4KTDH

Fab fragment of hiv vaccine-elicited cd4bs-directed antibody, ge136, from non-human primate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
217
Chain Sequence
VQLVESGPGLVKPSETLSLTCAVSGGSISTNDWSWIRQPPGKGLEWIGGISGSSGDTDYNPALKSQVTISTDTSKNQFSLKLTSVTAADTAVYYCVREGIVLVNLAVKNWFDVWGPGVLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine-elicited primate antibodies use a distinct approach to the HIV-1 primary receptor binding site informing vaccine redesign.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
molecule keywords GE136 Heavy Chain Fab
total genus 44
structure length 217
sequence length 224
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdH01
3O3AA 1PGRB 2FX7L 4P2YA 4X8JA 5J89A 5IJKA 3WDJA 1RUMH 4QHUA 5JXEA 1P4IL 2DICA 1I7ZB 5K93A 4UNUA 1RAMA 3UTSE 2DJ4A 5IF0A 1MUJB 3VFRA 2SEBA 4XZUB 1W0YT 3SDAD 5FYJU 1IZKA 4ORZC 5I15L 4I18C 2J5LC 3QPXH 5FYKH 2OXGA 3KYKL 4KQ4L 4NYLA 3EYOA 5E9DB 5J06A 1E4KC 5TJWK 2NY1B 3MFFA 1A6UL 3AY4A 4Z7OF 5IF0B 1F4WL 2KH2B 4JAMB 4JQVA 1HCVA 2EDDA 4U49A 1IEHA 4PJ9D 2VISA 3LDBC 5KVFL 1TETH 5KSBF 1BOYA 3V52L 1UCBL 2R4RL 5F7FA 4TRPH 2XZCH 4KRNA 2XN9D 1N5AB 1PKQE 3T0EA 2D7OA 1TJIH 2YPLD 1NSNH 1F6LL 4YDKH 4DAGL 5DK0A 1NDMA 2VDQH 2H45A 4DOHB 4YXLL 1TVBA 4QRPA 1U41A 5D2NA 4EBQL 2IPUG 5HGDA 4TN9A 4F7EA 4L8SC 5IROC 2FH8A 2QV2A 1JZ8A 3P3YA 4ZXBB 5DJXB 3TYGH 4JPIB 2IH3A 1QACA 4I2XB 4AEIL 4LLDB 4MJIB 5GS0D 1CLZH 2KUTA 3GSXA 3MBEB 2ZNXA 4M1CC 1KUMA 5D96B 1CGVA 2YSSA 4PJ8D 2ZSVB 2AV1A 5FM8A 4LVHC 2VWEE 1CXLA 1LO4H 2W9DL 3CXHK 2Z31D 4JR9L 1CFQB 2R29L 1FVCB 3HZVA 5GGSY 2D3VA 5T3ZD 1RV6X 3WFHB 5AYUH 3X3GH 1BWMA 5CJQL 4NZDA 3FFDB 4G6AD 4HUWB 5FK9B 3T2PA 3VCLA 3ZYJA 5AD0A 1FFPB 4QCIA 4X9IA 3L5IA 1FVDB 15C8L 5T5FH 3D2UD 5EG6C 1VFMA 2D7TH 2FJFA 4Z7NF 5I6XB 3LEXA 3RTQC 1WZ1L 3DTXB 3UDWC 1QSED 5EO9B 2X4UA 4PJ7F 4OKDA 5DT1H 3K4ZA 1BF8A 2DKUA 1SJHB 2CK0H 2LU7A 2ZCLH 5DZOA 2HFGL 5CEZD 3SKJL 4UI2A 1WWAX 3AUVA 4CJ0A 1NAMB 4XNMA 1YA5A 4X80L 1B0GB 5FF6B 3T3MF 1WISA 1F97A 5E24E 4GO6B 4Y16A 4PRIE 1CLOL 3WKML 5EU4A 1HNGA 1N5YL 1CXEA 1WTLA 3EYVB 3RVVC 2PR4H 2NY7L 1UXSB 5BV7C 3P4NB 3OKLA 2FX9L 3MRIB 3DVIA 1CFSB 4DKEL 1A5FH 3LIZL 2GITA 1JWMA 1PSKH 3LPWA 1IL1B 1KJ2A 4K3DL 5DYOB 3QA3A 2HFEA 2HRLA 2J4WL 2C9AA 2W9LA 4R7DA 1XCTA 4Y5YC 1BFVL 2I9TA 3QRFM 3GMPB 3O6FB 3MUGA 1EO5A 4F7MA 4B7LA 1UYWL 3VD4A 3M17B 2EDHA 4WY7H 5HI4C 3WD5H 3HCVA 3QBTB 2BVQB 4FXGA 4XMPH 3VXMD 4YHNA 4XTRD 4XCCH 2X2YA 4PB0L 4YHML 1ORSB 3S96A 1TNMA 2YC1B 2ZCKL 3FFCB 3H7LA 4P2RB 5JA9A 2DYPB 3D0VA 1Z3GL 4PLJC 1HEZB 2PNDA 1G7QB 3LKPB 3P9LA 3JV5A 5I8CA 4A2LA 1IC4H 3DXAA 1CL7H 4N0RA 5FDWB 4C55A 4J3UA 1TVDA 4N9OB 4G6ML 2M1KA 2VZ1A 4HIEB 4OB5H 4Z7VB 4FQPA 1I8KA 2JJTA 4EI5C 3BPOC 1D9KC 2XQBH 3EHBD 2KBGA 4L9DA 4ENED 5FDWA 4X7TB 4LPCA 3SDXE 4YAQA 3HRPA 2MCPH 4PRPB 2HTLC 2EYRB 3IJSA 3PWJA 4OCSH 4ZOCA 1JPST 5MENB 5C0GA 5KVEL 5BRZE 3SKOA 2R0KH 3FQWA 1ZXQA 5IB1B 1NLDH 5IGXL 1X5GA 4TVPH 4BSJA 3WFDL 3VRLE 4Q9RH 4UV4L 3QP3A 3UTTE 2F58L 1YMME 4NWUH 2MHAA 4MNGB 4NJAL 1OD7A 4HPOL 2ORBL 4PRID 5T1LB 1JZ2A 3BOVA 5E2TH 1QBMH 4NZJA 2F58H 2KPNA 3MBXL 3INUL 5JIPA 5AUMB 3EYSH 2Q6WB 4LQFL 4WFED 1A9BA 3GKZA 5GGVH 3ZT5A 2B0SH 3D39D 3A6CH 2H1PH 5I1GL 2P8LB 4D8PB 1DE4A 1RHHB 5HYEA 1R5IA 5C0CE 3RVTD 4NKDB 3EBAA 1MCKA 4RSVA 2H32A 3BEWA 3WNKA 1JRHI 1I7RB 1Q0XH 3OKLB 4MB4A 3CDYA 2W1NA 3UROR 2EE9A 5C08E 4PJDE 3VXOB 1FLRL 3VXUA 1A6AA 4RGMB 4LLYA 4EI5D 4Z77A 3BPCA 3HNTH 3SGEH 4YXHL 3O4OB 1X4XA 1ZVHA 3FB8B 1WBZA 1UZ8B 2FZ3B 4OV6F 4XPTH 2B0SL 3B3IA 4GBXA 3MRKA 1KENL 3OGCA 1ZV5A 3MGAA 2XTLA 4GBXC 3HUJB 2ARJB 1OSPL 2YEZA 4IRZH 3C6SB 4X7EC 3SDDA 4P2CG 4YBLB 4JPKL 3RIFF 1CE6A 1NCDH 1H3PH 1DQDH 5IHUL 3RQ3A 3UX9B 5KZCD 2CMRH 4X6CF 1K3ZA 4LKCB 1I3UA 4XP5L 3UC0H 3QIWC 1U58A 1I4FA 4KKNA 3V6OC 1Q94B 5L8JB 1IEAA 1B3JA 1MQKH 2VDMH 2RQ8A 4M5ZL 2VNCA 4HV8B 2XA8L 3O3AB 4G5ZH 4GAGL 4DGVH 4O51A 4JHWL 5I0ZA 4LASL 1QEWB 5TH2B 1DEEA 1EK3A 2Y06H 4WHYH 4X8XA 5C07A 3U0PB 1CICD 2OM5A 3MC0A 1F4XL 5L9DH 3RVWC 1ACYL 2M26A 5JW5B 3MLZL 5H94B 5JHLH 4O51B 4CBPA 2A6KB 1F45A 3N06B 1QPXA 4YO0B 5DEFB 4M6OH 4CU6A 2RIKA 5DJZB 4U1KB 3UTPE 4PJEB 4G6MH 1LO0L 1FZOB 4MLSA 4BUGA 5GISH 1D5XB 3AM8A 2OR8A 1A7PH 2VMFA 3BUYB 3QIUC 3CDCA 4WGVB 2AK4B 3P9MA 4I3SL 2OL3B 3BZ4B 4NM4L 5T1LA 2XFXA 1ZHKB 5GZND 3A6BL 3C9NA 1K8DA 1SJEB 4U1NA 2VITA 2Q87A 5DD1H 3FQRA 3AY4C 3P77A 3EYUH 2H32H 4PRHE 4OZHA 3OG6B 1DUZA 1MVUB 2V5RA 3PJSA 2ATPA 5MERB 4C56E 3PL6A 5EUOA 3CVIH 1P7KB 3T0VA 1IM3A 1OWWA 4U1GB 1CF8L 1QFUL 3RA7H 2QSQA 5C09D 3GIZL 4UILH 2ED7A 4RFOH 5B39B 4D3CH 4Z0BH 3SDDC 3VFWB 1Z9MA 3QFJE 4J3VA 2LTQC 4PS4L 4K8RC 4GXVL 3FMGH 1T0MA 1TQCB 1AD0B 1CQKA 5C08A 1CFNB 4HF5L 2W65A 1U3YA 4FQHB 1IQDA 2CSPA 5D1QC 1CLCA 3P0YL 5E2JA 3R8BB 1QUNA 3W39B 1YN6A 5IOPB 3MCKB 3HLAA 4BSVB 1CGYA 2F53E 1AI1L 2NY4C 1HXMB 2VLME 4FQ1L 5DFTA 4ZOEA 3QEHA 4PD4K 2NY6D 1N59B 4K7PY 1YY8B 1JPFB 4J3WA 4Y4KC 1AD9B 4DJMA 3NCFB 4IMLB 4UT7L 1BLNB 2YA0A 4ODXA 2JK5A 1H8SA 3BISA 4F3FB 5D9SA 2ZJSL 2BFVL 4KI5C 5JLZB 3G6AB 1N59A 2C3HA 5BV7H 1MFDH 4WO4D 3G5YB 5I8CB 4R6UA 1GGIL 1U93A 4Z7UF 1BQHB 1SEBB 5E8EB 1WV7T 3ZYOA 4BM7A 2J8OA 1BD2D 3FFCA 4O2EB 4W70A 4QWWD 4ONHA 2X6MA 4Y16C 3LHPL 5I9QB 4W4OA 3MJGX 2E7BA 3HE7C 1I9RH 2EYTA 2WBKA 3W0WD 2QL1A 3DUSB 1FV1B 3NGBC 1TTFA 4W4NA 2HMID 2ZUQB 4HIJB 5L7XL 1GPOL 3ULVL 3P4OA 1P4BL 3CH1B 2E7CA 3ARBC 3HCVB 5I8OL 5IVZA 2EEBA 1Y6MR 4KHXL 4ZDHA 1ZK9A 3ZYZA 1IM9B 3T8XB 3TO4B 5DD1L 5EBMB 5GRWA 1WIOA 3D69B 4NUJB 2DOCA 1ZLVK 2FBJH 1JPGB 4KDWA 4YC2C 3S96B 3GJEA 3RNQB 1WT5C 3RGVD 3QCTH 1X5LA 1XIWD 3MNZB 4J2XA 4UT6L 2XG4A 5HI5C 1F3JB 3EFFA 3V8OA 3K46A 4HBCH 4XNYL 1RZJC 1SEBA 1KENH 2DWDA 2VLRB 1HI6A 3GGWA 2CO7B 5HHME 5JA8B 1NMAH 3RX7A 5IW1A 4GW1A 5FUOH 1NUGA 1G7IB 3MNZA 5AD0B 1I8KB 3C60D 1LEGA 2OXHA 1QZ1A 2DAVA 5KSAD 4A6YB 5C0BA 5IMLA 1HHIA 1B4JH 3LY6A 1AH1A 3UBXG 4G9DB 1NMAL 2ICEB 3BUTA 4Y4HC 3MROB 1NUFA 2D9CA 5T5NG 3WL9B 1I3RA 4LLUA 1F6AA 3DX7B 5I1JL 4GUPB 5FXCH 3S5LG 2CRZA 3TESA 3L9RB 4L4VE 1FFPA 1UACL 2BERA 2GK2A 4I2XA 3NH7L 2AEPL 5GRXG 2Q8BH 4EDXA 3EDJA 3LRSB 4OF0A 3BW9B 2F74B 3BX7C 5BS0A 4QHKI 3VGDA 1Y6KR 2VLRE 2XT1B 2CJUH 4JO1H 3VMPA 4YHOL 1S7VB 1YEHH 3K0WA 4KC3B 3BGMA 2C26A 4LSDA 4MMXC 2FRGP 3NAAL 3LMJL 4IDJH 1I9RL 2A73A 1GJIA 3MA7A 4K3HA 4PYGA 1Q9OB 3O3EA 1I9JL 3I02A 1B88A 3L7FB 3C5SB 1JF6A 4FMFA 3X14A 3FT4A 3VWKA 1LO5B 2P43B 5HPMB 1CTOA 4JM2C 1KCSL 3IXTB 4JQIH 3BPLB 1MPAL 1D5ZA 1Q0YL 3S6CA 1CGUA 3CDGB 2I27N 5C07D 2QQKL 1J87A 2ZPKH 4U6HB 4UT7H 4GT7A 4OIAA 3HUJE 1QBLH 2COQA 3LQAL 3LKSB 3FB7A 4LVNC 5C7XH 1RJYB 3LEVL 1UM4H 5I1CL 3QQ4B 1IC4L 1NDGA 3FO2A 5TFSL 4BQBA 2BJML 3U30C 3LH2L 4ZFOA 2AJ3A 4RGNE 1I1AC 5EBLA 2Y36H 4X98B 3B9EA 4HV8A 3TGXA 3F6IA 3DV6A 5T1MA 1CU4H 5T1LD 2VERN 3K8LA 4HHAB 2C3WA 2FSEA 2N4IA 4M48H 5KSBE 4LSQH 4MA3B 3VFVA 5GS1C 2FGWH 4GXVH 5AG8A 4OLXH 5F6IB 3HPJB 1MIEL 2E6JA 1A2YB 4Z7WE 2DLEA 5AAMA 4M7KL 2NXZB 3CIQA 3GSXB 4WW1B 1DVFB 3BXNA 2EXYD 2X41A 1FYHB 3KPRD 3NIDF 3EYUL 1P7QA 2DLFH 5K33A 4MA7L 4URTB 3E3QE 4FABL 5E8NA 3QULA 3NIGF 3DV6B 5MENA 1M71A 3UTSB 1MFAL 4ZQKA 3VG0L 2WUBL 3N1FC 2AJVH 1R3LA 1KB5B 2VR5A 5JTWA 3ZE2E 3RZWA 4HGKC 1KIQA 5K9JH 1QR4A 1AO7A 5JW4M 3WHE1 2NMSA 1Z9LA 1Q9WA 1KT2A 1B2WH 4W4OC 4R7NB 1R5IB 1IC1A 4YXKH 4AENA 4F58H 4WJ5B 1NMCB 5FYKE 4X4YB 1M7DA 1E4KA 3WHE0 2PXYB 4QRTA 4PR5B 5TDPB 1MJJA 3QNXA 4C83A 4KKLC 5IG7A 2I5YL 2Y06L 4WRLA 5C0RH 1UA6H 2CGRH 4PJEE 5I8EA 4OKVA 1XGTB 3WNNA 4LASH 5JXEC 1XGYH 1VGEH 3ROOA 3VXSB 2C1OA 3QUZC 4DK3A 1CLZL 1GHFL 4UQ2A 3K4DA 4NN6C 1HH6B 3GZKA 4N0UE 2UZIL 4F37F 2X4NB 3Q6GL 1F42A 4Y7MA 3T2OA 3T4YA 4CW1A 2F5BH 3QIBC 3MUGB 1EO7A 3W0WA 3LKQB 5CHNA 5AUMA 1FNEB 1JWUB 3G6JE 4R26H 2VDQL 4MJ6B 3ESVF 2Z93B 4KMLB 3V7AE 1IGFH 1E4XL 2J4WH 1TJIL 2J8UE 3VG9B 1II4E 1NGXA 1AGBB 2VDPH 4W6WB 2VLLA 3CFDA 4QGTA 1JHLL 3MRIA 3MBED 2ED9A 4NQED 1FNFA 5GQBA 2BRRH 4P4KC 1OCWH 2B1HH 1D6VL 5DJ6B 5LJYH 2OI9B 1WF5A 1BJ8A 1PX3A 3UMTA 4JREB 4PJFB 4XPFL 5BW7A 3EOBA 3GBNL 3QZWG 4ORGA 4FQHA 4QXWA 1SBSH 3QUZA 1JFQL 1HH6A 5DUBA 3RNKB 4LARL 4ZUVB 3PV6B 1AP2A 4PJFA 4JFYB 3TBTB 5IV2A 3AS2A 5GZOC 5KG9A 1J1OH 4PJCE 2QSVA 2R23A 3BH9A 5E99L 3MYZA 4TSAL 5F70A 2NXYB 1FH5H 3KHQA 5FUZH 3HPLA 5JZ7C 2EYTB 3QSKB 1JN6B 2JIXD 3OKKA 5HI5D 4LGPB 4ZUVA 3VWJB 4RDQF 3EKCA 3TC9A 2GUOB 3QQ3A 4GMSH 1KPVA 4RMTA 5IVZB 4FQ2H 1UC6A 4I5BB 3CFJB 4KUZL 1UZ6E 4QRRA 7FABH 5D1QD 5IB3A 4XPHH 1VFBB 1JGEB 5EU5B 2GUOA 2HMIC 5FUCE 4HZAA 5AZEH 3D0VB 3UTOA 4ONGH 4NDMA 3FB5A 5D8JL 1N64L 2BHZA 5DEZA 3ZT6A 1LP9B 4L4TD 1OAZH 4K2UL 3L5XL 1X5YA 1BVLB 2BY2A 3O2DA 4LEXH 5ANMA 4PJBB 3OZ9L 1J5OL 4ODVH 1QSFD 5TDOA 3TPUA 5CEZE 4P46A 4S0SD 5DGQA 3PF2A 1UM5L 3O6MH 1YY9D 1F8TH 1R3HB 4JJ5A 3BVNB 5F9JA 3WSQH 1QFWM 2IF7A 1NSNL 4P46C 3RWIA 3CK0H 1KTDA 4CVZA 1J12A 2XZCL 1V3LA 5L0QC 5B8CC 3ARSA 1ZA6B 1NANI 1FAIH 2EIZB 2OMNA 1D6EA 2OL3L 3QNXB 2DYPD 2ADFL 3OMZA 1NAKH 5J11C 5I30L 3V4PH 3QUXD 1Z6JT 2VH5L 5KS9B 2MQ3A 1QEWA 2NY4D 1CGWA 3TBWA 1S7RA 1QG3A 2PW1B 3CK0L 1OM3H 4Q74A 4DCQA 2A6KA 3Q1SL 2V7NA 1NBZA 3W0WB 4N8PA 3I9GH 4KDTA 3BWAB 2RAMA 3BN9C 4ZOAA 2YRZA 3KPQB 4UZGA 2YSSB 2ZSVA 5IHBA 2DQGL 2IG2H 4GLRH 2HT2D 1ZKAA 3MJ9L 4M7ZC 3MLYH 4LAQL 4QRQB 4KGLA 3OPZH 1XCQA 4ZTOH 3FZUD 2X10A 4PB0H 1BVKB 2VRAA 4ZUWB 4F9LA 5I76A 4HWEH 5K9KA 2VLKD 5E2VH 3QO1A 2CLVA 2DI7A 3H7BB 3RGVB 1MHEA 5HVFB 5ICYA 1UXSA 5MEQA 1UCTA 1L0YA 3LN9A 4ODBD 2V7HA 1T21B 2AI0H 5L88H 5CWSA 4Z8FH 3U0WH 4Z76A 3MNVB 3VFGH 4WI7A 1MHEB 4QRRE 5BVPH 1MHCB 4M8VA 1PSKL 4NRYA 4N8VA 1TCRA 5J6HB 3G04A 4ISVB 5HYSB 1T7VA 2OR7A 4LSUH 4P4KA 3IDJA 3SKMA 1CDBA 2C7UB 2DWEB 4PJFE 2VLMD 5C6WH 1U8IB 5HSFA 4NUGH 1S9VA 4F8TA 2XXMB 5C8JA 5ETUB 3QXUA 1V3JA 3GSWB 4NRYB 1HE7A 1UZ8A 4F7PA 1LD9A 3Q5YA 1A7QH 3O2WL 3LQZB 4LCWA 3QIBA 3QG7L 5FCSH 5D93B 2X4TB 3WFBH 2SEBB 4B41A 3FONA 3QEUA 5E1AB 1T21A 1FYTD 3VE0A 2BNUA 4XTRC 3H3BC 5F3BA 3HI5L 4GS7C 3OAUH 5DD0L 4XNUL 5C3LD 4Y5XC 4U0RB 1XGUA 2X09A 2F5AH 1JGDA 1PW3A 2AJXH 4N8VB 3GJEB 5JHDE 1CIDA 3T2NH 2NY0B 3L3HB 4OZIB 1AXIB 3B83A 1U8OB 1I8LA 3O6KL 3U6RA 3V8CA 1IAKA 1IEAB 4HWBA 4H88L 1MUJA 3MRFA 2R15A 5A2JH 1V7MH 2E7LA 1AXTL 4MAUL 3SE9H 4BZ2L 1N6QL 1LDPL 3H8NA 4Z7QE 1PVHA 3DSNA 1XGYL 4R2GD 4R96B 4U1JA 3CX5J 1MLBA 3RI5F 5E8OA 5C0CA 1RZJL 5FGCB 5SWZB 1KN4L 3HMXH 5DJ8A 4PJAE 5IMKA 1FH5L 4GBXD 5FUZL 4BZ2H 1FFNA 4X4MA 5F1KC 3LCYA 2UYLB 3MROA 4X4ME 1GL4B 3MMEB 4WI2A 4D0DB 4NQEA 4NKDA 3FB6A 1DN0B 4LLVB 1K8IB 3HE7A 1PZ5B 4S1QH 3MNWA 1NL0L 2OJZH 1V7NL 3DO7A 2IMNA 2DL2A 5EUKB 1TJHL 3KNBA 4KMTH 2XZAL 4GRWE 1UCBH 3PWPA 2AEQL 3CLEL 2V9TA 3UJJH 1J11A 4PTTB 5EPMB 4E0RA 3SOBL 3HC3H 4HGMA 2WUBH 4Z7UE 5HGHA 4GQ9H 3BD5A 4KK8D 3OWEA 2DQCH 2J12B 3GMLA 5DUPL 5ACMA 1KTLA 3JV0A 2UV3A 3KPLB 3GSOB 3MYJA 4DVBB 5JMRA 2VDNH 2JIXA 1BFSA 3N85L 4G6JH 1AGFA 3SGKA 1S9WB 3U82B 4RISL 4WUKL 3T65A 3LS5L 3C8DA 1J1PL 4TNWK 1K6QH 1UT9A 4U1IB 4PJBE 5CIPH 2HFFB 4H0HB 1FPTH 5AYQA 3P0VL 3OPZL 5IIEA 3SGJA 1F02I 3ZKSD 3P4NA 2DQEL 2WQ8A 2YWYA 2XQYG 5IVXE 4KRPC 1CFNA 1NC2A 5IV2B 5IVXA 1AHWA 4X9BA 1JZ3A 4QRSB 3SJVB 1MNUH 5EN2B 1GOGA 4ERSL 3QNYB 3RNKA 1P2CB 2VOTA 2AAVA 3WXWL 1RFDH 1B0GA 1IQWH 1R0AH 1UVQA 1S7UB 5I18H 3KPSE 3PP3H 2YOCA 3WS6C 1NCBH 4XP6L 3RPKA 4MVBD 2VLJB 3QFDA 1LK2B 4U6VL 3HI5H 3LRHA 1VADB 1UM4L 3IETB 3BDXA 3UEZA 2UY6A 2GKIA 3PGFL 1ZLWK 5IR1B 1JZ4A 2DF3A 4M61B 4MNHB 5KSBA 5D9SB 4F9PA 4OI9A 1U3HD 4G8GE 1BOGB 4ZD3L 4JKLA 2QQNH 8CGTA 4K7PX 4NQCD 4NO3A 5CZXC 4RFEA 4P4RA 4OZ4B 3VFPA 1N7MH 4F7MB 2Q8AH 4K7PH 3VXME 2CUHA 4X7SH 4Y2DA 1TITA 5C08D 4MDIA 4PRHA 2HH0L 2V5SA 3GI9L 4KK6D 1ZANH 3CFCH 2XWBB 5GPRA 2AKRB 5FA3A 5DDHB 4IS6A 3BKYH 5ACZB 1MLBB 1MAJA 4V1DE 1OP3K 1SEQH 1U8LB 1FZOA 5CJ8A 3IFOA 5INDB 3MOAL 1IGMH 3DGCR 4NC1E 4O00A 2HVKB 3VFGL 1UKTA 1A3QA 4JFPA 1CGSL 4HUNB 4ZTPL 5TDPA 1MNUL 2YD5A 5JO5B 4LCYB 4BFIB 2XRAL 3I75B 4G6AC 1W2KT 4M48L 4RA0C 4L8CB 4EXPX 2E7HA 4TPRL 2ENYA 1CGSH 1OAZL 1E4WH 3PP4H 5DHVB 4AENB 5EO0A 2C4FU 1BD2B 4MB3A 1A7OH 3VXSE 2YZ8A 2XFXB 5CKGA 5IW6A 1QRNA 3QRGH 3RVXC 4WFEE 3PV7A 1SJHA 1QVOB 2FATH 4WO4A 4XHJD 1WVZA 1C1EL 4F7EB 2HAZA 4OCXL 2G75A 3P77B 1JNLL 3OAYH 1HQ4A 3Q1SH 1DQJB 4MXQC 2APVA 3MNWB 4UAOC 1C5DB 4GKOA 1QBBA 4ZUWA 5ESVB 3VFUA 1XIWB 4XVUD 1ZHKA 1MCJA 4IOFD 4LU5H 5GGUB 1IKNC 4JDZB 5BRZD 3KWWA 4BZ1L 3JTTA 3L3JB 1UM6H 1GIGH 3O81A 4I8DA 1GRWA 3VGHA 4CNIB 3QYCA 3U9PH 1XIWA 5EZOH 3ECBB 1IGFL 2VE6B 1NL0H 3C60B 5JQ6L 1IQWL 3PJSB 3RVXD 5EOCH 5GGQL 5FDYA 1HWHB 4TYUA 3V5DB 3EYFA 3VFVB 1Z5LB 2G75B 2HP4A 5CLTA 3CVHB 3WJJA 5C8JB 4GH7B 1QYGH 4PGDB 3C60A 4MD0B 3MV01 5J6GA 5K9KB 4P4KB 4YR6A 2O61A 2X1WL 3QI9C 2ATKA 4POYA 2V5MA 1UA6L 3QCVL 1N6QH 3RL1B 2GJZA 3QXAA 5C0FA 1BM3L 2GTWB 3OXSB 4JG0H 2IFGA 3HFMH 3HI6L 4KTEH 1KACB 4DFIA 1NBVH 5C0JB 3FQWB 2PETA 3QIBB 4I0PB 4XCFH 1EEYA 4DGYL 4Y8AA 1MCFA 2OR9H 2HT3C 4NHUB 1FNGB 2A74B 1CQYA 1J0JA 3O3BA 1XH3B 3RL2A 4FFZH 1CDUA 5FHBH 1JTOA 2Z35B 2MHAB 3MLXH 1BAFL 4G43B 4G8EA 5DD0H 3PWVA 3MRHA 3TBSB 4PJ9C 5E6IB 1IGIH 3MLUH 3PWPD 2A6JA 2I60L 4XI5C 5EA0L 2ADGB 4WUUE 2CDEB 5C09B 3RWHB 3UYOD 2PXYC 3QCTL 5DSCB 2WK2A 4ALAL 5JQHC 1OP9A 2OJZL 1JV5B 1NMCC 2WBWB 4HULB 3DVNB 2FR4B 1K3IA 4OGXH 1FE8L 2YPVH 4L9LC 3BIAX 2V5TA 3ZDXF 1DUYB 1DL7H 1G7IA 3SGEI 5MHSD 3O4LD 4X5LA 4RA3A 3OHXA 4JDVB 5LAXA 5IFJA 1KLGB 1FDLL 2Z8VC 3D2UA 4EQ2A 2AS5M 1JPTL 2FJGA 3L95B 3VXNA 3AXLB 4JHZA 1UB5A 3QUKA 3X3FH 5F93C 1CXIA 4OLWL 1LE9A 5AWNL 2CR6A 4O5LL 3GFUA 5EBMA 2WBJD 4N0UA 4MA7H 1QO3B 3ARFC 1KCRL 5IBTH 3MRGB 3AB0B 3STLA 4MSWA 3VFNB 3KXFE 1H3VA 2EDWA 2H2PC 4HWEL 1E4JA 4LHUB 4HDIA 1DQQB 5KTEL 1RULH 5TQ0L 1HHHB 3TBYA 3IJYA 4HUUB 4YHPA 5TFSH 4OLXL 5T1KA 1LNUA 1ZA6A 5T3XD 4JFZH 5F6IC 2DMCA 3T65B 3V6BR 3HC4H 2RBLA 1YMMB 4YHYC 1N0XH 1DBKL 1QHOA 2P8LA 3C8KA 5H8DA 3F12A 2B2XH 1QLEL 2P5ED 2AABL 3MV8A 3W9DB 3QIWA 5FYJE 4YXKL 1R3HA 3I6GB 4JJ5B 4UOW1 3UTSD 2ZZUT 5L9DL 2EDLA 4IBLT 2BHYA 5I30H 1NC2B 3LN4B 1I1AB 2G5BA 1UZ6F 1RJZB 4LCUA 4G7VL 3EJZD 4KJWD 2BDNL 4OJFH 4MQ7B 5I16A 2A83B 3JZ7A 5HJ3B 1T1XB 4YE4L 3W39A 5MEND 4FQQA 3IKKA 4PGEB 3I6LE 3LS4L 4FQXD 3MRNA 4L8DB 3ULVC 3VD5A 5L8KB 1BHGA 3BWUC 5AAWA 4X6CA 4X9GA 1G7HB 2EDJA 4PG9B 1KCSH 2DTMH 1KLUB 1PY9A 4HD9A 3TNMB 1YEJL 2NYYD 5FYJD 3BPLC 3ZKMD 2Y5TB 3SDCC 2JK5B 4HIJA 4AQOA 3L5XH 2YBRB 3CU1A 3WUWA 1X5ZA 1IC5L 3GHEH 3ALPA 4YDJA 5IIEB 3TIDB 1IL1A 5DYOA 5FM4A 1J18A 2QR0A 5F21B 3VXQB 2D4DA 4XWOC 3L1OH 4PJCA 1QLFB 1AGCA 1BFTA 5HI3D 3V5HB 3VI3E 1AGDA 2JJSA 4FQXC 3VE0B 5HBBA 3HRZB 4RGNC 1JWSB 4HT1L 3AS3A 3IDNB 1WWCA 2A6IB 4K71C 3I9GL 1I1YA 3T09A 1JV5A 2A9NH 1BECA 4DZBA 2WUCL 4RWHA 3S8WA 1UKSA 3G6DL 1XF3A 3FRPA 4QOKA 2X1XR 2JJWA 4RGOH 4D0DA 5CEZH 3ZE0E 1IAIH 1T2QL 5C3TA 2W0LA 1QOKA 4JAMA 1J1OL 2MFNA 2RFXA 4F57L 5HYSA 4RMSA 2O5YL 4CUCA 4Y4HB 1NGZA 2WUCH 3HZMB 1EHLL 5D6DC 4ONFH 4HS3B 32C2A 5FV1L 1ZT7A 1G9MH 4JB9H 2QQKH 4Q6IB 3DBXB 4FG6D 1MCQA 1OTTD 1T83A 5F3HB 3D39A 5LBSH 4LSVL 2BRQA 3D87B 3QDGB 1L0QA 1IAKB 1IE5A 5IBLD 4FP8L 5C07B 3CNKA 1CG9A 1RSFA 5D72H 1DQMH 4APQC 4YJZL 5LGKA 5B39A 1BJ1H 3D6GA 3V0VB 1QBAA 2AXFB 3LHPH 5IP4A 1KJ3L 2E8YA 5LG1A 1YEIH 3GKWH 1MJJB 3FOMA 2RJMA 2R1WA 5ITBH 4KQ3L 2C4FT 4EI5A 5TE7L 5IT2L 3N9GL 3RVUC 3SHSA 1MCPL 1U8OA 2VIRB 2VLJE 3ARBB 4HX1B 2EKSA 4Z7OE 4OAWB 2ZUQC 4YWGL 1NAMA 1TIUA 1LEKA 3HUJF 1DANU 4QF1A 3MXVL 1U3HB 4XPBL 1QQDB 1Q9WB 5C09E 3TN0D 4WIQA 3UJTH 3R06A 3H2WA 4QRRD 2BY1A 4TUOA 4F57H 3SDXA 3L3JA 4DQOH 3ULSB 2X70A 1DFBL 5E99H 2Y07H 3LEXB 2VN4A 5DEGB 1ZVSB 3LKSA 2NXZD 4RZCB 3FCTA 5GSVB 1CVRA 3FN9A 3PDOB 3VU2A 1HHKB 4LKXA 2Z4QB 1MOEA 3LRGA 3BE1H 1QSFA 2BVYA 3RKDC 3AC0A 4P46D 2GTWA 4M1DH 4FQ1H 2P5WE 1JGVL 1AKJB 4Z0BL 3VJ6A 4Q97A 2DWEA 4U7KA 2ADIB 2NY4B 3FB7B 4UT6H 2PW2A 4JKMA 4XCCL 4E5XB 1Q9OA 2CUIA 4UQ3B 3OKYA 4HWBH 1A2YA 2BSSA 1TJGL 5DFVD 2IANE 4XWGH 1X6NA 4Q9RL 4NCDA 1YEJH 2DQHL 3IDMA 2YD9A 3QUXA 5HGDB 2YUVA 3GDBA 3UTPD 4JGMA 5DI8B 5H35A 3TJHD 1TJGH 5EWIH 4RWYH 2LTQB 4X8JB 3HMXA 3C6SA 3SDDB 3QDME 3DGGB 5F89B 1T66C 1X5FA 4U1GC 2VLKB 1VFBA 1KCUL 1BQHG 2MCPL 1MJ7H 4YAQB 4HW6A 4NQEE 2B4CC 1AC6A 3K80A 4NFDA 3HC0B 4UT9L 4HMEA 3E6FB 3MFFB 4KHTL 2XQBL 3OL2A 5EZLB 1HHIB 4JY4A 1BZ7B 3D5OF 3L3GA 4HIEA 2BOBA 3LD8B 5F7KC 3VFTB 5GIRA 4NQSA 4UT9H 1AE6H 2R0WL 1WSST 1B2WL 4BSWB 4TSBL 1P1ZB 4PJDB 4CVUA 4HUMB 5IEHB 1Z3GH 2R2HB 2I24N 4R97B 1FZKA 3NABL 1QA9A 1YZZA 1QBLL 2CLRA 2FCBA 5FYKU 4XP1L 1E27A 3EYQD 2FO4B 4P4KD 4L8SA 5IMLB 4BH8A 1UEYA 1ZHLB 4WFGD 2CUMA 1EAPB 4K23L 5CZKA 4PP2A 1FO0B 5IBTL 4GSDH 2FIKB 1F2QA 4HH8A 5EU6B 4WFGE 4FQXA 5T1KB 3NIFE 4IOSD 3JV6A 1WBXB 2XA3A 4IHOA 1OAYH 4G8FA 2A2QT 4HDIB 4LCWD 1UJ3B 3ELAT 3QIBD 1OSPH 3L9RA 3IGAA 4AIZB 1Z0MA 3BGAA 4RWYL 2R4SH 1ITBB 1MIEH 5JXED 1DBJH 2K7PA 3TBVA 3VRIA 1FE8H 2YHGA 2YPVL 3QIWB 3A0OA 4YDKL 2J1KA 2DQFA 3DUUA 5ESQA 3G08A 3HNSL 4LPVA 5KJRH 4I3RL 2YRLA 1CFSA 2EXWC 3UYPA 3ARDC 3HB3D 4IRSC 4M7JL 4RIRB 4ETQA 3O0RH 3UTZA 5J7CC 3FT3A 1DFBH 4KH2A 2VTFA 3CSBA 2H8PA 2H3NB 2PN5A 1IGYA 2I9LB 3DRQA 5IB5B 4U31A 3K8KA 4JFYA 5E8PB 2A1WL 1M4KA 4WTZG 4P49A 1IQDB 4LL9A 2EE3A 3T0ED 4Z7VA 4FXGB 3F7PC 5L2KB 2H1PL 1TVHA 3DROA 3O4OC 1N6UA 2YWZA 4KXZI 1I7TB 3L3KB 1P4IH 1F4XH 3WLBA 1SVZA 4LLQB 2BMKB 3C87A 4X6FA 4C56B 2V6HA 1QBML 3DNKA 1I9EA 3MJ6A 4KUCD 4PGEA 4X6DB 5I2IA 3BZEA 2FLRT 2PTUA 2EH8L 4NT6B 3K7UA 4U6XB 1KB5H 3GHEL 1KTRL 4S1DD 1FFOB 4HJGB 4U2YA 6CGTA 4LSVH 4Q6IC 2VN7A 1GC1L 1C12A 5HYJB 2B8OT 1T1WA 3TWCL 3W81A 1I85A 5KVEH 1P9MA 3L3HA 4OZIA 1ACZA 1WIUA 1YNLH 4YIQA 1T1YA 3UBXA 3TPKA 4XCNA 2GW5A 4PJIA 4HPOH 3GI9H 4CKVX 2OS7A 3MUJA 2VZTA 3I6KB 1XZ0B 2BNRE 2GEEA 5HHOE 1S5HA 3KLHC 5ECJE 5IMOB 2XPGB 4FRWA 4HIHB 3TN0A 4KXZH 5EUKA 2HJKA 3CMGA 5BZDA 4LHUA 3SJVD 5E2UL 2E6QA 3DURB 3MJ8B 2B2XL 3QULB 2ITDA 4AG4H 2BVPA 5FYKL 4HKBB 2DDQH 4U1NB 3GMNB 5D70L 3ZHLA 3OKDA 5FUOL 2M2DA 1U2HA 2V17L 1A3RL 4KI5F 4WWKD 1FFNB 4FFWC 4MHHI 1BX2A 4R8WH 5F88B 2A0LC 4OCMC 3L1OL 4QCIB 2NLJA 3MLSH 2R9HD 2GAZA 1ZGLA 2WV3A 1AQKH 2WSKA 4R4ND 3BPOB 4NJ9L 3DWTA 4DTGH 4NBXB 3A6CL 1YJDC 1EO8H 3K4AA 1MQ8A 2ESVA 5LGJB 4PLNC 2J8UA 4PY7B 5EIQA 1U8MB 1FFQA 5F7HA 4HS6A 2Z8WC 3QUMH 2NNAB 5HPMA 5ICYB 5FA4B 4AM0A 5GGRY 1DLHA 4UDUA 4I9WD 2ZOKB 1UXWA 3M07A 1E28A 3R06B 5ALCH 5IMMA 5DURD 1JUFA 3RU8L 2NR6C 1MJ8H 3L3IA 3CVIL 2PTTB 4JFFE 4JO2H 4PRAB 4OLVL 2ZUSA 3I2CL 5FA4A 1EBPA 3T04D 3WJJC 5K59F 5GRVK 5FGRA 4PP1D 4DW2H 3WKMH 4AT6A 2FIRT 2P1YA 3PWNB 4NOBA 1H5BA 1NLDL 1BJMA 3JV4B 5FB8A 3VXRD 3O6FC 4K94C 1A47A 2VDRL 4GW4A 4PGCA 4YHYB 1BWWA 3LS4H 5C0IA 3DV4A 1MI5A 1IAOB 3CDGA 5LQBH 1T3FB 2YD3A 4XBGB 3B9KA 3UTQB 3GSRB 4M1DL 4F15B 5JHDB 4U6VH 4L3EE 4PTUB 43C9A 1ZT1A 2D31A 4HUXB 4P0DA 4TSBH 3F6LA 4JY5H 5CBAA 2JELH 3QDGD 4XB8A 4RFEB 4WU7A 2QADD 5D71H 1KELH 2FZ3A 5I18L 1I9IL 4NYLB 1MLCA 1EIBA 4X80H 4P5KB 3OJDA 3KDMA 1NBVL 2R0LH 2GK0B 5I1KL 2O5XL 2H9GB 5SWZE 1H8NA 3TIEB 5FOBB 2ZUVA 3QG6A 5B8CA 1CGTA 4WW2B 1KCUH 3RPIB 1NQBA 1WZ1H 1NFDE 2IGFL 1VEPA 4GRLB 4EN3D 5D7SL 3FO1A 1CE6B 3KR3L 4WEBL 4HIIA 4XCNB 1LGVA 4FZEL 4NT6A 4OFIA 3AU1A 2VXTL 5I6XC 2HVJB 3KYOA 5ILTH 5IJVA 1KCKA 3F5WB 1P2CA 5KW9H 2GHWB 2O26U 4LSRL 3F7YA 5LVEA 4I3GA 3OGCB 5KSUA 3NZ8B 2DJSA 4QRRB 2GCYA 1AO7E 4OZ4A 1ZLWH 1PYWB 5HHQA 4HFUL 3N85H 2BVPB 5C0ND 3T1FA 4P59H 5AWNH 4LVHB 1Q72L 3OR7B 4K3DH 1KCVL 3A6BH 1MH5A 5DXWA 1JPTH 5D96C 5E6IC 4DFHA 4N0CC 1H3TA 2V9QA 3MLUL 3OAUL 4WU5A 2K1MA 1EFXA 4FP8H 1MEXH 2VXUL 4BQ8A 3OKMB 3OJ2C 2XTJC 3MV7A 4LFHG 4C4KT 1EUUA 3QDMB 3V4VL 2YUZA 1ZHLA 5H37H 3MRLA 2ICWJ 3B8YA 1I85C 2R4RH 4Z0XB 5D6CA 1QFWL 4ZFFB 4HWZA 1ACYH 2EDYA 3HI6H 4KTEL 3ZMRA 1CZ8L 1GGCL 2DB8A 5FOJA 5EB9A 2AEIT 1NUNB 4J8RB 4QXTA 5DVNA 3QI9B 2DLHA 1EDQA 3PWPB 3PQYA 4LEOB 4Z0XA 1A7OL 3QXWA 3MGOB 1ND0A 4EJ1C 4MWFB 1C7TA 4JZJA 3SDDD 1ZOXA 4P3DA 3CMOL 3MRGA 4NNPH 3IXAB 4I18B 1FL3A 1EMTH 4OCRH 2ZG3A 3ZTJH 3P11L 4NQDD 5CJ5A 1D5MB 1DQDL 2FX7H 4X5WB 1QRKA 3RFZC 4YFLF 1KJ3H 1FVDA 1WCQA 1KIUA 2GITB 4JRXE 2XN9B 1XFPA 4XVTL 2P42B 1FIGL 2IBZY 4MA1B 1AXSA 3U9UB 2F8OA 3WIHH 4YUEL 2H6PA 1CT8A 3O4LA 5BZWB 2O93L 4FN0A 4NO0B 2D4FA 5JLZA 1FGVH 4PJAF 1LWRA 2H26A 4GAYB 1ETZA 2EZ0C 4R7DB 1ZLVH 4XCYA 3PWLB 3IU3B 4LCIL 5D1QA 4LLMB 4LHUD 3SJVA 4YE4H 4PJ8B 4TULL 2H8PB 1J1XH 5JHDA 1G7QA 1MSPA 1OTUC 1Q0XL 1RZKL 1FG2B 3WE6A 3WEXA 3RWFA 1ORSA 3O3BB 3BSZH 2BOBB 5GHWH 1CICC 4DN4L 3NIFF 3DVFA 5B3JE 5E08L 1OTUD 4LCWB 1MCHA 2A6DA 3H42L 1H0DA 1FL6B 3FCTB 5GSVA 3M17A 1CLYH 5DC4B 5DJAA 1DSFH 3RZCB 2EZ0D 3INUH 1PEZA 4G43A 4G8EB 1OF2B 2P5EE 1YDPB 5DRNA 3PE9A 4HJ0C 2ZCKH 2P5EA 3V6ZA 3QIWD 1WUNT 1A21A 1RUKH 3H9SB 4L4VB 4GMTL 3UTSA 1MRDH 1E4WL 3DVGB 4U1SA 5GGTA 1B6UA 1CBVL 4JPVL 2DL9A 2KZ1B 4KDVA 1A3LH 3S5LB 1OVZA 4NHCH 4WV1A 1N7ML 2QSCL 4MNGE 2HLAB 2QADC 1VHPA 4TQEH 1RUAH 3EJYC 3NFNA 1XGPA 5IBUB 4M8QB 2QQNL 4KKLD 2N1KA 4YO0A 4X6CE 4PRNB 4BA8A 1B0RA 1ADQA 1MFCL 4BQ6A 3VXRA 3PGFH 1OAQL 1NJ9B 1VKXA 4TSAH 4V2BA 4YLQT 2NY7H 3NACH 5IQ9A 2OL3H 3ZKXB 1X3DA 3WLWC 1SY6L 2XIDA 5F89A 2IAMB 1B0RB 4ZUTA 4LARH 4XGZB 5DK3A 3DBXA 1ZAGA 4LLAA 1E0OB 4ALAH 4MX7B 3DRTB 4M93B 4Y8DC 4KPHH 4HEPG 2PUQT 4IOIA 4YFEA 3D9AL 1K5NA 4OCYL 4P3WA 3IU4H 4J3SA 2K7QA 5D2LE 5CEYB 2X05A 3X14B 3WO4B 3HE6C 1LO5A 3MRPB 4TUOB 3TH3T 1VFOA 4OBRA 2DRUA 4NZRH 2DQIL 3VH8B 4FQLH 3BGFB 1OSZB 5ISZA 1BD2A 1CXKA 3SGDH 1A1NA 1F00I 5HYFA 1OQOA 2W60A 1JI2A 3Q5OA 2EE2A 4MD0A 4HFWB 2IH3B 2BVUA 3NCYS 4KK9D 4L8BA 2X89D 1H5BB 5IUSA 2NW2A 3QXDA 5HD8D 3NCCB 1F4HA 2EICA 3F7QA 1BFVH 1XGQB 1OP5K 1SBBA 4OF3A 3TF7C 2IBZX 4HFWA 4H5SB 1GHFH 4RMRA 5DUPH 1LD9B 4R2GC 2UVEA 3C6LD 2OX5A 3DOSA 5F71A 1OW0C 2EYSB 3SOBH 5GGUA 2NY2D 4G6FD 3U7YH 5TPWL 3WLBB 1CZ8H 1GGCH 1YPZE 4RISH 4F7TB 5C9JA 1N2RA 5MI0C 2ITCA 4XXCC 4EUPH 1XF3B 2ID5A 1FBIL 4DVRL 4GRWH 5DQDH 3QG7H 2YD8A 4FQIL 4R9HA 3PWLA 5BOZG 1HNFA 3MV7D 4QTHA 5KSAA 3O6LL 1RI8A 5CUSH 3R0NA 4WWID 4FQQB 4M4PA 1A22B 2HT4C 3TN0B 3UPRA 1EZVY 4WCYL 1MCLA 3SY0A 1XEDA 1YUHA 5GGTH 5DT1L 1JPSH 2XQYK 2V2WA 2XI9A 2EDRA 1XAUA 2IBGA 4RIRA 2AJSH 4YFLI 5GRVL 4ETQB 1KN4H 3HMXL 4Q9CA 2VABA 2ZSWB 12E8H 4WTWA 1ZWIA 4YIQB 3KPSB 5FGBC 1CI5A 1KG0B 5LXGL 3TJEH 3FQXB 2BNQA 5DUMH 3PQYD 5AYUL 1X5HA 3F7RA 5HXMA 1ADQH 1INQA 2XACC 1MRFL 4CMHC 5BS0D 1S9YA 2G5RA 5F96L 2NY0C 5HHVH 3LKPA 5L2JA 1S3KH 1SYSA 3DARA 3RRQA 3T2NL 4GMTH 5EOQL 4HLZH 3EO1B 1YEEL 4LBEB 4U0RC 4Y5XB 5C0RL 3KXFB 4NQDA 5D7SH 4UNVA 3L5WB 4NRXA 1QLRB 4XP4L 1CG9B 3ULUH 4FTVB 2FEEI 5J3HD 2NR6D 3MA9L 4N90D 3OG4B 4QYOB 3VFPB 3T4YB 4CW1B 4K3EH 5T33H 1V3KA 3G6JB 5J1TC 3CJJA 5MEPA 2PYEE 4DN4H 3U2SA 3GMLB 4MWFA 4N8VG 5E9DD 5I8EB 3AREC 2EXWD 4MA8L 4ELMF 2Z91A 2GY7B 4J8RA 4LCWE 5KVFH 2NCMA 3CFBB 3OR6A 5FO9A 5KZCB 2ZUUA 4Q2ZB 4CVWA 4JFQB 2BP3A 3RY5A 3P30H 3S9DB 4BFGA 1ZSDB 2F19H 2VL5B 4X4YA 1EAPA 3IDXH 4YPGB 2HN7A 1S78C 3MLPA 3QQ9C 3O2WH 1U36A 1ZHNB 5IHZB 3VFMB 3WSQL 2XZQL 1R24B 1FVEA 5GS0L 3BJ91 1AD0A 5C08B 3GMPA 3OZ9H 4KVCH 4AJ0A 5JPNA 3QEHB 4A6YL 1D3CA 3E6HB 2FATL 1U8NB 1FIGH 2NY5L 3B5GA 3D0LB 5C1MB 1NEZB 1NCBL 1T0PB 4NCC2 1ND0B 3TP4A 1K4DA 1LO3H 1U8PB 4Y5YA 1RZIA 4ZUUA 4EUPA 1WAAA 4ZTOL 5LCVH 2HFFA 4LK4A 3C5ZC 3GMQA 4OCLC 3WXWH 4PD4J 5D7JB 5DI8A 5H35B 1O7SA 1E6JH 3QG6B 3THML 3EYQC 1P69B 3OGOE 3PWUA 1U2CA 2IPTH 4CL7A 3KPRA 1P7QD 3CMOH 4LHJB 3FTGA 2DQEH 1E6JL 1CU4L 2HTKC 4L8DA 5FGCE 1T80A 3C8KB 3FL7A 2OK0L 4UV7L 2FYYA 3ABZA 3MOAH 1I7UB 1G9NC 3QDGE 4YK4C 5E2WH 4HEME 3MJ9H 2EIDA 3OB8A 1VGKA 1AQDA 5B8CB 3K2UH 4P9HH 1UADC 4EIZC 4GW5B 4XP9H 4JZNB 1JHKH 1AO7D 2VZSA 4Y5VC 4Z6AT 5GS0H 5F9OH 5HVHB 4HK3J 5DJZA 3ZZ1A 4HAFA 4MAYC 5HDQH 4Q0XH 5E2UH 1U3ZA 3FJTA 4RQQA 3PWNA 1FGVL 1ZEAH 3QWOA 1RJCA 2XKNB 2FD6H 1FZKB 5F1SA 5C70A 2N7BA 4LRNL 5ERWB 1IARB 5EC2A 3P9WB 3MRHB 3QXAB 5T3ZH 4LEXL 3UZQA 4ELME 5GZOD 1QFPA 4K2UH 3ZHDA 2AEQH 3B9KB 5F44A 3UJJL 1DQQA 2HWZH 4G9FB 2BSRB 3TNNB 3IS1X 5EIIA 3D25A 3PGDB 4YNYA 1YEGL 1YEDB 5ENWB 3NBNA 3LKOB 2LAGB 4KJPC 5ISZD 5T33L 3L6FA 1Y6NR 5DRZB 5DJCA 3G9AB 1S9YB 2R1XA 1U8MA 4P48A 1NFIA 1SM3H 3O45B 2VC2H 5EOCJ 5ICZB 5MHSE 1YEDA 3O8XA 5JOPE 1KJVA 4M7LL 3UCRA 3EO9H 4RNRA 3P0VH 4QT5A 5ALBH 2ICCA 3E2HC 4O2CB 5TE6H 5DS8B 1JL8A 4L3CA 4QHMA 1EVUA 4JVUA 4P3CH 1DDHB 1A9EB 4K94L 2VSDA 1HH9B 1J0ZA 1D5XA 2FX8L 3ULUF 1OTTC 4I0PD 4OBSA 4Q9QH 4KY1L 1NBZB 3BQUD 3TVMD 1D5BB 1TVBB 3GMNA 5E70A 5DUML 3DRTA 1B4JL 2E27L 3JXAA 4PV8B 4GW4B 4ODTL 5ENWA 3HG1B 3QUZD 1PQZA 4BYHA 4JREC 4CDGC 3WNMA 1ZA3B 2X4OB 1NFDF 2J6EH 2PCPB 4LLUB 1ORQB 2EDXA 3ZT7A 2B1HL 5EC1A 1EXUB 3QQNA 3RZCD 2DM7A 4S0TD 1CDYA 4U7SA 4QEGA 4RNRB 1FZJA 1A6ZB 2DKSA 2VDPL 3LOWA 3GSUA 4OZGA 2WANA 2Q86A 4HC1A 1SBSL 2JB5H 3MOBH 5M95B 4RAHA 4XBEL 1FBIH 2UY7A 1KEML 3QEQE 3EOTH 1IGCH 4JRXA 2VXUH 3KYAA 4V1DB 2CH8A 2BNQD 2CR3A 3MREA 3CFKA 3SE3C 3OKEA 1TLKA 5D2NE 4OLUL 2ICWA 4ODHH 3V5HA 1AGEA 3PNWA 5EUOF 2WM0A 1P5VA 3QNZB 1R3KB 2DI9A 2IPKA 2W07A 4X5WA 5J6GB 4D0BB 4LLQA 5DD3L 4LRIC 4WWKA 2C3VA 2AERT 4LMQE 2F53D 5I1IL 3CVHA 4CDHA 4PG9A 2C1PA 2BSED 1KLUA 2F5BL 4LSQL 4M6AA 4GG8B 2GSGB 3MTRA 1KJ2L 1WBZB 1IGTA 2WIIA 3ILPB 1FC2D 2G60H 4KKBD 4NNYB 4HJJL 3SGDI 1G7JB 1G7MA 4YPJA 1Z9SA 5DMYA 1FO0H 4FFVD 5K9QG 2J7LA 3LB6D 2DWDB 2VLRA 2OMBA 5E1HB 2V17H 4U3XA 5CJXC 2EDFA 2Y6SD 5KS9F 1RU9H 2EDOA 1LK2A 4NQTA 1WTGT 5C0AE 2JB6A 3CCHA 3G6AA 4PGBB 3VG0H 5I71B 4P9MH 1T22B 1NKRA 1PG7X 2AK4E 5CUSL 3MRRB 3BH8B 4UU9A 1KCLA 5IBUG 1NGWB 4OFDA 4FABH 1PG7H 5F6HI 2NY3D 1R5VA 4LSTH 5I1LB 4DVRH 4OZFH 4WI6A 2CLRB 3TZVB 4JQIL 4PGBA 2R8SH 3WFCL 1Z9OA 4XCEA 5JO5A 1OAKH 1FAKT 1RURH 4LVEA 1O7VA 1MI5E 5JXAL 3MLRH 1BZQK 1WFUA 1DVFC 2PO6A 1AIFA 4ZNEA 4JHWH 5T1DL 2HG5A 1F4YH 3PQYE 5FA3B 4WEMB 5GS2D 5IFAH 3WS3B 4NUJA 1MQKL 4LQ1A 3SQOH 4NFCA 5D1ZB 5TF1L 4G3YL 3BRFA 3LKNA 1NEUA 3ARFD 3KG5A 2Y23A 4M9OA 1AGFB 1FL3B 3EDKA 3AVEA 4C54A 4NZTH 4N0UB 5EU3B 1BZ9A 3MO1B 3VMNA 4QHNB 5DLMH 1NCDL 4OLYL 4U6YA 5SWQB 2XZZA 1T5XA 2C4XA 4HCRL 4WFHD 4IRZL 2HLFC 3RVUD 2JCCA 3MV8E 4KJYA 1OGTB 1DBMH 3KYMB 2EYRA 1KIPA 4FQLL 3MV7B 1DLFH 1YN7B 3S4SA 1JGVH 4H20L 5IG7B 3QHZH 4LVNB 2W0FA 1QD0A 5DHYA 3JWDH 1J05B 1ES0A 5KVDL 5CCKH 5GXBB 1F3DJ 1G6RL 5IW3A 2W60B 1FC1A 1RUQH 2F9BT 1I3VA 1BREA 4JM2B 3KJ4C 5D1XB 1MHHB 2X40A 3MJ7A 2OYPA 5CP3H 1CD1A 3LZFH 1FJ1B 1N2RB 4Z7NE 2H2PD 4L29A 1TDQA 4C83B 4UUJB 3O41B 4FZ8H 4JM4L 2ADFH 4UDTB 4XX1G 4NKMB 2FB4L 4XNXH 1J0HA 1T3FA 4XBGA 1OGTA 1RK0B 2ICWI 5CILH 5FYLD 2V2XB 1EHXA 1MCOL 2ZNWA 4AG4L 4JY6A 1HHKA 4TNVF 2P4AB 1G6RB 3MV7E 4PGCB 4EZMA 3RPIA 1XR8B 3BEVA 4KHXH 4O02L 3REWA 5CBAB 1GC1C 4LQFH 1M6OA 3RJQB 2ARJQ 1OAXL 1NUDA 4EI6A 3D85A 4F3FA 3GSRA 4PRAA 1EBAA 1HEZA 2MWCA 3OXRA 1ZLUK 4MMZC 1JHLH 2X4PB 4J1UB 4QOKD 5CBEB 3QI9D 5FECB 2FWOA 4ACPA 4NWUL 3O8XD 1M7XA 1GGYA 5C0CD 1T7XA 5C92A 4N0YH 3TWCH 4ZPVA 5B21A 4WW2A 3VGFA 4S11A 2ZWLT 3H3KA 1OAXH 1NEZG 4EVNB 4O58L 3ZDZE 4OZFA 2NW3A 4U3HA 4WV1B 4PJEA 2DM3A 3JVGC 4JB9L 4PRIB 4OZIF 1JF1A 1NDMB 4BKLB 3B9VA 3HE7D 4LCCB 2HFEB 3D39E 5CP7B 3RVVD 3BQUA 3TVMA 4OCSL 1MCBA 2I25N 1A0QH 2BXZA 3MV9D 1GZQA 2OL3A 2R2HA 3X12B 2VZVA 5F3BB 3DYMA 1N26A 2G9HA 3AM8C 2CQVA 4YC2B 4YHIB 3NIGE 4JFHD 4UTAH 3TO4C 4OF7A 5KOVC 3KJ6L 4Y19D 3E2HB 5I1GH 1X5KA 1XGPB 1DUZB 3RTQD 1DBJL 1FVCA 1DANT 5KS9E 4XPFH 4NQEB 5JIIA 1BJ1J 4X4XB 3DMMB 4HGWA 5A16B 2LFGA 1MEXL 1QVOA 1TENA 4WO4B 1V5JA 4NM8H 3V0WL 3DVGA 3MODL 4Y89A 4H8WL 4L9LA 2JJSC 3MA7B 3BZ4A 2JE8A 1E4XH 1LEKB 4OLYH 2JJUA 1J10A 1DLHB 4OCWL 5JHDD 3LKRB 5C07E 4DN3H 5ANME 1J05A 2DLFL 2DTML 3B9KC 3PGCB 5CP3A 3QXDB 1KIRB 1UB6B 1FSKC 3FQUA 3HR5B 4XMKL 1EA9C 4WHDA 2NXYD 4Y4KB 3QT2A 3PABA 4O2CA 4IIQA 4Z7QF 1A5FL 1VGEL 3BD3A 5IB4A 3VXOA 2ATKB 3H9SD 3KR3H 2WBJC 4KK6C 4MD5A 1HXYA 3NPZB 2FJHA 1AR1C 1T20B 3P0GB 2AGJL 4N8CH 2IH1A 3NTCH 1YPZA 3W9EB 2O5XH 4XNQA 3ZDZF 2R0WH 4R0LA 5D1QB 2VLRD 3GM8A 4KROD 3ZKND 3L3OA 3DROB 5MEOA 3O2DL 4LHQB 1DBKH 4I4WB 1P4LA 3HZKB 3T3PE 2NQCA 4MNQA 5C6TL 1KELL 1GGBH 5IM7B 4ZO9A 4QRUA 1YQVH 3IDYB 4NO0A 3UYRH 4E42B 4C56A 1C16B 4M00A 3ARXA 2JJVA 4OM1L 4Y2DD 4MJID 3LEVH 1JZ5A 1RULL 4PRHD 2OJEB 4X6DF 1HN1A 2KZWA 4KZEL 5FECA 1BVKA 4ISVA 4DGVL 4LNVA 3TIDA 5ESVA 1I7UA 1RIHL 3RDTC 3BIKB 1HSAB 2DQFB 4K9EL 3X3GL 5DK2A 3QCUH 4YZFF 3TV3L 2JKXA 4EXKA 1T2XA 3N9GH 5DHVH 1MPAH 2X9XA 2YA1A 1I7TA 4HQQL 5F9WB 3HRZA 3NPSB 4KDTC 4OCWH 3SKOB 4QHLB 3TV3H 4JO2L 2DLGA 4ELKB 5IFHH 3DJ9A 3ARFA 5DVOA 3IJHA 3K81A 5F7EL 3RA7L 3MLTB 4L3ED 3MZGB 1KPUA 1PLGH 3D0LA 2WIMA 4PRPA 4QXGH 4KV5F 3C08H 5D7IF 2DD8L 4Y4FA 1T1ZB 4PIRF 5FM5O 1BGXH 5JUEL 1AY1H 2NY5C 3CH1A 4XWGL 5C6TH 5JOPD 1HSAA 4YXHH 3KVQA 1NFKA 2AK1H 4BELD 1Y0LB 3JWOL 1PFCA 3V52H 4YHKH 5DF0A 3RWFB 4YDVB 3C6LB 4I3SH 2P24A 5IW1B 3QJHA 2PO6B 4N8CL 2F8VA 5KS9A 2F8XC 3W82A 4DWHA 3OR6B 3EFFB 4X6EB 1GZPB 5FO9B 3MLXL 1PBYA 4OIIL 5EU6A 4HWUA 5BRZA 1ONQA 4LOUC 1A6WH 1MH5B 1A6UH 4ZFFA 3EZ8A 5T5FL 3LQAH 3OAZH 4OGZA 4GKNA 5D2LA 3MXVH 1FZMA 5D6DA 1BD2E 1JMXA 5CSGA 4OGYL 1AR1D 2QKIA 4MSWB 4IOFC 1LEGB 5C0DA 4OM0H 3QJFA 5IT2H 4WFFE 4K3JL 1I1CA 4KQ3H 3TO2B 4YBLC 1HHHA 1LE9B 4JLRA 2NPLX 5BOPA 3UJTL 1RZ7H 4LIQH 1KIPB 3UTQA 4NQUA 5IB4B 5D7IE 5E8OB 5DJDA 1OAUH 1RZIB 4ZUUB 1AGBA 4ZNCD 4ZSOA 4OI8A 1WWBX 4NQXA 1DQML 2HJLB 1MVUA 1QYGL 4UV4H 4IJ3B 4NIKB 1OGAB 3QUML 4ZMAT 1J0KA 5E95B 4KK8C 1G7HA 1FYTB 1N6VA 5FKPB 1R3IH 1URLA 3KDMB 5L7XH 4O02H 2NY3C 3KAAA 4DAGH 4I4WA 4LNRA 4RGMC 3WFZA 2VLKE 4RX4A 2UWEB 2ITCB 5DD5L 2FB4H 5CINH 4JFQA 4PTUA 4TUKH 1H15A 4FZ8L 4JM4H 5EO9A 2CKNA 1GGIH 3H9YA 3ULVE 1T2QH 3KLAA 2IQ9L 3ZTNH 4V1DA 3MV9A 3TO4D 5MI0B 4JHBA 4GLRI 4I2XE 4OM0L 4KTDL 1RMFH 2AABH 5J56B 1EHLH 3RWJA 2GIYA 1UH2A 1JNLH 2A1WH 4DUVA 1GSMA 2O5YH 3IAGC 2VABB 1Z2KA 2ZSWA 5SWZD 4XP9L 2HTLD 1L0XA 2JB6B 4JFDE 3IDMB 5ETUA 3WNPA 4JRYB 3ILQC 3T4AB 3S37H 5EC2B 3RTQA 5TDNA 4HBCL 5KTEH 4H0IA 2CRIA 3KYOB 3S37X 4POZC 3PDGA 4D0CB 1XH3A 3GSVB 4Z5RB 4PLKD 2ADIA 5E9DA 3T0XA 4DKFL 5C0EA 3CU7A 3MNVA 4JN2A 1F58H 3DV4B 5LGHL 1OB1A 5L2JB 3KLSA 4MVBC 1DN2A 3BGFC 5JW5A 2WBJA 5D2LF 2H9GA 3VFSB 1JK8A 4G3YH 2FSEB 3FO0L 3GHBH 2VZ3A 1S5IL 5EIVA 2DD8H 2R0KL 1S7TA 5GSRA 2EYSA 4JN2B 5D5MA 4HXAH 5CGYD 3LSOA 3BFOA 5BJTB 4WU7B 4JFED 4M93C 3HUJA 4FTVE 3BKYL 2AXFA 4QT5B 2ARJA 5DMJB 2AJ3B 2A38A 1LEIA 5IFHL 2F54B 4Z7UB 4I77L 4K55A 2CRYA 2AK4A 3P9MB 5JXAH 3PWVB 4HIXH 4XT1C 3WFCH 3DSFL 4HGWB 3DMMA 3GEWB 1EAJA 2RR3A 3VXRB 4EI5B 4TVPL 1MF2H 1RJLA 3QISA 5HHXH 1C08B 4LCCA 1QLEH 2Q1EA 2ESVD 1RIHH 1IC7H 5BZDB 3MV8D 5EA0H 3W11C 4ZUTB 4WI9A 1IMHC 3JWDL 3QUXC 1KXVC 4XPGL 3ZHKA 3KLDA 5IMOA 1NCUA 1RU9L 2OQJA 2G9HB 4MQXC 5IWLC 2YXMA 2E7LC 1FHGA 5GGSB 2QADB 4KROC 3IKCB 3UXFA 3ZKNC 4HC1H 3OKDB 2YPKA 3BP6B 1TXKA 3O0RL 2WLZA 5IW6B 1LO0H 4Q6IA 5CMAA 4HKBA 4HCRH 4MJIA 4M6OL 1VESA 4LF3A 4ZSOE 3U48A 5DEFA 3SDYL 1JNHA 3BVNA 4PRDB 5F9JB 1JNNL 1V05A 3SEPA 2NTFA 1QNZL 4B53A 3DUHA 4HXBH 1MI5D 1UWXH 2X70B 4LF3B 3QHFL 2X4QA 4JQXC 4LLWB 5C0BE 4AEFA 1WAAF 3B9KD 2UWEA 1KB9J 4OT1L 2XWTB 4MXVE 1MHCA 2CD0A 4PJ5B 4XAKD 5F7NC 4AEIH 5CD5C 1UXWB 5E94A 1JHTB 3ARVA 5CSZA 3QHFH 1EX0A 3FTGB 3BGMB 5HYJE 4XMKH 5JDJA 1OARL 3QDGA 4HS6B 4L3EA 1Z5LA 4NSKB 4ODUA 3MV9E 1QSFB 5ITFB 3QFJB 1KXQE 2D7QA 3FO9A 4K23H 1X5XA 5JPMA 1DQTA 3MOBL 2BX5A 2AQ3A 1F4AA 4PJ8C 3SDYH 1DVFD 3GMQB 1FN4B 2DQCL 1MFNA 1K9TA 2CLZB 2GJ6B 3LIZH 5JW4Q 1A6AB 2YEZB 1A6TA 1K4DB 3NA4A 3SO3C 4IRJB 5A3IC 1TETL 1YQ2A 4CN6A 4O2FB 1T5WB 2CK0L 5FIEA 4EN3A 3RTQB 4OM1H 3KLAB 2G5BB 2J6EL 3QXVA 3PL6C 2NX5D 3B5TA 3O2VH 4XPAL 1FVEB 1YY9C 3KPPA 2B1AH 5GISL 5BXFB 3BQUB 3TVMB 4PY8I 1H0DB 2DBLL 1TTUA 3FB8A 2Y6SC 3QPXL 3H3PH 3GB7A 2CIIB 4JE4B 3S88H 4CN4A 2Y1VA 3JTSA 3MLZH 1JK8B 5E5MB 5BCAA 1WZMA 1W0WA 4K94H 4PJHA 3P9LB 5I19L 3U7YL 5E6YA 5SX4H 1J8HB 1FL5A 5KG9B 3LQMA 3QRGL 4JO3L 1FJ1A 3C8HA 4X83A 3NCBB 3K1DA 4M6ML 5F8QC 1IFHH 4O2EA 1Z0NA 3IDGB 4PFEA 1HIML 1YYLH 2NX5E 4ZXBC 4YHNB 2F54E 4XCYB 1JGUH 1O0VA 2DS4A 3OV6A 3SDAC 2YXFA 1KPRB 3DIFA 4ZTPH 1GGUA 5F1IA 4YXLH 1FQ9C 4S2SB 5DQ9B 3CFEA 2JB5L 2XNAA 3GKWL 5JQ6H 32C2B 4EOWL 2O5ZL 3BKMH 2W38A 4M61A 1KC5H 5KSBB 3LDBB 5KOMC 3U4AA 3FQNA 1H8OA 2VSCA 3CCHB 4AYFA 3IYLW 1SYSB 3BESR 1F6AB 3DX7A 4S2SA 5DQ9A 3SDXF 3DYPA 5EULV 4K7PL 4QKXB 1NH6A 2MQ0A 2XTJB 1M7DB 4PP2B 1KNOB 3EO0B 5EOTB 1A7RH 1IT9H 2KDGA 3MSPA 4GRWB 3J8F7 5I1LA 2V2TB 3LQAC 1E6OH 3VXTB 2J5LB 3R8QA 2R2EA 2WQRA 4WGWB 3TO4A 4A6YA 5DMGD 3VFOA 4ZFOL 4LLVA 2L7UA 3BYTA 4MNHA 3MUZ1 1UM6L 5JNYA 3NACL 3OKMA 4XAWH 3FQTA 2LABA 3ZE0F 4OI7A 1S7SA 4P3CL 3ULUC 3IFLH 1IAIL 1JYNA 3S4SB 1XF4B 1NAML 5GJTL 5SWZA 3QUKB 3BQUC 3TVMC 5F6HJ 1M71B 5BVPL 4IIQB 3U36B 4E41D 1CR9H 1ZS8A 3CD4A 1HK6A 5MERA 1U8NA 3PL6B 4GG6B 4TVPD 4DEPC 5EU3A 1DN0A 3SN6N 1VERA 2QSCH 4NSKA 5B4MD 5IQ7H 4AIXA 4NQVB 1ZVSA 2LVEA 4YDIH 4IRJC 2YK1L 4WUUB 5IVXB 4E9LA 4WW2C 2JIXB 4JPVH 4PBXA 3VFMA 1QSEE 3N1PC 4MJ5B 4L4VD 2FJFB 4RMQA 2DQUH 4RMWA 1WCBA 5FHAH 1S9XB 4KKAD 4PREB 35C8H 4JPWH 3MRDB 1JRHL 5DR5H 3CFBA 3QEGL 2ADJA 1AHWC 4PR5A 1DSFL 1FGNL 4M7LT 2EC8A 4ODUB 5I8KH 2PO6D 4HK0B 3HNVL 1BP3B 3RIAK 3O6FA 3X11A 5KSAB 4F15C 1PAMA 2EIEA 3FHQA 2APFA 4D0BA 4JFDB 5IFAL 3GIVB 4UQ2B 4TSCL 1U3JA 3GSVA 5ISZB 5HDOA 1EH9A 2Y5EA 1U92A 1JPFA 1S7QA 4JZOA 3JWDC 1XGUB 3FRUB 1A6WL 3RHWK 5B39G 1JGLL 3R4DA 4P2OB 1NDGB 4MAYD 4MQSB 2C7UA 4ZAKB 2Q8AL 3KXFA 3V5DA 3AAZA 4ZQKB 4P23D 3UO1L 4LCIH 1KV3A 4I9WE 1U95B 3CAFA 3REVA 3BKCL 5M94B 3ARGC 2OK0H 1NCCH 2A9NL 2P45B 4ZFGL 1VB9A 4P5MB 4NOFA 1F8TL 1OLZA 4CNIA 5KVDH 1BEYL 4EUPG 3QUXB 3VA2C 4J3XA 2KQMA 3OB0K 4KKCC 3S5LA 5CJOH 2BOCA 4C57C 3FO2B 2P46B 3FOLB 1N8ZB 5ID1B 3ARRA 1RZJH 4YGAB 4Z5RA 1LEIB 5ABDE 4HPYL 1K2DB 5I75B 1MREL 4G8IA 4XBPB 3FRPG 5DRWB 1R0AL 1HZHL 4UBDC 4PRNA 4YHLH 3MRJB 1JCKA 4A6YH 5HY9B 2JCCE 3MRBB 2X5PA 3Q48A 3C5ZD 1G1CA 4Y4FC 3S4SG 5MENE 1JE6A 5IK3A 4MA3A 3LKOA 3SCMA 4DGIH 5C0FB 1PJ9A 5EORH 4XGZA 3OKOA 2BZDA 5DO2C 1K4CA 3HN3A 1KLFA 4OLUH 1MELA 1A6VL 3HC3L 1R5WB 2BDNH 4OJFL 1HKLH 3O8XB 2D2OA 4F8QA 1BZ9B 3MO1A 2BOCB 3Q0HA 3RWCA 4KVNL 4MXWL 5IB3B 1T04A 1K5NB 4QTIL 5HDBF 2Y72A 3CLFL 1KTDB 3FAXA 4CVZB 1MHHA 3MJ7B 1YQVL 2DKMA 1AFVL 1RVFL 2BVOA 1T1YB 3UPAA 5ISZE 1CDIA 4OQTA 5H2BA 2X89A 4R3SB 2XKSA 1YYMH 5C0IB 5J12C 3B6SA 5KVMC 4L8CA 1W0VA 2HFGH 4L4JA 3MV9B 4XXCA 5TDOB 1OGAA 4YFDB 4YGVA 2QEJA 3WS6A 1J0IA 3K2MC 3H7BA 1OHQA 1BAFH 1I7RA 3C6LA 5GS1A 4P5TC 5DO2D 1AP2B 2MNUA 4EIGB 2O61B 4UOJA 2D7NA 4JLRB 4QXUH 5T3XH 5CJQH 5FYJL 3AROA 1KJ2H 3QNYA 3EAKA 5KAQF 1MFBL 4U3CA 4OFYD 4D9QE 3EOBB 4K8RL 3OAZK 3GM0A 3QZWA 3IXAA 3DI2B 4LSRH 5T3XE 2ED8A 4NBZB 2E8ZA 3TBYB 2DM4A 4JY6B 2WNGA 2VLJA 1QFOA 2YKLH 4Y19A 5BVJB 1MHPL 2NY3B 4EUPB 3L7FA 2VL5A 5ADOH 1ZT4A 3QH3A 4KJPD 4AMKH 4U05A 3BDBA 3JTTB 2WIIB 3ILPA 4NM8L 2BMKA 5EN2A 2BVQA 1SM3L 3TH4T 4LSPL 1M1SA 3GB7B 1DE4B 1RHHA 2AXGA 2HKHH 4JFDA 1W72A 2A77L 2ZKHH 3T3PF 4L4TE 4NN5C 1IAII 2YD7A 3I6LD 3G5XA 2JELL 4HIIB 2NW3B 1QSFE 2RFXB 2BNRD 1WWWX 3QUYD 2J2ZA 4G6KL 1G7LB 3IFPA 1MFAH 4FFZL 5LQBL 3WFEH 3UBXB 1JF5A 2QSTA 4Q0XL 2CIIA 4JDTL 4DZBB 1U8HA 1HSBB 2YBRA 3GO1H 4JG1L 2FNBA 4D9LL 3KPMA 3RWHA 4TQEL 2IANA 5E4IA 4PJ5D 5JORB 3AS0A 3IFPB 3PHQB 4KWUA 3T77B 4I5BA 3C6LC 4MCZB 3DXAB 2VYRE 4FTVA 1HI6B 3ETBF 1L7IL 1MAKA 3QFDB 5IJVB 4LHUG 5C0GB 2HVKA 3FQNB 2XTJE 4D9RD 3LPFA 3QCVH 1K4CB 5D8JH 4F9PC 2UZXB 3D3VD 1TZHB 4LVOC 4XC1H 1JN6A 3OKKB 5HDLA 4KKBC 3DLQR 5DDHA 1KGCE 5GRUH 4HWNA 3WUWB 4YEEA 3GK8H 5JNYB 4Z8FL 5IK3B 2PXYA 5J9PB 5B4MC 4RAUA 4GJTB 5CEXA 1CFQA 3CFJA 3PIQA 2ZUWA 3AS1A 3DVNA 4NKOA 2NX5B 2FR4A 5E2VL 1IGML 4Y5XA 3BDYH 1G9NL 4R7NA 2N7AA 2HKFH 5DFWH 5HGHB 1IM3B 4UTBH 3U46B 5F9WC 4JDVA 5LAXB 3IFLL 4P9HC 3RWCB 3MUY1 3ZO0A 5DJXA 2CKBA 1I1AA 3LN4A 3QIUD 2BHUA 1JBJA 3WIFB 2FD6L 3GMRA 1UWGL 2VO5A 3KNBB 1ODAA 3VWJD 4ZS7H 4PRPE 1G9NH 4LKXB 2YD4A 4AEHH 5E6ZA 3WLWD 1A64A 1JFQH 5EUOE 4BH8B 3BRDA 4OUUB 3G5ZA 2YS4A 4U6TA 2NY1D 3QZWB 5A1AA 4WI5A 3MMEA 3IDYC 2H41A 4P9HL 2FO1A 4YUEH 5DJ6A 1HXYB 2BRRL 2FJHB 1X9QA 1JJUA 1BFOA 4JZJB 2IWGA 5GJSL 4XP6H 1ZT4B 3ROOB 3IGAB 4AIZA 2E3VA 5IM7A 4IDJL 4ZYKA 3VH8A 5J3HC 4LLWA 1BBDH 3WXVH 3DO3A 4XB7A 5CIPB 4OAWA 4I48A 1L7IH 1W72H 2ENSA 2VZUA 3ET9F 4U1IA 5BW7C 1KEGH 4HK0A 4GG8A 3L5HA 4OZHB 1YEKH 2WBJB 3VFSA 5ACLA 1HILA 4NNPL 4RMVA 1J5OH 1AQDB 4ZPVB 5F7LB 1GOFA 3FOMB 5HHPB 5DC0A 8FABA 1GAFH 1NGQH 5FFLA 4M02A 3S34H 3M45A 4PJGE 4X98A 4M9PA 5DWUH 3BSZL 1A6ZA 1FSKB 4JO3H 1FNAA 4XXDA 5A2LH 2W0PA 3QO0A 3W2DH 1U8IA 1Q94A 2OP4H 4KVCL 3SY0B 2R1YB 4P5TA 1EFXD 3BAEH 5J1AA 3HA0A 5F72S 4FQ2L 4D9LH 2J8HA 3SPVA 3EYOB 1YMMD 4KJQC 5CIPA 1NCTA 1MLCB 4M62H 4M8QA 5EU6E 4WO4C 1F90H 3HZMA 3QPQC 3O9WD 3PGDA 5JPMB 1U3HC 3VMOA 3FB6B 3IB4A 4ZS7L 5J1AB 5ACZA 5FYLE 2EKJA 1TTGA 2FEDD 1UH4A 1S5HB 2VISB 3WDIA 1JYWA 2F54A 1I8MA 4Y4KD 1LE5A 5HDBE 4MZ3A 4PJIB 5HYIA 4XVTH 1CWVA 1L9NA 4P4RB 1TJHH 3MR9A 5JMOC 4Y1AE 4JFFA 5EZIL 4KAQL 4RX4D 3V0VA 3MRCB 4HJJH 2ITDB 2QQQA 1TPXC 5DQDL 1T83C 4S1SH 4I0PA 5CJXA 1NC4D 4RAUB 4MCYB 2HJKB 4V1DD 3HZVB 4OZFB 1RPQA 5JDSA 2NTFB 3RHWF 4DUWA 5TPWH 5I1AA 2PYFB 4LCCC 4IM8A 3WN5C 4F7CB 2E5EA 1F3JA 2HA1A 1TZHA 1SMOA 3VW3H 1OSZA 1QFHA 4GUPA 4QF1B 3GBML 4WV1C 4M6NH 3RAJH 1DBBL 3L5JA 1BX2B 3BT2H 4RDQG 3TH2T 3RZCA 4Y2DB 5BV7L 5CEXB 1JNNH 2GT9B 2F74A 2ERJB 4PV9B 2WWMD 1XR8A 2WP3T 3VGEA 1KN2H 3IF1B 2HJLA 5FGBA 4PREA 3ES6A 4P23B 3RKPA 5JW3H 1ZS8B 4F58L 5KBNC 5HHOB 4CMMB 4ZO8A 2HG5B 4JRXD 4XPAH 4J4PA 1L7TL 2I5YH 3OXRB 4NC1C 3GGWB 1LP9F 3HG1E 1TQBC 5EU7E 3QQ4A 5T3ZE 4K71B 4ENEC 1NANH 1IZJA 5EDXA 3EHBC 4JFEE 4LDOB 4XNZB 4KMTL 1IC7L 2P5WB 3I6GA 2Q3ZA 1CTNA 4JFEA 2YN3A 3G08B 1TVHB 4O9HH 4OUUA 3G5ZB 2A77H 3TCLB 1NGPH 1O5DT 2PF6A 1AFVH 1RVFH 2VQ1B 5HHMB 5IR1A 3RY6C 4QRSA 3S35L 2MOVA 5E6ID 1A7NL 1MJ7L 3F7VB 3SDCB 3KJ4B 5D1XC 4L1DA 4PJHE 1H15B 5EPMA 3H0TA 3GUTB 5A40E 3EJYD 5SWSA 1AGDB 2E6PA 4U6XA 3VA6A 3GMMA 3HS0A 4OV5A 5I76B 4JRWA 4MXVF 3RUGB 3SGKC 2A83A 4NQCE 3V2AR 4L3AA 3QEQB 4Y0GA 3JUZA 1NGQL 3DUUB 4XH2B 3T4AA 3D3VA 1UH3A 3EOAA 5CGMA 5TQ2L 3V7MA 4KRMB 2B39A 2Y7QA 5I1KH 3B2VH 4WWKB 3STZA 3TYFB 5DK2B 3DX9B 3SO5A 3PHSA 4PLKC 1YEGH 1FV1A 5CFHA 3T3ME 3WCYA 4M7KH 5FO7B 5I73C 1IILE 5I1JH 5I16B 2DQIH 4PUBH 5HJ3A 1HWGB 1A8JH 3HE6A 5EBWA 4CU7A 1NCWH 2BJMH 1A3RH 4G80A 3AFLA 4XCEB 4LRNH 4XMLH 4YDVA 3ARDD 3HB3C 4IRSD 5JIHA 1DCLA 4WNQB 4ZNEE 2C3GA 6FABH 3WKNA 1YYML 2R2EB 3BP5B 4X9HA 3VWJA 1L9MA 4GKNB 5E7FA 2Y07L 3V4PL 3TZVC 4NNXA 3AB0C 1JRHH 1QLRA 5EU7C 2KQNA 1XGRB 4NGHH 5C7XL 2VAAB 2FHBA 1MJ8L 2B4CH 2HVJA 3IJHB 1I9JH 4JKKA 4ZOBA 4NKIL 3B6SB 2CPCA 2FBJL 4BFBD 1CS6A 3O4LE 4X6FB 2VDML 4R90H 5I1DA 1CK0H 2JTDA 4X7FC 3U0WL 5JDSB 3RVTC 3RX5A 1BF2A 4NC2B 3UJIH 1FNHA 3CH8A 5D1ZA 3PHOA 4J6RL 3THMH 2AV1B 3WIHL 2QKIB 3NH7H 1J8HD 2WWMC 1EHNA 3C2AH 4M1CD 4HZLA 2CDGB 4L9LB 1V8HA 5C0CB 3HTLX 3IT8D 5BO1H 2XICA 3MACL 4I13B 4EDWL 5E00B 5IEHA 4JPIA 1UQSB 4JRYD 4KGJA 2PCPA 3UTZB 5HYQB 3ARYA 5HD8C 3I3BA 7FABL 3BN9D 1CLYL 1BEYH 1A6TB 4PJ9B 2RCSH 5HY9A 3TCLA 1W8NA 4R4FH 4OZGB 2Q86B 2P8MB 1KJ2B 1PD6A 2BC4A 1FLRH 2NLJB 4PB9L 3ZKQD 4DZ8A 4QYOA 4DUXA 4QLRA 2OJEA 2VH5H 1KFAH 1T20A 3O9WA 4DKAA 2FBOJ 5F1OB 4XAWL 3JUYA 3QDJE 3KPQA 1T66D 1FAIL 4YGVB 5C2BH 2OTUA 3NA9H 1DQLL 2GJ6A 2R56H 4EEEA 3CC5A 3Q6FA 2D0GA 1RZGB 2F54D 2FEDC 4UDUB 4Y4KA 3GSUB 4Z7WF 2VIRA 2BVOB 2ADGA 3VDBA 2VDLL 2DMBA 2OTUB 1LP9E 2RGSA 1G0XA 1S9VB 1ZT1B 4HUXA 3QAZB 9CGTA 5GS0C 3MBXH 4JFOA 5DFVC 5CSZB 1NC4A 3O3DB 3Q3GB 3SDXB 4ZYKB 4N1CA 3VXRE 1MJUL 3RL2B 5DMKB 4OUOA 2BSRA 5CZVL 2G2RB 4P59L 4NJAH 3TA3D 4E41B 5TDNB 5D5MB 3OHXB 5L8LB 1RIUH 4JFOB 1S3KL 3GMOB 4JFHE 4TNWF 2HYMA 4HAGA 4CN1A 1NFDB 1HILB 4K3JH 4JN1H 4CGTA 3F62A 1ADQL 3EOYG 4P5MA 1UKQA 1MFBH 1FFOA 4EVNA 2A6DB 1OB1B 3TJEL 4E41A 3BKJH 1X7QA 4BK5A 3DURA 5I1HH 4HSQA 2L0DA 1J88A 3OSKA 3HZYB 1RJLB 4KZEH 12E8L 2J88H 4OD3H 3TT1H 3I3DA 4UAOB 1I8MB 2R1YA 5GSRB 3U7WH 3L3DB 1OF2A 3ZDYF 3ZE1F 4GQPH 2WMPA 2CDFB 4OQTH 5A16A 4RAVB 5ESAA 3UYRL 2DM2A 3P73A 2ZJSH 3BYYA 3HZYA 4I3RH 5GRJL 5IWLA 4BKLA 1K85A 3ZTJG 2AK1L 2VXQH 3IDUA 4KJQD 1OT2A 1EUTA 1ZGLB 2FH6A 4YBQD 5D71L 1WJ3A 3T0EB 1AY1L 2E9IA 4OD1L 4U0QB 1JWSA 4JZNA 1ZLSL 1T89C 5FYLH 1P84K 3O6FD 4JFPB 1WT5A 4QXGL 1MAMH 2EIZA 4MAYB 4YEFA 2CK2A 1TZGL 2IQAA 3H9SA 4YHMH 4X7TA 4R4BA 2Q7YB 4G5ZL 4GAGH 5BJTA 5KVGL 1KC5L 1EEQA 5FYKD 4Y5VB 1Q72H 4APQD 5EO1A 3H9HB 3U4EA 3ARBA 2X9WA 3DECA 1WFTA 1INEH 4X4XA 3NZHL 3E1F1 4WY7L 3MLWH 3WD5L 4DN3L 5J8OA 1OARH 5ELIA 1EFXB 1DP0A 4Y19E 4MNQD 1CFVH 2UZIH 3JVGA 5E56A 4YNYB 1LP9A 1VPOL 4FQCH 2VXTH 4UMGA 1QFUH 3O3EB 2QJDA 4FQJL 4QRQA 1GGTA 4NZRL 3T1FB 3O9WB 4QNPF 4R4NC 4I1NB 1FNEA 1JWUA 2ARWA 4TTGA 2R9HC 5D7JC 4Z7VF 1N5YH 3C5ZB 3S3PA 3VDAA 4HWZB 3ARWA 3QDJA 2A9ML 4JFXB 2X44D 4N90E 4XVJL 4OSUL 3IU3A 3KPNA 4JHAL 4PJXE 5IKCA 5GGVY 3RUGA 3PIQB 4KHTH 1F3RB 1L6XA 1T4KA 5CJBA 1CDJA 3C5ZA 1BQLH 5SWSB 1CT8B 3O4LB 5INCB 5K9JL 5JPNB 4YX2H 1J0YA 4L29B 4P57B 1ZMYA 3U46A 1XMWA 2UZYB 3G5VA 1T4KB 3WHXB 5C6PB 4KRPB 1WZLA 3FT2A 4Y4FD 1FRGH 3BZFA 3VRLF 3BKJL 4LNRB 2P48B 3QUYC 1D5MA 4XCFL 1CXFA 1T1WB 2BCKA 3O11B 3KPPB 4FMKA 4P2QB 5TE7H 4X6CB 3PWUB 3S3JA 2ZOLA 4JG0L 2M8XA 3ESUF 4N5ED 2AV7B 4OLVH 3U83A 1H3PL 5E2TL 2CIKA 4HWBL 1IVLA 3MLVH 4KKCD 3RWGB 3D1MC 4QNPE 1ZWIB 4HLZG 4OT1H 2CLZA 3ALXA 3VXQA 1YNLL 4JO4L 1G7LA 4J3OC 1J8HA 1OGAD 5EU6D 1JYXA 1NGYB 4MD4A 5HGAA 1GC1H 4NN7C 2Q76A 1INQB 2GYSA 5LBSL 3PP3K 3MUHL 1JNHB 1XCTB 2ZUTA 2VR4A 5IB1A 2I9TB 1ZGLP 4ONFL 1VFUA 4FXKA 3MCLH 1HINL 1U9KA 3MRCA 3SCMC 5D2NC 5M7QA 3IVKA 5D2LB 1X44A 4UTAL 4D94A 3L95A 3EO1A 3VXNB 1UB5B 4H25A 4KTDH 1QA9B 1QSEB 1MRCH 2CKBH 4OFYA 4CMHB 1Q1JH 3FO1B 2H2SC 4JKPH 2MPAH 5D7KD 3TFKD 4AEEA 2V2WB 4MNQE 3HPJA 4PTTA 2EC9T 1I8IA 3M8OL 5DD5H 3DHJA