4KTDH

Fab fragment of hiv vaccine-elicited cd4bs-directed antibody, ge136, from non-human primate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
217
Chain Sequence
VQLVESGPGLVKPSETLSLTCAVSGGSISTNDWSWIRQPPGKGLEWIGGISGSSGDTDYNPALKSQVTISTDTSKNQFSLKLTSVTAADTAVYYCVREGIVLVNLAVKNWFDVWGPGVLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GE136 Heavy Chain Fab
publication title Vaccine-elicited primate antibodies use a distinct approach to the HIV-1 primary receptor binding site informing vaccine redesign.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 44
structure length 217
sequence length 224
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdH01
3RGVA 4NKOA 1BJMA 1NJ9B 2D0GA 1XGTB 4KK6C 4TULL 4DCQA 3O9WA 4OD2B 3CFBB 4PG2C 1CT8A 5J7CC 4EOWL 5IEHB 4OZGF 3LEYL 4FQQB 3UTQB 4M7JH 1FYTE 3U9UA 2XWBA 1OW0A 3EZ8A 2GJZB 4X9BA 5EUOA 2XZAL 1QBBA 4QTIL 4XNMB 3T0WA 5KANI 1AY1H 4CNIA 4HZLA 3GKWH 3KPRD 2A6KA 2DQFB 5FO9B 2GJ6E 3MR9B 3WIIH 5TH2B 4F7MB 3BPCB 3FONA 3QXVA 3OKYA 2APBA 4OAWB 2HMIC 2DB8A 4XVJH 4HKXB 5DJ2A 1IVLA 3MZTA 4P3DA 4ZUWB 3KXFB 1T04B 4JN1L 5F7MC 2VR4A 2J88L 3KHOA 4HKJB 2V5RA 3IDYB 2EIBA 1CBVL 4P2QE 5D1QC 3H42L 2R39A 3RQ3A 1UB5A 5FK9A 3QEQE 5E8DL 1F90H 4DUWA 1FFRA 3DO3A 3CFKA 3GBML 5JR1H 4IIQA 4RMQA 3CZFB 5JIKA 5C6PB 1M7DA 1KC5L 2YPVH 4XAKE 5CMAA 5D4QA 3S5LA 4NZUL 5F9OL 1I1AC 1V7NH 3CX5K 2H2PD 4LKXA 1UXSB 5TQ0H 5KAQF 3HFMH 2QQNH 1ERNA 2V2WB 3SE4A 3S36H 5C6TL 4MS8C 3QFDA 3BH8A 1HOCA 4JFPB 4UQ2B 4YDLB 4U1SA 4Q74A 5DMJB 3U7YL 2YKLL 3MLXL 1AQKL 2GKIA 3GHBH 1YQ2A 3OJVC 1TJGL 5HYJA 1U92A 4RQQB 5L7XL 1GC1H 3W11C 4MXQC 1AXSB 1U8JB 4Y5YA 4AIZB 3PABB 4KMLB 4JREC 1AP2B 1UJ3C 5L2KE 3S4SG 3TA3B 1JZ5A 1X5AA 3U0WH 2HJKA 3BPLB 3WXVL 4UZGA 1PG7X 5EUKA 3L3HA 1PFCA 2OL3A 4XBEH 4L3AA 2D7PA 4YUEL 3RUGF 3BYYA 3T65A 1S7WA 1IM9B 5EN2B 1LDPH 5FV2A 2F74A 4G9FB 5IROC 3STLB 1HSAB 4RGNB 1RU9H 4PB0L 5DD3L 1HDMA 4CVXA 5FA3B 3OG6B 3Q6GL 1OPGH 4ZNCD 5BS0E 4M48L 1C1EL 1TFHA 1JGEA 4NQCD 4X7SH 4AG4H 1UEMA 3WHXB 2CKBB 3ULUE 4KI5C 5C09E 3V7AG 3AGVA 4UV4L 2RR3A 4PJGA 1M7XA 1JVKA 3NIFE 4MNGE 4I8DA 5I8KH 3MYJB 1VESA 2JB6B 3BYTA 3QAZB 2QQKL 4ZUUA 1AE6H 3G5ZA 3D85D 3LQMA 1PSKL 5E7FA 2HWZL 4JFFB 4K23L 4P2OD 2FCBA 3UTPE 5TFSL 1ZA3A 1UQSB 5CHNB 3HI5L 4FTVB 4JQXC 4X6EA 2VLRB 1L7IH 5IFAH 4OBRA 5HGBB 4QXUL 1UYWL 5C6WH 2GFBA 3P0GB 5F6IB 4DTGL 1ZT7B 2VLJB 4UIKL 4EI5A 4WIQA 2R0WH 4IM8A 4PGZA 4G6JH 4UILL 3UTSD 1IGIH 1KJ3H 5CBAB 1X5JA 3DWTA 3ZSTA 3IKKA 5BV7H 1MJ7L 2ORBL 4LVOC 2NY4C 2P8PA 2YD5A 3C5SB 5C7XH 4TRPL 3HPLB 1L9MA 5ANMA 5KG9B 8FABA 4MA3A 1QYGL 1YYMH 5CIPB 4MNQA 4LFHG 1VB9A 5IT2L 4PRPE 4F37F 4I9WD 2HLAB 3PXHA 4PJFA 1JWMA 2AJVH 4HXAH 5EU6B 2OR7A 5HI3D 1XCQA 3VA2C 4LAJH 5DUBB 3TBSB 2ZUXA 4ONGH 1D6EB 3DVFA 3TH3T 2JF1A 4R4NC 4OLXH 3C6SA 2Z0BA 5IMLA 1T83C 2XZQL 5EWIH 2J8OA 2A9NH 3V6ZB 5CINH 3THMH 3BN3B 3O4LE 4Y19A 4HZAA 4FFYL 3DJ9A 2BSED 3PNWA 1J0KA 1MCFA 2BY2A 2BVPA 4PJ8B 2GTZB 3MROB 3T0AA 2F5AL 1G7JA 1JYXA 4L4TE 4DEPB 1A1NA 2GIYA 4RFNB 5DHYB 1N5YH 4JZNA 4YK4B 5TE6L 4P0DA 5D5MA 4I3RH 4ODWB 4U4BA 3QQ9C 1HQRA 2GTWB 5EZJB 4QRPA 3MRKB 4GXUM 4KI5F 1A7QL 3G6JF 4LCIL 4QRRD 4YDVB 1S5IL 4XCFH 1T5WA 3P4NB 1JI2A 3NTCL 4NRYB 3GJFH 5HHNA 1QD0A 4KY1L 5F72S 5E8PB 5KVMC 4OTXH 4N0UB 1SVZA 2BDNL 1YMMA 3U1SL 4PY7A 4QKXB 3QIWB 4KHXL 2FRGP 1YNKL 3MUHL 4OZGB 1E6JH 5DD6B 1DQMH 2VAJA 3CDFA 3FT2B 5D96B 2Q8AH 5MENA 1X5LA 1T66C 2VXQL 4OLZL 2DYPD 3LD8C 4KK9C 1FDLH 2PW2B 2VLKD 5I2IB 4LCYA 3H9ZA 4GG6A 1MFNA 6FABL 4BSWB 5FHAH 3EHBD 5ID0A 1J5OL 1BZ9A 2BNRE 1ZLVK 3ALXA 1JRHH 2WIIB 3N1QC 2ZNXA 3JWOH 1Q8MA 3T3MF 5F8RC 5I71B 4HBCH 5I76A 5I19L 4X4ME 2C3GA 5FDYA 1YEFH 1ODAA 1MUJB 3ILQC 1GRWA 5C3TA 2AEIT 3IDXL 1KXTB 5JHLL 1M1SA 3BP4A 5JQHC 4KK5D 3P9LB 3OBAA 4QHUB 5IJKC 5KOVC 1RMFL 5K59F 3K8KA 1BP3B 4KVNL 1IQWL 5T5NF 4U1LA 3KJ4B 5HI5C 3G6DL 5GS0D 2EDWA 5HYSA 5F7DB 3S8WA 1VFMA 3IDNB 5FM5O 5F3HA 5MEOA 1EUUA 2IQAB 5HHQA 3QEUB 4Y2DC 2X42A 3UTTA 3QO1A 1D5XB 1CDHA 4J3SA 5J3HC 4GKOA 1UKSA 4LEXL 1H5BA 2B7DT 2OTWA 4LCWD 4GKZA 1C7SA 3DMMB 5TE7L 3NAAH 2HG5B 2YMXH 1WZMA 2DM2A 5HJ3A 1FG9C 4GBXB 1AC0A 1CD1A 4MA8H 2OZ4H 5T3XL 4LQ1A 1N6QH 2UUDK 4NPYB 2QR0A 2NY5H 2H3NB 2NPLX 5FGCB 3C60B 3T0BA 1JZ2A 4GMTL 1U8LB 1ZSDB 4GKNB 3PJSB 2VYRE 4J12A 4S1QL 3IRZA 1MWAH 2ITCB 4H25B 5T1LA 3RUGB 4GKSA 5DD1H 5A40E 2F53E 2JKXA 4KFZC 3A67L 1LEIA 4RAVA 3VXRA 3QEGL 4M43L 3KPSA 3WDIA 5D2LE 3ESUF 3ARSA 3ZE2E 5DYOB 4NSKB 4D9RE 1QO3B 4M62H 2AEPH 5EA0H 1P1ZB 2K3TA 3QUXC 3B9KC 3OL2A 4XB7A 4LLMB 1WCBB 1MCQA 5KVFH 2VERN 1A3QA 4L3CB 5DMGD 3VFUB 3TEUA 3VD4A 4YDKL 4Z5RB 1WK0A 1UG9A 1LNUA 5F1IB 1A7NL 2YC1A 3HE6C 3UEZA 3KWWA 2IBGA 2IPUK 1CG9B 3VGBA 4JANB 3RJQB 1BJ1H 5DD0L 1HHHA 4R4BB 1X4XA 1ZGLA 3W2DH 3BPOC 2FH8A 3H7BB 3ARVA 3VW3L 5D1QB 3I2CL 2IPKA 3HZYB 2I60H 4N5ED 4RRPA 3QUZC 3FOMA 4WU5B 4QHNA 4Y4HA 3TIEA 3S7GA 3C5ZD 4LHUD 1MHCA 1UZ6F 5MP6L 5KS9E 4Z0XA 3EO0B 1PZ5A 1HIMH 1U91B 1FGNH 3B9VA 1I1AB 3HC0B 3IFPB 5FAAA 3MRHA 3SOBL 1ONQA 1MQKH 5H94A 2EEAA 5CILH 2G60H 5ACMA 3VWKD 4F9LC 4J3WA 3TFKD 1EMTL 4PRIE 1KCRL 2ZUQB 3N1FC 3UJTH 1KLFA 1S9WA 1J0HA 2PCPB 1B0GB 1A1OB 3OKNA 3H9HA 3Q3GA 5ALCH 3RPIB 3WE6A 2X44D 3ORJA 1MI5E 4JREB 1UJ3B 3KYMA 3LKQB 1WBYB 5IMKB 4HWNA 2AJUH 3HAEH 1BBDL 3NZHL 4WEBL 1XGUB 2FATH 1G6RA 1I9RL 1QPXA 2L0DA 2JJTC 4XPHH 1H3UA 1RULL 2DTMH 2FGWH 3KXFD 1K4DB 2NX5E 5ESVB 3T09A 3E6FB 1PKOA 4U6VH 1MLBA 4J23A 5GIRA 4JO3H 4PRDA 4XXDB 5CZXD 3VWJC 3QNZB 1I3RA 3MC0A 1I9IL 2ID5A 5AAWA 5KAQG 1CR9H 4YPGA 3ROOB 2KBGA 2I5YL 3TPUB 4HH8A 1FFNA 3GSUB 4X7TB 1RI8A 1NCWL 2ZKHL 3Q5TA 2NXZC 4KZDH 3MRPB 2CH8A 3G6JB 1EO7A 1EEQA 3SKJL 1YDPB 4OQTA 4MX7A 4WJ5A 1EERB 4P59H 4KRMB 4HWEH 1WISA 5FYJE 1GGCL 4P46C 5EUOE 3CJJA 5IMMA 3EAKA 1L0YA 4P5KB 1PEWA 2OMBA 3VG9C 4LCCC 2YEZA 3JV0A 2KKQA 2Y06H 3D2UA 1XF2B 2YUZA 5ADPH 5CKGA 2ARJA 3RY6A 2BC4A 1ES0A 4Q9QL 1A0QL 4X5WA 2WK2A 3TIDB 2D03L 4MB5A 3L3JA 1INDH 4NKQB 4YH6A 1G7MB 1KG0B 5DK0B 5TJWK 43C9A 4NP4H 3A0OA 3QDJA 3MREA 3FQNA 1B2WL 4JR9L 1EGJA 4LPYA 1KIQA 1IM9D 5DFWH 1XF3B 4W81A 1CF8H 1ZLUH 4G9FD 5AWNH 1OL0A 1NL0H 4P2RB 4QY8B 4RGND 2W60A 1JHLH 3GSXA 2NY4B 4KJYB 4GW5B 1BX2B 3OKOB 2DLIA 4HAFA 3EOBA 5IFHL 4LSRL 3MRFB 4YQXH 4NO3A 1D5ZA 4H8WH 3LQZA 2CIKB 3ARWA 4RISH 1GXEA 1JPTL 5EZOH 3DX7B 3ULSB 1DSFH 4ZMAT 3IFLL 4Q2ZA 5JNYA 4FQXC 1CIUA 2OMNA 4Z76A 3RIFF 4LSTL 3VXTB 4UV7L 3L3KB 5GJTH 1FZOA 5GISL 1A1MA 5A2KH 2PETA 4JFFD 1OD9A 4AK1A 4GW1B 2DDQH 2OTUB 5MEQA 1FE8L 3DO7B 4X80L 1DBAH 1UM5L 2UVEA 3MBEC 4FTVD 4OD1H 1KLUB 2KL6A 3O6LH 4ODTL 3X14B 3TF7C 2YR3A 3TNMA 3ETBF 3DGGB 3LSOB 4YFEA 2RJMA 4YXKL 3UBXG 1WWWX 2VLJD 5DC4B 5C2BH 1WEJH 2YWZA 3VH8B 5DJXB 1K2DB 2DLGA 4WEMB 4PJ9C 1ITBB 3X13A 4ZOAA 5FGRA 4GW4A 3VGDA 5FB8B 4ZXBC 2WBJA 5D6DA 1C5BL 4YHIA 1QVOA 4EQ2A 3PGFL 2PO6A 4PJXF 4PJGE 3EFDL 5EIVA 1JK8B 1JNJA 1QHPA 3BZ4B 1NLDL 1G84A 3HAEG 4OD3L 5I8CB 5GGQL 1LO3L 3LIZL 3M8OL 2J6EH 1PG7H 5CEYA 5EU6D 2BSRA 3LD8B 3P2TA 4M6NH 3HRZA 1HI6B 3SDCC 1YYLL 1ZHKA 4F7PA 1FPTH 1ZGLP 4YPJA 15C8L 1J12A 3KDMB 5C1MB 3UCRA 3U36B 5C0NC 5BRZA 1Q9LB 1CGXA 1T1ZA 1FAIH 5E2VH 2O93L 5LGHL 3EOTH 1UFUA 4J4PC 1U8HB 3MV8A 1MHHB 4ONFH 3L3IB 2DLTA 4JE4B 2HTKD 2PYFB 3ZDZE 5IHUH 3E3QE 3DIFA 4G8GA 3V6OC 1SYSB 4BK4A 2ITDA 4Y1AA 3QUMA 3R8QA 3FB6B 3PWJB 3F7VB 5ANME 2DJ4A 2VLLA 4HSQA 4M9PA 1Z6JT 3UYOD 3ZMRA 4IRSC 4M93C 5ETUB 4MNQE 3WD5L 1CD9B 3Q1SL 3GSNL 2GSGB 5FECB 1U8NA 4PJFE 4Y2DB 3TWCL 4R0LC 4Q97A 4NUJB 1NCTA 1SBBA 1ZS8A 4LRNH 4C83A 5B4MD 1OGTA 1PVHA 3QIWD 1IBGL 3R0MA 5JUEL 4XRCB 3R06A 1PYWA 2BK8A 1OARH 2NXYC 5J06A 5C08B 5I1GL 2VIRA 4UAOC 5D7IF 5IB3B 4EI6A 2GT9B 4L3EB 3VJ6B 3D87B 1X5FA 5FYKE 1JGVH 2OQJB 4R26H 4Y19E 5EC2B 2A6IB 4CBPA 3HC4L 1NCAL 1MFAH 4HF5L 2XFXA 4ZFFB 1N0XH 4H26A 3BUTA 3WLBA 1A7PH 3BWUC 3HB3C 4ETQB 1Z9OA 2FR4B 4OIBA 5DRNA 4KJQD 3WSQL 1H15B 4D0CB 5D5ME 3QUYA 5KSVB 2HYMA 5T5NG 5JDJA 3V0VA 1L6ZA 3MA9H 1KIPB 2UY6A 4XNQA 1AD0A 4X0KB 1G7PB 3KYKH 4PG9A 1HHGA 5DMYA 3VFOA 3CC5A 4IDJH 4P3WA 5INDA 4I13B 1SJHB 3QUXB 5K9OA 3WLWC 4YHLL 4Q9RL 1YMME 1L4IA 3EYQD 3KLHC 3AMKA 5I1EH 1BQHB 5MENE 3K0WA 5GRVK 1F58L 1IM3B 5KANG 4G43B 4L1DA 5LGJB 3HE6B 4GG6E 4XC3L 3BDBA 4GBXD 1RD6A 3EYUH 5EU5B 3V52L 3EYOB 5DTFB 5ILTL 5AYUL 3BPOB 3KYOA 1CXLA 1T0PB 5EC1B 3AXLB 3GB7B 4J8RA 3FQTA 3C60D 5D1XA 3P73A 4WW1A 3QUZB 2AK4B 4KVCH 3BZDA 4FRWA 1HNGA 3RI5F 3PGDB 3B5TA 5D1ZC 3UPAA 2UVFA 4KK6D 5GGTH 1UGNA 2QL1A 3HCVA 2V17H 3HLAB 4KV5F 3QCTL 2VXUH 3S9DB 2BOBB 3NCMA 2R56H 1OAYL 4O2CB 5F88A 4P3CH 1AY1L 2VDQH 4IOIB 3UTTE 2VDPH 3P77B 3GKWL 4NO0A 3SKUD 1UENA 3I50H 4PJEB 4YHML 3DHJA 4KZEL 4OKVB 4XVJL 4F58H 1BBJA 1FG2A 3LN9A 3HKFA 2VN7A 4HUUB 5FDWB 1DN0B 2C4XA 4LLQA 5B3NA 3RNKB 2XACC 1MRCL 1K85A 1BIIB 4JDZA 4K8RH 3S88H 1L9NA 2FBJH 1L7TH 4Z7WF 5LAXB 4YZFF 5HHME 3VWJB 1I8MA 3CFEA 3BP7A 3VXRE 5TQ0L 2HFGH 3MV7E 3KPSE 4URTB 5DR5L 3AS2A 4PV9A 2QQNL 5GRZA 1J18A 4RIRA 3QI9C 3GGWB 2BX5A 1MCNA 2X1XR 4KTYA 3ET9F 1TCRB 3O45B 2L7UA 2NXZB 1I1AD 3HPJA 3PQYA 4M8QB 4M3JA 2BJMH 1GVIA 4YBLC 5EBMB 3ECBA 2O5XH 3GHBL 3P40A 4TQEH 2VITA 3MOBL 1VHPA 4MS8D 4ZO7A 3W82A 4PJXB 3RX5A 3BGAA 4OI7A 1FNEA 2AJSH 4ZUTB 1CXKA 4OF8A 3SDAC 2KDGA 3SN6N 1DVFC 4LCCB 1ADQH 2LQRA 1LO2H 5ICXB 5IBTH 4D9QD 3CMOL 1Q94B 1ITCA 3BW9A 4BQ9A 3W11D 3CDYA 3IJHB 5TF1H 4OFIA 3MYZA 4IMKA 5ITFA 5F6HI 5J9PB 4LASH 4L4VB 4JKPH 1FIGH 1IT9L 2Y36L 1MOEA 3QHFL 3O3EB 3VXQB 1P69B 2YK1H 5FYLL 3TLRA 4KROC 1O5DT 3MV9A 4NBYB 5EB9A 1MPAH 1E27B 4ETYA 4AG4L 2R1YA 3QR2A 1IGCL 5GZNC 4GAFB 4JFQA 3B3IB 5L6YL 5L2JB 1XF5B 3GRWH 5I1DA 3BGMA 5I8KL 3QUKB 1D5IH 1F42A 2RGSA 2BMKB 4LSPH 3LKSA 4I9WE 2F54A 1BAFL 1PD6A 5EG6C 3TBTB 3VRJB 1X6LA 4NO5B 5DA0B 2W92A 3BD4A 4FQXB 1RUKH 4YHYC 5EBLA 3MRIA 2E8ZA 3A6CH 1L0XA 3ZYIA 4MDJB 2ILLA 4QXTA 1YY9C 4NQEA 2EO9A 1M7IB 2JCCA 3X3GH 4OKDA 1RZKC 3MBEB 5D7IB 4KKNA 3P4MA 3OKEB 4HC1L 1XT5A 2Q6WB 4NNYA 1KSRA 2NY0D 2VAAA 1N5AA 4X4YB 4G6JL 3S37X 2H6PB 3I3BA 1IGIL 1KJ3L 4FNLH 3IFOA 5BV7L 4WFGE 1TPXC 5IVOA 4MXWH 4UU9A 4OCYL 5C7XL 4PJ9B 1AQDB 3HG1A 3BZEA 1ZLVH 1YYML 3O6ML 4ZXBB 1YQVH 4MWFB 4QRRE 4LKCA 3CX5J 5DC9B 3WO3B 4PJHF 1JIBA 2HRPH 1H3XA 1YUHB 2DS4A 4MQXC 4HXAL 1VFAB 1AI1H 4MAUL 1BM3L 3PL6C 5IF0A 4M7KL 1MFCH 4OZHE 4TUJB 1CFQA 4K7FA 2ICWA 4LIQH 5TGBB 1NBVH 2D7TL 1T1XB 4OLXL 4JFYA 5DQDH 4TYUA 3L7EB 5D7JD 1KEML 3P30H 5EWIL 4APQC 4PJ5B 2DJUA 4AL8L 1DQJB 2NTFB 2ENSA 2VLKE 4JPIA 3ULVE 3GSNB 5CINL 3THML 4WHYH 1CGVA 3FO2B 4ZS6C 5DK2A 5C0EA 5IVXF 1G6VK 4WV1A 2J8UA 3TH2T 4HFWB 5JW5B 5F9AC 2XN9A 3MFGB 4GRLC 1B0RA 1R3JB 4NOFA 1FL6B 3QDJE 4CDHA 4NNPH 4ODXB 32C2B 43CAA 3MLZH 3IJSA 1PKQA 3QG6A 4K3JL 2UUDH 4MB3A 3IVKB 4WUUB 3BIKA 3GIZH 2NMSA 3QQ9D 5HVHC 1T1YB 2CGRH 2X4QB 2P5WB 4OTXL 1N59B 2VOTA 3LN4A 4RDQF 4IRSB 4M93B 3PWPA 4O5LH 2ZCHH 1OAUH 1AFVH 1ETZB 2A74A 1NDMB 4JQVC 4IOFC 1E6JL 1DQML 2NQCA 4PRHB 5JMOC 1OAKH 4WDIB 1D9KA 3MCLH 4R0LB 3F58H 2WQ8A 2DQEH 3OF6A 3QNYA 3FQWA 1T1WA 5IV2B 1FL5A 1U8QA 1RUPL 4YXLH 3QWOB 1NGZA 5F96H 1T66D 2NXYB 5FHAL 3SO5A 3C9NB 4KK9D 5CJQH 3SDXA 5MERB 3LKPA 1U8PB 3RGHA 3QULA 4JM4H 3JWOL 5I1CH 3KJ6L 2PTTA 1FHGA 2F8OA 5KSAA 4WWKA 4GRWE 4F80A 1WFOA 1BVLA 4NKMB 3MX0A 5KW9H 2GCYA 5ESQB 1RUQH 5D7KD 2HKFL 4PUBH 3IU3A 4Z7WB 3BP5B 2QADC 3CFCL 3QZWA 4TUKL 5T3XD 5KJRH 1EEZA 3FCTB 1CD8A 3EOAB 3BX7C 4QHLA 2F19L 5IBLD 1EXUB 5HI5D 3MA7B 2MQ3A 1QFWH 1JPGA 1MLCA 3NAAL 2F8XC 3MLWH 4O02L 4Y2DD 3HUJF 4OIIL 4WFFE 5F1NA 5J3HD 1ORQA 2BNQA 2H8PA 3MRQA 3CSYA 2FIKB 4OI8A 3UYPA 4MA8L 5T3ZL 2OZ4L 1WBZB 5A2FA 3SBWC 2UWEF 5C08D 1GHFL 4C56A 3F7YA 1RUAH 5AUMB 1KOAA 5INCB 4L3ED 5GGSA 2BY3A 4X99A 3VCLA 1OT1A 1KB5B 1MWAL 1QSED 2B8OT 1S7SB 1WUNT 1QLEH 3P9MA 1G7LA 1BEYH 2OL3H 4J1UB 1NBZA 4G8GE 5JHDB 4RX4D 4Y1AE 5D1ZB 3U0PB 3QG7H 4M62L 4UT9L 1LO0L 1XEDA 2O61A 2FNBA 1E6OH 1QFUH 1GIGH 1WIUA 3CZJA 2X89D 3MRRA 3JVGC 3OB8A 4WHYG 4ENED 3QDMB 3QUXD 5KVGH 4U1HA 1NUDA 3BEVA 3NH7H 2VXTH 3IXTB 3VE0A 2W0FB 4JY5H 3S3PA 3FMGL 2OCFD 1XR8B 3PGCA 3DX6A 3FT3A 4Y4KC 3HE6D 5HYQA 4NQSA 3OKMA 3OR6B 1F4YH 4WHCA 4DZBB 4EVNA 3HMXH 2VMFA 2QJDA 5I66A 4BH7B 4UDUA 2VABB 4JHAH 4D9LH 1EDQA 1UM6H 4OZ4A 1YPZA 2IH1B 5ALBH 3QUZD 2AK4D 3L9RB 1DTUA 3DI2B 3CPLA 4M9OA 3P4OA 4EUPA 2XA3A 2C7UA 3ARGC 4PGBA 3I9GH 3S96B 4NC1E 1MQKL 2W9DL 5ID1B 3TT3H 1Y6MR 1W72H 5L8LB 3FQXA 3QI9B 1RZFL 2KZ1B 1NDGB 2BOCA 5F9JA 3WNPA 5DJDA 1JGLH 4YBLB 5C0GA 5ALCL 1CGTA 4BFEA 4PJHB 4UTBH 4K94H 3L7FA 1S9YA 1H3PH 1MF2L 4PS4H 4QOKA 5JZ7C 3D3VA 3SDAB 3SE8H 1IEHA 1DVFB 3GM0A 2AJXL 5EOCH 1YY8A 3QQ4A 2KPNA 3BQUC 4NQDB 4DKEL 5FV1L 2IPUG 4BH8B 2DKUA 4XPHL 3TESA 5FCSH 2R1XA 2DTML 1J8HD 1N2RA 2QHLA 5HHVL 3G9VA 3RWEB 5I1AB 2RBLA 4IHOA 2RB8A 5IVXB 2IADB 5GSVA 3LKNA 4D2NA 1MCSA 4X7CC 3TO4C 2HT4C 2NLJA 1SJXA 3F65A 1PLGL 2ADIB 2EDJA 4I0CC 5CGYC 2E7LC 3UAJC 1V3KA 3L6FB 4HIHB 5H2BB 1CR9L 3P0YH 1T5XA 4JFXA 1R5VB 3L5IA 5T5FH 1CE1H 1KN2L 1MFBH 4KZDL 1U93A 4U2ZA 4F7TA 4G8FA 4XPTH 4P59L 2IF7A 1BQLH 4HWEL 4HCRA 1C12B 3LH2L 1E4KC 2NXZD 1Y6NR 4X4ZA 1FORL 2NY3C 4G8IB 4XBPB 2HFFB 4JPWH 3U46A 5GRXG 4YHYB 3BEWA 5BVPH 4R7NA 2PYEA 2Y6SC 2JIXD 3GBNL 2WINA 2JELL 2B4CC 4BM7A 3SPVA 4NP4L 3O2WL 4HGWB 1UCBH 5TE4L 3D9AH 1U8MA 1RZKH 4L4VD 1C08A 4I0PB 1FZJA 1DQDH 5GRUH 2A9MH 3CVHH 1CF8L 3EKCA 2YPKA 4NWTH 4AEIL 5DMIH 2OXGA 3CMGA 1TPXB 1JHLL 4ZO9A 1A6TA 4C4KT 4ODBD 1KT2B 1KTDA 3WUWA 4M8VA 4B5EA 4H8WL 1K5NA 1OB1A 1HQ4B 4PJAE 4XNUL 3PG2A 5EZOL 5C0CA 5AAMA 3PQYE 3DUSB 4LLUB 1KJ2A 1JV5B 4Z7OF 1YN7B 4MCYA 2J1KA 1JHTB 3PL6B 3U30C 2Z8SA 2B4CL 2ZOKB 5F97E 4Z9KB 3FN0H 1BVZA 3E6HA 4UT6H 5TDNA 1G7HA 2K1MA 4JVPA 3WFEH 3CLEH 1IEBA 5D70L 4PFEA 3BO8A 3HUJB 4FQXD 2CKNA 3BPNC 4APQB 3C6LA 4MD5A 1VACA 4HK0B 3EYFA 3GUTB 2QKIB 1JPFB 1G9NL 5HVFB 3VXMB 3HE7A 2GAZB 4U6XB 3OGCB 5DEFB 1QQDB 3O6LL 3MSPA 3B5GA 3OB0K 1W0WA 2UWEB 2YPLA 1F8TH 5C0IA 1QRNA 3U4BL 3MBED 1A5FH 2ADGA 5FM5M 4W68A 4GRLB 1WEJL 2HN7A 2VQUA 1B3JA 4OM1H 4L8SC 1WICA 3SDDC 4RMRA 1T2JA 3R8BB 2R23A 2RCSL 4PV8A 4DKFL 4KJWC 5K33A 1XGQA 4MYWB 4MQ7A 2AVGA 4P57A 3ZDYE 3O11A 5H35A 3MRLA 3FN9A 4EDXB 4XPAH 5HVHB 1Q1JH 1HXMB 1FIEA 2WWKT 4ZXBD 4XAWL 2Q3ZA 2JJUA 1CFSA 4XZUB 3WCYA 2F54E 4LQFL 3K1KC 5E8EA 4FXGB 4M6NL 3KYAA 3WKML 5SX4I 1S5HA 1HCVA 1NGYB 3QFJB 3ARDC 1EZVX 3N85H 3ULUC 2UZIL 4MA7L 4PJ5D 2M2DA 5AZ2L 1A4KB 2X1QA 4NQEE 3EYVB 5DURD 1TTGA 2EE3A 5HY9A 4HG4J 1A9BB 4XP4L 1FAIL 4PB9H 2MCG1 2P44B 3RAJH 2XKNB 1PX3A 1FNFA 4NRXA 3MCKA 4DGVH 5D9SA 1KACB 5IHUL 4PD4K 1DQTA 4AMKH 4DVBA 4F2MA 1NC4B 1S78C 3E8UL 2EDHA 4BZ2H 2QADB 4IDLA 1IGYB 3HG1E 3WFBL 2Z35A 2DIJA 3I3DA 4N8VA 4WUUD 2XY1A 4POZC 1ND0B 3I85A 4X98B 4AH2A 5IWLA 4YBHA 1AD9B 4WI3A 4NRZA 3HZVA 2P5WD 3ULUL 1DQQA 5IB1B 4IRSD 1QEWA 3KR3H 2G2RB 5IMOB 4XP6H 4XNYH 2EICA 3HNSL 3N0PB 2QSTA 4M5YL 2WP3T 4PRHD 1NAKL 3W5MA 5CEZE 5I9QB 1RK1B 2VZ1A 3JV6B 2X4SB 4F3FB 4UOJA 1ZLWH 4FP8H 4P4KC 2NXYD 3VFGL 2AP2A 1EO8H 1UA6L 5HHXL 5CP7B 1K3IA 1TENA 2VH5H 4UT7H 4ZPVB 2J8UE 4PBWD 1JI1A 4YGVB 2XN9E 3SQBA 3OHXB 5GS1A 1MVUB 1RUMH 3GMPB 1G9MC 3MA9L 1A6PA 3LN5B 3U7WL 1PKQE 1YN6B 3IFNL 3HB3D 4JGJA 1YZZA 3JTSA 4ZSOA 3VA6A 3GMQA 4HV8B 4EJ1C 4IDJL 5DQJB 2NZ9D 4ZFZB 3NFPA 4OGXL 4M1DH 3I6LD 5E0QA 1VDGA 4MHHG 4W6YB 3PWPE 3UTSA 1XGYH 2WNGA 5DRXB 1G0XA 1BFTA 4HIIB 5I1EL 1CK0L 4N1CA 3S34H 1CL7H 1GGYA 2JJSA 3EO9L 2W91A 3NABH 1EAPB 3BD5A 4D94A 3ULUF 5AZEH 3AAZB 5IQ9A 2Z92B 2R0LL 3NIFF 3SDXE 2IG2H 1P4IH 3ARZA 3X11A 2C4FT 5EOTA 3D39B 4I0KA 3O3BA 4A6YH 3MGOB 5E99H 3I6GB 4HUMB 1YEHH 4EN3A 3QDGA 2UYLA 2XPGA 4R7DB 3DUUA 1FQ9C 2G75B 1LD9A 2Y4SA 4KVCL 5JTWA 3RY5A 4CADB 1W8OA 1IAOB 4PJIE 4ZQKB 5DJCB 3RWDB 5HHOB 3QQ3A 1FFOA 4KTEL 3MJ8B 5FO7A 3KLDA 5D93C 4NDMB 2FEEI 1DEEA 1U3YA 1IAIH 5GGUA 1NMBH 2VXUL 5JHDD 1N7MH 1UVQA 2CLVB 3GK8H 2DQUL 3B6SA 1PG7W 2VDQL 4BK5A 5FXCH 3OKLA 4JLRB 4QCIB 2DI7A 3O8XA 2V7NA 5EPMA 2EZ0C 4PJCB 1Q9KA 4MGXA 2HAZA 3BISA 3QDMD 2P4AB 5ENWA 2BNQE 5LVEA 2ESVA 4F58L 4U3XA 4IRJC 4U1KB 5E6IA 4UIMA 4ONHB 5LQBL 1ACYL 3BQUB 3RWCA 2FB4H 5IG7A 5D7LB 4XX1E 1G9EA 3U4EA 4C56E 3FQUB 4J6RH 5IHBA 5F1OB 4HJJH 3NFNA 2ZSVB 4N5UA 1A02N 4X7FC 1VFBA 5IIEA 2WMPA 1A2YA 5SX5K 5HD8C 4HQQH 1Y18A 1NGPL 2APVA 1R24B 4HH9B 4JVUA 4PR5A 4QYOA 2HFGL 3HRPA 5ICZA 4MD0B 5LKNA 3O6FD 5SWZB 4ELMA 2DQDL 1DBJH 1HXYA 2EDTA 4ELKA 3EO1B 5T1KA 3NACH 5BMFH 1NAMA 4F7EA 3RWFB 3VDAA 2EDKA 3JWDC 3FB8B 5MI0C 1CGWA 2O5XL 1HHJB 3QI9D 4J3OC 3QPXH 1CGYA 5FYLD 4Z7VA 2AJSL 1QLFA 4DQOH 4ODVH 2NY3B 2Z8WC 1LO2L 3FRPG 3FTGA 1IJ9A 5ISZA 4TNWK 5HHPA 5I17A 2E7CA 3IF1B 3SDAD 1GJIA 1A6AA 2PW1B 1DVFD 4AIOA 1MCBA 4LASL 5CWSB 2Q7YB 3RU8H 1FIGL 1CDCA 3IAPA 4I3SL 5SWQB 4JQIH 1F13A 1FYTB 1OQXA 3GSVB 2VDNH 5EBWB 3D18B 4IBLT 1ZHNA 3WBDA 2OP4L 5IVZB 1MPAL 5F6HJ 4RA0C 1K4CB 2V9QA 4ZAKA 2XNAB 2DMCA 2HFTA 2GJ6B 5TDOB 2FSEB 3LMJL 3SGDI 2V2XA 5KTEH 3GRWL 4XP9L 4CU6A 5BZWB 3MBXH 3LEXA 4RAUA 3LPWA 2CSPA 4Y16A 4PBXA 3BKCH 5GZND 1MIMH 5DEGA 4OLWL 4U6HA 4P2QB 4Q9BA 3S4SA 4BJLA 3D5OF 5IESL 1NCCH 3RRQA 2EIEA 3DRQB 3QEQB 4KC3B 3MNVB 4LK4A 1J05A 3U30B 1J1PH 3ARFA 4AM0B 3NBNA 2R2HA 3IDJA 2DL2A 3HI1A 1W0VB 4N9OB 1TNMA 3D3VE 1P6FA 3PV6A 5EO0B 2Q8BH 4NQXB 1KYOJ 5BXFB 1YECL 3BPNB 4Y89A 1G7QA 3OG4B 4TTDC 1QA9A 3X3GL 2VZOA 4XXCA 4U1IB 1T4KB 4NZJA 4HHAA 1G7IA 3AUVA 2FWOB 2I25N 1DUZB 1YY9D 1RZGB 3MRJB 1J0YA 1ROWA 1Z5LA 1EFXB 3OZ9L 1BWWA 4C4KO 4DAGH 5C9JA 1XZ0A 4I0PD 4L8SB 4QXGH 4WHTA 4Y2OA 4FQCL 3SDDB 1MEXL 3R4DA 3OKKB 4GRMB 1YC7A 4BQ8A 5L2KB 1WC7A 2A6DB 4XP1L 4OCSL 3PHOB 1I1FA 2E3VA 3FRUA 5J6GA 4GQ9L 25C8L 4ZOBA 4MNHB 5F9WC 4LIQL 2NY7H 1S7VA 1P7QB 3DSFH 1I7ZA 4KQ3H 1I85A 2XQBH 3D48R 4M4RA 1A47A 5D2LF 1S7TA 1NJ9A 5DQDL 4XVTL 3P30L 3ZE2F 1GZQB 4Z7NE 5BS0B 3MLRL 1Y0LB 2N1KA 3ARDB 4PJBF 2W65A 2MMXA 5E24E 1CFNB 4APQD 1P9MA 5C09B 2W0LA 3B83A 1S3KH 5IEHA 4MNGB 3W9EB 4ZFOL 2DN7A 4JPVL 4OLYH 5LXGL 2MHAB 2EDFA 1ZT4B 5CCKH 4HPOH 2I9TA 1UB6B 4GRLD 3MR9A 3C2AL 3TJHC 3VFNB 5D7KE 2EH7H 4Z6AT 1MHEA 5GGVY 3GIZL 3TCLA 4TOYH 4K3HA 3WEXA 2CGRL 1DLFH 2X2YA 1T7ZA 1K8IB 1GGUA 3OXSA 1SEQH 1OAUL 2FX8L 3WS3B 5C0CE 3D69B 4PTTB 3F58L 4OFYA 1X5GA 4F8QA 4R8WL 1CLZH 5KS9F 1WTLA 4IOFD 1S7XB 3VGHA 5IQ7L 3CZFA 4OGYL 4X9IA 5F96L 4DGYH 1UKQA 4LSUH 4NCC2 1YNTA 4XI5C 3GNML 3U2SA 3QFJD 3L1OH 4M02A 3T0DA 4JM4L 4P4KB 3SE4C 1EBAA 1T7YA 5E4EC 1R3LB 4PRPB 4M6AA 1GGBL 2C26A 3MTRA 1F4AA 4YAQB 3SQOH 1F4HA 1QSEE 1RUQL 4NUGL 3T08A 4LNRB 4JZJC 3RTQD 1AXSA 1U8JA 2FJHB 4AIZA 5T3ZD 2BSSB 2W9LA 4ZYKB 4Z78B 1T89A 1NC4D 3TA3A 4L8CB 1HHKB 1U8IB 2X05A 2QADD 1SY6H 3O4LB 1T21B 2K7QA 3S3JA 3MUGB 1QFWL 4ZUSA 1U3HA 3KPLA 2R0KL 1OM3H 2WP3O 3QCVL 1RJLA 4PYHA 3HC3H 3ARYA 3D0LA 1TVHB 3MLWL 4L4TB 3STLA 2IBZY 2C4FU 2GEEA 4NO2A 5DLMH 4QWWC 1MAMH 2QSQA 1NSNH 3RWHA 5JOPD 1RIHH 3IDMB 3C87A 1TVBB 4DOHE 3VXNA 2FO4A 4MQTB 3GMRB 3AU1A 5DUPH 3FJTA 2D2OA 3WNMA 2BVTA 3BT2H 1V3JA 2IMMA 2BRQA 3U9PH 3G08B 3BOVA 4FA8A 4N0RA 5FKPB 3OTTA 1QFHA 1UT9A 2G9HB 2HT2C 5B38G 2DLEA 2J8HA 2OL3L 5F7EH 3LKRA 4N8PA 1RZ7H 1TETL 5IB4B 4AQOA 4HIEB 1NPUA 4HS6A 5D93B 5DS8B 1DFBH 1JPSL 2AJYH 1E6OL 4G6KH 3MLSH 2VLRA 4GXVL 3VRIB 3D1MC 4JFZH 5LBSL 2JJWA 5HGBA 3MACH 2BNRB 3JUYA 3RVVC 3LRSB 1TZGH 4JKKA 5C70A 3DPBA 1J1OL 1FO0B 1IC5H 5FO8B 2VXTL 1NEZB 4AQ1B 4KQ4L 3NGBC 4LDLB 4MMXC 3E3QC 3FO9B 2APTA 2XZCH 1F00I 1WF5A 5IKCB 3QIBD 4IRJB 1A14H 4HXBL 1NGQH 5KG9A 3IDGB 3RWIB 4WU7B 1FSKC 1OP5K 1Z9MA 1F4YL 2M26A 5GGSY 1J8HE 2CQVA 4MQSB 3VXOB 4RFOL 5EOQL 1VKXA 5EO9A 3V4UL 2ZJSH 4D9LL 4NHCL 3PDOB 3DX9B 5DUBA 1VPOH 4AEFA 5ALBL 1D6EA 1F3DJ 2VNCA 3MRNB 3ALWA 1BQSA 3X12B 3TZVD 5HDBE 5HSFA 4O51B 4ZSOE 2LFGA 1X7QB 4M61A 2D4DA 4I2XA 1NLBH 4LVNC 3CLFH 4OLUL 5MI0B 3KNBB 1NANI 4PJ8A 4UTBL 2GTZA 3MROA 1LO5B 1NCDH 2EKSA 3VFTB 3OAYK 1A4JB 4LAQH 2OTPA 1YEDB 1DJSA 1E28A 3WIFA 3C8HA 1CFVH 3CFJA 2F53B 3GSWA 5EOCL 2MWCA 4FMKA 1NGWB 5D2LB 1Q9OA 2AV1B 4QHMB 5HGDA 5JZ7D 3GO1H 1CN4A 3GJFA 3PXJA 1LEGA 3EDFA 5IB2A 4PJGF 3P4NA 4Y5XA 3K2UH 2PR4H 3BQUD 4JDTL 2BVQB 1AGBB 4K9EC 5D7LD 3TVMD 1IGJB 3QIWA 1DR9A 1OCWL 4XCEA 5FYKL 3BHBB 3FT2A 4YIQA 5E8NA 3ILPB 3QO0A 1RIVH 1E4XH 3MJ7A 4YBQD 3P0YL 4TUOA 4E41D 1FCGA 4QRUB 5IFJB 3GM8A 3LHPH 4YHPB 2HT4D 1NMAH 1CE1L 4OZIA 5CGYD 2ADFH 3OB0H 4BSWA 2VDML 4KK8D 2IH3A 1TQCC 1BQLL 5AEAA 5SWZD 1MJ8L 1BF2A 4NKDB 3KPPB 4ZUVB 4GS7C 4LPWA 3RL1A 3QIUA 4I4WB 4OV6F 1HZHL 3ZDZF 5F1SA 5I8EB 5CBEB 5HDQH 3V0WL 2NYYC 4HKBA 2AQ1A 5BVPL 4JCLA 4K9EL 3SGJA 1MFEL 5BOZG 3P9LA 5A16B 3GMNB 5KS9B 3QA3A 1DDHA 1B88A 1KNOB 2ESVE 4P9HH 4W70A 2A1WH 4UQ3B 2H2PC 1LE5B 4MJID 1TLKA 5JW4N 1KB9K 4PJFF 2Y6SD 5F7WC 3IDNA 1CDGA 3D9AL 3P11L 3QEUA 3FN3A 3AREA 1DQDL 5GRUL 4PRIB 1K6QH 2ENYA 1FYTD 1RFDH 4BFIB 1NBQA 1H5BC 5I1LB 5DMIL 5IW6B 3VMOA 3DMMA 2QTEA 4L1HA 3O4OC 3L5WB 1MI5B 4PLNC 2GJ6D 1YEKL 2H32H 4ELME 3L5XH 4JFED 1M71B 2F5BL 1ZK9A 2NW2A 1M6OB 1ZSDA 2VXSH 3HR5B 2NX5B 1XAUA 2CMRH 3GSQB 5F9WB 2O5YL 3MRBA 4Z7VE 3K46A 1NQBA 5D5MF 4H25A 3RUGA 1XF1A 4P2QD 3FN0L 4RGOL 3DVNA 2EDNA 1VGEH 3QEQD 3TBYA 4NKOB 2QLVB 3A6OA 5ISZE 4DCQB 2YRLA 3O9WB 5HYEA 3B43A 5JW4Q 5A2IH 4NSKA 5HVWA 4XAKD 1A7BA 2LAAA 1SBSL 4ODHH 1CT8B 1F8TL 3ZKNC 5I1JH 3UJJL 3MLYL 3EOYG 4TTGA 1JBJA 4LSDA 1OVZA 1CU4H 2XWBB 3IDIA 1FZMB 5EUOB 1BQUA 5IGXH 3EFFB 4L3CA 1LK3L 2GI7A 2P24B 5D8JH 1CFTB 1IL1A 1EFXD 2DIAA 4HZLB 3TN0A 5B22A 4GG6F 4MAYA 4LU5L 4P2OC 4XNZC 1XCTB 3SDDD 4X83A 3FONB 1U8KA 1CG9A 4OZFH 1Q1JL 4KJWD 2P42B 3NIDE 5DJ2B 3J8F7 3WHE0 3H7BA 3PHQB 4KRNA 3ARPA 3V8OA 5D1QA 2A6JA 2ADJB 3HZYA 1EJ6A 5J89A 2DM3A 3RL2A 4ZPTA 4DGIH 5FK9B 1IFHL 4R97C 1P7QD 5CZVH 2HFEA 3CFKB 4JRXA 2CR6A 4M6ML 1M7DB 4NWUH 5CMAB 3S5LB 3UBXA 4YFDB 5BS0D 4OLEA 4LKXB 4JDVA 3ARDD 3V8CA 1UWEL 3F7RA 5E9DD 4PRBB 1F11B 3ULUD 5E4EB 3QFDB 3RAJL 1HOCB 5C09D 2AQ2A 2L7JA 4LSSH 1WZLA 4DGVL 4S1SL 2XKSA 5E56A 4KU1A 2ZNWA 3NOIA 3SE3C 1X9QA 1U92B 1Q0YL 4HKZB 4JZJB 1QKZH 4QLRA 5IHZA 3HAEA 5F9DC 1X5ZA 1UJ3A 1SQ2N 3LKQA 1WBYA 4K7PX 4KMTL 4HWUA 1S78D 3UTPD 1XGUA 1FGVL 5EIIB 4S1RL 4B7IA 3VU2A 2HJKB 5L0QC 2COQA 3IJYA 3L3HB 4NKIL 4NN5C 4A2MA 3E6FA 3IETB 4POZD 4EUPH 1TIUA 1S7WB 5IROA 3NFSL 2F74B 2WLZA 1A6WH 1HDMB 1X44A 2OK0L 1I3GL 3ROOA 4PYGA 3TPUA 2J4WH 5BQ7A 4X7TA 1EO8L 2VH5L 3MRPA 3G6JA 1YDPA 1I1RA 4PJGB 5DJ8B 4P4KD 5J4MA 5IEKA 1AIFA 4ORGB 3FAWA 4Z77A 1RUML 3BKYL 1G6RL 3G5ZB 5T1DH 2Y25A 4PLOB 5KSBE 3LQAH 1XF2A 4J7RA 3ULVC 4WW2C 4WFHE 1ZA3B 2DRUA 4JQXA 4JY6A 4X6EB 4YHZL 2XWTA 2ZOLA 4UINL 3EHBC 4PLJC 5SX5H 3QDHA 4N90E 2DQCH 5DO2D 1IC4H 1WJ3A 2X4UA 1KG0A 3O4LD 2GFBB 5KN5A 4QGYA 4R2GC 3V79C 5AD0A 1VEMA 1WBXA 4LSQH 1AHWC 4OQTL 3NGBB 4L4TD 5DRWA 1RJCA 5AZEL 4JFOA 5DA4A 1KBGH 4P2RA 4QRQA 5C0FA 2H9GB 4KK5C 1T3FA 1AGFA 4JKWA 3TYGL 3BH9A 2ED8A 4GG8A 2P8PB 4ALAH 1BX2A 3LEVL 3MQIA 2H45A 2JTDA 5ANMB 2UZXB 4UOW0 8FABB 4MA3B 4WI8A 1FSKB 4HS8L 2CK0H 4MNQB 1INEH 5CUSL 3ULVL 4D3CL 4JN2B 5I1IH 4OZFG 2B0SH 3F12B 4PJFB 1KCSL 2XOTA 2LVEA 4ISVA 2EDXA 3EDEA 1EHLL 1XCQB 4HMCA 4X4XA 5HGHA 3L3KA 3MNZB 1A7OH 3C6SB 5IMLB 2OTUA 2VQTA 2K9UA 3IYLW 3GK8L 5CD3A 3L5HA 4N0YH 4XCCL 4Y19B 3X14A 4CRPA 1KPUA 5IM7A 2BVPB 3JZ7A 3DGGA 1VADA 2BNRD 4TVPH 1G7JB 3QP3A 3GHEL 1A1NB 2XWJA 4NYLB 3K74B 5D5MB 2EZ0D 1HQRB 1YEEH 2DAVA 1IKFH 1B6UA 5FB8A 4JY4A 1XMWA 3NA4A 2WBJC 3Q0HA 2R2CA 1B4JL 5K9KA 1MREH 1T5WB 4JG0L 1MRFL 4IRJD 3M07A 4J6RL 4S1DD 3VFSA 2GHWB 5HHNB 2PO6C 3GSRB 4NGHH 4OZHF 1JK8A 1V05A 5CJOH 2APFA 1HKLH 2J6EA 3DXAA 3DTXB 5I8CA 1YMMB 4PY7B 1F3JA 2B1HH 2AKRA 2FGZA 1CGSH 4Y4FA 2HJFA 5MENB 1B9ZA 3NCJH 1KULA 5DMGC 3ULVF 1P84J 5HD8D 4WW2F 4RMVA 4CGTA 1JNHB 4LCYB 4GG6B 5F7FA 3NACL 3KAAA 1TQCB 4KTDL 3QPXL 4ONOA 1RVFL 5ID0B 1Q9LA 4DQOL 4NQTA 4ODVL 4S10A 4N5EC 5J6HB 1U8HA 1MHHA 1U3JA 3O2DA 2PYFA 5JA8B 3O41A 2MKLC 2V5SA 3BP4B 4P4RA 2F53D 4R96B 5IJKA 1YEGH 5EIQA 4LF3B 1JE6A 3FB6A 1UWGH 4O2EA 2ARJQ 4JQIL 4KKCC 5HYSB 3CVIH 1CDUA 4HFUL 4D9RD 1CLYL 3VWKC 5FECA 5F3HB 1S7RA 5CLTA 5MEOB 3SCMA 5HHQB 3TFKC 3UTTB 1H5BB 2EIZA 4FQJH 2OTWB 4DFHA 4YHOH 4OGAC 4GKZB 5LWYH 1EVTC 2NW3A 4FZ8H 4KI1A 5HJ3B 2D7MA 3DYMA 1HINH 1A6VH 1H3VA 1R3HA 3BKCL 3V4PH 1MIML 1WT5A 4I2XE 4GRWF 1HYSD 1FNSL 3JTTB 1NCCL 4ERSL 5GJSL 2V2TB 1J1PL 2LV4A 1KEGL 5HHMB 5T1LB 2QSCL 4CVZB 4D0CA 3QUYC 1T22A 4RAVB 3KPOA 1KIPA 4N0FA 3VXRB 4FQ2L 4FABH 3MV7B 4X0KA 3KPSB 2PN5A 3UO1L 4KMQA 4NC1C 3ZL4L 2BXYA 2X89A 1ORSB 3HS0A 4Z95H 2OXHA 2DM7A 2XRAH 3UZVB 1SJHA 3WL9A 4TTDD 2DQJH 3B9KA 3IB4A 12E8L 2VISA 1TJIL 4V1DA 1Q38A 2EC8A 4PRID 1KFAH 1NKRA 2LAGB 5DRZB 1IM3A 3ROLA 1LNUB 4Q6YA 4G43A 5F1KC 5LGJA 4KPHL 4OZIE 3PV7A 3IDUA 1MI5D 5E6ZA 3KWWB 1JYNA 5IK3B 1AO7A 4O58H 4JG1H 2AXFA 3EYOA 3CUPA 3QH3A 5DTFA 1ZGLB 2C3WA 4H1LH 3CXDH 1BREA 1U95A 3BPLC 2WWMC 4KQ3L 4GMSH 2IPKB 3P4LA 4NFBA 5D1XC 2NX5D 3FOMB 3HNTL 1RJYA 5FEBA 1KTRL 2I07A 3BN9C 2B39A 4R97B 4Y8AA 4ZO6A 3TIEB 3O0RH 3RX7A 1MHCB 2FJGB 2HVKA 1GL4B 5GGTA 3RGVD 3RWJB 3NA9H 1RZJH 1T20A 2ICWI 1GOFA 1PZ5B 4MSWA 1S3KL 4QF1B 3O9WD 3E1F1 2EE9A 1K8DA 5EOCJ 1ONQB 4ZFGL 5H94B 4U2YA 2CJUH 2BOBA 2X4OB 5GGRB 3CDGA 3VMNA 4FG6C 3P77A 1CLCA 5D71L 5CCKL 1S9WB 3OKNB 5DHVH 3H9HB 3ZYZA 4HLZH 5FCUH 4EBQL 2AGJH 4JGMA 3WE6B 3K8LA 1OWWA 1KELH 1KN4H 5ACZA 4RCAA 3TJHD 2FEDD 5FOJA 2FD6L 4IMLA 3VGGA 5L0QB 1G6RB 2EKJA 3DURA 2ICES 3DROA 4NN5B 3DI3B 4LSVH 1CLZL 1A3RH 1DZBA 1MLBB 3OAZH 1BD2A 1PY4A 3AY4C 3BAEH 4PRDB 5GIRB 3WN5A 3VWJA 1M05A 2XA8H 4LSUL 1I3RB 1SM3H 3AVEA 5ACLA 2DICA 2Z93A 1OAZL 4IS6A 3L1OL 3T2NH 4YPGB 3RWGA 2ZUSA 3OV6A 1XIWA 1NEUA 2ZUVA 1FFNB 3LS5H 4QRRB 5IUSA 4XI5D 3ZT7A 3BSZH 1FBIL 4M8QA 2DD8L 2PUQT 5DVOA 3SQOL 1IC7L 5K9QI 4MX7B 2UZYB 5T33H 1UWXK 2EYTA 3LZFH 1U2HA 4OZHB 1ADQA 3ARRA 4P46A 5IMMB 3ES6A 3WFCL 4WTWA 1WFNA 4M5ZH 4G5ZL 3RPKA 1OP5H 2I9LA 5HYJD 5CEXA 2OR9H 2YEZB 3D2UB 4FOMA 2VLKB 4WW2B 3MLTA 4ZDHA 2ARJB 1MJUH 2BC4B 3V5DA 1ES0B 5DJ0A 4MB4A 2WUBL 4OJFH 3KLSA 4L4VA 1OTTC 1FL3A 1WAAE 5DHXB 1JYVA 3L3JB 3ZKMC 3VGAC 4R2GB 3O3EA 43C9B 3BE1H 1HWHB 3QDJB 2EE6A 3O3AB 3MREB 1FLRL 2JK5A 3BZFA 1MAML 3FQNB 3HI6H 1NAMH 1WVZA 1AHWB 1KIQB 2X4PB 5IBUG 1E27A 1QPPA 1RIHL 4JRXE 4RFNC 4WGWB 2W60B 4FQLL 2YUWA 3BT2L 2RHEA 3CFDB 3ZHDA 2CRYA 4KUZH 2IC2A 3U9PL 3EOBB 1UZ8A 4NO3B 2R2EB 3LQZB 3ABZA 5GS0H 1TVDA 1JFQL 3BJ91 3TBTA 2CUIA 1KPRA 4Q2ZB 4YFLI 4OB5H 4YDIL 4H1LG 4Z76B 5D96C 4MDJA 4JHWH 2BXZA 2AJYL 1JZ7A 4GUPB 1WFUA 1A1MB 3RVXD 3SHSA 1M7IA 4Z7QE 3UROR 3MACL 3WXWL 5D7IA 3U7AA 2EDEA 3DETC 3OKEA 1CYGA 2IQ9L 4GRWB 4JRWA 4JKLA 3WFHB 3RVVD 2EH8H 2R29H 2X5PA 3CH8A 4KXZH 1JZ8A 4EI5D 2XZCL 3WNOA 4KJQC 1N6UA 1P4BL 1T2XA 4PJ9A 5I18L 1A14L 2R0ZH 2X1PA 1KXVC 1NGQL 4GW4B 4X7DC 2GK0A 4PJAF 1Q72L 1FVEA 4M1GH 2WBJB 1D6VL 4G6MH 4CW1A 4YHIB 4XHQA 4G6AC 5I30L 2PO6B 4K7PH 4LEOB 4OCRH 3Q6FA 5DJYB 1VPOL 4MNQD 3VFVA 4XC1H 5SV4A 3EYQC 4HJ0D 3T2OA 1T1XA 5GQBA 1JUFA 4JFDA 2BSRB 4E41E 1BZQK 4PJ5A 1D5MA 4Z8FH 4XVSL 3SDCA 5EBGA 3AS3A 3MNWA 3CH1B 1ZHKB 4Q0XL 4F7PB 3CLFL 2JLLA 5GGVL 4WV1C 1NCDL 3DVGA 4ZFOA 3M1BA 1LVEA 1D7FA 5FYKD 3RVTD 1NCBH 4GSDH 2VKXA 4Y19D 1T1ZB 4H88H 4W4OC 3C60C 4DZ8A 4J4PA 4ODXA 4TVSa 4U1MB 2EDLA 1SMAA 3ZDYF 1FH5H 4TSBH 4U05A 4NHUA 5E2TH 5I6XC 3SKOA 3GO1L 3DIFB 1T0MB 4G8GB 5I1KH 1MFDL 4NBXB 2ITDB 1MJJA 4Y1AB 1OAQL 5E7BA 1SJVA 3STZB 3QUMB 5IB5A 5CEZL 4MJIE 1QHOA 3B9EA 4OCXH 1MCIA 2KUTA 1KTLA 2ZZUT 5F8QC 3VWKB 4XWGH 5DJZA 4XMKL 2FX9H 3I75A 4LLVA 1U8NB 4MZ2A 3QXAB 1TNNA 1YMMD 1NUFA 4C83B 3EIFA 1OGTB 3ZE0F 2ADFL 3W9DA 3R06B 5MEND 1GPOL 3C9NA 3CU1A 3K80A 3V4VH 1BFVL 5DT1H 3MMEA 2Q20A 2VIRB 5TPWL 4EI6B 4JFEE 2AXJA 1LK2A 1RQ5A 5KSAC 1A7RH 4KRLB 1JGDB 2R8SH 2XFXB 1SYVA 4H26B 5CS7A 2F58H 5C0AE 1JF5A 3D6GA 3UTZB 4NJ9L 4Z7WA 3PIQB 5DRNB 5IOPA 1P5VA 3IU4L 3QUYB 3LRHA 4P9HL 2A1WL 2NYYD 2W1NA 5E08H 2V6HA 4XNQB 1KJMA 3FCTA 4ZOCA 2DQTL 5JW4M 1GAFH 1HHGB 1HEZA 2BVYA 3VFOB 1OGAA 5INDB 1EXUA 3BWAA 4OF3A 3B8SA 1R0AH 3MA7A 4NQVB 2BVEA 4U7KA 3HNVH 5K9OB 1F97A 3DXAE 1DBMH 4JZOB 3KPQA 4E5XA 5JO5A 3UTTD 2ZUQC 3PP4L 3I84A 1YNLL 2OLDA 1DUYB 3GI8H 1JF1B 3NCFB 1WBZA 3L5XL 4J3VA 4N0CC 4OM0H 1DANT 3LS4L 4ODSH 2J8UF 1F2XK 1RZ8A 2Y07H 3QPQD 5AUMA 5CJ5A 2VXSL 2HVJA 2VDRH 3GSOA 2OS7A 4RWYH 3ZSSA 3DYPA 4ORZC 3QEHA 2Z31C 4J8RB 3FQTB 5JQ6H 4AZ8A 5D1XB 3P73B 3BIAX 4KKAC 1WZ1H 1F2QA 5HHMD 4J1UA 5T1LD 4MA1C 1N3NA 1TQBB 4XP5L 5D1ZA 4FN0A 2ZCLH 3VXRD 1TZIA 4ODHL 3MV7D 3H7LA 3KPSD 1I4FB 4WY7H 2D31A 3U82B 4AEHL 2XIDA 5E2UH 3FOLA 3HCVB 2D9QB 5E9DE 3QWRA 3C8DA 1BOGB 5JIPA 1QSFA 3N1GC 5IGXL 3B5HA 3ZKND 3QDMA 2IPTL 2CKBH 5D8JL 5C86A 4WI4A 2SEBA 1CVRA 5HPOA 1FZKA 2W0FA 4L9DA 3RIFK 3SDXF 2GITA 3BUYB 1XR8A 1U58A 4LHJB 3B9DA 1QNZH 4YHKH 4HDIB 1WTGT 1BBJB 1FG2B 4OCWH 2VDKH 4HT1L 2M1KA 3C08H 2VRAA 3HMXA 4LLQB 1P4LA 5FF6B 2NY0C 4LHUG 4DGIL 5ITBL 4JDZB 4PJIF 4BH7A 1UKTA 2ZCKH 1A6ZA 2B20A 3QCUL 3H9YA 4KGLA 3QNXA 4X6CA 1I8MB 1MCDA 3BP7B 1W72A 4G7VL 2AK1L 5D7SH 1JZ3A 2C1OA 2YD9A 3S96A 5DGQA 5ID1A 3M17A 5FUCE 2CO6B 4WI5A 1PJ9A 3V0AC 5FUOH 3D0VB 4PJAB 1MCPL 4LSSL 3B2VH 3HPJB 3PQYB 4HEPG 1PX4A 5C07A 3SDYH 1AGDB 1KB9J 3WO4C 3H9SA 5JW3H 2VITB 4JO1H 2DTSA 3TBWA 4V1DE 1FNEB 1QKZL 5CIPH 5F3BA 4Q7DA 4WNQA 5D7JC 5A2JH 3BW9B 5LCVH 4NQDA 1R5WB 3RBSA 2D9CA 1FRGH 1QOKA 4EZMA 4YFLF 3K4AA 5BVJA 4LP4A 1AO7E 3NCYS 1OOAA 3RWEA 5I1AA 3SGEH 5IVXA 4K3GA 3VGAB 5EFIA 4LLYB 1RZIB 4BQBA 5JDSA 1UM4L 3L6FA 4JJ5A 3WV0A 4WFGD 3MRMA 2R1YB 1AR2A 3T1WA 4M6OH 2XV6B 3MXVH 5IR1B 4JFQB 4O4YH 4HIJA 5I1DB 4YXHH 3BGMB 1CDBA 4KDVA 4GAGH 1AR1D 1RHHA 3VXUE 5L8JB 2DQHH 5T1DL 2F54B 5JLZB 2EDRA 4XBPA 3H0TB 3VI3E 3VG0H 1YJDL 4LPVA 1B6DA 9CGTA 2Y1VA 5EBLB 4OV5A 3JV4A 3ZTJG 1DBKH 5L8KB 4JM2A 3N9GH 4P5TA 4QXTB 1IEAB 4NQEB 2DQCL 3D2UD 3ULVD 4LBEA 3DHMA 3CVHA 1I8KB 4NNYB 4PLJD 1NCUA 1HNFA 1C5DA 3VXSA 1I1YA 2LU3A 1EPFA 1BD2E 4R2GD 1OY3B 1KBGL 4HCRL 4OUUA 4YX2H 3QDJD 4X5LA 1J0JA 4UU9B 4ALAL 1KT2A 5DUMH 5A43C 1DBBH 3HG1B 3BZEB 1ZANH 4U33A 2BRRH 1OSPH 1HQ4A 2FJFB 1INEL 1OQOA 3HA0A 4D0BA 3ZLQC 2B0SL 5IBLC 2E6QA 3OJMB 2P8MA 2C3XA 1JHTA 4EIZC 3PL6A 4LPTA 1G1CA 3QJHB 5IF0B 3MFFA 4FQHA 1QUNA 2ZOKA 1CFQB 4K7FB 2ICWB 1N64H 2B5IC 4PREA 2FLRT 1DL7H 4DN3H 2YBRA 1R3IL 4JFYB 1J0IA 3L3OB 3C6LC 4TULH 3GUTA 4JPIB 3VXMA 3DVIA 1P7KB 4N0YL 3OGCA 4YDJA 2Y7QA 4NJAH 4KHTH 5DK2B 5C0EB 4WV1B 4TVPL 2J8UB 1EIBA 2IANA 2FIRT 4JO2L 4LDEB 5CJXC 4F8TA 1FNLA 2DBJA 2XN9B 5DI8A 5GRYA 4E42A 1BVKA 1O7SA 1B0RB 1ZA6A 2X4RB 2XZAH 4QTIH 1KJ2L 2YRPA 1YEEL 43CAB 5I6XB 3IJSB 1PKQB 3QG6B 3FQRB 3RI5K 4Z0BL 1WQVT 4L8BA 4XNXH 3SKMA 1MREL 3DX8B 3BIKB 1SMOA 7FABH 2FHCA 5CJOL 2D3VA 3LN4B 2WBJD 4N9GB 1IKNA 3MLUH 2VDLH 3PWPB 2J88H 4XZUA 2PKDA 4ENEC 1CGSL 2PO6D 1QLRA 4Z7NF 5CGMA 3MUJA 2QHRH 5HI4D 4H5SA 5E8DH 5A1AA 2XZZA 1U8QB 3GBMH 3EJZD 4WFFD 5ICYA 1NGZB 1AC6A 1KC5H 5HDLA 3SDXB 1CDYA 4FXLA 2VWEE 4XCYA 3UJIH 3QULB 1A9BA 3JBG7 5C6TH 1R5IA 5KSAB 2YA0A 3R1GL 5K9JH 4OCLC 3U7YH 2YKLH 3MLXH 1AQKH 5F21B 2GCYB 4K07A 4HJGB 3PUCA 4PJIB 1LILA 1YEGL 3O2VH 5L7XH 4WUKL 2Y23A 3ZYJA 2PXYA 3QZWB 1BFSA 1GGIH 1EEZB 4G8GD 3CVIL 2E6PA 1HCFX 2WSKA 4Y1AD 3HZMA 4PJ7A 3CIQA 5IWLC 4QHLB 4G3YH 4NC0B 3WXVH 1DQLL 3T0XA 4LIQE 4KKCD 4FQJL 4YUEH 4A2LA 2G2RA 5LGKA 4YHOL 1G1YA 4BZ1L 1JPGB 3EW3B 2PNDA 1EA9C 4WRLA 2IWGA 4FZ8L 2BNQB 4JFDE 4PB0H 2H8PB 1HINL 4F3FA 4OGAD 5EULV 1A6VL 5EO1A 3QYCA 4PPTA 5JIHA 4M48H 1C1EH 2DQIL 3FRPA 3SBWA 2YSSA 3QRFM 3F7YB 4JRYA 3BJLA 1DLHB 1KIRA 3CNKA 3G04B 4UV4H 3OPZL 5GGSB 4X99B 5DVLA 1FJ1A 2FHFA 1MVUA 2Z31B 4LMQE 4L8DA 4FABL 1YN6A 1MCJA 3P9MB 1G7LB 1AKJA 1PSKH 3BP6B 4MA1B 4K23H 5TDPA 4CU7A 4Z95L 5DQJA 4ZFZA 5KVDH 5BW7A 5TFSH 4OSUL 3QUYD 3SO3C 2O61B 4POYA 2CLRA 2CUMA 4BSJA 3J7HA 2DLFL 3IKCB 3JVGA 4PRNA 5KSUA 3T4YA 3QISA 4QXUH 3MXWL 4DTGH 4UIKH 3BEVB 2JJSC 4NN7C 4HUXA 2WANA 2DKSA 1EAPA 3L3DB 4XH2A 4WCYL 1HWGB 1TZHA 2I27N 3RVWC 3EDKA 5IW1B 3PGCB 2VXVL 3DX6B 4ZOEA 4A6YA 4Y4KA 1FC1A 1UWXH 1QZ1A 5A3IC 2H1PH 4OCNC 3D39A 3CXDL 4XPGH 4HG4K 5HYQB 4NQSB 4GMSL 3OKMB 4EN3C 5C3LD 5BJTA 5IT2H 2NY0B 3ARBA 3PHSA 4EVNB 2IGFH 5I66B 1ED3A 2WWMD 1IAOA 4OZ4B 5HHOA 4HPYL 1S9XA 5D1XD 3MJ8A 5AYQA 1RZJL 1MY5A 2VR9A 3NA9L 5I0ZA 1J86A 3CPLB 1KF9B 1H3GA 3ARGA 3BN9D 3P4OB 4KKLD 3FQXB 1CICA 3ARUA 1OGAE 2RFXA 2BOCB 2BERA 2V7HA 5F9JB 4FFYH 5DJDB 2ICWJ 1IZJA 4P23C 5C0GB 3WO4B 5FCUL 3O8XC 1N8ZA 2F5AH 2J12B 3SJVA 1S9YB 1H8OA 1KELL 4FG6D 3D3VB 4PJEF 4NO0D 1KN4L 5TE6H 1A9EB 2HH0L 3SE9H 5D7JB 3BDYL 4OFPA 1YY8B 5HYJE 1LHZA 3NZ8A 4D0DA 4OQ1A 3N06B 3S35X 1A7QH 4LCIH 1RK0A 4M1CC 3MUZ1 3CK0L 1TDQA 1N2RB 3NTCH 3TJEL 5EU7E 5C0BA 5JXEC 4KY1H 3BAEL 5GSVB 2XA8L 3LKNB 3TO4A 3U1SH 4DKDC 5B21A 4KHXH 2NLJB 1YNKH 5I75C 5HDBF 4HH9A 1R24A 4AIXA 4MD0A 4OLZH 3DV6A 4JFXB 1T5XB 1E4WH 3FB5A 1EEUA 4K3EL 1B0WA 4BUGA 5B8CC 4NZRH 3OJDA 4M7LL 3BSZL 4BSVB 6FABH 1CE6A 4JFHE 1U93B 3FB8A 4F7TB 4G8FB 4FZEL 1KIUA 3I02A 1CD0A 2P5EA 1J5OH 3UP1A 4ZTOH 2WQRA 4U3HA 4U1JA 1QSFE 3PQYD 3EGSA 1OSZB 4OIAA 1XF4B 3PWUA 2WUCH 5DSCA 2W9EH 3U46B 5I15L 4R7NB 1MJUL 1A22B 2Q7YA 1IQWH 5SWQA 4F33A 3G6DH 2IFGA 4PIRF 4G8EA 2DI8A 3MLVL 4HIXL 1OTTD 1NAML 3T77A 4CUCA 5E8OA 2XNAA 3ZKMD 2YPKB 3G5XA 4ZD3H 1BLNB 3CSGA 4NCDA 4X6CE 4XGZB 1MHPL 2FSEA 1A6TB 3VFWA 5BZWA 3WUWB 1WLHA 3O2DH 1OTSD 2J3SA 1EK3A 1K5NB 1OB1B 4Y16C 4F9PA 5T3XH 1I9EA 2FHBA 5C0CB 3T0EA 1UCTA 4XBGA 5C07E 4S11A 1KJ2B 3DV4A 3QEQA 2C5DC 4GMTH 3H9SE 4MCYB 3GJFK 2VC2H 1K3ZA 3ARFC 2Z91A 1W0VA 4L4JA 3FT4A 2F54D 2B5IB 5HYFA 3E6HB 3MCG1 4TPRH 5B39B 5TDNB 2EC9T 3A67H 1IEBB 3BO8B 3QEGH 3ZE1F 3C6LB 1VERA 4MD5B 1HE7A 3EYFB 4XXCC 3WHE1 4AY0A 2DWEA 2P43B 1DUZA 4G42A 4NQED 4HUWA 2M8XA 3GMLB 2AXGA 5C0IB 3BRDA 4JAMA 1EFXA 2ICEA 2CXGA 4UDTB 8CGTA 2R29L 4MJ5A 3DETD 3INUL 1T2QH 1QSEB 3K4DA 3WJLC 2HN7B 4YNYB 3OGOE 4X6BA 4LRIA 4DVRL 2QQLL 2R0ZL 2R23B 2NR6C 4ELMF 4PV8B 5L2KA 1XGQB 4MQ7B 4P57B 4M1GL 1A7NH 5B38A 3SKNB 2NZ9C 4G6ML 5H35B 3HG1D 4O9HH 3MPCA 4Z7VF 4QRPE 4OCRL 2WIMA 5DD0H 2HKHH 4MNHA 2AW2A 1ZVYA 4G6AD 1MCOL 3I2CH 3KPMA 5E8EB 1F6LL 1U8OB 1EX0A 3MRCA 5MP6H 1JWSA 2AAVA 5CEZD 4DOHB 3FO0L 5D2NA 3UTOA 4BELD 5C09A 3MRGA 4CVWA 3SOBH 4MNGA 5HY9B 3VD5A 4GAYB 1T03L 1HH6A 4WENB 2MFNA 3LKOA 2DQGL 1I9JH 1U36A 3W0WA 2P7TB 4NRXB 1EMTH 3VH8G 1ZT4A 1KCRH 2OX5A 3MCKB 5E2TL 3VXSE 3JV5A 3S35L 1UB6A 2XN9D 1ZLSH 4DN4L 4DVBB 2RQ8A 3VFNA 1MH5B 4F2MB 5I1KL 4ZNEA 2HP4A 3RKDD 3NIDF 4NM4H 1OTUC 3GMOB 1C5CH 4UNTA 4RWHA 2Z35B 2YHGA 1RHFA 4N8VB 5EZLA 1BBDH 3D69A 1I9RH 2FX9L 3HZVB 4NRZB 1EV2E 5CP3H 3ZKXC 5DQ9A 1XGPB 1LP9A 2C1PA 4M7JL 1RULH 2Y9RT 3LV3B 1QEWB 3PWPD 3DBXA 1YC8A 3MO1B 1I9IH 3OF6D 2P47B 3WIIL 4L5FH 1KYOK 4FQIH 4LOUC 3S6CA 1N4XH 2I5YH 4PGCA 1H0DA 2O5ZH 2NZIA 5J56B 2CDEA 2ZKHH 2R8SL 4PRPA 1J8HB 5C71A 4NT6A 5E5MA 2F58L 3SKJH 1KPVA 2IANE 3LAFA 1GC1C 1JRHI 4RZCB 4L29A 5KSAD 5GS1B 1GGCH 3FB7A 5KZCB 1F90L 2AI0H 2YUVA 3VXPA 1RJZA 4ZYKA 5JR1L 1FLTX 1T89C 1SY6A 4ZSOB 1HHKA 2RIKA 3O6FC 2EE2A 3GMQB 4UOW1 2YPVL 5JPMA 3BMWA 3NFPB 1V7NL 3SO3B 3HFML 3HNVL 3BESR 4HBQA 1U3HC 1A0QH 3S36L 4HGMA 5B39G 2D03H 3BRFA 1HHIB 3QJFB 1MCRA 1J1XH 4KAQH 4MD4A 1LE9A 3HMWH 4NN7B 1II4E 1B2WH 3V7MA 4PP2B 3OQ3B 4OM0L 1GC1L 3FO1B 4ODSL 3CD4A 2HJLA 2BNQD 2H41A 4B7LA 1F4WH 2BVOA 4N0CD 2JIXB 4U6TA 3X11B 5IFHH 3U0WL 3G08A 4U7SA 3L95A 5FKPA 3OX8B 3O3BB 4RMSA 5MEPA 4C56D 4EN3B 1I1CA 2UY7A 4XBEL 2UYLB 2XPGB 2G9HA 5KSBF 3DUUB 5DEZA 5HGAA 4JHBA 1I8LA 1LDPL 3IFLH 2Z31D 5IB4A 3QQ3B 1RU9L 4LSTH 1FFOB 2IMNA 5DS8A 5FO7B 2YZ8A 4KKAD 3RZCC 1OPGL 2GW5A 4WY7L 4XMPH 5J57B 3TO2A 5E2UL 1XGRB 5SWSA 2MQ0A 4X7SL 3UYRH 3U4AA 5GGUB 1GZPB 4HS3B 2IAMA 3TNNA 4PJ7E 4X80H 1F6AB 3LRSA 1UM5H 3B6SB 1IGFH 2CKBL 1FO0A 1Z0NA 5E1AA 1QFPA 4ODTH 3B8YA 4P23B 4X4MA 1BQHG 5BV7C 3O8XB 1ZVSB 2V7NB 4PY8I 5EPMB 1Q9KB 2VZTA 1Z3GH 1AE6L 4I5BA 3BGFC 2E9IA 3MJ9A 5ENWB 2BHUA 3WUZA 4YHKL 1INQA 2ESVB 3VFMB 2VDKL 5E6IB 3RWCB 3C08L 5IG7B 1VEPA 2EYSA 3U4EB 1HH9B 5FM4A 3U83A 1C5BH 1L7IL 4JRYE 1LEKA 5IFAL 2X4NB 3PGFH 3NFNB 3EFDH 1NLDH 5LJYH 2R0WL 1Y18B 5GGQH 1LO3H 3LIZH 4RMTA 5I75B 4I0PC 3M8OH 3UPRB 3DARA 4PR5B 4QYOB 5ICZB 1GYAA 3C8KA 5FUOL 1X7QA 2VZUA 4ELMB 2KZWA 1HXYB 5B8CB 4ELKB 1YYLH 1VA9A 3B2VL 5T1KB 2MJWA 1TTUA 3U0TA 2NTSP 4F7EB 5HDOA 15C8H 1KTKE 3UXFA 5JW3L 3UBXI 2EEDA 1R3KA 4Z7VB 3S3SA 3F5WB 4B50A 2CDGB 2AJVL 1HYRC 3FTGB 1BPVA 5ISZB 5LCVL 2YD4A 5I17B 4ONGL 2DJSA 4WEUD 4QOKD 3D3VD 1A6AB 5DDHA 5M94B 2AEQH 4Y5XC 4PJBA 2A9NL 5DURB 2X70A 4C54A 3WD5H 3Q1SH 3GSNH 4K71C 5ESAA 3ILPA 2DBLH 2OJEA 5DMKA 1FVDA 4GH7B 4ZAKB 1N5YL 4YHPA 1UXWA 2X9YA 1IBGH 3T4AB 2DF3A 4M6OL 3CXHJ 5HPMB 3MXVL 4I3RL 4HWZA 4O4YL 2VQ1A 2V2XB 4YXHL 1WCQA 3JWOC 3KPPA 4RAUB 4ZUVA 2FECI 4XCFL 4GAGL 2EC9U 4Y16B 4Q6IC 3QIUC 3PDGA 4U6HB 3S4SB 4WO4A 1NFIA 2Q86B 1ZTXH 1QFOA 3QXDB 4HF5H 4OFKA 1KLGB 1XH3A 1J05B 3ARFB 1O7VA 2R2HB 3SJVE 3VDBA 2Q8AL 3PV6B 1KXQE 3WSQH 4P2YA 1FDLL 5FOBA 3N9GL 4P5MA 4X5XA 1ACZA 1BF8A 4RNRB 2RAMA 2PYED 1G7IB 3LB6C 4X6DA 3RDTA 5C8JA 3AREC 5C0BE 2WM0A 1JRHL 3MJGX 1Z5LB 5GS2D 4YX2L 4JJHA 5IW6A 4YHLH 4Q9RH 3ZO0A 5C9JB 4HBCL 4PGEA 1XZ0B 5CJ8A 3RTQC 1IGMH 3O81A 4WHTB 3L5WA 1YEFL 2H32A 4XVUC 1F02I 4UTAH 1KENH 1F58H 2BRRL 4YHNA 1OSPL 2NY5C 1WC7B 4X6FB 2GY5A 4UNVA 1Y6KR 4EEEA 1M71A 1I1FB 3Q48A 3N1PC 3I6KB 3FRUB 3NN8B 3W81A 2FZ3A 2XTJD 2YD3A 4PRAB 5J1TC 3ZKSD 5ILTH 3GSQA 2P5EE 4WI7A 1RURH 3CSBA 1LGVA 5FGBA 5C0CD 1N64L 1S7VB 1IAKB 1I7ZB 1EVUA 1ZT1A 1S7TB 1X5HA 3KGRA 3AS1A 1AJ7H 4YEFA 1JGUH 4L9LC 5E03A 4J3TA 2BCKA 3MRDA 3GIVA 2YMXL 4QRTA 5I9QC 2W65B 4NJAL 4KHTL 1FC2D 3K3QA 3C6LD 1CXEA 1N6QL 2NY5L 4MMZC 3HE7D 1RY7B 3QCTH 4S2SB 4QHKJ 1FZMA 3EFFA 1OAYH 2YPLD 2P24A 4AT6B 1QRND 1CFTA 4WTXA 4NFDA 4U49A 3REWB 3TN0C 4CN1A 4OZIF 5BRZE 5C0JA 1CQKA 4CL7A 4OZFA 2D7OA 4LPXA 4MAYC 5DD1L 3REVA 5KSBB 1XCTA 2I9TB 1PZUB 4XNXL 1MHEB 1KB5H 4YHMH 4C59B 3TCLB 5FA4B 3MV8E 7FABL 5JORA 3WEXB 4RFEA 4KZEH 1I7TA 4Y7MA 1S7UA 3FL7A 5A2LH 1SJEA 3OXSB 1TJHH 3MLUL 2VDLL 3PHQA 4MCZB 2AS5M 3UX9B 2AEPL 2ADJA 5EA0L 3T0EE 3VRLE 3ZKXB 3OR7A 3A6BH 1MRCH 2QHRL 2OSLA 3BFOA 3MGTA 2IBBA 5KVFL 3CDCA 2A83A 3K2MC 1EEYB 2NNAB 4WHDA 4I48B 3V6FA 1ZHBA 3H2WA 1YNTB 3KYNA 4QRSA 4KRPC 3QIBC 1JZ6A 5DR5H 3U2SB 3UJIL 5D6CB 4PRBA 1F11A 1S9KC 5GSRA 4R6UA 5K9JL 3W2DL 3GJEB 1WV7T 3VFPB 4LARH 4Y0GA 3MOBH 2I60L 3O2VL 4JZJA 4HKZA 2CXKA 4HX1A 3T1FB 3W39A 3TZVC 1GGIL 3CMOH 3O6FB 5EIIA 1FVCB 4MJ6A 5J11C 1HIML 3O3DA 1FGNL 4G3YL 3C2SA 1BMGA 2AJ3B 4ZUSB 2B2XH 1U3HB 3KPLB 5I1HH 3IETA 5CILL 2G60L 1IT9H 1RJLB 2Y36H 2CDFB 3D0LB 3QHFH 2VDOH 3UJTL 3PE9A 3JSSA 4CJ1A 4NO2B 5FYLH 2ZG2A 4YC2B 1FFQA 3MV11 3UDWC 3RWHB 3IS1X 3EBAA 3VXNB 2FO4B 5GPRA 1IGCH 3MOQA 5D2NE 3AU1B 4P2CG 5F7YC 4BKLA 2AJUL 5L6YH 2EXWD 5DJ8A 4KJPC 1NBYB 2FATL 5BZDA 3ARXA 1D5BA 5FFLA 3FFCA 4ORGA 3TVMC 2A0LD 2FGWL 1VGKA 4QNPE 2OR8A 3KLAA 3W0WE 4U6VL 1BAFH 1I7UB 4JO3L 4LCUA 1N0LA 4YBQC 1JZ4A 1WWAX 3LKRB 5KVDL 5KZCD 4ZNEE 4HS6B 3RZCB 5JOFA 4KK8C 1WAAF 2ZG3A 5ECJE 1NMCC 2FECL 2ZWLT 2X1WL 1JTTA 2CLZA 5CSZA 3WJJC 3K81A 4HC1H 1LP9E 5BV7B 5T1MA 5E70A 1I7RA 3EUUA 1AGEB 2H9GA 1MQ8A 3RNQB 2C9AA 4ZODA 3BGFB 2GUOB 4OCYH 2R9HD 2Y06L 4H8WC 2H1PL 4XPBH 1G0DA 4XPGL 5L9DH 5ADPL 3O6MH 3RVWD 2CRMA 1JPST 1D3CA 4JN2A 2IGFL 3F12A 5A3ID 1VKXB 2DWDA 4NNXA 2CIIA 5EO9B 1INDL 2C3VA 3L3GA 4MAUH 1BM3H 4X9GA 4EN3D 4M7KH 3QDGD 1H8NA 1N6VA 3MNZA 4Z7QF 5F89A 2D7TH 1OHQA 3VD7A 5DF0A 5AWNL 1G9NC 1KEMH 1NL0L 2D7QA 4AL8H 4M61B 4M3KB 4I2XB 1JWUB 1NFDF 4YQXL 2QEJA 2YD7A 1PY9A 1RAMA 4RISL 2EKSB 4PJCF 1DSFL 1E28B 1SEBA 5E2WH 3WIFB 4EDWH 3CFJB 4NYLA 2VE6B 4P23D 1JN6B 3SE9L 3O8XD 1YMHB 3GSWB 4YWGH 4AENB 4CMMA 4CN6A 4K3JH 3ZDXF 3T8XA 1Q9OB 5GJTL 5HGDB 3MOAH 3GJFB 5IB2B 1LEGB 3MGAA 2ESVD 3V95A 4Y5XB 5E6ID 3BD3A 3NCYP 3GSRA 2DDQL 3V5HB 2EXYC 1DBAL 3DTXA 4OD1L 4M1CD 4I18A 4XCEB 2A73A 4K71B 3WMSA 3AM8A 2YD2A 4YIQB 5JXED 5E8NB 4Y4FC 3QO0B 3MJ7B 3KPRA 4TUOB 3FFDA 1E4WL 3C5JB 5C2BL 1JNHA 4NZRL 2N7BA 3OKDB 4OZIB 4XMLH 1RUPH 3MV9E 3MUY1 4PLKC 2ED7A 2IH3B 2KH2B 5JA9A 5SWSE 5CAYB 2EDDA 4ZTOL 3RL1B 2X1OA 5T1KD 4Q6IB 3QIUB 3KJ6H 5JPNB 5J6HA 5J1AA 2WUCL 1J10A 4F57H 2LU4A 2W9EL 2MKWA 4HKBB 4PP1C 4MDIA 2J6EL 1PG7L 4R96A 2HKFH 2ZSWA 4RSVA 3QA3B 4LF3A 1DDHB 3BVNB 5ISZD 3HR6A 3CFCH 3NIGE 5FKAB 4TUKH 4KUCF 4G80B 4YEEA 1FPTL 2BNUA 4DUVA 2E7HA 4FXKB 2AV7A 4NQUA 5DVMA 4WFEE 2F19H 3SCMC 2JCCE 3AREB 2A38A 2ARWA 4ZD3L 3MZGB 2VTFA 5E2VL 4X9HA 3EOTL 3RTQB 4O02H 4ONFL 1QRKA 4OIIH 5DXWA 2YA1A 4KDWA 1QR1A 4ZAKD 1FNGB 2VZ3A 1OLZA 3O2DL 3RJDA 5T3ZH 1WT5C 5FM8A 3JTTA 1GHFH 4OCMC 3V5KB 1J87A 2NW2B 4RDQG 2V2TA 1MWAB 2R4SH 2VC2L 4Y16D 3HHRB 3MRBB 2VL5A 4F7CA 2WZPD 4CVZA 3DVNB 4TPRL 5E4IA 1T0NA 3TBYB 4LRNL 2I24N 2EDYA 3MV7A 3ARFD 4K3DH 4XB8A 3FZUC 4L9LB 2BSTA 4NQCA 4TNVK 5FUCC 1OARL 1ORSA 2F9BT 1AGCB 1HSBB 3S37H 4UT9H 5TF0A 1LO0H 1BFOB 4PJBE 1JGVL 1T2QL 3IGAB 4R26L 4DWHA 3IDIB 1MFAL 1N0XL 4O2FA 2BHZA 1A7PL 5DRZA 3X17A 3D85A 1IL1B 3TN0B 1P84K 4MAYB 4P2OA 4QTHA 2EYRA 2J7LA 3FMGH 2NR6D 4O9HL 1U8KB 5IK3A 3C09C 4H1LA 3K1DA 4D8PB 3KYKL 3RIAK 2HKHL 4UUJA 1NUNB 5DO2C 3WS6A 1DCLA 4KDTA 2A6JB 4OUOA 1A64A 3RL2B 4ZPTB 2FYYB 3LOWA 3KVQA 4LDOB 2HFEB 4QT5B 1C16A 2FJGA 4JRXB 4HUKB 3RWJA 4LHQB 4C57C 3UBXB 1HILB 4KRPB 3QIBB 4QF1A 3GFUA 2W9DH 3KPNB 3PWNB 4JDVB 1HN1A 2GJJA 5GGRA 2X4OA 3ZHKA 3ESVF 1RZFH 3EYUL 2G5BB 4U1GC 1BZ7A 1I9JL 3BXNA 5DHVA 5FYJU 4X6DE 4OF6A 1ZLSL 1FN4B 3OSKA 3SE3A 1MNUH 1MF2H 4NM4L 4R3SA 3U79A 2Y5TB 3U6RA 5IHZB 1C5CL 3HAEB 4LFHD 5HVGB 4LMQI 1I3VA 4FFZH 3TZVB 2AJXH 1P2CA 4DKEH 5J11B 1CTOA 1OTUD 4WFHD 5J13C 5MHSE 4K8RC 4OF0A 4XTRC 5GGTL 1VCAA 3IJYB 3LY6A 2V17L 4N90D 5HHVH 1NFDB 3ZT6A 2R56L 3VGFA 3HN3A 4U6YB 3VD3A 3WN5C 4P3CL 4PTUA 1T7XA 1L6XA 2VDPL 1PLGH 3CCHA 4OFYD 1S9VA 3GEWB 3PF2A 4L5FL 2CPCA 3I50L 4FQIL 1X6NA 1N4XL 2Z4QA</