4KTDH

Fab fragment of hiv vaccine-elicited cd4bs-directed antibody, ge136, from non-human primate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
217
Chain Sequence
b'VQLVESGPGLVKPSETLSLTCAVSGGSISTNDWSWIRQPPGKGLEWIGGISGSSGDTDYNPALKSQVTISTDTSKNQFSLKLTSVTAADTAVYYCVREGIVLVNLAVKNWFDVWGPGVLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GE136 Heavy Chain Fab
molecule tags Immune system
source organism Macaca mulatta
publication title Vaccine-elicited primate antibodies use a distinct approach to the HIV-1 primary receptor binding site informing vaccine redesign.
pubmed doi rcsb
total genus 44
structure length 217
sequence length 224
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdH01
1XF4B 3WIHL 4NO5B 3FT3B 5J3HC 3H2WA 1YYLH 1BFVL 1GOFA 2Z31D 4FHBD 3CFJA 3RTQD 3O3AA 2E7BA 1D9KD 1FYTB 4LF3A 3UTTE 1G7HB 1DBAH 4I9WE 4MQ7A 5F6HJ 4WHYG 5B39G 4L8BA 4MWFB 3B2UC 5D5MF 1RK1A 3T04D 4PJBE 1RUPH 1WZ1H 5HSFA 5A16A 4OZFB 4RWYL 1CE6A 4JO3L 2QQNH 3C60D 1PZ5B 5EZJA 2DBLL 1FGNH 3F7VB 4JN2A 4AENB 2NY5L 4PPTA 3G6JA 2XA8L 3TV3H 1NUGA 4MA1C 3TYFB 4B41A 5F1IB 2WP3T 3MPCA 5GS3A 4KQ3H 3EOTH 4NQCA 4U4BA 3GB7B 3G5XA 1ORSA 1AKJA 4NCC2 1KUMA 4MYWB 3QNZB 3HZKA 4LKCA 5EZIL 3VA6A 1HIMH 1GOGA 4ZFZB 5DRZB 3V4PH 3L3GA 2VDQL 5E2VL 1XR9A 4APQD 4RAUA 5K9KA 3QR2A 1DQJB 4QOKA 5DZLA 1K4CB 2UWEB 5IF0B 4O2FA 5J0BA 4HS3B 4K2UH 2OL3L 1P4IL 4ZO8A 3JV5A 1IAMA 2Z35A 3MA9L 4LVOC 4WV1B 3TESA 5HHMD 4Y4FA 5KVFH 3O2WH 2DQGL 4FRWA 5I1IH 1V5JA 1XCTA 3O6ML 3QQ9D 1IAIM 1Q9KA 2NLJB 4R6UA 4X4ME 5D7JB 3V8CA 2K3TA 4O4YH 3SDDC 4J3TA 3QEHA 1DN0A 3FAXA 2IH3A 3C08L 4K8RD 1UB6A 4JFFB 1E4XI 1T2XA 2DQHL 2FBOJ 3MV7E 1RZJH 4FQ1L 4K94H 4KMTL 3IJSB 4OZGE 5GRUH 3IT8D 4YJZL 3PG2A 3GMRB 4ZG1A 4AQOA 1C12B 4Q9QH 3JWDC 1VGEL 1FDLH 2P42B 4V1DA 8FABB 5FOJA 1BWWA 1MSPA 2FNBA 3O81A 3P4NB 4H26B 3MV8D 2EDHA 2EE3A 1NDGB 5DMGD 2VLRB 4EDXB 5DD0L 4JREC 3D3VE 5JXED 3FFCA 4YHNA 5HHVL 2WINA 3BWAB 3RWEA 3MMEA 1PQZA 5HI5C 3CJJA 1I9RH 5ID1A 5LGJA 2DTMH 4MJID 1WK0A 3NGBB 1OF2B 5FXCH 3MLYH 2IFFH 4PRHD 5I73C 3G08B 5FYKL 2ZG2A 4UI2A 4LLDA 3V4VH 1F6FB 3TA3A 4PJFE 4JR9L 3VXMB 4PJGF 2OBGA 4F7MB 5MEOB 2XTLA 3UTQB 2D7NA 4YBLC 1IZJA 3GSQB 4HWBH 1R3HA 1YEHH 3BH8B 3HZVB 1A64A 4YDIH 3NABH 4XPTH 3S35L 1EHNA 3UPAA 4O2EA 3BKCL 3U0WL 4JRXE 1XGRB 2B5IC 3KDMA 1N5YL 3EDJA 5DT1L 5IFHH 4EOWL 1M71A 2EXWD 1J0KA 5F1OB 1MIML 4NWTH 2MQ3A 3G6DH 1AJ7H 3VGHA 3KYMA 5LQBL 5FCUL 3MV7D 1BFOB 2KZ1B 1A7QL 1NAKL 4KJPC 4KVCL 4XP5L 4BELD 1YEJL 1A47A 2PTVA 3RDTA 5AEAA 1WCBA 4HWEL 4IRSC 2CK0H 4KMLB 3BXNA 4M6MH 4MNQB 1D7FA 3NZ8A 3K4AA 3WBDA 1FQ9C 2KDGA 1MLCB 4FZEL 4OGAC 3GJFK 4HHAB 2DL2A 4IS6B 3BP4B 3X13B 5JORB 4KK9C 3ZHDA 3OB8A 4FQHB 1A5FH 5HJ3A 4BQCA 1FVCB 1CVRA 1RJYB 1BAFH 1FP5A 1IILE 5KS9A 4P2QD 4FXKB 1X5GA 3QPQD 5EG6C 5LKNA 4R7DB 2XZCL 3FRPA 5F9WC 1N6UA 1CLOL 2ZOLB 5DWUH 5IMLB 4QRTB 1CTOA 3RPKA 4I0PC 4WCYL 1JF5A 2VC2H 4MJIB 3QUZC 1JK8A 1OSZA 2M8XA 1LO5B 4JVPA 5C2UB 5L0QB 4XVSH 4QNPF 2DBJA 3BZ4B 1WZKA 4NZUH 3SDXB 1IC5L 3QUZA 5J11B 1ORQB 4O9HH 4J7RA 3TJEL 2N1KA 1V05A 2DQJH 5ALCH 5GGVL 3V79C 1V7ML 3D39D 3O6LH 3HAEG 5DUML 4NBYB 4X7CC 3CGTA 1DBBL 5F21B 1U8JA 3P4MA 1W0VB 1GC1H 3FFDB 4NWUL 3K81A 3NAAL 4WFHD 3RTQB 3FZUC 2NY5H 4YBQD 1A4KB 3M07A 1KJMA 3BKYL 4KQ3L 5JMOC 1ND0A 5MEQA 2BSTB 2MCPH 4TUJB 2IPKB 3Q2CA 2UZIH 5ID1B 1QSVA 4JFHE 1ADQH 1NSNH 3VGGA 5ITBL 1KLUA 1HHKB 3FRUB 3AREC 1U6AL 5EUOF 1BMGA 3WCYA 4EI6B 1FGNL 1WFUA 4AIOA 3MUGA 1XGPB 1NCCL 1T20B 5I9QB 4X6CA 4PJCF 3EYSH 3FO0H 3GSVB 1MI5A 5GRYA 4GKOA 2FSEB 1C8PA 1VEMA 1HYRC 4JFXB 5D9SB 3ZO0A 1J86A 1FN4A 2G75A 2VR9A 4YIQA 1XF3A 1B0RB 2C3VB 4AEIL 4K8RL 5E2VH 2V9TA 1MCIA 3G5ZB 4EI5A 3RDTD 2W0FA 4K2UL 4QXGH 1S7XB 3B4NA 1M71B 3UAJC 3GSUA 1Q0XH 3F8UB 2RCSH 1W72L 2O93L 3EO1A 1AQKL 2AQ3A 3V6ZB 2R9HC 1T0MA 1S8DB 1F2QA 1H15B 1BOGA 1MJUL 5HGDB 4JQVA 1JGLH 4RFEA 3EDFA 4KJYA 4M8QA 2GSIA 3HMXL 2Y1VA 4BFEA 3HPJB 4M3JA 3TO4B 1J8HE 2EDOA 5D2LF 5BS0E 5F1SA 1GYAA 4LLWA 4JJHA 4RNRB 5I1CL 1XGTB 3U4BL 1RZJL 2HH0H 4U1NA 3RZWA 2ADGB 1XH3B 3P77A 3WXWL 2WBJA 4R7NB 2VDML 2NW2B 4Y89A 3RVXD 1RJYA 1NDMB 5DURB 1QKZL 1QBLH 2DMKA 2Q3AA 3T1FA 3ZKXC 1JFQH 2KQMA 2CDGA 3PP3K 4NHUB 3OG6B 3O0RL 2C4XA 4HZAA 3OKOB 3LN4B 3M8OL 4PB9H 1CF8L 4TQEL 3OAUH 4DGIL 1CFNB 2AJ3B 5D7IA 3T0EC 3ZT5A 1T83C 2MQ0A 2Q8BL 3HZKB 2X4NA 1OGAA 3L5JA 2AJSL 3QPXL 1B6UA 3GIVA 2P46B 4N0CC 5DQ9B 3SDCB 5CBEB 4I3SH 5CJQH 3JZ7A 4JM4L 1TQCB 3NABL 4LEOB 3QCVL 3W9DB 3S35H 4QXTA 5DYOB 1A9BB 2R2EB 4RGOH 4PRAA 3WV0A 1Q1JL 2CDFB 1RUKL 3PL6A 4F7TB 1IAKB 3JWOC 1LMKA 3ARFC 5DDHA 2APFA 5GGSA 1QBAA 2AK1L 3GSNA 3HI5H 4R4BB 4JQIL 1Z5LB 1NCUA 1QSFA 1WBYA 5FO8B 4KMQA 3NPSC 3GKWL 5IMMA 3FB7A 2Q7YB 1FNEA 2RGSA 2GAZA 1A7QH 2X1WL 4EKXA 3P11H 4ZSOE 3RWFA 3ULVL 4WWKB 4EOWH 4XMLL 2R0KL 4NWTL 3TBVB 3U0WH 4U1GC 1I8LA 1NAML 1FH5L 5SWZB 3KYKL 4G8IB 1U3ZA 4FZEH 3PWVB 4UOW0 2R4RH 2ICEB 2IPTL 4R26L 3P4OA 2UV3A 1TCRA 4QRUA 3TH4T 4APQC 1A6ZA 4C54A 2VL4A 1GGBL 5DJCB 5EU4A 2DOCA 1U8LA 2FEEI 4OGZA 2CK0L 1N0LA 1CU4L 2CLVA 3MRJA 3WSQH 1PKQE 3PHOA 3DO3A 3O9WB 1OW0C 2A38A 4YXLH 4P59L 5EOCL 2IC2A 1G9MC 4KPHL 5GJSH 1UWGH 4PRPE 5CJBA 2ADIA 3TIDA 4PREB 3RA7H 3MCLH 2HP4A 2OTWA 4OLUL 1KIRA 3H0TB 2VLME 5TQ0L 4YDKH 1IKNC 1UC6A 4IJ3B 3HCVA 2JLLA 5IT2H 3GSUB 5D71H 1A6AB 1I3GL 1FCCA 1NMBH 1A6TB 4L3CA 1X4YA 5GS0C 1T0MB 5FYLD 3VXMA 1DQML 3WJLC 3TNMA 3AY4C 5I76B 3KXFD 5D1QD 1U41A 2X4TA 1N0XL 1BQLL 2DIJA 2A6DB 3TZVA 2DAVA 1U8KB 2DWDA 3NFPA 3NOIA 3BIKA 4L8SA 5JLZA 4JHZA 2X2YA 2PO6A 5ICYA 4PJCE 2WIMA 1AR1C 4LCCC 1YMMD 4PJ7E 5F9JA 1CDBA 1YNTA 5LBSH 4EVNB 3C5JB 2QHRH 4LRIA 2I07A 5FGCE 3L7EB 2EH8H 2FZ3B 5EBGA 4M7LH 2ENSA 5JOPD 3BMWA 1JF1A 3VD4A 3U30C 4WVRA 3O2VL 4Z7UF 1LDPL 4XPBH 1YEFH 5T1LD 1RIUL 1SMOA 3DUSA 5E9DA 3HAEB 5D7IB 4YXKL 1I8LC 3OKKA 4WHDA 1T5WA 1P6AB 5BZWA 1MWAA 2ITDA 6CGTA 4XMKH 4GRWF 4HQQL 2HKHH 3GIVB 5CBEA 3SDCA 3MRNA 2R2EA 1ERNA 2GJ6E 5D70L 4F7CA 1RV6X 2R56H 1Y6NR 2D9CA 4HWZB 2CJUL 4U6YA 1NUFA 4I77H 2AXGB 1D9KA 4QTIH 3KLAB 5IEKB 3D18A 4HT1H 1CR9L 1SBSH 4D9RE 2EO1A 5EIVA 3MBXH 3JTTA 4I48A 4NKIH 2J8OA 4Z76A 1T83A 3TCLA 5KJRH 4KTEL 3K2MC 4ZXBA 4WJ5A 2OP4L 4G8FB 4G6KL 1AQKH 4NM8H 2N56A 1W72H 4HXBL 4XVUC 3DX7B 4OCRH 5SWSE 4QRPD 2QEJA 4Z7UE 4L5FH 4KV5E 5E8DL 3SO3C 1T04A 1UXSA 3GSOA 5EORH 3SCMC 5J57B 5H37H 4WO4D 1KCSH 4OV5A 4G6AD 2X4UB 1R5IA 1S7SA 3HNTL 5I1CH 4RGNC 2F53E 3QDJB 3P0GB 1N2RA 5L7XL 2VDMH 1EEYB 5HGHB 2HH0L 5I30H 3I85A 3WXVL 1UXWA 1HHKA 4X5XA 4XVJL 3TJHD 4HAGA 2Y36L 5FGBC 3TLRA 4AEHL 1U8OA 4QF1A 5A2JH 4B7IA 5T3XH 1FYHB 1QFOA 3U83A 1WITA 1M4KA 1WV7T 3ES6A 5K33A 2AJVH 1CICA 3VXUB 5J9PB 4NZJA 4U6HA 1TENA 3DHJA 1EUTA 3M45A 2J8UB 4G80A 4IHOB 1DQLL 1U36A 5EN2B 4K3JH 1EAPA 2W38A 3RGVA 5EA0L 1WBZA 1D5BB 1VFUA 2PO6B 4HFUH 4OUOA 1Z0MA 4MB4A 4HLJA 5T1MB 3G5ZA 3FN3A 4HPOL 4BQ9A 5JXEA 4LPXA 5CBAA 4L4TA 1KCVH 2UZYB 5KSVA 4PV9A 1MJJB 4WDIB 1KXTB 4QHMB 3ZKND 4XP4L 1HHIA 5C0CB 4OGAD 1UJTA 3A6OA 4ONFL 1YYML 2VZ3A 3GM8A 2IMNA 4OD2A 4TVSa 4Y5XA 1WZMA 4RFEB 6FABH 4GG6F 3OXRA 5IVXA 1FZOA 3HFMH 2G60L 5T3ZH 3OJDB 2X4SB 4TVPE 5IIEB 1ZLWH 4W6YB 1AO7E 1CU4H 5FK9B 2ZNXA 1GCFA 3C5ZD 2FEEL 4GXVL 3VWKC 4ENEC 1TZHB 2IBZX 4M1GH 4N90D 3V5DB 1JP5A 3KPPB 3KYNB 4I8DA 5DVNA 5FO9B 4CN6A 5EU6D 4YAQA 2GTZB 3KAAA 4P5TD 1MAMH 1U9KA 4YR6B 4ZDHA 5GGRB 1OARH 2C7UB 1QLFA 1D9KB 5JNYA 3WSQL 4HS8L 1EBPA 1KJ2H 1R3IL 1Q94A 2PF6A 4HIXL 1A22B 1T6WA 2EDXA 1AGEA 4U0RB 2F54A 2YWZA 2UYLB 4WJ5B 3CX2A 4WNQA 4Y1AD 2FECI 1BVLB 5HGBB 4P46A 1HHJA 4S1SL 2FO1A 3GSNB 1NFIA 2GSGB 5IB2A 1IL1B 3DOSA 1WIOA 1LE5B 4YE4L 1Q0YL 1ZHBB 1AD0B 3N9GH 1KELL 4FQXC 1I3RB 4OB5L 3HLAB 5HI3D 5I71C 5FECA 2A1WL 3SGEI 1MUJB 1OP5K 2H1PH 4XWGL 4X8JB 1WQVT 1HWHB 5DJYB 3G6AB 3L3KB 3BMVA 4YGAB 5ETUA 3RDTC 5FOBA 3LB6C 3PHQA 3WEXB 4JDVA 3PWVA 4M7ZB 4X5XB 1U8IB 2PNDA 3D2UA 4Y4HB 1NLBH 4M9OA 1LD9A 4QYOA 4UT6H 1HN1A 3JSSA 1CDUA 3BO8A 3ULVD 3KYAA 1PW3A 2BVPB 4NOBA 1DLFL 3GI8L 4NQVB 4JANA 4TPRH 5HYFA 1K3IA 3HTLX 4E41A 3SE9H 2QKIA 2BSRB 5FKAA 5HPMA 3NCJH 5HHNA 5EN2A 3BVNB 1NEUA 4I77L 2D7PA 3AROA 5M95B 3ROLB 5DD5L 1INEL 3Q5TA 4QRPE 5HYJA 1QSEB 3RPIB 4Z7VE 5A2KH 1VSCA 5T1MA 3SDXF 4Z7NE 5BS0D 4P4KB 5CP7B 1MCPH 1MJJA 4HDIA 3BE1H 1WAAE 2NMSA 3TV3L 2AABH 2YZ1A 2HT2D 2P1YA 1A7BA 5B21A 1XF4A 1ZVHA 2P7TB 5BXFB 3ULVF 1EO8L 3IDYB 1HXMA 3EZ8A 2OI9C 5IBTH 3SKMB 1WEJH 3MV7B 1REIA 4N8VB 4YHIB 3QDMD 2FX7L 4Y16A 3TZVB 2F5AH 2HKFL 2HT4C 1U8KA 2DWDB 3NFPB 4HC1L 4LF3B 1Z3GH 4D9LL 4Y1AB 4ONGL 2IFGA 1CXIA 5LXGL 5C09B 4M6NH 4M9PA 4FQXA 5DFVC 5JDSA 4N1EA 1FG9C 1NBYA 3L6FA 3SO5A 3RP1A 4JFQB 2NX5B 1AY1H 5FO9A 3S88H 5C07B 3CSPA 2EYSA 4TTDC 1NMCC 3MGTB 3OB0H 4JHBA 3G9VA 1YMME 4EI5D 1JZ8A 4OIIL 5DD0H 1QLFB 5EORL 5ADOL 1CL7L 3O3BA 1AKJB 4GOSA 3G9AB 4L8DA 2IPUG 1DQTA 4XVTH 4DTGL 5L2JB 3ZMRA 4R97B 1BVKA 4QNPE 4KU1A 5AWNH 5C08D 4LVEA 4EN3D 4XI5C 1XR9B 1T1YB 1QD0A 4I1NB 1F11A 4LIQL 4BH7B 5IVNA 3ZDZE 3V4VL 5IEHA 3LKNA 5M7QA 3HC4H 4AL8H 1E4WH 4PJEA 2YRPA 2UVEA 4U1KB 1YYMH 4FG6C 1C08B 2DLGA 5IEKA 5DFTA 1FIEA 3LKPB 1LE9A 3S36X 4X7TA 3HLAA 5ESAA 4U1HA 4E5XA 1MH5B 5GISH 4RA3A 3X3FH 1RURH 4DOHE 5C0GB 1XMWA 4NNYB 4YBQC 4WI2A 2UVFA 3T2PA 3QP3A 3KGRA 3QT2A 3O6FD 1U8IA 2EZ0C 4XRCA 5CFHA 4ONFH 1NBZA 4ISVB 4LVHC 3V0VA 5D1QB 2IAMD 5I17B 4S2SB 3UMTA 4JGUA 1MHPL 1MJ7L 3GSXA 2G60H 5T3ZL 1NMCB 5I1AA 5IWLC 2BVPA 1NDGA 3RKDC 1CE1H 1TZGH 4ZFFB 5GS0H 5E2JA 2QSCL 4RQQA 5JHDE 3PXJA 3BWAA 4NSKB 3EO0A 2JCCB 2R0ZL 3CMGA 3QDJA 3W0WE 4FMKA 5CD5D 2P8LB 2F8VA 1N2RB 3VFUA 3C2AL 4KY1L 5IFHL 4C83B 1LO4H 5HGHA 3D85A 3VFRB 3IFLL 4GXUN 5MEND 1U91B 1BD2D 1P5VA 1SEBA 3T4AB 2BRRH 1Y0LA 3MYJA 1PD6A 3GZKA 3U2SB 4JZOA 3RY4A 3AS0A 3HUJB 5HGGS 1M6OB 1P7QB 3VFNA 5DFVD 3T2NL 3UAJD 1S78C 2DWEB 4PGCB 4Q6IB 1YQVH 3QEUB 3MACH 5I6XC 1KJ2L 1QBMH 2R39A 4XCYB 4HCRH 1FNSH 4FQJH 4DVRH 3QI9C 4M7KH 2OJEB 2VITB 4O2EB 5C0BE 3MV11 3VG0H 3HE7B 4LCIL 1KV3A 2NYYC 2BOCA 4PV9B 4POUB 2NXYD 4JFQA 3IFPB 5CIPA 3O6FA 3I6GA 4HJJH 3KYMB 4LNVA 3E8UH 2P44B 3IGAA 5C07D 3N9GL 4Y19E 2DLEA 2NY2D 4Y5XB 2BSSA 5IVXB 2X5PA 3RDTB 4ZPVA 4MXVF 4TOYL 1DEDA 5I66B 3MO1B 1KCLA 2DJ4A 5DUBA 2ZZUT 5E9DE 4ODXA 5FA4A 4P9ML 3ZDXE 2NXZD 1V7MH 2XV6B 3RIAK 4Q7DA 1AE6L 1FGVH 5ENWB 4MAUL 5DEFA 1IGJA 4ELMB 1GGIL 1JI1A 4DZ8A 1FNGA 3JWDH 3ULUH 4F3FA 2GTZA 4I4WB 4UQ2B 3PABA 4Z0XA 1LEKA 4MZ2A 2XRAH 5I19L 3ZTNL 3B9AA 3SKOB 4ODTH 3DSNA 1C08A 1MIEH 3LKPA 1Q94B 1JK8B 3D9AH 3VGEA 3ZE0E 2ENYA 3MRLA 2OX5A 3SN6N 5I1EL 2PTTA 4Y5XC 2UYLA 5AZ2H 4GJTB 3SJVE 4JFEB 3I3EA 4P46B 1IC7L 4AMKL 1JWSB 4N0FA 1I7RB 2RIKA 3ARGC 3SE8H 2A83B 4YEFA 3Q0HA 2WUBH 5D7LA 3GHEH 3SGKC 4E0RA 5TH2A 2QADD 5T1LA 4BYHA 3FFDA 4KHXH 3GIZH 3SDAC 1JHLH 2DQTL 3BN9D 5HGAB 1QRNB 4FA8A 3LZFH 4MJ5A 5BW7A 3IJYB 5DJAA 3MLRL 1I3RA 3GMOA 4O51B 4Z7UA 1Z3GL 4D9LH 4Y2DB 2JE8A 1UGNA 5DR5H 1MRFL 5KVMC 2WK2A 1MCQA 2DDQH 1IMHC 1HCFX 2GQHA 4IDJH 1SEBB 3T4AA 1OB1A 2XTJD 4PG2A 1Y0LB 3MYJB 1F02I 4HJGA 5FM5M 3TA3D 3V4UL 4EI6A 5GHWL 5L6YH 4X5WB 3D25A 3TIEB 2WQRA 3C5ZA 4JZOB 4LGRB 1I75A 3CLFH 3NFSH 5DJXA 5LVEA 3PNWB 3TH2T 1HZHH 1O5DT 5J1SC 4JVUA 3QFDA 4NT6B 4JFXA 2BC4A 4LEXL 2J7LA 3KWWB 4KI5C 3BQUC 5CSBA 4OGYL 4GRLA 3X3FL 4M7JL 4I9WD 1MQKH 2XY1A 1J18A 3GHBH 1FFOA 1B6DA 3IKCB 3CSGA 3SDAD 3STLB 3VWJC 5BXFA 2VXUH 1QRNE 1J5OL 5T3ZD 1E4WL 5B22A 1H3TA 1ZTXL 3EDEA 2DLHA 1X5JA 1AFVH 4XGZB 1X7QA 5DJ0A 5AG9A 1KB9K 1CICD 2YWYA 1U8QA 5GIRA 4Y5YC 3PXHA 1RURL 1KT2B 5FDYA 1U3JA 4P9HC 1RVFH 3PIQA 2AK1H 3AB0C 4KJWD 1BD2B 1H3WM 3IS1X 4P2QA 3BW9A 3GJFH 3IETA 1D3CA 3ETBF 3X17A 1KJ3H 3MLWH 2SEBA 3B3IB 5KZCB 2J6EL 3IDJB 4YPGA 3RIFK 2NY3B 3HE6B 5E03A 1FG2B 1WTLA 5EO1B 3VXPA 3L9RA 4ODWA 1P4BH 1B0WA 4Z0BL 1J0YA 2AJ3A 1FBIL 3DMMD 4OKDA 4CAGA 4PJAF 4PRPB 5SWQB 4X6DA 2R0ZH 3PDDA 5AYUH 1TQBC 5DHVH 4OAWA 3VXSB 1GGYA 1D6VH 4X6EB 3QDJE 2Z93A 3E6HA 5DYOA 5FA3B 2WIIB 4EQ3A 5CGTA 4GAJL 1MPAH 3SDYH 2DM4A 2EDLA 1JNJA 1NMBL 5A2FA 3BP5A 5HYSG 4G8GB 2A83A 4MXWH 4LHUD 1AGBA 4WW2A 3FCTA 5T1LB 1DQMH 1KB5L 4MNHB 2YMXL 4OZ4A 5GSRB 4XB8A 4LLVB 4X7SL 4MJ5B 4IRSD 5HHOB 4HCRL 1BZ7B 2HJKA 3OR7B 3W82A 4Y2DA 1T1WA 4WWKA 2X9WA 5EOQL 2ATPB 3S8WA 4QHUB 2XOTA 1QACA 3T3PF 5SWZA 1BIIB 1FL5B 5CJ5A 1KCRH 2ICEA 2DJUA 4XNMA 3B9KA 3P40A 3P4OB 2CDEB 4M5ZL 1CXHA 4UTBL 1IKNA 4XBGB 5IESL 5DJXB 4HSQA 5HD8C 1JI2A 4XPGL 1U8LB 4PJ9D 4ZUWB 5B3JF 2NXYB 1OM3L 5FGRA 3B9EA 3O9WA 4PRHB 4PJAB 1OW0A 4G5ZH 1ZV5A 2RJMA 3QA3B 4W81A 2JCCA 2EYRB 3BEVA 1ACZA 3P9WB 1FVEB 3D9AL 2CGRL 4LCUA 3SGKA 3FOLB 3VD9A 3F7RA 4OT1L 1ZVSB 3FO2A 3W0WB 1L0YA 4JFEE 5DJ8B 1GGIH 4MJ6A 2JJTA 4AIZB 4RMTA 3DX6A 4P3WA 5I19H 2VISA 4P2RB 5F1NB 3A67L 5I18L 3S34H 3EUUA 3U7YL 4NZTL 4N5UA 3ZE1F 1CLYL 2VABB 4JPWH 2W9LA 2IAMC 2VLKB 4OD3L 2WUBL 1HQ4B 2NZ9D 5EZIH 5T3ZE 4K9EL 2I25N 4D94A 5JLZB 2VLLA 3VDCA 4XCYA 1A3RL 1A1MA 2HG5B 2BVTA 4JO2L 4YC2B 1A6WH 3W39A 2E6PA 4EJ1C 3N06B 4S11A 3C9NB 3DSFH 3C5JA 1RZKH 1JHTB 4YDLB 4W68A 3CMOL 2DQIH 3ARFA 2X1OA 3OJ2C 4OTXL 3QB7C 2M2DA 4DWHA 4LLUB 3VRJA 5I1IL 5ICZA 2R1WB 2YXMA 5D1XD 1MCKA 1Q9OA 3MLRH 3MUJA 4HIJB 2DQTH 1TVBB 4FP8H 3CLFL 2W0PA 3MJ7A 1ORSB 1U8NA 4BSJA 3E6FB 1AHWA 3BP6B 5C0FA 3W2DL 1MVFA 4D0DA 4JFZH 4JFFD 4PJXF 2OP4H 2V17L 5A2LH 4G3YH 1J0HA 4NM8L 4DZBA 3CH1B 1NGQL 3E6HB 2PXYA 3MRNB 5K9KB 4GBXC 2WIIA 1KCUH 4KZDH 1DQJA 3BDYH 4QOKB 4R4FH 3VGAC 4HH8A 1CQYA 3IXAB 3BHBB 4J6RL 4HGKC 5HHMB 5F7LB 1NGYB 4G8GA 4MDJA 4R96A 5F7KC 3WDHA 3OMZA 2DL9A 4GKSA 4WW2B 4U1MB 1ULVA 4YC2C 2YRLA 2QQQA 1VENA 4JFYA 4LLVA 3D18B 5KOVC 4NC2B 1U3HC 3DJ9A 3Q3GB 2MPAL 3UO1H 4QHKI 2A0LD 1UB6B 3V7MA 5ERWB 4ZXBB 5KSBF 3DBXB 2Y5TA 1M1SA 3AUVA 3LKOA 2EO9A 4XCFL 2ZOKA 4XP4H 4XNZC 4N0FB 4KK5C 3ZT7A 1H0DB 3MUY1 5C08A 4LSUL 2GCYA 43C9A 2A6KA 4JJ5A 3ARBD 2V2XA 3QQ3A 5ECJE 2G9HB 4LCCB 6FABL 1QRNA 1JPFA 4JGMA 4YDIL 5FHBH 4PJAA 3ECBB 4LARH 2WINB 3L1OL 1HILA 1YN7B 3B6SB 5FYKH 5C71A 5LGJB 5DS8A 2PR4L 1KB5A 2IAMA 1N7MH 4CADA 3MRKA 1EEYA 4RMSA 4M7LT 2ESVA 3QQ9C 4S1RL 3W0WA 4EDWH 2JJTC 4YDJA 3QZWA 3MOBL 3MJGX 3DX6B 4HJGB 1NAKH 1W8NA 2J8UE 4IJ3C 4U6XA 2VISB 1DUYA 1GZQA 2LU7A 3C5ZB 3RWIA 3H9SD 3Q1SL 4AG4H 4PJFF 1QQDA 2NY6D 2EDFA 1CFQB 5TE4L 3PWPA 3O9WC 1U42A 1C7TA 3SGDI 5TDOA 3LHPL 2XACC 4BQBA 2GUOB 1MHCA 1CN4A 3A6BL 3SY0B 2BCKB 5F70A 4KK5D 1LO3L 1OAUL 1DE4A 4XPAL 2JIXD 2QLVB 5BRZE 4NRYB 4GMSH 1EZVX 2PN5A 1KB5H 3TYGH 4LLUA 5JO5A 2VLJE 5IOPA 1A7RH 4L8CA 3GMPB 5F1KC 3MRRA 1Q9OB 4DVBB 4Q9CA 4JFDD 4P2OC 3QUMB 4RFOL 3LRSA 4HIXH 4WI6A 4PJXE 4MNQA 4U1SA 1F13A 1MLCA 4AEFA 2DKSA 1SY6L 4WW2C 4O58H 3PQYA 1TZHA 3CVHH 2Y06L 3FKUS 5I15L 4DAGH 4XHJC 3QQNA 1NLBL 4P2QB 4AYFA 4G9FA 3HNSH 4PJFB 1PKOA 2D7TH 5AAWA 4OCXL 1TQCC 2O5YL 4PJBB 2X42A 3OG4B 3I6KB 1KELH 5ADPH 5GQBA 1WC7B 2X4OA 3BKYH 1AD9A 3CFEA 4HFWA 4N1CA 3ULUE 5E8EB 4NQDE 4M43L 2A1WH 3BUTA 3O4LB 2R8SL 4O00A 3PWJA 1P7KB 1KPRB 3VW3L 3SBWA 1H9VA 4U7KA 1U8HB 3AMLA 3MNVA 1UYWH 1G6VK 4NN6C 5HHQB 4UT6L 4NWUH 2BNUA 1OAQL 3IAGC 1SYSA 2WV3A 1W8OA 1H0DA 3N0PB 2WLYA 3MXVL 2AEQH 4BSVA 1MRDH 5IMOB 1ACYL 43C9B 3MCKA 4OD3H 3HMXA 4HUMB 3P0VL 3H7BB 3ARED 1ND0B 5MEQB 2APTA 4FP8L 5DD6A 3IF1A 5E2WH 5IBUB 5DS8B 3IDUA 5HYEA 3DSFL 1EHXA 4X8JA 4QXUH 1JTPA 3C60C 5T3XD 1JZ5A 1A6WL 2ESVB 3K80A 2AK4B 4JDVB 1JIBA 5EUOA 4X9FA 3WD5L 4F57L 2CDEA 4QYOB 3RU8L 5I73B 1UB5B 2E27L 2Z31A 1HSAB 3D5OF 3LRGA 3O41B 4CRPA 1IGTB 4LSSH 2ZSWB 2XZZA 1M7IB 3WN5A 3IXTA 4YWGL 3WNNA 1SJEB 4JFZL 1BQHG 4NDMA 1PEWA 3ZL4L 1VFAB 2PO6D 2Z9TA 2R9HD 3MV9D 3T0BA 2F8XC 1F4WH 4OLYL 2VR4A 4Q2ZB 4LIQH 43CAA 3U9UB 2KZWA 2AJUH 4OIIH 2JB6A 4UTAL 1QR1B 3V7AE 4UMGA 5I1LA 4YHIA 3QUMA 1KULA 1QLEH 1RHHB 2Z91A 3H42L 3L3IA 4LASH 1DVFB 4AQ1B 1YZZA 1QLRA 5D1XB 2CRYA 4K71C 1CXFA 5AUMA 3SKNA 3DV6A 4PJ5D 2IAND 3RY6C 5C07A 2XPGB 3CZJA 3FQWB 5T33L 4JY6A 3MRQB 3ARFB 2GYSA 3H9SE 5HVHC 1DSFL 5IR1B 3MFGB 3T4YB 4PJFA 3U1SL 4S0TD 2EC9T 3L3JB 4HUWB 1UA6H 2IH1A 3BISA 5CIPH 4NYLB 3QUXB 2AJSH 4U1IB 2YUVA 1S7UB 5E8EA 1G7IB 5CSZA 3HG1D 4RGOL 3NCYS 4I0PB 1D5ZB 1OGAB 4HIEA 3FB6B 3EGSB 1FO0B 3T8XA 2AJZB 3UTTB 3ARBB 2F58L 2DI9A 4WHYH 4QXTB 4HPYH 5BJTA 4JDZA 5HHQA 4O5LL 1T1YA 4PRAB 2UY6A 5C0CE 5CEZE 3UJTL 2CDFA 4F7TA 5JHDA 3QIWB 4IIQA 1MHPH 2HLAA 4AG4L 1UM6H 4GW4B 2DYPA 5IEHB 2P48B 4HF5L 2VL5A 1X44A 2NY1D 4Y19B 4H20L 4MXVE 2ZKHL 4PJEB 3OQ3B 4PP1D 4TSBL 3P2TA 1JGEA 3CPLB 4NM4L 4KDWA 5DZNA 1UWXH 5JIPA 3DI2B 1AQDA 2AQ2A 5F89A 1P7HL 2FD6H 3ORJA 5ERWA 3MXWH 4ODUB 2YR3A 3RIFF 4HWBL 2F15A 2ZOKB 2G5BB 4WI8A 3CLEL 5DK2A 4XNQB 2Z31B 4QO1A 5A43C 3RUGE 4XWOD 1FNHA 1I7TA 2AV7B 3NCMA 4NP4H 5I16B 1EJ6A 1EV2E 4M4RA 1I7ZA 4NKOB 3MRJB 1QBML 5J6GB 1M7IA 3KHOA 3WN5B 2XG4A 1AJ7L 5BV7L 3VXSE 5CILL 4YX2L 4FFWC 4PJXA 2B1HL 4D9QE 2H41A 5LBSL 3I02A 4HCRA 1JF6A 2P5EE 3ZT6A 4H1LA 5JXAL 1IARB 4RFNB 2CIIB 3ARGA 4JPIB 3MA7B 4TNWF 4AIXA 1KCKA 4C56E 3VFSA 4N8PA 4U6XB 1GIGH 1PKQB 1IEAA 1GGCL 3QXWA 1CXEA 4OCXH 3A6CH 1ZHNA 2FGZA 5ICXA 4UAOC 5KG9B 2X89A 2R2HB 2RFXB 1LK3H 5JHLL 1JWUA 3THML 3P0YH 5DHVB 3JV6A 1YNLH 3MCG1 4PJDA 5JPMA 1L9MA 3P0VH 1WFTA 3S3PA 3DYOA 1Q9LB 2OCFD 1EGJA 3D1MC 2JELH 3K7UA 3KPOB 3RTQC 1OTUD 4UT9L 3PWUB 1NCAL 3PE9A 1DE4B 1OAXL 4EVNA 5J12B 4J4PA 3QIUB 3T1WA 5H35B 5E8NB 2HFTA 2NNAB 3R0NA 3MRQA 1OSPH 3DXAA 4NHCH 5F8RC 3T4YA 2BK8A 4KUZH 5FKPB 2IH1B 4YZFF 3QUXA 2MHAA 2BSSB 4LSTL 4UT7H 1RJZA 4P4RA 3ZYJA 1KXVC 5CSZB 2Y23A 3RWCA 2RB8A 4S1DC 1T5WB 3UX9B 5CJOL 4W4OC 4LSSL 2W9EH 5DUBB 3ZDZF 1I1AA 3FB6A 5D7LE 5DO2C 2AJZA 3UTTA 3VFOA 1G6RH 4HV8B 3NAAH 3PQYB 5FV2A 4YDLC 1G9NH 1KNOB 4P23D 5F3HB 1ZT7A 2E27H 4ZOAA 5J89A 4PTTB 1A4JB 1F4WL 4P2CG 2APBA 3F7YA 4PD4K 4I2XB 4QEGA 5GHWH 1CFTB 1HQRB 3BT2H 4Q58C 5FUOH 5EZOH 1IAOB 1IFHH 2ESVD 3D3VD 4UILL 1YMMB 3KLAA 2YS4A 4P57B 5KJRL 4CJ1A 3B5GA 5E56A 2XKNA 1P1ZA 2BNQE 4XNXL 1T4KA 3K8LA 3F12A 3PGCB 4IRSB 5HHOD 1Z9SA 1L4IA 2Z8RA 4MVBC 3MC0A 5B4MD 2FBJL 4P9HL 3QO0B 5D6DC 2Y36H 3V7AG 5DVMA 3O8XC 5FO7B 1J8HB 2W9DL 4NN5C 2BP3A 2R23A 3VJ6A 1OP9A 4V2BA 1MY5A 4OFIA 5IB3A 4UIMA 4XNQA 3F7QA 4K8RH 1JNNH 5FV1L 2BY0A 4NCC1 3RIAF 5HGAA 2FJFB 5E6IC 5D1ZC 1RUAL 1L0XA 4AZ8A 2NTFB 5JA9A 1IGCH 1RIHL 1IM9A 1OL0A 4HWBA 3VFMB 4AH2A 5BV7B 4MCYB 1OGTA 2ARJB 4HUUA 2B1AH 1OOAA 3CZFB 2YA1A 2BOBB 5IVOA 4QF1B 2VXTL 5DRNA 3C60B 3LEVH 2EIZA 3MLWL 3V6FB 2XXCB 3FONA 1EFXD 2J8UA 3MLXH 3QBTB 1P4BL 4RAVA 3EJZC 3U9PL 1AGDA 1KEGH 3GBNH 3QIBD 1EAPB 1T6VN 2ICES 4C4KO 5CP3A 1ZT1B 2D4FA 3O0RH 5DFWH 3SCMD 5GGRY 4ZPTA 1UH3A 3N50A 3OAUL 4ALAH 4DGIH 1OWWA 3STBA 3T3PE 3VXUE 1S7RA 4LSPL 4BFGA 5H35A 1FFOB 5C0CA 2NNAA 2NTSP 3MBED 3IDXH 1E6OL 1TQBB 4HF5H 5D7SH 5CJXC 2OR7A 1MFEH 4M6ML 3DV4A 3ULUC 2ZKHH 5C0ND 2VN4A 1I8MA 4XH2A 5E08H 5HDBE 1RHHA 1YPZB 5E24E 3MRDB 5KOMC 3OPZH 2XZQL 3CC5A 3V52H 1IKFH 2C1OA 1QA9B 2YPLB 3LQZA 3LN5A 2L4OA 1JPSL 5GGTA 4NQEA 1Z0NA 4L9LB 5BQ7A 4TUKH 1KFAH 5I8OH 4I2XA 4HS8H 3ULVH 4IOFD 4JPKL 4Y5YB 2Y4SA 4U6TA 3MRBB 1S3KH 2MFNA 3VWKB 4TTDD 1JV5B 3HE6A 4ZD3L 5GGRA 2VSCA 3QNXA 1FH5H 2C7UA 4NP4L 5KANG 1RY7B 1P69B 3HNVH 1I3VA 1T4KB 3QPQC 1UZ6E 2XQYG 1MFDH 4X6DB 5D2LE 4F15B 3MJ9L 4Z6AT 1F58L 3VXSA 4WI3A 5GS1C 4JDZB 1BEYL 4EXPX 3CFKB 2DQFB 3QIUD 5JHDB 5TDNB 1NCNA 1VA9A 4WIQA 4HLZH 4LHJB 2FX9H 4PB0L 1RZ7H 2JCCE 2XZAH 3OGCB 1RSFA 3DROA 4PGBB 3T09A 2ERJC 2YPLE 4LU5L 3MZGB 4LP4A 2UZIL 1JGEB 3CPLA 4KJPD 3KPSD 2I9TA 1YNLL 4JKWA 1F97A 4UIKH 2OTUB 3P9MA 1GZPB 2H32B 1T1ZA 3JVGA 5JW5B 5FM4A 4Z7VB 3WKMH 5F88B 4MA3B 1E27B 2OR8A 4Q9RL 2D7MA 1GPOH 4IMKC 5I1JL 3MLTA 2HFGH 3D2UB 1B2WH 4O02L 1LD9B 2DQIL 2JJSC 4G42A 3TWCL 3TO2B 2EIZB 4XBGA 4KKAC 4NN7C 3WUZA 5DD3L 1FAIH 5EUOE 3B9DA 4KK9D 3AMKA 4DW2L 1G7QB 4OCYL 2BVOB 5TQ2H 5E6IA 5T5NF 3FB8B 3RWGA 3BVNA 2LFGA 5GGTH 2YRZA 3FT4B 1MCPL 1HNGA 5HYJB 4QHNA 3BEVB 1FRGL 4URTB 4UU9B 1S5IL 5L2KE 2WUCH 1RUMH 3VXRD 4LOUD 3RL2B 1BX2A 3FOLA 1JE6A 4KI5D 3S88L 4K7FB 3BH9B 3OKLB 5FM5O 3GMMA 2ZCLH 4NPYB 2VZ1A 4OTXH 4PG9A 4P9HH 1JPGB 5DRWA 2MSPA 3MODH 5KN5B 4FNLL 3CX5J 1YJDL 1IFHL 3ESVF 1IEAB 1RUPL 4WW1B 1FNFA 3DYPA 3WS3A 3SKMA 5DK0A 1HOCA 3O3DB 1GSMA 4OLXL 4R3SA 2LAGB 1JWUB 4KXZH 4OZHB 3DI3B 4K07A 3TN0D 4EBQH 2DLIA 2P5WB 1NBQA 3MUZ1 2DN7A 1RUAH 2BNQA 1P9MC 2HN7B 2VWEE 5JDSB 4DQOH 2GFBA 3JTSB 4GRMA 5KVFL 3LN5B 1MVUA 1A6UL 2EKJA 4OFKA 4NQEB 2YPLD 2EDJA 4JRYE 2W9DH 4KJWC 4BSWA 1R3LA 1CXKA 1K6QH 3LIZH 3SDDD 2A9ML 5ESQA 2C3WA 5F7FA 3BEWB 1FFPA 2NY1C 2R1WA 3I3BA 5EWIH 3QXAA 3CVHA 2ZUVA 1T7XA 4ZUTB 4XI5D 4PJIF 4XHJD 4F2MB 4P4RB 3MJ7B 3O3BB 4RISL 2D31A 5GISL 4ZTPH 5FYKE 1MREL 4NGHL 1AP2B 5CUSL 3RWCB 4YHMH 1WSST 5LJYH 1ONQB 4K3EH 1A1NB 5ITFB 3BD3A 5DC0A 3FQRB 4HV8A 4RWHA 2BERA 4AL8L 3G5VB 2LTQC 3VXSD 4JZNB 4N0UB 5DEZA 1U95B 2W91A 3C08H 4PTTA 5IGXH 5L9DL 1HSBA 1MJ8L 2BNRB 1CE1L 2BY2A 1LEGB 3IDNA 3OF6A 1WFNA 3BGAA 4Y8AA 2WMPA 3UBXG 4BFBD 4LFHD 4G43A 4UV4H 4OF8A 4JFYB 1E4XH 2IANA 2MTPA 3GI9H 1LE9B 4OM0H 2UY7A 4KY1H 4U1HB 4E5XB 2A74B 3P9MB 2ATKB 5HHXH 2E7LC 2UUDH 1T1ZB 4NQDD 4K3DH 5ACZA 1M7DA 2V5MA 3DBXA 2JJWA 1KIQB 1H8OA 1FPTH 1IKFL 5I1GL 1V7NL 4LRIC 3UBXA 5C08B 5J56B 4KTDL 5IVXF 1U92A 5JR1L 3BKCH 2G9HA 4LCCA 3RQ3A 3DGGB 2QL1A 1QSFE 1R3KA 3BZFA 3OPZL 1XIWD 1R24A 3HZYA 4KROC 1BF2A 4QT5A 3EOBB 3QWOB 5I9QC 1EJOL 1IM9B 4XXDA 5EH1A 2VLJA 3VFMA 3LMJL 3L3HB 5TE7L 1ZWIB 4XP5H 2Y06H 1OCWL 4GXUM 3GMMB 4NPYA 5C0RL 5GGQL 1MCOH 1UADC 1JYVA 2P5EA 3HNSL 2HRPH 2YPVL 2YA2A 3GSNH 3DRTA 4KKNA 3RWIB 3DVNB 5SV3A 1G0XA 5K59E 1KYOJ 1NL0L 3WMSA 5I1DB 4C56A 3WS3B 4FQLH 5DK0B 1T22B 4M7KL 3ZKMC 2ICWB 5D96B 3ARRA 3VFGL 1CFQA 4GG6A 2CO6B 5TDOB 3EDKA 4S1DD 1ZA3A 3IDGB 3TT3H 2YSSB 2VKWA 2VITA 1RZ8A 3C8DA 5JW4R 4ODHH 3IVKA 1NMAL 3W5NA 5D2LA 1NEZB 1CGUA 2FX9L 1TLKA 4ZSOB 4JRXD 1XF5A 1R3IH 4KZEL 4YUEH 2X05A 2XZAL 4P23C 1AXTL 3DV4B 4R4NC 5DJZA 4M1CD 2HT3C 1MFBL 5EC1B 3UPRB 1CFSB 4XH2B 3LRSB 3HA0A 4PR5B 1LO2H 4JG1L 1FGVL 3MO1A 4LRNL 3KYOB 2NW3B 3UTPE 1UYWL 3K2UL 4TTGA 2CKBB 4UB0H 1BJMA 1FSKB 2XICA 4OUUA 1Q38A 3WFEL 3WKML 1K2DB 2H26A 2IMMA 4HUKB 1UJ3C 3ALXA 4WHTA 3EYFB 5C3TA 1QSFD 3QNYA 4F3FB 2AV1B 4LPUA 4NKMA 3CSBA 4I4WA 4QTHA 3PABB 4Z0XB 4ERSL 1RD6A 2X4OB 5ITBH 3BFOA 1BVZA 1HE7A 3QDAA 3X12B 4EQ2A 4MJ2A 4YWGH 4OLXH 3U4AA 2Q76A 3ZL4H 2GJZB 4XBPA 4LCYA 3QAZB 3VWJB 3GHEL 4U05A 5FB8B 3WFHA 3T2OA 5H94B 2DQFA 2JJVA 1YJDH 2WNGA 2Q86A 3OXSB 2BNUB 4LSQL 3BGMB 1BQHB 1DBJH 1A6UH 2CMRL 3AGVA 2P5WE 2GJ6A 3RAJL 4MQ7B 4AEIH 5ILTL 1F4AA 5DQDH 3WN5C 4MB5A 2IALB 1OTSD 1RZGA 4KJQC 2YD2A 3DGGA 3WJJA 3QEQB 3WDIA 5H8DA 4MD5A 4EBQL 5HHME 3GMOB 3T0XA 2DDQL 3HZYB 5KSAC 1MHHA 3ZKSD 4Z7UB 3DWTA 4KTYA 2Z31C 4RISH 2Q8AL 2JJSA 4WTZG 4JAMA 5MHSE 3FQUB 3MRMA 3GHBL 1WEJL 5MERA 1HH6B 1Z9LA 4JE4B 4LBEB 4ELKB 2PTUA 3K1DA 4S1QH 3FQNB 5F71A 4DN3L 5C0AB 2A9MH 5D7KE 4RMRA 3QCTH 4Z7VF 3R06B 4ONGH 1K6QL 4OZHE 4F7EA 1FL3A 1U3HB 4LKCB 5DD1H 5EU6E 3EFDL 4J3XA 4OI9A 5C1MB 3GMQB 5EB9A 4OFPA 4BZ1L 3O41A 3QUZD 4RAUB 1KN4H 5MENA 3LPGA 1HYSD 4V2CB 2QADC 1INQA 4QHNB 1DQQA 5KVEL 4HS3A 2R69L 4CW1A 2C3HA 1N5AA 4PY7B 3HMXH 3L7FA 3RL2A 3M8OH 5L9DH 4HPYL 1J5OH 5ADOH 3B2VL 2P5WD 1JPGA 3TBYA 3UXFA 4L4VD 5KN5A 3SE3C 5TE6L 2J6EH 3N85H 3KJ6L 3VE0A 5B38B 4NUJB 4FG6D 2FJHB 2FCBA 3ULSB 5C6PB 2BZDA 2AJYL 4UV4L 1QR1A 2QR0A 3U0TA 1CFSA 1XIWB 3PP4H 3IU3A 3HR5B 1C12A 3VFPB 4R90H 5JZ7D 4YPJA 2OK0H 3ARWA 3HI5L 4XAWH 3VXUD 4LFHG 1S7QA 1F3RB 3SKNB 4JLRB 2BNRE 4OUUB 3DV6B 3DXAD 2VLRA 1KJVB 1F6LL 3HB3D 3VGDA 4EDXA 4Z7WA 3OKMA 4WHTB 3H3KA 4G6AC 3CLEH 3ARUA 3CDFA 2VIRA 2YMXH 1QPXA 5GPRA 2PUQT 4RRPG 9CGTA 1PQZB 1NGXB 2HVKA 1MHEA 4DGYL 1JHKH 1NCBH 1TIUA 4CJ0A 1ZHKB 1CDIA 3N1MC 3MRCA 2GT9A 3FL7A 4Z7QF 4I0PA 5DGRA 4X98A 5BV7H 3C5SA 1A1NA 4S1SH 5CILH 5C0BA 1NBVL 3TN0A 1T5XA 1XCQA 3RUGA 3LMJH 5K59F 4YO0A 4RMUA 3AAZA 1ED3B 4Q0XH 4FABH 2GY7B 3OXSA 2Q86B 4NUGH 1BZQK 3WIHA 1QEWA 4Y2OA 2KPNA 4WU7B 5IB1A 3FQTB 1DANT 4XMLH 4CUCA 2WWMD 1F5WA 4N9OB 5FF6B 4Y19A 2R4RL 4X83A 1UENA 3QO1A 2H2PD 5HHOA 1A3LH 1XGRA 4Y16C 3OR7A 1GGBH 4YX2H 1S9YA 5C7XH 5E1AA 2A6IB 2AK4E 4FFYL 5E95B 1RZIB 4DJMA 3HE6D 3UJIH 1JYXA 2ATKA 4L1DA 5I2IA 3OSKA 5ACZB 5E6ID 3FQUA 3MRMB 4G7YL 2OTPA 2AEPL 3FQNA 2F54E 1FZKB 4G8EB 2VQ1B 1LVEA 3HI1A 3WIIL 4QHLB 1PLGH 5DLML 4JQXA 3CFIC 4OLUH 4PJIB 4HKJA 1FFNB 3D39B 4PJ8A 4PTUA 3SQOH 3QDMB 4LDLB 5IJVA 1B0GB 1F8TH 3RBGA 1F4YL 3LVEA 1DLHB 2VZTA 5IM7B 1U0QA 1JGVH 4LMQE 4PRHA 2EH8L 2XQBL 2LVEA 3DXAE 3DVGA 3P9LA 1KG0A 4A2LA 4HZLA 4UINL 4CW1B 2OS7A 1UM5H 4GAYA 5IW6A 3ARGB 1ZVSA 3SOBH 3O8XB 1P2CA 3D87B 4PGZA 4UBDD 3V5KB 1FC2D 4P5KB 4NJAL 4XBEL 3CFCL 2VDNL 4XMKL 5B38A 3DRTB 4HQQH 3ARDC 3VD7A 3EIFA 4ZNCD 4RWYH 2UWEF 3I2CH 2QR0B 3SE4A 3X14B 4L4VE 1AE6H 1ORQA 3CX5K 4KV5F 1BFVH 1RIVL 3NA9H 3VD5A 5TF0A 2HJFA 4ETQA 3LAFA 1ZA3B 4XPBL 5JPMB 3E1F1 2YSSA 3MROB 1S7QB 1RZ8B 2YK1L 5DSCA 5C0NC 3VWJD 5GGUB 5D2LB 1CGXA 3H9SB 3P4MB 5F9DC 4ORGB 5EIIB 3MRPA 3ESUF 1QFWI 3FOMA 3WUWB 1P84K 1NGPH 3VXNB 2P8MA 4DCQA 2VIRB 4UILH 4WU5B 2RAMA 1EFXB 1UM4L 1KEMH 5BS0B 1IEBB 3IFOB 1OT1A 5L0QC 1EBAA 2CIKB 2IQ9H 4PP2B 2AXJA 4P2RD 1U93A 2MPAH 1D5MB 1CLCA 4JN1L 4C56D 3RGVD 4X98B 3QXTA 3W0WD 3HRPA 2VUOA 4PRNB 4MLSA 2N7BA 4KHTL 1G7MA 1MCNA 2ITCA 4QRQA 5DVLA 4MA1B 3WNLA 2PXYB 3QCTL 4QY8A 3I3DA 3LZFL 1H3GA 4S1QL 4DN3H 4Y4FD 1GRWA 5IFJB 1YNKH 4F37F 3FQTA 4OCWL 3F7YB 4K94L 4MDJB 5GRUL 4OLWH 1U3HD 4LSDA 5EFIA 3W11C 4CMHC 3RZCD 3RVXC 5KSUB 5D9SA 1UT9A 5TE6H 1XF3B 1IAOA 1NPUA 3UO1L 1VGEH 4GUPB 5FHBL 5EU6A 1YMMA 3EO9L 3QO1B 1OWRM 2VQTA 1EHAA 4XVJH 4DUVA 5KVEH 5I6XB 4JQXC 5A40E 1HHHA 3HPLA 4MS8C 3TBTB 3QEGH 5CEZD 3MOAH 4V1DE 3DETC 3DX8B 3IFNL 2FIKA 3BIBX 3S96A 2ZPKH 4LGPB 3QO0A 3VWJA 5FB8A 3OX8A 3MOBH 2J5LC 3SE3A 1CD1A 3CFDA 3AU1A 3KJ4B 1DQLH 4JCMA 2D3VA 4MSWA 4FQQA 3BQUA 5C0JB 4HKJB 2D2OA 3MLXL 2YEZB 3PP4L 5KSAB 4HPOH 4OGYH 4QWWC 5L2KD 3REWA 3JUYA 2NZIA 3LS5H 2FJFA 1JRHL 1DLHA 2MKLC 3I75B 3HS0A 2VAAA 3DTXA 3VXTA 1YN7A 1KG0B 3NTCH 1L7TL 2COQA 2VXUL 3T1FB 1EFQA 4JAMB 2W07A 4NHUA 3RVWC 1LO0L 1OGTB 2ARJA 4HUUB 4LBEA 3V0WL 4ELKA 1IAII 3LN4A 2ADJA 3OWEA 4TUKL 3R06A 1F6AA 4Z7WF 4WWKC 3LD8C 1SM3L 2XN9E 1TVDA 2PYEB 2X4NB 4IM8A 1EXUB 4NZRH 3BJLA 5I71B 4JR9H 4YNYA 1CGWA 2NY0D 3I9GH 3E2HB 4GT7A 4GS7C 1IGYB 3O4LE 5DJ2B 3TNNB 2AK4D 4CVXA 2XZQH 3T0EE 5GXBB 4WUKL 4OZIB 2FHBA 3QUYD 4LNRB 1OTSC 1WIUA 2ZUWA 4JREB 1NCWH 3WHXB 1U8PA 5EOTA 1MHCB 3AS3A 1SJHA 1NBVH 2XWJB 4HWEH 1FLRL 1G6RB 2JIXB 5HYSA 4HKBA 3QIWC 4HG4J 4LPYA 4APQA 1X4ZA 1BBJB 1S3KL 4M61A 3KPRB 4NRZA 3LY6A 5LGKA 5JO5B 2D03H 2ZUUA 3QHTC 5IOPB 3I50L 4PLKC 1S7VA 3OKDB 4P5TA 3T0EB 1A6VH 3TBVA 1XIWA 1J1XL 4J8RA 3KPLB 3MR9B 3MRIA 1FVDA 5HHOE 3VW3H 2FB4H 3M1BB 1QNZL 1KSRA 1OARL 4PRNA 3ROOA 2AEPH 1G7MB 1QA9A 2YPLA 5I75B 1IAIL 3DVIA 1A6ZB 5D8JL 1L9NA 1MY7A 5F7HA 1F00I 4UINH 3DURA 5DLMH 3GEWB 2DM2A 4CKVX 5F44A 1TVHB 4M93B 3OKMB 5CZKA 3FMGL 3PHOB 5EBMA 4MNGB 3NCCB 5FYJU 1EHLH 3TJEH 2OXGA 4XNYL 5TJWK 1JV5A 4TSAH 4F33A 4MXQC 4L3ED 5GRZA 5J6HB 1IBGL 2RBLA 1CQKA 1ZOXA 5EUKA 5H37G 2VC2L 4AEEA 1OAQH 5E4IA 4XXCC 2IQAB 3WHE0 3ZHKA 1KPRA 3P73B 2JB5L 2V2WA 3S96B 1GPOL 5IHLB 2O5XH 3MNVB 5LAXA 3RVVD 5I76A 1QFHA 3AU1B 5TDNA 1QHOA 2FYYA 3NMEA 3AVEA 5E2UH 2A6DA 1NSNL 3I2CL 2YEZA 4BK5A 3ZTJH 3E3QE 1TZIA 3D39E 1XEDA 3T08A 2EC8A 2QHLA 2IGFH 4L8SC 2P49B 3PV6A 2N7AA 1HK6A 5DEGA 2VAAB 1JWMA 1LP9A 4K55A 4LIQE 4KKBD 1S5IH 2AABL 4L4VA 4HK3N 4LOUC 4PBXA 2I9TB 1T1XA 3GI8H 1RUML 1B88A 3C6LD 4TNVK 1DANU 4XC3H 3GSWA 4ELME 3V4UH 3INUL 4DQOL 4ZFGL 3ARXA 4JFDA 2ZSVB 2R4SH 3LPFA 3ZHLA 1FZKA 2IQ9L 2E9WA 1BLNB 1SMAA 3TBWB 5K9JH 1GHFH 2B4CL 4UNUA 4G6JL 5E8OB 5E2TH 1RZFH 3FB8A 3RWGB 3U7WH 2GK0A 1K4CA 1KN2H 1S9WA 2XWBB 5DF0A 4O2FB 4KI5E 4NDMB 3L5WA 4J3SA 5C70A 1CE6B 4XNUH 4OJFH 1JN6A 3PF2A 2CK2A 4WV1A 1G6RA 4ONHB 1ZA6B 4HKBB 3F7PC 2APXA 4UTAH 3RWHB 5F1IA 3ZE0F 3GKZA 1O7SA 43CAB 2AXGA 4R97C 1CT8B 4NQCB 1UA6L 1VFBB 4I3RL 4YHYC 3WFCL 1QLEL 4F8TA 2XFXA 4Y19D 5BVJB 3QCUL 4IOIB 5F6HI 2RR3A 4ZS7H 1IQDB 4IRZL 4KFZC 1ZSDB 1XZ0B 2NY7H 3SDDB 4ETQB 2ZPKL 5BRZD 2VDLH 4GH7B 5T33H 4X9GA 1BREA 4YZFE 2ESVE 1PZUB 4P5MA 4LPWA 5J13C 1LEIB 3VD3A 4S0SD 4TNWK 2GY5A 2I60L 2NR6D 3KPSE 3FQWA 1PBYA 1X6NA 5D7IE 2DJSA 1DZBA 1L7IL 2CUMA 4K7PH 3S37X 4TSBH 1LK2A 1MF2L 5IQ7H 1E4XL 1OGAE 4NYLA 1J1PH 3IJHB 1T03L 2BJMH 2R2CA 2WSKA 3RX5A 1JRHH 1H3UA 1JRHI 5J6HA 1EO7A 4WEUD 3G08A 2J3SA 3I9GL 4BM7A 4YQXH 1BD2E 4GAJH 1VKXA 1FO0A 3V0WH 4H0HB 3P73A 2UZXB 4V1DB 1MCWW 5LAXB 4QY8B 5BRZA 1H3VA 1DBMH 1UQSB 1U95A 2YBRB 35C8H 5IHZA 5IFJA 3LV3A 4KQ4L 1F2XK 1OAYH 1LEGA 2ID5A 5CCKH 5JTWA 2V7HB 1D5BA 3MRGB 2P24A 3RWEB 4RX4A 4WY7L 1LO4L 1BGXL 5EU6B 4K23H 1VFOA 4J1UA 1AIFA 4ZYKB 1MJ7H 4MNQE 2QBWA 3HC0A 5JIKA 2I9LA 3FO1A 1BFSA 2BDNL 1TETH 1A6PA 3GK8H 4ZFOB 3VRIB 2ADFL 1VGKA 4ODUA 1QNZH 2DIBA 1UACL 1D5IH 1G7JA 4KPHH 3JVGC 4F7MA 4UBDC 1PG7X 3KYKH 4KRPB 5DK2B 3KPQB 1OM3H 2J12B 3GSQA 1JPST 1TJGH 4OZIE 2D03L 1WJ3A 1U92B 3PJSA 3QG7H 1I7TB 5IV2B 5C0IB 4NQDA 4PGJA 1XGQB 4JEGB 5TPWH 1R24B 3IU4L 4RRPA 2W60B 2XTJB 4QT5B 4UT9H 12E8L 2HTLD 3GM0A 1FZJB 4YR6A 4ODSH 3DRQB 2EDKA 3VXME 4WUUA 2Z4QB 5F7DB 2CUIA 5J4MA 4KZEH 2GITA 1SBBA 1VEPA 1TMCB 5JOFB 2QQKL 2O5XL 3DUUA 1Y6MR 4R4ND 2CKNA 3MNZB 3FHAA 4ZO6A 1DEEB 1CZ8L 5CKAA 5JA8B 4XNYH 3RX7A 1KPVA 1LO5A 5DI8B 5FYJH 5C0DB 4KKCC 4JM2F 4ESKA 1ITBB 5A3IC 3PWLA 3ET9F 5E99H 1KLFA 3BWUC 1MAJA 1A02N 1V3LA 2VKXA 4PJDB 4PGDA 2DQDH 4LVOB 1G6RL 4UB0L 3HKFA 1Q9LA 3KPOA 1MRCH 2EDEA 3PWUA 3CNKA 3GMNA 1W0VA 1UG9A 4WHCA 1LEIA 2OXHA 1P9MA 1WZ1L 1XF5B 2PYFB 3BT2L 4NBXB 5B8CC 1J1OL 4QRTA 4K3HA 5EZOL 5CD3B 4KKAD 3QDME 2IGFL 3CDYA 3RAJH 4G8GD 1AXIB 1MUJA 3WHE1 1EGJH 2VE6B 5IVZB 3T77A 5JPNB 4NQCE 3L3KA 4M6OH 1B3JA 1Q72H 2FATL 4PJ9C 3PHQB 1IGMH 4Y0GA 3MRIB 3MR9A 1OP5H 1FV1B 3D0LB 3SE8L 5EDXA 4Y4HA 3R4DA 2AEQL 4NNPH 3RWJA 4P23B 3R8BB 3WLWD 3TEUA 5FGSA 1ZT4B 3QG6B 1ZVYA 3GIZL 4IMLA 2YC1A 1I8KA 4OCSH 1OT2A 2OSLA 3LB6D 4JO3H 4OIBA 2IBBA 4NZDA 3F62A 1MI5B 4MNGA 5E2WL 1FLTX 1XGYL 2UWEE 3QIWD 2XA8H 5AZ2L 4HX1A 5FHAL 4N0YL 5E2TL 3VH8G 4OSUH 4X6FB 1MI5E 1B0RA 2C3VA 5C9JB 1GHFL 4EI5B 3RVTD 3WUWG 4XCEA 2RHEA 1P1ZB 3QCUH 3QQ4A 3MA9H 1OP3H 4HJ0D 4OLVH 3RU8H 1K4DA 2YN3A 3PGCA 1KLUB 1QFPA 3LEXA 1MCFA 1Z6JT 4OLEA 2Q76B 1N3NA 2D7QA 5T1DL 3S97C 3RHWK 3VRIA 4LCYB 5DZOA 1K5NB 4Y16D 2R29L 5C07E 1EEZB 4N8VA 3BGMA 4KJYB 1MRFH 2R23B 3VJ6B 3WDJA 4I3RH 4KUCF 4KMTH 1NLDH 4N9GB 4JO1L 4Y1AA 1NKRA 4JKPH 5C09A 5IG7B 3CSYA 1RZGB 5C2BL 4AEHH 5C0IA 1MF2H 3PV6B 5T5NG 2VDLL 1KIPA 1X5KA 5AD0A 1OTTD 2VTFA 4X6DF 2J4WH 1PGRB 5LCVH 2X1QA 4NN5B 4WFGD 3ILPA 4D8PB 2B20A 2VQUA 2ZSVA 5F7DA 4H5SA 3D69A 3D3VB 3MZTA 4ZOEA 1OAKH 3L5XH 2Y6SC 4I13B 4D0BA 4X4ZA 3V6FA 2JK5A 4JM2B 1MFCH 5GRJH 4YK4B 5DMJB 5DQ9A 5HYQB 1Y18B 4FFWD 5EU3B 3PWLB 4GRLD 4BZ2H 4YQXL 1B9ZA 1AGDB 2VDKH 4OI7A 5FM8A 3PL6B 1DSFH 3SCMB 1INQB 2WBJB 4LSPH 4R7NA 1YEHL 5GGSY 4Z18A 3A0OA 4Y2DD 1C5CL 5GGSB 2V5YA 5C92A 4PY7A 5FO8A 4JRXA 2CDGB 1ZA6A 1CI5A 5ID0A 4XPTL 4U1KA 1KCVL 4NC0B 5I75C 3ZYIA 1CFNA 3VWKD 3QULB 1F3JA 3SE4C 1T3FA 1RZJC 2AW2A 2XFXB 5TGBB 1YN6A 1HWGB 4WEBL 4O5LH 2WWKT 2HTKC 3OAZH 4I18A 1IQDA 1MNUH 1I1FA 3UDWA 4XPFH 2VDRL 2ZJSH 3D0LA 5GJTL 3MJ9H 1T0NA 1I9IH 2VXVL 4KVCH 3VFTB 1P84J 3WNMA 1ZGLP 1S9XB 1D5IL 2C1OB 5GZOC 5F97E 2H6PB 1JYWA 5DJCA 4IMLB 5EU4B 3QUXD 1EH9A 1MIMH 1E4JA 2NPLX 5K9QG 1FNEB 5SWZD 1A5FL 2FHCA 1GC1C 4Y5YA 3VG9B 1R5VA 3MRBA 4JG0L 2VN7A 1MHEB 3RWFB 3CCHB 4HUNB 3TIDB 1F8TL 4PY8J 2HVJA 3H0TA 5IHBA 3QQ4B 1SY6A 1U91A 3V6OA 1NGWB 2XQBH 4G8IA 4X7FC 5EU7E 1A6AA 1N3NB 3BRGC 2VZUA 4YHOH 3DVFA 4XPGH 3WNOA 1VEOA 5HD8D 2PW2B 4KKBC 4GAGH 4YEEA 3QSKB 1P7QA 3I6LE 4TUOA 2ED7A 4O9HL 2YBRA 4DEPC 3O3AB 5TDPA 3OZ9H 3D6GA 4MAYB 3C6LA 1T2JA 1YMHB 2VDNH 2YHGA 2B1HH 1F90L 3NACL 1N59B 2P24B 1JGDB 4Y5VA 3EYOB 3K4DA 1WWBX 2BVUA 1ZLWK 1DBBH 1NGZA 4YE4H 4X6CF 1FHGA 1MRCL 3L7EA 2YN5A 4OB5H 5EZJB 2R0LH 2MCPL 1GAFH 1NEZG 4AENA 4CMMA 3GNML 4ELMF 5D4QA 3O4OB 4WI4A 2OZ4L 1BHGA 2A2QT 4IRJD 3BIAX 3LN9A 3FT3A 3TO4D 2GHWB 3HAEA 5CEYB 3KPQA 3L3OA 3HC3L 1NJ9A 3T3MF 4PJIA 5I66A 4LDOB 1GC1L 4LSVH 3QDMA 2VLJD 5IV2A 1G7QA 5HYQA 1JGUH 4NQDB 4HEME 2CXGA 1C7SA 1IGML 5A16B 4FMFA 2DMCA 1N6VA 1H3PH 1HYSC 2LTQB 1FNGB 1Z9MA 5C0AE 4HBCH 5CZXC 4JHWH 1T2QL 2QV2A 5T1DH 2Z4QA 2H3NB 4MA7H 1AH1A 2B8OT 3TN0C 1KEML 3MYZA 5CJOH 5KVDH 2NLJA 1CG9B 1T3FB 2F74A 3QEHB 1DBKL 4OSUL 3DX9B 3U46B 1G9NL 5DRZA 2W0KA 3QUYA 3EO9H 4FQIH 4H88L 3L3GB 1D5XB 4R3SB 5F9OH 5HI4D 1JYNA 2YD1A 2YD3A 4K3EL 4PJDF 4F9PC 5F93C 2AXFA 1RU9L 1T0NB 1V3KA 2EDBA 4MLIA 1S9XA 4F7CB 3B9KD 1I7RA 1V3JA 2HN7A 3JTSA 2NY5C 4OFVA 3ZDXF 2C4FT 1ZGLA 1GJIA 2R29H 2B2XL 1UXSB 3S3SA 4U6YB 4LPTA 5IKCA 1XR8A 5JHDD 4I0CC 2EH7L 5DJAB 1YC7A 5CD3A 3GRWA 4C57C 4O51A 3MMEB 2VH5H 3KXFE 1U58A 1RQ5A 3UYOD 4NNXB 4Y1AE 3GI9L 4I48B 1CBVH 3QDJD 4IEFB 4F8QA 1IGIL 4PP2A 4GW1A 1I85A 4Z7OE 4KK8C 4WTXA 4TULL 5LCVL 1FV1A 3FQXA 1CXLA 3EFFB 3ARDB 4U3XA 5CLTA 1WZLA 2EDQA 3F5WB 4P23A 3TA3B 1C16A 3S4SB 3ZE1E 3LH2L 3QXVA 1CICB 3VXUA 1XF1A 4U6HB 4TUOB 5E1HB 5AZEH 3B8YA 3DNKA 1QKZH 2XTJC 4ZQKB 2CKBL 4QWWD 2ZG3A 1YMHA 3STZA 5HDQH 4KROB 1WBZB 3QISA 2W59A 1N59A 4QCIB 5CEXB 4KKLD 4G43B 3OJVC 4PB9L 1R5IB 1S7SB 1W0WA 1URLA 4FTVA 1OAZL 4K3DL 4DEPB 3B2UD 3PP3H 4Q6YA 5JZ7C 3TO4C 1HHHB 1L7TH 4WDIA 1JPTL 1KBGL 2FWOB 4CDHA 5C6TL 5I1GH 3RGHA 3SKJL 3OKYA 1X4XA 5JUEH 4HIHA 4AM0A 1M7DB 4X8XA 3RUGF 3P11L 1OVZA 4I0PD 4J23A 1QBBA 2EE6A 2M1KA 2R0KH 2LQRA 3CFDB 3U9PH 1KEGL 3M17A 2P4AB 1FO0L 3GBNL 4NC1E 5MEOA 4D3CL 4U33A 3CDGB 1IJ9A 5MI0B 1S7WA 3J7HA 1MCRA 2X7LA 3QXDA 2R0WL 5IVXE 4EDWL 1MNUL 4H8WL 5CZVL 2N4IA 4HHAA 3CU1A 1DN2A 2XWTB 4ALAL 3X13A 3S36H 2C5DC 5ALBH 1JZ2A 2FR4A 1KIPB 5IB5B 2BXZA 3KDMB 3KYNA 3PWPD 1CFVL 1QFUL 4TVPD 3BAEL 4FXKA 1GXEA 2VR5A 2VUYA 3L3HA 2DM7A 4FFVC 3JUZA 3GSNL 3FTGA 4LP5A 4XB7A 4R26H 5GJSL 4NQUA 3LQAC 5JNYB 1OLZA 1FZOB 4MJIA 4WFGE 3OJDA 3A6BH 3LKQB 3ALWA 1I8IB 3EKCA 3T0VA 3THMH 1WCBB 4JFOB 2EEBA 3DX9A 3PGDB 1EXUA 3C2SA 5FK9A 5EPMA 2I5YH 3N1PC 3V2AR 5I15H 1VPOH 3W9EA 1IGYA 3UCRA 2HMIC 3T2NH 5FA3A 4X0KB 4IS6A 3VI3F 3WIHH 1N0XH 3IDGA 2VDOL 4LHUA 3WHXA 3E3QC 3KPPA 4JPVL 3V6OE 1UCBL 1UZ8A 4Y4KB 1SJHB 4CVZB 4RFOH 4POYA 1AGBB 1X5LA 3R1GH 4YAQB 5KS9B 4HKXB 5CAYB 1MEXH 1DL7L 1UJ3A 5HYSB 3CH8A 5F7WC 4IIQC 2R1XB 5ID0B 5FYJD 1KC5L 2OL3A 5F7EH 3WLWC 4ERSH 3GJFB 4O58L 2ZUQB 3VXRA 1HI6B 3NN8A 1NAMA 3BPNB 4M7LL 4TUJA 3NFNA 4PD4J 1YN6B 1QFWM 4E42B 3J8F7 2AI0H 2X41A 4OI8A 3G6AA 1BQLH 4RSVA 4H8WC 3PWNA 4HKZA 2BY3A 3F6IA 3SDXA 3WFEH 3WEXA 3BPCA 2HFFA 3O2VH 5BMFH 3EFFA 4DUWA 3KR3L 5GS2H 4K94C 3O6FC 2A73A 1DBJL 1U8JB 2CMRH 4X6CB 2MCG1 5DUPH 2ICWI 3QDHA 3RZCC 1ZHBA 4MAUH 3MSPA 2Y7QA 3T3ME 4OZFH 4H0GA 1JGUL 3ROLA 2J2ZA 3C87A 3KNBA 2EYRA 1KPUA 2D4DA 1MFNA 4F33B 2B4CH 2CJUH 2KL6A 4GMTL 2DLTA 4GSDL 3KG5A 4RDQG 2W0FB 5T1KA 3I84A 1J7VR 1NGWA 5ETUB 4IOSD 1RULH 4PLJD 4MJ6B 3IDYC 4AIZA 4YDVB 1SYVA 1H3PL 4MS8D 3QH3A 3UYRL 5E5MA 4JFFE 1S8DA 1OTTC 1T2QH 3EZJB 5TQ2L 5FYJE 2V6HA 3S98A 4Y88A 4OBSA 4JY5L 1PYWB 3C6LB 5I1KH 3TO4A 2FGWL 5KVDL 2C3XA 5TF1L 4LLYB 3EYVA 5IW1B 5HDOA 3CAFA 4OCRL 4Q9QL 3U48A 2G75B 2IALA 1NC2D 4LSRH 1NBYB 4LLAA 3RPIA 4HBQA 2GK2A 1AC6A 4U1NB 3SKUD 3WO3B 4KAQL 2R69H 2NW2A 2NQCA 1IGIH 4JFDB 2P7TA 2EH7H 5GS1B 4OM1H 1FNAA 3CUPA 4MX7B 1HXMB 1BOGB 4GAFB 4PUBH 4WWKD 5HGDA 2APVA 4G6FD 1N64H 3MV7A 3L3OB 1ZS8B 5MP6L 3BP6A 3H9ZA 4QRRA 1YY9D 2L0DA 5T3XL 3VCLB 1HXYB 3LSOB 1J1PL 3NFSL 1WWWX 2IPUK 4FQXB 4LQ1A 3VXOA 3KPSA 3DIFA 4NFBA 3NPSB 5DQJB 4PS4L 4POZD 4K3JL 3BZDA 4BH7A 2XKSA 1KTDA 3MRFB 4Y4KA 2GW5A 3KJ6H 2DD8L 4UZGA 1UJ3B 2DTML 1AO7D 5FYLE 1I3UA 4ZUUA 2VNCA 3TBYB 2OL3B 1SEQH 3NCYP 4KQ4H 2IFFL 1K8DB 2WZPD 2DQCH 1FAKT 3V9FA 1MH5A 15C8L 5E7BA 5BVJA 4E42A 4KWUA 3V52L 4PLKD 2L7JA 1OAZH 4HKZB 1IRAY 2Y5TB 5K9OB 3T0AA 1KLGB 2HFFB 3EBAA 4CN4A 2AXFB 2MQCA 1KBGH 1F11B 5GS2D 2NXZB 1K3ZA 2BDNH 3GK8L 2ZCHH 3BGFB 1ZGLB 4ZUVA 5DT1H 3LKNB 4L9DA 4NRXB 1BBDL 1OQXA 5D1ZD 4OBRA 4HLZG 4LKXA 2HT2C 4YHPA 5HDBF 4KUCD 4N0UE 4XPHL 5IKCB 1JTTA 2F58H 2DICA 2X09A 4PJ7B 1XF2A 4GBXA 2EECA 1X5AA 4PJEF 4J3VA 1VESA 1CDYA 1NGXA 3L95B 4OD1L 1A2YB 5KAQF 4UNVA 2V7NA 5E9DD 1EDQA 2OR9H 2C4FU 4HIIB 1A1OA 1QFUH 2VXQL 3HCVB 4XCCH 1R5WA 4YDVA 2BMKA 4G7YH 3F5WA 5C0BB 1P5UA 3MLSH 5AAMA 1BOYA 5AYUL 3SHSA 5JW3H 4NO3A 4RBPK 3TNMB 5HTSA 1M6OA 3HG1E 1UQSA 2HFEB 2J8UF 3RJDA 1BAFL 5C0AD 3PWPB 5KTEL 4FOMA 4JCLA 5D2NE 1CLOH 2IADB 1KCRL 2EE2A 3BD5A 4I2XE 4OZHF 4BQ6A 2J1KA 2P8LA 3VFUB 5C0RH 4C83A 4PREA 1AIFB 4KGJA 4XX1G 3MBEC 4JZJA 3C6LC 2AEWA 1KIRB 3D85B 3VFRA 3IFPA 2FWOA 2HRPL 4JPVH 1QFWH 2VYRE 4X99B 1HDMA 1QSEE 3TYFA 4L8CB 1VDGA 3AREB 2DQJL 1S7TA 3MREA 3OR6B 4UQ3A 4UUJB 5GGVH 3U82B 4NO2B 5F9AC 4PJ9A 5E4EC 1DTUA 5I1HL 3HI1B 4Z78B 3CDGA 1A0QH 3V5HA 1RJLA 2X7LB 2YOCA 1FFNA 2ITDB 2WW8A 3CXDL 3LQAH 4L8BB 4XP6H 4P49A 4E41E 1RK1B 4P2OD 3VXOB 4PJIE 5HI4C 1UM5L 5F9JB 5DEFB 1YNTB 4LHUG 3DVGB 3P9LB 4OZFA 4Y4KC 4HZLB 1J0JA 2DLFH 2I07B 4YHZL 2OZ4A 2FZ3A 2E6JA 1AXTH 1JF1B 4FQ2L 4HWZA 1MFBH 4WO4C 4DK3A 1WC7A 5GRVL 4ZUUB 3K8KA 1C5DB 1JCKA 5E9DB 5D7JA 1K8DA 1I8IA 4ZPVB 1HHGB 4LLMA 2EEDA 3RKDD 1QP1A 3S3JA 1RZKL 3DHMA 4JFOA 2CPCA 3A67H 5EPMB 3U7YH 5D93B 3TCLB 3BX7C 4ODXB 3W9EB 1VACA 1IEHA 5HVHB 3WO4C 5ENWA 3B83A 4HC1H 2UWEA 5IK3B 5IF0A 3UYRH 5BO1H 2AAVA 3P4NA 4H26A 4BSVB 4JY5H 4ORGA 5EIIA 1T21B 2H2SC 3MLZL 4MB3A 4X4MA 5L2KA 5LXGH 1XFPA 3RY5A 3VXNA 2E3VA 2X4PB 4N0YH 5HI5D 2NR6C 4YFEA 4X7DC 4OM1L 3BPOB 3VXRB 1XCTB 4PJ8C 1TTUA 4OZGB 4YFLF 4YHML 2X4UA 3KS0H 4LCWA 1IEBA 1V8HA 2V5TA 4F58H 4GBXD 2VE6A 3IFOA 5IBTL 4MHHI 1MCLA 2ZNWA 5IBUG 1ZHLB 1QBLL 4B0MM 4Z76B 4JFHD 4N5ED 4UOW1 1PDKA 5EULV 5DGQA 7CGTA 3IFNH 4UV7L 2ARWA 3RWJB 2FEDC 1FC1A 1JWSA 1UB5A 4PY8I 5DQDL 4OLWL 4GRWH 2F53D 4RFNC 3MV8B 2VB5A 5D5ME 4D2NA 5C9KA 1AO7B 4BKLB 5MP6H 1OPGH 3FFCE 4PUBL 1WAAF 1X5HA 3ULUD 3TF7C 2Y7QB 3HZVA 3IXTB 3IJYA 3EJJX 2YUZA 4Z7NF 1ZGLM 4NFCA 4N90E 3KNBB 4X6FA 1Q1JH 4XZUB 5JOEA 4GQ9H 4XMPL 1JJUA 5CBAB 3RI5F 5T1KB 5KSVB 4YXHL 3RWDA 3DPBA 1CGYA 7FABH 1MCBA 1V7NH 1C5CH 5EBWA 1T0PB 1HDMB 4PJHE 5C08E 3IRPX 3QCVH 2E9IA 4PFEA 5E7FA 2H32H 1GH7A 4OD2B 4UUJA 4I3SL 1CD1B 1G9ML 2NY3D 4P48A 3OXRB 2Y07L 5GRVK 5M94B 1KENH 3ARPA 4Z78A 2YKLH 4G80B 2WANA 5GRJL 1RUKH 4GRLC 2BSED 3L3IB 1TPXC 4IHOA 4KH2A 2A6JA 4FFZH 4G7VL 4NT6A 3RGVB 1QLRB 2CH8A 2BC4B 5DMIH 2IPTH 3WS6A 4Z7QE 1NFDA 3W81A 3BP4A 5GS0L 4ONOA 4CMHB 4FQHA 3PIQB 5AD0B 4XPFL 4OGXH 4L4TB 2OR9L 4HGWA 2XPGA 2LE9A 3EJYD 3IETB 2XN9D 5IR1A 3IKCA 4U1LA 2NY4D 4LMQI 2PR4H 5IW3A 3ZYOA 1H5BB 5F3BB 4YXLL 1IC4H 4H5SB 4P59H 5IMLA 3CUPB 1CDCA 3K74B 4PG2C 4Y4HC 4U0RC 4S1RH 5JDJA 2PW1B 5J1AB 2PYED 4OLZH 5DXWA 1UKTA 4BH8B 2OK0L 4OD1H 3DETD 4QRRB 3RA7L 5INDA 1INDH 1KF9B 1IGFH 4B7LA 4HIEB 4BJLA 3BXNB 4FZ8L 4DKFH 1CGSH 1OQOA 1A14H 4MJIE 3TNNA 1VACB 1T7ZA 4CU7A 1G1YA 5I8OL 4U7SA 4M3KB 3LKSB 2AGJL 5EOTB 3BP5B 4FXLA 4YUEL 5E08L 2VL5B 3QIBA 4R7DA 3LDBC 5L88H 1DP0A 2ZCKH 1QHPA 3MCLL 5L2KB 4K71B 5JW4N 2G5RA 2OJZH 2PETA 1F3JB 3QULA 5D71L 5F89B 4W6XB 1S7VB 1GVIA 3OKDA 4P5TB 5SV4A 1YDPB 4FQCH 1YQVL 4I18B 5D8JH 4NQED 1YYLL 5FOBB 2Z93B 1KLGA 3V6BR 3FRUA 4YHOL 3CFBB 1FNSL 3PDGA 3BQUD 4KI5F 1DQDH 4TSCH 1QFWL 4M1CC 3FT2A 5SWZE 1IZKA 2AXHA 3LEYL 1YC8A 4ZUVB 1XGPA 4TOYH 5E2UL 4TN9A 4PJCA 5ESVA 1QRKA 1TVHA 3HE7C 4DFHA 4E41B 3LKRA 3RTQA 1PEZA 3WJJC 5I1HH 4PJ7A 1XF2B 1WFOA 5HHNB 1J8KA 1VADA 1KJMB 2A9NH 5J3HD 2GJ6D 3KPTA 1QYGL 5FECB 4PRDA 1FVEA 2D7TL 2IPKA 3D0VA 4K3GA 2E8YA 1LDPH 2ICCA 4LCUB 4P2RE 2EEAA 3KJ4C 5F96L 4ODBD 2DLFL 5EUKB 3RVTC 4JPIA 1JVKA 1MIEL 2IQAA 3C6SB 2IEPA 5EBWB 4X6CE 4XXCA 3MGOB 4OCYH 2XQYK 5I1EH 1K9TA 2EC9U 1U2HA 5I8KL 5D70H 3SJVA 4OQ1A 4JANB 2MMXA 1A7PL 3W11D 4H1LG 5FKAB 3KXFB 5DA0B 2IADA 2Z0BA 5I1JH 3FN0H 1QG3A 3N1QC 1IM3B 1NFDB 4QTIL 3L6FB 5F9OL 4CNIA 2D0FA 3P77B 1XH3A 2EXWC 3MBXL 4XNUL 4QOKD 2NX5A 2XIDA 4GW5B 4X4XB 4XP9L 2F8OA 3L5IA 4HT1L 4JB9H 4KK6D 4L4TD 5GGVY 5IMKB 2E7HA 1QO3A 3MJ6A 2F53B 3HI6L 4XAKE 5GGTL 3OKOA 4HH9A 4RA0C 3BESR 1T89A 4R2GD 5K9JL 4LHQB 3BKJL 4BH8A 1DBKH 3VFVA 1AHWB 3E6FA 5C0FB 2GSIB 1MOEA 3N1GC 1K8IA 2VH5L 2VLMD 3X3GH 2CQVA 3VFOB 3CH1A 1RU9H 5C6WH 5SWSA 3QWQB 4UDUB 3W39B 1ZT7B 3LKSA 2JJUA 3SO3B 5DR5L 4MD0B 4E41D 1JN6B 2APWA 1CFTA 2IG2H 1FSKC 3WFCH 3QIBB 1I4FB 1UZ6F 3JV4A 3IYLW 1RZKC 2GIYA 1L7IH 1CTNA 4U3HA 5ICZB 4F7PA 1C5DA 1CT8A 3WXVH 1TVBA 2NY0C 3MJ9A 1X3DA 2EXYD 5ESAB 3VI3E 5BZDB 1XIWC 4YXHH 5BVPH 4M5YL 4XMPH 4FFZL 3WLBA 4TRPL 5D72H 1QOKA 2HTKD 3U30B 4OCWH 1ZANH 5GZOD 2HLFC 3GBMH 1TCRB 4QRUB 5I17A 3HFML 5DDHB 4I0KA 4R4BA 4P5MB 1Z5LA 3Q48A 4FTVE 2A6KB 4JJ5B 3O6KL 1G7PA 1VHPA 3F58H 1BM3L 5BCAA 1OLLA 3LKRB 4GXVH 1RFDL 2NTFA 3WS6C 3G6DL 1U58B 1KB5B 2IAMB 1ZLSH 5IGXL 3D0VB 4OGXL 1IGFL 1ZHLA 2X6MA 4MMXC 3QHFL 2QJDA 4U6VL 1WBXB 2Z92B 4HMDA 2BOBA 1FL6A 4X6DE 1CD9B 1IC4L 2YXFA 3C60A 3VGFA 4DKAA 5KW9L 5KSBB 2BVQA 1I1RA 3MV8A 1E4KA 4PYGA 4NIKB 1AO7A 4BKLA 3BN9C 1NCDL 2DWEA 4MXQD 2B5IB 3UJTH 3X11A 1HKLL 1I1CA 3PGFH 1CGSL 2CLVB 1KJ3L 4W70A 1A7OH 1BZ9B 2MKWA 1HILB 5TE7H 4WTWA 4Y5VC 3AM8C 5AG8A 1CYGA 3TVMC 2Q87A 1BIHA 2QQLL 5DWUL 2OQJB 2OTWB 1M05A 3NIDF 2I9LB 2O5ZH 4X4XA 1R0AL 4WFED 4HW6A 5GZND 5ISZA 2DQEL 2DI8A 4AM0B 2ZCKL 4NKDB 1DUYB 4IMKA 4NFDA 3U2SA 3MRRB 3BYYA 4KVNH 3SQOL 4DVBA 3DUSB 3VFNB 1I8MB 3EW3B 4MQTB 5HVFB 1L0QA 1TITA 5ALCL 2OJZL 5FYJL 1YPZA 3QEUA 3TT3L 2EYTB 4UTBH 2W65B 1MWAB 5DUMH 3U6RB 3O2DL 1Q0YH 3TJHC 1CL7I 4WFEE 3T0WA 2GUOA 4XCNB 2DMBA 3KPNB 5I74C 2FR4B 1MCCA 2C1PB 1NL0H 4HGWB 5EOQH 2H1PL 4XWGH 4DZ8B 3BGFC 3I50H 3VGAB 3CFCH 5LGHL 5DMYA 1KC5H 1H5BA 5F3BA 3S9DB 1QZ1A 1X5XA 4ZO9A 1J1OH 1J1XH 3CFEB 3GMPA 3SKOA 4F9PA 4OF5A 3QRFM 4YBH