4KTGA

Crystal structure of double-helical ggc-repetitive rna 19mer complexed with rss p19
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
121
Chain Sequence
MTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA silencing suppressor p19
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
total genus 36
structure length 121
sequence length 124
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ktgA01
4JK0D 1RPUA 4J39A 4JNXA 4KQ0A 4J5VA 4JGNA 4KNQA 4KTGA 1R9FA
chains in the Genus database with same CATH superfamily
4YSSA 1A2YA 1A7PL 4E36A 1JYVA 2IWEA 1J1OL 2WUBL 3VX0A 2ZOTA 5K59F 2Y72A 2QQLL 3D85B 2LFGA 1AGDA 3BUYA 3OAZH 5T8IA 4Y4HA 3CHQA 1J18A 1ZTMA 5C0AE 3UX9B 5JO5A 1FNHA 1XGTB 1TEGA 1EWHA 4HWUA 2ERJC 5D2NC 4LLYB 4EN2A 1WFMA 2HTLC 4HC1L 3RTQC 4Z5RB 2B14A 3LN5A 1SBSL 4G8GD 1KTCA 3F00A 1SM3L 3MLZH 4XMPL 1U4EA 3VXPA 3IMBA 1IM3A 2N7SA 1IBDA 3V5DB 4I48A 3VFVA 2XN0A 4YBQD 1U8LB 2V3EA 1CFMA 1SYSB 4F58H 2IGFH 4FG6C 5IHHA 1DJIA 5C9JB 4X6DF 1TETH 3RNQA 5ACLA 5JHMA 1BDYA 4KJQC 1M6OA 4XNAA 1U93B 2O72A 1Z9MA 4NQSA 1PGRB 1AD9B 2WBJD 3QUMA 3L4ZA 4LK4A 3VYNA 2FGWL 3DGDA 2HN7B 5G4NA 1BYPA 2PLTA 3C08H 5CCGE 4PRIB 4CVXB 3BISA 4AJWA 4Y1TA 1TJGL 5ESAB 2Q2LA 4GMSH 4I3RL 3UP6A 3BRFA 3VDCA 5FDWB 1TOXA 1LO0L 3B2VH 3VDAA 5AVYB 3QI9D 1MNUL 2RH0A 5F1KC 4F57L 3IXAB 5KTEH 3HR5B 2IANA 4O2EA 4UMGA 2F68X 3I75A 2ALWA 3O6LL 3U9UA 4DVBA 4UB0L 2ZWZA 3FH5A 1HAWA 2QQKL 3LPOA 4F7MB 5DMJB 3MX0A 1ZLUK 2NYYD 3V52L 2XRAL 3NGBB 1D5BB 1Y6MR 2Y7QB 2PYED 5CN1A 4AQ1C 4HAFA 4W1TA 3SODB 2Z34A 4HMCA 3GGWB 3KYKL 1IL1B 1XQ4A 3QR0A 2FEEI 1PY9A 4B9FA 2CRYA 3MRGB 1IKNC 4P9HL 4WV1A 4DP0X 1W0WB 4LCWA 1I9JH 2Z35A 4PJ7F 2CLVA 1P69B 3DECA 1JNLL 3IGKA 1BZDA 1TEFA 2XG5B 2KQMA 3O3BA 4WFEE 4K07A 5HYSB 2H6OA 2DJUA 1AR2A 5GGQL 3BXNA 1LE9A 3R0MA 3H9HB 2R56H 3LNHA 1IAIL 1EAPA 2MQ0A 4M5ZL 3OX8B 3PL6B 1T7YA 5D93B 1DO6A 4PCSA 2A9ML 4D0CA 4D3CH 3QEUB 4G8EB 4ZMTA 3QO1A 4B3EA 4IKLA 4MJIB 3O0RH 3TIDB 2QGCA 1OAXH 4TSCH 1GZPB 3W57A 1T3FA 1JK8A 4PJ5B 5F6HI 4JHBA 3ARWA 3L16A 4UV4L 3K6OA 3X1GA 4LOUC 3UGUA 5C0DA 1O9ZA 1B4LA 4MNQE 1WYJA 3GBDA 4UQIM 2D2OA 4HP5A 1UZ8A 1U3HB 4NN5C 1YPZB 4FKKA 4E9VA 1JPFA 1OGTA 2ZSWB 1J0HA 4ZMOA 1U91B 1YMHA 3CVDA 3OKLA 2FIKB 3ZKXC 2B5IC 4ANUA 1SEBA 3K6SB 5C07A 4RMSA 3VSTA 4MZ3A 3LVEA 5C0AD 1ASQA 2AXJA 2BSBA 4OF5A 4ODVL 1O7DE 2IADA 4WO4B 4WK4B 3BLPX 4A55A 4Z7WB 2K1MA 4OM1L 5I74B 1CL7H 4TOYH 1F2QA 3Q8EA 2LU5A 1UM4L 4R0LA 2XVLA 4N6RB 3CBKB 4HPOL 1FE8H 2Z8RA 4K7PH 3EHBC 5IQOA 3HW7A 2XA3A 4JHUA 3DSNB 2BRRL 3L7FB 4E5XB 3WEBA 3BPOC 4WI0B 2HAZA 2HRLA 5LGJB 1D5IL 1KCBA 2ZG3A 1U8CA 1ZA3B 5DO2D 1RJZB 1W72A 1ZT7A 5EBMA 4OTXH 5DDHA 5D7IA 1TTFA 1W6WA 2TSAA 2BNQB 1KLGA 3RGVB 5IHUL 4PG2A 3FRUB 1EJ8A 1FYTB 4KAQH 1RK7A 1KBPA 5I17B 5KYWB 5D1QE 3UTOA 2QSVA 4AH2B 1MOEA 4BXSV 5C0ND 1HH9A 1T0OA 3PDOA 4U1NB 3HMXH 5J11B 2CQVA 2Y7OA 3ULUE 2K8MA 1DFBH 4LVNC 1RIVL 4PUBH 3MLSH 4YHLH 1E8WA 5DUPL 1V27A 1A14H 3BEWA 5TDNA 5DEFB 2ZSVB 3HE7B 1PG7X 5D7SH 5A6LA 3Q8BA 1JTPA 3O3EA 4ETQA 1XL4A 2RHEA 3T04D 4IRSC 4ERSH 1QQDA 1UM6H 2P45B 5BOPA 3H8NA 3Q7JA 4A2FA 4HWBH 4YSEA 3KGTA 5ICZA 2QADD 3EJYC 2Z3FA 2AK1H 4HPHA 2DPKA 3P3TA 3ARBA 2ATPA 4N26A 3WS3B 1Y0LA 3VAEA 1J1PL 4APQB 4LCCB 4AIEA 4WFED 1KUMA 2XDHA 1CLZH 2YD1A 5MEOB 3BKYH 1PLGH 5EOCL 5MEPA 3IMSA 2K70A 3B43A 3HI1B 2KZ1B 5C3TA 3R8BB 4JX0A 3NJGA 5CJ8A 1NAKL 3ILPA 1AGBB 2V17H 2BNUB 2CBQA 3B8SA 1IBBA 1UCBL 4HJJL 4Y5VB 4J3XA 3VFGL 2OTUA 4Z3HA 5A2KH 2BP0B 4MSWA 3QCTH 4MNQD 1RZ7H 1RIUL 4AW7A 3KR3L 2OSXA 3BRDA 4M7LL 5KVFH 1EEYB 4JZJC 3IXTA 2ZKWA 1RUQH 2FSDA 3L5IA 2JQMA 4RFNC 1I7TA 3SGJA 2W95A 4GRWF 1G1YA 4R96A 5G4OA 1FVCA 3RJQB 3VD5A 5GIRB 1NKRA 3FSZA 3IJYB 3HG5A 2YR3A 3TBSB 1XCQA 5ADPH 4YC2B 1HOEA 3RWGA 3TN0A 4Y8AA 4CC4C 1Z9PA 2RQ8A 2VUYA 1MCNA 2F6AA 1XR9B 4Y16C 4PWKA 3VMPA 3SQBA 3T8MA 1TMCB 3D4CA 3LD8C 4UILH 4NI6A 3BQUB 3H7LA 4MQ7B 4UTCA 4YHPA 1JGUL 2UZPA 1YEJH 4N2LA 2AEIT 1AZBA 3WJLA 3WMSA 1MPAH 4X99B 4XP1L 3VRLE 3WSQH 2EIBA 5D1XE 1CICC 4NRXA 4EI6A 4AY0A 2VW4A 4WUUB 1KXTB 3U25A 4ONGL 5IV2B 4PJ9A 3CD4A 5ACZA 4XGZB 4ZAKA 1NBYA 5AL0A 4XN8A 4NERA 3ZE0E 5IFAL 5TE4H 5IUSA 1P1VA 4G2AA 5B3JF 2PTVA 2VTFA 1O6SB 2Y5TA 1UD8A 3C6LA 1ZGLP 5HJGA 3L4UA 2D3LA 4L4VE 4WTWA 4FLOA 2FJGB 1F18A 4KKBC 3RWEA 5TDPB 1USQA 4XVSH 3QNXA 3O6MH 4ODTH 1KNOA 3A24A 3DO4A 5D1QD 3TA3A 4JRXB 3QFJE 1EO5A 4GS7C 3TBWB 3LRLA 3MNDA 5AWNH 2V2TA 4RCAA 5I66A 3A23A 1ZJAA 4L23A 2DM2A 4LPYA 5CLXA 2ADGA 4GAGH 3ULUD 3SDDD 3GKWL 4F9LC 3B2MA 2WIIB 3QUGA 4HIEA 4X6EB 3RVUD 4UTBA 1JP5A 1JWMB 4JFYA 3MBWB 2X7LA 4D2NA 3RQ3A 4KH9A 4Q7DA 3VFMB 1K4DB 4IBSA 1HHIA 1MVUA 4JDEB 4OZGA 4QHKI 2MHAB 1BBJA 2HKHH 2JH2A 1NLBH 2M26A 1TO4A 2P1YA 4B27A 5AKVA 2IALB 1KSRA 2AAVA 2ZYIA 5FW7A 2W81C 1MFDH 1EAQA 4KTYA 5E5LA 1BEXA 1G6VK 3CJJA 4LCYB 3SYOA 1MSPA 3TCLB 4G6KH 3ISWA 1P84K 3QZPA 4HU2A 4L8DB 1XBDA 3UO1L 3SKMA 1G9ML 2UZXB 1QUPA 5JR1L 2GK2A 2Q20A 3EUUA 4ORGB 4JFQB 4RFEA 5D71L 3FSAA 1HQ4A 1ZRUA 2HFFA 2IDCA 2NY5C 4JFUA 1R47A 3RDTA 3L5XL 3GNMH 1I1FB 3GSNH 2XTLA 4M4RA 4PRNB 2FEDD 2E9BA 3ZIYA 2JCCB 3HCVA 3SYPA 3WEOA 3MNVA 3V6FA 3VSUA 2YS4A 2JI1A 1H3PL 3T2OA 8FABB 1OXYA 3G6JB 5I0ZA 2HH0H 4JG0L 1FSKB 1I85A 5T1LA 4IRJC 3RHWK 1YUHA 1IGYB 5DGQA 3IFNH 3T6ZA 3E8UH 4GKZB 1TKWB 3CXHK 4LLDB 1RQ5A 1JV5A 4Q6IB 2HT3C 2X6AA 5CJQH 4DKTA 2C3GA 1BEYL 2HRPL 3APMA 4W9KC 5K33A 5IVXB 2CLRB 4PJAF 1VGEL 1SNRA 4Q8BA 1UOWA 1WCBA 3KE0A 3ARRA 3CZEA 5IJDC 3OHXA 1YNLL 5FM4A 2EDOA 3MV11 1W80A 3HG1E 4X6DE 2XXMB 4R4FL 2PO6C 3NJLA 4QY8B 4ODWA 4P04A 4RSVA 3RGHA 3NIFE 5D1XD 4PWHA 3J27A 4M7JH 4I18A 2G5BA 4WVRA 1BX2B 3QUZD 2QHRL 1XIWA 5DEGA 2BSRB 3WAJA 4LPTA 3CPLB 5FO8A 4XNXL 1FL5A 3SDXF 4KZDL 2KH2B 3N44F 5I0WA 4JHAH 2XG4B 1YEIL 2W1NA 4ZUWB 1JHKL 3CHOA 4TLUA 5SWSE 4NN7B 3KGSA 4ZX4A 25C8H 3VWKD 4OLYL 2X6CA 4IKIA 1E4WH 4L4VD 1F4YH 1T21B 2AXFB 5B3NA 4MAZA 4XC1L 4JFVA 2W80C 5HGAA 3SGKC 2R4RH 1ZS8B 2X2UA 4CNIB 2A9BA 4X6FB 4JL2A 3DI2B 4HKBB 1I7UB 1LEIA 4YIQA 2BINA 4NQEA 4NFDA 1MF2L 4G1MA 3WNOA 1UJ3C 5A16B 4AZ8B 1A7NH 4UINH 4FQPA 1TYRA 4K3DL 4MHHG 1E67A 4XVTH 4JO8A 3K8KA 1INQB 3FYEB 3MFGB 2AQQA 3P30L 4AVJA 5CD3B 1FHNA 4WWKA 1U36A 1UWGH 5BV7L 3MNZA 4PJ7E 4BM7A 2BSSA 2QKIA 2F54E 4QHMA 3DYOA 4UV7L 5AYQA 3KWWA 2XPGB 3RFZA 5I1AA 1AXTL 5EFIB 2YGNA 5MI0B 2A99A 1LO4H 2QPEB 3VFUB 3DRTB 5J3HD 3I02B 3ET9F 4XCCH 3LMJL 1SLVA 3O6FB 1SVZA 5E99H 5E8DL 5E94A 3FTGA 4IBLT 3O8XB 3QPXL 3MRDB 5SV4A 4P46D 4PG9A 1L5GA 1KJ2A 2UY6B 1OE1A 1KEGH 1OW0A 1BFSA 3PP4H 2J5LC 1DQIA 3N1PC 3E8VA 3SO3B 5GS0L 5IEHA 4DVRH 5E2UH 2NXZB 3ZE1B 1WWAX 3TFKC 1KIQB 4S1DD 4BINA 1EX0A 4CRPA 5D1ZA 5HVFB 4L29A 2XZQH 5GHWH 1D5ZB 2A77H 4N8CH 3F01A 5CU9A 3FSOA 4OCNC 3HZKB 2J71A 3V5KA 1NWPA 4NJ9L 3AGVA 1HWHB 1J8KA 2Y2TA 5CJBA 2EE9A 3PWUB 2YJQA 4MVBD 1A9BA 1KB5B 2ZXDA 3BI9X 2FLBT 5A7BA 2YMXL 2HA1A 4GW5B 4HK3J 2VLLA 1S7RB 5T3XE 1QSVA 1RMFH 5E1HB 3NJNA 1T1XA 4ZW7A 3WDJA 1R3JB 3HG1D 4AXWA 1XB8A 5IR1B 4Z0XB 4MASA 2V9QA 4FTVA 1Z5HA 1WT5A 2VR8A 4PLJC 3ETBJ 2X4OB 3G9AB 3GMMA 2WXPA 2VR7A 4G11A 5EU5A 1OCWH 3RFRA 2A1WH 3ARVA 2WXHA 1VCBC 4G6JL 1MRCL 2J88H 1KDJA 4DTGH 4DGYL 1PL3A 4A38A 1AR1B 2BIOA 3IMVA 3T8VA 4Y5YB 1OP5K 1D7BA 3ALPA 2EH8H 5ECGA 3U1QA 1BVNT 1J0IA 2Z8VC 1AP2A 4RGNE 3OXRB 5C09B 3MRKB 3QISA 5SWSD 2A6JA 2JV6A 2KDGA 4A66A 1Z5LB 5T3ZL 2COQA 4AIZB 1SY6L 1VPOH 1BAFH 2BW5A 5BMFH 3U6RB 2QR0A 3NESA 1PQZB 1FNEA 3KXFB 4TUOB 4FE9A 4WI6A 5CSGA 4JM2A 5KJRL 5KBKA 3UJIL 4ZYKB 1CXFA 2YUVA 4LMQE 1HCVA 4YSPA 1YY9D 1HILA 4K94C 3P1VA 4WTZA 4DJMA 4U1JA 4EIBA 3FQUB 4PRDB 4BCXA 5JA9A 3QDJA 4GIAA 2QFRA 2W0PA 3DURB 5BO1L 2KPWA 4JHZA 3I9AA 2F54D 4X5QA 5KSUB 1W91A 1BLNB 3TU6A 4FQHA 5DJZA 3KPMA 4DP4X 3C6EA 4A7GA 3H9SE 4G8FA 3IEAA 1QNZL 3QT2A 4PSRA 5TD4A 3M86A 4NQDB 4ONHA 2E8ZA 3GJFH 3UBXB 2VO8A 3L1FA 2XZAH 4Y4FD 2ZKMX 1CK0H 2AI0H 4HWEH 3SBRA 3UIZA 1XO8A 2G9HA 2UUDH 1TZGL 2GVYA 2CR0A 4H1LG 1CB4A 2YEQA 3B3BA 5LN4A 5CINH 4G43B 1RI8A 3WKYA 5I1CL 1LD9A 2H1XA 4OFDA 3HN5A 1QBMH 4GRWE 5DGRA 3UOAB 4TKWA 5TE6H 5D70L 2OMUA 3WFHA 1M05B 1N0XH 5M95B 1XF4B 1U8IB 2RTTA 2C3XA 4X8JB 3IDNB 4GSUA 1E8ZA 2KDYA 3L5WA 1S5IL 3S3BB 4QRQA 3QRGH 2VGLM 3VXUE 4N8UA 1IAKB 3MGAA 2DJ4A 4PJ8D 1BZEA 4XNQB 3QUML 4I88A 3MU3A 4FQJH 2FJHB 4UT6L 2G9KA 3MV8A 5I71C 3AS2A 4XNMA 5T3XD 5F96L 3S8FB 1MHEB 1R5VA 2DMKA 3JUYA 3QEHB 5MP6L 4ZOCA 1SZNA 3QWRA 4QHNA 4DPBX 1MJJA 3LKRA 1NGXA 3S4SG 1U95B 4NGHH 5JPNC 4S1QL 1WISA 1VENA 4RGOH 5CGYD 4MZIA 2ITDB 4GY4A 2ZOKA 4N1EA 4V11A 2AJYH 4WGWB 1A0QL 2ITFA 2Y1VA 2F15A 2R0KL 2DQMA 4Q9RL 5C0GA 2HPOA 3VFRA 4X42A 4RGND 3R18A 4OUUB 3FU9A 4TRPL 2DQGL 4UTAA 5AW3B 5GRJH 3EOTH 5HYJA 3DA0A 3FT3A 4HIHB 1EIBA 2ZAHA 5IVZB 3QSKB 1U30A 2BWDA 1XF2A 1CXHA 3ZPDA 3L6FB 3VRIA 1CTMA 2CNYA 4HH9A 3RWJA 3ZL4H 2NUTB 2QT6A 2CE6A 1K8DA 3DIVA 4J3SA 3VJ6A 5IEKA 3STZB 3E3QE 3MXWH 4JZNB 4OJFL 5ESVA 4Z7UB 5FK9A 3UIYA 4F33B 1Q38A 4K71B 3BUPA 4LSQH 1C5BH 2WWMD 3U0WH 5BUGA 4UDUB 3ARSA 1GL4B 2BO0A 2OMTA 2H45A 1QO3B 4XOAA 2CXKA 2DEYX 3TT3H 3EFDH 3MRHB 4NAMA 1AKJD 4AT6A 5KS9F 3GSOB 3VD3A 1OGAE 3HZVA 1L0QA 4J2XA 3BKJH 3DXAE 1V05A 2C1PB 3IWVA 4H2CA 3S9DB 1U8NA 1ZLDA 1ZVHA 3LEXB 2R2CA 4LDLB 3O9WC 3N2JA 3F7YA 1F3DH 4KKLC 4XOEA 1QFWH 3K4AA 3NA4A 1LO2H 1QTYT 5AYUL 2Z0UA 3H9SD 5EZIL 2GIMA 3H42L 4P3CL 1ZGLB 1BQKA 1W16A 1FPTH 4X7DC 1CU4H 1INEL 1BD2E 1GS7A 1MAMH 1JK9A 1WAAA 1KJMB 3GXNA 1FCGA 4XXCA 4X6CB 2RBLA 3SDCD 1NUFA 1FG9C 4LF3A 1ZHKA 3P0VL 4TVUA 5I1JH 3OJDB 1DE4B 3ZSSA 3A6CH 4XPTL 2OP4H 4PJDA 5EBWB 2NQCA 4TTDD 2IMNA 3QIWA 4WENB 2HCZX 4TXVB 4HGMA 4DHLA 1KTLA 1ZA6B 4HDIA 2NPLX 4A6YA 4CU8A 2F19L 3LPFA 4PJFB 4XXDB 1YN7A 2VE6A 4JLRA 5DMYA 4PJAE 3VTTA 2VRAA 2VDKL 2H6PB 3N50A 3CFEB 5FYKU 2CHWA 3ZUCA 4A2EA 3NQIA 1OAKH 1HU8A 3VXUD 4GAAA 1MI5A 1ZY9A 5F7UA 3EOBB 1LP9B 3CFDA 3F65A 2JJTC 3BH4A 1SRDA 1W72L 1LK2B 5FYKL 1CDBA 1SHMA 3QIBB 4DO5A 1JPST 2YPKA 3WHE0 2NX5A 1UT1A 4ELMF 1OV8A 1U92B 2GABA 1YG9A 5ELIA 4WY7L 2NXYD 4OFIA 1MREH 2AITA 3U9PL 3T65A 3SDXE 3BFWA 3IJ7A 15C8L 4JN2B 5KS9B 1K6QL 4QRFA 5BO0D 3WN6A 3US1A 3GSWB 4NZJA 2QVTA 4GUPA 4I0PD 3VI4A 1A7QH 2W9EL 4M1CD 4MD4A 1QFWI 4GXVL 1FFQA 3OPUA 4KO5A 4EN3D 2XFGB 1E7VA 1XR8A 4PJBA 4BCYA 1YO4A 4P5MA 3T3PB 1PEZA 5GJTH 2Z8WC 5E2JA 4X98A 1AE6L 4R8WL 4RMWA 2X70B 5I5MA 1S6NA 2XX0A 4JG5A 3TJEH 1LDSA 1WV7T 1EBAA 4HIQA 1KCWA 5C0RH 3SIKA 1YMME 5GRWA 3RWHB 3RX9A 5AAMC 5I1KL 5CP7B 3WGUB 5HYSG 3V0JA 3FB8B 2WLLA 4DCQA 2IQAB 3RWIB 4JS7A 4QCIB 4DWHA 4DN4H 1JXJA 4Z95L 4Z7VA 3GK8H 2OL3H 3UMTA 3D0LB 4YDJA 3VB9A 3QJFA 4PVBA 2M2DA 4EBQH 1X5FA 2CH8A 4HALA 1ORQA 4RFOL 1OGAD 5B39B 1IM9D 5JIDA 4XOCA 3DXAD 2G2RA 2WYIA 3S36H 2Z31D 1FAIH 5DHYB 5CMAB 3PQYB 3O6KL 1DSFL 4QRRE 3NIGF 2DQIH 2WCGA 5H94A 4E9TA 1G1KA 3LXCA 3GXUB 4HGKC 3D1MC 4BJLA 5FV2A 4TTGA 1ZVNA 5KJ7E 4JMXA 4IHOB 4KK6D 1BD2D 3L9YA 4P2OB 1D9KA 5GRZA 5C0EB 2X6VA 3ILDA 4TSAH 4YSUA 1RULH 4ZMXA 3WDHA 2J1ZA 5CBAB 4HJ0D 1MKFA 3R06B 3SY0A 2CGYA 2C9AA 2GTZA 2CO6A 2YWYA 1H15A 2Y5QA 3GRBA 3QAZC 1IIIA 3MLXH 4GXFA 5TF0A 2AW2A 3N1GC 4Q74A 2J1KA 2ATAA 1WK0A 1MG3C 5EPMA 2X4TA 4MVBC 1CFNB 1YEHL 3GIZH 3M07A 4DZBB 5LQBL 4KHXH 2WZPD 1NC2D 1A4JB 4WHDA 5I9QB 3HS8A 5E8PB 4YXKL 5JOPE 4XWOD 3UEQA 4E5XG 2BIHA 5L88L 5C08E 4TNWK 4F8NA 4NO2B 3C5ZC 5E8NA 1EGJH 5HY9B 4P5KA 2PCYA 2FWSA 4H2AA 1HZHL 2W9DL 3LIZA 3KW8A 1FZKB 4IBVA 2NNAA 2VXQH 4H40A 2E76C 3HZMB 3TIEB 1KEMH 1BECA 3X13B 4ZTPH 4G42B 1BCIA 2VIRB 3B9KD 4XE5B 1MHCB 1OL0A 4BWUA 3M1OA 5E7BA 3TASA 4ENZA 5BPPA 1RK0A 2WB1A 4U4BA 4H88L 3PWVB 4EXKA 4RBPK 5K9JH 4KQ4L 4M43H 1JZ3A 3CCHB 3DSFL 1TLMA 2RACA 5HD8C 1NDMB 3WIHA 4AYEC 4ZSOA 2B15A 3JBG7 3KPQA 3EXJA 3IJEA 4UTBL 3U9WA 3GXDA 2HX8A 1MY7A 3GMPA 1WIOA 4IHBA 3RA7L 3GXMA 3N1QC 3W82A 5E4OA 4ZFZB 1NOFA 4HKXB 2E6JA 3BP4B 3RRQA 3ZZLA 4R2GC 1EFQA 3EFFA 5DVOA 3KWTA 4V33A 1YMMD 3WN5C 1NUDA 2GFBB 2DLHA 2CJSA 2WVVA 5HVWA 4HS3B 5DFWH 4PJCF 1TTRA 4M8VA 3J8F7 3VXTA 5D2LA 1AMYA 5CBEB 2HJKA 3DV6A 4FKEA 1S8DB 4O51B 2VITB 4NIYE 4NT6A 4ZS6C 2ESVA 2H2SC 3EH2A 2ZXBA 4QUOA 3O2DA 1I1AD 1UURA 3ZIMA 3WIFA 4TUJB 1O7SA 2OJEA 5ALBH 4YDLC 3GMRB 4IOIB 1TVHB 2ZZUT 2YK1H 1IO4C 4QRRD 4I2XB 1T2QH 1ROWA 2C4FU 3GSXA 4JL1A 4QPEA 5ISZE 1WWWX 2VDNH 5BZXA 3BESR 4L0ZA 4C4KO 3PHOA 3VCLA 3ARDD 1S5HB 5AZUA 4FP8L 3BW9A 4IDJL 2BVQA 5I6PA 2WTPA 3A6BH 5AW8B 1E8XA 35C8H 1GCYA 2J7LA 4G5ZL 5JHAA 3MUZ1 2FX7H 3KPOA 4OLXH 4QRSA 1REIA 1ZK5A 3BAEH 2WXGA 5SX4H 3TC9A 5KBPA 3RY6A 5EWIH 5CLYA 5SX5K 1OOWA 3HRZB 1IAMA 4X8CA 3UH8A 3UZVA 4ZTOH 5CEZL 2LFEA 3N41F 3HC3L 1DQJB 2O61A 1INDL 1RZKH 1QWNA 5J1AB 5JOPD 1EFXA 4GMTL 5DYOA 3TWCH 5C08D 1HN1A 5B1BB 4JPVL 1D3CA 1XGPB 1YYCA 1T6BX 2ENSA 2VLRA 1O9WA 4PJIF 5PCYA 4JO4L 4WSJA 4F80A 2VMEA 4JY5H 4R83A 1VF5C 3TBYA 1RZIB 1JZHA 2BSTA 4MX7B 1CBVL 5C86A 3E6HA 2XTJB 3KM2A 5EOTA 4BV1A 2ZXWB 1HKLH 4MNHB 2G3ZA 4KJPD 2EKJA 1N64H 4X9BA 1S78C 4OUOA 5DI8A 4FZEH 1OAYH 2ZCHL 3QQ3B 4NUGH 1F4WL 1NCBH 4R3SA 4XWGH 2R69A 1UD4A 4KFMA 1BA9A 2NY6D 4HUKB 5CGTA 2B59B 3NAAH 5DRZA 4WK0B 3E0GA 1SUJA 1MFCH 4F8PA 1KCUL 5JXAH 5DLLA 3S34L 3U2SA 4GUQA 2HLEB 5DJAA 4OCRH 1MJ7L 1QA9A 2HMID 1FH2A 1BQLH 4JM4H 4Y8DC 5TQ0H 2FAUA 4M1GL 1CFSB 5D2NA 3D18A 4PQXA 2VQ1A 5EZLB 1ADQA 5LKNA 3C12A 3DROB 6CGTA 4PIRF 5AZ2H 1YA5A 5B8CB 2C3HA 1SQ2N 5CM1A 4MJHA 5CZVL 5KYYB 3A4DA 3ERXA 4U1MA 1JV2B 3MMEB 3ASNB 4GKOA 1NUGA 2B0SL 5AKRA 5SX4I 3BDBA 2YKLL 4LOFA 4Q9BA 4K2UL 2EUVA 3KMDA 1FCCA 1ANUA 4Y19B 1T7VA 4DP8X 5EZJB 1AD0B 1BMZA 4AL8H 1U8OB 1KJ2L 5HHQA 1DZBA 1A21A 2YBRB 2I27N 2R9HD 3EH1A 4GI8A 3SE3C 4AEEA 5DJ2B 3W3BA 1LO3H 4TULL 5EOCJ 5D8JH 4EVNB 1WITA 1UD2A 2IDSA 4IMKC 2GY5A 5DTFA 2OR9H 2IEPA 1D5MA 4LLAA 4HS6A 3KJ6H 5ITFA 5H37G 5K1NA 5ISZD 2F7RA 2CKBA 2QZ5A 1QLFB 3FO1B 3OB0K 4H25B 4CC0A 4IKKA 1GC1C 2XA8H 2YN3A 2YSSB 1R3KB 3V0WL 4WNQB 3ZRCC 2VLJA 2OTWB 4HUNB 4E0RB 2HJLB 1P5VB 1KC5L 4I13B 3T2QA 1U8KB 2XWDA 2IMMA 5B1CA 1NCAL 5BVPL 3L3OC 1K5WA 1PNDA 4XCFH 4K8RL 5DLML 4N4YB 5F7EL 3CTTA 5AB9A 2DZEA 2HZHA 1EAJA 3MRCB 1EZVY 1IC5L 1OARH 4MA3B 4U0RB 2ZXGA 4WHCA 1M7XA 1WG3A 4P4RA 3MJ8B 3ZZ1A 3FF8A 3D4ZA 4JN1L 3VD2A 4QEGA 3KYNB 4EI5D 3FXIC 1BV8A 1GKOA 3QAQA 5DS8A 2XWTB 4DN3L 2BH0A 1AQ8A 3Q05A 3IKCB 4HX1B 2Y22A 2KT6A 2Y1AA 4AEHH 5J5EA 4LEEA 1U58B 2DLGA 1XXDC 1BM3L 4UQCA 1HZKA 3SDYH 1KJVA 4M6ML 2OMYB 3B7UX 4ELME 4LNRA 4QF1A 5C8JB 1IGIH 3H0TB 5DJYB 1NL0L 3GXIA 4JFWA 3RTQB 1AXIB 4NBXB 1TO5A 2RR3A 1H5BA 3WD5H 2P43B 1ZLWK 4FNQA 5JORB 2J57A 4YAQB 4AEIH 4P4KC 5DZNA 1SXBA 3FQNA 4P2QA 1DVYA 2AMGA 4XMKL 4GRMB 5IESH 3ZKND 4G6ML 1KXVA 4DK3A 1NPUA 3T9WA 4FLQA 4K23L 5D7JA 4A7VA 2PCFB 1AG6A 1CVSC 1S9XA 3QORA 1NBVL 4Z8FL 3VD0A 4KMLB 5I5JA 3GKZA 4FERA 4NSKA 3D2UB 1BBDH 1V5JA 4LASH 4MD5B 4MS8C 2QVKA 4XCYB 4B5EA 2GJPA 3AWEA 1DQVA 2W94A 4PU2A 2C7UB 1I8MA 5BVJA 4P8QA 4LARL 5KUMA 1DQQB 4TQEL 1N67A 4PV9B 3L3JA 3P3SA 1OSYA 2DDQL 4OGYL 5I6XC 3P9LB 1FORH 2G60L 4GXUM 3H9ZA 1QSZA 4UIMA 4ZFOA 1Y6NR 3LQZB 4CILA 4KKPA 3MROB 2BPBA 4LSRL 2FNWA 1E30A 3Q6GL 4ODSL 4K4KA 2Y6TE 1PZDA 1N59B 3UTPE 2AJZA 3VE0B 3G5ZB 1SBBA 1PEWA 2PW1A 4XMTA 3JYCA 4NKDA 3PCYA 4OLUH 1B0RB 5HSFA 3ABMB 5CSBA 3EJRA 4K9EH 3TFBA 3HMWL 5D9SA 5EUOB 2X1PA 4AEFA 1E90A 3TO4D 1KCRH 1QFWM 4KWUA 2APSA 2VXUL 1M2VA 5L2KE 3L95A 4BFOA 2IXQA 1KXQA 1VEOA 4XPHL 3DX7B 5F7FA 1QSFE 3X14B 1VADA 4X4YB 4QHUB 2AP2A 5DQDL 4DPAX 4GSDL 1SUHA 3QG6B 4Y1AA 3ZR6A 1QPKA 4QYOA 3V4PA 4BQ8A 2DM4A 3ULVL 2FE0A 2CGRL 3VXSE 3QQNA 1BQHB 2R2BB 4HIXL 1PBYA 3VUAA 1H0DB 4H8UA 3O41A 5GGVL 3HTLX 2VL4A 3BD3A 3G08B 3NACH 2PPFA 1KLUB 4HBQA 1FFOB 2GTWB 4Y2DD 2X4PA 3TESA 5LG6A 1RSYA 1RVFL 3EGXA 4KGLA 3NJVA 3HFMH 2ISDA 2VN3A 4B95C 2DWYA 4IRSA 3MV9A 2WYTA 1FNGA 4LLQA 1I53A 2Y4SA 1A65A 3LKOA 4OI9A 1WFNA 4J3BA 3JQOB 1IU1A 1OVZA 4NKOA 3DMMC 4OZHB 5LBVA 5CIPA 3SGEH 3WLWD 3CFJB 4BH8B 4RWYL 2BHYA 1NCWL 4UNUA 4MJJA 3CN1A 1FO0H 3FUMA 3GMQA 2EDTA 3VDBA 3FB7B 4NPYA 1OALA 1TZIA 2X6MA 5EU3B 3FT9A 4FA6A 4N0UE 1N10A 5IZ7A 3Q9QA 1MEXH 5E1GA 1MIEH 5CR1A 3MYJB 5CZXC 5CLWA 1S7SB 2AQ2A 4UTAL 2E7HA 5EF2A 3LH2L 5ITBL 2YGOA 3UTTB 1OHQA 3FUKA 4HK3N 4A68A 2GY7B 2DQCL 2KL6A 2I32A 2OULB 4YBHA 3ZGHA 1IC0A 3EHBB 4NS0A 4WW2B 3OAZK 2ZWNA 3O4LE 2DQEH 4HU8A 2BVOA 2EUZA 3HC0A 3WFCH 2DLFL 1AGFB 4NM8H 5DHXB 4ZXBB 5E08H 2GI0A 5JUEL 1T7ZA 1D2OA 5KVDH 1MCLA 4X80H 1NCHA 3CHXA 1KLFB 1YUKB 3LN4B 5HGHB 1YQVL 1HC1A 3BAKA 4PJCE 5KVGL 2CO4A 3FYIB 3VH8A 4AVKA 2YPLA 3WNKA 4GFXA 1YJDL 3BE1H 1BZ9A 3AREC 2E27H 3H53A 4ODBD 2DQDH 1O0VA 2LHAA 4J4PA 3MACH 4JDTL 4E9XA 3SJVA 2AHIA 1A2YB 3UBXG 3WXWL 3X12A 1TT6A 4CN1A 1Z2KA 4WSKA 3TZVA 3NCJH 1DDTA 2F5AH 2IVFC 1RZFL 1XMWA 3BUYB 5C97A 3DIFA 2OJ1A 3II2A 3QIUB 4Y4HB 3WMQA 3BAWA 1FH5L 2DH2A 3UTPD 3CDCA 3QUKB 3VXOA 1FF5A 1ICTA 3MRQB 1BQUA 1P4LB 5E1AA 4AOFA 4WWPA 1HE8A 1RZKC 3MBED 2P8PA 1F6FB 3HB3C 3QDMB 3LN5B 1BWMA 2K9FB 2KZWA 3F3HA 4XP9H 4K3JL 4YFLI 1OAZL 3ESUF 3RYMA 4QT5A 1HIMH 3VXPB 5L2KD 4A6YL 3VFVB 5JHDA 5FLUA 1QSFD 4UU9A 2IBGA 5GS1C 5CLTA 4QWWC 2KYIA 1A7RL 1I3RB 3A4AA 4AQZA 1HQRA 4GBXA 4PRBA 2GKIA 2QSQA 2DS4A 5I8CA 5IOPA 2QDVA 1EVUA 4IGBC 1NQBA 3VXSD 1XCWA 4NQSB 3DGGA 5IW1B 1TNMA 5AOIA 1OLZA 4B50A 5I1GL 4P3DA 3SKNB 2ZX8A 2BP8B 3RX8A 2PUQT 2CAKA 2IOMA 3DX4A 3AMLA 4W9FC 3R7RA 2AVFA 1J5OL 4MDJA 2ZICA 5DSCA 3B37A 4PJIE 5FO9A 3KPSB 2CRMA 3S7GA 3ESMA 5CWSA 3V0VB 2YGQA 2IANB 4O2EB 4LSPL 4WJ5B 4FTDA 4RFNB 3U2IA 5L9DH 3U9UB 4GIPD 4DVBB 1J8HE 2P5WA 1GGYA 2GCYB 3L4TA 1PY0A 2JQAA 3V7MA 4GAJL 4PH8A 4OIBA 1CE1L 2LU4A 1U8MA 1PX4A 3GO1L 2BM3A 1MCIA 4WRLA 5AW9B 5BNXD 2I60L 4Y5XC 4WFHE 3W5MA 5JQHC 4JGNA 4JY6B 4OLVL 3BH9A 4Y9EA 3LD8B 1B0WA 3GTNA 4IBYA 1T04B 2ODHA 4P2RE 3V4VH 2HMIC 2B3IA 3CVCA 5AVZB 2Y2YA 2E9GA 2VR5A 2IAMC 4WV1B 3O4LD 1QP1A 4MFHA 1GVIA 4FYQA 4MRCA 5KJ4A 4IRJA 4W9IC 2Z35B 5JMRA 3WY3A 4UAOC 4AL8C 3KLAA 4G8GA 2XWBB 4B9KC 5EU6E 1UVQA 3WFDH 4AQEA 3P77B 4BH7A 1LE9B 5IFJB 2XWJA 2X5PA 4PJHB 5FUOH 2Q8AH 1OK0A 1FZJB 1UJTA 1N5AA 4NQCE 1ODAA 1XH3B 3LNEA 4HOMA 4O58H 4D0CB 1T6WA 5FM5O 2CBPA 1RUKL 1GW6A 1S9YB 5E51A 5LBSH 3BKCL 4HOZA 4DOHE 1U33A 1R5WB 2CSPA 1A3LL 3VW3L 1FL3A 2WBJA 4KBPA 2NT1A 1T3FB 1TZ8A 3SCMD 4L37A 2KKQA 1TG8A 2P48B 3MLRH 1JHTA 4OD1H 2HVBA 3FU0A 2ZP0T 2VDML 3GEWB 3VVWA 1JPFB 5AW5B 2XIBA 3NYKA 5I0DA 2QLYA 5L7XL 1BVOA 5C07B 2CCWA 5DJCB 3VM7A 1E4KC 1WAPA 4D8OA 3U30B 4OB5L 3IJ9A 2IADB 3PYCA 1URZA 4PRHE 1MCPH 1RJCA 3L1OH 2EC9U 3WNJA 1AHWC 2QPDB 3CUPA 1WUNT 2DB8A 5CUSH 3NPSB 5A2IH 4MHHI 3TBTB 2ZCKH 4G9FB 4P23C 4R0LB 4FNUA 3IT8D 4C59B 4E2OA 1JGEA 2FLRT 1UYWL 1EA9C 2PYEA 1ZSDB 3BLKA 5F1IB 5DF0A 3GEFA 5FX3A 3ZYJA 5JXEC 5GGUA 1XAKA 1EO8L 4AM0A 1UJ3A 1T4KA 1QR1B 2IPUG 2OX5B 3FKUS 3W39A 5E9NA 1F97A 3TV3H 5KSAD 4NRYB 1TIUA 3MLTA 3K91A 3VGFA 5BS0E 1GJIA 1W72B 1ZT7B 3BIBX 5DDHB 1FRGH 5D7IB 5ABZA 2BCKB 3QG7H 3VG9C 1KB3A 3BSZH 3CVHB 5D4QA 4M8QA 2WSPA 3D9AL 5B7EA 2ZXQA 1SGKA 1S7QA 4R90H 3PV7A 5F9JA 5JA8B 1AZCA 5A43C 1TFHA 1YC8A 5H35A 1J8HD 3LN9A 5IB4A 4XX1G 3J07A 3LEVL 1HH9B 2OCFD 4JG9A 4MLIA 1G84A 3MOAH 3V0FA 3US9A 3WXVL 4JREC 3BCFA 1OANA 2WWKO 3KPNB 5EDSA 4XPFL 3WIHL 4CVUA 1ZHNA 1JSYA 4WFHD 3BEWB 1OTUC 1QYGH 2AQRA 4NC0B 4YVNA 2ROYA 3X2QB 4BFKA 5CAYB 4KITB 3G6DH 4AUJA 2VJ8A 3N40F 4KJWD 2ARJA 2V0AA 3BOVA 4KGJA 4P2RD 3S88L 4AI7A 1U6AH 5HI4C 4S0TD 4O2CB 2Z92B 1KZQA 3FFCB 3A22A 2WTOA 3L3DA 3ARBB 4MMZB 3JTBA 3VWJD 4G7VL 3GHPA 3HC2A 3ETBF 4IMLA 5EU6D 1CIUA 4JGMA 2F18A 2OJZH 1XL6A 2A6DA 3CZKA 1EHNA 2ZE0A 5CCKL 5FYLL 4NQCD 5MEPB 2ORBL 4YE4H 5B39G 1XTLA 3LCYA 3UBHA 4ZMPA 4PY7A 3MTRA 4H1LH 1KCKA 1AO7A 3Q2VA 4J8RA 4Y2NA 2DWEA 2G2PA 1CTNA 4JRYA 5I1HL 3EDJA 3OM3B 5DD3H 4PRIE 4UQEA 3U4BH 2OTUB 2FTAA 3JTTB 3V6ZA 4MSWB 4X4XB 1E5CA 4U6VL 3HMXA 4QR7A 1GOHA 1AXSA 2JXMB 3BUIA 4FXKC 1NKOA 1W0VB 3QC6X 1BPVA 3WFEH 1ZD6A 2B1AL 3BLBA 5E2TH 2F53B 3IXTB 4A7QA 2WLIA 3IK2A 1I7TB 2LU7A 1UFGA 3LRGA 4BRVA 2H4EA 4B97A 1FVCB 4NZUH 3PRZA 1OM9A 1UQSA 5IBUB 5BXFA 3PG2A 1JIBA 1HHJB 5FWRA 3TN0B 4BA8A 4HWBA 1BVLB 4XT1C 5A6MA 2VXVL 5C6TL 3SDAC 1KTDB 3U46A 5LXGL 1F3JA 3JVGA 3MV7E 2R39A 4UT7L 5GGTL 2ZD0A 1BZ7B 4WHYG 1EVTC 4J3OF 3KPRE 1ZVSA 3L3GA 5AW6B 2W9LA 5T1KD 1M2OA 3OLGA 4NRXB 1G5GA 4EI6B 5BRZB 5EC1B 3J7HA 3QJRB 3F6JA 3MA7A 3MCKA 2XQYK 1UA6H 1NDTA 3UP1A 2GPZA 5EU7E 3I85A 5DK0A 4F7EB 4H20L 4NHUB 5DRXB 5BS0D 3BEVA 5ANMB 4PVMA 2X10A 4QIRA 1OAUL 2H5UA 1A7OH 2UZIH 4KMTH 3NFSH 5E1QA 1JXKA 2AXHA 3RVVD 5ETUB 3FU7B 3TT1L 4YO0A 3QNXB 1J11A 3QULA 3MREA 2E7LA 5CEXA 1QATA 1T2JA 3N85L 4QYAA 1JF1A 1F56A 1SOXA 1WIPA 2OMVA 4XMVA 3V0DA 2ADGB 3QQ4A 3OKYA 4Z9KB 1JF5A 4NENA 5F6HJ 4XRCB 5DVLA 4MNQA 4HIEB 3FN3A 1L0XA 4YGVB 1NA8A 5KZCB 5AVUB 4B9GA 3NRQA 7TAAA 4J23A 4JFYB 1IILE 1DBMH 3AB0C 4FYTA 4AVIA 3QQDB 1QLRB 1HHIB 1MVUB 4OZGB 3WTSA 1KPUB 1BBJB 4HG4K 2VQTA 1ND0A 4U7KA 1ADQL 3TNMB 4J5VA 2R59A 3AVEA 1TZHA 2ZUUA 2WXLA 5I1EL 5TK2A 2M8XA 2V7NA 3VB8A 5T1MA 2FO4B 3II1A 2FZ3A 1UWXK 2VZ3A 3V7AE 1C5DB 4HV8B 3VFWA 4AQAB 1A3RH 3U0TA 1C1EH 4XZUB 4OGAD 1I7ZA 4ZPVB 3PGDB 4LHQB 1CFBA 4DGWC 3F7LA 3PAYA 3PWNA 4W81A 5EN2B 2JK5B 1FGVH 5IK3A 3FFDB 3CZGA 1FVEA 3IFOA 3MNWB 3BYYA 2E7BA 3LKQB 4RVBA 5I24A 1B88A 4PRID 1AI1H 2BERA 5IFHH 5JQ6H 2VL5B 1UWYA 2NZ9D 1DQTA 1E0OB 1UB5A 2QSCH 4LCWE 3MJ6A 1FYTE 4QHPA 1EJOL 5BZWB 1X7TA 1NMBL 2YMTA 4FG4A 1FJ1A 5JQIB 1RHHA 4JJHA 5HJDA 3SZ6A 4L48A 3AG4B 4H8HA 3H3PL 3LZFH 3QRLA 1BSIA 3UJJL 4F3FB 1TSRA 1JV5B 3H9YA 4GQPH 4K5MA 4CN4A 1E4XL 5D1QA 5HHMB 1BZQK 4P9ML 2JI3A 3RHWF 4X5RA 4XR8C 1IEBA 2UVEA 4DP1X 2EYRA 5DJ8B 5EEUA 2F8IA 4R7DA 3SDDA 1CD8A 3MV7D 4FLHA 4CVWA 3LS5L 2F5BL 3AT9A 3KPRD 4J8QA 4ODWB 5TF1H 2YBGA 5EDXA 1GGBH 1HAUA 1XX9C 2YFOA 4LSTH 3CDGA 2DYPD 2G5BB 4PWEA 5C0JB 2XNAB 5EUKA 4UQ3A 1XIWB 5DEGB 5DQ9B 2I9LA 3DVNA 5FO8B 4JAMA 5DWUH 3C8DA 2PWFA 4XP6L 4M93C 1ZMYA 3W2DL 1MJ8H 2XV2A 4YHNA 1GGCL 4KZEH 4S10A 2ZAGA 2ZXAA 2YAPA 3OG4B 1JDDA 1GMEA 2QQQA 2H8PB 1XXFC 1IM3D 3O9WA 5HGAB 5ICXA 3VNYA 4E9SA 1SXZA 3OTTA 4N9GA 4S0HA 3IRZA 4KPHL 4NQEB 2APVA 3QUYC 4E68A 2YAEA 3CN2A 4DEUA 1I8KA 1ZHLB 4XMLL 3DTUB 5KSBB 3EJSA 4I3SL 1I31A 4JGJA 5I76A 3FQWB 3Q6FB 1Z3RA 5EB9A 1E43A 3BPCB 1E6OH 1UG9A 5EORL 4S0SD 2XWXA 5J6HA 1IGCH 2X2IA 2GITB 4LHUB 2WLKA 3MNZB 2IFFH 5B1JA 3KL3A 3STLB 1G1CA 3D52A 2BSSB 3MXVH 4PY8I 2OI9C 3KPTA 3CN0A 3HE6C 4TMPA 4E9QA 5ILTL 2Y7MA 1OWWA 3KWWB 3S3PA 3LKNA 4JFHE 2K6WA 1EHAA 1EXUA 4RGMB 4XMZA 2DI7A 1GY1A 2X2YA 4DUWA 4PRPA 1FV1A 3INOA 5F7NC 3FTGB 4YHYB 1A6VH 3WO3B 1OM3L 2AEQL 3IGAA 4PG9B 1L5GB 5GJSH 3BGAA 3FT4A 4NHCH 4GP4B 5D1XA 4XPAH 1HZLA 2BIIA 1ZANL 1CDIA 1DL7L 2JJTA 2JKTM 2ZP9A 3QUZA 4JM2F 4WTQA 4Y2OA 2B39A 5C7XH 5IEHB 3LNDA 4DO4A 3BMWA 4N2EA 3GBNL 4XHQA 3BWUF 6PAZA 4ZO6A 3GDBA 3NABL 4Q4IA 4IBUA 3NJMA 4LCWD 1FYTD 5D1ZB 5I0VA 4L29B 1DBBL 2GB2A 4LEXH 3VWKA 4JPKL 3GUTA 5FUCE 4L3EB 1A1NB 4NZRL 1NUNB 1VEPA 3OMAB 2FHCA 2ZWLT 4I1RA 1KTBA 1DN0A 4N20A 2VH5H 2EZ0D 1MIML 1A9BB 2YZ8A 4A7GF 3OMZA 2V7HA 4NNPH 2ZIDA 5DMIH 4ZS7L 1PJWA 3AS1A 3FOLA 4GRLD 5FC9A 2E8YA 2VLLB 4JO1L 3QQ9C 1I8UA 1RPKA 4L8BB 3AG2B 2NLJB 3AY2A 4R4BB 4IU2A 4NJAH 5LGKA 4AJVA 3ZE2B 3WKQA 2FECI 2I7SA 2ODIA 3GMMB 3UEZA 3UCQA 2IF7A 4AUYA 5I82A 5JW4M 5FLVA 5AAMA 3K46A 4HUUA 3WJJA 4GW1B 5KW9L 1Z9LA 4F20A 4QHKJ 3NBNA 1K8IB 2GJ6A 4APQD 2QLVB 3UYRL 2VAAB 2A4CA 4V1DB 3LKPA 3CZFA 4J3UA 2AEPH 4D8PA 5DD1H 5HGBA 4G6FD 4F7CA 5IQ7H 1HDMA 4U3XA 2WNKA 3SYCA 3ZVVA 1Y18A 1FFNA 3S35L 1IVLA 2XV6B 2AV7B 1A4KA 5F89A 2CHDA 2FX9H 2YEVB 3QXWA 2NY1C 4P46A 3UC0L 4ZMLA 4G82A 4XBMA 2Q76B 2W65A 1VGKA 3GJFK 1XF3A 4N5ED 1CGVA 3C60C 4ZX3A 5E2VL 4OQTA 2CJUL 3OGCB 5EIVA 3OXSB 2Q8BL 3EAKA 3LB6D 4PJXB 2X4SB 5F7DA 3DBSA 1YEGH 3FAXA 5CO1A 4O02A 2VUKA 3IETB 3QR2A 4HAGA 2DQTL 3N5AA 4ILDA 5EO1A 5CKAA 1OB1B 5J6SA 1COBA 3HKFA 2MNWA 4U1JB 4JVWA 1EUUA 3MLUL 3T77A 2HVJB 3UZEA 2MPAL 3FBKA 3QDJB 2ZAIA 4XTRD 1DVFD 3P2DA 2P52A 1NKGA 2FUQA 3OPZL 3KPPA 5ESQA 4FCAA 3BAJA 2VLKA 2AERT 3IB4A 3MRIB 5SWZB 4CBZA 3KDMB 4L5FE 1ODUA 2X4RA 2DOCA 2QZQA 4FQHB 3RZCC 4MNGA 4HJEA 1RUAL 4JFHD 5CHNA 3NZSA 4N22A 5D7HA 5CEYA 3FONB 4HSCX 4N68A 4MA7L 2ATKA 2BFVL 4G8FB 4ONHB 3U36B 4F9PA 4NCDA 2J73A 5EF3A 1T03L 1UD3A 5INDB 2GEEA 5FOBB 3IDYC 2G9HB 1ADWA 2GQHA 1XSIA 3CXHJ 3BKML 5BOZG 2PWGA 1GS6X 3NIDB 4JB9L 1QKZH 4OZFG 2EDBA 1LD9B 5I75C 2N56A 1GZQA 3V4LA 2CDFA 4BWTA 4W4NA 1DP0A 2ZX9A 1SOQA 3MODH 3MBXL 3DYPA 4QJ3B 5IROC 3I3BA 3EDFA 5SWSA 3WFHB 3U1SL 2EDXA 3TVMB 4OSUL 1K4CB 3F6IA 5EBLA 2E7DA 2GT9B 4CADA 4GUCA 1GH7A 3X1NA 4HUXB 4WNJA 1E42A 1M9SA 1YDPB 3GINA 1BQHG 5D72L 1MQKH 1JTOA 5L6YL 3ZGIA 5FA4A 4KJYA 3AJ7A 5E4AA 12E8H 2E5EA 2ZXCA 1VRSA 2ITCB 2FK9A 4JO3H 3D0VA 4OZIB 3D7PA 4A7SA 5MENE 1EDYA 1HFUA 1K5NB 2IG2L 3DTXB 1XCTB 1WAAF 4XCEA 3S8WA 4E42A 2VWEC 4NWTL 4KXCA 3DJTA 1MCDA 2ZP8A 3GJFA 4BFEA 3B4NA 4W6XB 2DIBA 3UACA 4PJDF 2GHZA 2F54A 2F1BA 4AKOA 1CN4A 4ABWA 3L2MA 4N2KA 3W9EB 1ZLSH 3AMKA 1ROCA 4LSUH 1HOCA 2W38A 3VFRB 1DO5A 3P2TA 3QAZB 3TH4T 2VXSL 3MLZL 1G7QA 2YRZA 4EXPX 1I9IL 2MKLC 2XC8A 5B4MC 4U1IA 4Y4FA 2H26B 1NGZA 1YNTA 3MRJA 3FOMA 3QZWA 4HH9B 5E9DB 3RWJB 4F58L 4N0CC 1BFVH 4HQQH 4F1ZA 1AJ7L 4X8XA 5CILH 3C5ZB 3APFA 3VQ2C 3UJTH 2Q3ZA 3RY4A 2P26A 1ZT4A 3ZL1A 2KC0A 4M6OH 4NM4H 1E6JL 2B8OT 3KH3A 4JJOA 4PJ9D 3OSKA 3AS3A 1L6ZA 3L4VA 4H8WH 3NCYP 4WJKB 5FFGA 4G5AA 2E86A 1AHKA 4AT6B 2EQDA 2XN2A 2KZBA 3C6LD 4X9HA 3KBEA 2C4XA 3MVSA 1U8NB 3VI4F 4YHKH 2D7MA 4OGAC 2DMBA 3OC5A 3JV0A 5H37H 3DHJA 1NBCA 3QZOA 3G5XA 3TA3D 4PJBF 1JHLH 3LRMA 1C5CH 2NTFA 4OBRA 2EJ1A 3HNTH 5IVOA 3OZKA 4LSSH 1JK9B 3UBGA 3D3VB 4QNPF 2DIAA 4QLRA 3PNWB 4I77H 3WE6A 4Z7OF 4WGKA 1EMTL 5IQLA 3QO0A 2P47B 2DTMH 3I3DA 4DGIH 2GBAA 1THAA 3LH9A 4Z7VF 4XXWA 4R2GB 1KG0B 1KTLB 1Q9OA 2OM5A 3KHOA 4HDIB 4Y7MA 3RAJH 3W1ZA 5ID0A 1RERA 5E0FA 5L8KB 2ZKHH 4FQQA 1SXCA 1YN7B 2VE6B 3NGBC 2H2PD 3WHXB 1CGTA 1B4JL 43C9A 4V2CB 4HFUH 4Y4KC 3MLVH 2R56L 2ZTBA 4N0YL 4WEMB 3VGAC 4HLZG 1EBPA 1WZMA 3SE8H 5JHLH 1AMXA 3BUDA 1I75A 4OD3L 1MW2A 1OPGL 2HT2D 4N2OA 1IQWH 4YQXH 3CMGA 3BVNA 3NJHA 3CFMA 2BHFA 3AT8A 2OSYA 3G9VA 4LBEA 4J3OD 4RMUA 1P4IH 1VFOA 3CFDB 3RDTD 1OAXL 3CVBA 2R1YA 3K2IA 5MEND 1BYNA 3ZDZB 3PABB 5LNGA 2YQ3A 2OMWA 3QXUA 2A38A 4XNYH 5EU4A 2W8CA 1PLAA 1QBBA 3L4CA 3T65B 2YGPA 3PL6C 5CCJA 4FJ6A 5D93C 5ADOL 1AQKL 4KRPB 1KY7A 3ALWA 2EILB 5GGSA 4WU5A 5ERWB 4P5TD 4LCUA 1BFOB 3EYSH 1ZTXE 1PKQB 1CL7L 1R1CA 2PP7A 2B3RA 2JKWA 5IMKA 4LRIA 3O8XD 4TQIA 1P53A 3T4AA 4LQFL 3H9SA 2HXAA 1T5XA 4ANVA 2GUYA 1U3HC 3SE3A 1DUYB 2A9DA 2YAOA 3BMVA 3BQVA 2AQPA 2O1AA 4K7PL 5IQ9A 4LCIH 1SJVA 2KS0A 2AK4A 1TENA 3BIKA 5C0IA 1Z9SA 2UXGA 3SDCA 4V2BA 4M03A 3MJ9A 2UWEB 5F1OB 4S2SA 2QELA 4WO4C 4R7NA 1YEKH 3RWDA 5JIMA 5I74C 1CCZA 3WKML 2O6FA 3DOSA 2WLLB 4DCQB 3HLAB 2AQ3A 4BSWB 1NEZA 1W15A 1B0GA 2J8UF 4Z7VB 3H54A 4OM0H 1L3WA 4C55A 4YDJB 1AH1A 4AGMA 4NP4H 3BFOA 3HVDA 4HHAA 1ORQB 1QTPA 3RURA 2PCPB 4X6BB 2G2RB 3GRWH 4QOKB 1LNUB 3RU8H 2H3NA 2X28A 3HUJA 2ZOOA 1T89C 4PEEA 2VDMB 2WNGA 1DCLA 3HMXL 4UANA 1M53A 5I16B 4XN7A 4D0BA 4NRZA 1ZE3H 3MLSL 1GIGH 4MXWL 3LXUX 1H6TA 1M56B 4JDVB 4HGWB 3ZDXF 1WZ1L 4YHZH 1KB5H 4FL4C 1A14L 4RNRA 3RGVC 5E8OA 2K0RA 3ARFB 5D7SL 4KXBA 1T7XA 1HS6A 1JNHB 3TO2A 4YK4B 2J55A 2VCOA 3GBMH 3QEQE 4FNSA 3S8GB 3JWOH 3U4KA 3SE9L 4BDVA 1H15B 4H26B 3TXAA 4KKZA 2Y7LA 4O9HH 3EJZC 1R9FA 1S7VA 4KXAA 4I0PA 5J11C 2NSQA 4P4KA 1K2DA 3SPCA 3B3IB 3TWYA 3OQ3B 1RCYA 2WQWA 1BOYA 1RZ8A 1KBGH 1HHKA 4RAVA 1CLZL 3KYMB 2OL3A 3HE7C 3NCXA 4Q0XH 4O2FB 4U1SB 2AJXL 3RWCA 1DN2A 3DNKA 5I6LA 5T5FL 3ZMRA 1EXGA 4KKQA 4P5KB 3VNZA 2L7JA 2A9NL 2M83A 3LS4L 4DP2X 1V3JA 2P8MA 2VMDA 4HWZA 1KN2H 2V17L 3F58H 1IJNA 1CT8B 3SBPA 3GF8A 4ZFGH 3QCTL 4XAWL 1WTGT 2DYRB 3MPCA 1FDLH 3NRFA 2XV3A 4NXKA 1OGAA 1GHFL 4XP5H 1IM9A 3H3BC 1RK0B 2ICEB 5DMGD 1X5XA 3FQTA 1RFDH 2ZUQB 4FQXD 3RUGA 2Z31A 2R4SH 4KKAD 4Y5VC 5ADPL 1I3VA 4WGVB 3EO0B 1RJYA 3IF1A 3M8OL 4BK5C 2DKUA 4HF5H 3DDFA 4DKEH 1RUML 3BCDA 3AXIA 3KPQB 1F4XH 4X4KA 3IJEB 3RI5F 4F5CA 2WXJA 4X7SH 2CO1A 3IYLW 3MA9L 3OHMB 5HDBB 1V7NH 3MV8E 1CF1A 1BD2A 3GMPB 1YEJL 4AGOA 1BLIA 3FUIA 2LT9A 3ZDXB 4ZUSB 3S0PA 3QNYA 2FSEA 5HYQA 3W81A 1Q9KB 5FUZH 3EFFB 3REVA 4XX5A 1EGJA 4Y89A 3UTSE 2FBRA 1L0YA 1ZTXH 2VR4A 1NFDA 2WVVB 3ECQA 5AKTA 4PYGA 5DHDA 1HNGA 5D2LB 5EA0H 2VXQA 3DKHA 2HJKB 2K45A 5TE4L 3QA3A 1NC2A 1HCFX 3BQUC 3PHQA 1BJ8A 4PJAA 5BJTB 1BREA 4NQUA 3Q1SL 3WAKA 3FTUA 1B6UA 3IU3A 1UB6B 3N42F 2OJEB 3IDIA 1X5MA 4UQ2B 1NLDH 5JLZB 4NAJA 1ZHBA 5FHAH 4JGUA 4KNQA 1G7IB 1G4MA 3V6BR 2XBTA 4GAGL 1OIOA 1P9MA 4FXGA 4JM2D 1R34A 3PJLA 4EE2A 4DETA 2QTVA 4P07A 4Q2ZB 3B9KA 5TGBA 4KXDA 4RISL 5IBUG 1ZEAH 4P3WA 5BQ7A 3S96B 5F72S 4PV1C 3SDXA 1NAML 3U4EA 2YGVA 1OOAA 4M3HA 3QEQD 3MAWA 4DAGH 3KPOB 1NLBL 2G0LA 1A25A 1MDAA 4GT0A 3QZNA 1OGPA 5LGYA 2NSXA 3P73A 1MCOH 3ULUL 2VZ1A 1F3DJ 1H6UA 1FZOA 3ENEA 4RZKA 4U6HB 5LWYH 4KX9A 2NRDA 4NNYA 4DP6X 1ACYL 1KT2A 1OCOB 4LLUA 3REWA 1YYML 1EFXB 5DYOB 2A5UA 2F1EA 2CO7A 4UT9H 5FCUH 4E9WA 2KERA 1AGEB 1FG2B 4JQIA 4OFYD 2SODB 4QRTA 3QJHA 3GNML 2XUWA 4ODHL 2BSTB 3V6OC 1YMMA 3E6HB 1DBAH 2LW3A 4FZ8H 4WI9A 3GI9H 5EOTB 3FPXA 2I9TB 3UBXI 1EEZA 1UM5H 1U2YA 5F1NA 3TCXA 3VG0H 4DFIA 1OP4A 4M8UA 4PJDE 4FJYA 1UEMA 2YD6A 2J21A 4APXA 2G3MA 1I1AA 2X9WA 3E8UL 3FQ2A 3PQYE 4G6AD 4C83B 3EBIA 5FGCE 3UBFA 1W9XA 4HZLB 1CGSH 4XBEL 4BXVA 3VXMB 5DRZB 4XMXA 5FDYA 4HJGB 5DK3A 2EVIA 1BVKB 3U7WL 4G9DA 3WNNA 4FA7B 1H3XA 1HCYA 4E9LA 5EIIA 3BWAB 2FR4B 3LZRA 4IIQA 1FSKC 1X9UA 1A47A 1ED3B 3R0NA 1H8LA 4HA1A 3X11B 1JBJA 3D18B 4GLRH 3ISYA 5CU5A 5F9OL 2LAGB 4AMKH 1KELH 4JANA 4Z7NB 3F7RA 3W0WE 2OZ4L 3QWRD 4M7JL 1J1OH 2WUBH 2HFGL 3UTSD 2BOBA 2XICA 2QQLH 5FO7B 1SJHA 4A04A 5F8QC 2BNRE 3A3YB 3ATDA 1GYUA 5B1KA 2F7IA 3ARGB 1X5AA 4U3SB 4S1RH 4UQAA 4EKXA 5E6IB 2JKLA 4LKCA 4OKVB 25C8L 3VI4E 4NO3A 1PDKA 4HC1H 4TVPE 1BPLB 2B77A 1F4YL 5C08A 1SM3H 1HHGA 2FATH 1UXSA 2NY3D 3GQFA 4R97B 3TEXA 1A6AB 2A9AA 4IDLA 4B7LA 5LGHL 3DO7A 3NFPB 5DTFB 2JJSA 4X0NA 1D5MB 1L4IA 1OT1A 1XMEB 4HS6B 5IKCB 1T20B 3T1FB 4QNPE 4YPGA 1A7NL 4UINL 4CSSA 2A6IB 4RQQB 4Z7OE 4XVTL 4AK2A 4NN7C 4L8CB 2VLJB 3EIFA 1OP3H 1EXHA 4BFBD 5IHZA 1CYXA 4AG4L 2AKRA 5J06A 5I0XA 1AQDA 2WOYA 3G6AA 5E24E 1IEAB 3L3KB 2P5EB 3JTSA 4N0FB 5I6NA 4W9EC 2J25A 2N1KA 4I3RH 3P3RA 2QGEA 4KDTA 4Y5XA 2FJFB 2NNRA 3GMNB 1H8NA 3FTVA 4EJ1C 4F57H 3JV6A 3F7VB 1LO4L 4GKNA 4L3FA 1BG9A 2NCMA 3NJIA 5F7WC 1KJ3H 4KY2A 2LABA 3MNMA 3O6LH 4UB0H 3FCUB 4FNLH 5DS8B 2BHUA 1G7JB 1QHPA 1ZDSA 2EEBA 2XVKA 3APDA 4PS3A 3FH8A 3PGFL 4GLRI 4PGBA 3OKMB 3V52H 3WEAA 3U7YL 1HCZA 4NB7A 1WJ3A 5DJ0B 1A8JH 3FQYA 3NRPA 3HPLA 4OU3A 5MI0C 2O5YL 3I50L 4HHWA 4KNSA 1VJSA 4M61A 3TX4A 3O6FC 1H5BB 4P9HH 4JBSA 4KI5F 2A6KB 3ZO0A 3FT2B 3DDGA 5GHWL 1N8ZA 4N8CL 1JNLH 1M1XA 5F3BB 1X9RA 1UTDA 3PQYD 3NJXA 2R8SL 2NY4D 3K2UL 4LLMB 4OQTL 5GGQH 4XN2A 4MJ5A 4X5LA 3HBZA 3SO3C 2NZIA 4OQ1A 5D7JB 5CF3A 3TEWA 5FKAB 2CK2A 4W70A 4O02L 2D7TL 3QORB 4M5ZH 5DT1H 2NXZC 2MQ3A 3NZHL 1E4KA 1ETJA 3AWFA 3V0IA 2MRYA 2XACC 2CNZA 4LHUG 4PIBA 3B2PA 2MCPL 5L2JA 1B2WL 4GINA 1AHWA 3UC2A 3NCCB 4UV4H 3QDAA 4CU6A 2PP8A 2MTPA 1I8MB 3W0WD 3S3DB 4MD0B 3EG9A 3MKGA 4FN0A 1ZE3C 4HBCH 1CI5A 2J8UE 4KK5C 1QWHA 3KLDA 4DTGL 2EXYC 1NBQA 1HL9A 1CIDA 1T22A 2QVFB 2BNRD 2YUZA 1AZUA 3MO1A 3QUXC 1VLXA 4UIMB 1RKRA 1GPOH 4UQDA 4JFDB 4N1HB 1Y1UA 2D03H 4LLWB 1HX0A 5DFVC 4KROB 4MA1C 4ODXA 2AJZB 4TVPD 2ENPA 3FO2A 4YSDA 4ZSOE 5AG9A 1UM4H 1WIUA 2DQUH 2PW1B 2XTJE 4F15B 2B20A 3GTTA 3X3FH 1J0KA 5D9SB 3CK0H 4EMZA 1USZA 3GPEA 4IOFD 4UOJA 1AR1C 2IAMB 1JZGA 2H0JA 2W0FA 4OFPA 5D7KE 1M9WA 2GJJA 2WZAA 4M5YH 4Y5YC 4IQHA 1M2VB 5IJVB 1LK3L 3T0EC 1AOZA 4UAOB 3UAFA 4XO8A 2NR6C 4W4OC 3VXQA 1KGXA 3TEUA 1OP9A 1JXDA 1D5IH 1VADB 2QVIA 4MKMA 1A6TA 4TVPH 4UMSA 4ZW3A 4L2YA 4QYOB 5DURB 3I6GA 5F21B 1IQDB 1O6TA 2BMKB 3RWFB 2OMZA 1QUNA 4L9LC 2ESVE 5AOZA 1GAFH 3UZQA 1J0JA 4Q89A 4QKTA 4L3AA 4WI5A 1QI5A 1IAII 2YPVL 4N2GA 4OGXL 3WNIA 2NY2C 2WXNA 2J3SA 1HYSC 3S35X 1T0NA 5CJOL 1FNGB 4LLQB 3JZYA 2CXGA 1DJYA 1MLBA 3P4NB 4G1EB 4LL4A 5H4ZA 3NFNB 4MCNA 4NKOB 3RL1B 3F12A 1CK0L 3DUSA 5B3SB 4FFWC 3WU1A 2CIIA 1FHGA 4KVNH 4I0KA 1D9KD 2WXIA 3AG1B 4P57A 3TJPA 2UZYB 4NPYB 2CG9X 2WQ8A 4UWQB 2DQFA 5DZJA 1QBLL 2VC2L 5IMMA 5DR5L 1QBML 4WSGA 4KKAC 1CLOH 2P24A 1II4E 1SDDA 1HXYA 2JTYA 5DZLA 1FWXA 3UGEA 3EYOB 2XY1A 1OAJA 1JGDA 1FAKT 1JWUB 2A0LC 3NPZB 4HXAH 3I9GL 2P46B 1L9QA 1TVBB 5ICYA 2BVOB 3T6QC 2NNFA 2Z0BA 5FGBC 2Z91A 3EYQD 4W9GC 5EOCH 3TYFA 1MH5A 3MUY1 5FAAA 5FV1L 2VLRE 3TO4A 2NW3B 2IBBA 1PU0A 2VISB 3VFOA 1NAKH 1F11A 2EO1A 1FLTX 2L7QA 4HJJH 2EIZA 2HT4D 1QAWA 1HEJC 5KWYC 1QX1A 3SDAA 3ESPA 4J1UB 4UYQA 3UXFA 3KR3H 2G30A 3VH8B 4M7LH 1PG7L 4OI8A 4LDEB 5F88B 1BZ9B 4L3CA 4RGOL 1MJUL 1JE6A 4Y2DA 3NVQA 1TXKA 3L5HA 1FO0A 3S5LA 2YAFA 5E6RB 5KVEE 1HH6B 3AUVA 2FB4H 5T3XL 1SJEA 2K4AA 1ACZA 3TZVB 3OJVC 1FL6A 1C16A 4KUZH 5FGSA 3ZT5A 3DIFB 3CFNA 4MQSB 3EOTL 1P2CB 4FNRA 1DDHA 5IM7B 4F7PA 3AU1A 3VXOB 2VERN 3K7UA 5DRNA 2XTJD 2HFEA 5D2NE 2EDYA 1KBVA 2XJLA 32C2B 3K0YA 5D7KD 4ATTA 2FWOB 4QT5B 3MXWL 3BZ4B 1EH9A 2C9XA 3LV3A 4G7SB 4LSVH 3IVKA 4N2NA 4B53A 5LLIC 1MFVA 3U0WL 3W9DB 1HQRB 4K73A 4ONGH 3TT3L 3EFDL 1KIPA 2CM6A 5IFAH 1FN4A 2J44A 5KBNC 2ESVD 1QSEB 4JFSA 4XHJC 4LP8A 2Y7NA 1N6VA 1FA4A 3W11D 1DEEA 4Q9QL 1V3LA 3GJEA 3MFFA 2XBZA 3QJQB 1ID2A 4MJ2A 3FO0H 5J6GA 4R4ND 4ZFFB 4ENED 4K71C 2XZCL 3UAJC 4FYRA 1QFWL 5K9KA 3BAIA 1YSOA 2VZTA 1LO2L 4XI5C 2A73A 3QXDA 4FXKB 1HT6A 1TTCA 4JRWA 1TJIH 5CWSB 3KLHD 1FPTL 2WUCL 2JJWA 3GKWH 2ICWA 2XIDA 2WVTA 3IU4H 3F64A 1CDHA 4NFCA 4ACPA 3FHEA 5IG7A 4JQVA 4HVBA 2J6WA 1D2PA 3HI6L 1JUFB 1N0LA 3A6CL 3KAAA 1E2ZA 4WDIA 3CX5J 4HT1H 1CD1A 4NNXB 4OI7A 4HOWA 3MI6A 3BH9B 3V8CA 2D9QB 3JV4A 3Q5TA 2D4DA 8CGTA 2VMFA 3WHE1 4NLHA 3MHZA 3TURA 2PXYC 1NJ9A 1OT4A 3UO1H 1G9MH 2H9GA 3MJ9L 2AS5M 1P6WA 5FW8A 5DVKA 1OAKL 3EGSB 5JR1H 4HZAA 2IGLA 4G8GB 2DLEA 4XH2A 2VLRD 1UVQB 2P80D 3AQXA 4P05A 2WLNA 4BH7B 1A1OB 5L2KA 4MAUL 2XWJB 3L5XH 4AJYV 4CSTA 3TYGL 4HJTA 2PP9A 1AGCA 4H0HB 1N5AB 3BJ91 3ZTEA 1UEYA 2WLHA 3LQMA 1YLBB 3D25B 1H3PH 1MXDA 2RD0A 2Y06H 4KQ3H 2MOVA 3GSVA 2PPEA 3K2MC 4I9WD 4JG0H 5HHNB 1KFAL 1MREL 4IBZA 1XF5A 3UDWC 3VXSA 2ZJSH 4A7TA 1T0MB 3D6GA 1MFMA 2P7TA 3BAYA 2PTUA 2WTRB 4EUPA 3BVVA 3ELQA 3KVPA 1DBKH 1DBJL 3PDDA 1A6UH 3CZLA 5C92A 1F90L 4RAUA 1BEYH 2HRPH 4PJEB 4Q97A 2ZQKA 1VGEH 2ICES 2YQ2A 3QIBC 4TNEA 3VFPA 3WTTA 1HINL 3QI9B 4BHUA 3PIQB 3GSQA 2VDPL 2EE0A 4ZUUA 1YNLH 1D6EB 2IQ9L 1YEEH 2XFXB 3HKZA 3CBJB 2YJLA 4FMVA 4R4FH 4AW4A 3CUPB 2EVFA 1C7SA 3RTQD 1ZAGA 3NSDA 3II3A 1QZ1A 5C0RL 2AXGA 2E4FA 3AAZB 3FU5A 5JMOC 2F0CA 1YRKA 1TCRA 4FULA 4N87A 1I3GH 3AY4A 4XC3H 3K6NA 3TH3T 2QHRH 4JJ5B 2ADIA 2IOIA 3FTWA 4I0CC 3GB7A 4HYTB 4FQLL 4BKLA 4CA4A 2KMWA 4DN4L 5GGUB 3GK8L 4XNXH 4FG6D 4KZDH 2OL3L 4WCYL 4L1DA 4BKTC 4KJQD 4ICXA 1JHKH 3W39B 4EBQL 4P9HC 3O4LA 5LBSA 2Q86B 1PYWB 4IBTA 4UM8A 2AMUA 2MH4A 4TS6A 4UQ9A 3D2UD 3S3SA 3Q8AA 3FTXA 4QO1B 3V9EA 2UX6A 3PWPB 1EZUA 4RMBA 4L8SA 4M8QB 1N7ML 4HLEA 4MLSA 1MF2H 2G2NA 2HLFC 3HOGA 1WHPA 3PGCA 4FFZL 1KXQE 4HUMB 4K7PX 5D5MA 2N7BA 3ISRA 4K3DH 5F9JB 3MRNA 1TSHA 4TSAL 1RULL 3T8XA 4N8VA 1JCKA 3IDGA 3T09A 2ADFH 2R1WA 1NGQL 4PJGB 1HHHA 2HB0A 3F84A 4XPBL 2XWZA 3MLXL 4QAMB 3HHSA 5AB1A 3CC5A 4UV7H 1Z5YD 3E38A 4CSPA 4XZ4A 4PGDA 1KULA 1MVFA 2WLYA 3GIZL 2JFCA 3IJHA 1HSAA 1F1DA 1G9NL 4KX7A 2N3JA 5C0AB 4P2OC 1B4TA 3LMJH 3N06B 5CCHE 1AKPA 1WFJA 5E8DH 5T1DL 3T3MF 1CLVA 43CAA 4O00A 3L9RA 1EGJL 2EXWC 1VFBB 3Q8CA 3CZSA 3W5NA 3WFZA 1CFTA 4ANXA 4RRPM 1NMAL 4OCWL 1ZPUA 1G9HA 5F7LB 2ALAA 5GS0H 3H6JA 2BOLA 5JIPA 4M93B 1KOAA 2HX9A 1KEML 2YUWA 3BSZA 5TH2B 4P5SA 5I9QC 1P1ZA 4PY7B 3EYFA 2ZUTA 5J13B 3U6XS 3ETTA 3NA9H 1ET8A 1UZ6F 3UFIA 2P5PA 1ZT1B 4LT7A 1NFKA 1A6ZA 5KSAA 3V6ZB 4K3GA 5E8EA 1LDPH 3V5HB 3P2BA 1I8IA 4LOUD 1ZGLM 1E40A 4LFHD 1NFIB 3QUYB 2GUOB 4NJ9H 1XT5A 2I7OA 5DD0L 3BZFB 3TPUA 1C12A 3LPWA 4BA0A 2WLIB 1E5UI 2AQTA 3CNKA 4PJIA 4XNBA 1ZWIA 1WBZA 4OF0A 4J6RL 4WU7A 4LZKA 5BXFB 2Y25A 5E00B 4EAEA 1I8LA 2OI9B 1BQ5A 5C71A 2F8OA 4EPSA 3KYAA 1F3JB 2E9JA 4K5NA 4IS6A 4YR6A 4G6JH 2PTTB 1S3KL 3Q9PA 3EHBD 4DGYH 3C60A 2I07B 2XN9B 4TSBL 3VM5A 3VXNA 5HTSA 4P2RA 4H1LA 4G70B 3MA7B 2FBJH 4CDHA 1IGJB 2OSWA 4JQIL 2QADB 3SQOH 3CSYA 4EF3A 3JZ7A 5ALBL 1Q8MA 1RPQA 3VWJA 3BEVB 4PJHE 1LO5A 3IDMB 4FOMA 4LPCA 4MMYB 5T3ZH 1SY6H 1BJMA 1JZFA 5EU6A 4JEGB 5ENWA 3SPVA 4GQRA 3B6SA 1CLYH 2C9VA 4Z77B 1DQKA 1N2RA 1CI3M 1TITA 2IPKA 3FCSA 4B9YA 4NQCA 4YO0B 4FDWA 4XO3A 2FGZA 1M42A 4NO5A 1OE3A 5DZAA 5KAQG 3UJIH 3OKDB 4XN4A 4HXBL 5F0JB 3MREB 3DX9B 2HG0A 2X38A 4AYID 5CEXB 1SYVA 1JF1B 1PTZA 1HSBB 1PZBA 35C8L 3MC0A 2VSDA 4MGXA 4QRPB 3P3YA 1L9PA 2PWDA 3QQ4B 5C0FA 3F7PC 4NENB 4ZQTA 2FX7L 3HS0C 1Q94A 5BO1H 4MNQB 1X9LA 3BAEL 4R5XA 3K72B 4F2FA 5ANHA 5IP4A 5EWIL 3S3JA 5DMKA 4GG6F 4NUMA 4ZTOL 3X1EA 1MRFL 3BZ5A 1JNJA 4IRSD 2V2WA 4BZ2L 2OSLA 3SKOA 3TS8A 4G9FE 4JY4A 4YNYA 1TZHB 3ZBMA 5IROA 3EJYD 3PXHA 4HZ1A 3EBGA 2WCSA 5HHPA 3NCYS 3L81A 4YDKL 4H13C 5T1MB 5KUKA 3TBBA 5E5RB 3BZEB 3FCTB 1Z0MA 3VFWB 1T1YB 1HNYA 3L2NA 1TZGH 4UOQA 2WNWA 2VM4A 1HKLL 2JMRA 2KBGA 5AB2A 1IFHH 4C4BA 5T1KA 4BBWA 2V9UA 5I1CH 3PWNB 5F9AC 1RU9H 3HZ3A 2PF6A 3MUGB 5HDWA 5IK3B 4FZEL 4LEBA 2MFNA 4ZUVB 2B4CL 4KOBA 1FVEB 3JXAA 5D70H 5I30L 1NCDL 4XWGL 4FJZA 2V8LA 4OFVA 3GTVA 3TL5A 3C6SA 3KL5A 2K3TA 3OLIA 5BS0A 3LKSB 4M7LT 1UB5B 1FJ1B 1RHHB 3NQKA 4OCRL 3CFBB 4AYGA 1OCCB 2LQRA 4MA8L 5E1IA 4JM4L 4UT6H 5D4JA 5H2BA 1NAMB 1WWBX 3VMOA 1IAOA 2D73A 5D1QB 3BT0A 3ESVF 1LWJA 3N43B 3SO5A 2X41A 4EO5A 5MP6H 3MLPA 1VESA 1IEBB 5C0CE 3O11A 4U4IA 3E6FA 3NTCH 2EYRB 4Y16D 2EDFA 3LQAL 3JWNG 3BH8B 3CGTA 4R7DB 3SDDB 3OZ9L 4GP8B 5EOQL 3IMWA 3ATFA 4IIZA 4JFEE 4S1QH 3ZYZA 2RAMA 1TFPA 3ROOA 1GSKA 2E59A 4UZUA 1XGTA 2NQ3A 1A0QH 3V0EA 1CICD 2R0KH 3P0YH 4LLYA 4DKAA 2XYBA 4GXUN 5EUKB 1B6DA 4ZBJA 4Z5RA 2CUMA 4TRPH 2DQGH 3DVNB 3IDYB 5B8CC 1JGLH 1ZKAA 3V5DA 3S4SB 4JVPA 4JFZH 1U8LA 5AYTA 1SVCP 4JQXA 3VU2A 5DHVH 4JHWH 5I75B 1E27A 1S46A 1SYSA 3DJRA 1EHLL 1G9MC 3LIUA 2F58H 2OV0A 3DYMA 4KKBD 3ZOAA 3MDJA 4F8TA 1U93A 2O5XL 2XA8L 1VEMA 4GSXA 1G6RB 3KPLB 2VOTA 2EUXA 1AD9A 4OF8A 1K9TA 4URTB 2VJXA 1VKXB 3SKUD 2HN7A 5F7YC 3M88A 3H55A 4PRIA 3K6DA 2DLTA 4NZDA 4URKA 4HMDA 5FDWA 5DA4A 5AG8A 1OARL 4BUGA 2DQHL 2VDQH 1P7QB 2OMXB 4NYLB 2JB5H 5J6HB 1WH0A 4WKZA 3QHZL 3PS6A 4C58B 4FADA 1DZ0A 5HJBA 3ZHLA 5AYUH 2CO3A 4G9FD 4AEHL 3H42H 4P3CH 3FUEA 1BAGA 1Q72L 3RBGA 3BDYH 2Q9OA 4KOCA 1XBRA 2Y7QA 2QPUA 3SDYL 2BS71 4GO9A 1A6WL 2EE2A 1P5UC 1U8PA 3GGWA 1IL1A 4GQZA 2FHFA 2CCLA 3P0VH 1LGVA 2YC1B 3MRGA 3RKDC 1CLCA 3WD5L 2LLNA 3FT4B 3TEZA 1W0WA 4DUVA 2BOCB 2DYPA 2G5UA 3ZHNA 4A63A 1BFTA 4CMMA 4JUSA 5IESL 2F19H 3IMTA 2YXFA 4OJAA 1BWWA 3IRPX 5AAWC 5HYSA 5IHWA 4QXTB 2L3BA 5GQBA 5HPOA 1JRHH 1XGUB 3H9HA 4PGCB 3ZE0B 4F7TB 4Y0GA 4IRJD 2ZOWA 3GUTB 3OX8A 3JYBA 3PL6A 3DLQR 4G80A 3FB6B 4L4VB 2NY5H 3QDGE 2RFXA 3SYAA 1ZLUH 3TBVA 2AABL 3TIDA 2HT3D 4DEPC 4BELD 1W72H 2LV4A 3TH2T 2VSCA 3U0PA 1OD7A 4K15A 3NCMA 3QFJB 1G7HA 1KIUB 2V7HB 5C0CD 2ADJB 3CVHH 1M57B 1AO7E 1U3HA 3B34A 1T2XA 3PNRB 4IOSD 4JRYE 4KTDH 4WY7H 3U9PH 4MCMA 1U91A 2EECA 3VI3F 4JFED 3GMOB 3K6SA 3NIFF 2PO6D 3AQZA 4IU2B 5DD5L 2GBVA 5IWLC 1A7BA 5TDOA 4UNVA 3OR6B 4LL9A 1A64A 5AVVB 5I19L 4FX5A 1WCQA 4POZC 5F1SA 5BV7C 3KGUA 2W9EH 1GTNA 4GXVH 2G4GA 4ZI8A 3CVIL 2R0ZL 3PUCA 2WXFA 1N9PA 4K9EL 2WP3O 4Z76A 4BZYA 2JLLA 5I8KL 1AE6H 4PWJA 2VDRL 5HHOB 1FFNB 2DWXA 3DSNA 1ZIAA 2YOAA 4YFDB 3L7FA 3ZTJH 3LTVA 5DA0B 3ZL2A 1WWCA 4P46B 5I1KH 2UXTA 1A9EB 4WKXA 4WI0A 4AGPA 3L45A 1N5YL 5DC2A 1T89A 1ZA3A 1XF3B 3FTSA 4PV8A 5AAPA 4Y4KB 5GS0C 1RJZA 3VGAB 4A2LA 1AANA 4W9CC 4Z95H 2K6YA 3ETSA 4O02B 3OKEB 1KYOJ 4M1DL 5IB1B 1JYNA 1KCVL 2BNQA 1N26A 3NACL 3RGVA 5MEQB 1JRHI 5AVWB 2CIKB 3FRUA 1FYTA 1ULVA 3C8HA 4F2MB 2PKDA 5C70A 3T77B 4G8IA 5KYWA 3BFQG 3HFML 3T3ME 5EV7A 2FEJA 2K9UA 4PLKD 4AH2A 1DSFH 1UHVA 5FFLA 3MCLL 4TUKL 3BVUA 3TOPA 3PV6A 1G0XA 4U1NA 2EDQA 1YN6B 3DBXB 5KVFE 3RIFF 4JUTA 4K7FA 3OKOA 4TLKA 1PX8A 2MWCA 3N9GH 5DQJB 4B6ZA 3C8KB 4GRLA 5DEFA 2ZSVA 1FO0L 4FFVC 1X7QA 3HG1B 4X6DB 1YNTF 4RMQA 1U21A 4FLSA 2UYLB 4LP4A 2BC4B 3ILEA 4EQ2A 1UZ6E 1MEXL 1MIEL 2J43A 3NSJA 3OV6A 1QABA 3MTXA 1U42A 5EC2B 4X0KA 3WS3A 1YEHH 4APQA 5LQBH 1T5WB 1VFAB 4LCCA 3NP3A 4QTHB 3H4FA 5GRVK 1LQSR 2JSFA 4YXKH 4ANWA 3SE4A 2BDNL 5I1IH 1G0DA 1GZQB 5L88H 3TFKD 5L8JB 5SWSB 1MHHA 3HI1A 3QYCA 3S2AA 4NM8L 4O5LL 5EBLB 5E08L 1HZHH 3QDGD 4UF7C 4CADB 1ECZA 2EDKA 2X53A 3CU7A 1AGBA 4Y5VA 2BNUA 1OT2A 4OV6F 4IU3B 2PW2B 1TPXB 3L8QA 4X80L 2BP0A 4WW2C 2PR4L 5I15L 1P4BL 3O3DB 1ZIBA 4H0LC 1D5XB 2ZYRA 4TLSA 1PSKH 3GLAA 1AO7D 2DEWX 2XYCA 4P2AA 2W07A 1EEYA 4JRYD 5GS3A 2X4QB 4LIQE 2DQDL 4CVZB 5CSZA 4XCEB 3KCWA 5GRYA 4ZXBC 4H88H 3I6KB 4PLJD 5GIRA 3IJYA 1MWOA 4LKXB 3O45A 4WUKH 4KQ4H 4PJ7B 1DVFA 4DGVH 5JPMC 3DSFH 4PCTA 4U1HB 1UXWB 4CMHC 1WS7A 1XR9A 2QEJA 4PY8J 2Y0SA 4FL4B 1H8SA 3L4XA 1MCQA 3ARTA 1XH0A 3CLFH 3RX7A 5I8OH 3V0AC 1RIHH 1HOCB 3QARA 2A74A 2VC2B 3RA7H 3IPBA 3QJTB 4X99A 5IGXH 1TNNA 4U1IB 5LCVA 4Y4FB 2AV1B 3QNZB 3Q8FA 1NGZB 5GRUL 3QZWB 5IBLD 4TQHA 4WUUA 4Y4HC 4MDIB 3QIUC 4JDZA 3CV5A 5IV2A 4JFPA 3JT2A 5LNEA 4XGZA 3QBTB 2FLMA 3SE6A 3THMH 1JN6B 3LVTA 5FB8B 1KPRB 1O6SA 1ZT4B 4GG6E 5CJXC 5F2FA 1XDTT 2FJGA 3O2VH 5TDPA 4I89A 4NC1C 4WFFE 2X12A 1J5HA 4JRXA 4M48L 4KO9A 3VH8G 1X4YA 3PE9A 3FL7A 2R0LH 3CXDL 1X5HA 4PJ8B 2WIIA 4OLZL 3WYRA 4FP8H 1HL4A 5C2BH 4HFWB 1LVEA 4IDJH 4TPRH 4JE0A 4Q6KA 4X6EA 3ZE2E