GAMf 1VQ9T 4FM4B 3OYEA 3JB9I 4J7IA 3OYJA 4C8QF 2E6ZA 3CCUA 4LD6A 2DXBA 2JTMA 1VQ9A 3MEAA 2YHTA 3RERA 5DLQE 2VXEA 2EJFA 3M57A 2RHUA 3NFCA 1W2BS 4HT8A 4C8QA 2X4WA 3ZBDA 3LW5E 3CCST 4OB1B 3I55T 4PJOE 2DIQA 2HNIA 4II1A 3NTHA 5HK0A 3MP1A 3OW2S 1O9SA 1QW1A 2LRQA 2O4XA 1YIJT 3KBGA 4QVCA 3O8VA 2EJ9A 3CCSA 4C0DC 1VIFA 4C8QB 3I55A 4LDXA 2ZPGB 4MDWA 2RK2A 3CCQT 3N5BB 5D6XA 4QVDA 1YIJA 2VV5A 4IUTA 3CD6T 3HRUA 2ZCFB 2GFUA 2BIVA 3DKMA 3GNFB 3CCQA 4M7DE 3M4YA 2CZ1B 3ER0A 5LJ3d 3UT1A 4ZN3A 3CD6A 2RHXA 4ZTJA 3GP8A 2KMTA 2ZPIB 5GAN5 2V8KA 4OB2B 5HKCA 4KBMB 2RJDA 4C92C 4OB0B 4KUDK 1N27A 3RMSA 2CZ7B 3CBMA 3OQ5A 4BI8B 5A0GA 5GAOm 3DLMA 1BI3A 4BY6C 2LTOA 1NZ9A 2K5IA 3HL8A 3OMGA 4QVZA 3J81E 4MZPA 4C8QE 2EQMA 3VJPA 3LGLA 4MMKA 1X01A 4HCZA 3MP8A 4C0ZA 5FRMA 2RJCA 4LDYA 2Y4YA 2JUFA 1VQMT 2L3RA 4ZN1A 2BUDA 2L5QA 3A8GB 2KSSA 4A54A 1QVGA 4XQ3A 4J6WA 1VQMA 3EFRA 4NOYA 3L1AA 2JN0A 3PNWC 3JCMg 2RI5A 4QW2A 4GY5A 5J39A 3CXCA 4PJOD 2ZPEB 4E7JA 3JB9D 2G3RA 4XAXB 1KHIA 3OS2A 3OYLA 2DXTA 3C12A 4C92G 4R56A 1JRIA 5GAOq 4BDYA 5FLXE 2IG0A 3E19A 2LCCA 2XICA 1S72T 4LDVA 2XD0A 1WGSA 2GCXA 2DZCA 1WNLA 4JRKA 2D6FA 1S72A 3S3NA 2V8JA 3BDUA 5GMKl 1B34B 4M7DC 5HK3A 4EMKA 2HD0A 1I5LA 3X26B 4OF1A 4M78F 2RD1A 3OYKA 5FU6C 3INZA 1WPYA 2ZPHB 4C0GA 3PIOA 1FWZA 3MCAB 1NJIU 2P0PA 2E12A 5GANg 4EMKB 3NTIA 4UC4A 1NPRA 3EFSA 4M78A 5GAN2 4NS5A 1VQLT 1IREB 3PFSA 2WSFE 2XK0A 4XU0A 1KQSS 5CKFA 3M55A 1Y71A 1VQ7T 1VQLA 4N4GA 4M78B 1MHNA 4C8QC 1VQ7A 2DD5A 2H3JA 1H3ZA 2ZPBB 2JNGA 3BW1A 3DB4A 5J26A 1FX7A 3VYHB 3CCRT 1P92A 4OVAA 3OYNA 3MO8A 5GAOl 1YJNT 3CCRA 4BE0A 5L8RE 1N6AA 1G3TA 2MAMA 3CPFA 5J3BA 4M7DG 1H641 4JUVA 3UWNA 3L2QA 2VUBA 2DK3A 2E10A 4XU3A 3VU3C 1YJNA 2RHYA 2A7YA 4E47A 5FRNA 3FJPA 1UGPB 2XI9A 4QQDA 2VC8A 1XTDA 5LJ3g 1N9RA 3MHXA 5EG2A 4Y91A 2DPPB 4Z02A 1MGQA 3V7SA 1QVFS 3G4ST 4M78E 4XTXA 3JB9F 2KQWA 1SSFA 3Q1JA 1QP3A 3UPUA 3HRTA 3G4SA 3URGA 4PJOA 3X25B 4JLIA 3V8KA 4M7AD 3QHSA 3VUZA 1WJSA 1UB4A 2RI2A 4JDSA 4IUUA 5C0MA 2F5KA 4FL6A 1NE8A 2A3LA 1HK9A 3CCLT 3KUFA 4MZTA 5FU7C 4X9DA 3HFOA 5KE3A 4M77F 1VIEA 2OTJA 3CCLA 3TU4K 1VQPT 3BDLA 3OYHA 2QQSA 5CQXA 2LX9A 5FROA 5KH6A 4L6V5 3P8DA 3V8LA 2DTIA 2X4XA 1VQPA 3FDRA 4ELZC 2LT4A 3OBWA 2QA4T 3M54A 2XG8D 3JCMX 1K73U 4IURA 5GANf 1K8AC 3MEUA 3OA6A 2QA4A 3QG1A 4M77B 2E41A 4O5VA 3ZFJA 4A4KA 4C5HA 5GAMd 1OZ3A 4LDUA 4QQGA 3G71T 1KQ2A 4IUVA 3KXTA 4XTUA 1UGRB 4OGCA 1V29B 3G71A 2WACA 2I2LA 4M78D 5CKBA 3V7CA 3QIIA 1FXXA 5GAN8 1UGQB 3GNGA 3SFMA 4E7HA 1KC8C 2M0OA 1YHQT 4XTZA 1QVGS 3M56A 3R6OA 4M78C 1BI2A 3P8HA 4EMHA 1YHQA 1M90C 3PT9A 2R5MA 2R5AA 3G7ZA 4RCCA 5GAN4 3G6ET 5GAN6 3CXCS 2JTFA 4D6WA 4VUBA 2Y4XA 1QP2A 4EPCA 3G6EA 4FT2A 1D3BB 4BE2A 4F7UF 3QYHB 2DIGA 3ME9A 4JRIA 2YRVA 4N4HA 1N8RC 2MWOA 3HHTB 3LH0A 4GLKA 4M75F 4M7AF 3CCVT 3OMCA 4J5YA 1K8AU 2EWNA 3TREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ9 B;  3X26 B;  2PUO B;  2PVO B;  2PUK B;  2ZPH B;  1PSE A;  4XK8 E;  2PVG B;  2WSE E;  1IRE B;  2WSF E;  4RKU E;  2CYZ B;  3WVD B;  3QXE B;  2DD5 A;  4KT0 E;  2ZPB B;  3VYH B;  4ZGD B;  2DXC A;  1AHJ B;  3VYG A;  2D0Q B;  5L8R E;  3A8O B;  2ZZD A;  4ZGE B;  4FM4 B;  1UGP B;  2CZ6 B;  2O01 E;  2DPP B;  2DXB A;  2AHJ B;  1QP3 A;  3LW5 E;  1GXI E;  3X25 B;  4OB1 B;  2PU9 B;  2ZPG B;  3A8M B;  1PSF A;  2PVD B;  2ZCF B;  2WSC E;  4ZGJ B;  3WVE B;  2CZ1 B;  1JB0 E;  2ZPI B;  4L6V 5;  1UGS B;  4OB2 B;  2ZPF B;  4OB0 B;  3X20 B;  2CZ7 B;  3X28 B;  3A8H B;  4Y28 E;  4OB3 B;  1UGR B;  1V29 B;  2QDY B;  3A8G B;  1UGQ B;  1DJ7 B;  3A8L B;  2ZPE B;  3X24 B;  1QP2 A;  3QZ5 B;  3QYG B;  2CZ0 B;  3QYH B;  2DD4 A;  3HHT B; 
#chains in the Genus database with same CATH topology
 4QKU A;  4FW2 A;  3TEE A;  2EQU A;  4HCB A;  3OS1 A;  2MF2 A;  3JB9 J;  2HAX A;  1OU8 A;  4BE1 A;  2NWM A;  3I35 A;  3S6W A;  1X6B A;  3QBY A;  1KC8 U;  2NUT B;  2EKO A;  4PJO C;  1M90 U;  2RHZ A;  4LE9 A;  1S1N A;  2V8I A;  2MOX A;  2JVV A;  5HY6 A;  4P5N A;  1M9S A;  2P4R A;  4J9I A;  4M75 E;  2ROL A;  2ZGW A;  3CME Q;  4DBF A;  4A63 B;  3EFO A;  1Y7X A;  2QAS A;  1WQ7 A;  2RNA A;  4JJN K;  2LMJ A;  1G8X A;  2EQI A;  4KUI A;  4PJO G;  3QJY A;  1N8R R;  1PWT A;  2PZ1 A;  1M3A A;  1WYX A;  4RG8 A;  5GAM g;  5M9O A;  2PU9 B;  5GAO p;  1KD1 C;  2M16 A;  3EG0 A;  2WSC E;  4J9H A;  4NL2 A;  2CSI A;  2JZ2 A;  1YJ9 T;  2KRM A;  2FB7 A;  1VQ6 Q;  2BKD N;  3J80 E;  1YJ9 A;  2L8D A;  4E6R A;  1M4Z A;  2EIF A;  1LNX A;  3X28 B;  4C8Q G;  1U3O A;  3CCM Q;  3OYG A;  3M59 A;  1M1F A;  1UHC A;  4BY6 B;  5LJ3 h;  2JXB A;  4E7S A;  4OMM A;  1ZQ1 A;  5I2S A;  3TQ7 P;  1VQ8 T;  1ABO A;  3JB9 H;  1RI0 A;  4LDW A;  3CC7 T;  1VQ8 A;  3E9G A;  1YCY A;  4AT1 B;  3CC7 A;  3RES A;  4OP0 A;  3A98 A;  3QZ5 B;  4FCY A;  4BAC A;  4RTT A;  5AYF A;  3CC4 T;  2VWF A;  2COY A;  4BUG A;  3CC4 A;  3SB2 A;  1VYU A;  2WSE E;  2RO0 A;  1IB8 A;  2DKG A;  1Q81 U;  5GMK m;  3FLG A;  1Q86 C;  5LJ5 j;  3NGP A;  3HFN A;  5CAI A;  4RTV A;  1ZA1 B;  3EHQ A;  2R57 A;  1X69 A;  2KE9 A;  3OS0 A;  2DMO A;  1QQJ A;  1TUC A;  2V1R A;  4XU1 A;  5LJ3 f;  1NLP C;  4FSS A;  3H41 A;  2DFU A;  2D0Q B;  2OAU A;  2J05 A;  2O9V A;  4JPB W;  4K11 A;  2LCL A;  4F7U A;  4ZGE B;  1W70 A;  5FW9 A;  4C92 D;  1IZ6 A;  3F70 A;  1OX8 A;  2QDL A;  4J8O A;  1YIT Q;  2LX7 A;  3KFV A;  4OML A;  1HYO A;  1I4K 1;  1SG5 A;  1SHG A;  3D7S B;  4C0F A;  1NJI C;  2PQW A;  1KQS P;  3JCM h;  4HVV A;  2KT8 A;  4X9C A;  5A0D A;  5A2Q E;  3A8M B;  2K2V A;  5GAO n;  2K57 A;  3V7R A;  3WVE B;  4DOV A;  1N8R U;  1A0N B;  2W10 A;  1AWX A;  5CCA A;  1LPL A;  2OTL Q;  4E7K A;  3IQL A;  2RF0 A;  4JJB A;  1NG2 A;  4M7D D;  5C6S A;  2RB6 A;  4HT9 A;  2DAQ A;  1UEB A;  2FPE A;  2BZ8 A;  3DB3 A;  3GLX A;  3EG2 A;  3HKS A;  1TTH B;  1VQ5 Q;  2F2W A;  3NTK A;  3L2U A;  1OZ2 A;  4FIB A;  4ZNX A;  1EIF A;  5IXF A;  2KK4 A;  2FVU A;  4E7I A;  1ZBX A;  3X24 B;  1CKB A;  2E64 A;  4C92 A;  1NEB A;  1NJI R;  3LLR A;  1N9S A;  4XTW A;  2K3Y A;  1PD1 A;  1D09 B;  4A4H A;  3JCM d;  3EG9 B;  5LJ3 e;  2KRO A;  4OMF B;  2A08 A;  3V8J A;  5KYW A;  2YUP A;  2GGR A;  1OU9 A;  4BDZ A;  2DL3 A;  3EG1 A;  1KD1 U;  2CYZ B;  1QVG P;  1QLY A;  3PMI A;  1NPP A;  3CC2 A;  2BTT A;  3WVD B;  1IXD A;  4HXJ A;  2YSQ A;  3UDC A;  2K2M A;  1WIE A;  5GAO r;  2DYI A;  2LQN A;  2FL7 A;  3ZEH A;  2ZAE A;  4PJO B;  2JM9 A;  2CRE A;  2LJ0 A;  4CRI A;  4F7U G;  1NM7 A;  3RMQ A;  4M7D A;  5KYN A;  2ZZD A;  2D8H A;  1RI9 A;  2VGM A;  2K5L A;  5GMK e;  2CP6 A;  1UUE A;  1MND A;  4F04 B;  2EJF A;  2X4W A;  3LW5 E;  3CCS T;  4OB1 B;  3M0T A;  4II1 A;  5HK0 A;  1O9S A;  1TOV A;  3CCS A;  4C8Q B;  2ZPG B;  4MDW A;  3CCQ T;  3GBQ A;  4IUT A;  1IHV A;  3CCQ A;  3M4Y A;  1LCK A;  1VYT A;  2V8K A;  4KBM B;  4C92 C;  2MCN A;  1YN8 A;  3OQ5 A;  5GAO m;  2F1L A;  3DLM A;  1BCM A;  3VJP A;  2JJ9 A;  3MP8 A;  2I0N A;  4LDY A;  2A28 A;  3E2U A;  3A8G B;  4A54 A;  3PVL A;  4GBQ A;  3EGX B;  1WXB A;  1LVK A;  3PNW C;  3JCM g;  1MMA A;  2RI5 A;  3CXC A;  3JB9 D;  2O88 A;  1KHI A;  3OS2 A;  3OYL A;  2CUB A;  3SHW A;  4C92 G;  1QKW A;  1PRM C;  3MJX A;  5FLX E;  1S72 T;  1K0S A;  4R0K A;  2DL7 A;  4JJD A;  1S72 A;  2IPO B;  5GMK l;  4M7D C;  2EPD A;  2LZ6 B;  1WZO A;  4M78 F;  4OF1 A;  1NJI U;  3PIO A;  3NTI A;  2CT4 A;  4M78 A;  2YDL A;  1AWJ A;  3VS4 A;  2HDA A;  2WSF E;  2OJ2 A;  2XK0 A;  5CKF A;  1Y71 A;  4PJJ A;  2VAS A;  2H3J A;  2JNG A;  2X3X D;  1P92 A;  4OVA A;  2SRC A;  3CCR Q;  4BE0 A;  5L8R E;  1G3T A;  1N6A A;  1R77 A;  3CPF A;  4M7D G;  1BU1 A;  1MUZ A;  4JUV A;  2VUB A;  1VQK Q;  2A7Y A;  2QG9 B;  2VC8 A;  3UA7 A;  5EG2 A;  3JB9 F;  2H8H A;  1VOM A;  2KQW A;  3UPU A;  3URG A;  3EH1 A;  1QCN A;  1UB4 A;  1GBR A;  2F5K A;  4FL6 A;  1NE8 A;  3CCL T;  3KUF A;  4J9F A;  1ZA2 B;  1K9M R;  4M77 F;  2OTJ A;  3CCL A;  3TU4 K;  5CQX A;  1VQP Q;  1UDL A;  3P8D A;  1RAA B;  2X4X A;  4D8D A;  2F2V A;  5GAN f;  1K8A C;  3MEU A;  3OA6 A;  1D0Y A;  1TS9 A;  1PM3 A;  3ZFJ A;  1OZ3 A;  3KXT A;  4Z89 A;  2PNI A;  5CKB A;  3RR6 A;  1IHW A;  3QII A;  5GAN 8;  2P84 A;  1UGQ B;  1KC8 C;  1OV3 A;  2RQV A;  4XTZ A;  3M56 A;  4M78 C;  3P8H A;  1M90 C;  2EGC A;  3G6E T;  4RCC A;  3CXC S;  1KSW A;  2CP5 A;  2KEA A;  2K9G A;  2QK0 A;  3G6E A;  1ZBJ A;  2MK5 A;  4M75 F;  1YP5 A;  3TRE A;  2AKK A;  4DOW A;  2KGT A;  2PUK B;  4M75 A;  1I81 A;  2GTJ A;  2FPF A;  1IGQ A;  4F7U B;  3REA B;  4J7F A;  4M7A B;  3BFM A;  5CQY A;  1GCQ A;  3TVT A;  2L3P A;  5LJ5 g;  1O75 A;  1Y96 B;  4KRT A;  3FJ5 A;  4J6X A;  2D8J A;  2C06 A;  3CEY A;  1QWE A;  2D0N A;  2KT1 A;  1VQN T;  4JRQ A;  4RUG A;  2DRK A;  3DLL A;  1VQN A;  3L2Z A;  4JRP A;  4HA8 A;  2R58 A;  3I9Q A;  5EC7 A;  5LJ3 j;  1AVZ C;  1OOT A;  1M1G A;  5D6Y A;  1M2V A;  4DEY A;  3QO3 A;  3C0C A;  2HKN A;  4OMN A;  4Z8A A;  1UE9 A;  5GAN e;  5CKH A;  2J06 A;  1SF9 A;  3HPW A;  2GFA A;  1JB0 E;  2LQ8 A;  5IN1 A;  1WHL A;  2CKK A;  5DLO A;  1M1K R;  5GJV B;  2ED0 A;  2CGH A;  3MEW A;  5IHI A;  2DVJ A;  1M30 A;  1K9M U;  4C92 B;  1SHF A;  5CR2 A;  1T3L A;  2FHD A;  1M5Q 1;  1Q81 C;  2RM4 A;  3L2R A;  2KI7 A;  1ABQ A;  3CCE Q;  3RKX A;  3OW2 P;  3I5R A;  3A8L B;  3OYM A;  2DO3 A;  3LWH A;  1YWP A;  1KJW A;  2JW4 A;  4CI0 C;  2P0Q A;  1GCQ C;  5KYW B;  1X75 C;  2L89 A;  5IAY A;  1T0H A;  3OYA A;  2Y90 A;  2CZ0 B;  1VA7 A;  3CCJ T;  1JJ2 A;  2OX7 A;  1WLP B;  2FRW A;  5IHN A;  4EIK A;  3CCJ A;  4PFZ A;  2X3W D;  2VYT A;  3QJ6 A;  3MPU B;  3BE3 A;  2D1X A;  1Q7Y R;  5A0L A;  1M2O A;  4M7D B;  3M9Q A;  2DZ9 A;  4BD3 A;  3OYY A;  2KDS A;  4XTY A;  2KRN A;  2XID A;  1D3B A;  5L23 A;  2EFI A;  3PIP A;  1WJR A;  3I5S A;  4M77 E;  4HKE A;  2XDB A;  9ATC B;  1AT1 B;  2KXD A;  3EAE A;  4L59 A;  3CCU T;  4Z88 A;  3VYG A;  1JU5 C;  2EYX A;  2VXF A;  3RNJ A;  3CCU A;  5GMK i;  2DYB A;  4A53 A;  1YI2 Q;  3ULR B;  1VQ4 T;  4A4F A;  5KCO A;  1VQ4 A;  1W2B A;  3CPW P;  4FSX A;  3CMA T;  1ARK A;  1E6G A;  3CMA A;  4HCC A;  3M0P A;  3SWN A;  4FU6 A;  4ZTF A;  4EDU A;  3OS5 A;  2K6D A;  2RA2 A;  2CP0 A;  3LH5 A;  2LDM A;  1K4U S;  2QTX A;  2LJ3 A;  1C0M A;  3OB9 A;  3HRS A;  1RLQ C;  4BB7 A;  2DRM A;  2ZPF B;  1VQO T;  1U1S A;  1QVF P;  2J6K A;  2IIM A;  1MV3 A;  2F69 A;  4IUQ A;  1VQO A;  2X4Y A;  3HSB A;  1Y57 A;  1M1K U;  3VS5 A;  3QPH A;  1MMG A;  4KH0 B;  3T9N A;  2KBT A;  1AEY A;  2F2X A;  4NL3 A;  5IHK A;  2LQW A;  1OI1 A;  2MI6 A;  3JRZ A;  5GAM e;  2KRS A;  4TVR A;  1PD0 A;  4DBH A;  2DD4 A;  5ECA A;  2DBK A;  1JJ2 S;  1VQK T;  2KAF A;  1VQK A;  2DF6 A;  3QWX X;  1TWB A;  3RIR A;  2L0A A;  5GAN 3;  3LYI A;  1XQH A;  3MKD A;  3I56 T;  1WHG A;  4O6J A;  1TSF A;  2QXF A;  3JV3 A;  2DJQ A;  4AG2 C;  3I56 A;  3SDZ A;  1AOJ A;  4KT0 E;  1Q7Y U;  1SKU B;  2XU8 A;  3SWN C;  2RJE A;  1X27 A;  4FT4 A;  3FRN A;  2O9S A;  4J9B A;  3VRZ A;  2QEX Q;  3QDR B;  2CP3 A;  3O5Z A;  5GMK h;  2YRD A;  2ABL A;  1AZG B;  3JB9 I;  3OYJ A;  1R0C B;  3MEA A;  2VXE A;  3NFC A;  1W2B S;  2K7A A;  2W0Z A;  3I55 T;  4PJO E;  3NTH A;  2O4X A;  2LRQ A;  1YIJ T;  3KBG A;  2LNH B;  4C0D C;  1WHK A;  3I55 A;  3M0Q A;  3N5B B;  1YIJ A;  2ZCF B;  3CD6 Q;  3GNF B;  2CZ1 B;  5LJ3 d;  2AK5 A;  3NPF A;  1T0J A;  4OB0 B;  1N27 A;  3RMS A;  3CBM A;  4BI8 B;  1BI3 A;  1RAF B;  2M0Y A;  2L2P A;  1NZ9 A;  3HL8 A;  1BBZ A;  1MV0 B;  2V26 A;  4MZP A;  4C8Q E;  1JQQ A;  4HCZ A;  2RJC A;  2Y4Y A;  2JUF A;  2L3R A;  4ZN1 A;  1VQM Q;  4XQ3 A;  4J6W A;  2CH4 W;  4GY5 A;  5J39 A;  4E7J A;  4XAX B;  3C12 A;  4R56 A;  1JRI A;  5GAO q;  4BDY A;  2IG0 A;  3E19 A;  2XIC A;  1UFF A;  4LDV A;  2XD0 A;  1WGS A;  2DZC A;  3S3N A;  1U06 A;  2SEM A;  1T3S A;  5HK3 A;  4EMK A;  1I5L A;  1GL5 A;  5FU6 C;  3INZ A;  4C0G A;  1FWZ A;  2HSP A;  2E12 A;  1NPR A;  3VS7 A;  5GAN 2;  4NS5 A;  2JMA A;  4FW1 A;  4HVU A;  1BK2 A;  4Y92 A;  3M55 A;  6AT1 B;  1VQ7 Q;  3NMZ C;  3BW1 A;  1FX7 A;  1M2V B;  2X51 A;  3OYN A;  4HCK A;  2MAM A;  1YJN Q;  1TUG B;  1D0X A;  2PTK A;  2RHY A;  2YUN A;  5FRN A;  3VRY A;  2CT3 A;  4QQD A;  1YJW Q;  5LJ3 g;  1N9R A;  3MHX A;  4Z02 A;  1MGQ A;  3V7S A;  2E3H A;  2QGG A;  3G4S Q;  1SSF A;  2RQW A;  1IO6 A;  4WTO B;  3X25 B;  4JLI A;  3V8K A;  1FMK A;  1WI7 A;  1QWF A;  2RI2 A;  4IUU A;  5C0M A;  5KYY A;  2A3L A;  5AT1 B;  1PNJ A;  2DLP A;  2DNU A;  4MZT A;  5FU7 C;  1I0C A;  1ZLM A;  2QQS A;  2LX9 A;  4KGV B;  5FRO A;  5KH6 A;  1MMD A;  2DA9 A;  2QA4 T;  3TSZ A;  1WX6 A;  1HJD A;  2QA4 A;  1RAC B;  1YNZ A;  4C5H A;  4LDU A;  3G71 T;  1KQ2 A;  2AKL A;  1UGR B;  4OGC A;  1V29 B;  3G71 A;  4M78 D;  3V7C A;  1CSK A;  4E7H A;  1YHQ T;  5D7U A;  1SSH A;  1YHQ A;  1Q82 R;  3PT9 A;  2R5M A;  2R5A A;  2KYM A;  3G7Z A;  5GAN 4;  2AZS A;  1K0X A;  2Y4X A;  4ORZ A;  1D3B B;  2JTE A;  2EBP A;  2MWO A;  3LH0 A;  4GLK A;  3CCV T;  1D1B A;  5CO7 A;  3CCV A;  2EYZ A;  4RCB A;  3RUX A;  2GF7 A;  4AFS C;  4PFO A;  3QSU A;  2JT4 A;  1AD5 A;  3FEO A;  1K76 A;  2FPD A;  2GNC A;  3A5Z B;  3L42 A;  2KR3 A;  2KNB B;  3M58 A;  2O2O A;  4MML A;  3MP6 A;  3THK A;  4DQ2 A;  2DXC A;  4KGZ B;  1AHJ B;  2RK1 A;  1LOJ A;  1W6X A;  1BKB A;  5DM7 R;  1PC0 A;  4PJN A;  4M77 D;  1LJO A;  3JAM E;  3CME T;  1K9M C;  4BI3 A;  4M7A E;  2CZ6 B;  3CME A;  2MWP A;  1G3S A;  5CVI A;  1JXM A;  1V76 A;  3JSC A;  3EFO B;  1KK7 A;  4N0A A;  4IUP A;  5GAN h;  1H92 A;  2X9H A;  4PKC C;  1RAE B;  2QQ9 A;  2PVD B;  1WQW A;  4C0D B;  2LQK A;  1VQ6 T;  1YJ9 Q;  1UGS B;  1WA7 A;  1VQ6 A;  4JZ4 A;  2CS7 A;  3CCM T;  4QQ6 A;  4M75 D;  2EQK A;  4OB3 B;  3CCM A;  5LJ5 f;  1NEG A;  4ATO A;  1D0Z A;  2P4T A;  1VQ8 Q;  4YTL A;  2NLU A;  2YT6 A;  3CC7 Q;  1K9A A;  4J6Y A;  4AFZ C;  4M77 A;  2JS2 A;  4C92 E;  4KUL A;  5IXB A;  2HEQ A;  1UJY A;  2JM8 A;  1OX9 A;  1AWW A;  3L2W A;  4RMO A;  2QEX T;  3CC4 Q;  2DEU A;  4OMQ A;  3ZL7 C;  3PVQ A;  5GAN d;  2QEX A;  1UG1 A;  3OYF A;  2CSQ A;  2MMP A;  2RMO A;  5CIU A;  1TXQ A;  3M4G A;  2RI3 A;  2E5K A;  1G5V A;  2HQE A;  1VUB A;  5FU6 B;  2ECZ A;  2YLC A;  4XTV A;  4WF2 A;  1Y07 A;  4PK4 A;  2K3X A;  4FYW B;  3EHR A;  5FWB A;  4N0A C;  4J9G A;  1B07 A;  4MZM A;  2EYQ A;  4XU2 A;  3M0R A;  1K73 R;  1JXO A;  2J6F A;  3OSS C;  2VGN A;  3S3M A;  2LVM A;  2O4X B;  2HQX A;  1WFW A;  3FB9 A;  2DJZ A;  1YIT T;  2LNV A;  1OPK A;  2Z0W A;  4M78 G;  1YIT A;  2DBM A;  2K5F A;  1M3B A;  2G6F X;  1M1K C;  2E65 A;  3CBO A;  1B7T A;  2K3B A;  2B86 A;  1XOV A;  2E6N A;  1SRM A;  2C0T A;  1PRL C;  1WHJ A;  3RKY A;  4AMC A;  4ZGJ B;  1W1F A;  1RAI B;  3J7A F;  5LJ5 e;  3H6Z A;  4LUE A;  2NYS A;  2OTL T;  5FU7 B;  2BZY A;  4M77 C;  3VKI A;  1U1T A;  2OTL A;  3JCM P;  4B9W A;  5I21 A;  2K4Y A;  3HP9 A;  1D1C A;  3JCM J;  4X34 A;  1N5Z A;  3RBB B;  2A0F B;  2HSE B;  3JB9 G;  2DL4 A;  3TSW A;  2CDT A;  2NUP A;  1D1A A;  1QMC A;  2QDY B;  4N4I A;  1G2B A;  1VQ5 T;  1PKS A;  1RAH B;  1ZHI A;  5CKE A;  3CPW S;  1AZE A;  2RHI A;  3A1P A;  3PE0 A;  4B9X A;  4C8Q D;  1VQ5 A;  4J83 A;  1Q7Y C;  1RAD B;  1W4S A;  2HBP A;  4JS4 A;  5GAM h;  1RL2 A;  3MEV A;  1R0B G;  4M77 G;  5GMK j;  4A4G A;  4WCI A;  4OMP A;  3WXM B;  2E5Q A;  2XHC A;  2QI2 A;  3M5A A;  2QQR A;  2AT1 B;  1X43 A;  4PL6 A;  2LCS A;  2PUO B;  1OYX A;  1MNE A;  2LC4 A;  4M75 C;  4BI4 A;  2RJF A;  2B8A A;  1YJW T;  3MET A;  2ENM A;  3M53 A;  1FYN A;  1KQS A;  4ELY C;  4PJO F;  1YJW A;  1YFN A;  1SEM A;  3CC2 Q;  2M51 A;  4MDX A;  3QXE B;  1R8O B;  3SD4 A;  1U8R A;  3CXC P;  3JCM W;  2HZY A;  3NHN A;  2O31 A;  5I2M A;  3AHU A;  2ROT A;  1GRI A;  4CC4 B;  3JCM Q;  4CC2 A;  4RTY A;  4M75 G;  1YBY A;  1WXU A;  5KCH A;  1BIA A;  5GAM f;  1FMV A;  1Z9Z A;  4J7I A;  4C8Q F;  1ZSG A;  4HVW A;  1J3T A;  4LD6 A;  1UJ0 A;  3RER A;  4AFQ C;  2RHU A;  1ZX6 A;  4C8Q A;  3ZBD A;  1AWO A;  1KFZ A;  3U23 A;  2DIQ A;  2HNI A;  4KGX B;  3MP1 A;  3CCS Q;  1QW1 A;  4F16 A;  1RAB B;  3UAT A;  4LDX A;  1GFD A;  3HRU A;  2BE9 B;  3CCQ Q;  3ER0 A;  3UT1 A;  4ZN3 A;  2RHX A;  4F17 A;  4OB2 B;  2OI3 A;  3VS3 A;  1CKA A;  5HKC A;  4KUD K;  2CZ7 B;  2LTO A;  4QVZ A;  2K5I A;  2M02 A;  8AT1 B;  3LGL A;  1X01 A;  2HKQ B;  3M0S A;  2L5Q A;  2KSS A;  1QVG A;  1YWO A;  2L3Q A;  2VVK A;  1F1B B;  2ZPE B;  4X1V A;  1JEG A;  1QCF A;  2YWW A;  2DXT A;  3EGD A;  3SEM A;  2NUZ A;  2AIR B;  1S72 Q;  2GCX A;  1WNL A;  2D6F A;  2J6O A;  2V8J A;  1WPY A;  1PG5 B;  1GBQ A;  4UC4 A;  1PCX A;  1IRE B;  2HL5 C;  4XU0 A;  1KQS S;  1ZUK A;  2DER A;  5KYX A;  2KXC A;  4M78 B;  1MHN A;  4C8Q C;  1WDX A;  4AG1 C;  2DD5 A;  1H3Z A;  5J26 A;  3VYH B;  3CCR T;  2HCK A;  3MO8 A;  3CCR A;  1H64 1;  3L2Q A;  2DM1 A;  2DK3 A;  2E10 A;  2E3I A;  4E47 A;  1X2K A;  1ZUY A;  2FZK B;  2FZG B;  3Q1J A;  3HRT A;  4M7A D;  3QHS A;  2MIO A;  1WJS A;  3R6N A;  4CC7 A;  1ZUU A;  1GFC A;  4X9D A;  5FWC A;  2OTJ Q;  3CCL Q;  1VIE A;  2AZV A;  1VQP T;  3BDL A;  3OYH A;  3VS1 A;  1FMW A;  2V1Q A;  4L6V 5;  3V8L A;  4GLM A;  1VQP A;  1VQ9 Q;  3FDR A;  4ELZ C;  3OBW A;  3M54 A;  1M27 C;  3JCM X;  3UF4 A;  2JMC A;  4M77 B;  2E41 A;  4O5V A;  5KYU A;  3G1J A;  2ED1 A;  3RDV A;  4IUV A;  1KD1 R;  1UGV A;  1FXX A;  5I11 A;  3GNG A;  4J9C A;  3SFM A;  2M0O A;  2C0O A;  1QVG S;  4DEX A;  2YXY A;  4D8K A;  4DBQ A;  3G6E Q;  4VUB A;  2COZ A;  1QP2 A;  2GQI A;  4EPC A;  4F7U F;  4N4H A;  2YRV A;  1C1A A;  1SRL A;  2COW A;  2HBW A;  4M7A F;  2DX1 A;  4J5Y A;  2EWN A;  4D6W A;  1Q95 G;  3QZ9 B;  3PGG A;  2PVO B;  4PJM A;  4RTX A;  5GAN j;  4M7A A;  3L2V A;  4LUD A;  4XK8 E;  3CQT A;  2QQA A;  3VV0 A;  2RPN A;  1Y96 A;  4M75 B;  3RKW A;  2FEI A;  4JS5 A;  1B34 A;  1SPK A;  3JCM b;  2M9U A;  1VQN Q;  4DA4 A;  5CKD A;  2LP5 A;  2BZX A;  2E1H A;  2RQU A;  1JJ2 P;  4E7Z A;  3TCJ A;  3FIF A;  1Q86 R;  1OPL A;  4AFU C;  2DEQ A;  3EG3 A;  2RH2 A;  1VQL Q;  2AHJ B;  1JO8 A;  1E6H A;  4LD9 K;  5KE2 A;  5IT9 E;  2C0I A;  3QKJ A;  1PSF A;  1PHT A;  2EQJ A;  5IH2 A;  1RAG B;  3S3O A;  2NUP B;  2QGF B;  4C92 F;  1OUL A;  2QTV A;  3UA6 A;  2DTO A;  4LN2 A;  1Q82 C;  3H0I A;  1BI0 A;  1NLO C;  1NYF A;  4R55 A;  3A8H B;  2MPX C;  3JCM f;  5GAN 7;  4A4E A;  2KYB A;  4Y28 E;  3GPL A;  3CCE T;  3OY9 A;  1W2B P;  1I1J A;  4PNO A;  4ME7 A;  2FRY A;  2P0K A;  3CCE A;  1H8K A;  3GIB A;  4PLI A;  1DJ7 B;  4OGE A;  4M7A C;  1TH7 A;  1KG1 A;  1KHC A;  2K79 A;  2JOY A;  4C5E A;  3OBY A;  3QUI A;  3CC2 T;  3H8Z A;  2HL3 A;  3OYI A;  5HCK A;  3FC3 A;  3QYG B;  4M7D F;  4B6M A;  1BYM A;  3CCJ Q;  2GQV A;  2LJ1 A;  4IKF A;  1ZSZ A;  2VB6 A;  3LWI A;  4EMK C;  3E1S A;  1YCS B;  5LL6 S;  3VS0 A;  1PSE A;  4C5G A;  4M7A G;  3GF5 A;  3VS6 A;  3PTA A;  2LT1 A;  3CBP A;  4JLG A;  4E7L A;  4JJC A;  2QAZ A;  2EKH A;  3LGF A;  2OAW A;  4FYV B;  5D6W A;  3VUB A;  2D9T A;  4ZGD B;  3CCU Q;  1TU0 B;  2XDD A;  1WJQ A;  1G3W A;  1UTI A;  1X2Q A;  2KVQ G;  3A8O B;  2XDP A;  2YLB A;  1YI2 T;  4V2S A;  1I8F A;  4RTW A;  2FYK A;  1YI2 A;  1VQ4 Q;  2NUT A;  2O01 E;  1MMN A;  3H0F A;  5CK9 A;  1G3Y A;  1XNI A;  2DL5 A;  3OW2 A;  3CMA Q;  2EYW A;  4FYY B;  2M1H A;  1VYV A;  1GXI E;  2HMA A;  4LXC A;  1Y0M A;  5GAM j;  1HD3 A;  3LX7 A;  2DET A;  1Q86 U;  5DY9 A;  3JCM e;  1K1Z A;  3SWN B;  5LJ5 h;  4F7U E;  3EH2 A;  1EFN A;  1HSQ A;  5I22 A;  3OYC A;  1QVP A;  2DTH A;  1NBE B;  1I5O B;  3C95 A;  1X6O A;  3X20 B;  2EAY A;  1UEC A;  1RUW A;  2ESW A;  3EGD B;  2YUO A;  1VQO Q;  1ZSZ C;  1JBM A;  3BY7 A;  4RG2 A;  3HTR A;  3OYB A;  3ASK A;  3OSV A;  1I07 A;  2J7I A;  3PMT A;  1M8V A;  1EX4 A;  2EW3 A;  3AT1 B;  2F5T X;  2KY9 A;  4C5I A;  2DIL A;  2DXU A;  2FO0 A;  3E9F A;  2XMF A;  1BIB A;  5KYX B;  3C94 A;  1U5S A;  2CUD A;  3P8B B;  3C4S A;  2A36 A;  2E70 A;  1G83 A;  1K73 C;  2XKO C;  3CPW A;  4PLL A;  2X35 A;  3JCM c;  3OYD A;  2PVG B;  1GCP A;  3GOX A;  1QKX A;  1HXD A;  5LJ5 d;  3QDF A;  4RKU E;  2EJG A;  3I56 Q;  1BI1 A;  2DVE A;  1Z9Q A;  2IVW A;  1XJW B;  2X4J A;  4Q5W A;  4EMG A;  4F14 A;  1KQ1 A;  4L5G A;  1Q82 U;  2OTJ T;  1M8M A;  2VKN A;  3JCM V;  4RTU A;  2QQB A;  1QVF A;  1VQ9 T;  4FM4 B;  3OYE A;  1BCO A;  2E6Z A;  2RQT A;  2CP7 A;  2DXB A;  2JTM A;  1VQ9 A;  2YHT A;  1EZZ B;  5DLQ E;  3M57 A;  4HT8 A;  2EYY A;  3OW2 S;  3I55 Q;  4QVC A;  3O8V A;  2EJ9 A;  1VIF A;  3REB B;  5KYU B;  1YIJ Q;  2DL8 A;  2RK2 A;  4QVD A;  3H0H A;  5D6X A;  3CD6 T;  2VV5 A;  1ACM B;  4JZ3 A;  2DE0 X;  2GFU A;  4IIO A;  2BIV A;  3DKM A;  4M7D E;  2H3E B;  3CD6 A;  4ZTJ A;  3GP8 A;  2KMT A;  2ZPI B;  5GAN 5;  4FYX B;  5GJW B;  2HQH A;  2RJD A;  2RQR A;  5A0G A;  1B3Q A;  4BY6 C;  1WXT A;  3OMG A;  3J81 E;  2EQM A;  4MMK A;  4C0Z A;  5FRM A;  1VQM T;  1QCO A;  2BUD A;  4J9D A;  1VQM A;  3EFR A;  4NOY A;  3L1A A;  2JN0 A;  8ATC B;  4QW2 A;  4PJO D;  2G3R A;  3EGU A;  1K8A R;  2JS0 A;  4ANJ A;  2LCC A;  2CH4 A;  2L3S A;  4JRK A;  4IIM A;  1M3C A;  3BDU A;  1OQK A;  1B34 B;  2GBQ A;  1KC8 R;  2HD0 A;  3X26 B;  2RD1 A;  3OYK A;  2ZPH B;  1M90 R;  3MCA B;  2P0P A;  5GAN g;  4EMK B;  1KIK A;  1PKT A;  7AT1 B;  3EFS A;  2YUQ A;  1VQL T;  4PFP A;  3PFS A;  2FG0 A;  2EVR A;  1VQ7 T;  1VQL A;  2E4H A;  1NYG A;  4N4G A;  1VQ7 A;  2ZPB B;  3DB4 A;  1E7O A;  3H9N A;  3EG9 A;  5GAO l;  1YJN T;  5J3B A;  2QYZ A;  3UWN A;  4XU3 A;  1YJN A;  3VU3 C;  4DBR A;  1C6V X;  3M0U A;  3FJP A;  1UGP B;  2XI9 A;  1XTD A;  4Y91 A;  2DPP B;  1QVF S;  4LNP A;  3G4S T;  4M78 E;  4XTX A;  1H3H A;  1QP3 A;  3G4S A;  4OMO A;  1TG0 A;  4PJO A;  2EGE A;  3VUZ A;  2MYS A;  4JDS A;  1WHH A;  2EGA A;  1TUD A;  4QT7 A;  4J9E A;  1HK9 A;  4E2F B;  1WHM A;  3HFO A;  5KE3 A;  5KYY B;  2BE7 D;  4KH1 B;  1BB9 A;  2DTI A;  1K73 U;  2LT4 A;  2XG8 D;  4IUR A;  2QA4 Q;  3QG1 A;  4A4K A;  4CC3 A;  5GAM d;  4QQG A;  4PJL A;  3G71 Q;  1UHF A;  4XTU A;  2CP2 A;  2WAC A;  1V1C A;  2I2L A;  1X6G A;  1ZSZ B;  2ATC B;  3QWY A;  4RTZ A;  1YHQ Q;  3R6O A;  1BI2 A;  1RLP C;  2YRC A;  4EMH A;  1OEB A;  2A37 A;  5GAN 6;  3VS2 A;  2JTF A;  2GTO A;  1IGU A;  2FZC B;  4FT2 A;  4BE2 A;  4M4Z A;  2RN8 A;  3QYH B;  2DIG A;  3ME9 A;  4JRI A;  1Q81 R;  1N8R C;  3HHT B;  3EGX A;  3OMC A;  1K8A U;  1IRX A;  3CCV Q;  4ESR A; 
#chains in the Genus database with same CATH homology
 3QZ9 B;  4DOW A;  3PGG A;  5CO7 A;  3CCV A;  2PVO B;  2PUK B;  3TEE A;  4M75 A;  2EQU A;  4RCB A;  1I81 A;  5GAN j;  3RUX A;  2GF7 A;  4F7U B;  4HCB A;  3L2V A;  3OS1 A;  4XK8 E;  4M7A A;  2MF2 A;  3JB9 J;  2HAX A;  4BE1 A;  4J7F A;  2QQA A;  3S6W A;  3VV0 A;  3QSU A;  1Y96 A;  4M75 B;  3RKW A;  4M7A B;  3BFM A;  3FEO A;  3QBY A;  5CQY A;  4JS5 A;  1KC8 U;  5LJ5 g;  2EKO A;  1O75 A;  3A5Z B;  1Y96 B;  3L42 A;  4PJO C;  3M58 A;  1M90 U;  2RHZ A;  4J6X A;  1B34 A;  4MML A;  3MP6 A;  3CEY A;  2C06 A;  2V8I A;  2DXC A;  4DQ2 A;  1AHJ B;  1VQN T;  4JRQ A;  2RK1 A;  3JCM b;  2M9U A;  1LOJ A;  1BKB A;  5DM7 R;  4DA4 A;  3DLL A;  5CKD A;  1VQN A;  2E1H A;  4M77 D;  2JVV A;  3L2Z A;  5HY6 A;  4JRP A;  4P5N A;  1M9S A;  3TCJ A;  1LJO A;  3JAM E;  4HA8 A;  4M75 E;  3CME T;  1K9M C;  2ZGW A;  4BI3 A;  2R58 A;  5LJ3 j;  4M7A E;  2CZ6 B;  3FIF A;  3CME A;  1M1G A;  2MWP A;  1G3S A;  1Y7X A;  2DEQ A;  5CVI A;  2RH2 A;  1WQ7 A;  5D6Y A;  4JJN K;  2AHJ B;  3QO3 A;  3JSC A;  4KUI A;  4PJO G;  3QJY A;  4LD9 K;  4N0A A;  4IUP A;  5KE2 A;  5GAN h;  4RG8 A;  5GAM g;  5GAN e;  5CKH A;  5M9O A;  5IT9 E;  3QKJ A;  2PU9 B;  5GAO p;  1PSF A;  4PKC C;  2EQJ A;  2QQ9 A;  3S3O A;  2M16 A;  1KD1 C;  2PVD B;  2WSC E;  4NL2 A;  1WQW A;  4C0D B;  3HPW A;  2LQK A;  4C92 F;  2GFA A;  2JZ2 A;  1YJ9 T;  1JB0 E;  1VQ6 T;  2LQ8 A;  2DTO A;  5IN1 A;  2FB7 A;  1UGS B;  2BKD N;  2CKK A;  3J80 E;  1YJ9 A;  1Q82 C;  5DLO A;  1VQ6 A;  2L8D A;  2CS7 A;  1M4Z A;  1BI0 A;  4R55 A;  2CGH A;  2EIF A;  1LNX A;  3X28 B;  3A8H B;  3MEW A;  3JCM f;  3CCM T;  5GAN 7;  4A4E A;  1K9M U;  4C8Q G;  4Y28 E;  4C92 B;  3OYG A;  4QQ6 A;  3M59 A;  1M1F A;  4M75 D;  2EQK A;  4OB3 B;  3GPL A;  3CCM A;  5CR2 A;  2FHD A;  3CCE T;  1M5Q 1;  5LJ3 h;  4BY6 B;  5LJ5 f;  3OY9 A;  2RM4 A;  3L2R A;  1Q81 C;  4PNO A;  4ME7 A;  2P0K A;  3CCE A;  3RKX A;  3GIB A;  4PLI A;  1DJ7 B;  4OGE A;  1ZQ1 A;  5I2S A;  1VQ8 T;  4ATO A;  4M7A C;  1TH7 A;  2P4T A;  3A8L B;  3JB9 H;  1KG1 A;  1KHC A;  4YTL A;  1RI0 A;  2DO3 A;  2NLU A;  3OYM A;  3LWH A;  2JOY A;  4LDW A;  3CC7 T;  1VQ8 A;  4C5E A;  3OBY A;  3QUI A;  3E9G A;  4CI0 C;  3CC2 T;  4J6Y A;  2P0Q A;  1YCY A;  3H8Z A;  3CC7 A;  3OYI A;  4M77 A;  3RES A;  1X75 C;  2L89 A;  4OP0 A;  3FC3 A;  3QZ5 B;  5IAY A;  4C92 E;  4KUL A;  3QYG B;  3OYA A;  4BAC A;  4M7D F;  2Y90 A;  2CZ0 B;  3CCJ T;  3L2W A;  1JJ2 A;  1BYM A;  2GQV A;  5AYF A;  3CC4 T;  4RMO A;  4IKF A;  2QEX T;  3CCJ A;  2VYT A;  4BUG A;  3LWI A;  3CC4 A;  3SB2 A;  3E1S A;  3QJ6 A;  4EMK C;  5GAN d;  2QEX A;  5LL6 S;  3OYF A;  2MMP A;  5CIU A;  1PSE A;  4C5G A;  4M7A G;  3M4G A;  5A0L A;  2RI3 A;  4M7D B;  3GF5 A;  3M9Q A;  2WSE E;  3PTA A;  2DZ9 A;  2RO0 A;  4BD3 A;  2HQE A;  2LT1 A;  2KDS A;  1VUB A;  3CBP A;  2DKG A;  3OYY A;  5FU6 B;  4XTY A;  4JLG A;  1Q81 U;  2XID A;  5GMK m;  1D3B A;  2YLC A;  4E7L A;  3FLG A;  4XTV A;  1Q86 C;  5LJ5 j;  1G5V A;  4WF2 A;  2EFI A;  1Y07 A;  3PIP A;  3HFN A;  3LGF A;  2K3X A;  5CAI A;  1WJR A;  4M77 E;  2R57 A;  4HKE A;  5D6W A;  3VUB A;  4N0A C;  2XDB A;  3OS0 A;  2D9T A;  4ZGD B;  3EAE A;  4L59 A;  4XU1 A;  5LJ3 f;  4MZM A;  3CCU T;  2EYQ A;  3VYG A;  4XU2 A;  2VGN A;  3OSS C;  2XDD A;  1WJQ A;  2D0Q B;  2OAU A;  1G3W A;  2VXF A;  3A8O B;  2KVQ G;  2LCL A;  2XDP A;  2LVM A;  2YLB A;  4F7U A;  2O4X B;  4A53 A;  5GMK i;  3S3M A;  4ZGE B;  1YI2 T;  4V2S A;  1I8F A;  2HQX A;  4C92 D;  2FYK A;  1IZ6 A;  3F70 A;  2DJZ A;  3FB9 A;  4J8O A;  1VQ4 T;  1YI2 A;  1YIT T;  4A4F A;  2LNV A;  5KCO A;  2O01 E;  4M78 G;  1VQ4 A;  1YIT A;  5CK9 A;  1W2B A;  4FSX A;  2K5F A;  1G3Y A;  1I4K 1;  3CMA T;  1XNI A;  4C0F A;  1M1K C;  2E65 A;  3OW2 A;  1NJI C;  2M1H A;  1GXI E;  3CBO A;  2PQW A;  3CMA A;  4HCC A;  3SWN A;  3JCM h;  5GAM j;  3LX7 A;  4FU6 A;  1XOV A;  4X9C A;  4EDU A;  4ZTF A;  1Q86 U;  2E6N A;  3OS5 A;  5DY9 A;  5A0D A;  3JCM e;  3A8M B;  5A2Q E;  2RA2 A;  3RKY A;  2K2V A;  3SWN B;  5LJ5 h;  5GAO n;  4ZGJ B;  4F7U E;  2K57 A;  2LDM A;  3V7R A;  3WVE B;  2QTX A;  4DOV A;  3OYC A;  3J7A F;  5LJ5 e;  1QVP A;  3H6Z A;  2DTH A;  1N8R U;  2OTL T;  5FU7 B;  3OB9 A;  3HRS A;  5CCA A;  4BB7 A;  4M77 C;  3VKI A;  1U1T A;  2OTL A;  3C95 A;  2ZPF B;  4E7K A;  3JCM P;  1X6O A;  4B9W A;  5I21 A;  2K4Y A;  3HP9 A;  3X20 B;  2EAY A;  3JCM J;  4M7D D;  4X34 A;  5C6S A;  2RB6 A;  4HT9 A;  1VQO T;  1U1S A;  2DAQ A;  3JB9 G;  2F69 A;  4IUQ A;  1JBM A;  1UEB A;  2X4Y A;  3BY7 A;  1VQO A;  4RG2 A;  3HSB A;  3DB3 A;  3GLX A;  1M1K U;  2QDY B;  3HKS A;  4N4I A;  3ASK A;  3OYB A;  1VQ5 T;  3QPH A;  3OSV A;  1ZHI A;  5CKE A;  3T9N A;  3CPW S;  2RHI A;  3NTK A;  4B9X A;  3L2U A;  1OZ2 A;  4C8Q D;  4FIB A;  1VQ5 A;  4J83 A;  1Q7Y C;  1EIF A;  3PMT A;  2KK4 A;  4NL3 A;  1M8V A;  1W4S A;  2HBP A;  4JS4 A;  2FVU A;  5GAM h;  1RL2 A;  1OI1 A;  1ZBX A;  3MEV A;  4E7I A;  4M77 G;  2F5T X;  2E64 A;  2MI6 A;  2KY9 A;  3JRZ A;  3X24 B;  4A4G A;  4C92 A;  5GMK j;  5GAM e;  4C5I A;  3LLR A;  2DXU A;  2E5Q A;  3WXM B;  1N9S A;  2XHC A;  2QI2 A;  3E9F A;  4TVR A;  4XTW A;  2K3Y A;  1BIB A;  3C94 A;  2DD4 A;  3P8B B;  3C4S A;  3M5A A;  2E70 A;  2QQR A;  1JJ2 S;  1VQK T;  4PL6 A;  1K73 C;  2XKO C;  4A4H A;  3JCM d;  3CPW A;  2PUO B;  4PLL A;  5LJ3 e;  2KAF A;  1OYX A;  2LC4 A;  2X35 A;  4M75 C;  1VQK A;  3JCM c;  2RJF A;  4BI4 A;  2B8A A;  3RIR A;  3OYD A;  3MET A;  1YJW T;  2PVG B;  4OMF B;  5GAN 3;  3GOX A;  3LYI A;  1XQH A;  3M53 A;  1HXD A;  3V8J A;  1KQS A;  4ELY C;  5LJ5 d;  4PJO F;  4BDZ A;  1YJW A;  3I56 T;  4RKU E;  4O6J A;  2CYZ B;  2EJG A;  3PMI A;  1BI1 A;  2QXF A;  1NPP A;  1KD1 U;  2DVE A;  4MDX A;  3I56 A;  2IVW A;  3CC2 A;  3WVD B;  3SDZ A;  2X4J A;  3QXE B;  3UDC A;  1R8O B;  3SD4 A;  4KT0 E;  4Q5W A;  4EMG A;  1U8R A;  2XU8 A;  3JCM W;  3SWN C;  5GAO r;  1Q7Y U;  2RJE A;  2FL7 A;  4FT4 A;  5I2M A;  1KQ1 A;  3ZEH A;  3AHU A;  4L5G A;  3FRN A;  4PJO B;  1Q82 U;  4CRI A;  4F7U G;  2OTJ T;  3JCM Q;  3RMQ A;  4M7D A;  3QDR B;  2ZZD A;  3JCM V;  5GMK h;  2VGM A;  4M75 G;  1YBY A;  2K5L A;  5GMK e;  2QQB A;  5KCH A;  1QVF A;  1BIA A;  5GAM f;  1VQ9 T;  4FM4 B;  3OYE A;  3JB9 I;  4J7I A;  3OYJ A;  4C8Q F;  2E6Z A;  3CCU A;  4LD6 A;  2DXB A;  2JTM A;  1VQ9 A;  3MEA A;  2YHT A;  3RER A;  5DLQ E;  2VXE A;  2EJF A;  3M57 A;  2RHU A;  3NFC A;  1W2B S;  4HT8 A;  4C8Q A;  2X4W A;  3ZBD A;  3LW5 E;  3CCS T;  4OB1 B;  3I55 T;  4PJO E;  2DIQ A;  2HNI A;  4II1 A;  3NTH A;  5HK0 A;  3MP1 A;  3OW2 S;  1O9S A;  1QW1 A;  2LRQ A;  2O4X A;  1YIJ T;  3KBG A;  4QVC A;  3O8V A;  2EJ9 A;  3CCS A;  4C0D C;  1VIF A;  4C8Q B;  3I55 A;  4LDX A;  2ZPG B;  4MDW A;  2RK2 A;  3CCQ T;  3N5B B;  5D6X A;  4QVD A;  1YIJ A;  2VV5 A;  4IUT A;  3CD6 T;  3HRU A;  2ZCF B;  2GFU A;  2BIV A;  3DKM A;  3GNF B;  3CCQ A;  4M7D E;  3M4Y A;  2CZ1 B;  3ER0 A;  5LJ3 d;  3UT1 A;  4ZN3 A;  3CD6 A;  2RHX A;  4ZTJ A;  3GP8 A;  2KMT A;  2ZPI B;  5GAN 5;  2V8K A;  4OB2 B;  5HKC A;  4KBM B;  2RJD A;  4C92 C;  4OB0 B;  4KUD K;  1N27 A;  3RMS A;  2CZ7 B;  3CBM A;  3OQ5 A;  4BI8 B;  5A0G A;  5GAO m;  3DLM A;  1BI3 A;  4BY6 C;  2LTO A;  1NZ9 A;  2K5I A;  3HL8 A;  3OMG A;  4QVZ A;  3J81 E;  4MZP A;  4C8Q E;  2EQM A;  3VJP A;  3LGL A;  4MMK A;  1X01 A;  4HCZ A;  3MP8 A;  4C0Z A;  5FRM A;  2RJC A;  4LDY A;  2Y4Y A;  2JUF A;  1VQM T;  2L3R A;  4ZN1 A;  2BUD A;  2L5Q A;  3A8G B;  2KSS A;  4A54 A;  1QVG A;  4XQ3 A;  4J6W A;  1VQM A;  3EFR A;  4NOY A;  3L1A A;  2JN0 A;  3PNW C;  3JCM g;  2RI5 A;  4QW2 A;  4GY5 A;  5J39 A;  3CXC A;  4PJO D;  2ZPE B;  4E7J A;  3JB9 D;  2G3R A;  4XAX B;  1KHI A;  3OS2 A;  3OYL A;  2DXT A;  3C12 A;  4C92 G;  4R56 A;  1JRI A;  5GAO q;  4BDY A;  5FLX E;  2IG0 A;  3E19 A;  2LCC A;  2XIC A;  1S72 T;  4LDV A;  2XD0 A;  1WGS A;  2GCX A;  2DZC A;  1WNL A;  4JRK A;  2D6F A;  1S72 A;  3S3N A;  2V8J A;  3BDU A;  5GMK l;  1B34 B;  4M7D C;  5HK3 A;  4EMK A;  2HD0 A;  1I5L A;  3X26 B;  4OF1 A;  4M78 F;  2RD1 A;  3OYK A;  5FU6 C;  3INZ A;  1WPY A;  2ZPH B;  4C0G A;  3PIO A;  1FWZ A;  3MCA B;  1NJI U;  2P0P A;  2E12 A;  5GAN g;  4EMK B;  3NTI A;  4UC4 A;  1NPR A;  3EFS A;  4M78 A;  5GAN 2;  4NS5 A;  1VQL T;  1IRE B;  3PFS A;  2WSF E;  2XK0 A;  4XU0 A;  1KQS S;  5CKF A;  3M55 A;  1Y71 A;  1VQ7 T;  1VQL A;  4N4G A;  4M78 B;  1MHN A;  4C8Q C;  1VQ7 A;  2DD5 A;  2H3J A;  1H3Z A;  2ZPB B;  2JNG A;  3BW1 A;  3DB4 A;  5J26 A;  1FX7 A;  3VYH B;  3CCR T;  1P92 A;  4OVA A;  3OYN A;  3MO8 A;  5GAO l;  1YJN T;  3CCR A;  4BE0 A;  5L8R E;  1N6A A;  1G3T A;  2MAM A;  3CPF A;  5J3B A;  4M7D G;  1H64 1;  4JUV A;  3UWN A;  3L2Q A;  2VUB A;  2DK3 A;  2E10 A;  4XU3 A;  3VU3 C;  1YJN A;  2RHY A;  2A7Y A;  4E47 A;  5FRN A;  3FJP A;  1UGP B;  2XI9 A;  4QQD A;  2VC8 A;  1XTD A;  5LJ3 g;  1N9R A;  3MHX A;  5EG2 A;  4Y91 A;  2DPP B;  4Z02 A;  1MGQ A;  3V7S A;  1QVF S;  3G4S T;  4M78 E;  4XTX A;  3JB9 F;  2KQW A;  1SSF A;  3Q1J A;  1QP3 A;  3UPU A;  3HRT A;  3G4S A;  3URG A;  4PJO A;  3X25 B;  4JLI A;  3V8K A;  4M7A D;  3QHS A;  3VUZ A;  1WJS A;  1UB4 A;  2RI2 A;  4JDS A;  4IUU A;  5C0M A;  2F5K A;  4FL6 A;  1NE8 A;  2A3L A;  1HK9 A;  3CCL T;  3KUF A;  4MZT A;  5FU7 C;  4X9D A;  3HFO A;  5KE3 A;  4M77 F;  1VIE A;  2OTJ A;  3CCL A;  3TU4 K;  1VQP T;  3BDL A;  3OYH A;  2QQS A;  5CQX A;  2LX9 A;  5FRO A;  5KH6 A;  4L6V 5;  3P8D A;  3V8L A;  2DTI A;  2X4X A;  1VQP A;  3FDR A;  4ELZ C;  2LT4 A;  3OBW A;  2QA4 T;  3M54 A;  2XG8 D;  3JCM X;  1K73 U;  4IUR A;  5GAN f;  1K8A C;  3MEU A;  3OA6 A;  2QA4 A;  3QG1 A;  4M77 B;  2E41 A;  4O5V A;  3ZFJ A;  4A4K A;  4C5H A;  5GAM d;  1OZ3 A;  4LDU A;  4QQG A;  3G71 T;  1KQ2 A;  4IUV A;  3KXT A;  4XTU A;  1UGR B;  4OGC A;  1V29 B;  3G71 A;  2WAC A;  2I2L A;  4M78 D;  5CKB A;  3V7C A;  3QII A;  1FXX A;  5GAN 8;  1UGQ B;  3GNG A;  3SFM A;  4E7H A;  1KC8 C;  2M0O A;  1YHQ T;  4XTZ A;  1QVG S;  3M56 A;  3R6O A;  4M78 C;  1BI2 A;  3P8H A;  4EMH A;  1YHQ A;  1M90 C;  3PT9 A;  2R5M A;  2R5A A;  3G7Z A;  4RCC A;  5GAN 4;  3G6E T;  5GAN 6;  3CXC S;  2JTF A;  4D6W A;  4VUB A;  2Y4X A;  1QP2 A;  4EPC A;  3G6E A;  4FT2 A;  1D3B B;  4BE2 A;  4F7U F;  3QYH B;  2DIG A;  3ME9 A;  4JRI A;  2YRV A;  4N4H A;  1N8R C;  2MWO A;  3HHT B;  3LH0 A;  4GLK A;  4M75 F;  4M7A F;  3CCV T;  3OMC A;  4J5Y A;  1K8A U;  2EWN A;  3TRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...