4KTDH

Fab fragment of hiv vaccine-elicited cd4bs-directed antibody, ge136, from non-human primate
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
217
Chain Sequence
VQLVESGPGLVKPSETLSLTCAVSGGSISTNDWSWIRQPPGKGLEWIGGISGSSGDTDYNPALKSQVTISTDTSKNQFSLKLTSVTAADTAVYYCVREGIVLVNLAVKNWFDVWGPGVLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vaccine-elicited primate antibodies use a distinct approach to the HIV-1 primary receptor binding site informing vaccine redesign.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
molecule keywords GE136 Heavy Chain Fab
total genus 44
structure length 217
sequence length 224
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdH01
4EDWL 3RY5A 3W9DB 2HWZH 2L0DA 1MAMH 3R8QA 4KHTH 1HHJA 1YYLH 1ZVSB 1LP9F 4PRBA 3VH8A 3PDGA 1KJMB 3UZQA 4FXGA 1XR8A 5EUOA 3BPCB 2F5AL 4IRZL 2DYPB 1BLNB 5DJ0B 1IEBB 2FSEA 2Z4QA 1GPOH 2R29L 4WDIB 4PLOB 1CR9L 4GAYB 2R0KL 1MF2H 4G9FE 2Z8WC 2V9RA 4LDLB 3RZCC 1KLFA 3UP1A 3C09C 1DLFL 3I9GL 3PQYB 2E27L 3H0TB 4I5BB 5I2IA 2Y5TA 3I85A 2BSSB 2UWEB 1NCNA 3QQ4A 5TDOA 4PJ8B 4HV8A 4NM4L 3PWPA 4XMLH 3R06A 4CU7A 3S5LB 4OF0A 2IAMA 4WUUB 4ZNEA 3U0PA 5HGBA 3HPJB 3O9WA 5JO5B 5IB3B 4ZS6C 4CVZA 3K8LA 3OHXA 2WLYA 5HYIA 4FA8A 2JK5A 1N2RB 1XGYL 4UINH 3PP3K 2BSTB 5AWNL 2EDOA 2D7MA 4JFED 3WNPA 4IEFB 1HQRB 8FABA 1MJ8L 1A6VH 4WW1A 2FHFA 4F9LA 4LSRL 4R2GC 4G8GB 2XY1A 2BVQA 2NW2A 1Q9OB 1G7LB 4UDTA 1DQJB 4WUKH 1TDQA 4H8WL 2XN9B 2BSRA 3UCRA 4GBXB 1FO0H 4MA3A 4Q6IB 3TIEB 5EFIA 1KF9B 4HS8L 3UROR 3VRLF 2GJ6E 2VLRE 4LHUG 1PLGL 3BZEB 5L9DL 5HI5D 1WEJH 3C9NB 1LP9E 4DW2H 3MUZ1 1WT5C 2ADJB 4UNTA 3MJ9H 1JNHA 3W39A 4FXKA 3WEXA 3OKLB 1DJSA 1FPTH 3PWNA 3D0LA 3OR7B 4Z7QE 4P46A 1BWMA 1KB9J 1RUPH 4YHOH 3VXSB 3OX8A 5I1LA 1YEGL 2X9XA 4NKIL 1XH3A 3C2AL 1I7RA 4RWYH 5FYJE 4JPWH 4O4YL 1CFQB 1FIEA 2DTML 4X9HA 1XEDA 3BKYH 4H25B 2D31A 3KPPA 4NJ9L 3QO1B 2AW2A 2NY0D 1AC6A 2R1WA 3H9HB 1ZHLA 3MX0A 4YIQA 5F1IB 1OSPL 2IBBA 2W91A 4IRSB 1U8LA 2CJUH 1KIUA 2VDML 5E5MA 5IIEB 2FO1A 5IW6A 2CMRL 4XNUL 1HHHB 3IT8D 5GGRY 2B5IB 3TN0A 2VR4A 2KQMA 5BVJB 2OSLB 1C12A 4QTHA 1JRHL 4X8XA 3FOMB 2W65A 5EPMA 1WTGT 1LO0H 1SHMA 1I7TB 3GMOB 3OHXB 2X40A 4EJ1C 3V52L 3QWRD 4PLJC 5C8JA 4R90L 1HQ4A 1RHHB 2F53A 3EYFB 2P45B 5KOVC 1JV5A 5C0BA 3ECBB 5MEOA 1T66D 4FQQB 4NM4H 3MLRL 4OT1H 5CWSA 3WUWB 4WUUD 1AGBA 2FECI 4NO0D 1SQ2N 4U33A 2FB4H 4LMQI 1RIVH 5EOCJ 3MBXH 4GW1A 3WD5L 5ADPL 4CN4A 2BVOB 3O0RL 4PJIE 4HWBH 1E27B 1RJZB 4H20L 1D3CA 5IMMB 1EUUA 3S96B 1HH6A 3FKUS 2OMNA 2BSRB 1AKJD 5CEZD 1P4BH 2XRAH 3FO1B 5IR1B 5CEXB 4OZIA 5GGTL 1Z3GL 1U8MB 4Y2DC 4U6YA 3WXVL 3MO1B 2EKSB 3WN5C 4XVJL 2DQJL 3CXHK 4J6RL 4DK6A 4ELKA 1NMCB 3QG6A 4OQTA 2JELL 3J8F7 3O41A 3DO7A 4U49A 1VFOA 1CE6A 1UB5A 3LH2L 4I4WA 1IC5H 4ZUVB 3B9KD 4P4KD 1ULVA 3S3PA 3IJHA 2QJDA 2CDEB 3JV6A 1XH3B 4F7MB 5IKCA 1BQHG 5IB3A 4M6MH 4EI5C 5BQ7A 2ED8A 4L9LB 4PD4K 4NKMA 4P4RA 3LQAC 3RDTA 1NGYB 3KNBB 1T2QL 3B2UC 2EZ0D 4OLZL 2EEDA 5J06A 5SX5H 3UO1H 1FYTA 4JKPH 4YIQB 1G6RL 3DHJA 5I17B 4G6FB 1PVHA 1MCWM 2X4UB 4GKSB 4JANB 2DTMH 5LAXA 1EHXA 1N7ML 4YHMH 3TN0B 3O2WH 1CXLA 3NCJL 4OZHE 1UM4H 4JRXA 4PRAB 3G9VA 3CPLA 2NXYB 4XP1H 3ZHKA 2VDOH 3MLVH 5AD0B 3S88H 2AQ1A 1RVFL 4HS6A 3RNQB 4L3EB 4IIQB 1DEEA 1U8QB 3PIQA 5CILL 4WI3A 5LGHH 1UCBH 1PY9A 3DV4A 4EDXB 4NCC2 3V2AR 2R69L 4R2GD 5E2VL 3B3IA 3EHBC 3OKNA 4H1LA 5FYLH 5FHAL 4ORZC 4YHKH 1MCOH 4DZ8A 2VDNL 4ZXBC 5I75B 1MIEL 2BNRE 5F1NB 5KVDH 5C0EB 1IGYA 1CLYL 5INDA 3L3HB 3TO4B 2CRMA 4HWBA 4HSQA 4X8JA 2UYLA 1MCDA 5DUPL 3RY6A 3AS3A 4F33B 2H2PD 2FYYB 1VESA 2B7DT 4P46C 4ERSH 3DGGA 1SEQL 3O3BA 3RTQC 3AROA 2IPTL 3HZVB 2VLRA 5C0ND 2OTUA 3DGCR 2ZP0T 1SJEA 1F90H 2HWZL 3QPQC 2HP4A 1R24B 5FDWA 4L4TA 3MBEC 2YR3A 1YUHB 4KK5C 3TJHD 3QDMB 4MVBD 3U30B 5BZDA 1LK2B 3U9UB 3NVQA 4BQBA 2ATKA 1LILA 3RVTC 5GSRB 3VFOA 4QRRA 2Q8AH 5ITBL 4D8PA 4Z7WF 4X4XA 1YEGH 3SDYL 1NC2B 2LTQC 1FNGA 1T5XA 2RBLA 5DQJB 2F58H 4AEEA 3I6GA 3RWCB 1S9YB 1BJ8A 1LD9A 3UZEA 1REIA 2E7LC 2NX5E 3MJ8A 2PTUA 1ETZA 4Q2ZB 2BY0A 2VN7A 5F7KC 5LAXB 4YX2H 3D3VE 3IDUA 3KAAA 1T7ZA 3VFSB 1S3KH 5TE6L 1F02I 1RJZA 1T1WB 5BV7H 3NTCL 3D9AH 3WV0A 4YO0A 3P73B 2GAZA 3WFDL 4WUKL 1A2YB 1DLHA 3TC9A 1BBDH 2X4OA 2VRAA 3Q48A 1N4XH 2ZCHH 3VFMA 4XCFL 3BH8A 2AXHA 1Q0YL 2FB4L 1BEYH 4JM4L 3VFNB 4JPKL 4Y5VB 1UACH 3MO1A 4HPYL 4EDXA 3LEVL 1AFVL 4PJ7A 4Z9KB 1S5IL 1OP3H 1LNUB 4Q74A 4QLRA 3RWFB 3GIZH 2VAJA 4NPYB 3DO7B 4NO0B 2D4DA 2BMKA 3MV8A 4JE4B 3UYRL 3Q3GA 4WTXA 5DGRA 5K33A 5IWLC 1N5AA 4ISVA 4NRYB 4EN3B 2HT2D 1RUKL 1NMAH 1RURL 3KR3L 2C5DC 2J8OA 5FYKE 3TBWA 2RFXA 4NC2B 4F15C 5E94A 2B0SL 1TVHA 2NY6D 3D3VB 5DRXB 4WHYG 3DGGB 4NKDA 1BFOA 3VA6A 3KNBA 1CU4L 3MXVH 4L3CB 1NCAH 5B3JE 1T89A 4YWGL 3FQXB 1N3NA 2WM0A 2DQHL 1HKLH 4G9FB 3L3JB 1DR9A 1XIWA 3OB0K 5JZ7C 1UXWA 5SX4H 4LLDA 1T21B 4JFEB 2K7QA 4HZAA 1IKNA 3FB5A 4ONFL 3FCTB 1RK0A 3B9KB 3LKRA 3UO1L 1JUFA 1I8IA 3Q6FB 5AD0A 2YPKB 3RFZC 2UZIH 2F58L 1YEIH 4KXZI 4XNMB 3BI9X 1JWUB 4WUUE 2YD9A 3RNQA 4YHLL 1QOKA 1Z2KA 4NQSB 4PJHA 4C4KO 4N8VA 3QCUL 1AH1A 4XCCL 4HK3N 2BRQA 1N6QL 2W92A 3S35X 3WO4B 4OLUH 3I6KA 2EDEA 4QRRE 4JDTL 3S4SB 3EAKA 2CQVA 2HKHH 4JO2H 4C56E 4PRHD 5TF0A 5HYEA 5I15L 2O61B 2EE9A 3DVGB 3ARGA 1KCLA 2J2ZA 4X6EB 2OZ4L 1HYSC 3KPOB 5A16A 4JN1L 3T77B 4X99A 2I60H 2Y06H 1OTUC 4O51A 1RUQL 4PJBB 4DKEH 5BMFH 5DJXA 3TYGH 3BH8B 1BBJA 4JM4H 3K46A 4NKOA 1P4BL 4M03A 4MYWB 3NPZB 5C0CA 2BSED 2CO7B 2CRIA 3HI6L 2OQJA 1CGVA 1MIEH 1OGAA 1C8PA 3RWHB 1MUJA 1JK8A 4K7PH 4MA1C 1D6VH 3FT4A 4PJ5B 1D9KD 1YPZA 5FFLA 3PWPD 4NO0A 2GJZA 1V7NH 3K1KC 5DJDA 1UWGL 1MLCB 3HUJB 4UQ3B 1I9RL 5J6HB 1KLGA 3DUHA 4OF8A 2C4FU 1JRHI 1C5CL 3VI3F 2A74A 5D2LE 1N6VA 3L1OL 3VFWA 4EOWH 4J2XA 4RQQB 4KAQL 4LLYB 3TIDA 3GBML 5C0GB 4JDZB 1Q9WA 1J11A 1YJDC 1VFBB 1PDKA 4FQXC 2HT4C 5D7LA 5DF0A 3RUGE 2C3VB 4KMTH 1QKZH 35C8L 4DEPB 5DJ0A 1L7IL 4Y5YB 4KUZL 1K3IA 1PFCA 4I13B 1CDGA 4BELD 4P46D 4QOKE 3TBSB 2MKWA 5TPWL 4N9OB 3REWA 2R2CA 5IHBA 4K9EH 1AGDA 4NWTL 2IGFL 2A9MH 1MI5D 3U9PL 1JPFB 1MFEH 3JTTB 5J1AB 1CFSB 3L9RA 3M8OH 2PF6A 3IXAA 4DVRH 5FM4A 2GAZB 1VKXB 4BUGA 1C5DA 4IRJB 2VXSH 2IPTH 4LHUA 2EYSB 2CKBL 1P7KB 2HVJB 3MCLL 4JKPL 5DJ2B 1YNKH 3O6ML 5KW9L 3D85A 1SYVA 2BFVH 2VDQH 5I18L 5EUOE 3ZYJA 4WGWB 3VCLB 5IEKA 4RFEB 3DBXA 3GHEH 3P2TA 4OCRL 4U1JA 4F2MB 1ZA6A 1CFNA 5CSBA 4JFPB 3U4BL 3RWJA 2R0LH 4MD0B 3VFGL 3QWOB 2X44D 4BH7B 1E28A 5TE7L 3N0PB 5DRNB 3ZYZA 2CLRA 1LEIA 1XF5A 1LE9B 5E8NA 3EO1B 5E4EC 5KSAB 2XWTB 2VSCA 1OPGH 4JDTH 3GMQA 4L4VD 2I24N 3CIQA 4TTGA 3MTRA 3PGDB 4QXTB 4R9HA 4MQXD 2J88H 4OJFL 3DROA 5HVFB 3TA3C 1BIHA 2Z9TA 1KJMA 2RGSA 4JQIH 2XN9A 1CTOA 1DDHB 1BVKA 2ORBH 5FGRA 3FTGA 5FHBH 4CVXB 2E7BA 3VI3E 3RHWF 5KANI 3OBAA 4JQVA 3BDYL 5D96C 5K9OB 4OV6F 3RL2A 2Z8RA 3DYOA 3LPGA 1QG3A 1T21A 4JFEA 3TWCL 3W11D 2ADJA 2J8HA 3LPWA 2WINA 4QY8A 3RKDD 5C7XL 5IQ9B 5JHDB 2EXWD 5I8OL 3S4SG 3DVFA 5HHOA 1NMAL 1RURH 4JKKA 4DGVL 5I0ZA 1E6OL 4M61B 2FEDC 1CG9B 5B3JF 3GB7B 2WUCH 1WFNA 3HC0A 3GIZL 2X7LB 1NDMA 1Q9WB 2QEJA 5D7LB 5F96H 3QQ9D 1WFOA 4TNWK 3SY0B 3ZDXE 1ZTXH 1EMTL 4H25A 5D1QB 4ONFH 5KSBE 1PLGH 3ARDB 5E9DE 4Z95H 3UTQB 4YDIH 5IB1A 2BSTA 2EC8A 5E2UL 2QKIA 3O6FC 5SWSD 3TVMD 2NY2C 3WFEH 4YEEA 3C8KB 1W8NA 3KPOA 2FO4A 4OM1L 4TSCL 5GS2D 4PJEE 3MFGB 4LLMB 4UBDD 4Z7UE 1HHHA 5F7DB 1GOGA 1B9ZA 2EH7H 1MHEB 1YY8A 2D03L 3ZDYE 1I1YB 2BVQB 3PABA 4PJ5D 3ULSA 5I1JH 4NKOB 3RGVD 5I1DB 4Q6IC 4HIJB 3FOMA 1KJ2A 1I1FA 1WCBA 5HHNA 3SO5A 3IDJA 1MUJB 1UZ8B 2BZDA 2K9UA 4JN1H 5IFJA 3NTCH 3M45A 4GKNB 5DSCB 2V5TA 2X1XR 5C09D 2HRPL 5GJTH 3T65A 3F7QA 3HG1D 1FL6A 4EI6B 2VE6A 5KJRL 5GRWA 4JY4B 5CGYD 4GW1B 3CDFA 1CFTB 1EVTC 1X6LA 2VLMD 5F44A 4PJXF 3VXMD 5C0FB 4JKMA 2H9GA 4K94H 1LEGA 4L3ED 5GRYA 1S7QA 2J8UE 1V7MH 4I3GA 3KPSE 3FO9A 1V7NL 4AIXA 1QRNB 4M02A 2ZOKB 1IEAB 1EO8H 4JM2A 5C0CE 1GC1L 4GT7A 4P2QD 2IWGA 4KMQA 2A1WH 3PGCB 3D48R 3TZVA 2R9HD 5C92A 2XIDA 1R6VA 3CCHB 2B20A 4X6CA 2XN9E 3BP5B 4MX7A 1MVFA 1ND0A 3V6BR 2NY4B 3TBTA 2OI9C 1JTOA 5IW6B 1RPQA 3AU1A 1T7XA 2HA1A 1BZ9B 2Y5EA 3JSSA 4EDWH 3O4OB 1QSED 4DKFL 2ZUQC 5C0AA 4PJHF 5DD1L 3L1OH 2C1OA 5DDHA 2DQGH 1F45A 1NDMB 4Z8FH 1R3LA 1X5ZA 4I0KA 3IFLL 1MFEL 5DLML 4OFDA 5IJKC 3QXAB 3W5NA 1PZ5B 2GSGA 1KJ2L 1PD6A 1MY5A 1CE1L 3NFSL 4L8CA 3ARFA 1X7QA 3EJZD 2BCKA 1A3LL 3JBG7 5C08A 4DTGH 3U7AA 1KNOA 4JVUA 3BP4B 4L8DB 4LSDA 3WNNA 4PGBA 5DQ9B 5T3XE 1NCDH 1TZIB 2FIKB 5TFSH 2EDWA 5D9SA 1XGQB 3OAYK 4PP2B 3CXHJ 4I8DA 3FB6A 2OZ4H 1IT9H 2VXTH 1NFKA 3BD5A 1MEXH 3PQYD 3QUYA 1FJ1B 3PUCA 4APQD 3DXAA 3H3PH 4KDVA 4S2SA 4HIIB 1PKQE 1MFCL 1HZHL 1I3GL 4M1CC 2GUOB 2HVKB 1QBAA 3PV6B 3LHPL 3RWDA 5SWZD 4JY4A 5GRUL 5ESAA 5HGHA 1M05A 2IH1A 1S7TB 4L4JA 2EE2A 5GGVY 3KJ6L 1Q9KB 4DGYH 2RJMA 4JAMB 2AEPH 4XCEB 2IADA 5EZOH 2QLVB 3E6HA 1X44A 2DKMA 5ESQA 1ZOXA 1MOEA 4RMSA 2CLVA 4U6HA 3S88L 3QUML 5TE7H 3FQRA 4ZO7A 5JIKA 1SJHA 1YEFH 1AGCA 5IT2H 2HKFL 1FNEB 2H41A 1LO2H 2UV3A 1WICA 4G8GD 4UAOB 4GKZB 3H3BC 5E2TL 4MB4A 1SJEB 1OP5K 4CMMA 3IU3A 5I1CL 4QOKB 4BJLA 1OL0A 1M6OA 5JR1L 4OFYD 4KDTA 4NRXA 4P2QB 3RPKA 3LQMA 2B8OT 3ILQD 4U1HA 2A38A 3U9UA 4DKFH 2VOTA 3MLSH 1BVZA 4M4RA 4F57L 4XT1C 3C2AH 5EB9A 1R3KB 3IDJB 3BKYL 5L88H 3O6FD 1HEZA 4OUOA 5CMAB 3W82A 1BJ1H 2PYEB 2R56H 3KPNA 4OBSA 2YUWA 1PG7H 5E8EA 1T6WA 3RY6C 3QDHA 2ADFL 4X6FB 2DQJH 4CJ0A 1OSPH 1H15A 5CEZL 2AJSH 4P2OA 2R9HC 3KLAB 3EFFA 5I75C 4NZTH 1OM3L 5IFAL 1I1RA 4K2UH 4QXUL 3GMLB 1FYTD 2DN7A 4M7ZB 4IMLB 2XNAB 2ZNXA 4HT1H 3NMEA 2J88L 2E3VA 5I1EH 3TO4A 3FRUB 2WQRA 2ZOKA 4Z95L 5MP6H 1AXTL 1Z0MA 4RWHA 5DRZA 3EZJB 4GBXA 4O02H 5CAYB 4N0RA 5ALBL 1XFPA 2M26A 3T0AA 4LLWA 1JHKL 4KRMB 1JL8A 4NFBA 4TSCH 3O3BB 4Y5XB 4NZDA 4B7LA 1UENA 1T0MA 4M7KH 3T3ME 5L6YH 2WBWB 3Q5OA 3G5ZA 1GZQB 1K4CB 1W72A 4DFHA 3PV6A 3RWDB 3WIIL 1TVDA 1RZIA 3CVHL 5L8JB 1FDLL 2XPGA 5KJRH 4BFIB 2R4RH 4RDQG 1IAMA 5DS8A 4B41A 1N5AB 2M1KA 1KTLA 3BIBX 3VXSA 3GZKA 3QNXB 5E9DD 2AI0L 4JO4L 2CIKB 3RVTD 4EZMA 3D87B 4F7CA 2Y6SD 2O5ZL 3D39E 3FQRB 3VXSD 1JI1A 1GGCH 2DL9A 4JKLA 2P5EB 4YNYA 5IG7A 5C7XH 4NCC1 5DJCA 4LNRB 1R0AL 1E4XI 1F6AA 1U58A 2F15A 4UQ2B 3O45A 4HJJL 1XCTB 1ZT1B 3OKOB 4FS0A 5H2BB 1I9JH 4C83A 4LCIL 4OM1H 3HLAA 1ZMYA 3MRRA 4XZUB 1IM3B 4M1CD 5JXAH 2VDLH 4QGYA 1FCGA 2X4QB 1EEYB 4LRNL 4Z77A 1J1XL 3ARBC 1ZANH 1D5BA 4HC1A 4ODTH 4GMTL 4K3JL 4PGZA 3BSZL 4KQ4L 4NFDA 3SE8H 2OL3H 4P2RD 3QPXH 4HQQH 1G6RB 4C57C 3KYKH 3VXUE 2B0SH 1GCFA 5F9JB 1DBKL 1A3LH 3IDGA 1VHPA 1R3JB 1JGDA 2W9DL 2C7UB 4GLRH 3VXME 3GUTA 3MLSL 5D1ZA 2PR4H 1NGQH 1QBMH 5KVMC 1AGBB 1NUNB 3QIWB 4FXLA 4O2EB 2NXYD 2YRLA 2DQCH 5D2NA 5ESAB 5CD3A 4NQVB 3EOTH 1Q38A 3TJEL 2BMKB 1H8NA 3GDBA 1T1YB 5DMGC 4EQ2A 1UM4L 4IMLA 4HH9A 3UTSD 3U7WL 5BOPA 3KXFE 3FRUA 2X05A 3S96A 3C60B 1HE7A 5GIRB 3Q1SL 2VLJE 4YHZH 1VPOH 2EDLA 1TITA 4M1GH 1FZMA 4ELME 4HKJB 4BK4A 4F58H 2D31B 1MH5B 1ZS8A 3LEYL 5C0CB 1RI8A 4RISH 3ROOB 3HMWH 1JTPA 2WWKT 4MJIA 4KKNA 5C1MB 1N3NB 3G5ZB 4GS7B 4J3VA 4IRSA 4R0LC 1IAKB 5GGSY 1RZIB 4PGCB 5FGSA 1CD8A 2ARJA 2UUDK 4GW4B 3CMGA 4NRXB 5ALBH 2JJSC 4XCYB 1D5IL 3S37H 4E5XA 1OHQA 3GSNB 4DGIL 5KVFH 1MWAH 4GFTB 3LQZB 2P42B 5ADOL 2X4NA 3OKDA 2W65B 4N5EC 5J0BA 43CAA 4XNMA 3BD4A 2VQUA 5DK2A 2R23A 3LQAL 1AD9A 4RSVA 3EYUH 3OJDB 3HI6H 2XZAL 2F5BH 1FYTB 1YEKH 4QXGH 4GG6F 1N0XH 4JZJB 3QEHB 4O58L 1XCTA 1F4XL 1INQA 1S5IH 3W2DL 1F90L 5DHVB 4I18B 1E4KC 1G1YA 4K7FA 1CD1A 5EU3B 4A6YB 3V6OE 3D18A 2EDHA 4X4MA 4K3JH 1T2JA 3DX7B 1GGBH 1R5WA 1YNTA 5A16B 1IC7H 3NFNA 1HKFA 3DTXA 1VKXA 5IVNA 1YEFL 2AEIT 5LGJA 3KYOB 4KTDL 4OZFG 4OI7A 3EOYG 1P69B 2OCFD 4MAYA 3NA4A 3LS4H 1Y6MR 4WNQB 3KS0J 1EBAA 3HRZB 2BOBA 2HJLA 2IAMD 1OAKH 3DSFL 4GMSH 4G7VL 1S8DB 1XR9A 1YN7A 2E9JA 1YEHL 3EDDA 2EKSA 2FJGB 2V5RA 1IAIL 2Z91A 1Q1JL 1ZT7A 4NQCB 2HFGL 4PRPE 5A2KH 3LHPH 1WIUA 4R6UA 2GJZB 3NABL 3MRBB 1U95B 4PJEB 1XGTA 5AYQA 1U8NB 4RA0C 1CDJA 4HJ0C 2W0FA 1PQZB 3GI9L 4Z0XB 2YMXH 1RIUL 5FO9A 5F3HB 3WJLA 1YEDA 4JPIB 5ERWA 3SDXE 4NKMB 4HBCL 4P4RB 3F6IA 3F12B 4YPJA 4OKVB 1ZS8B 5JW5B 1FZJA 3LKPA 4U6VL 3MYJA 5EC2A 3MLYH 3MRDB 1AE6L 3GI8H 4OLYH 1LO2L 4ZXBD 5GJSL 4RRPA 1A7BA 3RWEA 2DI7A 3ULVC 2A9NH 1DQTA 2VR5A 2MSPA 5K9KB 1VFAA 3QJHA 2AERT 2WBJD 1EO5A 3LPFA 4HUUA 4QHNB 1MELA 2UY6A 4WTWA 4G6KH 5L8LB 3SE9L 5FYKU 5DMGD 3SDXF 4RRPG 1G9NC 2AXFA 2LVEA 2OX5A 4HUWA 4NBZB 5BMFL 1RUML 2OM5A 1C1EL 2CDFB 5DK2B 2CXGA 4L3EA 3IDGB 1C5BH 3VXPB 3QEQD 4MJ2A 2VUYA 1LD9B 4Y1AD 4L8SC 4EVNB 1QFOA 4OSUH 3V8CA 4P4KA 4ODTL 1U42A 3QI9C 4YBLC 4AIZA 1WBZA 4HS3A 4YDLC 4UTBH 3DMMA 1FGVH 4NQVA 1I9JL 1RD6A 1DN0A 1LEIB 4ZTPH 1KIQA 4LKXA 5B8CB 2HJKB 3AREA 4LLUA 1ZLUH 4CBPA 4X8JB 1FNHA 3C08L 1U8PB 3NPSC 1YY8B 3ZSTA 3SO3B 1MPAH 2BX5A 3MRLA 1XF2B 3JWOH 4JRYB 3SKNB 1YN7B 1BD2A 3EYQD 2R2EA 4ODUB 4BSJA 4XNZB 4FABH 1QPPA 1PW3A 5EO9A 5C0RH 2W0PA 4KKBD 4JO2L 3OJ2C 4GMTH 5L2JA 3S34L 4NHCH 1DSFL 1VGKB 2VLKB 3GSWB 4LEXH 4Y4HC 1SMAA 3OPZL 1LVEA 4JJHA 4RGOL 1U8NA 4JREC 5E0QA 5FUZL 1NFDB 3CMOH 5GSRA 2ZUVA 4OFPA 4HD9A 3G6JB 1AKJA 3T0XA 1XF1A 1MHCA 2MPAH 3BRFA 1YJDL 5E94B 1YEDB 1GRWA 1S7QB 2R1YA 1T22B 4HJGB 2IANB 1WQVT 1OAZH 1ONQB 1QRND 2LFGA 2VKWA 4X7FC 4QHMB 5EZIH 43C9A 2PO6D 3CFEB 4JFEE 3CVHH 1CIDA 4N0CD 3U7YL 4BH8B 3ARDC 2FLBT 3KS0H 4Y2DB 4X7DC 1K85A 2DWEA 2YA0A 4OGXL 3AUVA 1D6VL 2JJWA 4K3DH 1DQML 3VGAC 1BD2D 3VXUD 5K9KA 2R8SH 5TE4H 3QCTH 4KK9D 1A0QL 3QDJA 3MRNB 4ZNCD 1NCWH 1R5IA 1P4IH 3KYOA 3C5SA 3LV3A 4MSWB 2AV1B 4WNQA 3KHQA 4Z7WE 5HGDA 1HCVA 3VGBA 4QHLA 4HIJA 2IG2H 4NP4L 2VSDA 3I3BA 3LKOB 2YN5A 2OXHA 3GK8L 1NFDE 3BPNB 2PXYA 1S5HA 1HDMA 4GXUM 4NCDA 2R0ZH 3EDJA 5KN5A 4R4NC 1OD9A 4XX1E 4JCLA 5H35A 2ZSVA 2DQIH 5JIHA 3Q3GB 3TJEH 5I19L 1WT5A 1G7MB 3ARFB 3BAEL 3M1BA 1C16A 3B6SB 3O3EA 2HJKA 1U3HD 3AAZA 4H26A 4X4ME 3DX8B 1S9WA 4UT9H 3BP4A 3DPBA 4L8DA 5B22A 5CHNB 3D3VA 3F12A 3NCBB 1BFOB 2Q8BH 5IMLB 1FO0A 5FKAB 1IM9A 3LZFH 3U0WL 3LD8B 2YZ1A 5JW3H 2VH5H 5T5FL 1KELH 1Z9MA 4AK1A 1AY1L 1G7QA 4XB8A 2AXJA 1A3RH 3B5HA 2FH8A 1XIWB 3QJHB 4HJ0D 5KSBF 2PW1B 4MD4B 1MPAL 4MNQB 4HBCH 1UKSA 2KPNA 4LLDB 4Z7OF 4PRPA 2W07A 1F3JB 1P53A 1JZ5A 5DQDL 2CKNA 1RK0B 2P5WB 3GI9H 1RAMA 4G7VH 4P9HH 1B0GB 4AMKH 1KCSH 4PJ8A 1NLDH 1MAJA 2ZCLH 3VRIB 2QHRL 5TFSL 5SWSA 1GGYA 4HULB 1PYWA 2DYPD 4HK0A 3L7FB 5EUKA 1J8KA 1E4WH 4WHTA 1ZLVH 4DGIH 5JMOC 3AY4A 3U4AA 2EIBA 5FGBC 4HLZG 4PRIE 4Z7OE 5CP3H 4MXWL 2HT2C 5IJVA 1LDPH 4ZOBA 4G3YL 4M62L 5F89B 4OZFB 4P5TA 5BRZB 2BCKB 5JW4R 1I1CA 4WWID 3LRGA 4FQPA 1JI2A 2F5BL 5E8OA 1W0WB 4XPBL 5DJXB 1AE6H 4N8CL 2DQFA 4S1QH 2A6KB 3GRWH 1Q9OA 2N7BA 5GRJH 1EZVY 3VXUB 3T8XB 1UWEH 2ZWLT 3JTSB 3SKNA 1TTFA 3W2DH 1JNNH 4M7LH 3FMGH 3WO3B 5J11B 5IBTH 4CVUA 3OZ9H 1ZA6B 1S5HB 4QWWD 4OSUL 2X42A 4I48A 2I9LB 3L3OA 4OZ4B 1GGBL 1SBBA 4HXBH 3LIZL 1YDPB 3A6OA 3DIFB 3CVIL 3FFCD 3QUYB 3BZEA 3BUTA 3TT3H 3AGVA 5E56A 2Z92A 5ACLA 1CLCA 1YN6A 4JPVL 5T5NG 1AXSA 1NFDA 3ULVL 2CGRL 1E4XH 2NNAB 1B0WA 4QHUA 4XCEA 2R1YB 1VGEL 1JGUH 1UM6H 4MNQE 4TN9A 2YD4A 5E5UB 5KAQF 3FT2B 3HS0B 3QDGE 1DSFH 1RSFA 4R97B 5IB4A 3F58H 2VZVA 3ILPA 1LO3L 1CQYA 4L9DA 2C3VA 4Q58C 3MOBH 2CKBA 4TUKH 2H32A 4M00A 4ZODA 1B90A 3LN5A 5BZWB 3L7EB 5EIIB 3THMH 1FRGH 2BRRL 3BIKB 4G6JH 2C4XA 3GJFA 4LEOA 4NNPH 4KJWC 3ARXA 5EOCL 1B3JA 4IOIA 2YD1A 2F8XC 4Z7QF 1OCWL 3MYZA 4PJXE 4LP4A 1R5IB 3QUXD 3B9VA 3DX9B 3GGWB 3QFJB 3L95A 2YKLL 3D85B 4J8RA 3N9GL 4J4PD 3WUZA 2AJYH 3BJLA 3NACH 5D8JL 2R2BA 3FO2A 2MQ0A 1NC4D 3DX6A 5MEND 1QSFE 4NUJB 1ZLWH 5TF1H 1EO8L 3WHXA 1T7YA 1YQVH 2VDKH 1ZLWK 2MTPA 3CFDB 5D1ZD 2MMXA 2D2OA 3P4OA 2W9EH 1IT9L 2VXTL 2EXWC 5DVNA 1D5MA 3W0WB 1W0YT 5D7LD 5HHVL 1MCWW 3DECA 4JM2F 4YHYB 2AEQH 4U6XA 3QAZB 5I8EA 1XF5B 1ZWIB 3O45B 3VXTA 1C1EH 3X13B 4WU7A 2FO4B 1XT5A 1INDH 1RZ7H 5DR5H 3G6AB 2XWTA 3AAZB 3RVXD 2XZQL 4OF5A 1W0WA 4HIHA 2UZYB 3BPLB 5EBMA 5IVXA 1H5BA 5KSVA 1UWEL 3VRJA 4P2CG 1FO0B 4K3DL 5FOBA 4N5ED 5C3TA 4UTBL 5BS0E 1U41A 3ZE1F 2NY2D 1B88A 3CNKA 1CGTA 3MA7A 1NGXA 3BUYA 1AP2B 1J1OH 4HCRA 4TNVK 3WS6C 5DSCA 4JFDA 3HAEG 2HT3D 4PRPB 4H1LH 1HINL 4FNLH 2EDJA 3FRPA 1JPTL 4M6NH 2WINB 2BK8A 5JOPE 3BWAB 4BFEA 5CD3B 3OZ9L 4RAUB 1IAII 2Q6WA 3VFVA 1NBZA 1JYXA 3FQUA 4OF7A 5L7XH 4M43L 3G6JE 5GS1B 4XMPH 4OLXL 4RGNE 1RQ5A 2QQNL 1OAZL 3TT3L 4MS8D 1NGPH 2CIKA 2I9TA 4GG8B 4K8RD 1NAMH 1QSEB 3VWJC 1G7PB 3I2CH 4HMDA 3EUUA 2FSEB 3MGAA 2DLIA 5FYKL 1QBLH 5EULV 1GL4B 5EBWA 3ZE0E 12E8L 5D72H 3SE3C 1ED3A 2AK1H 5DVKA 3CFKB 1VADA 4LF3A 3BKCL 3GJEB 4L29B 2A77H 5HHXH 4PGCA 2EDDA 4MQXC 1SY6L 3MOBL 4LRIA 4OCYL 2DQFB 4K7PY 4Z77B 1KG0A 1X4YA 3QXTA 5JQHC 2H45A 3TFKC 1FBIH 5CJ5A 4E9LA 3RIAK 1VPOL 1EBPA 3HE6D 5HVHC 3QISA 3K2UL 4PJDB 1EEZB 3BKMH 3T2NL 4FQXB 3V5DB 5EZLA 1N2RA 1MCBA 3I75B 2NMSA 4WU5A 1HOCB 3BN9D 3K3QA 4FMKA 3BN9C 3GUTB 4HZLA 2C26A 4HX1B 2NX5D 3KPMB 2LU4A 3QEUB 4L3AA 3O3UN 5LXGL 4M93C 4YDJA 4Y4KC 1MI5B 3H9YA 3SOBH 5TQ2H 4DAGL 5ANMB 1YQVL 2QR0B 3GK8H 2WBJA 5IMKA 1YMHA 1IQWL 5C0EA 2J6EH 3CC5B 1NEZA 5J9PA 1K2DB 4JFHD 5ID0B 5I76A 1S3KL 2VZUA 1JZ2A 1DBJL 2ATPB 4IRZH 1J1OL 1MH5A 3TF7C 1AP2A 1EIBA 2ARWA 3KPRA 4YK4B 3P9MA 2P43B 5C0DA 3RBSA 3AM8A 1MF2L 2EYRB 2UVFA 3FQWA 4IHOA 1I1AC 3MLVL 2FECL 3MRJB 1JWSB 4AYFA 1RZKC 3X12B 2Z0BA 4LU5H 4F37F 3VDBA 4LK4A 2VXUH 2BXZA 2OK0L 4XCYA 3NH7L 4JAMA 5BCAA 3QDMA 4HUKB 2EIZA 2IQAA 1E0OB 5GS0C 3D2UB 3QQ3A 4MJIE 1A1OB 4ZFOL 2I9TB 2ICWA 3SGDI 3SQOH 1JZ7A 3BXNB 2APWA 4HFUL 4X80L 5E5RB 3GMNA 3GSOB 1TVBB 3P4OB 3EOAA 3IJYB 4LLVA 4XAWH 3OJDA 1A6PA 1AGCB 3MYJB 5EC2B 2R39A 4WI2A 3V5KA 12E8H 4OLWL 2P7TB 5I1HH 2JCCB 3V0VB 2YBRA 1JPST 8FABB 2DQDH 4XWOC 5LCVH 4X6DA 1AHWA 1M6OB 5EORL 2DBLL 1U2CA 4PJXA 4K8RH 4HIHB 4NNYB 2N7AA 1KENL 4P23D 4XBPA 1OP5H 4X9BA 1I9IH 2CLZA 2QQKL 1TZIA 2FIKA 4LVHC 1U3HB 5FM8A 2UWEF 4NNPL 1R3KA 2IC2A 3HC4H 1F4WH 1BQSA 1NC4B 4OCXH 5EFIB 4NGHH 4PV9A 4QF1A 3JVGA 1JYNA 1DQDL 1DUZB 3N1PC 5JW4M 1G7HA 2IF7A 3CLEL 4AENB 4PR5A 3SDYH 1MCSA 3K80A 3O6FB 4ONGH 1FAKT 2YKLH 3QEUA 5M94B 4PY8J 3REVB 5I8KH 5ENWA 2FD6L 4L8BB 5E00A 2BC4B 4ZUUB 5H94A 1D5IH 2IH3B 2FBOJ 3S37L 3E6HB 3HHRB 4NZUH 3OX8B 1JF6A 4G5ZH 4XH2B 4TUOA 5SWQA 1YMMA 1AR1D 3O6LL 5J7CC 2VMFA 2YPLE 4UV7H 4YX2L 3MJ7A 4O9HH 4JPIA 2OTWB 3ZTJH 4FG6D 3I9GH 2A6IA 4NKDB 2XFXA 1BQLH 4NNXB 1JF5A 2X1WL 5GGVH 5BXFA 3MLUL 3WFDH 1UA6L 4TRPH 5F1IA 3OKMA 3W0WE 5CJOL 2D0HA 1MRDH 4J4PA 5LG1A 4LQFL 3RX5A 5HI3D 2ZG1A 1D7FA 2V9TA 4BKLB 3FZUC 2YPVH 4R4ND 1UB6A 2YZ8A 1UXWB 2P44B 4YBQC 1DCLA 4DKDC 1A7NH 5DS8B 2NY7H 1MFNA 1AFVH 2DWDB 4ODVH 2JIXD 3SDAB 1I8MA 4NN5C 2B4CL 3BHBB 1AQDB 3G6JA 1JN6A 4ONHB 3GBLA 1I8IB 1MCKA 2HMIC 2IAND 1U91A 5EC1A 4L8SB 4FFVD 5CJQL 2VDKL 1HEZB 4P2RB 43C9B 4WCYL 5EOQH 4QRTB 4YDLB 5KS9A 3IRPX 1B0RB 1A14L 1HOCA 1P9MA 3GSNL 3O2DL 1G9ML 5ISZB 4U4BA 3DURB 4KJQC 5KSAD 3DWTA 3RNKB 4X5XB 4RZCA 5A3IC 1KN4H 5I16B 1FG9C 3ESUF 4P59H 3E3QE 2AK4A 1AGFB 2VXVL 5JPMA 3T0EC 4LKXB 4M48H 4OLVH 3AREB 1QBLL 2CLZB 1TETL 4O51B 1TQCC 5GZND 4NO3A 3HE6B 2F5AH 3MJ9A 4K3EL 4QGTA 4P3WA 5DJAB 1OGAE 5DJZB 2AQ3A 4RCAA 1Z9SA 2EZ0C 4XNXL 3TFKD 3V8OA 2ENYA 4OUUB 1V8HA 4ELKB 1K4CA 1W72B 2C3HA 4O58H 2V5SA 3QEGL 7FABH 5D2NB 3LY6A 4E42B 3RRQA 3MXWH 4GW5B 2BC4A 2FGWL 5H94B 2E5EA 4Q9QL 4H1LG 3UBXB 4R0LA 3IF1A 4TTDD 5IVZB 2LABA 1NCUA 3O3EB 3WNOA 1B4JL 3CLEH 3VG9B 1L6XA 5EUOB 3NAAH 1FZMB 2ITDB 3QFJD 1L0XA 5FYLD 4DFIA 1A7OL 2A83A 4GAGH 4HC1L 2XFXB 1ZV5A 5LGKA 3KPLB 3L3IB 4GQ9L 3MLZH 4KI5F 3HZVA 1UG9A 3QWRA 4HXAL 1ADQH 3KYNA 4H0GA 5T1MA 3SKOB 5AAWA 2IPUK 5CZKA 4RMVA 3CX2A 5ILTH 3RU8H 3QQ4B 4NN7B 5TDOB 2JJUA 3MCG1 1P6FA 5TGBA 2LAGB 4P3CL 5J1AA 3RUGF 4GG6E 2YD3A 3IXAB 3ZDXF 2IAMB 2DLTA 2OJEB 4G8EA 1XF4B 4PRHB 1S78D 4PTTA 2A0LC 4KVNH 3MREA 5D2LF 4LCCC 1WIOA 4HS6B 1NC4A 2E7MA 3RQ3A 2R23B 4HFUH 2VLKE 4X80H 4Z7NF 1KPUB 3V4UL 3K1DA 5CD5C 4OZHB 1YC7A 4CMHC 1J8HB 1QO3B 2MQ3A 3T1WA 1FE8H 2GY5A 5BVPH 1U8HA 4JFPA 3WIFA 4P5KA 1GIGH 1HHGB 2PTTA 3GMRB 1ORQB 4BH7A 4WFHD 2ZSVB 5HYJB 3CFIC 3QUZA 5LBSL 1KEGH 4A2MA 1N64H 3ZKMC 3AFLA 2VITA 2BVUA 4KMTL 4XMLL 3QUXC 5KSAA 3L6FA 5EO0B 2JJSA 1G9EA 1QVOB 2G75B 4MAYB 1UEYA 1EAPA 3QR2A 1WCQA 2NLJA 4OZIF 3K8MA 4NQED 1FVCB 5DJAA 1HN1A 5DJZA 5T3XH 5LCVL 4P23C 1YEEH 2Z93B 3TNMB 3WFBL 1WFUA 5EO1B 1XIWC 3OKMB 3FTGB 1K8DA 1CDCA 2I9LA 4WW2C 1JPSH 5K9OA 2HFEA 1LDSA 1IILE 2EXYD 3D6GA 3GSXA 4LAQH 3GHBH 1IQDA 3MRBA 1EO7A 4PJCB 4APQB 5KVEH 1H8SA 2Z92B 4TVPD 5F7EH 4MNHA 3CK0L 4X9GA 1JNJA 3TPUA 1L7TL 3AMKA 3BHBA 4NZUL 4NUGH 1JN6B 3LKSB 4ONHA 3B9KC 1EPFA 4XNXH 4Y4HD 1TVHB 1HXYB 4NO2A 4YFLF 3EGSA 2BVYA 4PJAE 1MJ7L 4M7LL 3WSQH 4QRTA 3LKPB 3H42H 3OB0H 5KSBA 5F3BA 4HK0B 1UVQB 3IKCA 3V6ZA 2DDQL 4S0TD 1AR1C 4ZDHB 3KYNB 5GGQH 4JFFD 4OJFH 2ICWJ 4J3SA 3WJJC 2XOTA 3L3JA 3SDCD 4CW1A 4XHJD 4Y19E 5E8PB 1RJYB 1OTSD 5E6ID 4OZFA 5JHDD 1EV2E 1AGFA 3GSVB 5K9JL 2DICA 4U1LA 4OD2A 1IKFH 2PO6B 3HE7D 4XAWL 1A2YA 4R90H 4N0YH 2ZOLA 3R0MA 1YQ2A 5IB5A 3GGWA 4N1HB 3L95B 2NY5H 2A6KA 5FUCC 1S9VA 3ZHLA 5GPRA 3TPKA 4NOBA 1QSEE 5DZOA 4MCYA 3UBXG 3U7YH 5C86A 5FUOL 1ZK9A 5JXED 3ZE2E 3WUWA 3MRHA 1RJLA 1T83A 3MV7E 1FL5A 5GHWL 5SWZB 1F4YL 3ARGB 1J87A 3UBXA 4JFQB 3U79A 2ICEB 3F7YB 3GSQA 3SDDC 2W0FB 5L0QC 2IFGA 3OV6A 2OR8A 4YPGB 2YC1B 3ETBF 1NLBL 5T5NF 4AMKL 4LCWD 4M6OL 5IVXB 3TM6A 5GISH 5DRWB 4YXKH 4PGDA 3P3YA 3SBWC 1K3ZA 3ZDYF 1FVEA 5BRZE 1OTTD 1QLEL 4KHTL 2EYTB 4P59L 1J0KA 5I73C 1MHPL 5EDXA 1OAYL 2IMNA 4LEOB 5D7KE 5DJDB 4AQ1B 1IQDB 1UT9A 4PJCA 1IGCL 5I1KL 4HHAB 4KKLC 1PBYA 1HXMA 5FDYA 5EZJB 4F80A 3FONA 3DMMD 5SX4I 4LSQL 5IKCB 3OQ3B 2EIEA 2HRPH 3KLHD 3CXDH 3UX9B 1UZ6E 4QHMA 4HMEA 4RQQA 5HYJD 4PS4H 4NQDA 2Q3ZA 1I3UA 1ORSB 1OGTB 4Y2DA 5DUBA 3S4SA 1OARL 5T1DL 4ZPVB 3QAZC 3BEWA 1S7UB 2PTTB 3GMRA 2MCPL 5ISZE 5DHYB 3ALXA 1UFUA 1EFXD 1EJOL 3C6LA 3L5JA 5B4MC 5CJXC 4FN0A 3REWB 3ARBD 1UH2A 1F8TL 3QIUA 3WMSA 5F8RC 4N0YL 5E4EB 1NAMB 3ZTNH 4FHBD 4X0KB 4PJ9D 1P7QA 4CADB 4QNPE 3L3GB 2R4SL 5HYQA 4D0BB 4ELMF 1YC8A 4LARL 2OQJB 1RZGB 2OLDA 3FT3A 5MERA 3WL9B 2YWZA 1MAML 4XBGA 3MRHB 4FTVD 1TENA 1B6DA 3OKNB 4H1LB 4W4NA 3RGVB 4UIMB 1C7SA 1FJ1A 4OF6A 5C0JA 3FAXA 1P5UA 4HZLB 4LSVH 1KLGB 1QQDB 5AYUH 2ZUWA 1MJUL 3IS1X 4ZO6A 2XZCL 1F2XK 4ETQB 3WFBH 3D39D 1UM5H 4NQUA 4PJAF 1I4FA 1DP0A 2DLFH 4JFDE 1RVFH 2B1HH 4IMKC 2PTVA 4GRWB 5F7FA 3FQNB 4K2UL 5HTSA 1CVRA 1JNNL 5FOJA 5CBAB 3C5JB 4K23L 4Y4FC 4CVXA 5H37G 1N0LA 5A2IH 3G6DL 5F7YC 3PHOB 1I8LA 5FYLL 1LO5A 4JHWL 1IGCH 5I1KH 5HHME 5E6ZA 5M95B 4TOYL 1CVSC 5C2BL 1MCJA 2ZUTA 4AEIL 2NXZB 1M7IA 2GKIA 5IV2B 1OOAA 1QLEH 5DWUH 2OL3A 3MLZL 2V2TA 2FEEI 5DI8B 1CR9H 1FH5H 5KW9H 4G9DB 4AZ8A 4G9FD 1FGNH 3BGFC 1DBAL 2CSPA 3KPRD 1RK1B 4NZJA 4PLKD 4JGUA 4ERSL 3HC0B 1CICD 4C54A 3RVVC 1QA9B 5GRUH 1UACL 2HAZA 1CFNB 4L9LC 5CKAA 4YFLI 3SKMA 5EBLA 1BQHA 1KFAH 1L7TH 4PJ7E 3KYMB 4OIIH 1FO0L 4RGNB 3U48A 2BY3A 2P7TA 2NY5L 4LCYB 4FFWD 3QXDB 2BVPB 2ADGB 4NQEE 4ZYKA 3GO1L 2ICEA 1F8TH 3GSQB 4QO1A 4QT5A 3M1BB 3QXWA 1OCWH 3QIUB 1MI5A 5DVOA 1A7PL 3CLFH 2H1PL 3STBA 4NNYA 1HHKB 1A9BB 4X7SL 4ODSH 5C6TH 4HGWB 5IMLA 4KVCH 2H2SD 4KUCD 1WISA 5IQ7H 4G6AC 1NJ9A 5MENA 4PV9B 1KB9K 1T80A 2EKJA 1IBGH 1Y6NR 4JLRB 2XA8H 3MV7A 3MRKA 4ZAKA 4JM2C 4OB5L 1T0MB 4HHAA 1AXSB 3QB7C 1K4DB 4Y19B 2ICCA 2R15A 3CFJB 3N50A 4E41D 3T4YA 4D0DB 1EZVX 4KTEL 1QKZL 1B0GA 4UIKL 1CL7L 3CGTA 3D25A 4GRLB 2YSSA 4XCNA 4AY0A 4D2NA 3D2UA 3QQ3B 2QQKH 5T1LA 1RV6X 1JPSL 4XH2A 3UTSE 3PGFL 1F4WL 5AZEH 2HFTA 1KN2L 3GMNB 2YXMA 1U9KA 4OQ1A 5BW7C 3PGCA 4M5ZL 3QQNA 1FNLA 1EH9A 4P5TB 4JB9L 1ZT1A 3OKOA 1PAMA 4S1SL 4OLZH 3OTTA 3TH3T 1CFVH 4ZFZB 3MV9B 2Y5TB 4PG9B 5F9AC 3UPAA 1BGXH 2RIKA 5C0NC 1A7RL 3RWGA 4X6BA 1OSZA 3O4LA 3QH3A 5D1XD 4UU9A 3DRQB 2VXQH 4P3DB 3C87A 5DA0B 3RPIA 1HYSD 2DQEH 1KIPB 1CBVH 4M7JH 4XAKE 1U2HA 2IPKA 4BSWB 5DFWH 2MHAA 3UBXI 3SKMB 1DUZA 4GKNA 3ZO0A 4L4VE 4JO4H 1YNLL 2FJFB 1CD9B 3FB7B 2R4SH 2H26A 4ZYKB 3SDCA 5BS0B 3EYUL 4XI5C 1KACB 5JHLH 1C08B 3PL6C 1FFNA 3S3JA 5F1KC 4J1UA 3O9WC 2W59A 2HFFB 4ODVL 1V7ML 4KUCF 3QO0A 1IAOB 5EBGA 1YY9D 1Q0XL 1F58L 5IK3A 2QADC 1GZPA 2EDTA 3HI5H 3FN3A 3P4NA 3QFDB 3FFDA 4HKJA 2DYPA 3BH9B 3FN9A 3STZB 1IEBA 5HDLA 2O5XL 2FRGP 3CSBA 1ZLUK 2X1QA 4JLRA 5ETUB 3BVNA 3SJVA 3DXAB 4NKQB 4S2SB 3ZHDA 4M6OH 3G5YB 2HT4D 3PDDA 3W81A 5F9WC 4WI5A 3BD3A 4RFOH 2YD5A 3NZHH 4B53A 2XZCH 3ZZ1A 1G84A 4PY7B 5D1QD 4PRPD 5E2WH 3FQUB 4KHXL 1JGEB 2PYEE 1WAAA 3T3PE 4HG4J 2HJFA 1Y0LB 2NTFA 3BGAA 3U0PB 4M6ML 1OAYH 4W4OA 1H8OA 2DS4A 4F15B 4OCWH 2NX5B 4YXHL 2IGFH 3QXAA 1UC6A 4N0UE 1ZHBB 3OF6D 3UYPA 3MRPA 1A6UH 5B39A 3A0OA 2JB5L 3JZ7A 4RFNB 4LCYA 5D5MF 3HZYB 4JHWH 5HVGB 3V6FB 2X10A 1HQRA 3O6MH 1JPFA 3JTTA 1GOFA 4L29A 2X4TB 1CDHA 5CP7B 3EDEA 4CRPA 3WXWH 2X89A 3TNNB 2PW2A 4XPHH 5E24E 2ERJC 4G8GA 5DJ2A 4XP1L 2FZ3B 4X6BB 3B2VL 4JGJA 2GQHA 5LGJB 4D9LL 2O5YH 4U1IB 2P8MB 1BWWA 4V2BA 1J5OL 1RZKL 4ODXB 1NGXB 35C8H 2X9YA 3MRIB 1J10A 4ZS7L 4UNUA 1JV5B 5I1IL 5GGUB 3RKDC 4OIIL 3GIVB 4KI1A 4XTRC 5E2VH 1WVZA 4YXLL 3G5VB 5CJOH 3RHWK 3WIFB 3KLAA 4OD3L 5J57B 4HMCA 4HWZA 2BNRA 4QRSA 4UUJB 4DVRL 2GJ6B 3LEVH 2OYPA 3ILQC 5GS2H 1XGTB 9CGTA 1QLRB 3EJYD 1X4XA 3CD4A 4LVNB 2XNAA 4XP5H 1JHLL 4TTDC 5E70A 4N8PA 3FL7A 2JELH 1QVOA 1HHIA 2F54D 4GRWE 3AS1A 1T03L 2AJXL 5ERWB 2VDNH 5IQ7L 1QFWI 3TYFA 4V1DE 1PEWA 1LEKB 3LEXB 3QHTC 4YE4L 1PSKL 1NCTA 5IBLD 1RZFH 1BJMA 5CLWA 2FWOB 2EYRA 3UDWA 3B8SA 5IGXH 1BIIB 4N8VG 4WFGD 3H7BA 1GZQA 1WJ3A 3QZWG 5IVOA 1X5IA 4XBEL 3JV0A 2P5EE 3MRFA 4BFIA 3RI5F 4D3CH 1U8OA 1UB5B 4JEGB 4PLNC 2YHGA 4I4WB 5KAQG 2EIZB 2XQBL 5FYJH 3ARBB 5CINL 2AABH 1QHOA 1A1OA 1ZVYA 1CGXA 1F2QA 4HEPG 3LKSA 1OWRM 1UXSA 1YY9C 4YDIL 3BMVA 1P84K 5IW1B 4QRPA 4UV7L 5L88L 1T20B 2LE9A 2WIMA 5C2BH 1UCTA 4K3EH 1FVDA 1J8HA 2CUMA 3JV4A 4GLRI 5E8EB 2FJFA 3FB7A 1F6AB 3AB0B 5JUEH 3V6FA 4PREA 3SDCB 3DV6A 5D7IB 1MAKA 4HKBA 4HPYH 5ANMA 2EDKA 1FN4A 5E8PA 3QO0B 4OLYL 5C07E 4MJ5A 4Z7UB 4X7SH 1TQBC 3MLWH 5I1EL 1CTNA 1K2DA 5ID0A 3FB8A 3PNWB 1G6RA 3FRPG 1N59A 1WCBB 2ZOLB 2NY6B 3D3VD 4R96A 4P23B 4OQTH 4F7EB 3NBNA 3STZA 1GC1H 4MNGA 4JRYA 1O5DT 3MRIA 5FO8A 1CLYH 5IROA 1N6UA 2ICWI 3OKKA 4EI5D 3FQWB 2Z8SA 3LB6C 5SWZA 4HLJA 2VNCA 4HDIA 1DQLL 3QG7L 2NCMA 2OJZL 2D7PA 3GSWA 4M7JL 4APQA 1MREH 1LEGB 4ZUVA 2PXYD 4XGZB 5IEHB 5HYSA 3RZCB 4DKAA 1KTDB 4YPGA 1IBGL 1JWMA 5F7MC 4F7CB 1BFVL 4LASL 3L5WB 1NCBL 2OTWA 4OCLC 2V9QA 3GSOA 1C5CH 3QHFH 2AJ3B 3SPVA 3EOAB 4GKOA 4LLVB 1EXUA 1NCAL 3FO0H 4U1KB 5DJCB 5EG6C 5FYKD 3O11A 1QR4A 4MJIB 3E2HC 2C3GA 1INEL 5I17A 3ISWA 1AQKL 2D0GA 3HNVL 1SJVA 1FFOB 3EDKA 2VABA 3AU1B 4WO4B 5C08E 2AV7B 2PYFA 1EEYA 1QP1A 4LGSB 3BIAX 3QDJB 5LBSH 5JOFB 1KEGL 1HXMB 3V4VH 4KRLB 3P4MA 2GEEA 1EK3A 4PJIF 2X4NB 4IOSD 2ZCKH 1A6UL 1K8IB 4NWUH 4WUUA 4Z7WB 3QIUD 1NC2A 1VEMA 4M5ZH 5IB5B 1XAUA 4QRPB 4KV5F 4U3XA 3VWJB 3I02A 2BNQA 1KT2B 2YS4A 5KVGL 4OD1L 3NIDE 1HDMB 3B2VH 4UT6L 5K59F 2UZIL 5GZOC 1N4XL 2ZCHL 5D93C 3Q5YA 3VXOA 4WW1B 5J1SC 4JRYD 3WXWL 2V2WA 1A47A 2KL6A 3LKNA 4ZUTB 1NGZB 2VQ1A 1S7SB 1EERB 5TE6H 1CGSH 4C56D 3NFNB 4KGJA 3VH8B 4Q9RH 5INCB 1ITCA 4YXLH 3QZWB 3MJ7B 4F58L 4FQ1H 5F7LB 1HWHB 3IDMA 4GQPH 3KDMB 3M17A 1N5YL 3ARED 3BISA 5I73B 3QNYB 5DD6B 4XPBH 5MERB 4GSDH 1KJ2H 4OZGB 3P77B 1JPGB 3KJ4C 4MDIA 1JNHB 2HVKA 3H0TA 4I5BA 3WBDA 1MJJA 3OR7A 2AJXH 3L5XH 3ARVA 3PWUA 4LCWA 3D69A 2EH8L 4LSUL 1UJ3C 1HH9A 3IFPA 1CL7I 3DHMA 1NEUA 4I3RL 1RJCA 5CIPB 1NFIA 3PWPE 4Y4FA 3QXVA 3X3FL 1T20A 4Q9CA 4G8FB 4KJPC 5D7LE 4Y16A 4Y88A 5E2TH 5I8CB 5F70A 4BZ2L 3H9HA 1RUPL 5F88B 4X98A 2COQA 1ZANL 5HSFA 5DUBB 1NCCH 3KXFB 1U92A 4GKZA 1G0YR 4YBLB 4WW2F 1ETZB 2WNGA 1CS6A 2DQHH 4QOKA 4NT6B 4X83A 1DLFH 1VFAB 3QIBB 1FZKA 1CD1B 4WO4A 5EU3A 5DFVC 3TH4T 5I16A 1BVLA 3ES6A 2XWBB 4WWKD 2BRRH 5EU4B 3FB5B 5BS0D 3FOLB 4G8EB 2J8UB 2RCSH 3F7PC 3OAZH 5C9KA 1RZFL 3QDGB 3V0WL 4G9DA 5IMOB 2D7OA 1UJTA 5HYQB 2EIDA 4OCRH 3WFCH 4JFFA 4Z18A 2E27H 4MAYD 1SM3H 4BZYA 3O9WD 1ZLSL 4G8IA 2WP3O 2XQBH 3S3SA 2AJYL 1OP9A 3OKLA 3DVNB 5JLZA 3WIIH 5KZCB 3VWJD 3H9SB 3QUZB 4MLSA 2AJVH 2DMCA 4JREB 3QDAA 1IZJA 3RTQD 3MNZA 5C07A 5AAMA 4Q0XH 4WFGE 1X5AA 4MD5B 3FO1A 4PJ8D 1DBBH 3LRSB 5CZXD 5IFHL 3KPPB 3VI4F 2P5ED 3TESA 4G7YH 4GSDL 4MNGE 1JK8B 4EI5B 3NIGF 4HEME 5T1MB 3TVMB 3RY4A 3UTZB 4NQEA 5GSVA 5CGMA 2BOCA 4YC2C 3GO1H 5ALCH 1IL1B 4PGEA 4LCWB 5JW4Q 3V52H 1A6WH 1L6ZA 4HT1L 3LKRB 3T4YB 4Q9BA 2R69H 5I9QC 3BZFA 3VJ6B 4ZO8A 1XIWD 4GRLA 5EA0L 4XMKH 3CX5K 1MVUB 5IG7B 4K7PX 4LLYA 1MSPA 4XCCH 5CKGA 1VFBA 1FPTL 3OF6A 2G9HA 2DWEB 5FYJD 3S9DB 1JJUA 4GBXD 1UVQA 1GYAA 2CKBH 1SMOA 5MI0B 3RIFF 1MHPH 4TUJB 2IBZX 3CFBB 4Y5VC 2J7LA 1T2XA 2ZNWA 3DMMB 3TLRA 3AS0A 5D6CB 1UWXK 1A3QA 2X41A 1IAIH 1UM5L 5HHPA 2VIRB 4NDMA 1WBXB 3JWOL 2JJTC 5E7FA 1NGQL 1QBML 1YMMD 3DI2B 3H9SE 4Z8FL 4JKWA 2X4SB 4ELMA 3U2SA 3I6LD 3NCJH 3N1QC 5KOMC 3ULUL 4K3HA 5FB8B 2R2EB 4ODUA 5EO1A 5E08L 1RJLB 2M2DA 4R4FL 3CH8A 1A6TA 4NO5A 2EE3A 3QG6B 3OKEB 2Q86B 3HE7C 4GXVH 2VLKA 1CZ8L 5C0IB 5FGCE 3AVEA 1T1YA 3IJHB 1S78C 4GRLC 2YOCA 1S7RA 3FHQA 5ADOH 4F7MA 4TPRH 2XKSA 3AREC 3PP3H 2ZPKL 5BQ7B 5C2UB 1NBVH 1KIRB 3EYOB 4Y16B 1A21A 4DAGH 1ZGLB 5C0GA 4BH8A 1IGFL 1K6QH 1PKOA 4TSBH 3G08A 4I1NB 3IYLW 5E95B 2OTUB 1JNLH 4Z7VE 4HWEH 4FQIH 1MEXL 2J5LC 1L7IH 3HB3D 3KPSD 2EC9U 4IMKA 4MWFB 4OCMC 2VB5A 2VDOL 3RL2B 1N8ZB 5MEQA 1T0NA 4PRAA 3EO9L 4XTRD 3VW3L 3B8YA 3I50L 1F3JA 4P2QE 5IROC 3U9PH 4QY8B 5JDSB 4ETYA 1Z3GH 3MNVB 4D8PB 2GITB 5K9QI 1TCRB 3JUYA 5A2FA 4L4TD 1P7KA 2HVJA 2XACC 4M61A 4R8WL 3VRIA 3X3FH 4K9EC 4O2CB 4UILL 1CXEA 5T1KB 4F8QA 4I77H 5CZXC 3NCMA 4YHKL 5IM7A 5J11C 4PJDA 3SY0A 3QEHA 3PE9A 4FQLL 2Y72A 3TBYB 2D03H 1A6WL 4ZAKD 1A7QH 5DD0L 2VL4A 5B38A 5F9OH 1NL0L 4CN1A 4WU5B 2H6PA 1FHGA 5T1LD 3VH8G 3VFSA 4A6YA 4U0RC 4FRWA 3PL6B 3UTTA 1QR1A 3QIBD 5DK3A 5F89A 1MHHA 4LVOB 3EJJX 3KPMA 5DYOA 5IHUH 4P49A 3KHOA 5FA3B 1WAAE 2HRLA 1ZLSH 4GAJH 5DWUL 3UYOD 3MUJA 5A1AA 2KQNA 5CHNA 1B6UA 4FQ1L 4PGDB 3CC5A 4D0BA 4NFCA 4IRJD 4XXDA 3P4NB 3QFDA 1HIMH 4AEFA 5FB8A 4LCCA 3N85H 4B0MM 3CDGB 3BH9A 4CDHA 1XF3A 4EXPX 4K71B 1YUHA 3C6SA 3PJSB 4OFYA 2AJSL 5DHVH 5BZDB 5GJTL 3DYPA 1WK0A 1KB5B 5I6XC 2FH6A 5DQDH 2VYRE 4HLZH 1IGIL 3HA0A 1JE6A 2RFXB 5KTEH 1SM3L 3VWKC 5C71A 2DQUL 1K5NB 5HJ3A 4QHKI 1KIRA 1RUMH 2CIIB 2ZG2A 3EYSH 3TV3L 2NQCA 3L3DA 4L3CA 4WEUD 5DK0A 5HY9A 1H0DB 2AJUL 4FQJH 4JN2A 5ESVA 2NX5A 4S0SD 5ELIA 3JWNC 3SE9H 3GJFB 4EIGB 2V2XA 2APBA 5B39B 3HR6A 3C6LB 3VFRB 3H8NA 1O7SA 1FFPA 1JZ3A 4APQC 3NZ8B 1IVLA 3ZL4L 1LK3H 3B9KA 3FCTA 2N56A 2R0WH 5IT2L 1JWUA 3PHSA 3W5MA 5CSZA 3BPOC 4NQSA 4PJHB 2ESVA 4NZTL 4LDEB 4HWUA 5T3ZE 2QL1A 2XWJA 3UYRH 3WHXB 1V3LA 5TH2A 2A6JA 3NIFF 4FZEH 1ZA3B 4MGXA 1A6TB 2R56L 5EBLB 3RWFA 1GC1C 1YDPA 3DIFA 3RGVA 3VMNA 2GSGB 2O61A 2HN7B 4N1CA 3S36L 5D2LA 2GT9B 2BNQD 3ZT5A 1QQDA 1SBSH 4PJGF 2DQTH 4N90D 4Q97A 4PLKC 5AEAA 5JW3L 4X99B 1U8PA 3K2MC 4PRDB 2Y25A 5E08H 4FQ2L 1UWXH 4BSVA 5E9DB 1VGEH 1BGXL 1QLRA 1EGJH 3MRLB 3QDMD 3NOIA 4PGBB 3VRJB 3WJJA 1HHJB 5CSGA 4GJTB 1U8JB 4X4YA 3PV7A 4Z7VF 1NCDL 2CD0A 2FBJH 4NWTH 5HYFA 3C5JA 4PP2A 2EEBA 4QXUH 1YECL 2OS7A 1J8HE 3U7WH 4F9PA 4YXHH 2QADD 5CJBA 5FCUL 3MV11 1DUYA 4ZFGL 1YNKL 2NZ9C 3ROLA 3C9NA 4IRSD 1NBVL 5TE4L 4AT6A 1HSBB 5J6HA 5K9QG 3B5GA 5L2KB 2NY0C 1X3DA 4BKLA 1NBYA 5CFHA 3TBTB 5I30H 4HF5H 3RVXC 1R0AH 4F9PC 3HG1B 1WC7A 2H2SC 4H8WC 4LFHG 2A73B 3ARBA 2FX8H 5K93A 1XZ0A 3VGFA 4N8VB 5T1LB 2X4PA 5HGBB 5DDHB 4JDVB 4YQXL 3MXWL 3HI1B 2BVEA 2XI9A 5D71L 4QRUB 5IM7B 2JLLA 3QUMH 1FL3B 3CFDA 2R0ZL 4X4ZA 2GY7B 4Y5YA 4AH2B 2YXFA 4MZ2A 3SDCC 5B38B 2HT3C 3O11B 3OSKA 4IDJH 4JFYB 3A67L 3QHZH 1AGDB 2WBKA 1KCRH 2BP3A 5FXCH 1CLOL 3QUMA 1TQBB 2AJUH 4PJBA 4PUBL 4P2QA 3QRFM 3WIHA 3HAEH 4R4BB 2HTLD 5E6IB 1WZ1L 4KUZH 4U1NA 4QXWA 3UMTA 1MRDL 1OP3K 4JHZA 4TVSa 5GS3A 5C70A 4YZFE 5TQ0L 3S35L 3QUXA 1DQQA 4KJQD 3UXFA 5KSAC 1T1XB 3O3AB 2IPKB 1ZA3A 5ANME 3V95A 5CMAA 4QTIL 4C55A 1BZ7A 5I1GH 5E1AB 5HHQA 5JDJA 5JXEA 5C09A 5CS7A 5CEZH 1AHWC 4ZSOE 4YFDB 3UTTE 4YDJB 3CZFB 5JORB 4E42A 4PRDA 4PRNB 4I77L 3WKML 3ULUH 3KJ6H 3C5ZD 4I9WD 3UJJH 1OAQL 4DCQA 3OXRA 3LS4L 1FDLH 5DHXB 3VGDA 1BVKB 1FAIH 4ZXBB 2XV6B 4HFWA 1OTSC 2KBGA 3IDNA 4JN2B 5DT1L 5ESVB 4CAGA 4RISL 4R7DB 4WHYH 2VAAB 1NAKH 4M48L 3TCXA 4MNQA 1KLUB 4MXWH 4XRCB 5IF0A 4XNZC 3MACH 4FQHB 3G5YA 1CFSA 2G5RA 3L9RB 2BHZA 2I07A 4TNWF 2XPGB 3BAEH 5TDPB 5MENE 4PY7A 1S7VB 4GG6B 3RAJL 3U46A 1X5KA 2I27N 2IQAB 2A73A 4NBXB 4JG1H 1QNZH 3GB7A 4QTHB 3MGTB 4P3DA 3QCVH 3TV3H 3MBEB 5BOZG 5DVLA 4MB3A 3U30C 3GBMH 3VFUB 3WIHL 1KPUA 4Z0BH 4MZ3A 5IW3A 4DGVH 4XPGL 4OAWA 2IFFL 1QO3A 4K94L 1T7WA 3CVIH 4JHBA 4UQ2A 2YBRB 4BQ6A 5IGXL 3QI9D 2Y7QA 3ARPA 5BS0A 4K9EL 4I0PD 4X6DB 4LCWE 5DUMH 4J1UB 2X4QA 3HUJF 2V17H 4G6KL 1MRFH 1BOGB 4L4VB 5FHBL 5E6YA 4QOKD 1XGRB 4XP6H 1BQUA 3JTSA 3P0YH 5EU4A 3FOLA 2YK1H 3L6FB 5FYJU 1DANT 1BX2A 3PXJA 1KBGL 4U1MB 1ZEAL 3QDGA 3UPRB 5ICXA 1EAPB 2NLJB 4GXUN 4WFFE 4JPVH 5LJYH 4BZ2H 4Y16D 2G60H 3QNZB 2GW5A 5I8OH 3FO0L 3BVNB 2AK1L 4AENA 3GIVA 1W2KT 1X5GA 3R1GH 4PJFA 3T0EE 4RGNC 4RGND 3FQTA 3HUJE 1WBYA 1MJJB 1BREA 4NZRL 4UUJA 1HSAA 2VLLA 1CE6B 1KCUH 4QHUB 5I74B 2WIIB 4JZNB 4O5LL 1MNUL 3U6RB 4U6TA 3TPUB 1F42A 5DEGB 5MHSD 4NN5B 5CIPA 3HB3C 3SGJC 2NY4C 2B39A 2VISB 3BPCA 4EN3C 2DRUA 5B39G 1R5VB 3EGSB 3UC0H 1MWAL 3IJYA 4NNXA 3BW9A 3GFUA 3BDYH 1G9NL 4OLWH 4KJYA 4TSAH 3OMZA 1VA9A 1XCQB 3UJJL 3BWUC 4D9QE 4P57B 3S34H 1IAKA 3GKWH 1WFTA 2X4UA 4GKSA 3PQYA 4JANA 5T3ZD 1F3RB 3LDBC 4M8QB 5D71H 1FZKB 1U36A 2R0WL 3QFJA 4KPHH 3PABB 3ULSB 3ES6B 2D9CA 2LU7A 3SJVE 4NKIH 3VFOB 3OKDB 4ZAKC 3T0EB 3GRWA 1I1FB 2PO6A 3NFPA 5GRVL 3EDFA 4OGZA 1R3LB 1TJIH 1D5XB 3ZKXC 3PWVA 3VFUA 3RP1A 4LASH 5F9JA 4BZ1L 1QFWH 3HE6C 1H3XA 5IFJB 2C7UA 1G7HB 5F6IB 4NUGL 3ARRA 2G9HB 5BV7C 3ARFD 1WZ1H 4LPUA 1NC2D 5C09B 1AD0B 1J0HA 2W60B 3U82B 1KUMA 2WUCL 2K1MA 4Y5XC 3ULVD 1CLOH 5ID1B 3O3DA 3HPLB 4G43A 4M8VA 4WV1C 2QSQA 5C0FA 1JZ6A 3O4LD 1H5BB 3DX7A 4PJBE 2C3XA 1XGRA 3SKJH 1EGJL 3FO9B 5DQ9A 3VDAA 1ZVHA 4MXVF 5C0CD 2Y36H 1IEAA 4U1MA 4N9GA 3RL1B 5E2UH 4X7CC 3VFMB 2Q87A 1WSST 3ZMRA 1ZHNA 3MA7B 3VGHA 1BM3L 1P1ZA 4R7DA 3G6JF 4QHKJ 1ACYL 3TZVB 4HIIA 3MUGB 3ZKND 4M4PA 5F72S 4FQHA 4XMPL 3N1GC 4KY1L 4NQEB 4KZDL 3UJIH 1NBZB 3KPRE 4ZSOA 1H3TA 1U95A 3BKJH 4GW5A 1WUNT 5DLMH 4DOHB 1PQZA 5IEHA 4J12A 3S5LA 1X5JA 4Z5RA 4QTIH 5FO9B 4E41A 3TBWB 1MFCH 1EUTA 1HZHH 3UJTH 3L5WA 2VISA 5B38G 3VMOA 3E8UH 2D7NA 3UTSB 4NQTA 3BKML 1BECA 4JJ5B 3SDDA 3QULA 1QFHA 3WFCL 4XNQA 3G08B 4PJ5E 5LWYH 5IB2A 1OTUD 3GJEA 3OGCB 4ENEC 4YXKL 2VC2H 4GH7B 1KCRL 4HKBB 2QV2A 5FKPB 3V6OC 4DN4H 3LH2H 4DEPC 3MV8D 3MRGA 1I3RB 4LFHD 4Y5YC 2M8XA 4P0DA 4WFED 1T1ZA 2GK0B 1VEOA 3LKQB 2OJEA 4Z7WA 1DLHB 1DQMH 1NAKL 4HUWB 3UPRA 4CN6A 3H9ZA 5ECJE 2HTKC 1WAAF 1A6ZB 2XTJD 2BOBB 1FCCA 4WWKC 3D1MC 1T89C 1EGJA 1QFWM 1UQSB 3ECBA 4QRPD 5D7SH 4FQQA 3I6KB 3X3GL 1CDIA 4PJFB 4RFNC 4G5ZL 2FGZA 1A1MB 2Z31C 5JZ7D 2WW8A 3ZE1E 3O8XA 2KDGA 3DUSB 5DD1H 4NPYA 1KBGH 4LU5L 5F7UA 4NP4H 4BZ1H 4UT7H 3DVIA 3ARTA 4ISVB 4EN3A 4R0LB 1J0ZA 4PV8A 1PY4A 5IMMA 1FQ9C 3AY4C 5D70L 3SHSA 1JHTB 3BO8A 1JWMB 4NHCL 3QZWA 5SV3A 5FUCE 2ATPA 3SE3A 3BPLC 5F6HJ 1FLRH 1BM3H 2KZWA 5ACZB 2AGJH 3FQNA 2VDLL 1YA5A 1ZGLA 4KROB 1A14H 3GSNH 3O2DH 1J1XH 5J13C 3FQXA 1MNUH 2FX9L 4P99A 4X6CF 1JGUL 1MCFA 1MRFL 4P57A 4RDQF 15C8L 4CMMB 3PHOA 5DO2C 4YH6A 3VXNA 1LO4L 1I85C 1AXTH 1YPZB 2AXGB 2IANE 1VEPA 2DBLH 2AV7A 2PYFB 3LZFL 3DXAD 1JCKA 2F53E 1BHGA 5C0BE 1NFDF 2ZKHL 4PB0H 4LVNC 2DLEA 4XAKD 4DJMA 2J6EL 3EBAA 4ZQKB 1DVFB 3ZE2F 4MXQC 5JPNB 2G60L 1OF2A 1KCSL 3HR5A 5SWZE 2OL3B 3GJFK 2E9BA 5BJTB 2V2TB 5JTWA 3GJFH 1F5WA 1K5NA 5FF6B 2QBWA 1I3VA 3QDJE 3EYFA 4NM8L 4UIKH 4P4KB 3IKCB 3ALWA 2DB8A 3V6ZB 4BQCA 2D0FA 1XMWA 2W60A 3ELAT 4KI5C 1FP5A 2B2XH 3HZKA 1ORQA 4DN4L 1B2WH 3HPLA 3INUH 4X6EA 1FFPB 5I66B 4GBXC 3QXUA 4LIQH 5DYOB 4OI8A 2XWBA 2YUZA 1FORH 1KIQB 5B8CA 5JQ6L 3T1FA 1HH6B 3P0YL 4LHUB 2AV1A 3T0ED 4KKAC 4KKAD 3ULVH 3M17B 2KKQA 5CSZB 4HC1H 4EKXA 1EFXA 1T04A 4RFEA 3JWDL 2YD2A 4LRNH 4J7RA 2DKSA 2P4AB 4PJ7F 1K8DB 1F4HA 2PCPA 3AB0C 3PWJA 4G8IB 4S1DD 3B3IB 3RVVD 4MD0A 2HFEB 3RA7H 2DQEL 2AI0H 5GGRB 2XYCA 1IGJB 2X5PA 5ENWB 5F8QC 1TJIL 3C6SB 1G7MA 3PJSA 4M1DH 2WWMC 4FFZH 5F1NA 4BFGA 3VW3H 5D7JB 4UOW1 4HAGA 3IFPB 1K4DA 1OVZA 3BZ4A 3CSYA 4FTVB 4KTYA 4TUOB 3S37X 4EUPB 2B4CH 5SWQB 3W11C 3VXSE 4D0DA 4HXBL 4MHHG 5HDQH 1TZHA 1QEWB 2MPAL 2NPLX 3PGDA 2NY6C 1BAFL 2E7CA 4ODBD 4QXTA 3UTSA 1AC0A 3BMWA 2CIIA 4JPKH 1M7DA 4YBQD 5I8CA 4AIOA 2JF1A 4LDOB 3ZLQC 1CQKA 4TSAL 4XPAL 4PP1D 1KGCD 1W72H 3IAQA 4ZDHA 2W9LA 4QWWC 3QRGH 5T33H 4IJ3B 4PTUB 3TA3B 3ULUC 3QIBA 4KVCL 3KYKL 1EFQA 1KN4L 3WFZA 3BGMA 1IL1A 4PGEB 2C9AA 3JWOC 2DWDA 3VG0H 1OAUH 2DLHA 5J89A 4HBQA 3KLDA 2VXVH 4FZ8L 2V7HB 3HAEB 3RJQB 3BPOB 4FQ2H 4HGKC 5D96B 5D72L 4ALAL 5L7XL 3VJ6A 1A4JB 5A40E 1UYWL 1A6ZA 3E8UL 2FLRT 5DR5L 1OB1A 5D8JH 3VCLA 4RMQA 4I0PC 1RIHL 4MCYB 1UQSA 4WY7L 3BP6A 2DIJA 4QRUA 4NHUB 1CL7H 3DURA 2F19L 3DUUB 5CCKH 2WWKO 4JO3L 3GM0A 5ACMA 5FECB 4X5XA 5E8DL 3T0VA 1V5JA 3EW3B 1WWBX 4YDKL 3C8KA 5HHXL 1IGYB 4HH9B 1FORL 5C9JA 1CWVA 4WHDA 1C16B 3B6SA 1B4RA 4RMWA 5EH1A 2XTJC 4L5FL 1JHTA 2FEDD 3MRMB 2YWYA 5EU5B 3QI9A 3P9LB 4KJPD 1F4XH 5E9DA 1H3GA 1P7QB 2XXCB 5E6IA 5F1SA 3T2QA 3SN6N 2AEWA 1FFRA 1KEML 2DIBA 4LVHB 5JXAL 4ZS6D 1T1XA 5IBTL 5F7HA 4XBGB 5GRZA 1LNUA 2R29H 4ZUWB 1HNFA 3F5WA 4GW4A 1BFTA 5ETUA 1A9EA 1DUYB 1FC1A 3Q6GL 2PW1A 4RMRA 3D0VB 5C0JB 4J3TA 3ARWA 4YAQB 5MEPB 2NZ9D 4MQTB 4WWKA 5EZJA 2H2PC 5CJ8A 5IHUL 5IQ9A 5D6DA 5F3HA 1P4LB 1Q1JH 3TO4D 2X70B 5D7SL 3MCLH 2A77L 2E6PA 4OZFH 2PR4L 3EYOA 1A02N 5FK9A 2BFVL 2VDQL 5I18H 4K3GA 1NUFA 1KYOJ 2J4WH 1KYOK 2D4FA 3BYYA 3TN0C 4P2OD 1LMKA 3MJ8B 1DBML 2N1KA 2NXYC 3ARDA 4NN6B 4AH2A 2JB6B 3VXQA 1IC7L 3F7VA 4RIRA 1I8KA 2QKIB 2KH2B 3NIGE 2ZUXA 4PJDF 4QHNA 2VZ1A 2XTJE 3CCHA 2C1PB 4IOIB 2X9WA 5CZVH 4LLMA 5E8OB 1NAMA 5F7DA 3TO2B 2X4OB 1BZ9A 1MCIA 1RU9L 3U46B 2HJLB 3MBED 2OZ4A 3SCMD 2NR6C 1B2WL 4Y5VA 3MBEA 5T1KA 1RZJH 3OAUH 2P24B 4CVZB 2ARJQ 1MCNA 1ZT7B 3K4ZA 3O4OC 4NO5B 3KXFD 4P5KB 5FM5O 4F8TA 2VLJD 4F3FA 4TULL 1IGJA 1EJ6A 3LD8C 4YDKH 3W9EB 4N68A 4LAQL 3NA9L 3K2UH 1C5BL 1YN6B 1VENA 4M5YL 4QT5B 3V7AE 1WZLA 3VD5A 4XVSH 3ULUF 5F7EL 1RZJC 1KPRB 4ETQA 4EUPA 1Y18B 2XZQH 2G75A 1D6EB 3MQIA 1BBJB 3RX8A 4Y4HB 1XF2A 3MRCB 3OXRB 1H3PH 4ACPA 4K23H 3IAGC 4M7ZC 4DWHA 4Q6IA 3A6CL 1HNGA 1ZTXL 2P49B 4HIXL 5F7WC 4U2YA 5C08D 1MRCL 3B83A 4WEBL 4KTDH 4LOUD 1ZHKA 4P5MB 4FFWC 4PD4J 4MNHB 3MCKB 3BWAA 3FN0L 1RFDL 1EDQA 1AKJB 4RAUA 4Z78B 1JGLH 3MLRH 4KGLA 3VGAB 4U1SA 3ME0A 3QJFA 4A6YL 1A6AB 3PWPB 5C0AB 4J8RB 4EBQH 2OR7A 4YHIB 1SYSA 4KU1A 1UXSB 4RBPK 1QA9A 3NABH 1QSEA 1NAML 4POYA 4UB0H 1QHPA 1OW0A 1WZMA 1TJGH 3DUUA 5GJSH 1CYGA 4OFKA 2RHEA 3U1SL 1ES0B 4GUPA 1PZ5A 3IDYB 4PB0L 3SEPA 3QRGL 5IESL 5T33L 1P7QD 4H88H 2R1XA 3S5LG 4KKCD 4LSTH 5DMIH 4ORGB 3ARGD 4HUMB 2Y7QB 4ZFOB 3CFCL 3V0AC 5CEZE 4LLUB 4OGXH 4HUVA 4QCIB 4FTVE 1A3RL 1H3VA 1OLZA 1A8JH 4UU9B 3DI3B 1CD0A 5C0RL 4FP8H 5EPMB 2B2XL 4JQXC 2CR3A 1KXQE 1KIPA 1TCMA 1A0QH 4YQXH 3UTPD 1EMTH 4LCCB 2GK2A 5EZLB 3WKNA 3FT4B 1S7XB 4MQ7B 4J3OC 4R97C 3QWOA 4CMHB 3DMMC 3OKKB 3AMLA 1J88A 3RVWD 3BEVA 5DZLA 1AD0A 1MIML 2F54B 4CL7A 1A5FH 4H0HB 3OAUL 3MLUH 1NMBL 4LCUA 5CGYC 1HSAB 2VLLB 3TH2T 4C58B 1S9WB 2WBJB 2GYSA 5FA4A 4A2LA 4RX4D 5E03A 3O81A 1IGTA 3TBVB 3P0GB 3C8HA 5DEGA 3O6LH 5IK3B 3Q6GH 2CLVB 3WLWC 4CDGC 4GG8A 3IDXH 4JDZA 4PB9L 1H0DA 5B21A 3A6CH 5KG9B 1KN2H 4KK5D 1QTYT 4NQCD 4CU6A 1FNSL 5GGVL 3QO1A 1SJHB 5AZ2L 4U1KA 1NANH 3OKYA 4RIRB 4Y1AB 3VA2C 1H3WM 4XVTL 4ZTOL 4JO1H 4XB7A 3WS6A 4HWNA 3TEUA 1NBYB 1A7PH 4LPTA 2HH0H 4DTGL 1G9MH 4XX1G 1WC7B 4U1SB 4U1HB 4WVRA 3R4DA 5B4MD 3RWIA 5FHAH 2DI8A 3HFMH 3IFNH 4YGAB 3HI1A 1I7TA 4CU8A 4IRSC 1FAIL 2AS5M 1Z6JT 3QP3A 5IHZA 3FN0H 4W68A 5CILH 5LGHL 2B5IC 3QULB 2VL5B 1E28B 1WLHA 3WDIA 1QBBA 3P9WB 3QIWD 1YPZE 4ZFOA 1NCBH 1RULH 4G42B 3EFFB 5H2BA 4C83B 1ZSDA 5CZVL 1JIBA 1P7HL 1D6EA 3BESR 4QYOA 5IMKB 1IAOA 5EZOL 2V6HA 1I3RA 3L3GA 1DZBA 1FRGL 3ESVF 1TXKA 1KJ2B 4JZOB 1IFHH 4FFYH 5HHOD 4KK8C 3TGXA 2P8MA 1IGMH 5CBEB 1G7QB 3KDMA 2O5XH 2HMID 4XVSL 1DEEB 25C8H 4Z76B 4G6ML 4PBXA 3E3QC 3ROLB 3SJVB 5EUOF 4PR5B 4R2GB 2DM7A 4W81A 1NH6A 5E1AA 3T4AB 5DMYA 5HHQB 3MRJA 1QRNE 1X6NA 1A64A 4U0RB 2VC2L 4LKCB 4NQXB 4P9ML 4LVOC 1MQKL 2EXYC 1CT8A 1PZUB 4WTZA 3MLTB 5H8DA 2GJJA 3VFPB 1KULA 4XPTL 3BE1L 1A6AA 5DVMA 4WW2A 1FH5L 3VXMA 2VXQL 4ONOA 1G0XA 4W70A 4DCQB 5SWSB 1GGUA 5IB4B 1DFBL 4PJGE 5GIRA 7FABL 3PDOA 1S7WB 2WSKA 3L7FA 1Q9LB 5E99L 2I5YH 3O2WL 4YUEL 5IHLB 3KPTA 4GUPB 5A2LH 1HILA 4Y1AA 3NN8B 4X98B 4Q9RL 2NTSP 3KXFA 5DD5L 1Q0YH 3BRGC 1P5VA 3TT1H 3S98A 1LHZA 5HPOA 4UTAL 5CP7A 5I6XB 4PB9H 2Q8BL 2FHCA 2ZUYA 3CH1A 4OCSL 3MUY1 4F7TB 2I25N 2FATH 2CDGA 1MWAB 3THML 5FEBA 3VWKB 6FABL 3IU4L 1KV3A 2BXYA 5DC0A 4KVNL 4ZQKA 4H88L 2Z8VC 1CLZL 3HPJA 4Y4KA 4MMZC 4ZTOH 1T6VN 4M9OA 1RZKH 4I48B 4ODXA 3QA3B 1S9YA 4UB0L 4QF1B 5J4MA 1LE5A 1AD9B 5GZOD 4I3RH 4YR6A 1MCQA 4UBDC 3GBNL 3X13A 3AC0A 1MFAL 1V3KA 3MR9B 3MXVL 3NGBC 4AEIH 5FUOH 1KNOB 4PBWD 3UDWC 1RZJL 4IIQC 5AG8A 2P5WE 5KSVB 1NCCL 5HGAA 3P4LA 1LP9B 1D9KC 5DZNA 2B4CC 1XGQA 3D5OF 1MFDH 1U0QA 4KROC 4LSTL 2FGWH 4R7NA 5DMIL 2OI9B 1CU4H 3OG4B 4DVBB 2G5BB 4JVWA 3GM8A 3VRLE 1PG7L 1QZ1A 1NEZG 1NDGB 4W6WB 1F4YH 3NAAL 4KK6C 5HDBF 3PWJB 4YHNA 2WLZA 4NQXA 3VXNB 4OTXH 5DURB 5AG9A 5I2IB 2DM3A 4FP8L 1F3DJ 1RFDH 4L4TB 4P46B 1F6FB 4YHOL 4PJEA 1J7VR 4HKZB 4MXVE 2NY7L 3VXMB 3LQZA 3SDAA 5ESQB 1YYML 3NCYS 4ZG1A 5D1XB 4ZPTB 3PWLA 3WN5B 4O00A 4P9MH 5K9JH 4OKVA 2A83B 4JB9H 1QSFA 3JWDH 3BQUB 3VFTB 4OAWB 3KPQA 1ZHLB 3GNMH 4OFIA 3S36X 4RNRB 5L6YL 1ED3B 2C3WA 5EOCH 3RA7L 5TDNA 4G42A 3SE4C 2NY0B 5I71B 4OCSH