4KTDL

Fab fragment of hiv vaccine-elicited cd4bs-directed antibody, ge136, from non-human primate
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
b'PVLTQPTSLSASPGASARLSCTLSSGFTVGRYSIFWYQQKPGSPPRYLLYYFSDSSQHQGSGVPSRFSGSKDASANAGLLLISGLQSEDEADYHCAIWHSGAWVFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GE136 Heavy Chain Fab
publication title Vaccine-elicited primate antibodies use a distinct approach to the HIV-1 primary receptor binding site informing vaccine redesign.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ktdL01
3CLEL 4MXVF 4YHIA 4EDXB 3Q5OA 1F3DJ 1JGVL 2F8OA 1CDGA 2HWZL 2XXMB 3AU1B 3OHXA 3U48A 3QXTA 4KWUA 1U2CA 2R0LH 4MXQD 3D85A 4RAUA 2BNRB 5DD0L 2F53B 2M26A 2ZG1A 3JV0A 2H9GB 3HE6B 5DSCB 1CLCA 1BJMA 5ADPH 5GS1C 3O4LB 5E8DL 3EYUL 4U49A 1EO8L 1WT5A 3EDKA 3MFFA 4XP4L 4JRXA 3X14B 1U6AH 2YA2A 2V5YA 4PJHE 2GSGA 5GJSH 3GRWH 5J12C 1KTKE 1YJDH 3ULVE 4X6CF 8FABA 2ID5A 5SWQA 2X2YA 5JMOC 4OT1H 1J1OH 4PJCA 4X4XA 4Z95L 4J3OC 4WV1A 4HKJA 1BZ9A 4NM8H 2QQNH 1BLNB 1A4KA 4OQTH 2VDPL 3UP1A 5DA4A 3NIFE 1ZA6B 2PKDA 4LSVL 3PGFH 3P4LA 2ATKB 2ZCLL 4Q9CA 3MRFB 5KZCD 3BOVA 3WUZA 2HRPH 2NX5D 2YZ1A 2VDRL 3BKCL 4GMSH 1CR9L 3C09C 4Q2ZA 4L8BA 3H6JA 4G7YL 4IBLT 3LQMA 1AXIB 5I8CB 3D3VA 4I2XB 3MLSL 3GMPB 1T7WA 1ZTXH 1QEWA 4GG8B 2VDQH 4XHJC 4ZFFB 1R3JA 3E8UL 3EYVA 2GKIA 1OM3L 5DDHB 4KDTC 4AENB 4TVSa 1YY8B 3HRZA 4U1JA 5I73B 1IC7L 4Y88A 2HVKB 3W82A 4L9LC 3U7AA 4GW1A 3BX7C 1C16B 4PJXA 2C5DC 3QEGL 5CGTA 2NW2A 2NXYC 3ZE0F 5D1XA 5CIPH 1KPVA 3MODL 1NANI 4MJID 1IEBA 2EE2A 4I4WA 1EEYA 1QFHA 1I1FB 4PJGE 1F8TL 1MFNA 1CTOA 3A6OA 2UWEA 4PD4K 3QDGE 3VA2C 3MRNB 4NFBA 4U6VH 3V0AC 1A6AA 2R15A 3MLPA 3PABA 4ODHL 4XBPB 1UFUA 3IFOB 2PCPA 5J7CC 4MDIB 2WIIB 4GRWE 5BRZA 4PLKD 4S1QH 1U58A 4Y4FD 3GSWB 9CGTA 2HMID 4MCZB 1AY1L 3VGAC 4LLVB 1S9WB 3GIVA 4UILL 1CFBA 1S7UB 1F4YH 3OJVC 4JM4H 5E9DB 3LMJH 2CKNA 5EUOA 3KXFD 4R0LA 4K71C 3F7YA 2ENYA 1DQQA 3P4OA 5CWSA 1YPZF 3JV5A 4NFDA 3CU1A 4JR9H 1CCZA 4MNQA 1RSFA 5IVXE 4O02H 5D4QA 4RFOH 5FF6A 4QTIL 1BP3B 2QEJA 4UT9H 1XF5A 3BGAA 5IOPA 2NY4C 3D0VB 3EO0A 2LQRA 3QNXA 2ZSWB 3UXFA 4Y5YB 2H26B 4NSKB 1QRND 3MBED 3DX6B 5DK2B 1R3KB 4YQXH 4JRYE 1U8PA 3DHJA 3LRSB 1GXEA 3NFSL 1YYLL 4ERSL 4OV5A 2E9JA 2AXJA 5FDWA 5DGQA 3RHWK 4ONOA 2BMKA 2CDEB 3BJLA 2VE6A 3LKQB 4EVNA 2YD1A 3B9KB 4JG1H 4NZRH 4D0CB 1FZJA 4IMKA 4PP2A 1E28B 4L3EE 1KACB 4YNYA 3WO3B 3QXDA 6FABL 5CD5C 3VXSD 5FAAA 1QFUL 1SJHA 5DJ0B 3NABH 2FJFB 4OF6A 4U1KA 1R24B 4H8WH 3RX7A 1IE5A 3MV9A 2G2RA 3JTSB 3VFGL 2DF3A 2EXWD 4HZLA 4BZ1L 1D3CA 2IBGA 3G5ZB 3I2CH 2VXVH 5F9OL 3G6DL 1NMAL 4JN2B 4PJHF 3W11C 8CGTA 2BY0A 3ULVF 3U4BL 1EJOL 3SBWC 3V6OC 3CFJB 1YMMA 1FZOA 3FONB 2GAZB 4I9WE 3QZWG 3AMKA 2AGJH 3UPRB 4OZ4B 3CZJA 3NIFF 5FGCE 5EU4B 4PJEE 5E24E 4G80B 3S37H 4X5XA 4BZ2L 3QNYB 2AVGA 4W6YB 1X5KA 1NC2A 5JDSA 1IM9A 2PTVA 4U6TA 4X9HA 5H94A 2ADFL 5F1IB 1TLKA 4I18A 3FTGB 3QO1B 5D2NC 2WIMA 3WL9B 4JM2F 4MNHB 4BFIB 4C56A 4F80A 4P2OD 4TSBH 1N3NA 1KB9K 4JGUA 5I71C 5TE6H 4EBQH 4BQCA 3BGMA 1KIPB 5FOBA 5EWIH 2DM4A 4RGMB 1UZ8A 3NN8A 3F65A 3T4YB 5I76B 3RUGA 2P49B 1MF2H 3TH4T 3QXAA 2R69H 2C26A 3BW9B 5F72S 1S7WA 4PJGF 2IPUG 1ORSB 3T04D 3TA3A 3H9SA 2R8SL 4HPYL 2E27L 2FR4B 3MUJA 2MNUA 5F8RC 3TT1H 5CLTA 1A21A 2YXMA 3IT8D 5H37G 3UBXB 5L2JB 1KLUA 2P5WD 4FFZL 4NQXA 1KULA 4PRHA 1NEUA 1TCRA 5ENWA 2P48B 3TO2A 4YDLB 4HUXB 5DHVA 4GRWF 3E3QE 1RUMH 3VRIA 4J6RH 4RMQA 4CN1A 3P9MA 4ZXBB 1ACZA 5BV7L 1JMZA 1QVOA 3SJVB 3ALXA 2JLLA 1A02N 5FGBC 4G8EB 2IFFH 3KPSB 5FGRA 2R1YA 4XI5C 1QG3A 3Q3GA 4Z78B 2VSCA 5DMIL 5KOVC 1Q0YH 1WEJL 1AFVH 1DR9A 4OZHE 5K33A 5EU7E 3T0EA 1MSPA 3K81A 3N1QC 2DQUH 3HMWL 5HI4C 3V4VL 1OOAA 3QJHB 4EZMA 2AK1H 4NO5A 5KN5B 1CLZL 3W9DA 2YPLA 2VXSH 3CC5A 3HC3H 4Y2DC 4WHTB 3B43A 5E8PB 3DXAE 1U8MA 1RAMA 4K8RH 4PJ5B 3RGVB 3QUYD 2EDNA 4JAMB 2VN7A 4JPIB 1J0IA 3SE9H 4KMTL 1JPST 4LSQH 5EIQA 2F15A 5DJ8B 4XVUD 4NRZB 1JK8A 3BIKB 3WFHB 4HLZG 4XNYL 1YEHH 5KS9E 1LO5A 2HLAA 1TQBC 2GK0B 4N5EC 4R7NB 3AGVA 2KDGA 4G8GD 4EN3C 2LU7A 1SYVB 2ZJSL 1E4XI 3RWFB 1MH5B 4X5LA 4FQJH 1ZEAH 3K2UH 3T0VA 1DZBA 1F00I 2ZUUA 5T1DH 2WWKT 3QUMA 4KK5C 1X9QA 3LN9A 5BVJA 1P69B 4NOBA 2WLYA 4HIEA 1RK0B 3EJZD 5D7LB 4LLWB 4DEPB 1S7TB 1OAXH 2ICWI 3GJFB 3RBGA 3TC9A 1J0ZA 4RNRB 4OJFH 4M7LT 3KYKH 4LDEB 5L7XH 3ARFD 1U91B 4ELME 1HHKB 3AY4C 1CGTA 2DJSA 1G1CA 4XWGL 4WHYH 5C0JB 5GS0D 5GRYA 1WIPA 4O2EB 2Q7YA 3O6LL 1KCKA 4D8PA 4PJEF 2HP4A 1A6WH 1YZZA 5D2LE 3F5WA 3LEYL 4KRMB 4XPFL 4JFED 4LCYA 3GMMA 2X4TA 4HDIA 3DARA 3FO2A 3SDXE 4F2MA 5CUSL 5I74B 1K8IB 2YD4A 5KANI 2R23B 3TBWB 4MVBC 3C8KB 5CZKA 1A1MA 1RZKH 1JF1A 4GH7B 4P57B 3RVWC 4HJ0D 4NN6C 4D9LL 2AJSH 3ZKNC 3DGCR 1YEKL 5ACLA 1XGRB 4GOSA 1KXTB 1NL0L 1PG7L 5CZXD 4X6CA 3QQ3A 4XX1E 1O7SA 2PTTB 2VB5A 4MDJB 3HG1E 2NNAB 5HGHA 5JLZA 5HGDB 2F58H 3HLAB 3NCMA 4U7MA 5HYJE 4L5FH 1C5DA 5DD6A 3RWJB 1GOHA 3CD4A 4P2RD 3NA9L 4GS7B 5TGBA 4LSUH 1BBDH 4HIHA 3EHBD 4WCYL 1J1XH 1RUKL 3RNKB 3PL6B 1BVKA 1CD9B 1ETZA 3KNBB 1AGFB 4K55A 3VWKC 1V7NL 1A5FH 4KUZL 3RPIA 2X70B 5FUZH 1KYOJ 1VFBA 3O3EA 5D7IE 1PYWA 3QJFA 2X42A 2D3VA 3L7FB 3HE7B 4LPTA 5DJ6A 3VFMB 5DLMH 3EO1B 1ZWIB 3P9LB 2V5TA 3QQ9C 3QUZB 3ZTNH 2Q1EA 5E94B 5L9DH 2BX5A 5L88H 1YQVH 4ZOBA 3CSYA 1BD2D 2FB4H 3PHQB 5BZWA 1MI5B 3TBTA 4IDJL 1U3HD 4QY8B 1N6QL 1MCBA 4OZHF 3DV6A 3ELAT 2P24A 4KJPC 5LXGL 1BFTA 3MNZB 5FYKE 4X7EC 4N68A 5JMRA 4CMHC 5I66B 1Y6KR 1ZANH 1KIUA 2EICA 2AV7B 5DC4B 2W0LA 1H5BB 3NCEB 3DRTB 4R96A 3K4AA 4RSVA 1EA9C 5E70A 4JHWH 1M7IA 1Q9WA 2OQJA 3G6JE 4WHCA 3T0XA 2BY1A 3QUKA 5CIPB 2J5LC 1A6TB 1XF2B 2OZ4A 4WFEE 2I25N 1A7PH 4QGTA 3E6FB 1OP5K 4CADA 1VKXB 2A9MH 4K3DL 3GSOA 1OP5H 5EO1A 1CLOL 1AD0A 4LPWA 1PEZA 1UWXK 2X9XA 3EW3B 5A2LH 5KVMC 5MEPB 1HSAB 1UCBH 1XAUA 4NC1E 1JGDB 1UWXH 2VR9A 3DRQB 1J9CT 4XC3H 3NTCL 2NY2C 5MENB 5FFLA 5KS9F 1HQ4B 1S3KL 2L7UA 3BP5B 2XN9E 4XCFH 3ZDXE 1YPZA 2YUXA 1NCCH 5E7FA 1I75A 3V6ZB 4XNXH 5BVPL 3MQIA 2BSTB 3U1SL 2ZWLT 2Z91A 3ESUF 4ZOEA 4GKZB 1U36A 1MLBB 4OLZL 1NCNA 1AE6L 5FA4A 2DWDA 3VWJA 1EFXA 1FYTA 4ENED 1GOGA 1G9ML 4DW2H 1F11B 2ZUTA 4NBYB 1K3ZA 5JXED 1ACYH 1T2QH 1LHZA 3JWOH 1N5YH 5ETUA 1RJYA 1CGWA 5I2IA 4ELMF 3ZKQD 1JPTL 3EBAA 4WW2C 1DBAL 2EKSA 1RURH 5GRVK 5I1AB 4GG6E 4UDTA 2XPGA 2FYYB 4UTBH 2WK2A 3IDJA 1AKJB 4M7LL 4ZD3L 3ZL4L 1IC4H 2RFXA 5D2LF 1BZ7B 4GXVL 1Q1JL 5JO5B 4KHXL 4PTTB 3CMGA 4A6YA 3ARWA 2UUDK 4P46D 3CVHL 3VXUD 2C3WA 3UTSD 3DTXA 1BM3H 4M62H 1S5IH 1RJZB 2XTJB 5D6CB 1ZLSL 4H88L 1T3FA 3SDXF 1KN2L 3UZQA 3WS3A 2ESVE 4X99A 3UDWA 5KVGH 5FOJA 4KGJA 1UM6H 1ZMYA 2B4CH 1ZVSA 2P5EB 3BDYL 2HVJA 3CVIL 4TQEL 1I1AA 3BPLC 5E2WL 2RBLA 2V7HB 4KVCH 5JNYA 1FYHB 4PJHA 2BDNH 3F12B 4QRUB 3AS2A 1JNNL 2FWOB 4G6KH 1TZHA 3QFJE 3P0VH 2VC2H 4L4VD 1JP5A 3DX9B 3OJMB 3VJ6B 1S7VA 4X7SL 1P53A 3WDIA 2Y1VA 3OXRA 4J3UA 1KT2A 1AR2A 3H9HB 3A67L 1BIIB 4KPHH 2W1NA 1N0XL 4FNLH 5FV2A 4NN7B 4LPCA 1BZQK 5IESL 3WHE1 5T3XH 3TV3L 4JFOB 5D7IF 4HFUL 2Z8WC 4JFFA 4OLXH 3ZSTA 4JM2A 1S78D 1E6OH 5EC2A 2QQKL 3TVMC 3TNMA 3LV3A 2EEAA 2BVTA 4JFDE 1ZA3B 1DVFB 4YFLI 3P73B 4JQVC 4NHCH 1NLBL 3OF6D 2O5ZL 1CFVL 1VFAA 4F7EB 3EOTL 1T0PB 4EKXA 5BV7C 3P0YL 4QRSA 4GW4B 3OKMA 3BRFA 2XFXB 4PJGA 4EDWL 3BP6A 32C2A 4F57L 1PG7W 3EDEA 2BNRE 4LHJB 4DUVA 1EXUB 5B4MD 4KQ4L 1U41A 15C8L 4RIRB 3HI6L 1VEPA 1JPFA 3DIFA 4NC1C 3O4LE 3R8BB 2FJHB 4X7FC 3LIZH 3GK8H 3KJ4B 1VADA 3O6FB 4LAQL 1YEDA 1IGIL 3EOBA 2XY1A 3ARDD 2ZCHL 2QBWA 2WSKA 4IIQA 3U0PB 1JNJA 1CD1B 2GW5A 1E4XL 5CSZA 2ATPA 5JW4R 4W4OC 3IGAB 3ZDXF 2Y07H 1G9NL 3T65A 1NCWH 4UOJA 2VZ1A 1F58L 5HJ3B 3ZTJH 3KPRB 1I7UA 3SY0B 4S10A 3LZFL 5IHUH 3ZE1E 2ICEA 1F45A 2Z92A 3OAYK 4P59L 2MQ0A 2EDWA 2JF1A 2PYFA 1AP2B 2YRZA 5GGTL 1GGIL 4LEOA 3TFKC 2J1KA 3C8DA 4KROB 5EZLA 1NAML 1IGYB 1PQZA 5E99H 2DYPD 2VDNH 1VERA 4YEFA 3NCJH 1IGJB 1INEL 2IAMD 5CBEB 5L2KD 3X17A 4ZTOH 3SQOL 3DX8A 5AYUH 1FNEA 4AJ0A 4ZODA 2DM3A 4GG6F 4XNUL 3DROA 1L0QA 1C1EL 2Z31B 1MWAH 4L8SA 4YHMH 1M6OA 5DVMA 3BPCB 4L3EA 4NCC1 4EEEA 4N9GA 4LIQL 2NZ9C 2APBA 4Y16B 4OZGA 3IDGA 1VESA 4H20L 2OCFD 2GEEA 2Q86A 3F6IA 3OKKB 3RFZC 2BNUA 4LVNB 4QHNA 4Y1AD 5BW7A 2YKLH 3WLBB 3UTZA 2DTML 3EYSH 1JE6A 1YUHA 2G5BA 4R2GB 3LRGA 1ONQA 3HCVA 3JWDH 3PHSA 5TE4H 3IRZA 1OD9A 3FB8A 4YPGA 2UZIL 4OF8A 1QO3B 1DUZA 3I85A 2ZZUT 3CCHB 4NDMB 4QRTA 5HHMD 2O61A 2W60A 1MCWW 3O6KH 4BK4A 4JKPH 1K6QL 5GGSB 1ZHBB 1X5HA 3L3OA 5IB3A 1R5IA 2Y23A 4HBQA 3HPLB 1FL5A 2DBJA 5CGMA 1IGFL 1WZLA 2PR4L 2VNCA 3O0RL 5E9DE 4L4JA 3S36L 4LLYA 4HEME 1NEZG 3QQ4B 3AREC 3V5DB 4IRJC 1A7NL 4LVHC 5GJTH 1UWGL 5KSVA 4P5TD 5L8JB 3LQZA 3OZ9L 1HI6A 4U1NB 4LBEB 5D1ZD 2Q87A 4OF5A 3MLVL 3TIEA 5JIIA 4DK3A 3RVXC 3RI5K 4DGIL 5ADOH 4NRXB 3G6AB 3IFNL 3SOBH 3C5ZA 5DK0B 5BS0B 3K2MC 5DWUH 5JPNB 1DQLL 4KRLB 5F7YC 4YDVA 2AJYH 2Z93A 3BVNB 5C86A 2AJZA 3EOAA 3FQRA 2A1WL 1N8ZA 5CZVL 2SEBA 2H2SD 3MR9B 4OGYH 5HYQA 2HFTA 1PKQE 3A6CL 1SQ2N 4LVOB 4MA1C 2V17H 1AGBB 1OSZA 1H3PH 1S7RB 1PJ9A 5C2BL 1TJHL 3NIGE 2E6JA 3IFLL 4B7LA 4TNWK 3STLA 1IC5L 5FO9B 1I8LA 2WBJA 4AEHL 2A9NL 1G7HB 4HKXA 4JDTH 4IHOB 5HHOA 2XOTA 4ODUA 5CJBA 4XMPL 5EOQH 3MGAA 4PREB 4ZYKA 1G7JB 1WFUA 4LSRL 1EK3A 4JFQA 3MBXL 5F7EL 4I0PA 1YEEL 5MEQB 1EHAA 5T5FL 3ZYZA 1XCQB 5I1KL 5JHLL 3ARGB 1FFNA 4U1SB 3QCUL 5F7FA 3I75B 5C0BE 4O5LL 1HHJB 4LCIH 3Q6GH 4HKBB 4WU7A 5T1KD 1RUPL 4BZYA 1HWGB 1G6RA 1PG7X 4OZHA 1IJ9A 3IFPA 2IJ0C 3O2VH 1IM3A 1HOCA 3TJEL 1NAKL 5H2BA 2BSED 3SE3A 1CFTA 3BUYB 4MSWA 2Y5TA 5IF0A 4PGBB 1I8KA 1OWWA 4BUGA 5M95B 3ZE1F 1A7RH 2BNQB 4HKZA 1FLRL 3NZHH 2JIXA 3BDXA 3GIZL 4IEFB 5GSRB 1C5BL 4JPKL 3WDHA 1QPPA 4KK6C 3PG2A 2DQHL 5E2VL 3L3JB 4HUWB 1XZ0A 2R1XA 1N6VA 3TF7C 1W0VA 4HS6B 2BC4B 3C60B 2XKNB 4F9PC 5D96B 3V95A 5JDJA 1DBKH 3RDTB 1MRFH 1G9MC 3HMXH 5KS9A 5IB2A 3RZCA 4NQCB 4QTHB 1EEZB 3L3IB 1EPFA 1Q0XH 5LQBH 1KV3A 4NO2B 4XT1C 3MLTA 5LCVL 4H5SA 5DQDL 5KSBB 3FQUB 1OT2A 5JW4M 2AEQL 5EU6A 5I30L 4LSTH 1J8KA 2VLRE 4N8CL 3CXHK 3UJIL 3CFDB 1T6WA 4YUEL 4UNUA 4MAYA 3TA3C 5CEYB 1LVEA 1WWCA 2ZCKL 1D9KA 1U3HB 3FCTA 5I75B 1VDGA 1WFTA 3BGFC 1CI5A 4JN1H 2X10A 1IGCH 4Z0BH 1T5XB 1YC8A 5D5MB 3FZUC 1H3GA 1V05A 4Y4KB 3MPCA 3B6SB 4LF3A 2CLZA 3DNKA 1OTSD 1DQTA 1DBMH 4FTVE 4PB0L 4ZAKB 4ELMA 4RFNC 3SDAA 4DZ8B 3SJVE 5HYSA 2MHAA 1L0YA 3BE1H 2D9CA 4BSWA 5KSUA 1OF2B 5D2LA 3WYRA 1EZVX 4EOWL 4IRSC 4DKAA 4CDGC 2KQNA 4LHUG 1G0DA 3DO7A 3ROLB 2IWGA 1MHCA 5IWLC 1MJ7L 4H1LH 3ES6A 5E56A 3OX8A 3SDXA 4MGXA 3KS0H 1AJ7L 43CAB 3J8F7 4RGNB 2AXGA 2V5MA 5L0QC 1WAAE 1LNUB 2ICCA 1YMHA 4PLJC 1IAKB 2VQ1B 4LDLB 3SDCD 5JR1H 1JWUA 1T1WA 3KPNB 1FAIH 3UJJL 3MRBA 4P4KB 5FECB 5C0IA 5IV2A 2PYED 1R0AH 4ZUTA 1QLFA 2X1QA 4P0DA 4V1DE 3BUTA 5C0CD 3O11B 3HG1A 3HAEH 2NY5L 4M1CD 5I1CH 4CL7A 3O3BB 5HYJA 1T21B 4NZDA 2FNBA 3MUY1 2P46B 4MNGE 1RY7B 1X6NA 2YEZB 1MFEL 2BVPB 3S96B 1J1PL 5J9PB 2VRAA 2E7MA 3R1GH 3NIGF 3SGDH 3IETB 4JY6B 5BQ7B 4F58L 1BFOB 2BOBB 2OP4H 3R06B 3S5LB 2Y6SC 4NC0B 2R2HB 1CFSB 1QSFB 5CJXA 1U8NA 4LARH 3FO0L 4JHBA 2JKXA 1QACA 1NQBA 1UC6A 5DD1L 3AXLB 2UYLA 1RUQH 1H3WM 1H3TA 2CIIB 3RKDD 1XGQB 4CJ1A 4MA8H 2VLKD 3B4NA 4LHQB 1LK2B 2DMBA 3KLHC 4F7CB 5CJOH 4KH2A 4M6OH 4IOFD 2NXZD 1CZ8H 3CDYA 3TO4B 3EYFB 4RMUA 2YD3A 1FNSH 2IANE 2LAAA 5FO8B 3P2TA 1HXMB 5H8DA 1G9NC 2FJGB 4QRQB 2X4UB 4KKAD 4KI5D 1ORQB 4PJ9D 3IDIA 3V0WL 5FYKU 1FG2A 2ZUYA 1CFQB 4R4ND 3FB5B 2VWEE 1CIDA 3UYPA 2X4OB 2D03L 1EBAA 4NQEB 3O9WD 3KYAA 4EI5D 2J8UB 5I1HH 4HPOH 4JKLA 1VFUA 1IQWL 5IKCA 2K7PA 5D7JD 4AEFA 3LEXB 2BFVL 1I3GL 4Z0XB 5EBGA 4M93C 3SDDA 2AK4D 3GHBH 4R26H 5IW3A 3FOLA 1X5FA 3RVVD 3VI4E 2R9HC 4R4BA 3MRJB 3VXRD 3HI1A 5HDBE 4FS0A 3OKOA 1I7ZB 3DMMC 5DRXA 4PJ8C 3VD4A 3V0VB 4Y19A 4OFDA 3LPWA 2AJVL 4XBEL 1AIFA 2XA8L 4JKWA 4BH7B 3NZ8A 3F58L 3C6LD 5DRWA 2PXYC 1T2JA 4P48A 4RISL 1TVBB 3FQWB 1B0GB 1J8HD 1IKFL 2XWBB 2CK2A 3F7RA 4MJ6B 5JOEA 1DN0B 4GG6A 3GJEA 4M8QB 3MRRB 2NLJA 5IJVB 2VISA 3STZA 4U6XA 1MI5E 2PO6C 5HHNB 2NR6C 5IHZB 2ARJB 3CPLB 4U0QB 5ITBH 1X5IA 3ARRA 3QPQC 1FBIH 4PGCB 3MLWH 2YD2A 5KSAD 2CKBL 3RVUD 3FRUB 1Z3GL 3D6GA 1XIWA 2FO4B 2ESVA 2BJML 4Y5VA 3RWEA 3FMGH 5DEGA 2DL9A 1WAAF 1OAKL 3ARBB 2VO5A 2G75A 1BGXH 1MWAB 4OLYH 3CMOL 1ZGLP 1J0YA 1PSKL 4OCRL 3HC4L 3ILQD 5T5NG 1S7SB 1UWEL 4S1SH 1J87A 1HN1A 5LAXB 4PLOB 1AQDA 2MQCA 3MOBL 3HC0A 5ID0B 4N8VA 4YC2B 2VLJA 5C08D 2NX5E 1EJ6A 1G6RL 4HBCH 2CXKA 5FYLD 3PNWA 2H2PD 3BEVA 5JA9A 3MRHB 4XBGA 1MLCB 4LOUC 4UT7H 3W81A 1QHPA 4P2YA 1LEIA 2M2DA 1CXFA 1HILA 3L3DA 3T2NH 3WIIL 5DJZB 1R5WA 5HI5D 4ETQB 4UB0L 4ZSOE 2IAMB 1YC7A 5IMMB 1I1CA 4NUJB 1UKSA 5DI8B 3G5VB 1FFPA 4L8CA 5GRJL 4ZFGH 2ITDA 3LKNA 3ZKXC 1D5IH 3VRJB 4LU5L 1MFAL 3VMNA 1B4JL 4HC1A 1NCAH 3MLUH 5F71A 4MJIE 4N8VG 1SEBB 4JANA 5HI3D 4XNZB 4HAGA 5ISZA 4M6AA 3I3EA 2IMNA 4EDXA 3UX9B 2PW1B 3AU1A 2LFGA 4OI9A 3H42H 1HSBB 2V9TA 4KMLB 3HI5H 4HMCA 2BNRA 4WGVB 2K3TA 1IFHH 2HTLC 2H9GA 5EO9B 4Y5XB 3HE6A 2HFEB 5E95B 5DQJA 1NMBL 1JFQH 1CDHA 5C70A 3O4LA 1QLRB 4LP4A 2GJJA 3UDWC 4Y7MA 3KXFE 3QAZB 4XNMB 4PRBB 3X14A 4XZUA 2ZKHL 1FVEB 1EHLL 4PRAB 4E41D 1I1AC 2DQJL 5K9OA 4OM0L 4DWHA 3D2UB 5CGYC 1XGYH 4Y2OA 1S9XB 3EJYD 4HGMA 3MXVL 3MLXL 3HUJB 5B39A 4K23L 4LRIA 5EA0L 1ZA6A 5E08L 4RQQB 2NY0D 2ATKA 2DQEH 4MD4B 1OGAD 3VI4F 5DC0A 4MXQC 2O5XH 3BP4B 4XMKL 2NYYC 1XCTB 2QQLH 5HDBF 4G8FB 4G6ML 1TENA 4XRCB 5IIEA 3VG9B 3TH3T 1U8KB 1T2XA 1NCUA 3GB7A 1CF8L 3H3PH 3LD8B 4GFTB 5I8CA 4OLWL 4XVJL 4KK9C 4I2XA 5DQ9B 2AABH 5GISL 1BQHA 5GHWH 1L7IH 5B38G 4GG8A 5CJQL 3V4UL 4WTXA 3SPVB 5JOPD 4ZFFA 5TQ0L 3U79A 2VLLB 3VXSE 1UCTA 4AENA 5GS0L 5CHNB 3G04B 2EDOA 2HVKA 1MOEA 2R39A 5B39G 2VDML 4HXAL 5C0EA 1C16A 1AHWB 1JPSH 2QV2A 4AG4H 2DICA 3BZEB 3MLRH 1NFIB 2IPUK 1ED3B 3O4OB 5CSBA 1KJ3H 4OGXH 5D7SL 2D9QB 1I1FA 3MOAH 4Z8FL 2P8PB 4G6FD 5DFTA 3W39B 3MRNA 4CJ0A 2N4IA 4KVNH 1HKLH 3IDUA 3ARUA 4HGKC 4LKCB 1CICD 1BQHG 5HGBB 4APQC 1DQMH 1GC1H 4XBPA 4D2NA 3IFOA 4I48B 2XQBL 4HJGA 2YZ8A 5C6TL 4MDIA 2WIIA 3ET9F 3ZKMC 1EVUA 4WO4D 5JW3L 3GSWA 4MCZA 4LLVA 1S9WA 4PTUB 4YDKH 3BIBX 3WNOA 1S7UA 4DFIA 3Q5YA 5EUKB 5E9DA 2MCPL 4IIQC 4RX4D 3CLFL 4G6JL 2NY5C 2X4RB 4GLRI 4YFLF 1UB6B 2EIZB 3CDFA 4K9EL 2X4PB 4FQXC 4F15C 5HDQL 3HNSH 2VDOH 5DJDB 4XPTL 5D8JL 3D0VA 1HHHB 3BSZL 3U7YH 1Z9MA 2ZSWA 3IJSB 2MPAH 2MOVA 4Y5YA 4RDQF 3QA3B 4H1LB 4NSKA 3U9UB 5DK2A 2VXQH 4UI2A 3QDJD 3V2AR 3LRSA 3FQXB 1H8SA 5E03A 3MO1B 3QUXD 4PY7B 5C71A 1W0WB 3LS5H 4PGDB 5EN2B 1PKQA 3TJHD 1NFDB 2HMIC 1RMFH 2LVCA 4HLZH 1TVDA 2CDEA 3KPOB 3LPFA 4D0CA 3TEUA 1F4HA 2R0ZH 1E28A 2IBZX 5JORB 2DIAA 2YA0A 3NCYP 2HFGH 1CXKA 3MFGB 3VFRA 3RJQB 3HAEB 1FHGA 1JGLL 1PY4A 2FJFA 2NPLX 2HTKC 2N1KA 1P1ZB 2IG2H 4A2LA 3JTSA 2NY6D 4LSPH 1L6XA 1QBLL 3RTQD 3G5ZA 3NCYS 3O8XD 2WUBL 4LPXA 2W0KA 2P7TB 4NBZB 3GI9L 4JN2A 3EZJB 3T0DA 2ZP0T 3GSNH 1N4XL 3MBEC 4F9LC 1D5ZB 3CFJA 4OF7A 2VOTA 2GAZA 1KNOB 1VPOH 2AEIT 1M7XA 1ZAGA 4JFYB 3UPRA 3C8HA 1GHFH 3N1MC 4OZ4A 3RU8H 2BXZA 4LCCB 5EU4A 1ZLUH 4PG9B 4G80A 1X7QA 3QNYA 2OJZL 4HZAA 5EIIB 3VXTB 1FVCB 4NPYB 1P9MA 4ISVB 4BELD 1QSEB 3LS4H 4KTEL 4NZTH 2OR9H 2QR0B 3ZSSA 5F1IA 1QLEH 3MLYH 3FTGA 4NO0D 4KAQH 4LQ1A 5FKAA 5LVEA 3UBXI 4WW1A 3WL9A 3UZVB 3TT3L 2Z8VC 4MNHA 4BFIA 2EXWC 2CDGB 2RR3A 1FFOB 3ARZA 1LE5B 4F7TB 1KCSH 3L3KB 4G8GE 1KIPA 3MUGB 4L3AA 3C5ZC 1W2KT 1EEQA 1C08B 2VAJA 2W59A 4JKKA 2B0SL 4KHTH 3T4YA 5I76A 5I0DA 1FRGH 4OKVA 5EBWB 2VLME 3BW9A 2YOCA 1MHHB 1RULH 4PRIB 1MAKA 3WXVH 1ORSA 2VLRA 4YHIB 3RIAK 5L2JA 2C4FU 1NUGA 1RD6A 2AAVA 5IQ9B 2CMRL 3O2WH 1I8LC 2B1AH 4YHKL 4YHYC 5I1LB 5EZIH 5TF1H 3HR6A 1GIGH 2LU4A 5ALBH 4G7VL 4ZXBA 5I16B 4RZCB 5L8LB 5EPMA 1P4IH 4JFEE 3SJVA 2C3VA 1MIMH 2VR5A 1JJUA 4JQIH 1EMTL 1I85C 2I07B 4ZUVB 4G8EA 1UM4H 5JIKA 4HHAB 1KCRH 1QQDB 1JYVA 4JJ5B 1SHMA 1JHLL 4XXCA 4POYA 12E8L 4M02A 4JRXB 5IROC 3TZVB 3CX2A 2HH0H 2I9TA 2LABA 4FQLL 1Y6MR 8FABB 3H3KA 1YECH 4V2BA 1TDQA 4ETYA 1J0HA 4YHZL 5KN5A 4QRRD 5F7WC 3OAUH 3EFFB 1YEIH 3WNNA 1OARL 4WHTA 1TTFA 5E8PA 1KEGL 2BNQE 4PJ5A 3RGVA 3CFIC 5D7JB 4JAMA 2D7TH 4FXKB 4HS3B 4V1DA 5E6IB 4JPIA 1UM5H 4HSQA 4XVSH 3SCMD 4P2RE 3PE9A 5KANG 2IPKA 4YHOH 1KTLA 4HW6A 1WIUA 3E6HB 1MPAH 5KVDL 4MNGA 5DJ8A 3WKML 4NRZA 2VUOA 3O2DL 1FSKC 5B3JE 1QEWB 4ODTH 5C09B 1R3JB 4N5UA 4NQCE 5DMKB 3WNLA 2GK0A 3CXDH 3STBA 1MHPL 4R7NA 3BQUB 1GGCH 3PWLB 4M5ZH 1SYVA 4HUMB 2V9QA 3RWFA 2EDXA 4PJXB 4PLNC 1T83C 4G3YL 1MH5A 1BD2E 2C4FT 2NW2B 3T2OA 2A77H 2AJXL 2OZ4H 4LEXL 1FH5H 2IPTL 3L5IA 3CFBB 5H35B 3UYOD 2JJUA 4JG0L 2NY4D 3MLZL 1G1YA 4IJ3C 3QUYC 4MAYC 5EG6C 1RK0A 4LLWA 1QYGH 1A9EB 3GJFA 4N1HB 5D5ME 5IFHH 4RNRA 5C0AB 3V6BR 5BOPA 4XVTH 1U91A 1HHKA 4Y4HB 4ZFZB 2PCPB 3O81A 2DLTA 2F5BH 5C0JA 4C54A 5A2IH 3LPGA 3NMEA 4O2EA 3V5HB 4OD3H 1U58B 4XVUC 1DLFL 4GJTB 3OXSB 4TVPL 3NIDE 4WFFD 3D9AL 1AO7B 4B0MM 1FVDB 1DDHB 4YX2L 4F7MB 5CD5D 1K8IA 2XKSA 3BD3A 3GBML 4KTYA 5IM7B 2R23A 1DQQB 1JNLH 3C8KA 1LO3L 4H0HB 4N0YL 3T77A 2W9EL 1SY6L 2YS4A 1U8JB 5F96L 1XGRA 5ESVB 1XF5B 1MEXH 1INDH 4OFIA 1NGWB 2PTTA 2X41A 4MDJA 2XY2A 4N90E 3HLAA 5HGDA 3W11D 4DN3L 1MCCA 3FAXA 5HHQB 4MHHI 4UIMB 2ERJB 1HH9B 5GS0C 3RNKA 4WWKA 3PL6A 1IGML 3IU3B 3GRWA 4J3VA 1AGFA 2HLFD 2VE6B 3MYJB 2DQCH 4DFHA 3NPZB 5GGVY 1Q72H 3QZWB 5ELIA 1QSFE 3QXDB 4OQTA 3L7FA 3HE7A 4HLJA 4JFHE 3VFMA 1RZ7H 5LJYH 3EO1A 1ZWIA 3P9LA 1U8OA 4HJ0C 4PRDB 2YPKB 5E94A 3W0WD 3O6ML 3PDGA 4HWEH 3UTSE 4QO1A 3WIHH 2FD6L 4P2QD 3PHQA 3S34L 3RX8A 1MI5A 4HZLB 5KW9L 1UJTA 3P30L 3PXJA 1NBVL 3MNZA 5E4EB 2JELL 5E8NA 3WBDA 2XZCL 5TE7H 1YMMB 3C08L 4JZNB 5I66A 1RJCA 4PD4J 4RAVB 1H5BA 1A14L 3DRTA 4ODXB 2XT1B 3DJ9A 4DGVH 4FQ1L 2OK0L 4OB5H 2YN5A 1CE6A 5E5RB 4X5XB 3VXMB 3MNVB 1JV5A 2AI0L 1XF2A 1A6TA 4QOKB 4K9EC 1P5VA 2ZSVB 1ROWA 2JJTC 2V2XB 3QCVH 5HYIA 3MV11 5JDSB 1IM9B 3M17A 3JV4B 1N7ML 1VKXA 2NX5A 1MCJA 2EDHA 3MV7D 5SV4A 3S9DB 5MEPA 1HSAA 3VGFA 5DUBB 4NFCA 4K2UH 5B3JF 3DRQA 3OKYA 4FZEH 5IP4A 5MENA 4I77H 5CILL 4LGPB 1HQ4A 4R90H 1NJ9A 2P43B 4RGOL 4Q9RH 3S3JA 1N64L 3VXQB 5FOBB 1QD0A 1UZ8B 3V6ZA 1JZ5A 1CWVA 5HDLA 5I18L 1IZKA 3AROA 2NY1C 2R0KL 4GKZA 3IDXL 1MLBA 4UOW1 4ZUUA 4NZUH 1AQKH 4XPGH 4CGTA 5MHSD 5J3HD 4DZBB 3MRMB 1F11A 2EKJA 1EAPA 5DO2C 3VD3A 5D5MF 4TSCH 3VFPB 2PNDA 2OR8A 5JPMB 2H1PH 1LE9B 5AG9A 5B21A 5I1AA 1TIUA 3VRIB 2FYYA 4KQ3H 3WIFB 1BZ7A 2R0WH 5JO5A 3NIDF 1O0VA 4PTTA 2D7OA 4Y4FA 5FYJH 1X4ZA 1MNUH 5I8OH 2DI7A 1FORL 5DZLA 3Q3GB 3ARXA 4N5ED 4PJ7E 2P5EA 4EN3D 3MNWB 5T1MA 4GRLB 4QYOB 5KG9B 1MREL 2BOCB 1KJ2H 3TN0B 3GEWB 3VDAA 4C55A 3F12A 4QRUA 5FUOL 2F5AH 3AB0B 3FRPA 3VFNB 4KK5D 5K9QG 1G9EA 3QIWB 4NGHH 3KR3L 2FWOA 2AJUL 5JXEC 5TH2A 2OTUB 4Q9QH 3OL2A 2EXYD 1F6LL 3DX9A 3VJ6A 1OSPL 2JCCB 1ZS8A 5CLWA 1Z0MA 3H9HA 3T1FA 1BIIA 3GSNB 3ZT7A 4DTGH 5I9QC 2VIRA 4K3JH 1K8DB 2APVA 5DEFA 5HGGS 4JFPB 1JGVH 4YLQT 3PWPB 4JFOA 2R2EB 2HLAB 5BO1L 1QFPA 3SGEH 4MVBD 3QRGL 1KB9J 4L29B 4UAOB 1T89A 3RVWD 2JJSC 3VXSA 3WFBH 5J11B 3ZKND 1RHHB 3P73A 5IBUG 5EOCL 4OCYL 1ND0A 4F7EA 5BVJB 2XACC 3B8SA 1VEMA 1BQLH 2NY7L 5E8DH 5HPMB 5LWYL 4GW4A 3U0WH 1OW0C 1EO8H 4M9PA 4ZO8A 2XFXA 3V79C 2X5PA 4M7KH 4NQDD 1CL7I 4XP4H 4ZUSB 1FJ1B 4GBXB 3PHOB 4UBDC 2K1MA 3NPSB 1EXUA 2Q7YB 5CEZD 4D8PB 1Q8MA 2N7AA 1CBVL 4NQSA 4RIRA 2DJUA 4Z95H 3VWKD 2FJHA 3C2AL 1LP9B 2VDPH 3IXTA 1K3IA 3FO2B 5KVEL 3O6FA 4R6UA 3REWB 4G6AC 4F2MB 4BQ9A 4I1NB 1S78C 3QDMB 4X6EB 1A1MB 1V3MA 3QQ9D 2KQMA 3U0PA 1DANU 1MCEA 5T3ZD 3BKYL 4Z77B 1OAYL 1CD1A 3MRLA 4ODVL 4NO0B 4Z7UE 3MLSH 1QPXA 2Y06H 3IGAA 1LO4L 4M3JA 1CD8A 4X6CB 5DJ2B 2MKWA 4DVRL 4LLAA 3IU4L 4P2OA 3BYTA 5JLZB 3E8UH 3KPRA 1OM3H 3OBAA 3VXOA 3SY0A 1C5DB 2V7NB 5JQHC 3GSRB 3EKCA 3QDAA 4LCWB 5EFIB 4CAGA 2R0LL 1ZHNB 3K80A 1IGYA 2H6PB 3ULUD 2P45B 1B9ZA 1NGPL 3KDMB 2X4QA 2OX5A 3E2HB 1IGJA 3EAKA 4U6YB 4Z7QE 4TOYH 1NDGB 1VFBB 2W9DL 1ADQH 3QJFB 3K74B 5AZ2L 2Z31A 3ARDC 4NKOB 1KCVL 3BPCA 3C09B 5I73C 3LRHA 4ODHH 3UAJD 2OXGA 2GTWA 1JBJA 5SX4I 4P3CL 4J12A 5GJSL 1YJDL 3U2SB 2NY2D 3FB7B 3CSYB 3GGWA 2YSSA 1JMXA 1SBSH 1J1OL 1F97A 1AY1H 1MVFA 1F6FB 3OKKA 4NM8L 1OLZA 4UNTA 3WNPA 3PQYD 4PJ7F 4OQTL 1KC5L 3MCLL 2MWCA 3OKDB 3QIBD 3WLBA 1T5WB 1DQJB 4Z7NE 1KOAA 25C8L 1ZT1A 3PGFL 2R2BB 5JXAH 1GZPB 3MCG1 1U8QB 4JDZB 2HRPL 3N1GC 5SX5K 1QO3A 4GMSL 4NOFA 3NFPA 3CCHA 4NDMA 5SX5H 2NXYB 4L1HA 4CN4A 1FNGA 4KK8D 4PGJA 4KGLA 5GGSA 1ZHBA 4MZ3A 2I24N 3HPLA 5FHAH 1DANT 3WXWH 4XCEB 3MUZ1 2AW2A 1F2XK 2VDQL 4J4PA 4CADB 4QRPB 3GSOB 4OBRA 5EO1B 2ZUQB 3BKMH 3QQ4A 1EHXA 3V5DA 3HZYB 5C8JA 2MSPA 3NFSH 1YYLH 4ERSH 2Y36L 4U1NA 4LBEA 1T4KA 2Q8AH 3IXAA 3REVB 1A22B 4WEBL 5DUML 3V6FB 3O3UN 5HVHC 3MZTA 3VGAB 4O4YH 4NC2B 2V5SA 4NJ9H 4ESKA 4NRXA 3G6AA 5D71H 5DK0A 1DSFL 4P9MH 5BS0A 5JPNA 1J86A 1P7QD 4OCWH 6FABH 3D18A 1HH6B 3BVNA 4JGJA 1QFUH 2GJ6B 4U6VL 4PJFB 2RB8A 4Y5YC 2RAMA 3MR9A 3QWOB 1DL7H 3P11H 3P77B 5DC9B 4HEPG 5FXCH 5M7QA 3VFGH 1N5AB 1S7RA 3TPUB 5ETUB 1RJYB 5I2IB 3RI5F 3B9KC 1OHQA 5FO9A 1NMAH 3SKJH 1EJOH 1KXQE 1F4YL 1NC4D 5DMGC 5ACMA 3IDJB 2RFXB 4LLMB 2I9LB 4ONHB 3QXVA 5L6YH 3DTXB 4JR9L 4PREA 43C9A 4JGMA 1G7JA 4RFOL 2ED8A 4UT9L 1X5YA 2DLIA 5E2UL 1UGNA 2GFBB 5MEQA 1MELA 1XCQA 1D5BB 3JSSA 3ARGA 3E0GA 4U1SA 4OI7A 1QSZA 1HHJA 1OAQL 1LEKB 4HKBA 4X4ZA 4Z7UF 2NY3C 3BUYA 3SE8L 1Q94B 3X11B 4PGBA 3RWDB 4HG4K 1X4YA 5C0CE 3UTTB 2BNQA 3QDHA 3H0TB 5F1OB 5GSRA 2XIDA 4PJDB 1P9MC 1R3HA 4Y89A 5ILTL 3NFNB 3D85D 4OZFG 4P2RA 1LEGB 4NM4L 3L3JA 1FZMB 4WJ5A 4HUWA 1VACB 1H8NA 4HS6A 1T03L 4JFXB 4H8WL 2BC4A 5I8KH 1UA6H 2R8SH 1G7QB 4HXBL 1X4XA 2CUMA 2XKNA 3C60A 5ALCH 2HJLA 1EUTA 3RDTA 2OL3L 5MP6L 4FFZH 5AAWA 4NQCA 4QTHA 2GJZB 1EEZA 2DD8L 5EC2B 3ETBF 3L3IA 3I2CL 2KH2B 2VXVL 1RJLB 3LV3B 3WJLA 4D0BB 3GSUB 3FQUA 4PRIE 1UB5B 3LEVH 2YD6A 4P2QB 3CFDA 2AGJL 3VGEA 3HFML 5DUPH 5I1DB 5CEYA 4Z7NF 3WDJA 4PJGB 1K85A 1U3HA 3PGCB 3QNZB 1FGNH 1UKTA 3QDGB 3QP3A 5D5MA 4E42B 4BFGA 5HHXH 2MFNA 3TFKD 1QR1A 3V4VH 3B6SA 4ZAKA 1W8NA 1U8HA 3FFCB 1JPFB 4DZ8A 2IH1A 1JZ7A 1N26A 3D3VD 4C83A 1CDCA 4OFKA 4YHNB 1OF2A 2DBLH 2EH7L 1YEDB 3QG6B 4TSBL 3ROLA 2BSRA 4EBQL 4KI5E 1KBGH 3K3QA 1EX0A 1V5JA 2FIKB 3Q1SH 3MV7B 43CAA 3MSPA 5BXFB 4M43H 3S7GA 2NZ9D 1LNUA 3CZFB 3Q2CA 4WY7L 1MF2L 1S7XB 1IAKA 2VQ1A 5D1XD 5IVXB 1PEWA 2R69L 4JZJC 3KPNA 4XNYH 5FECA 1I7UB 3B83A 1WK0A 4XAWL 3O11A 5ICYB 3WSQL 4HV8B 1UJ3C 1RI8A 3O3BA 2ZJSH 1CL7L 1N2RA 1YY9C 1T21A 3VH8G 1OTSC 1PQZB 1MAML 3OAZK 4FFVD 1RUML 4JRYB 4J6RL 2YEZA 3BPOC 2BVPA 4Y2DB 4E0RA 3RJDA 3OAZH 3S6CA 4QCIB 5BRZD 1ZSDB 1TPXB 1KJ2B 1GGUA 2CRMA 4X6DE 5C09E 3IETA 5KTEL 5BQ7A 3V52H 4MAUH 1BFOA 2BOBA 4NNXB 3DROB 1A3QA 2IFFL 1TFHA 3R06A 3L5JA 3S5LA 2R2HA 4L3EB 1CFSA 3CX5K 2CD0A 1Q0YL 1QSFA 1AFVL 4QXUL 4XWGH 4N9GB 4YK4B 4ACPA 5F21B 2DQUL 4JFZH 4BA8A 2AK1L 1NEZB 4JVWA 1U93B 3I84A 3SDCC 3HC3L 4P46A 3HHRB 3LEYH 3UTSA 1XMWA 2NQCA 4XPFH 4LFHD 3RVXD 2FX8H 1XGQA 1K5NB 4D9RE 1TQBB 1N59A 1ONQB 4MS8C 5IGXL 3P4NB 4ZQKA 5DURD 4F7CA 4HJJH 3SE9L 1OGTB 4D9LH 3MREB 4TNVF 3EYFA 1RZFH 2O61B 1FDLL 4X98B 1YEKH 3WE6B 2I5YL 1NANH 3MACL 1FL5B 2QADB 3AAZB 4PJEB 1ERNA 3H7BB 1GL4B 5C08E 3CUPB 5FYLE 3DSNA 4QRQA 4XPAH 2X4UA 3CFKB 1ORQA 4G9FB 1IZJA 1J12A 3NA9H 4O51B 2X7LA 4XCCH 3LQZB 1HI6B 1RUKH 4XP9H 1X6LA 4M8VA 3TIEB 2J8UA 2FL5B 2LAGB 1BVZA 2VJXA 3K2UL 1V7NH 3MV9D 1SJXA 5T1DL 1HQRB 4XP1L 3RKDC 4KUZH 4H26B 1YEFH 1OAXL 2GSIB 1NMCB 2Z93B 4Z0XA 4OJFL 3U7WL 3EOAB 4M7JH 3G5YB 4IOFC 1NCBL 4NN6B 4NT6B 2SEBB 2NXZC 3IKCB 3MRJA 4GS7C 4IMLB 5A3IC 1II4E 2OTPA 1I7ZA 2R56L 3PL6C 2WANA 3V0VA 3U30B 4PB9L 2IQAB 1YJDC 4KFZC 4MQXD 4IDJH 4J1UB 3UJTL 1N6QH 3STLB 3S97C 4BH7A 5DK3A 1AXSB 2A38A 2V6HA 5IB5A 2A6JB 1NC2D 3AMLA 5FKPA 1TVBA 4PJ9C 3FQWA 1B0GA 3HE7C 2XWBA 4MJ6A 1C5CH 3VD9A 1DN0A 1RZKL 4R4NC 3MRRA 5IJVA 2AJSL 3QUZC 3O9WC 5C07B 4L8DA 4EI5C 1W0YT 5CCKH 5HHNA 3GMLB 5IHZA 2ARJA 3GKWH 3FT3A 4C56D 4PGCA 5D93B 3FRUA 1FFNB 5C0GA 1T7XA 3BMVA 5CKAA 2FO4A 4Q7DA 4IOIA 4K7PH 4K3DH 2F58L 1MRDL 5IG7B 3ARBA 4E41E 5E8OB 1UYWH 4ODWB 4XCNB 1MWAA 4DK6A 3VD7A 1J1XL 1CFTB 1H5BC 5IF0B 3F7VA 5ANME 2EO1A 4QWWC 3TA3D 5KOMC 3H9SD 4BSJA 3DXAB 3KHQA 4QOKE 5LAXA 2JIXB 4UDUA 4KJQD 2J88L 1KENH 4X8XA 5ID0A 5FUZL 3C6LC 3N0PB 5BVPH 4PRHD 1DBJH 1L7TL 5E6YA 3TCXA 2X1XR 5K93A 3MRHA 1QHOA 1FO0A 1XZ0B 1MLCA 4J7RA 3WHXB 1AE6H 1YQ2A 4X6FA 3ZTNL 4X6DF 1G9MH 4F7PB 5L88L 1YQVL 1EZVY 1WITA 3LH2L 5DJZA 1NBYA 4ETQA 2CLRA 2J5LB 5JOPE 2IAMA 5KS9B 4GUPB 5F44A 5IMMA 5KSAC 3RVUC 2OXHA 4NUJA 5DI8A 3G5VA 1JPTH 3WFEH 1DBAH 1D6VH 1Q9LA 4YPJA 5FUCE 3IB4A 4LHUB 4O2CB 3VRJA 3A6BH 2EYRB 4PLJD 1MJ8L 4GXVH 3ZT5A 2YPLD 3U0TB 1PLGH 4JHWL 3TWCL 4XMLH 4RWYH 3AM8A 1ZLSH 1D9KB 1KN2H 4PJAE 2ZUVA 4K3HA 1IAIH 2PW1A 5FCUH 1A7PL 3BDYH 4WDIA 4H0IA 4UV4L 4JY5L 1X44A 1PW3A 1HSBA 3CVIH 3RL1B 2P8LB 3SDAB 3MCKB 1HWHB 3JV6B 2MHAB 1BMGA 2WMPA 2CUIA 5SWZB 4MQ7B 5K59E 5EO9A 4XC3L 2HFEA 1FV1B 5D2LB 1RV6X 5HI5C 3D0LA 1Y0LB 4UTAL 4XCFL 2WQ8A 2XTJC 2LE9A 1QLRA 4I3RL 1NCCL 1KIRB 2Y6SD 4F37F 3GKZA 3OX8B 3SDXB 3H2WA 1TCMA 2L4OA 4XNXL 2ITCB 4PRBA 3VE0B 1FVEA 4PRAA 5C0RH 1F3JB 1YMHB 3A67H 4ODSL 4P5TA 1P84K 3GM0A 3MJ9H 5D1ZA 3D2UA 5DTFB 3MRBB 2B2XL 3D69B 3M8OH 4Z7UA 4OSUL 1S9XA 3TV3H 1GPOH 4ALAL 3HUJA 4H8WC 3KLHD 1N5YL 4WUUD 1DJSA 4MD4A 4PJIB 1RZGB 4PUBH 4QXGL 5HYJB 2QQKH 3OR7B 1RURL 3QDJE 3QIUB 4UT6L 4G8FA 4XRCA 5GRVL 1U8KA 5GGRB 4OCXH 4JEGB 2O5ZH 1CFVH 1UKQA 1GAFH 3EOTH 1BQSA 1NH6A 3C6SA 5DQ9A 1I4FB 3T2QA 3QWQB 1BM3L 3P0YH 4NN7C 1S5IL 2H8PB 5ESQA 4N0FB 3SPVA 5KVGL 1F02I 2BRRL 1UM6L 3CDCA 4OLVH 5D7IB 5MEOB 1U8NB 5KVFL 4AL8H 3ZHLA 4OV6F 1T89C 5CHNA 15C8H 3G04A 4G43B 4KVCL 4S2SB 1AHWA 4Y0GA 3BZEA 1DVFC 3BISA 1NFIA 3EUUA 4QKXB 4DKEH 1ED3A 4XC1H 4ZOCA 4KZEL 3HNVL 1X5LA 4I0KA 4LAQH 3QHZL 2OSLA 3CXHJ 1IGIH 3P0VL 5E4IA 2NY0C 2VC2L 4TRPH 2P8PA 3MXWH 3W39A 3TVMB 3HMXA 3KAAA 1B88A 2R9HD 5JW4N 5IMOA 4LKCA 1IARB 1E4XH 4I48A 4CU7A 1KN4H 4PJ8D 1G9NH 2DM2A 1LP9E 1AGDA 5IUSA 4LMQI 3G6JB 5I1JL 5IFJB 4YAQA 2JB5L 5T3XL 4HIXL 2OLDA 5F6HI 4PTUA 2E9BA 2Y4SA 4QEGA 2XZQL 3M1BB 1E6OL 5GGTH 2B7DT 1GGIH 1BFSA 2JK5B 5D6DA 5J1AB 1NAMH 3KS0J 4NQVB 4X80H 2PO6D 3QEHB 1MCRA 4NHCL 2V2TB 2EIZA 3SGKC 4JCMA 1ZOXA 2XN9B 5DJDA 3SQOH 3L5WA 3TP4A 5I1GL 4XNUH 1S7QA 2FECI 2VN4A 4KKBC 1HHHA 3IJSA 4HIJB 4H1LA 1XT5A 4LIQH 1J0KA 4FQ2H 5JHDB 3S37X 2FDBP 2BVOB 2VZVA 3MO1A 4PY7A 4PJAF 4L4TD 4H20H 4PGDA 3QQNA 5EN2A 3QG7H 5F70A 3GK8L 3KPOA 5E8EA 2DTMH 5DRZB 2AV1B 4JJHA 2VZTA 1GGBH 2Z31C 1GJIA 2V5RA 3HAEA 2E3VA 3BD5A 3BDBA 3U6RB 4HCRL 4U1GC 3GUTA 1K6QH 2Y07L 1QBBA 4YBQC 4Y16C 3VDBA 2B1HL 1KB5L 1NCWL 1XIWB 4HK3J 2ESVB 4Y5VB 3WJJC 3S36H 5DEGB 5IHUL 3ARPA 4Q6IC 2DQTL 1A7NH 4K3GA 1UWGH 4QRRE 4Z9KB 5ICZB 1D5ZA 4LP5A 4JPVL 5E99L 1EFXD 5GRXG 2XQYG 1FYTD 3QUXC 4PG2A 3MLVH 4Z5RA 1KNOA 2CGRL 4X7DC 4U31A 3B9EA 4X8JB 3TJHC 5C6PB 1NCDL 4LCCA 5TPWH 4DGIH 4YGAB 3QFJB 3IFNH 4OQ1A 1FVCA 3VXTA 5AYUL 5C0CA 1DQLH 4ISVA 1MCDA 3HPJB 4XBGB 2A1WH 1OAZH 2HTLD 2VDLH 2RCSL 4RCAA 3D25B 1PD6A 5IMKB 4EQ2A 1LEIB 2QSQA 1HILB 1V7ML 4XNQB 1WWBX 3IJHB 2E7LA 1HINL 1I9RL 1TJHH 4TULH 1JGEB 3W2DL 2CDGA 2NY6C 4C4KO 1LE5A 4F7TA 1DE4B 2YKLL 3L3KA 3O8XC 4AEHH 2A9NH 3EYSL 3AREB 2ITDB 2GJ6E 4PJFE 3MUGA 4IRJB 3JWDL 5TE4L 3L3GB 1C08A 2V2WA 1I1AD 2DKMA 5T1LD 4ZS7H 1HE7A 5CGYD 4JFDB 4YHPA 3ULVD 4YE4H 1MHHA 4PRIA 2ZOKA 1RZKC 3N1FC 3O6KL 4KDVA 4LVOC 3B5HA 4JKPL 1FPTL 1XGPB 5F7EH 1YEEH 2KKQA 2I26N 3U4EB 1RUAH 5I1KH 1JWSB 3QCUH 4PRPB 5IQ9A 4O5LH 2NYYD 2J12B 1SEQL 1T66C 5E1AB 2Z8SA 4IM8A 1A1OB 1V3LA 2CK0L 5I1LA 5D70H 2A6IB 4PPTA 4S1RH 1LP9F 5GJTL 3TJEH 2NW3B 4KK9D 4TN9A 5I16A 2H45A 4RZCA 2WP3O 4WFFE 5DQJB 3OB8A 5J6HA 1B0RB 1YEJL 2I07A 3RIAF 1VGEL 4ZUVA 4M48L 1XF4B 3W5MA 4HHAA 4JO4L 1QQDA 4HWBH 1JUFB 4JFFD 4JJ5A 1XR8B 4JM2D 2OMBA 4H0GA 4JPKH 4XZUB 5D72H 5B38B 3ARGC 2AJYL 3TZVA 5E2VH 4LPYA 1S5HB 4FFYL 5K9OB 5F7HA 4ZUWB 3EFFA 1YNTB 4HD9A 3GZKA 3GDBA 1M1SA 3UTTE 5B39B 3QT2A 4U3XA 1H3PL 3QULB 5F8QC 1MIEH 5D7JA 1YN6B 4PJDE 3BZ4B 4FXKA 3SO5A 3O3AB 2VR4A 4HS3A 4GT7A 5E6IA 3V6OE 2DLEA 5FM5M 3T4AB 3UO1H 5LCVH 5IIEB 3C2SA 4APQD 1QKZH 2XTLA 5DQDH 2HKHH 3TESA 2D7PA 3GB7B 4AEIH 2AEQH 2IEPA 3E6HA 3ZKMD 3MRPB 4N8CH 5EOQL 1RU9L 3UJIH 4FXLA 1WVZA 3TBVB 1BOGB 3PXHA 1BQHB 1NKRA 5I19H 1BEYH 2A83B 2O26U 2ZCKH 3KYNB 4Q97A 5C09A 1E6JH 3AVEA 4XB7A 2FX7H 3QISA 2HKFH 1QBAA 3RDTC 5DMKA 1WICA 2PTUA 2CIKB 4PS4H 3VFTB 3M45A 1H3VA 5CEZL 4WNQB 2DQIL 3BQUA 3PWLA 4MHHG 3Q6GL 4G5ZH 3FN0H 3KHOA 5C0EB 3SKNA 4E5XA 5D2NE 4DUWA 4P2QE 3O2VL 3ILPB 4KXZI 4FQXD 3BH8B 3FKUS 3CFBA 5H35A 4EOWH 2NTFB 1DTUA 3KJ6H 3D39D 2XZAH 4CW1B 1A7RL 1MJ7H 1A9EA 5SV3A 3NZHL 5C0AA 5T3ZL 1SYSA 3SCMC 3WUWG 1FNHA 1AJ7H 3QI9B 1WWWX 2F54D 4Y4HA 3FFCE 4Y4KC 4ZFZA 3WCYA 4HJGB 1UVQB 2CQVA 3V5HA 4LNVA 4ZAKC 1R3LB 3OXSA 1AO7A 1DBKL 1FVDA 1DDHA 1MRFL 2FGWL 2IBZY 1JVKA 3OR6B 1G0YR 1RVFH 3MROB 2NY5H 3QFDB 4F7MA 2AQ3A 3MV7E 1MJJA 3FO1B 5IM7A 4HWZB 2YWZA 1Q0XL 5A40E 5LQBL 4WI9A 4XH2B 4OM1H 3ULUL 4RGNC 1F6AA 2HTKD 4CNIB 4LSTL 1U8JA 2IQ9H 5ESVA 4D9QD 4IRSB 4F58H 2PUQT 5FYJE 1E4WH 4P4KC 3VFVB 5BCAA 1NGWA 4PJFF 1INQB 1T1XB 2HFFB 4U6HB 3ESVF 2R4RH 4Z0BL 4ZOAA 5HHQA 1KFAH 1U2HA 3HN3A 5DJXB 5INCA 4UIMA 4GAFB 3FO0H 1HH9A 3WNKA 2ZUSA 3MGOB 3FJTA 2UV3A 5DD1H 3IU3A 1PKQB 2YXFA 1S9YB 3BE1L 3MYJA 3BHBA 4NP4L 2I27N 1LWRA 2IALB 3MOQA 3QZWA 1M71B 4R8WL 3I9GL 1KCLA 2J8HA 4XWOC 3VFRB 1GRWA 1XEDA 3CDGB 4PRDA 2YPKA 3VMPA 5IQ7L 1UEMA 5JR1L 4KDWA 5F9WB 1R0AL 3DI3B 3TM6A 1NSNH 3C5ZD 2FECL 3V8OA 1SVCP 1F4WH 4MLIA 3V0WH 5C0BB 4XP6H 4JZNA 4NWUH 5IBTL 2HT4C 1EGJH 4RAVA 4P23B 1TJIH 3TO4C 2EIEA 4HX1A 4O00A 4ODXA 2UY7A 5EOTB 4B7IA 4MB3A 2BHYA 1DFBH 2HLFC 1IQWH 4PJDF 1X7QB 3R1GL 4FABH 4HWNA 3VXMA 1KIQB 3MNVA 5IMLB 4QOKA 2BFVH 4I13B 1I3GH 2ZSVA 2V2XA 2OP4L 3ZT6A 2BXYA 2XRAH 4CU8A 4G9FE 5HSFA 5BZDB 2WBJD 3JV4A 1CN4A 1LK3L 1FLTX 5HHOD 1EH9A 2E9IA 4LARL 1JHKH 5FKAB 4ORGA 5DUBA 4ZS6C 4WW1B 2AJVH 1RUQL 3CFCL 1KEML 4XBEH 4MA8L 4I0PD 1VB9A 3VXQA 4PJBE 5EU5A 3SGJC 5CJOL 4FXGB 5SWSB 3VA6A 2ICWB 3EYOB 4M6OL 1U8IA 2C7UA 3ROOB 4OKVB 1EUUA 4AQOA 1YN7B 3S35H 4W6XB 1IRAY 2VLRB 1NAMB 4DZBA 3MRMA 1FNSL 4AZ8A 4RAHA 2YHGA 4UU9A 1BWWA 3GMOB 2CKBH 5M94B 3VFPA 1Z3GH 3DETD 5JPMA 4XPBH 2BJMH 1LE9A 4WWID 3DOSA 1CICA 3HR5A 4EI6B 1A2YB 4FTVB 5C07E 2UZXB 3DMMB 1PSKH 3LHPL 4PJ8B 5EPMB 3WIFA 2VXTH 4OCRH 3HC4H 2C3VB 1UWEH 4HMDA 1MCLA 3P4MA 5I1HL 2LTQB 3RA7L 4NN5B 4RFEB 4HPOL 1A9BB 3RZCD 2PXYB 3NVQA 4M1DH 5IR1A 1NDMB 2DRUA 3MNWA 1TZIB 2I9TB 1UADC 3GHBL 1WTLA 4GRLA 5IVXF 4JLRB 3ARBC 4E9LA 4R26L 1DLHA 4P5MB 4QYOA 5KG9A 2F74B 2BOCA 3TN0A 5EU6D 2PO6B 3VFNA 1BJ1H 5J3HC 2ZNXA 4UB0H 3QIWA 4RA0C 5LGHL 4MAYD 1HKFA 2FATH 4V1DB 2OTUA 2A74A 4P99A 3DWTA 4YC2C 4U1HB 1HK6A 2JCCA 2IPKB 3GSXA 2YBRB 4LU5H 1MFAH 1MHEA 1B4JH 1KTLB 2RIKA 4QF1B 4W6WB 3QDJA 2M8XA 2CRYA 4MNGB 2HJFB 1CXLA 3JWDC 1QFOA 3GSNA 5F89A 4M6NL 5IJKA 4QXTB 1K8DA 5DZNA 2OTWA 1IGTB 1EERB 3ECBA 4JFPA 5ITBL 1FBIL 3PWPA 2R2EA 5DMJB 3MLWL 3LB6C 3BIAX 2VXUL 1VA9A 1BAFL 5EZJB 4ZPTB 4L29A 3FMGL 2EYSB 3LDBB 4UINL 3O41A 4HUVB 3D1MC 1BGXL 4OLYL 1RHHA 4X9IA 1ODAA 1MAJA 5CINL 4FZ8H 1U3YA 3PQYE 4CKVX 4BH8B 4XNZC 5HPMA 3OGCB 3WFDH 2EXYC 3I50L 3RTQA 4LMQE 3IRPX 3HG1D 3K7UA 4NO3B 4GSDH 3ME0A 4ZUSA 3TIDA 1FJ1A 1UENA 4GBXA 5GGQH 3PHOA 3D5OF 2DQJH 3H8NA 4OM0H 5SWZE 3FOMB 4QLRA 4PRNB 5AZEH 1RZIB 4QGYA 1MCHA 4TSAL 2IANB 4Y5XC 4CVXA 3T2NL 4ZNCD 1LP9A 3DYPA 5EA0H 2FSEA 3KLAB 4HF5H 1KTDA 3REWA 4RWHA 5D7KE 3QEQD 4KY1H 3QDMA 5FEBA 35C8H 2GY7B 2I60H 4X6EA 4G6MH 3QAZC 1DUYB 3ARVA 1D5IL 2YRLA 3L5HA 3DX7B 1DQDH 3T77B 2FHBA 4Z77A 2J2ZA 4GKSB 4NO0A 4OLWH 4XVJH 2ILLA 3MLUL 4EXPX 5GISH 3WS6C 5DJ2A 5DZOA 4PJBF 3QWRA 1JF5A 4PJIE 1Z9LA 2V7NA 3GSRA 5GS0H 1FL3B 4KZDL 4LCWA 5EFIA 3DV4B 3H42L 5E5UB 2QHLA 4OZFH 1OCWH 1ZHNA 4N0UE 3HI5L 2VDMH 4WWKB 4OLEA 1P5UA 2RQ8A 3PF2A 2KL6A 2H6PA 5DD5L 5ICXB 4YDIL 3KDMA 4U6YA 1JFQL 3WNMA 1NDGA 5FIEA 4AM0B 4Z8FH 1IAMA 5C9JB 1B4RA 2WBKA 1AXTL 2C1PB 1EO7A 4WFED 2HG5B 4NKOA 5GRZA 1U8OB 1E4KC 5F6IB 2XQBH 3OTTA 5C6TH 5IEHB 3U2SA 3FB7A 4JZOB 4OAWB 5JW3H 1AHWC 1SM3L 1NUNB 1C12B 3N06B 5D1QC 1XGYL 1HEZB 3O4OC 2EDYA 1JRHH 1CU4H 1FNAA 1SJEB 4I3SH 3OKDA 5F9JB 4GMTH 1T5WA 1DQJA 4OF0A 2R2BA 2DQEL 2MCPH 1GZPA 5E8NB 3SDDD 2ICES 2NY1D 1U8QA 1HZHH 2DQDH 1F90H 3P3YA 3SHSA 4DQOH 4JDZA 3IYLW 2QQLL 3G08B 3CLFH 2E8YA 5DXWA 3EDDA 4K9EH 5FB8A 1CE6B 4Y19D 3CK0H 5DO2D 3ULUC 4X83A 3QRFM 1JV5B 5D8JH 2AABL 4FP8L 3Q0HA 3GSQB 5GHWL 1L7IL 4XCEA 3P0GB 3M17B 1W8OA 2DQGH 3H7LA 5KZCB 1JYWA 4QRPA 3RQ3A 2NX5B 3EYQC 1H9VA 3HZYA 3UAJC 3QXWA 5D6DC 4OUOA 1JPSL 4GQ9H 4AG4L 3MLRL 1QBML 4HUUB 2IMMA 1T22B 1KGCD 1NJ9B 1X5JA 4GRMB 3REVA 3V6FA 4ZSOB 5INDB 5FM4A 3QIBC 3B9AA 4CMMB 3L6FB 1RZJH 4OIIH 4Z7WB 1HH6A 2ADGB 5ITFB 1YNKH 2GJ6A 4PJFA 4ZUUB 5JHDE 2P4AB 1JGLH 1UXWB 5HGAB 4LAJH 4PJCE 4NCC2 4IRZH 5IHLB 1H3UA 3QWOA 2Z8RA 4MJIB 4FQXB 1BWMA 4KK8C 3P77A 1EAPB 3KLSA 1N5AA 5GSVA 3TPUA 1E27B 3MV8D 3OWEA 2X4NB 4P3DB 2WUBH 2VLJD 2D7QA 5HBBA 3GI9H 1MVUB 1BVLB 2F54B 4R97C 4LLMA 3BN9C 2I9LA 4ONHA 3DSFH 2D0FA 4M5YH 1CVRA 4Y4FB 3NCBB 1RFDH 2VQTA 2N7BA 4WW2F 1WUNT 1CDIA 2VH5H 2ZPKL 5E0QA 2R1WA 1TNNA 3KPPB 5GS2D 2E7CA 2GFBA 4YBLC 3S3SA 1D5BA 4KTEH 3KXFB 5T1MB 3U7YL 1LEKA 4J23A 2PF6A 4CVZB 1B6UA 1AI1H 1Z0NA 2VXQL 3NGBB 2IBBA 3C5SB 2Y25A 3QXUA 1Q94A 3H9YA 3QPXL 4JDVB 4J3XA 3LS5L 3X11A 5ISZD 5TH2B 1OB1B 4G8IA 4PJIF 3RWDA 3WIHA 1WLHA 1Z5LB 3UTTA 3JZ7A 5IBUB 3H0TA 3VW3H 1ZS8B 4PJDA 4BK5A 3NFNA 2R0ZL 3SBWA 4UBDD 1QRNB 3MBEB 3V6OA 2DDQL 5EBMA 4YXKH 3T1FB 1LEGA 4HGWA 1FZMA 3RNQA 2F53D 1VACA 5BRZE 2VIRB 3QHFL 1VEOA 1X5AA 3HE6D 1FC2D 4K07A 5DEFB 4JFXA 2IG2L 4WFGE 1G7QA 3O4LD 2E7LC 4YO0B 4G6AD 2OYPA 1WC7B 1PFCA 4LSPL 2CMRH 1IBGH 3FHAA 2GJZA 5IFAH 3VXSB 1TVHB 4YHKH 1RJLA 4D0BA 3GSUA 2C4XA 3FO9B 4G7VH 2J6EH 3BAEL 4JREB 1UB5A 1ND0B 1JTOA 1F2QA 4P2QA 1EMTH 1GHFL 5A2JH 5I1DA 1MJUH 3MGTA 3LOWA 4PRPE 2E8ZA 3OPZH 3PGCA 12E8H 4KTDH 3L9RA 3MYZA 3QNZA 4ZMAT 4E42A 3LS4L 3QDGA 3VCLB 3VDCA 3RBSA 4NQSB 2ZG3A 3QUML 3G6JF 2GY5A 3FFCA 1NGZB 1OARH 1QLEL 3MLYL 4KAQL 3DUSA 5L8KB 3IXTB 4YHNA 5AAMA 4WVRA 2YPVL 1B2WH 3QG6A 5I1IL 4ONFH 1WT5C 1KCSL 3RWIB 2CKBB 4YHYB 1Q9OB 1F3RB 4U05A 2FIKA 3VFUB 3MRLB 3MV7A 5BXFA 4G9DB 3L5XL 2BSSB 4FQHB 5KVDH 3CZFA 2BHUA 1FRGL 1M4KA 3WKMH 3B2VH 1S7XA 3MV9E 5IVXA 3O2DH 1CTNA 4WV1C 1RULL 4OTXL 5EBLB 4P2OB 3WXVL 4B50A 3QEUB 5AUMB 1P7HL 3VXOB 4TVPD 3OKEB 5HD8C 1RIHH 1MHPH 3JUYA 5ICYA 5E6IC 4HV8A 3PJSA 4PJCF 2B1AL 2M1KA 1JPGB 5BOZG 4JRYA 2AJXH 5EZIL 2IPTH 4Y2DA 1ZVHA 2Q6WB 4QCIA 5T5NF 2FLRT 5MI0B 2X4QB 1ZSDA 1KJ2A 1P4IL 4JG0H 1MIML 5HHPB 3I6GB 5FYJU 2P5WB 4NNXA 1UM4L 1KCRL 1GSMA 4DGYH 2G9HB 1JF6A 5E9DD 1L4IA 2GTWB 1I3VA 3ARYA 1F4AA 4RMWA 4P4RB 3GGWB 2YSSB 4NHUB 5K9JL 1DLFH 1NEZA 1U93A 3MV01 3LY6A 4KUCD 5D1XC 4DCQB 2OS7A 3TBSA 4C56E 2GI7A 3D9AH 2CR3A 1K5NA 1BPVA 2VYRE 3GBNH 1I7RB 1ZT1B 1FO0H 1JYNA 2ZUWA 4LLUB 4M7ZB 1OY3B 3P4NA 5E2TH 4XVSL 4QHLB 4N0YH 1UXSB 5J06A 3KPLB 3NFPB 2QHRH 1OGTA 3R4DA 3MREA 4FFVC 4Y4HC 5CJ8A 2W9EH 2NMSA 1SY6H 1C7SA 1FNGB 4X98A 5CD3B 5F96H 1MPAL 1IILE 5IVNA 3WE6A 1G7MA 2BCKB 3QUYB 3AAZA 1IAIM 1XFPA 4PJEA 3H7BA 3B9KD 4DAGL 4PRHE 2VDKH 3CUPA 2R29L 5DMGD 3CXDL 3CFKA 3AY4A 4G9FA 4R0LC 1D5XB 4MLSA 1GGCL 4M5ZL 2O5YL 4O51A 5C8JB 1MFCL 1T4KB 3IXAB 1D6EB 2A77L 2FL5A 1EAJA 1FH5L 2OZ4L 4JO3L 4ODBD 3AS1A 1HQRA 4H26A 3BZDA 4NNYA 1OVZA 4N8PA 1QYGL 4KRPC 2GSIA 3D18B 4G8GB 3WHE0 4PJBA 3S4SA 4XVTL 1YEGH 3IAQA 3ARTA 3K8LA 3G5YA 4NT6A 2NY3D 3IVKB 3IKCA 3EJJX 4LKXB 3O6MH 5J1SC 1HIML 2ORBH 2F5BL 4IMLA 1T0MB 1ZHKB 4ZFOB 4GLRH 4YDJA 2XWTB 2C9AA 3LKOA 2IQAA 4J1UA 4G42B 4IMKC 1FE8H 2HT2C 4U3CA 1AXSA 3ARFB 1U95B 2A6JA 2XZCH 2ED9A 2OI9C 1JNLL 3NACH 3D87B 3DBXB 3K46A 4GW5B 43C9B 3AFLA 3O45B 4OZFB 5C07A 4HULB 2OK0H 1X5XA 3UPAA 4JFEB 3GMLA 2A6DA 1X3DA 1I9IH 1EHNA 3S4SG 4BFEA 1WQVT 1K4DB 1INDL 2PW2A 1M7DA 4D3CH 2BVQB 3B2UC 1CLYH 1J7VR 1OLLA 1PZUB 3FT2A 1ADQA 5IG7A 4LSSH 5E8OA 3HKFA 1MCPH 3FN9A 4ODWA 4A6YL 4XCNA 4D94A 4M4PA 4HH9A 1CD0A 5HVWA 2EH8L 2NZIA 2VL4A 3Q5TA 4Q9BA 3DXAA 4MQXC 5TFSL 4WUUE 1N64H 2DQCL 1A6VH 1JTTA 4MD0A 1R3HB 5CS7A 5I15H 5AD0B 5I18H 4P2RB 2APFA 2CO7B 2R0KH 2YWYA 3ULVL 2DB8A 1ZLVK 4WJ5B 3WHXA 1ZLVH 4ZXBD 4I18C 3T2PA 4F7PA 3ZDYE 3SJVD 3WIHL 3DURB 4OFYA 7FABH 2HJLB 5CEXB 3ZLQC 2X9WA 4GUPA 3KPSD 4C4KT 4C59B 3HRPA 1PY9A 3CIQA 4UNVA 3JUZA 5SWSE 3ABZA 1F13A 4LHUA 1G7PA 4O2CA 4KU1A 5TE7L 2EYRA 1RPQA 2ADJA 2X4SA 4OCMC 1BD2B 4JO1H 3U0TA 3LAFA 4DGVL 1GOFA 5J56B 4PJ5D 3RGVD 3ZDZE 1FGVH 4KJQC 4BYHA 1KELH 2EZ0C 4OD2B 5F7DB 2UZYB 1QR1B 1YY9D 1WBYB 5DFVC 3RL1A 1MREH 1ZK9A 1U8HB 2P8LA 3MCKA 3JV6A 2IH1B 4C83B 2B5IB 4LIQE 1CE1H 4MQ7A 5GRUL 5SWZA 4M1GH 4K2UL 4FZEL 1FV1A 4BM7A 3VH8B 3KR3H 1CGUA 4WUKH 4R90L 1Y0LA 3HZMA 2BSRB 5C0NC 4Q9RL 1KIRA 4WW2A 1GZQB 3U46B 2ITCA 3T0EC 2Q76B 3VE0A 2XA3A 1EV2E 1F3JA 4M6MH 4MA3B 2XQYK 4NZUL 1AQKL 3TN0C 4GAJH 5DTFA 1RIVL 3D69A 3BPNB 1J5OH 1A7BA 3RPKA 4MS8D 5BO1H 5D7LD 4TSCL 1IL1B 5TDOB 3V5KB 3ZYJA 4HG4J 2H1PL 2HJKB 4NWTL 4PJIA 3QRGH 4AT6B 1N2RB 1IQDB 1RZGA 3OR7A 4JVUA 4ELKB 4X7TB 3QIUA 3BI9X 4MYWB 4HK3N 4KQ3L 4E0RB 5GGRA 4N0UA 4L4TE 5EOCH 5CP3H 2NY7H 1I4FA 4LQFH 4XGZB 5LWYH 3EFDH 4QXWA 4U3HA 3V4PL 2H8PA 5DGRA 4HH8A 5I8OL 4N0FA 2YK1H 3DVNB 5D7IA 3WO4C 3U36A 5B8CB 1AGEA 3PP4H 5DJCB 4TNVK 5MEOA 4YHLH 4NNPL 5J13C 2VKXA 4NUGL 4UAOC 4G43A 5J11C 1CBVH 3RIFK 3T8XA 4HIIA 2F19L 4P46B 4S2SA 3VXUB 3UTSB 3C2AH 1N59B 1CFNB 4ZQKB 1OP3K 5KJRL 2CUHA 1OP3H 4EUPG 3TVMA 3I3DA 1OAYH 5A3ID 4GBXC 1BREA 2QKIB 4JQVA 4AIZB 3PL6D 4DTGL 1X5GA 4K3JL 2FZ3B 3LCYA 4DVRH 3IU4H 3G6JA 5IFJA 2FBJL 4L4VB 2CR6A 3PIQB 1TQCC 2IFGA 3HE7D 2X7LB 4JHZA 1Y18A 5A43C 3M1BA 4WI3A 1XGTB 5F97E 4KKNA 3WFBL 2JK5A 5J1AA 3QUZD 3ZDYF 5HHVL 4NQVA 1PZ5B 3QEHA 2V2TA 2W9LA 1NGPH 2A0LC 1CDBA 3IDYC 4N9OB 2IGFH 1MI5D 3X3GL 2XN9A 2Q7NA 1BQLL 3BP7B 2W9DH 3N85L 3T08A 3CGTA 2CXGA 5AZ2H 1E0OB 3U0WL 1QSVA 4PR5A 1YYMH 1P2CB 1IEHA 1KCVH 2EC8A 4PGZA 3R0MA 1HXYA 4M7KL 4HIJA 1BIHA 4P3CH 4W4OA 5JHDA 2KZWA 4QWWD 2BVOA 4UZGA 3VU2A 3UC0H 1RQ5A 3ZDZF 1J11A 2EEBA 4K7FB 2QSCH 4M00A 5EORL 4WI4A 1KC5H 3MCLH 3E2HC 3MA7B 5DRZA 25C8H 4XAKD 2WV3A 2AV1A 5IB5B 5FKPB 3WFCL 3M07A 2R4SH 1A3RL 1NUFA 1TJGL 2E6QA 5JW4Q 3UTOA 3CX5J 4O58H 4L8DB 3U6RA 4U4BA 5MEND 2MQ3A 3MUHL 2Y06L 3FT3B 1TITA 4GAGL 1NGQH 4AH2B 2H32H 1ITCA 4JFFE 5C0GB 3L1OL 1NGYB 3CNKA 3IF1A 3ARDB 4IOIB 3BMWA 2YUWA 3BRGC 4PJ7B 5DVLA 2Y7QB 1P6FA 5JW5A 4EXKA 2FO1A 5JUEH 4UIKL 3X13B 5ICZA 2Y36H 3LKRB 3F7VB 1FCGA 4HAFA 5F1NB 4JO2L 5DUMH 4WEBH 4X8JA 4UDUB 1IAOA 4LGSB 2CJUH 3QFJA 4TOYL 4M03A 1CVSC 1DSFH 1A6UH 1ADQL 3PWJB 1IC1A 3HPJA 2CPCA 1FO0B 3X3FL 1DBBL 2ZUQC 4X6FB 1AKJD 4HQQH 4RMTA 3MA9H 2DYPB 3D25A 3T3PE 5IMKA 1JN6B 1Z9OA 4TTGA 1NBYB 3F7QA 2CLRB 5IEKB 4XNQA 1SBSL 3IJHA 5L2KB 2IC2A 2XTJD 3UCRA 1A4JA 1JGEA 3I6LD 4OCSH 3OKNB 1DE4A 2VTFA 1Q9LB 4Z7WE 5ESAB 4OI8A 2P5ED 3AREA 2EDKA 5JXAL 1OD7A 4IRJA 5EU3B 4CRPA 5IB4B 1MFBL 3L3GA 2EDFA 3KWWB 3NCFB 1TZGH 1I8MB 2BY3A 4JFDA 3VWJC 3ZYIA 4AY0A 3DGGB 5HVHB 4S11A 2DS4A 5IW6B 3IDMB 4WU5A 3D39E 4Y1AB 5FYLH 1T20B 1XGPA 5E2UH 2QQQA 4F37K 5FHAL 1P7KA 4WDIB 2FEDC 1TETH 3U4EA 3VG0L 3WXWL 3AS3A 1JWSA 1S9KC 3MRCA 4PRPA 1OAQH 4M61B 2F54E 5E1AA 3BKML 5DR5H 2XV6B 4ONGH 1A1OA 4GKOA 2A6IA 5HHMB 2DMKA 2NW3A 3SE8H 1WZMA 3L95B 3D0LB 2Q8AL 2DLGA 1P4BH 3U9PL 3UZEA 1B0RA 3GI8L 1XF4A 3OJDB 1OAUL 4O4YL 3WD5H 1MCFA 4NJ9L 1JUFA 4NRYB 5ILTH 1XR8A 4FQCH 5D71L 5JQ6H 1ZGLB 2P47B 4P9ML 5B38A 4OCWL 1RIUH 3W9EB 4NM4H 4LFHG 4P5TB 1CG9B 1S5HA 4L3CA 4ZUWA 5D1ZB 1I3RB 1DVFD 1PVHA 4OZGE 4D9QE 3ULVC 1DL7L 1YNTA 4U1IB 2OMNA 4Z7UB 3P11L 1T03H 5BMFL 4HXBH 2K9UA 1DN2A 1WFOA 4KC3B 3QULA 2OL3H 5MP6H 1YN6A 3BZ4A 1YNLH 3O3AA 1XGUB 2DD8H 4N0RA 4YEEA 1QRNE 3T4AA 3SKJL 2MMXA 1SBBA 2NY3B 5K9KB 1ZHLB 4XP5L 3UPCA 3MRPA 3FQNB 3C6SB 5L6YL 3TBVA 1BOGA 3SKUD 1MQKL 4HS8L 2A83A 3HFMH 5ESQB 1JHTA 5C7XH 4YH6A 4JHAL 3KYNA 4K3EH 1IT9H 3GO1H 5TJWK 3O6FD 1CS6A 4JPWH 1BFVH 4XPHL 4H25B 4JM2C 1T0NB 2CIKA 3VFTA 4OZIE 1WBXB 3CSPA 4WNQA 3ZZ1A 5LBSH 1WZ1L 3CFEB 5F3HB 3ILPA 1NGXB 3BH8A 1MFDH 4F9PA 2EH7H 1J18A 2OSLB 3ALPA 2NTFA 5LKNA 4KKBD 3KPRD 4CW1A 1IAII 2DLFL 1NLDL 4BFBD 2A2QT 3CH1B 1XH3B 5T1KB 5IMOB 5EZOH 1QFWH 1A3LH 3QI9A 4X7CC 3LKPB 3BWAA 2G60H 2XWJB 5I6XB 4KROD 4WY7H 1UVQA 3MX0A 1AGDB 5AWNH 1A0QL 1R3LA 1K4CB 1H0DB 3BEWB 5I8KL 4YAQB 1UA6L 2APWA 2O93L 4NJAL 3CVHA 5ALCL 4XAWH 3PWNB 5FYKL 3WSQH 3OR6A 4K8RD 2Z31D 3MROA 3QFDA 5HHOE 5ID1A 1CL7H 4X6BB 3FO1A 4HWZA 2GQHA 3T3PF 1MAMH 4XH2A 4BKLB 1FIGL 4CNIA 1GGYA 1A8JH 4YBQD 4Y16D 3LEVL 5KTEH 1CDUA 1P84J 4IRSA 3L5WB 4K94L 3VFVA 1S7QB 2EYTB 3NAAH 5DUPL 4Z7WF 5IWLA 4MA7H 2D31A 1INQA 5KBNC 2ADIB 1T1XA 2HFFA 4U6HA 5FHBH 5TQ2H 4R2GD 1I9EA 4QXUH 1FGNL 5DJXA 1OTUD 1AD9B 5HHXL 4Y8DC 4LLDB 3MGOA 5IW1B 3EIFA 4LASL 2MTPA 4JZJB 3THMH 4LDOB 1RK1A 5FM8A 1S9YA 2RGSA 1EFQA 5JIHA 1YDPB 1TPXC 2P5WE 5EC1B 5E8EB 5JA8B 1E4JA 3MJ9A 1MCIA 2DBLL 3JBG7 2IH3A 5IGXH 2IALA 4J4PD 1M71A 4WEMB 4YXLH 4L8SC 1UJ3B 4U0RC 4GKNB 3BH9A 2WWMC 1T80A 1KBGL 3Q1SL 3BPOB 3CDGA 4MZ2A 1FDLH 4YK4C 4M43L 3VFWB 5I1EH 4O2FB 3GUTB 4Z6AT 4TUKH 2I5YH 4ZNEE 1PX4A 3MACH 3CAFA 3GNMH 2YMXH 3LN5B 2P1YA 5BW7C 5MERB 3F8UB 5I0ZA 3TH2T 1VGKB 4KJYB 4WEUD 5BS0D 2Z4QA 4D0DB 5C0BA 4OZGF 5EU6E 1WBZA 4P23A 4GXUM 5SX4H 4Z5RB 3SDCB 1HYRC 5DA0B 1ZLUK 4ZDHA 4PV8B 1I1YB 5EOTA 4I0CC 4PBXA 2PYEB 4XP1H 2VLMD 4BSVB 5DT1L 3C5JB 1KIQA 2QADC 5IMLA 5C0CB 3V52L 3NH7L 4MAUL 2ENSA 5CP7B 4WUUA 3EGSA 3U7WH 3A0OA 5CKGA 5BZDA 2XNAB 1T66D 2ICWJ 2J4WH 5F7NC 1NCBH 2DMCA 3Q6FA 4DOHE 2R56H 4JFZL 5F7MC 2AEWA 4NKIL 4TTDD 3O3DB 4PB9H