4KTGA

Crystal structure of double-helical ggc-repetitive rna 19mer complexed with rss p19
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
121
Chain Sequence
MTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
molecule keywords RNA silencing suppressor p19
total genus 36
structure length 121
sequence length 124
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ktgA01
4KTGA 4JGNA 4KNQA 1RPUA 4JNXA 4KQ0A 4J39A 4JK0D 4J5VA 1R9FA
chains in the Genus database with same CATH superfamily
2UUDK 3PQYD 4Z7UE 1I7UA 4N2HA 5DJ8B 2EDWA 4Z3FA 4F2FA 3AG1B 1AQKL 3ARDD 4IOIA 3E8UL 3E9TA 3S48A 5B4MC 3V0DA 5IIEA 3OLDA 2EE9A 1R3LB 4OIAA 1DVXA 1RURL 1U2YA 4Q6IB 1CC3A 5D1ZA 3FU3A 3U2JA 1WBYA 1R5VB 4NJ9H 3W11D 4XPGL 1F6AB 3NJVA 1G1KA 3GI9L 4QHMB 1DEEB 4ABVA 1IFGA 2C4FT 3MGTA 3UTSA 1S5IL 4LKCA 4BXSV 3HR5A 4TLUA 4HKXB 1KBKA 1E7VA 2YPKB 2CPCA 1L7IH 1Q4NX 3L3HA 3HE6C 3SYPA 3RIFK 1A6WL 1XQ4A 2P8MA 1RJCA 4NJ9L 4PBXA 4XGZB 1DQJB 1JK8A 4P05A 3EGDA 4P2OC 3WN5C 3DWTA 1PD6A 2HSIA 5EBWB 1KTKE 5CWSB 3B9EA 4PS3A 3F64A 3VI4F 1MLBA 2VQ1A 4U2YA 5I82A 4AYBA 3QXTA 3EFDL 4F2EA 4B9ZA 1H9VA 1RUKH 1NTDA 2DJ4A 2A1WL 2IWFA 5ANMB 3RWEB 2AJZB 1VEMA 4N3UA 5I8OH 1HI6B 3DGGB 3RTQD 4DVBB 1RZKC 1T20A 1DVFB 2H6UA 2XFXA 3BZ4B 4N6QA 5FFOA 3MBEC 2IXQA 4B3VA 4QXGH 4XPFH 1ADWA 3WN6A 2EIKB 1OM3L 4K23H 1AGEB 4FE9A 4HIEB 4AQAA 2OR8A 4DVRL 1CE1L 1XTLA 4V33A 4R90L 2F58H 4UBDD 3EH3B 2G4GA 3V2AR 3K8KA 1BM3L 1E30A 3KYAA 1CZ8H 3AG3B 4YDVA 2Q3ZA 4OY9A 1AD9B 4WW2F 1IKOP 4PGDB 4WGKA 3AT8A 8FABA 4X99A 4WTZG 1XEDA 3OG6B 1LO3H 2D7TL 2Y2TA 3UTQB 4X5WB 1NCUA 3GEWB 2D2CC 2QL1A 5C92A 4IRJC 1J8SA 4G8IA 4JZJB 2EEFA 4CILA 5IGXL 1QZNA 1ZLVK 5IHWA 2EINB 3K1KC 5F7LB 2HWZH 1I8IA 4X0KB 2ZYIA 2CR3A 5EOCJ 4D3CH 5IB3B 3X13A 4AQ8C 5DUML 3TH2T 4NO5A 3BUPA 5LGJB 5HDRA 4P23C 5GGSY 1JN6B 2B9AA 2YD8A 4GIOA 1OY3B 2PO6A 1G9NC 5EZJB 3PDGA 3WNOA 1AVAA 4QRSA 1EHKB 1MCJA 3ARGB 3KPLA 3QEGH 3VXNB 4L0ZA 1BBDL 2WLYA 4J3OG 4PRNB 1K8IA 1GYCA 1WIOA 1F11B 1XSJA 1DL7H 1RK1A 1ROWA 1X5ZA 1SOSA 1T83C 1VESA 2X41A 1ZV5A 2AANA 4PJGA 2E6QA 1SMAA 1NAKH 2O6FA 3L3GA 2W5PA 3FT2B 4FOMA 3DSFH 1K6QL 4XB7A 2M1KA 1CICD 4YXKH 2ZXDA 3IDUA 4OFYD 3ZE2E 4LIQL 4BZYA 4UQBA 4YX2H 4GO9A 3VTTA 1M71A 1TETH 5D7LB 1SJHA 3CVCA 5BW7C 3K4AA 3QO1B 4WSKA 1P4LA 2VZOA 3GHEL 5DVPA 4ZUWB 1OWRM 1KB9K 3ULUL 2QPFA 2UZXB 5I1DB 4BJLA 2I5YH 2GUOA 3B9VA 3ZL2A 3NZ8B 1I1FB 3PWNB 2D0FA 4IK6A 5T3XE 4TVPH 4KRPD 1CLZH 5GGSA 1VADA 2E0PA 3LNHA 3HR5B 4YK4C 5K9OA 2H3NA 4K9EH 1TETL 3B1TA 1DO6A 5CMAA 3FO1B 1A9VA 1JDDA 3ABKB 3QXVA 1YEJL 3EW3B 4QIRA 3VGGA 3O9WD 1IVTA 1A6UH 4YBLB 1CDUA 2I5YL 1U3HA 1CIDA 3VFNA 4OCXH 3QXAB 2AQ2A 4HCRL 2YOAA 2R7EB 5IQNA 2LTQB 2QVKA 2DIJA 4ZK8A 2QQLH 2X7LB 2VLLB 4AL8L 3D2UA 3TNMB 3EFOA 5HJ3B 4QRBA 3X12B 4KC3B 3MDJA 5FO8B 5DK2B 4PJEA 4N2OA 1NBYB 4P9MH 1SPDA 5L0QB 3LKPB 3H42H 2X9XA 2Y06L 3F8UB 2R56H 2I7SA 1T1XB 4QT5A 4EQ3A 4E5XB 3DX8A 2CAKA 1BQHB 3HC2A 4ZMNA 5DJCA 1OP5H 5HVFB 3SQOH 1JUFB 1N68A 1GZHA 1YLBB 2IH3A 4UT6A 4UUJB 3S2CA 4D9LH 1K9TA 4L2LA 2ARJB 3O2WH 1HWGB 2GAZB 4AQ1C 1SHXA 4NENB 3KH3A 2P5WE 3HNTL 3UPCA 4C4KT 5AAMC 3CDCA 3SKJH 1S5HB 1CFSB 2V17H 3ISRA 4N25A 4NFDA 4UI2A 4Y9EA 2OJEA 3V6ZB 4O5LH 1QLEB 4NWUL 4WNQB 1S78C 1LEGA 4P0DA 2C1OB 5C6TL 2EIDA 1FL6B 1ADQA 1UC6A 4X6FB 4X7SH 3DIDA 3TN0B 2XYBA 4ZFGL 4NHUA 5I24A 2FO4A 5DJ2A 4OGZA 1KF9B 1JGVH 1ZWIA 5CCHE 3TH3T 3PAZA 3D39B 4FI6A 1KN4H 3LKPA 3SBPA 2BNQA 4YPGA 4A2GA 3H0TB 3MLUH 3FXIC 2P48B 4WHCA 3QR2A 2PO6C 3O6MH 2Q20A 3O6LH 2KLTA 4N9GB 5A6IA 4GBXB 3AVEA 3W9DB 3TIEA 1G1YA 4EI5A 3SBWA 1NGZB 3AS1A 5LGJA 4HULB 1QYGL 3EJZC 2WXOA 4ISVB 1SDYA 1BVLA 3MV8E 2DQJH 2WMPB 1BYOA 1T7VA 2YBRB 4K71B 1MEXL 3L5WA 3ALXA 3OKOB 2B16A 5JQIB 3K80A 2VYRE 4WUUE 3L5WB 3VD9A 2BSBA 4AENB 3VTAA 1BZDA 4GRLB 3QH3B 2IAAC 3QPXL 3NCJL 3B2PA 3NCWA 5F3HB 1R5WB 1M2VA 1CDGA 2AP2A 3EH4B 3NJMA 4UZUA 3D9AL 4MNHA 2B1HH 1INQB 1WUZA 2CDEB 1DSFH 1HHGB 3ABLB 2VDQH 2VKXA 3T8VA 5CEXA 4E9LA 4NN6C 2Y3AA 4F5CE 3QUXA 4HKJA 1YEIL 2CNZA 5C6PB 2IVFC 2UZIL 8CGTA 4EZMA 4EIUA 1ED3B 3NGBB 3GSVA 1XIWC 2P7TA 1ZWIB 3FT4B 2Q86B 4XHJD 5KOVC 3BOVA 1PDKA 3KCPA 5INCB 3TNNA 2C1PB 1KEML 5KYWA 1S9YB 3L4UA 3T8XB 3FB7B 1MG2C 5FM4A 5F8RC 4UQ3B 1HESA 3DX7B 5CEZD 2ZXBA 4Y5YB 1VAHA 3OGCB 4F7PA 1SYSB 4HS6A 3OKLA 2BFVL 4FAAB 4P5SA 3APCA 3T0EC 1GC1L 3QDJD 3MC0A 4JFXB 5E00B 1JF1B 5DD3H 2K7PA 3WEXB 3CBRA 1CPUA 3M07A 3C5ZD 3LYRA 3PAUA 4HUUA 4ODBD 4BFKA 3L4VA 4DKFL 1QPKA 3OMNB 5DHVA 3HVDA 4NDMB 5DFVC 1QRNA 3MBED 4PRIB 4G1EA 3NJIA 4HEMA 4LPCA 4ZMQA 4HK3J 4N8VG 1JFHA 3PPSA 5T3ZD 1IE5A 5KZCD 3DX0A 4RQQB 4BIKA 3MJ9L 3CG8A 5HY9A 3RI5K 1XCXA 2JCCE 3D06A 4KI1A 3AMLA 5JW4M 4QHNA 3S8GB 2QVIA 3JYBA 4XN7A 1U4EA 3MTRA 3QAQA 3IS1X 5F0MB 3U46B 4FD0A 4O02A 7PAZA 3TM6A 3P3UA 1FO0L 1QBMH 1A5FL 2DEWX 2R1YB 5I17B 1NCIA 3PHAA 3HG0A 2Z1KA 3QVAA 4N22A 1IBZA 3UG5A 4EN3B 4WU7B 3UBXA 2OSLA 4KDWA 5DEFA 4ELKA 1QSFD 5DMGC 1Z9PA 1G7PA 3RNQA 4EXPX 3Q44A 4IK7A 1LXMA 3PGFH 3WUZA 3QQ3B 4PJ5E 2AV7B 4MCYB 5CN1A 3FO1A 4GIAA 2FH8A 1XD1A 1HH6B 1VADB 3HB3C 4APQD 5K9OB 1HCZA 2AJZA 3D4YA 4X42A 4XXDB 4G9FA 1UXWA 3PCYA 5AW5B 2EKSB 2L7UA 1UWEL 3E1ZA 2I7OA 3B2VH 1ZAGA 1N6QL 2CK0L 3OZ9H 1PFOA 1HKLH 2IAND 1E6JH 1S9WA 1GZHC 1UFGA 4DP8X 1CI5A 3KHOA 4PJCF 5E6YA 1RJLA 4JDTL 4N26A 2ZF8A 1WZLA 5GZNA 4BHUI 3UYPB 2GEQA 4MWFB 3C9NB 4P23D 4S11A 3PS6A 2R29A 2BRRH 2EDMA 1V27A 1BIIB 12E8H 2VXVH 5AENA 3J27A 3VH8B 2EXTA 4WUUD 4LSQH 4N2AA 1KYUA 5F97E 2ZWZA 4H5SA 3QEHA 1NLBL 3SDAA 2IOOA 3NCBB 1IKNC 4UTBA 2XQBL 3ZDXF 3GSVB 3HFML 4H1LB 2JKJA 3FO0L 3OR7A 4YXLH 1CFTA 1EFXD 2BPBA 1SNRA 4PJ7E 3VB8A 2ZSWA 1KPUA 2DV6A 4HPOH 4KMTH 3EH2A 5F7NC 1VFOA 2WUBH 2WXKA 3BQUD 3HMXA 1KCVH 1SHWA 3KWTA 5K59E 3U25A 1P7BA 4X4YA 5CCGE 5DEZA 4PHZA 1YEGL 1GZPB 1BXVA 2DRUA 4IMLA 3R7RA 4L3FA 3QEQE 4OUOA 3HFMH 1UZGA 2WXNA 4QRPD 4YZFE 4MTMA 1U92B 2VDOL 12E8L 4Z7VF 5B7FA 1J5CA 4YGVB 5JHDE 3HE7B 1A21A 2ENQA 3DA0A 3CH8A 3NFNB 4XP1L 4ESKA 1BECA 1O9ZA 4FYQA 4MJ5B 2ZX9A 2G5BB 3FQUB 2GBTA 2YPVL 5JW4Q 2PTVA 1FIGH 3G5ZB 4Z7VA 1P6AB 2X44D 2VDOH 2A0LD 2JNZA 4I7ZC 3TIEB 4L2YA 2VXTH 1EO8L 4Z7QE 4XMXA 3ZKXC 2EABA 1E2VA 4LASH 1VACA 2DQIL 3QIWB 4OFIA 2IBZX 3QUGA 2OV0A 5DJAA 1MHHB 1FNEA 2KLRA 1XBDA 3RNKA 1MI5D 3RJDA 1K3ZA 4NC1E 5KBNC 2YQBA 3KS0J 3QEUB 3DX6A 5EU5B 2UY7B 5D5MB 1FNGB 1G7IA 1Z9SB 5CS7A 3DGGA 1NJ9B 5D5MA 1NOFA 1WHPA 3N1PC 3QULA 2Z8RA 4JFUA 4WTZA 5K93A 4AEIL 5DFAA 5I28A 2YK1H 4DKEL 5HP5A 1FQ9C 3H7LA 3I3DA 1XXDC 1J5IA 2X10A 2NCMA 4EE2A 4I3SH 3WY2A 4HWZA 1Z5HA 3JT2A 1ND0A 3BPLC 3HC0B 4PJCA 4R5TA 1IC7H 3CVHA 4Y4HB 1DBBH 3OJMB 1UCBH 3MRDA 2IDUA 3KPRD 3VI4B 2XKNB 2H9GA 4POZC 2JCCB 2VQUA 2EIMB 1LP9B 1QLRB 3NRQA 4NQDA 3D3VA 5IB2A 2HKFH 1BJMA 3GUTA 1ZKAA 1T1XA 4JG1L 1FH5H 3RL1A 3NCYS 2UXFA 5EZLB 3FC8A 4FP8H 4PLKD 4DKAA 3WJMB 3S8WA 1HHJA 1PCSA 1MFUA 3C6EA 3ISWA 1ZA3A 4J7RA 1CICA 5D70L 2IQAA 5C08A 4C56D 1P2CA 1I3RB 1QHOA 3CVIH 3RY5A 2A6JB 5BS0B 2YRZA 1UCBL 3FN9A 2OMUB 2LABA 4H1LG 5SWSE 3UC0H 3BPCA 3WNMA 2FJGB 3PQYB 2OSYA 4Z8FH 5FGRA 1U2CA 2WLIB 3IEAA 2W0KA 3ZBMA 5C0AD 1AGCA 4L4VE 4QCIB 2LR4A 1DVSA 1EZLA 2GJPA 1T20B 3S34H 1TQBB 4PJHA 5IBLC 2BZCA 5IB5B 4PP2A 1BIIA 2VM4A 4GW5B 4UTBH 5SWQB 2XSKA 4UIMA 5CZVH 5EG6C 2CK0H 1XZ0B 3JUYA 4NO0B 1HZHL 1NGPL 3AG4B 2NSQA 5IMLB 4MCMA 3EZ8A 1NM4A 4BFFA 1MHCB 3CGTA 4K8RH 4M6ML 3GI9H 3SO3C 1QR4A 4RFEA 1T1YB 2F68X 1U8KA 1ZJBA 1HINL 4POZD 1DZBA 4PBVC 1L0YA 3TL5A 4JFFE 3UJJH 3TBYB 3MNMA 2W9EH 5EUKB 1UCTA 1YMMA 3HPJA 2LV4A 4U6YA 3I02B 4IKJA 4GKSB 3L81A 1QO3B 4D0CA 2J71A 3LN9A 1GMEA 4U0RC 5SX5K 3SSGA 5DMKB 3UABA 1VFAA 4B60A 3QI9A 5E8EA 5EU3A 2DQGL 4PJIE 2ZD0A 3AWGA 1T1WB 3DROB 2ZYRA 3MA9L 4NZFA 1ETZB 3TJEH 1NCWH 2CKBH 2ZCLH 4IBLT 4JKMA 3WIIL 4I0KA 4MAZA 1O6VA 1ZA3B 4KUCD 5C08B 1PG7H 1P5UC 3NSYA 4F8OA 3I75A 1BVZA 1YNTF 4MNQA 3KXFD 2VL5A 4H8QA 4JE0A 1AJ7H 2HJFB 1MIEH 1OCCB 4PRIA 5J12C 3T3PE 4HBCH 1QLFA 3A4EA 5ABAA 3LPOA 5DD6B 3U48A 4KO5A 5KVGH 5DDHA 1MAKA 1I8LA 2FQEA 2ROXA 1Q94A 5FDWB 1AQDA 2X1XR 2Z93A 1I1FA 1Q1JL 4P49A 2B2XH 4HAGA 5DA4A 2V2WA 4NP4L 1J87A 2ZPKH 3P3RA 1GMIA 4XAKE 4LO9A 1S7WB 4K7PY 4QXTB 1T7XA 2CRMA 3GTNA 4RA3A 4KX9A 5K9QI 1ET8A 4IGBD 4HLZG 3SO5A 4ZXBA 5JPMC 5L0QC 2WTRB 3OGCA 4F7PB 4MDJA 3OKYA 3LKNB 4X6DE 3M1BB 5C0GA 4QOKD 5LNDA 1MWAL 2WANA 1A2YB 2VAAA 3EYSH 3NT0A 1P9MA 2NY1D 4M5YH 1CGUA 3OSVA 3VFRB 3KW8A 3CPUA 4P2QD 3NA4A 3FCUB 1CDCA 1J05A 3D1MC 43CAA 3QJVB 4LDLB 2E7CA 3EYVB 2A6IA 2VN7A 3BPLB 4FZEL 5SX5H 2UVFA 5AW6B 3GZOA 5E5MA 1J1OL 5IFHH 1DZ0A 2CRZA 2VQ1B 3JSSA 4I3SL 4XTRC 3MI6A 5E9DE 2KYIA 4AYID 5GJSL 4KJQD 4M56A 1RZ8B 4X0NA 3ZKMD 2NUTA 2I60L 5I26A 5C2UB 3B8YA 4A39A 4TMPA 3S97C 2BDNL 3RY4A 4O02L 5JXAL 1QFWL 1GIGH 3B9KB 3QZWB 1J1OH 2DEXX 2K0RA 1V10A 3ARSA 1TQTA 3NJHA 5D7LD 3UMTA 1PZ3A 3EYSL 2XPZA 3E6FA 4PTTA 4G6FB 3UADA 5FA3B 5I18H 2ADJB 2BSDA 2VISA 1MPAL 4A04A 4L29B 2XX1A 1AS7A 1IT9H 4KHTH 5FKPB 2TAAA 3PABA 5D72L 1LO4H 2X0VA 4P5TD 2CBQA 3ZDWA 5JZ7D 2AQSA 4N4YB 1CT8B 1FDLH 2W38A 5SX4I 4AW4A 3FRPB 3PRZA 4S1SH 5B22A 3T1FA 3VJ6A 4JDEA 2UZIH 1FFPA 3PY9A 4JHVA 4Q2ZB 3GPEA 4NLHA 5AOIA 4Z77B 1WWWX 3FJTA 1EVUA 4YBHA 3VU1A 2E74C 1IC4L 1AGEA 1CYGA 4HIEA 2VGLM 2PABA 2Q3AA 1X9UA 2A73A 5DJYA 1X5FA 3OAZH 3RIFF 5JMOC 1MH5A 4M93C 4U3SA 1OTTC 4Y4KC 3T0AA 4HUVA 4K3GA 3VA2C 4BFRA 2DQFA 4GP8B 3ZX1A 1K4CA 1PQZB 4XC1H 3BUIA 1KJ3H 3VFSA 1U8PA 4Q9BA 3SO3B 2OK0L 4AG4L 3QJUB 4BKLB 5IJCC 3ESNA 5DHYA 3H56A 4Y1AD 2CKNA 1VLXA 4PRID 2X6CA 1A8ZA 1LK3H 4GG6E 2C4FU 1AACA 1YYMH 1FHNA 2OX5A 4B96A 1BQHG 2YPLE 1UJ3A 5E9DB 1IM9A 3MRPB 3RGVD 3QQDA 1E5ZA 3TA3A 3H3BC 5JR1L 3O2WL 1JWSB 2I07B 2AJVH 4ZO7A 4NUMA 3CX5K 3HN8A 4XAWH 3T0ED 1XGTA 4UWQB 4PJGF 1XSIA 2NOYA 2W0FA 4U1NB 2PWFA 5FYLE 3BAKA 3FCGA 1DQDL 4GI8A 4JANA 2F6AA 2CZNA 2XG5B 1OANA 5EBLB 4H8WL 3DETC 4WU7A 5LBVA 1HCFX 3UBXB 5DK2A 1JZ8A 3MA7A 1F0LA 1FPTL 1SVZA 4H2CA 4LLYA 4XX1G 5I1IH 1GSKA 3LB6C 4FA7B 2J8OA 3PJLA 5ESQB 3CK0L 3U46A 2XWTA 4U6TA 3QJHA 2X7LA 4PJ8B 4B9IA 3NGBC 1AS6A 1YQVL 3VI3E 2YAQA 1DVQA 3PNRB 1SY6A 4JDVA 5I1AA 1KCRL 5ISZB 4JUTA 4A37A 4NO3B 4JN1H 1NDMA 3G6AB 1F18A 3D85A 2JK5B 5AD0B 3AREC 1TKWB 1UM4H 1BQLL 3VFSB 2AV1B 2D3JA 3ARTA 1C5CH 5IV2B 3D8MA 1NIFA 2VN5A 2RGSA 1GOGA 2BSEA 2ZKYA 4JFYB 5KYUB 1A6AB 4QDGA 4EBQH 1BF8A 4XE5B 5DHDA 2NUPA 5CBAA 3KJ4B 2BERA 3BAEL 1KCRH 1MH5B 1CLCA 1FFQA 5E2VH 4DH2A 3DC0A 4Y2OB 5DVNA 3QWOB 1IBGL 4UQEA 2CHZA 5B8CB 1DVYA 1NAKL 2WV3A 1WIPA 2WXPA 1T7WA 4IM8A 4R96B 3K2MC 2Q76B 5HVHB 4UMGA 1COBA 5HI3D 2XZAH 1AXTL 2HUHA 3FO2B 5EORH 2E7MA 4Y5XB 3RWCA 4PMEA 2CGRL 3HNSH 4NQCA 1NANH 4IJ3C 4R5XA 5CSBA 1BQLH 4OZFG 3W39B 3QS2A 3TC9A 3RDTB 3BP5A 1A9BA 4IBSA 5D7SL 3BD5A 3FT4A 3WSQH 4AQ1A 1TYJA 2IAMA 4TXVB 5D7EA 4HCIA 2K4WA 5E8NA 3SPVA 3BAEH 2OTUB 2AITA 2R0LH 4LVHB 1DQMH 4BSJA 1Y7VA 3MCYA 2C3XA 3VMNA 4MQ7B 5KW9H 3GSWA 4ZMPA 1Q8MA 2WXMA 4LLQA 1XDTT 3O3BB 3UTTB 5GZOA 3RQ3A 5BXFB 4YSUA 4DZBB 4GRWF 4NQDD 3OMZA 2J6EA 3ZR6A 4QKTA 1WF5A 3RURA 5I5IA 2IH1B 3GMNB 1U58B 2MPVA 1FFOB 1MVUA 5AL8A 1P5UB 4WHTA 2CO3A 1AKJB 3LZFH 2BM3A 4EI6B 4BINA 1CU4L 4LB8A 2R23B 3U7WH 5KSVA 2Z91B 4HS8L 2NSXA 4F7KA 3OKOA 2IANE 4K8RD 2GTZA 1KLUB 5HHME 3FCTA 5CR8A 2AKRA 2VXTL 2FSDA 1M2OA 5KJ4A 2FX7L 4PD4K 2DQIH 4PGDA 5KW9L 4KTDL 3ARBA 2H3XC 3U9WA 5MENA 3FT1A 3RTQB 1S46A 1N0XL 5KZCB 1R47A 3P30L 1HEZB 1KT2A 4V1DA 5JHLA 3BSHA 2Y69B 1J88A 1NUFA 2ALWA 4RZKA 1KWGA 3QUXC 4JM2D 5H4YA 3F01A 4G59C 3D4CA 3UZQB 4JFPB 1X9RA 2WBJB 4X4XA 2ED6A 4UT7H 4P3CL 4TNVK 1OAZL 2LQRA 5FW8A 3R06B 3FTGA 1Z9NA 3ULVD 1KELH 2P80D 4ZW8A 2R0WL 3MV9D 4NXSA 3P9LA 3ZQ9A 4NQVB 4AG4H 3OG4B 2VABB 2A74B 3HIZA 5AVXB 1LEGB 1JZGA 2CH8A 4F80A 2JI2A 2ZXEB 4ZUSA 4TPRH 2ITFA 2OTWA 2HT3D 4U49A 1QQDA 2IH1A 2XA8L 1KIRA 5I0DA 4PWKA 4QNPF 5SWSD 4CN1A 1EQWA 4HQQL 3WHXA 1SJVA 3IJEA 5C8JA 3SQRA 5HPMA 4YIQA 3WS6A 1U8IA 1KJ2A 3U1SL 3VD5A 4F2MA 4ONHA 2VWEC 4A6YH 3QEQB 5EWIH 3OAYH 4AJ0A 2C5DC 3V0WL 3CVIL 4U1KA 3QEQA 4YUEH 3GXNA 5HYQB 4RA0C 3VU2A 5JW4N 3BXNA 2Y22A 2IPKA 3RVUC 2DJSA 1Z9MA 2UZPA 3FRPG 5C08E 3BQUC 3Q2VA 2AXWA 1ASPA 2EYRB 4NUJB 4PWHA 2HLAB 2Q6WA 1XSOA 5FYJL 1J9CT 4P2RB 1DFBH 3VO0A 3K91A 2CMRL 5HJDA 3SDAD 3V4LA 3GO1H 1VJSA 1JD9A 2CNYA 5CINL 1IIKA 4ZDHB 2YA1A 3KDMB 4PWJA 4WW1B 1LM8V 5IQ9A 4FYRA 4OZFH 2G30A 2NT1A 1A7OL 2J88H 3RWJA 1MNUL 5K9JH 1N2RB 3P4OA 4U0QB 3NCCB 3EUDA 4OTXL 1WAAF 2Q7YA 3LV3B 1QRNE 3RPBA 3MRIB 3IKCA 4FFTA 5JHDB 3MRIA 1ZS8A 2R9HC 2W80C 3FUJA 1JBJA 1E5YA 1FNHA 2HG0A 5DJYB 4ZJ9A 5IT2H 3UAAA 2XBDA 2XN9B 4FEMA 1E43A 2EVFA 4RGNC 2FIKA 4KY1L 3VXQB 2Z65C 1JWMB 2HT3C 4RRPM 3ME0B 1EK3A 2NY6B 1FYTE 2O5XL 3DMMB 2VR9A 2Z31A 1U8MA 4DKFH 3UZEA 2VE6B 4OM0L 3TO2A 2CBMA 2V8MA 3H6JA 1GKEA 2EECA 5J9PB 1T2JA 4K7FB 2IQAB 3IRCA 4K4KA 4JPVH 4O2FA 1GC1H 1KB3A 3HG3A 2AKRB 3RPIB 4BH8A 3FONB 1R3HB 3BXNB 4XWGL 4RX4D 3L1OH 3RG1C 4OLWL 1FYTB 2VISB 4ZOAA 3QDJB 4GUCA 3ROLB 2HKHH 3OHXC 1A14L 4ONGL 4XC3L 4FCAA 1ZDSA 3QG6B 3S36H 3VXUE 4M1DL 1OSPH 1R3KB 3F7YB 2G3XA 5D2NA 3SDXB 4YHOL 2X6BA 1SDDA 4XWOC 3MLSH 4GKZA 2WK2A 5AEAA 3ZKQD 4LCIL 2DTMH 2LE9A 1RJYB 4YDJB 5CNHA 2E76C 4K71C 2FEDD 2P80A 4NRZA 4UILL 3Q1SH 5I1CL 1CD8A 1XT5A 4ZUVB 5JPMB 4BK5C 5B1BB 2R69H 3ARPA 4QRAA 1YMHB 1I8IB 2HCZX 5AYUL 1UTDA 3REWB 3CXHJ 3KGTA 3F58L 2VABA 2IOIA 3E6HA 3KPRB 3VWKA 3QXUA 4ODXB 1T5XB 2FO1A 4G7VH 4I2XE 4PRHE 4WEEA 1INDH 3F7VB 4NUGL 4U3SB 4GAJL 2XICA 4MSWB 4AL8C 1U8CA 2QQNL 5EBMA 4EOWL 1KCUL 1U93A 1VENA 3DOSB 5FYLD 4HW6A 4GXVH 4XODA 4KNQA 1TQSA 3X1EA 3BWUC 2W60B 3G5YB 1NH6A 1DBKL 2VMFA 5KSUA 3D87B 4G72B 4JQXC 5G5DB 2W60A 4HCRA 4Z7IA 5J11C 2K6YA 4KJYA 2DM2A 3ZSSA 4Y9GA 4MBOA 2A99A 4Y2LA 2XQBH 4YHZL 2NR6C 4AJYV 3B9KC 5DQDH 1FSKB 2J8UF 5KYUA 5LWYH 1SVCP 3NCFB 2H1LM 2V7NA 1TG8A 1MCDA 3ULVH 3ESMA 4KK8C 5KSVB 2AK1H 5K39A 1I4FB 1AYRA 5DRXB 1CLYH 1NBVH 4MMYA 4DFHA 3X3GH 4XPHL 2GIXA 5DQDL 2P49B 3ZDZF 3UEQA 3O4LD 5KWYC 1L0XA 5JQ6L 4G83A 2XWTB 1J8HE 4DN4L 1I7ZA 1S9XB 4WAFA 4Y88A 4KMTL 1A4KA 2L4OA 5JORB 1TF4A 1ESOA 2OSXA 4UM9A 1SY6L 2E7DA 1KV3A 5ECGA 3L4TA 2EDFA 3D48R 1AD0A 5JW5A 1BF5A 5DD0H 4JM4H 5D5MF 4PY7A 1HH9A 4YHNB 5LWYL 3THML 3FCSB 3E2HC 3HRZC 4RDQF 2C26A 4AH2A 1IQWL 3HPJB 3RRQA 2X40A 4G6MH 1D9KA 1CXKA 1RK7A 3CFEA 3Q01A 4RFNC 3TA4D 3W0WA 2CO6B 3OKNB 2PO6D 2OL3H 1TPXC 2DQGH 2DJMA 1S9VB 2FQDA 4L1HA 2VE6A 4MNGB 4R26L 4G11A 1S3RA 2J6EH 5ID1B 1KIRB 2H2SD 4AEEA 1KIUA 1TJGL 4KXCA 4OF8A 4YHPA 1YYLL 5JZ7C 1YG9A 5DXWA 4I1PA 1PX8A 5DYOA 4K3EH 1XZ0A 4NO0A 4S1QL 4X7EC 5IESL 4UIKH 3D0LA 3DARA 2VDKH 3Q05A 3L3OA 2IH3B 2FGZA 4JZNA 4LEEA 5DRWA 1QP1A 3SE9H 1EVTC 1CGYA 1DVTA 1ZANH 3NRFA 2PTUA 3RU8H 4XMWA 3QR0A 5KVEE 1AXIB 1BZ8A 1G9MH 2P5WA 4WWKB 5HHOB 2MCG1 1MI5B 3TBVA 4U31A 1S7RA 4LP4A 5DEFB 4FA6A 5GS0D 4RMVA 1N8ZB 1HEZA 2A9DA 3VFPB 3F83A 1F3JB 3MBWB 2D7NA 5AYTA 2Z9TA 4L0PB 2PW1B 4TL4A 3ZE0E 1OSYA 1M3JA 1S9VA 2PWEA 2RTTA 5AWNH 1T6WA 4XCFH 2X12A 1EXUB 2XRAL 3RU8L 3DSFL 1XIWD 2HKFL 5ILTL 3LS4H 4RMRA 2VDLH 5IREA 3V5DB 1TJIH 5KG9A 4KI5F 5CBEB 1SBSH 3ABZA 3ULUE 5J1AA 2WUCL 3GBLA 4F9PA 1BXAA 1QLEL 3DPDA 5HJGA 3GHEH 4KFZC 3VACA 4W9ZA 3WIFB 4PJGE 1TSHA 4WHTB 1NC4B 5AWNL 1AD0B 4F9PC 4U33A 1LE5A 4AV4A 1CJYA 4XP4H 5KOMC 1J0YA 5EEUA 3VRLF 3NH7H 2VO5A 4UM8B 2NZ9D 3KR3H 3RFZA 4LSUH 5HHVL 5LHDA 2Y5QA 1DJWA 4CBZA 3AU0A 4O02H 5JXAH 3PAYA 3DUSB 2R8SH 3D7PA 1NEUA 1GA2A 1C5CL 4KQ3H 1OTUC 5ENWB 2VR4A 1LD9A 1RIHL 2DWDB 4FQ1L 4JPIB 5CZRA 5EU4A 3N9GH 1UASA 5GISL 5CIPA 3U6RA 3ZHFA 4J8RB 3RGBA 1LNUB 4OCLC 3HKFA 5E2VL 1SYVB 4LZKA 4IMKA 2APTA 2MWCA 4P48A 2AQPA 2AZAA 3WD5L 1A7RH 3UERA 1Y6MR 4P3DA 3U2SA 1I9IL 2P43B 4L0YA 1J18A 3GBDA 3HI5L 3ZQXA 3WNIA 4LCUA 2E9BA 1UVQB 2FJFB 2QQLL 3ZKMC 5H2BA 3OJVC 4LCUB 2J6WA 3I85A 1CGSH 5GRJL 2VXSH 1EHLL 2QGEA 4LQ1A 5KBMA 4KQ3L 3QNZB 1JPGA 3GJFH 1ZLUH 3QHZL 3F2LA 4FHJA 1OHQA 3VFVB 1IGJB 2YFNA 2NYYD 1FZJB 4MAUL 4NP9A 2R56L 2YEZA 5DLLA 3IMBA 5EZOL 4J12A 1KJ3L 4QRPB 2F1BA 3NFNA 3HBZA 2F2HA 4GSDL 1T21A 4Y16D 3W56A 5LBGA 2GABA 1DJIA 4L4JA 4MD4B 3RGVA 4CW1A 5HYIA 4ZPVB 3FTWA 4FABL 3NCYP 4ZSOA 3GRWA 2AABL 4G82A 1MQ8A 3DUSA 1M6UA 2ATPB 3GSRB 1MZYA 4DAGH 1RZKH 4YHLL 4KKPA 1EBAA 1IX2A 3KWWB 5BXFA 5E4EB 4N2IA 1B0RA 3O3DB 1A1NA 1NFIA 3QDGA 1R6VA 3KE0A 3T0EE 3O3AB 1CWVA 3EJRA 1KPUB 4PG2A 2PCFA 2YO3A 4DEPC 3MV9E 4YDZA 4ZFGH 3ES6A 3RZCB 3BGFC 4LLAA 4NKIL 3ZRFC 2R1WA 1PD0A 1IILE 4NFBA 2NW3B 3CDGA 2APBA 5IKCB 2X6VA 5CSZB 3DJRA 3EFDH 4DKDC 3ATAA 3ETSA 3QWNA 3NZUA 4JY5H 4P5RA 5CO1A 1C08B 4KFMA 2HRPH 1FFTB 4HIPA 4OF6A 4DJMA 3KBHE 3QAZB 2BNRA 4F57L 3O4OB 4ZMLA 2BW5A 1PX4A 2MOQA 5EBWA 1T66C 1F1AA 4JO8A 4OGXL 4F58H 1UFUA 3AGWA 5EFIB 2OMTB 1JWUA 2WLHA 4I1NB 1ZMYA 4MYWB 3WS3A 1P5VA 2VDRB 4LCCC 5FCUL 5IROC 3DYPA 5HSFA 3IETB 2C9VA 4JQVC 5SWSB 3S5YA 4Z3JA 1JZEA 3IETA 2GB2A 4E9XA 4JY5L 3I74A 3CN2A 2IC2A 4TUOB 2G9KA 5KANG 4R7DB 4AVJA 3FU6A 3IWVA 5CD5D 1Z3RA 3BD3A 4HGWA 5BRZA 3ZSTA 5KSUB 1XGQB 3BZEB 3S35H 2KHAA 2WLZA 2G4EA 3KYOA 4ZUTB 4J4PD 5GSVB 2NY2D 2XWEA 2A6JA 2BVOA 4KVNL 3O45A 4TQIA 4F58L 2D7TH 4X4YB 1KN4L 1A0QH 4OBSA 1GGIL 4F93B 1JZ3A 5I1EH 2HN7A 1BX2A 2MQCA 3OMAB 4NAQA 2EH8L 1E6OH 3PHQA 4OLYH 4ZYKB 4HPHA 3UP6A 3NFSL 3LIZH 1H19A 2WVSA 4MASA 4Z76B 5DD3L 4ZUVA 1BGXL 1F3DJ 4P07A 1WZ1L 2D7OA 4NRXA 4NSKB 3S4SB 5K33A 1W91A 3B9KD 4QY8A 1A7PL 1BEYL 3PWJA 2D9QB 5EORL 3IVKA 1VIWA 4NQUA 2UZXA 1A02N 2R0ZL 4OD2B 1B88A 4QJ4B 2J5WA 1RUQH 5FECB 4ZMYA 3M8OL 1EUUA 1YNKL 2ZZUT 2BW4A 2QBWA 1AGFA 5GGVL 2ATKB 2Y25A 4ANXA 4DP1X 1I82A 2NNFA 2WLJA 5I1EL 5K59F 1CXFA 4X9HA 4WK0B 3B37A 1ZXQA 5LBSH 3SDYH 3T8XA 2KUTA 3DPBB 3T6QC 5DVKA 2GCYB 2A74C 4ZTPH 1NCTA 2FNWA 3ETBF 5CU9A 3KWXA 4KKAD 1KXTB 3SKNA 1U21A 5IMKB 5MP6L 3VFRA 5CAYB 4ZFOB 5EU5A 4YXKL 5M95B 1B4JL 3TO2B 5HDQL 1EH9A 1MCIA 2YUZA 4AW7A 1G9HA 4K7PH 3VFUB 1A7QH 3UL4A 3VFTB 4JQVA 3P2DA 3FBKA 3QIWA 4WI9A 4HKJB 3QHTC 2QKSA 1PX3A 3V4PA 3IF1B 1NAMA 2ZXCA 4X6DB 3RWIB 5D1QC 3H9SB 1Q0YL 2BIMA 4TLKA 5CHNB 4OD1L 3ZXAC 1QEWB 3QFJB 5I8CA 5LXGH 4PS8A 3FMGH 2JJVA 1QSED 2OQJA 3Q2NA 3L1EA 1ZT4B 1QG3A 3EBGA 3JWOH 5SV3A 4AENA 1DQDH 3VWKB 1H3XA 4E9VA 4TNWK 4C54A 1ID2A 4JKWA 3HE7A 3W1ZA 2UXGA 3JTBA 1FCCA 2R4RH 3JV0A 4CSSA 2IG2L 2BSED 1YQ2A 3D51A 4AL8H 1WO2A 5J4MA 4TRPH 2HP4A 2SEBA 3Q6GL 4PVMA 5I1JL 3GUFA 4HCGA 4OD3L 5DU7A 5T1KB 4L4VB 1QKZL 5I5MA 2QQKH 3TT3H 5INDB 4YLQT 4DIXA 3GM8A 2AHIA 5DJDB 5GS0C 5IMOB 4OJCA 3PQYE 5IEKB 4BV1A 1QBLL 2CALA 3HLAB 4ILDA 1CFNA 4QLRA 2EDLA 3ILDA 1WC7A 2JKSA 4A2HA 4ANWA 4AITA 5HPMB 3PV6A 5T8IA 4WO4C 4G7QB 1K8DA 3DYMA 4K7FA 4M6AA 5FV1L 4AMWA 1YUHB 2DL9A 3GZPA 1E8WA 3CMOL 2H2PC 4LF3B 1HE7A 1GH7A 1V05A 1E65A 2JQZA 4NJAL 3QNYA 2LFEA 4PGEB 4OLVH 2VRQA 4KRPB 5A1AA 3N06B 3SDXE 1NICA 2DKMA 5FYLH 4GXUN 1BVOA 5BO1L 1B2WH 2J88L 3GS0A 5L2KE 3LKRB 2A74A 3UX9B 3MNDA 4PYGA 1DJZA 2WXQA 1JZ7A 3QNXA 4PJXA 4W9CC 4JG9A 4JCLA 3A21A 2XN0A 1CFVL 1RUAL 2XN1A 3LRSA 5DFTA 1V5JA 5FHBH 1TNNA 1G4RA 3FQYA 4YNYA 2XV6B 2ZF9A 4LT7A 2EUXA 4FQPA 1BREA 1TZOA 2GT9B 3BKJL 1ZHKA 2HH0L 3P40A 4JRXA 1UD6A 3CDYA 2BNRD 4LVOC 3TEYA 1Q72L 2DIAA 4GI6A 4RAHA 5GS2D 2CIIA 1HZLA 3CAFA 4I2XB 3SD5A 5LAXB 1FL3A 1U3NA 1WGVA 3QYNA 4BDVA 4PJFE 1G7LA 5C0DA 4KVNH 2GFBA 5KAQF 2J8UE 2P44B 1JGIA 4I4WA 3C60D 2GVYA 2Y72A 3KDPB 2B9BA 3IE9A 4PV8B 3SYOA 3F7VA 1MCCA 2KBGA 3OKNA 4JO1H 4WCYH 5DEGA 1M56B 1RFDH 1AH1A 4H44C 3RB5A 5BS0E 4P23A 5IQOA 3TZVC 3SKUD 5GGUA 1BGXH 4RRPG 1NIEA 1WAEA 5KBKA 4PVNA 4IBWA 2CM6A 4XMLH 3O3AA 3VXUB 3K5RA 2NSMA 3ULVC 4XVSL 3VH8A 1DQIA 4NHCH 2KZKA 5HYEA 5IW6A 1J1PL 2AJYL 2DTSA 1EANA 1WH0A 2VJ8A 5ELIA 5F7WC 2K9UA 1D2OA 3IGKA 4BFJA 4HFWB 1QWNA 4Y16A 3T09A 1MCWW 4K5LA 3V6ZA 1CN4A 1G1CA 1F4HA 1IC7L 3D33A 4MCNA 1DANT 4MD5A 4GH7B 1U6AH 4PI2A 4P9HL 5AVQB 3VI4E 5C9JA 2GAZA 4XNUL 1HHIB 2YN3A 3V6OC 1OXYA 4PUBL 5SWQA 1II4E 4XNXL 2YWYA 5BMFH 1XB3A 4TOYL 4MS6A 2DH2A 3FHAA 4MQXD 2WVVB 4Z78A 4F91B 3HAEA 1D5IH 3WMSA 1H8OA 1ACYH 1UOVA 2WLMA 1PMYA 4K3JL 3KL5A 1KCUH 4U6HA 2IF7A 3MROB 4I0PA 2K9FB 3ASNB 2XQYA 4H0LC 3N40P 1S7QA 1NFDE 1JWMA 3IU3A 4CN4A 5BJTB 3MYJB 1NC4D 2H1XA 1J48A 3CTTA 4MSWA 3BPNB 2J1WA 1UGKA 5CZVL 5DT1L 3L4XA 3G7TA 3UEZA 4JRYE 1WEJL 4OJFH 5I6NA 1NGPH 1HHJB 2R0KH 4BKSC 4E9YA 5HGAB 2RBLA 2GQHA 4G7SB 1JZJA 3ET9F 4TNVF 1S2EA 5BV7B 3BKMH 4XNZC 2HJFA 4LSUL 5HHVH 4JUSA 5LG6A 4N0UE 3MV11 4MJIE 2G0KA 2X42A 4HUXB 5T3ZE 4FG6C 4HLZH 4N90E 4LPVA 3AQDA 1CLYL 1IBHA 2FZ3B 3WEAA 1W6WA 1PZ2A 1SHSA 3B83A 2J55A 4U1SB 2DWSA 3BE1H 3FN0H 1I8KB 2R83A 3K6DA 4K94C 3D39E 1ML0A 2A4ZA 3HS0C 4LLDA 3QO1A 4KO6A 2MTPA 4IJTA 5BVPH 3LKQA 3JWDC 1MJUL 3IFOA 2NYZA 4LL9A 4S0HA 3D69A 3GINA 5E8NB 3SPVB 3S5ZA 4HMEA 1JIBA 3GRWH 5CKAA 5T3ZH 1OCWL 3WL9A 4HIXL 3ZZLA 1Y18B 2YPVA 2GK0A 5BV7L 1F58H 2CLZA 3CQPA 3TJHC 4QI3A 2YD1A 4CN6A 1JHTA 4RGOH 1N3NB 4FQ2H 1CL7H 1ORQB 4QD2E 4L9DA 3Q6FB 4Q14A 1BA9A 5JXED 1HNFA 4J23A 4F33B 4P2OB 1BOYA 1YY9C 4KK5D 3BE1L 1F3JA 3MBWA 3MHZA 2ZX5A 2PO6B 4R7DA 3VI3A 4YHKL 3U7YL 4Y2OA 4HFWA 3BP4B 4RGOL 2CK2A 3IDMA 3WUWA 3WEOA 4ADJA 6TAAA 4M48H 1T03L 4BA8A 4NC0B 3L4YA 4URKA 3NJJA 3ATEA 3CC5A 3BT2L 1TCRA 3H7BA 3W37A 3D0LB 3QCTH 3GF8A 4LLMA 1LDSA 2NTFA 1R0AL 1VSCA 4JFDA 4MNQB 2PTTA 4FFVC 3CZNA 4KKBC 2VXQH 4EIBA 4YLBA 1R3LA 2ICEA 4I0PD 4X4KA 4AM0B 4APXA 3RZCD 3L16A 4M7ZB 1I1YA 3I6KB 4PH8A 2NXYD 2UVEA 2FVNA 3FRPA 1RIVH 5AOZA 4WIQA 1I1YB 3AQXA 3I6KA 5DRZB 2O93L 2UX6A 3D39D 3UPRB 2OP4H 3GMMA 4FXLA 4FXTA 2XNAA 1RVFH 4MQTB 5HGDA 1VPOL 1MF2L 3MJGX 5EZLA 3LSOA 3FOMB 4N0YH 5MEOB 4JFEA 2ED9A 4RH4A 2PPCA 1HH9B 2DDQL 4FJZA 1PKQA 3QJSB 1FIGL 3DI3B 1JS4A 3TBYA 5JOEA 4PLNC 4NKDB 5FC9A 1HILB 4PJ9A 3NZ8A 1E4JA 1GZQB 5DGQA 5E2TL 4X6FA 4L3AA 4FCHA 4XOAA 4FS0A 4WI0B 3VI3B 2AW2A 1T0OA 3EDFA 2OLDA 3B2UD 2DBLH 1F90L 1RSYA 3C87A 4R0LB 4P2OA 4ANUA 4JEGB 4R3SA 1XGRB 1KTDB 3SDAC 4F7CA 2QPUA 4GW5A 4LP5A 1RZGB 2DB8A 4IRJD 5IW3A 4JVUA 1GS6X 4GEIA 4ERSL 5DJCB 4IS6B 5F1OB 3MBXH 2W59A 3DX3A 3RVWD 1AMXA 2WYIA 1F41A 5I2IA 2WYTA 1KJ2L 2WBKA 3CNKA 4S0SD 5BQ7A 2ZQKA 7TAAA 3LKQB 5E03A 3SZKC 5FYJD 3BAXA 5GGTL 4N2BA 1S5IH 1NEZA 4ATTA 2V2WB 3ML8A 1XGYL 4D9QD 2DM4A 3GSXA 1FZMA 3X3GL 4PS4H 4I9XA 4HT1H 1QRKA 5D7IE 5DLML 1A7RL 4OJEH 2Z0BA 5KSBE 4JG1H 1XV8A 2WWMC 3TT1H 2I60H 5DMYA 2EZ0D 4L1TA 2JK5A 3KWUA 2E9GA 2PETA 5DRNA 5EU7E 3MRGA 4N2MA 5KSAA 1BMWA 2XN2A 1HXYA 1GGCH 2EC9T 1TU2B 1KGCD 1PF3A 2WMPA 2VZ1A 5D6CB 3BGMB 1EA9C 2YRPA 1GGBL 2EEXA 4PJBB 2V9UA 1W80A 2VDRL 3ECBA 3WLBB 4BK5A 3S36X 3AZUA 4G6ML 4KXZH 4DZ8A 3A6BL 5EHFA 5I76A 3HVNA 2OJZL 4OCMC 3SQBB 4BUHA 5IWLC 4GG6A 3RWFA 1QFUL 1DLHA 2VDOB 4Z7OB 4Z3IA 3K1DA 1JE6A 1UB6A 4RX4A 4JGJA 5IVOA 4CVWA 3IJHA 3PDOA 3H0TA 1HQRB 3ROLA 2JTDA 5E4EC 3X1GA 2A6KA 4JM2A 2YMXL 4OI8A 3JWDH 5JDJA 3EYVA 5L7XL 1BJ1H 2V9TA 4KZEH 5F89A 2X87A 1D5BB 1BFVH 4WU5B 2Z31D 4Z5RA 3STZA 5EUOE 1NPNA 4PCSA 1RK0B 1UJ3B 2F15A 3MAWA 3QUZB 4WFFD 4Y4HD 5D1QA 3RKDD 3U9PH 2YD5A 1EFXA 2A9NL 4F7CB 1KGYE 4M00A 5D1XC 4R90H 4ATWA 2MOGA 4GQ9L 1EGJL 5FA4B 3ZU8A 2IQ9H 4NQEA 4YXHH 4Y2DB 3HC4L 3STLB 1UJTA 1CFSA 1JJUA 3WGUB 6PCYA 1UKSA 1ASQA 1N5AB 4QMEA 5AZ2H 4U1GC 1GR7A 5DO8A 4M48L 3ARUA 2H8PB 2FT8A 1JP5A 3EYOB 3MACH 2P46B 2VDLL 5HI5C 2F7PA 3ZKXB 4G5ZL 4JN1L 2C7UA 2QADD 4L8DA 3HG2A 2IANA 1IBGH 4WFHD 3GBML 4MCYA 3I50L 4TVUA 4L4VD 35C8H 4R4BA 3OXSA 4HGKC 3S37X 4X8GA 1Z0MA 2DLHA 3LSOB 4G9FD 5JXEA 4HLJA 1QD0A 4OGXH 4DGWC 3JTSB 1QKZH 4Z7UB 1YEFL 4EN3A 2YD0A 1AI1L 2HT2D 4GMTH 4JO5A 4MYPA 1E4WL 3S35L 3LNIA 3U1PA 1DCEA 1FG9C 1KUMA 4CVZB 1QBLH 35C8L 3ISYA 3MTXA 4OF7A 4JG5A 5HXMA 3SBQA 1ZGLP 2FK9A 1BG9A 4JL2A 4LIQH 1IL1B 2X4SA 3IK2A 3MR9A 4FXKA 1NGQH 2XETA 1MWOA 2GBUA 4XPTH 1A3LH 1G0DA 3VMPA 4PI0A 2MPAH 3TBWB 2QR0B 1QX1A 4NHUB 5CJQL 3INOA 4YIQB 3WJLA 3QQDB 3V0AC 3WXWL 1GC1C 1OGAB 1UM5H 1CF8H 3ECQA 3U0PA 3QPXH 2XKNA 3FSZA 3VWKD 1NKOA 3OR6B 1M7UA 2EXWD 3CFIC 4MXVE 4D8PB 4F7MA 4A38A 4CKVX 4N0UB 4G6KL 1UKQA 5IQ7L 2NQ3A 2UY6A 2EO9A 4U6XB 3ULUH 3MRHA 2M2DA 3H3PH 4FQIH 5FO9A 4GSXA 2WBXA 1OGPA 2Y4SA 3JZ7A 3ZKNC 3T0VA 1E8YA 1WZ1H 3LZQA 2DIEA 5C97A 4W70A 5HD8C 4XRCA 2C1PA 2VN3A 2B1OA 1UT1A 5F71A 2Q7AA 1NEPA 3DHMA 4NRYA 5ABZA 2WBWB 3T77B 2VXUL 1QABA 3C60B 4JKPL 4ZMTA 3WTSA 3VD2A 4JFEB 5AAWC 2YEVB 4JFFB 2LLLA 2OMVB 5IJKA 5JIHA 3QWRA 2FATH 2EVIA 1JI1A 5HHNB 4OKVA 3OQRA 4UT7L 1DLHB 3R8BB 1TSRA 3AM8A 4JDZA 2HJKB 4LMQE 1SVBA 4ZUUA 3T9WA 3GYRA 5IHZA 3DHUA 3VQMA 1XGPA 3WXVL 3H4FA 1E9OA 3U9UB 2YQGA 2BY0A 2W07A 2EICA 4JW3A 4KDTC 3MVSA 3P9MB 3B5TA 2DQHL 4G1EB 4AYEC 1X3DA 4O5LL 2OL3B 4XN1A 2O72A 1SMDA 1W72H 1A6ZB 4C47A 3QZLA 2HX8A 3QRGH 3UG3A 4NUPA 5CUSH 3QFJA 1PZDA 4K3DL 2I32A 3AABA 1H6EA 3I6GA 4GKZB 4M8UA 2VLJA 1AANA 1MHEA 2AEQH 3O0RH 5C0AE 3SKJL 1NIDA 1ITCA 3FU9A 4DQOH 3MZTA 2QZ5A 3JV4B 3L9RA 1NEZB 1QFUH 2WKOA 3W9DA 3IU3B 4DKTA 2C34A 5IK3A 3RIAF 2Q8AL 1CGXA 4OKVB 3GLZA 1U36A 5JHBA 4Y2DA 3FUIA 1W15A 2UWEF 5HHOD 2PP7A 3MRLB 4OZFB 3HNVL 4MAYD 4P5KB 4ODWB 3FB7A 3U4BL 1SZNA 1JZ4A 4U6YB 1UT9A 2EE6A 5CJXA 2NY3B 3H9ZA 3PGFL 4OZHF 4O2FB 4GBXD 4NZTL 5F96H 3TONA 4DN3H 1RK1B 4F3FB 1D5XB 4NKOB 4XRCB 1WAPA 3N42B 1IQDB 2NLJB 3ENEA 3SN6N 4C59B 1I85A 1U8MB 4FFYH 3ZTDC 5JR1H 1H9DA 1TVHB 1LD9B 1G7HA 2C9AA 2DWDA 3ARGA 3IDIA 4W9FC 5F9OH 2XWZA 4R4FH 4CA4A 2PXYA 4X5XA 4IJ3B 1IKFL 4J3TA 1YYML 1SN5A 3GSUA 2JFCA 4PG9B 4ETQA 3AAZB 3BWZA 4X50A 1FN4A 1UH2A 2G2RB 2IDQA 2W8CA 1Z5LB 3WHE1 2KZBA 3ZZ1A 5LN4A 3NIFB 3G5ZA 5GZOC 4AUUA 1KGCE 4GAYA 5I1GH 1ERNA 4KJWD 1U4FA 3KNBB 1KLGB 3UAJC 5HGGS 1AGCB 2P5EA 1YQVH 4NERA 2X4UA 2NPLX 1NFDF 2VMCA 2ZCZA 1GL4B 4OH2A 1GGIH 1IL1A 1A7PH 1WBYB 3TLRA 1E3FA 5L2JB 5DQJA 1E67A 2JB6B 4FFYL 1MNNA 1TUPA 2BY1A 3S3PA 3H2PA 1Q9OB 2GI0A 3LIZL 4X8JB 2VDQL 5KS9A 4R4FL 1DQQB 4WI2A 2DQTH 3UDWC 2AK4E 4IMLB 2VNCA 2NCEA 3QUYD 1FAKT 1WFNA 5D1QE 5LQBL 1PKQE 3T0EA 1KV7A 5EBLA 5DUPH 4HKZB 4U6HB 4NO2A 3T04D 3G5VA 4XNMB 4XNZB 3KPSE 3EGXB 1PLBA 5PAZA 1HVXA 3ARBD 4O9HH 2FLBT 5F9WC 3RUGB 4D3CL 3NTCH 3PGCA 1TMCB 4G9DA 2XPGB 4FLOA 1KJVA 4M7LH 3ZDYB 1R75A 3HA0A 3F62A 3MUHL 3WFBL 1AZVA 4PW4A 5CJXC 1IGCH 1T7YA 3T4YA 5DD1L 1O75A 3IJ8A 4ETQB 1FI8C 1HZKA 4XBPB 2GC4C 5D2LB 2H4EA 5T1LD 4FX5A 4Y2DC 2WKGA 1HOCA 1PY4A 3RL2A 2OW6A 3BFOA 4Y16B 3MJ9H 4NKQB 4XNAA 4FFZA 5TDNB 4B3EA 2WOYA 4BFIA 3AREA 3D25A 4L23A 2VUOA 4YR6B 1ZV9A 1K8DB 1NGXA 3B9AA 3DOHA 5L88L 3DLQR 4LLVB 1G7IB 5F89B 4B7IA 2PCPA 3V5KB 4ETYA 4GLRI 5D7JD 3T6XA 3QDHA 3NDYE 1KBBA 3K6OA 3UJIL 1F6AA 2WTPA 4JRYB 5TJWK 3HG1A 4CSTA 2NXZB 4A1RA 4DCQB 4X9YA 3GTVA 4PB0L 1P0SE 5EZJA 4PJDF 1PLCA 3VG0H 1FF5A 2NNAA 4XXCC 2VLLA 2GFBB 2X6MA 1JPST 4JJ5A 3GD1C 4OFKA 4F7EA 1CDJA 1QUNA 5E6SB 2G5BA 3FFDA 5IHHA 4XP9L 1WEJH 2FYVA 2W65B 3QG7L 3KAAA 3AXLB 3P4NB 3S88H 2E75C 4AK2A 4I3GA 2KPWA 4KO9A 4ZX6A 1AO7B 3FU0A 3LNEA 4AEHL 3B6SB 2JLLA 5I23A 2MHAA 2DMGA 4L3EB 1JGDA 2XWJA 5HGBB 1KCWA 3H54A 4DGVH 4B7LA 1NGZA 4IKKA 1I1AB 3QT2A 1L7IL 2V4LA 3BIAX 3I6LE 5DMJB 2Q7NA 6PAZA 1IJNA 4JDZB 4ZUUB 2DJUA 1ZGLM 3VVWA 5CILL 4HWZB 4AUJA 3T5WA 1TVBA 2J2ZA 2Y2WA 3WFEL 1F4XL 1DJYA 2YD2A 3P77B 5DZNA 1G9MC 4Z0XB 3SGJA 1WWBX 2AXFB 3NCMA 4GPVA 4OI7A 1J0ZA 3NJLA 4I48B 4FQXB 4WY7H 4K9EC 2FO4B 5DJ2B 3STBA 2X70A 4AYGA 3VW3H 5T1DL 1RZJC 4PGBA 5L9DL 4IBUA 1A7NL 1DVFC 1F5WA 3A24A 2XACC 2YD4A 4JO4H 4TULH 2ITCA 5CGYC 1ZTXH 2VDNL 4WV1C 3SGDH 4K55A 1N64L 2P24A 4UV4H 5IMMB 1AGFB 4WQOA 5ADPH 1IKFH 4KK6D 4U6XA 1UD8A 4CC4A 1VRSA 4X6BB 1IM9D 4NZRH 4YDJA 4EKJA 1YSOA 5KVFL 3L95A 4NNXA 4PLOB 4TM9A 3ZTNL 5LGKA 2EKJA 3IJ9A 2PR4L 3A67L 2B59B 5GGQL 5DQ9B 2NUPB 2YRLA 1KTJA 2G9HB 3I2CH 4G9DB 1QPPA 3V5HB 2D4DA 3MRMB 5SX4H 2FUTA 4QXWA 3F00A 2P9RA 5LN8A 3WO4B 1MREH 4PRHA 2A4EA 3BVWA 4OUUB 5F9DC 2GY7B 3V5DA 5KG9B 3S96A 2FBRA 1QMUA 1OTSC 3UAFA 3CDZA 4XMKH 3CFJA 3M1CA 3L9EA 4YC2C 4HSAC 4MA3A 3TA3C 1CGTA 2OMXB 3KLQA 5ALCL 3EFOB 5HJ3A 4WJ5B 2G60H 4IOIB 2Y1VA 4JFEE 2V9RA 2X3BA 3UG4A 4YPJA 4KGJA 3HUJE 4JY4B 1UWXK 2X2JA 1XF3A 3NESA 4FLQA 3BAWA 2BRQA 1LVEA 4I89A 4NZDA 2PR4H 4M7ZC 1CG9A 1MI5A 1E5BA 3DXAB 3OSKA 4N20A 5FUCC 5J3HD 2VWEE 2EDBA 3S9DB 2XY2A 1EV2E 5H94B 3ZDXE 4QF1B 1W8EA 3AWFA 5E6ID 3V4PL 1JHKL 15C8L 5EUKA 5AOKA 2DDQH 1U42A 1A25A 2ZTBA 4XZ4A 2EE0A 1A66A 4BZ2H 1T6VN 4Z7NB 2ZXGA 1QR1B 3IDMB 5IVXE 2N1TE 1N2RA 2C3VB 3P4OB 1MAJA 1OAUL 4WWPA 1MFAH 4Y19A 5A6LA 2FT6A 3P0YH 3DUUA 1ETJA 3QP3A 4Z0BH 4XMTA 5HDBB 5JOPD 3IAPA 3STLA 1T89C 1Q0XL 4RDBA 1M05A 4K3HA 2DQDH 3FQ4A 2VIRB 1KG0A 2JXMB 4DSYA 1ETB1 4TTDD 4HVBA 1SQMA 2WLNA 4AT6A 5GRWA 1JHTB 2R2HA 3SDDC 3PV6B 2XI9A 4JHBA 2XZCL 3BSZL 1M1XA 3HN5A 5D2LE 4YSQA 2Z8SA 3V6OA 3HI5H 5T33H 4QCIA 3TBWA 5EOTA 1BIHA 4KVCH 3HPLA 1WA0X 4N2KA 1ILUA 3FRUA 3BJLA 1JZHA 1WFUA 4HJ0C 3LPPA 5CZXD 1OP9A 3KYNB 4C56A 1EX0A 3X12A 2QDVA 4H20H 2B20A 3W5NA 4NAMA 2YD3A 2NY5H 3GLDA 3VH8G 4LCVA 1EEZB 2B4CC 4Y2DD 3QDMD 1R34A 2BVQA 1J12A 4ZT1A 1MG3C 3BYYA 2YFOA 4J8QA 5CJQH 3M7FB 2KQNA 1JTOA 3V0GA 4PWGA 4AIOA 3HC3L 3ZT6A 3TPUB 1NCCH 3QK0A 3H55A 2ARWA 3C09C 2NY5L 3RFRA 4NC2B 1MPAH 2MKWA 1IAKA 1ES0B 1VGKA 2YPLA 3VFVA 3EKCA 5D72H 4FQIL 3FB5A 3C60C 1TITA 2E27H 4NNXB 4F92B 4GSQA 3X3FL 3DKHA 1HTYA 2OSWA 2MIZA 3U4EB 4IU3A 7PCYA 3LZPA 3ZTJH 1P53A 2BSTA 1RUMH 3LPFA 1P7HL 3N3EA 3LQZA 5EEXA 1PZ5A 5IMMA 1T5WA 1LMIA 4Y5YA 4WY7L 4NWUH 2VZVA 4Y4KB 5KVGE 5JQHC 4CC0A 1AZNA 5J57B 5GHWL 1KCSL 5C0IA 4JPKL 1WBXA 4Z7OE 2VW4A 1RZGA 4NCC1 4NQTA 3SCMA 1PBYA 1RUML 1JGEA 4I8DA 1D9KC 4JO4L 2VERA 1CBVH 2C4XA 3DJTA 4L1LA 4QLWA 1T2QH 3CDFA 5E8PA 3T0XA 4Y4FA 1TQUA 1R33A 4UNUA 2FRGP 2HRPL 3RX9A 4HJSA 2VM9A 1IAIM 4B5EA 1OAXH 4N6RA 2WXRA 1V3MA 5I6MA 3MV9B 2XX0A 5B38G 2ATAA 2LW3A 3B56A 5BZXA 1XO8A 3V9CA 3JVGC 4OF3A 2XUWA 4X5QA 3RA7H 4HKXA 1CR9L 3I9GH 1W72L 1I53A 5BZWA 2WY3B 1TU2A 3KYKH 2DQJL 1WFTA 3THMH 2X3CA 3T3ME 4AYMC 5FUCE 1SOKA 5G2NA 3O6LL 4F15B 1REIA 2E9WA 2F8OA 4JY6A 1FAIH 1BX2B 3VXSD 3LX9A 3TBTA 4FQQB 4X5WA 1OM3H 4XP5H 3GRGA 4N0FB 1VKXA 5ALCH 3ZE1F 5KYXA 2NT0A 4KKLC 3RWCB 1XMEB 2DQCL 4FI7A 3F7KA 3W0WD 5C0AA 3D2UB 2GJ6A 5JW3H 2Y24A 3PWVB 3TASA 1ZHNA 2APSA 1J8KA 4M9PA 1TTCA 4RVBA 3NFSH 3Q7JA 5EU3B 3M86A 3H2QA 2WXJA 3BWUF 1I3UA 1U3HB 2ZKHL 1HC1A 1UXLA 2FCBA 2H0FA 4GSRA 3UCRA 1PZUB 1DCLA 1M6OA 3KYKL 5IESH 1Q9WA 4MVBC 4GKSA 3DUHA 3FCBA 5E7FA 4M5ZL 1LE9A 2YPVH 2LFGA 3II2A 1S6NA 1X5AA 5D7LE 5DZJA 3DIFA 3DECA 4FQLH 5FOJA 1HHIA 3ELAT 3NZHL 3LQAL 1FVCB 4HV8A 1LQBC 1G43A 2ZAGA 4HJUA 2F1AA 4IIZA 2COVD 3DX9A 4PREA 4PJHE 3BZ5A 4K9JA 1T22A 3LKOA 4P2CG 4PREB 2DQDL 4HG4K 2K4AA 5HI4D 4EVNB 4IRJB 1KJ2H 5JHDD 4FKKA 3SGKA 2ZX6A 2D73A 5C7XH 3NN8A 3PU7A 4PP2B 4P5TB 3PWPE 3CHOA 2EQDA 4NRXB 3S4SA 3LNFA 3SGEI 2R8SL 4XT1C 1EPFA 2VDNB 1SQ2N 1I7TB 4FG4A 5AAPA 1IC4H 1XCTA 3VAEA 2AJXH 1CTMA 1HL8A 3KPLB 2EC9U 4N0CC 1GY2A 4NOBA 4ZAKD 5JA8B 2EVHA 2RMNA 1AR1D 3N42F 3ARQA 4QUOA 1LLAA 3RBGA 2R1YA 5I17A 1NQBA 2FEEI 4E9QA 5TF1L 2BVOB 2WXGA 2YSSB 1H8SA 1JHLL 3N41F 2X4TA 1MFNA 5LCVH 4NGHL 1X5XA 3QWQB 3E3QC 2HRHA 1ZSDB 5AVWB 1LWJA 1SXAA 3CFCH 4Y19E 4QAWA 2FR4A 1G9EA 1BEYH 3POCA 4YMPA 3D85D 4QPEA 5DJ6B 3LZFL 4QHLA 5EOCH 4W1TA 2YEQA 2BZ7A 4JO2H 3DV6B 2ADIB 4FI8A 4ODSL 2VJXA 2GTWA 3FQNB 1O0VA 2KDYA 4JMXA 2GUOB 4YE4L 2WD0A 3KPQB 4QEGA 4X6DA 2AZUA 3IPEA 3RWIA 1KULA 4KZEL 2K3TA 2VN6A 4QHUB 4K9EL 5DUBB 3FZUD 9PCYA 4X5XB 3TYGH 1KT2B 3IJYA 5FV2A 3PP4L 5BQ7B 5C0JA 4OAWB 4PJDA 4PGEA 2IAMC 1WWAX 2EIBA 1MCBA 2J4WL 3BN3B 1G9NH 1VGEL 3D0VA 4PTUB 5LUMA 3GB7B 3IMSA 5KAQG 3A23A 3TCLB 1UACH 4ELMF 2JKNA 4LNVA 1KWKA 4HC1H 1M7IB 5IKCA 1DHKA 2EO1A 2QVTA 3CFTA 4KX8A 4HMDA 4BZ2A 5I6PA 1N19A 3SQOL 3V55A 4MBRA 5C70A 4QRRD 1TTRA 1B2WL 3PJNA 5IEKA 1OAXL 3O6FA 3B8SA 5ITFB 3HB3D 4AC4A 4APQC 3G9VA 4L8BB 5I19H 1IVLA 1I7RA 2AMGA 1XF4B 2N0MA 4OLVL 4A66A 3KWWA 2GK2A 3BIKA 2VH5H 3QC6X 4DP9X 3LY6A 2AAAA 5IB4A 1D5ZB 3W9EA 4L5FH 3QDGE 5I6KA 1P7KB 4NN6B 1I4FA 3W2DL 2YAPA 2YMOA 3BVNB 2VLKA 5BVJB 1F2XK 1I8AA 4LSVH 4BSVB 3ZE2B 2JELH 4JZJA 1A9BB 2CA4A 4AQ1B 3MJWA 4KJPC 2O5YH 2HTKD 5CZXC 3W0WE 4F9LC 5I8CB 1I8MB 4JGUA 3HS8A 3C08L 1BZ7A 5J9PA 3FL7A 2QTVA 2DLEA 5AB0A 4HJTA 1AMYA 3HLKA 4PJDB 5EEWA 3C5SA 1R3IL 4KOBA 3NK3A 2ICWJ 3X11A 1F2QA 2ADGB 1OOWA 3TH4T 4JFQA 3K2UL 3S5LB 1R5IA 1MIEL 3V4UH 2OMVA 3WIHA 2WSKA 1NM9A 1U93B 3O6ML 3AU1B 2AJ3A 1U33A 3N0PB 1U8HA 2X5PA 2VTFA 4Q74A 2OR7A 4G8FB 1HI6A 4LAJH 2AGJH 3APNA 1I1AC 5H37A 5DJ6A 3FULA 3K2UH 3SJVB 4ZX5A 3II1A 2OMTA 5AB2A 3FQRA 1TCMA 2RACA 3A67H 5GGQH 2RA1A 1S9WB 5AALA 3DMMC 4TS6A 5FECA 3BWAB 3QJFA 3HHMA 2IDTA 2FJHA 3EFFA 3TEUA 1L6ZA 2YS4A 1TNMA 3GIZL 4OZ4B 3MX0A 4QJ5B 3K2IA 4B9GA 3PXLA 3KLHD 1XGUB 5IW6B 1BYNA 4HOMA 4Y5VB 1N4XL 1IGCL 1SOXA 1N0XH 5F6HJ 1RZ7L 1BZ9B 4YZFF 5BMFL 4E5XA 1NOLA 2Y7QB 5EO0B 4OZHA 3WFCH 5J5EA 3MRNA 3J8F7 3RNQB 2G3ZA 2X3AA 2B4CL 3CZFB 1ACYL 2XWXA 3VCLA 4Y9BA 3OX8A 1TTUA 5BNXD 4LLDB 4XC3H 5T1KA 3TO4C 1IC0A 3JTTB 3B9DA 4I4WB 3TBSA 4WJ5A 1KYOJ 3GC3A 3T2QA 1RUQL 4IRJA 2JKLA 4EN2A 2NXZD 5D6CA 4F8NA 2UUDH 1FJ1B 2AEQL 3O0RL 4K7PL 5LBSL 2X2HA 5ECJE 3FO9A 3K6IA 4YAQB 4R7VA 5I30L 5EOCL 3HZMB 1JPSH 1AO7E 2FECI 1A3RH 3ZQWA 1O6SB 3WDHA 2R4SL 5MP6H 1DE4A 4OV6F 4AQEB 1XCQB 2R2CA 4L8DB 4AVHA 3AGVA 1BOGB 1U95A 4WHDA 2WWKT 5E2WL 4YE4H 4R9HA 2CO4A 1TDQA 3JV5A 2G3NA 3QISA 5MHSD 4OJYA 4KMQA 3UC0L 4TPRL 3CZSA 3MYJA 4LDCA 1GTNA 1WD8A 1XHHA 4HIIB 1ZT1A 3C12A 4MAYB 4N87A 3UYOD 3MREB 4D9RD 5GS1A 5E6IC 3QI9D 1TZIA 5F9JB 1T7ZA 1SXBA 2WQWA 5AKSA 3L9BA 3EH5B 4BWTA 2FSEB 4IRSD 4P57A 4H0HB 1UD4A 5D1ZD 4JRFA 4JFOB 4GRWH 1T1ZB 1JNLH 4XAKD 3LH9A 3VG9C 4L37B 1W72A 3EHBC 4ODHH 3V0JA 5FKPA 4N5EC 3X14B 1YJDL 3U2IA 4L1BA 2GSGA 2W9EL 3O2VL 4KZ0A 1UWGH 1TZGH 1XGRA 3E1F1 5C9JB 4FQXD 1S7VA 4K73A 5GGVY 4YH6A 2MMXA 2OXHA 2HVJA 4UOJA 1VFBA 4GT7A 5F9AC 4R6UA 2LOEA 5I1LB 1ID5I 2JI3A 1B6DA 2VCOA 1A9EA 4RETB 2OAAA 2HLFD 1XD0A 4TRPL 4ZG1A 1UA6L 3BYTA 4GRWE 1HHGA 4P46A 2Q5BA 3TGXA 5D2LF 4MZ2A 4WHYG 4XCNA 3O2VH 4P46B 3SDXA 2VN4A 1Z32X 1JNNH 1KB5H 1T5KA 3K5SA 4QY8B 5F6IC 4YSEA 4MD4A 3U7AA 4CW1B 2EIJB 2ICWB 1KYOK 3CWGA 1UA6H 4DO6A 5LQBH 4M7LL 1AJ7L 1BBJA 3U79A 4XVUD 1YCSA 4LASL 2XNAB 3NQIA 4GY4A 1VERA 1YEEL 4JZOB 2F5BL 2JVUA 5CP3H 4LARL 3IDYC 4NZ8A 1EXUA 3SDCD 3S8FB 3W57A 2ALAA 4Y4KA 3LH2H 1JPGB 1XTMA 1X5MA 2EO7A 3DDFA 4S2SB 2GBVA 4JE4B 3KLKA 3QIUA 4RIRB 1TJMA 3ILQD 2EDOA 1B9ZA 5E99L 1EAPB 3H9HA 3EYUH 3OAWA 4I3RH 4PMFA 4AGMA 4BFOA 3POHA 4NIYE 2N0KA 5L4IA 2EE3A 3PL6A 4XP6H 2CG9X 4JRYA 2VLRA 3DVGB 3KJ6L 5IEHA 3VD0A 4HP5A 3VQLA 4M1DH 2BLFA 1FVEA 3F7RA 3KM1A 2XTJD 4C57C 3MRRB 4CJ0A 1RSFA 4WNSA 2DQEL 3ECUA 3JT0A 5LG1A 1PY9A 3MUGB 1JV2B 5GS3A 5EF3A 3LN4B 3HZKB 1J9QA 4TNFA 1SMOA 1E3ZA 5IQMA 3MLYL 2XCMC 4ACTA 2EXSA 2XIDA 3Q48A 5KYNA 5KJ7E 1BG1A 1WVZA 4ZZKA 3G08A 4DW2H 3KDMA 1C12A 1E5AA 3WY4A 3FB8A 1K3IA 5EEZA 3DURB 2A3TA 3U6XA 4L8SC 2Y36H 1YVLA 1KENH 1JK8B 4KITB 3V6FB 3QZNA 1F90H 3KVDD 4JM0A 2VLME 1SFDA 3WN5A 4A6YB 4HXBH 4JRYD 2YC1A 2VZ3A 3W0WB 1PKQB 4ZMWA 4OCSL 4C56E 1DQTA 2PW2B 1NC4A 2PYFB 5J6GB 3EG9A 4WO4B 4U1NA 2O6PA 1AE6L 4WF7A 2AK4B 2DQCH 3FU7A 4ELMA 3C2SA 1KENL 5AKVA 1DUYB 4XVSH 3FONA 3ARDA 3Q2LA 4DKEH 4JM2F 3QDGB 1GIGL 3NSCA 5B39G 4OCWH 1LO2H 1NPUA 1UZ6E 1GJIA 2ILLA 2R2EA 3AITA 5GRVK 3IFPA 4MD0A 1DEDA 2HVBA 2NY3D 2CU9A 3IU4H 2ICCA 1NL0L 3GSRA 4P2QE 2W81C 3MMEA 4XN5A 1F4YL 3QUHA 3RVUD 5GS1B 1GXEA 4Z3EA 3MLWH 5KN5B 3UGUA 4M8QA 5I0ZA 4LAQH 4M6OL 1FGVL 4LPTA 4O51A 1YDPB 1PYWA 3FQ2A 3HZKA 5GISH 2IIJA 1NCCL 4K8RL 4YNYB 3DDGA 2OI9C 2KZWA 3IRPX 4FG2A 4R7NB 1AC6A 4POUB 5DVLA 3UO8B 2DQUL 2Q7YB 5CGMA 4TV3A 3CZJA 3GDBA 4GG8A 4XOEA 4QRUA 4MXQD 1R9FA 5HVHC 2BSRB 1OLZA 2WQXA 1KIPB 4FRWA 4NZRL 1MJ8L 2E7LC 3GTTA 3MGOB 1S7QB 3X11B 4OLUH 5T5NF 1FYHB 5EIQA 2ZAHA 3HAEG 4D9RE 3L3DA 4FFYA 4F3FA 3QQXA 1CURA 3CFJB 4X5LA 3FF8A 1JPTH 4MXWH 4N24A 4LVHC 5DR5H 4ZTOL 5I66A 4OR1A 2KLSA 5HYQA 3ULUD 2GCYA 3FUNA 1EEUA 3V9EA 4YSTA 1IFRA 2DMKA 1UH4A 3ARFD 2XVLA 5AW8B 3O41A 4GP5B 2O5ZL 4GAFB 1KPRB 3RZWA 4JCWA 3IM1A 2RAMA 1L9RA 4ZMXA 1RH8A 1KNOB 4MXQC 4NEHB 4OLUL 2HX7A 2GJZA 2E5EA 2WCSA 3F7YA 1NUDA 4IDLA 1C12B 4NCDA 1CBVL 1XF5A 1IARB 5IFAH 4MCZB 4XXCA 1GAFL 5CLZA 3SDDA 3BLKA 1JHKH 1UD5A 3ESPA 4FERA 1LWHA 2VLRD 4Q8BA 2ZXWB 2CIKA 4NQVA 3NIDF 2IBBA 1JMXA 1YEEH 3DIVA 3F04A 4GW1A 4P2AA 1ZT4A 2VR8A 2X1OA 3T6ZA 5T1KD 1NBCA 4NM8H 3TZVB 3QUYA 2GHZA 2GSMB 4GQPH 2RQEA 3O4OC 3O9WB 3EDEA 3BT2H 3LRHA 4HKBA 2Q76A 4Z23A 3DMMA 3FTSA 3BPNC 3T4AB 4B27A 4GW4A 4ZAKB 3P4LA 2KT6A 1N8ZA 5HHNA 5DWPA 5FUOH 3IAGC 4K15A 1RU9L 2COQA 3B3BA 3VFWB 1YEHL 1MOEA 4G3YH 2F8XC 3T0WA 3ARFC 1H6FA 4EUPG 1E5CA 1JZ6A 4HJGB 2WUCH 1DBML 4Z95L 1BAFL 3QXDA 3WENA 1X5KA 2DY2A 4J3VA 4N1HB 5CCKH 3KXFB 4BCZA 1JXDA 4L4TD 5F0LB 1TIUA 3HZYA 1CQYA 4XVOA 3OWRA 4CAGA 3GMLA 3ZO0A 3TIDA 4DPAX 3WE1A 4OW6A 1YHPA 3CSFA 1P7KA 3GMPB 2X4RB 4H20L 2WN3A 4H13C 4BA0A 3VI3F 1QSFE 4HBCL 4G1MA 3VXOB 3OKKA 4A7SA 5EN2A 3QNYB 2VDMH 3FN3A 3O3EB 4ZW7A 3D50A 4FDWA 1GZPA 5I5JA 1HN1A 2UXTA 3IFPB 1NC2B 3MV7A 3QIBD 3U0PB 3JXAA 3UGXA 4F9LA 4Z3TA 3K6SB 4KI5C 1TJXA 1U0QA 3BUYA 2IBZY 4BYHA 5CSZA 1BD2B 3ERXA 2ZSWB 2W0LA 4N5ED 3BQUB 1PG7X 4MVBD 3S0PA 4ICWA 2W0FB 4HISA 1OQOA 4G8EA 5I71B 4QOKB 2EEAA 3NCEB 3OF6D 4IEFA 3QEHB 1NDGA 3HG1D 5IHBA 2M26A 4A67A 4WFHE 4HH9B 3FHEA 5J56B 4H25A 3N1QC 3WG7B 3HEIB 3DTDA 1KBVA 4DPCX 1AIFA 4CVZA 3AADB 4XN4A 2PCXA 2C1OA 4BK8A 5GRVL 1U30A 1KB5A 4BDVB 5K1JA 2HX9A 1TZIB 2X4OA 3JTSA 1UADC 2W91A 5GZND 4OIIH 4RBPK 4XBPA 2FIKB 1IGMH 3DK2A 3MV7D 4YDIH 4EO5A 5F7KC 4HV8B 1UXWB 1R19A 3OL2A 2FDBP 4JG0H 4I0CC 4KHXH 3UCQA 1JPFA 5D2NE 3J07A 4LHUB 2DN7A 5AW2B 3TV8A 4UTCA 3ZHKA 2HFEA 1FWXA 1JRHH 5DS2A 4OIIL 5IVXA 3EGXA 1BFTA 2XWDA 3VE0A 4QXUH 3QIBC 3W3BA 3V4PB 4GAGL 3VRIB 3LXBA 4YHPB 1PNDA 3K46A 1NBYA 1RZKL 4QXVA 4QHPA 5AW0B 3L48A 3GSNA 3ZE0F 3F85A 1F4AA 4ZO8A 1MJ7H 2ZWYA 4L9LC 5EO1B 1IUZA 1WBZB 1JPEA 1LK2B 5I74B 1DQQA 1MFVA 4MA7L 4P4KC 5EDSA 2ODIA 4I18A 3N04A 5E1GA 5KYXB 5D2NC 4HXAL 1BMGA 1H8LA 1WRFA 4AH2B 4HMCA 5DMIH 4HFUL 4S1DC 2A2QT 4OZHB 2BOCA 2H32H 3GK8H 4KK9C 2XY1A 5A2FA 5L6YH 3GMOA 4H8PA 1CLVA 3KNBA 5C6TH 3V5HA 1E8ZA 3BP6B 1IKNA 2HPOA 4Q9QH 1TENA 4PP1D 4PJIA 5DQ9A 5FM5M 2C3WA 2R4RL 2BVPA 1ADQL 4YWGH 2LVCA 1SDDB 3IDJB 1AOHA 2FNBA 2SEBB 1XR9A 3H1ZA 1FAIL 3NEEA 2IV9A 3CSBA 5GIRB 3T3MF 1BJ8A 4EBQL 3RVVD 4E9RA 1FNSH 4E42B 2ZOUA 3L3KB 5ITFA 3FSVA 2QQKL 3TT3L 1IC1A 1YA5A 4GQ9H 3PF2A 1EHAA 1OAKH 4BKLA 2N7SA 3X2QB 1QI5A 1V3LA 3C09B 4HIJA 4QRPA 3KXFE 3FUFA 4IBQA 4DQOL 1NGYB 3C8KA 4FEIA 4KXBA 5AW7B 5HGAA 3U36A 3ZMNA 5A7EA 2JELL 5I16B 4P4RA 3GBNH 5CINH 5HI4C 1G6RL 4HJGA 5EMYA 4A2EA 1NMAH 4QYOA 1BPVA 4QRFA 1HSAB 4JB9H 3UTZA 4EI5C 1J5HA 3J2PA 3PNWA 4PTUA 3L5IA 5CJOL 4FA8A 5HPOA 5K9JL 1D6VH 3EJPA 4Z6AT 4WTQA 3EO9H 4XH2A 2OPCA 4KI5D 4O9HL 5EPMB 5IBTH 2VXVL 2WB7A 3SGEH 3WOVA 4QXTA 4I85A 3C5SB 4KQ0A 4GS7C 1BPLB 1NMAL 5I2IB 3DGDA 3W81A 2VLJB 3KGRA 5FYLL 4HK0B 4LBAA 2E4FA 3C6SA 5DHXB 2NY0D 4WFEE 2FIRT 3NA9H 1BAFH 5IB3A 1MJJB 2DLFH 3IKCB 1A6ZA 2F53D 2H7WA 1KBPA 4L29A 2GSIA 5AZUA 3MO1A 2MOVA 3TPUA 1MY5A 1TJHL 4YGVA 5E94A 1YMHA 1AKJA 1KJMA 4PJXF 3QQ4A 5FYKH 2QT6A 1LP9A 1QLRA 2X9WA 3GXDA 1DJHA 2QPDB 5C7ZA 3BD4A 4RZCA 4W4OA 2P4AB 1Q1PA 1BDYA 4MLSA 1H3WM 4Q4EA 5GGRY 1Y0LA 3ZYJA 4JNXA 2B1AL 1IAOB 4PJEE 4UQIM 3D3VE 4BK4A 1DDTA 3D08A 4NPYB 2K78A 3EOBB 5GRUH 2VLKE 4XPTL 4B9JA 1MXDA 2Y2YA 3BZDA 4ODSH 1FYTA 3VD1A 3DRQA 4UQ9A 2A9CA 3WFCL 4XCEB 2WSPA 1YMMB 2HN7B 1UM5L 3BUDA 3MUY1 2OJ1A 1RZPA 3IDGA 2BX5A 5E9DA 1S3KL 3UJIH 3CBKB 1A7QL 3FMGL 1E4KA 2IH8A 1RERA 3DHJA 4F1SA 1U8JA 1WBZA 5GSVA 3JWOL 4UTAL 5T5FA 4PJCE 4WNQA 2F54B 4JFDD 4TNGA 2P8PA 3N55A 1AS8A 5F9JA 2CKBB 3E9UA 4G8GE 2X4RA 5DHMC 5AG9A 5DRXA 4MJ2A 2CO7B 4IIQC 4HWBA 4GYBA 3WKPA 5J11B 4P5MA 2XBTA 3TURA 2GIMA 2ZUQC 3NACH 4GXUM 4XXDA 2V7NB 2Y6SD 3RI5F 1M4KA 2LVEA 4FQHA 2XPGA 1OPOA 4N3TA 1SXCA 5BRZE 1P6WA 2B14A 1RLWA 4IBYA 1X44A 3C6SB 4QXUL 5EEVA 2BVUA 3MLPA 5J0BA 5IVNA 3UJTH 2WZPA 2WB1A 5I19L 4NO3A 2XG4B 2QKIA 4JFQB 1UEYA 3O8XD 4ELKB 2D9CA 4W6YB 4GW4B 1HHKA 5B1JA 1FHGA 2DQHH 2F61A 3G5YA 4R2GC 4PJ8A 5IR1A 1QFOA 2EUWA 1BLNA 3G6JE 2GJ6B 5CUSL 3WFEH 3U30B 4QRRB 2R7EA 4NJAH 4WFGE 1BLIA 3RJQB 3QI9B 1P7QA 1TO4A 1LHZA 2VRAA 4YSPA 5BS0D 3HUJF 4ODHL 3AACA 4HDIB 1X5JA 3O6FC 4TSAL 3VG0L 4AYDC 1DP0A 5MEQB 4XPHH 1X4YA 5K69A 2JB5H 3VG9B 3CSPA 4JPIA 5I71C 3K7UA 4OVUA 5ICXB 3PUCA 3W2DH 2WGNB 5IB4B 2WUBL 3FAWA 1HFUA 2WC7A 1XGUA 3GXIA 2DKSA 4FXKC 4MWFA 4FNLL 1U8KB 4R97C 3RGHA 3AAZA 4Z3HA 4GSUA 5BOJA 5DD0L 5KTEH 2JB5L 4MJ6B 2V7HB 2RQ8A 3C8DA 3NIGE 1NA8A 1MHCA 1QSZA 3IPFA 4RCAA 4TSBL 1NUNB 1QACA 3SYAA 2V17L 1F4WL 2I9LA 3GSOB 1I3GH 4P46D 1OB1A 3FQTB 3SYQA 5JIDA 4XVUC 3CHQA 5HHXL 1NFDB 4K7PX 2RALA 2XQ0A 4FLSA 3ZTJG 2Y7SA 5BV7H 4DGYH 2BHUA 4AIXA 4B95C 5GS2H 4Q9RH 3QQ3A 4M93B 4QXGL 2ODHA 3LKNA 4OZFA 1FNEB 2UWEE 4H4NA 1MCHA 4L8CB 1DQKA 3PQYA 1OOAA 4LDEB 3LQZB 2CMRH 4M4PA 3MGOA 3LD8B 2DWEB 3V4VB 1LGVA 2F58L 4XMUA 3MROA 5HHXH 5KS9F 1G84A 3GM0A 15C8H 5E4AA 2BIPA 5L4JA 1N7ML 1G94A 3BDYH 3VM7A 1UXSA 4G6AC 2F5BH 1FFRA 4BQ9A 2ENJA 5F70A 1NCJA 3PP3H 1QTPA 3EOYG 4FJ6A 5DDHB 4Q6YA 3EYQC 2DQTL 4N0RA 2V5TA 3N6YA 4XMPL 2WNKA 1QW9A 1OT1A 1QYGH 2DH3A 3CSYB 3DBSA 4Y1AB 4ZO9A 2IMMA 3ZDYF 1BMZA 3NBNA 2L04A 5HHPB 1KY6A 3UTQA 3KLAA 2R29L 2GJRA 2JCCA 4MJ6A 4OD2A 2CM5A 5LVEA 1N59A 4PWFA 4YDNA 1ZPLA 1GAFH 2JJTA 1PJWA 2PNDA 1ZGLB 2KZ1B 1CVRA 1O9VA 4CDGC 1N6VA 1BWWA 5EOQL 2JMRA 3KPMA 5FYJU 5IT2L 4NQDE 5IB1B 4KKCD 1A4JA 2DZEA 3EJYC 3CZFA 5DK3A 3ELQA 4HC1A