4KTGA

Crystal structure of double-helical ggc-repetitive rna 19mer complexed with rss p19
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
121
Chain Sequence
MTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA silencing suppressor p19
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
total genus 36
structure length 121
sequence length 124
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ktgA01
4KTGA 1RPUA 4J5VA 4JGNA 1R9FA 4KQ0A 4JNXA 4KNQA 4J39A 4JK0D
chains in the Genus database with same CATH superfamily
2V9RA 4WFHD 1KB3A 3FXIC 4PYGA 5E7FA 4UCFA 4FQCL 4JFPA 1BXAA 2XZAL 3R19A 1KPVA 3BZEB 2OSYA 5FIEA 3DJSA 3EFDL 4KDWA 3EKCA 4MAZA 5FECB 2MTAA 4BWTA 2BP0B 4XNBA 1VZHA 3P3UA 3PE9A 1WZKA 3QCTH 4WCYL 1AD0A 5E8OB 2K4WA 5FC9A 5IF0B 4CUCA 5FYJE 3QZWB 3U82B 1LK3H 1B6DA 4H0GA 5GS2D 3IDNB 4I3RH 4P23D 3FU3A 4BKLA 2KLSA 3PPSA 5IOKA 4A7QA 4EE2A 3TURA 3UAJD 1VZGA 5I6KA 1TVHB 4K5NA 4GO6B 2X9WA 7FABH 1MLBA 4NIYE 4IW4C 5FGBA 4O02L 1BVOA 4EZLA 1BOYA 4YK4B 2ZE0A 2CWRA 4JM2F 1X9QA 2GITA 3FTZA 4QF1A 4KDTA 4CNIB 3K7UA 4LSVH 2WB1A 1IE4A 4WNJA 4YJZL 5I18L 5I5RA 3OKNA 5K1JA 4EIUA 1OAZH 1Z3RA 2VW6A 2ZOKA 2Q7YB 2VM3A 3WXWH 2VCOA 3MUJA 3ULUL 2OW6A 4HWUA 2F2HA 2WQRA 4GI8A 3JWDL 4YC2B 5JYLA 4J12A 3QH3A 5DVPA 3D6GA 3SQOL 3GXTA 3VB9A 4GBXD 1PD0A 1RIHH 4UIKL 4OF3A 5SX4I 5TQ2L 4FFYH 4MA8L 5IMLA 2J1WA 2OSXA 3MNWB 3RDTA 1E2ZA 3LN4B 4KO9A 4S0HA 1IKOP 2P5EE 5DQ9A 2WIIB 3AGWA 2FCBA 2WZ6A 4GAAA 5DDHB 4JRLA 2E27H 5IBLD 4JDZA 3VRJB 1D3CA 3GD1C 1MFBH 3ZDZB 5EIIB 1FNFA 1JWMA 2FIKA 4NN5B 4GPVA 2NTSP 1Y18A 2ADJA 5E9AA 3ME0A 1J0KA 1IBBA 1KDJA 3RWIA 1CPUA 4X50A 5DHVH 4L05A 4RBPK 3VH8A 1N6QH 3IU4H 1IL1A 1UM4H 4N2LA 2LW3A 3ALWA 1SOKA 1T7ZA 1C5CH 2DYSB 4MQXC 5TDOA 2NY2D 3CVHA 2RBLA 1C7SA 5I0DA 1A2YB 3F65A 3VD3A 4L4VE 1M56B 4PGJA 2F54B 4J3BA 3BXNA 1V7NL 3WUWB 3MLZL 1J5HA 4KJQC 4UUJB 3SO5A 1WC7B 2EDRA 3CMOL 5E4OA 4X99B 4W9KC 2X1OA 5C6TL 2M26A 1EAOA 1R9FA 4PSPA 4UZSA 2E9GA 1JUFB 1KGXA 3NRFA 1NCWL 4P5RA 4BCXA 1NEZA 1L9NA 5F6HI 1S9YA 2XIIA 3ILQD 3S3PA 1QZNA 4Z7NB 2HLEB 5JW4Q 1E7VA 2CUIA 3ZTJH 4Z7VB 1HQRA 2EDTA 4XVJL 4G80A 2CM5A 2PYEB 2DDQH 3U30B 3UC0L 1VFMA 1LLAA 4KRPC 4LEOB 3AFLA 4DUXA 4M4RA 5DVKA 4G8GD 5J1AA 5EN2B 3QO1A 4RGNE 2G4GA 5FF6B 1HH9A 1R0AL 4D94A 2VDOH 1DQTA 3LIUA 4DGYH 1KLUA 4PRHE 1QWHA 2Y1VA 3OZKA 3GSNB 4LOEA 1TNNA 4P2CG 5DRXB 5TDNB 5B3JF 3HZ3A 4X42A 2VH5L 5K39B 1QI4A 4D9LL 4RDBA 1IC1A 3WKMH 1TQSA 4IOIA 3ZHNA 3QB7C 3G5ZB 4EBQL 1P5VB 5IB5B 4DK5A 2H32H 3QRGL 2AJ3B 1A7OL 3BUDA 3OZ9H 3DHMA 4H88H 3ABZA 4FLRA 5TQ0H 1MRDL 3SD5A 4CSTA 3IVKB 2HKHL 5G55A 1MCFA 4PPTA 4UTBH 3T8VA 3ZVVA 4YIQB 3HMXL 4XCNA 5CGYC 2WWKT 2YD9A 2NW3B 3TBSA 3BN9C 3RUGE 3P9WB 3ARSA 3FTWA 5DWUL 4Q9RH 1U21A 4OTXH 4U7MA 3KDMA 3HNVH 1AIFA 1MWAH 3AG3B 4FXGB 4LU5H 4QCIB 1XXFC 5HJ3A 4UM8A 1F6FB 5GGQL 4KK8D 3T6WA 2CIIA 4A6YA 4DVBA 3G5YA 3SZ6A 1DJGA 3BP7B 4JFYB 2O5YH 3M17B 2VJ0A 3KWXA 3RTQD 1ZTXH 1CXKA 2AQPA 4AEHH 4Y5YB 3RY6C 3WXVL 3BWAA 4KUZH 4H7VA 5J11C 1DSFH 5DJZA 5LAPA 3OG6B 1KJ2A 1ES0A 4LO9A 1BECA 3STLB 2YRPA 3IJYB 1RURL 2WQVA 2EH7H 2WAQA 3QFDA 1AKJA 4R7NB 5IM7B 3L13A 4ZO6A 1A9BB 2Y6SD 1U8CA 3X1FA 5C3TA 1T4KA 1EAJA 4H25A 4JG1L 1UHVA 4M9PA 1RV6X 4R97B 3TJEL 4HLEA 1SYVB 4MD4B 3NSFA 4JO5A 4PRDB 4P2RB 4WEBH 3T3MF 3DO7A 3TBYA 3WE6B 1M3JA 3J07A 3LNIA 1NPUA 4HUXA 4OI7A 1S6NA 3W57A 1QFUH 4H8WC 2WHVA 4BFNA 3BFQG 3EDKA 1UA3A 4ANWA 5AVQB 1F56A 2XOTA 3ARYA 1EUTA 3CLEL 1GYUA 3O6FC 4MJIB 1T1XB 4N22A 4PJBB 1J8SA 3R18A 3DHPA 4Y4FD 3APMA 3Q44A 4PMFA 2JJTC 1AGFA 4R0LB 4XCYA 3BP5A 2OQJA 4G6KH 4AVJA 4F7CA 5T3ZD 2HWZH 3CSYA 3T09A 3UMNA 1BVZA 4ANKA 1BLIA 1LQSR 4MX7A 1L9OA 1YDPB 1BV8A 2W9EH 1SXBA 2IV8A 1DVZA 4HEMA 3RYMA 1SOXA 2VXSH 2H6PB 1KELH 1T20B 1J0YA 1QLEB 4CU8A 1MI5A 1UCTA 3FFDB 1ZS8B 4MXWH 2PWEA 4D9RE 1GTNA 4LLDA 2CLZB 2WYHA 1J5CA 4UV7H 3FUMA 1AZCA 2QKIB 3BJLA 2PW2A 3IF1B 3PPEA 1FCGA 1XR8A 4XMPH 1FGNL 5DD1H 2R0LL 3GNML 1REIA 5FYJD 3VU2A 4ZQTA 2HT2D 3QYCA 4X4MA 3NTCH 1K4DB 3KYKL 2AJXH 3MNDA 3RB7A 5HVHC 1GIGL 2PTVA 1NFIB 1TITA 4N1CA 2Y7MA 4ZT1A 1S7TA 5L88H 1N64L 3OR7A 1ACCA 1JPST 5HHXL 3FN9A 3CWGA 4AEEA 4XGZB 2WZ5A 1FIEA 5SWZE 5FUCE 3U6XS 4DKAA 4KVNH 3MLSL 4QXUH 3T0AA 3DRTB 4MD0A 3H7BA 4HWEH 1DDTA 3RWEA 5F71A 2XHNA 1OAYH 5F3FA 4FNUA 15C8L 3LV3B 1ZSDA 1LNUB 3MV7A 3AG4B 3ULVE 3SDAC 1G0DA 4ZJ9A 3NFNB 1ID5I 4L8SC 3MJ6A 1ND0A 3VD4A 4OCYL 2EXWC 4OFDA 1JIBA 2BW4A 1CL7H 3IM1A 4AH2A 2Y07L 4R7VA 1NGZB 3ECBA 4JCWA 3VSVA 4OD2A 1L9PA 2O5XH 1TOXA 4JW3A 1NCAL 2NT0A 2IAMD 3FU8A 3IFNL 2D7TL 4RNRA 3V9FA 2YLHA 4P5TC 4XMUA 4AQ8C 4YPJA 4YWGH 4PJGF 4H8WH 4N2GA 4AW7A 1ZLEA 2IFFL 3G5XA 2C3XA 2XU9A 2G9HB 5KEZA 3CPLB 3EGSA 3ZTNH 4QTFA 4QRUB 4K9EC 3FHQA 3TBCA 1ZGLP 4QWWC 2Q76A 1GZQB 3C5ZC 2ARWA 3ETBF 3LPFA 1KFGA 2A3TA 2EIBA 1JGVL 4IKLA 4NWTL 1AQDB 5TFSH 1UH4A 5DGQA 1BVNT 1KLGA 4XNDA 1T1ZA 1TJGL 5AKTA 4L4VD 1GHFH 2G3ZA 1FO0H 3FH8A 5HDRA 3TTSA 4WNSA 3O6FA 3PDOA 1XIWB 1U6AH 3QUGA 1A9EA 3LHAA 4AGPA 1RIVL 2JJTA 4PJ9D 2VE6A 4Q97A 4U1KA 2KDYA 3DOIA 2R1XB 1ZRUA 4HFUL 3UBHA 2ITDA 5AWNH 5KBKA 1NC4A 4WW1B 5C0CE 4JPSA 2VLJB 2Z4QA 1OM3L 2DIEA 1MFUA 4LRNH 2AK4A 5J56B 2ZX7A 3MLRL 1GPOL 1MLCB 3H2WA 5GGRA 2DQTL 4L3EB 4UM9A 3VXRE 2WYIA 2J1YA 4I9XA 3VYOA 4W68A 4HJSA 4TQ8A 5CJBA 4B96A 5JPMB 2WWOA 2GAZB 3TFBA 3BUQA 4HWZA 4RGND 3VG9B 4KX7A 2DS4A 2NY7H 3VWJD 2R69L 2Y2WA 3A5VA 4WGVB 2DWTA 2KZKA 1IGYB 1EFXB 2QSVA 3WGVB 1NLBL 4MXQC 5EULV 5FOBB 2BMKA 4PWHA 1MJUL 3CFEB 3TH2T 5T1LA 4KZCA 4ZS7L 3K2KA 5D2NE 5L0QC 3OAUL 1JZJA 5K9KB 1KBWA 4G6JH 1A6VL 2X2JA 2VIRB 1E50A 3IGAA 2CR3A 5AYTA 3B1TA 3HG1A 1DBJL 4PIBA 4X8JB 4AYMC 5AW2B 2GBUA 5E2VH 4Z7WE 1H3PH 4QXTA 4HUUA 2P48B 4QEGA 1A7NL 3TT1H 3K8LA 5CZRA 3ZE2F 2FECL 3MMEB 4YO0A 1JNNH 3F62A 4P59L 4R2GC 3ZGHA 4BKTC 1XFPA 1SMOA 5FCUH 2YPVL 3ESMA 5DMKB 1PIFA 5JMRA 1NFDF 1DSYA 1ZD6A 1OE2A 4ENED 3JZ7A 3W81A 1FV1A 5CP7B 2YOCA 5JIQA 2VZ1A 4NNPL 4NC2B 3FB8A 3OC8A 1S7WB 4PJ8B 1YQ2A 1OOWA 3O8XC 2E86A 4DHLA 2HJFA 1CZ8L 2V2XB 4NO3A 4P5TA 4AQ8A 1NMBL 2LOEA 3P4NA 3K5RA 5CWSB 1NGWB 1E42A 3GJEB 1IM3B 2YWYA 4PGBA 2EE3A 4J2XA 4MAUL 4J23A 4RZCA 1MJJA 3WUZA 3UAAA 3GMPA 2A38A 4L1LA 3ZKXB 3MUGA 4K8RL 4FL4C 1LEGA 4HEPA 4G9FB 3GMMA 1BBJB 2QVFB 2WBJA 1NCDH 3N04A 2WZPD 4B0MB 4NZUL 1SRDA 5GZNC 3WIIH 3CFIC 4OH2A 4L1TA 4UV4L 3I84A 1ED3B 4RAUB 4IBQA 2R2HB 1DEEB 5IJVB 2Z31D 5DHYA 2HTKD 5CSZB 4AGMA 4H8UA 2DPKA 5ALBL 1MDTA 2X42A 3GO1H 4UQ9A 2A1WH 4P2OB 4QYOA 4V33A 3IXAB 4BZ1H 4NP4H 4OF5A 4PJIB 4XN2A 5C0BE 1XF3A 4OZ4A 5I8OL 3SJVA 2F7QA 1Y0LA 1IEHA 5EZLA 3SY0B 2EVFA 3NSXA 1SF5A 5INCB 2YPLA 1T7VA 4PB9L 2ZJSL 1VAHA 4M48H 4WI0B 3ECWA 2YK1H 1GYCA 1B4JL 2EO9A 2J4WH 2Q3AA 3F6JA 3JWDC 4AQEB 4OZHE 4FQHB 4YHYC 1QUPA 2A73B 2VXVL 4YQXH 3ES6B 1WAEA 2C3WA 3GEFA 1S7QA 1QATA 3SDDA 5HYEA 4B0MM 1XL4A 5JW3L 3T1WA 4XXDA 3MRIB 4G6MH 2V8MA 4M9OA 1IQWH 3CLFL 4KNSA 3TZVA 2W0LA 3DX7B 1YAZA 3P9MB 4B9ZA 1MCNA 4LNVA 3AS0A 5JIDA 5JW5A 5FO9A 5LGJA 4D9RD 4RBPH 2ODHA 4NKDA 2JKSA 5LAXA 3K71B 4FEIA 1JWUA 1CF1A 3CSTA 4OFKA 4DZ8A 2BDNH 4WV1B 2DD8L 4JRXE 2EEBA 4NNYB 1XGYL 4XAKD 3LRKA 1RLBA 1SHWA 2YGQA 3IDXL 3QDJA 2FLRT 3ARFD 3BQVA 1C12A 3FCBA 3BEWA 5C0DA 3D9AL 2AQ3A 4WWKD 2GY5A 2CHWA 2B7DT 5J3HD 4F93B 3X3GH 5I74B 4FA7B 4ZTPL 3QJZA 3HBPA 3L9RB 5DHDA 2Q9OA 3GS4A 4M61A 1R4XA 2X09A 4AMKH 3FQUA 4S11A 5DQJB 2JXMA 3MYJB 3VXQB 3ZDYB 1I1FB 5SWZD 3P2TA 5JLZA 5KSBB 2PMZA 1SHSA 4AEFA 1HE8A 4WCYH 3QULB 4B5ZA 2EJ1A 1MH5B 2PNDA 4N0UA 3CQQA 4X6BB 2CSPA 3H42L 1UQSB 1RHHB 2ALWA 4P9MH 3O8XA 4K3DL 3J7HA 4L1HA 4XCEA 2PKDA 3ULVD 4WVRA 4I5BA 3HE7B 5T1JA 3OR6A 1KXTB 2OMZA 4HK3J 1J0HA 2GSIA 4WFEE 1KTDA 4JPIA 4OVVA 3AG1B 5DR5L 5DYOB 2WP3O 1WCBB 2P42B 3V52H 3CHRA 3FT0A 2HH0L 1NWPA 2QPUA 3LVEA 1CS6A 3NIGE 4XPBH 1MKFA 2ESVA 3I9PA 2F6AA 5GZNA 1T0NA 3OAYK 3X1GA 5JDSB 3KYOB 4HBCL 3CGTA 5KVFL 3RNQB 1UH3A 2FHBA 1EFQA 4NO2A 4WRLA 1LE9A 3JWDH 2X6UA 1DYZA 3JV0A 1PW3A 1ADQH 3NCJL 1JDAA 4O02A 4RIRA 3RURA 4UIKH 2P80A 4JFDE 5TQ2H 3T0EE 2H26B 3MRPA 2Z8SA 4LLYB 3KPMB 1DQLL 2A83B 1GZPB 1QA9A 2X7LB 1YNTB 2KERA 1RPQA 3KPSE 5D7HA 3V7AG 4P2YA 4DETA 3FRPG 2K6YA 4JFFD 43CAB 4H20L 1SVBA 5C0FB 4DFIA 5ILTL 3HFMH 4X7SL 5I17A 3BZ5A 5HD8C 2R2EA 4WEEA 1TQCB 2WIMA 4J3SA 4MMYA 2VZVA 4OZGE 4F8QA 2BNQE 4CKVX 3MACL 4GAGH 4YPGA 3QUXB 2AJYL 1TZAA 2H0PA 3MREB 5FS5A 5C0CD 1BMZA 1BXXA 2QADD 1ODUA 1YY9D 3QI9B 3RZCD 1FG2B 3FQXA 4Z7UA 3O11A 3FQ4A 2NNAB 1YVLA 5E2TH 3S8FB 1S4IA 1CFNB 3BCDA 2GK2A 5DD0H 1E9OA 3VXRD 1V7NH 2I9TB 3QWOB 4Y4HB 3PJNA 3BAEH 4LSSL 3PXHA 1IKFH 1P0SE 5ALCH 2AZAA 1U8OB 3PCYA 5DI8A 1ZA3A 3IDGB 3T77A 1E4WH 3HC0A 4FULA 2JVUA 4TQHA 3P11L 3QGVA 1QHQA 3K8MA 3P9LB 5D1ZA 1GR7A 4MNQD 1EHLL 1F4WH 1R24A 1DO6A 2A4EA 2PP9A 2VL5B 4X4XB 3F6LA 4OKVB 2K9UA 3ZSSA 4XCCL 3U4EB 1NEPA 2FSDA 3BVTA 1CLVA 4N4YB 1Q72H 4RFNB 4Q89A 5FM4A 1FFPA 5FHBH 4YLBA 2FO1A 4GSUA 3LSOB 3RJQB 2J2ZB 1K85A 4TXVB 5I76B 4R7DB 3WL9A 5HJBA 2CLRB 3ZJAA 2H47C 4NX0A 1KGWA 1ETZB 4B7LA 3WNJA 2AI0H 4BWWA 3D48R 2EEFA 2NYYD 3GHBH 3CN1A 4NO0A 2F1AA 3KWWA 3TFKD 1QTSA 3GGWA 1IBDA 3QUYC 1JZ8A 1NOFA 2CKBB 2RQEA 1UXLA 3VXPB 4YSTA 4LVOC 1G5GA 1QPKA 4CDGC 4IJ3C 4DP5X 4EBQH 1D9KC 4NM4H 2XJKA 3QIWC 4X6DE 2MCMA 1A7OH 5CP3H 1MRDH 1SM3H 2HKHH 4YE4L 4GXVL 4FMVA 4K2UL 1X5ZA 1Y1UA 3QWRD 4JB9L 2FATH 3B6SB 5D1QC 3ULSB 1HYSD 5DD5L 1HIML 1RL1A 3WTUA 5D93C 4FI6A 3VXMB 4XO5A 3WJLA 1GGBH 4HIIA 1RUQH 4G1MA 3DIDA 5ANME 3SODB 5C1MB 2X0UA 1IAOA 4GIOA 1RJYA 4U6VL 3HE6C 1RUKL 3PS6A 4HKZB 1JVOA 4Z78B 1X7TA 4X80L 3IS1X 3SE3C 2VMCA 2WBXA 2BVOB 3HMXA 4HJGB 2UZIH 3VGAC 5E24E 3OM3B 1X9UA 1Q0EA 1H19A 1EZUA 3QEUA 2FX8L 4XWGL 4XO4A 4FGMA 4RCAA 1U3HD 3CN2A 3IE4A 3CFUA 4KH2A 2A9NH 3RGVC 1DN2A 5JNYA 3NCYP 2OLDA 3EFOA 1CGXA 5C0BD 3RIAF 1OF2A 4N2IA 5LQBH 3WLBA 3THML 1IEBA 3VFMB 4D0CA 4R7XA 1R33A 1PEWA 2XVBA 2WKGA 4G6FD 4EOWH 3R06A 2WCGA 2X41A 4P2QB 4Y1SA 1G6RB 3TVMD 1N5YL 4WQOA 5H37H 2V2WA 3HVDA 1X7QB 5HGBB 3I02A 4N2OA 2IGLA 3UXFA 3WMQA 1CGTA 1PZ5A 3DIFB 4AMWA 3SYOA 3MCLL 1CG9A 2VXQL 2EP6A 2MFNA 1NMCC 4PTTB 4M8RA 5FUOL 4PRPE 4UOQA 3S4SB 1FNSL 1MREL 4FG6C 1IAII 2N1KA 4WKZA 3TC9A 2EICA 2ZXWB 4AQ1C 3AXLB 3QARA 4G8EB 2V2TA 4RAVB 3NFSL 4WU5A 1AO7E 4BSVA 3RBSA 4YZFF 4B9CA 4Z8FH 2XCMC 4IOFC 4Y1AE 1MFAH 3AT9A 4PY8J 2J12B 1KIPB 2R56H 4JRXD 5LXVA 3MRJB 4H4NA 5EZPA 4N3TA 5J6HB 2BSRA 4V2BA 3IBOA 3N44F 5CXPA 3TT3L 3CZEA 1ZANL 4N9GA 2VSCA 4KGLA 3VX0A 3ZSTA 1A21A 1WBXB 2PPDA 2BSSB 2VW4A 4GAYB 4E41E 1BZQK 5LG1A 3HOGA 1IJ9A 3EYFB 5CR8A 3R7RA 3ECQA 1VFAB 4PJFA 5EUKB 1EAQA 2Z92B 4C54A 1B88A 4WUKH 5IR1A 1AR2A 4MS8D 3MR9B 5GGUB 1ZGLA 2F53E 2DJSA 3T6QC 2I60L 4FKEA 5AOLA 1D9KA 2XETA 1ZEAH 3D2TA 1Z5YD 2NY1D 2QKSA 3QIWA 3S4SG 4WO4D 1FIGH 3W2DL 4ZZFA 3CJJA 1BZ9B 1WFTA 4D0BA 1KYOJ 2G5RA 1HX0A 4MJ6B 1OE3A 3GPSA 1GYAA 3ZYZA 3CFMA 1D6EB 1M3IA 2XPYA 3FZUC 4ALAL 4AY0A 2XNAB 4LEXH 3SY6A 2ZOWA 4WFED 4L29A 3PU7A 2K78A 3NIDE 5DJYB 2NY5H 3N85L 4NKMB 4CMMB 2ORBL 3WYRA 1L3NA 1BEXA 3MLSH 4YDVB 5DMIH 2CD0A 2VWEC 3CDYA 4XVSL 1FNEB 4K3GA 4PRAB 3CFQA 1NAMB 2IQ9H 5ISZB 1ZV5A 1KBGL 3HN5A 3DOSA 3IGKA 4N2FA 5DK2A 3GDBA 5ACZA 3BZ4B 1QYGL 4M5ZL 3BHBA 1KZYA 2Y07H 2X9ZA 3C60B 3ZE1B 1Q9KB 4JFDD 4FZEH 3O45B 3RTLA 2B4CL 3T0ED 1NCAH 5J13C 4UF7C 1M4KA 3FQYA 1D5XB 3KPSD 2G9KA 3NK4A 5AB1A 2D7TH 3HZKB 2Z9TA 3TO4C 1DZ0A 3H3BC 2F9BT 2GTZA 4L8DA 4DP4X 5AB2A 5IVXA 1LMIA 5GS0D 1ZLUK 4ORGB 1E5CA 5M7QA 4L18A 1YEIH 3HPJB 5ICXA 4ZW3A 1IX2A 4N8VA 4ZAKA 2XXFA 3GHEL 2BNQD 4JCLA 2DLFL 3GSOA 1XGUA 4E9YA 3U4AA 1BLNB 3ATEA 3FB5B 3GSVB 4GBXB 4ABVA 3U0PA 1L5GB 1CGYA 4ZBJA 3BJ91 4TL4A 3L3DB 1UACL 2NUTB 4KROC 4MSWB 2FJHB 4L4TD 5CN1A 5C2BL 4WU7A 2E47A 2ZOUA 1U58A 3NOIA 4GRWH 3FYIB 4ODWA 1U8PA 1XCTB 4OGYH 1TTCA 4G6AD 4AQ1A 2ZWLT 4X6FB 1E30A 2BIQA 2YHGA 3BH4A 3DYMA 4PJ7E 2KQMA 5T5NG 3UG3A 1H9VA 5IW1A 1SJVA 1J88A 4K8RC 4BSJA 4HIHB 4ILDA 2X6AA 4MMZB 3NQKA 3RG1C 3WY2A 3BH8A 2KLRA 1NCCL 2HT3D 4HFUH 5DFVD 2VZTA 3B3IB 3K6DA 1MW1A 1HXMA 2J3SA 3BOVA 5IEHB 1OM3H 2YLKA 1MFDL 4WI9A 1G7MA 3MNZA 3LRSB 1MELA 4N5ED 1G6VK 3GK8H 3MLRH 4PB0L 4TTDD 4NLAA 3I3BA 4OCXL 1BMWA 5D7JD 3N41B 3EDEA 3KL3A 5MENB 2FR4B 2BP3A 1TTGA 4XNZB 4EI6B 3P77A 4XNUH 3DK2A 4BZ2L 3ARGD 3U0WH 2R69H 4H8VA 3I3DA 3SPJA 2YAOA 1ZSHA 1KPVB 1MCLA 4CL7A 4OIFA 1NLBH 4QRBA 1BCIA 2XYBA 3CFKB 4KV5F 3S3SA 2DY2A 2G75B 4JM2C 3GXMA 3OAUH 4UAOB 2CHNA 1EJFA 3TBWA 5ITFA 2ALAA 3NJHA 3FQWA 1DBJH 4HV8A 3BAYA 1AVAA 4G8GB 4N2NA 5ESVA 1MNUH 2H45A 3GIVA 2WN2A 5EO0B 3BPLB 5TE6L 2EVIA 4L3AA 5EBLA 4PG2C 2Q7NA 1FE8H 2X4UA 2HG5B 4NQXB 4A2EA 4GY4A 1E6OH 5ESAB 3TP4A 1QBAA 1TNMA 3NH7H 4UANA 1OAUL 1TPXB 2JLLA 3QORD 3GLEA 4QF1B 4ELMB 1MVYA 2QVKA 1PKOA 3I6KA 4EN3C 1B3IA 1LO2L 2P49B 4GS7C 2JB6A 4GG6B 2YRLA 3TO4A 3QQ9D 1MFVA 1E9QA 4PJDB 3RPIA 3ROOA 4I1PA 1D6VH 2ZUTA 2YPVA 5HJGA 2YKLH 4X8XA 4TNWF 3V5HB 3AZUA 3TNMB 5J57B 3TBTA 4DPCX 4PJXE 3UYPA 2FYYA 2X0WA 5DQ9B 5E5MA 4JFTA 4MZ2A 4R8WH 2QPDB 3GRBA 4NWUL 5BRZE 4Z3TA 1JWMB 2QELA 3FQNA 1HINL 3O3AB 5EZIH 1T5KA 1A8JH 4ZUSB 3OHXC 3ME0B 4D3CL 1HEHC 3VDAA 4R9HA 5ID1A 1WZAA 2M2DA 2ZCHH 4DZBB 3VFSA 5CEZL 5IY5B 1JNJA 1EMTL 2QSCL 5B1BB 4BUGA 5TDOB 5IG7A 2J5LB 3WAKA 4GUCA 4PRPD 4MB3A 1DCLA 1FAIH 3OAYH 1BQKA 2L7QA 3QC6X 4UINL 4QRTA 4YHKH 2IH1A 1S8DB 1AGCA 2C7FA 3ETTA 1D5IL 3LB6C 4YS4A 4PB9H 5BZDB 1J8HA 1WAAA 1AO7D 3BUTA 1URIA 2A9CA 1QSEA 3ALPA 1LP9A 2AEQL 1JI2A 1DLHB 1SMDA 3V4VL 2DMHA 3VXUA 3MRLA 3POCA 2OS7A 1A4KB 4PRNA 5DJAB 4ZTOH 4QOKA 1S9YB 3TX4A 2PCPA 2H2PC 3VRLF 1Y6MR 2VUYA 2JB5H 2VMEA 1AOHA 3PXLA 4OCNC 5FWQA 3RRQA 4DERA 1V3KA 4E41D 3CIQA 3HAEB 4BH7A 3BKYH 3KPRE 3L3IB 5SV4A 5D1XE 2ZXDA 2DBLL 4MZ3A 4Y4FB 2FNBA 4FQLH 3VUAA 2WQSA 4IIQC 1J0ZA 4IIZA 5F93C 4MA1B 4JFSA 3QO1B 1YPZA 1HH9B 4F7TB 4WTZG 5L2KA 1SPDA 3LPGA 4KAQH 3U1PA 1KBVA 1KLUB 3X1EA 4ABQA 5JXAH 4RAHA 3MBXL 3D9AH 4X5RA 1INEH 1N4XL 5T3XD 3UEZA 5SWSE 1N0XH 5D5ME 2VMFA 4PG2A 2YUXA 4TQIA 1K4CB 3QUMH 3W37A 4U1JA 1WGVA 4JGNA 1IC4H 2DYPD 2YD0A 5KSVB 3QPXH 1MG3C 4IMLB 3S34L 3T2LA 1KF9B 2WSKA 1SJHB 4LHQB 5EBMA 2G5BB 3IRPX 1A3ZA 5HVGB 3HAEG 2VN3A 3TYGL 3NEEA 4FE9A 4Y2OA 4K3DH 3PWVA 4RISL 5I1GH 4G3YH 1KJ3L 2W95A 4WWPA 4JDTH 5E99H 2F8XC 2CIIB 1JHTA 3A47A 2E7CA 4L1DA 1DVXA 3G5YB 3BAWA 4F1ZA 5K59E 1IKNC 5DR5H 2BPBA 4O9HH 2VZUA 4AYFA 1MCQA 2XWZA 2ED6A 3FUNA 3NEOA 2R2CA 1FSKC 3D2UA 4GJTB 4M7LL 5E8DL 4PBVC 2FBJL 4P05A 2EC9U 3TN0C 5BRQA 2KPWA 4FMFA 2HKFH 1PL3A 1S78C 1U93A 3MXWL 3KS0H 2UUDH 5KVFH 3BLBA 2B1AH 1CFTB 4TUOA 3OHXA 4HXBL 4DVRH 5KVEH 1B9ZA 3B43A 1JGLL 1TXKA 3BWAB 2YKKA 1FL5A 5CIPH 3AS2A 3FCTA 5DJZB 1E0OB 2DQJL 1G0XA 1BAGA 4MDJA 1PQZA 4Y4KD 3C5JB 2GJZA 3EYSH 1DQLH 2P5EB 3QFDB 1AKJB 3D12B 3QCUL 4NQDE 5AKSA 5IQ7H 1U8CB 4H20H 3TV8A 1AKPA 1M2VA 1T4KB 2P24A 3EYUL 4H25B 3ECUA 3DO7B 4U1MB 4MLSA 2QVTA 4OFIA 4R5VA 4HUXB 7TAAA 2DM7A 5CINL 3MACH 3CSFA 1EEZA 4G2AA 3KWUA 2WTRA 4XMZA 4Z23A 4GP8B 1VENA 4DP0X 5GGVY 1V3JA 5GGSY 3NCXA 3VYNA 3GBMH 3ZDZF 4EUPA 1CLOH 5HDWA 1AMXA 1YN7A 3BSZL 1YMME 4LPUA 4UU9B 2ATPA 1IMHC 1KC5H 2ICWB 3JYBA 1YCSA 2DLEA 5L4FA 3BP5B 3FU6A 5I30H 3DVFA 5LGKA 6PCYA 3PWUA 1E2VA 4Y9GA 1J9CT 1W0WB 1R5IB 1Q1PA 4PJHF 4C4BA 1EO5A 2F5BH 4FQPA 3A67H 2Z0UA 5C09A 1QNZH 1F11A 3B9DA 2NYKA 4M1CC 1RK0A 5ETUA 4NQEA 2B5IC 2Z8RA 1IGMH 3ARBA 3IFOA 4CKQA 1C08A 4LARL 5DXWA 5KVDH 4PHZA 1UJTA 2A74C 2X40A 4ZO9A 1EHLH 2OYMA 2PW2B 4P57B 1R3HA 4ECNA 2VC2H 4XNYH 2B1HH 1E5BA 4OJEH 1RKRA 5ECGA 3UTTA 4AQZA 3P73A 3WHXA 1OGTB 4O5LH 1YEHL 1OTSD 2GI7A 4Q6IC 4RGNB 4HFWB 1SLUA 2AHIA 3VWJB 2NZ9C 4JKPH 4Z7VF 1GCFA 3GMNB 3H9SE 1OP4A 4PRHB 3EW3B 1ZHLA 3U1SL 3VXNA 3HBQA 4UILH 2CDGA 3MV9A 3OKKA 5KANG 1QI5A 1FBIH 1S7TB 1CFMA 2C9AA 3G08A 5SWSA 1AQKL 1F4YL 1M9SA 3F85A 4KI5E 1UEYA 5E8EB 2ZPKL 4QKTA 1CU4L 2WC7A 3B2VH 1TZIA 2BVQB 2QDWA 2JSFA 3H7BB 4R26L 3QHFL 1KGJA 3RWEB 1NCGA 1BAFH 5E51A 2A9ML 1IKNA 1ERNA 4YE4H 5FHAL 5BO0D 3O81A 3MLVL 4NRYB 3S8WA 1ZSDB 1Z9LA 1DJIA 3RUGB 5E7BA 1AHMA 1QAWA 1ND0B 4JVUA 3GUFA 2OL3H 4UOW1 1XGRA 4HBQA 4JFXA 3TN0A 3ECBB 3OLGA 1KWKA 1KENL 4UT6L 5EUOE 1BF8A 2MHAB 3L6FA 3DJZA 4H40A 4X80H 5CZVL 1UKQA 3ASNB 3LS5L 5BRZD 2EEDA 2BWDA 3E9TA 3FMGL 4XN4A 1OKEA 4M1DL 1SN5A 1JF1A 2CK0L 4CSSA 4FP8L 4ALAC 1P4UA 3OGOE 4F9PC 1F4AA 1NUFA 5C0EB 3AUWB 3BUYA 2GBVA 3KVDD 5GRUH 1OY3B 2UYLB 4AKPA 1I9IL 1ZT4A 3G6JE 3LY6A 5LDUA 1UKSA 2XV3A 4EZJA 4B9KC 4HPOL 2LTQB 2PXYC 2JCCF 2ZD0A 1T1ZB 4TMPA 1PLBA 2OJZL 2QMKA 2NQ3A 4JFEE 5AW7B 1AXTH 1I7ZA 1TJMA 2X3AA 4N85A 4Q2ZA 4AJ0A 1WUZA 1CICC 2CUMA 2UWEE 3K74B 4HA1A 4LCWA 3QE5A 5E1GA 4FABH 3C2AL 2VE6B 2NW2A 4YMPA 1VDGA 1NGYA 2B4CC 3DRQB 3KPNB 4P3CL 1NC4B 3U4KA 1FCCA 1UXSA 1ZLUH 1NBVL 3RIAK 3DTXA 3H4HA 5FUOH 2IMMA 3MLPA 1YNLL 1OP5K 4JHZA 4UM9B 1T6WA 2IWEA 2ZTBA 3HC4H 4LCCC 4OV5B 3VXSA 3K4ZA 1KG0B 2A74A 5AOZA 3AQDA 1QFWL 1PX4A 5MEOB 4DEPC 3BZFB 1LO3L 1ZKAA 3SYQA 2ZNXA 1WGOA 3MKKA 2VXQA 4RMWA 3PUCA 3L95A 2OZ4H 4GKOA 1JZ2A 2OXHA 2EO1A 4E9XA 2IBBA 1ZANH 4Q6IA 3W11D 3GXNA 4PJBF 3UYRL 3JWNH 4OLUL 5T1LB 5EF0A 3QG7H 4MJ4A 2H7WA 1DVFA 4ZI8A 5CUSH 4QRPA 5I24A 3U9WA 4HXAL 1JTPA 4NI3A 5F9DC 3IGAB 4PJCE 4OJFL 3V6OE 1UVQA 1RH8A 1ZVNA 5IMKA 3L1OH 5C0IA 4JL2A 3AVEA 4GIAA 2JH2A 4HUUB 4PRBA 4AITA 4B3EA 3OGCA 3QFJE 4MCMA 4DAGH 3ARFB 3MBED 4YO0B 2BH0A 1EWHA 4UQ2A 1X4YA 1KCSH 2YD4A 3UCQA 1CFVL 3LKPB 3B83A 1V55B 3DV4B 5LHDA 2W91A 1IAKA 2Y06L 4LNRB 3DSFH 1JV2B 3R7QA 1SF3A 5KAQG 2D8KA 2QPFA 4OT1L 4XXWC 1MG2C 4QJ4B 5SWZB 3N85H 3TCTA 2PPAA 5AUMA 1UEMA 2ORBH 4LCIL 1LTXA 4LMQE 5DURB 1BBDL 1F8TH 3SCMC 4XVSH 4ZSOA 4BA0A 3P4NB 4NAMA 3RFZC 1FNAA 3OMNB 5DHXB 3ARTA 4XNMA 2R4RH 3PABB 3BIKA 4ONHB 4NPJA 1HAWA 1S7UB 2DIAA 2NMSA 1KLFB 1QR4A 1BEYL 3FN3A 3OKLB 4RZCB 3RL1A 5A7BA 2PO6B 3C6LC 1QYGH 3MUGB 4IU2B 1I1YB 3DA0A 3GMMB 3DXAA 2APSA 1TEGA 2WBJB 1N9PA 2ADYA 2YRZA 4BHUA 2B4CH 4OLYL 1FGVL 1IVLA 4JR9H 4FNSA 4NQDD 1JG9A 1IBFA 4O58L 4PHXA 2EYSB 2QVMA 4JCMA 4JFHE 3WN5C 1HSAB 5DJ8B 3IN0A 3LDBB 1M7UA 4BK5C 1P7HL 5E94B 3KPOA 1D2OA 5B1CA 5D96C 1TZHB 3HC3L 1CICA 2VDKL 4QYOB 4J8RA 2DLFH 3F8UB 1HHGA 5LWYH 3CFCL 4YEFA 1S5HB 4OZ4B 3FT3A 4JDEB 3QQXA 2D7OA 4PLKC 1Y0LB 4S1SL 5FW6A 5FGSA 4FG0A 5FX3A 4E5XB 5IKCA 3PP4H 2CA3A 4IU3B 3AQZA 5DU7A 3G04A 1INQB 3QXDB 4OUOA 1YMMD 2TRYA 2CRMA 4DO4A 2H9GB 4QHKI 1AXSA 1CE6A 1YEKH 3KE0A 3MTXA 4JN1L 4NENA 2UZYB 2BVUA 4PJ5A 1R3LA 3SDDB 1PLCA 4I0PC 4MGXA 3DOHA 3L3GB 4NUMA 4PM1A 4ATWA 4GMTL 4BEIA 1QEWA 1AHKA 1Z1WA 4TSCH 5C0CB 3TZVB 4GLRI 2WMPA 3VFUB 4OM1L 2A99A 4HWNA 5CBEB 4K7FB 1URZA 3PRZA 5FO9B 3HBGA 3DYOA 4OF0A 2QR0A 2Z7WA 1MHHA 2N7SA 3Q6FA 3IAQA 1UCBH 1W8NA 3NCCB 4RSYA 1I1CA 2VDRB 3NJIA 3IMSA 1DQJA 5ECJE 4X7TA 4E5XG 4ENZA 5L8LB 3AREA 3SKNA 5I9QC 1FDLL 3BEWB 1PG7X 5F7AA 3KLLA 1I3RA 4YR6A 3QZBA 4BZ2H 3VMNA 4LLUB 4GEIA 4L0PB 4P5MA 3MGOA 5HPOA 2VW7A 5HHVL 4X4YB 1FL3A 1T83A 2K1MA 5D2NB 1S9VA 4KI5D 4BFIB 4J5VA 1ZXQA 2JXMB 4QRAA 4WFGE 4Q56A 1HJBC 5JLZB 4DKTA 2P47B 3IDMB 1TYJA 1IFGA 4R4FH 3NT0A 4Z7WB 4X9GA 4XXWA 3DGCR 4OD1H 4N0UB 3WO4B 5KN5B 3CK0H 4QTIL 2VLRD 2ISDA 3D3VA 1H8OA 1HILB 1DBAL 3P40A 3SCMA 1MY5A 4TLUA 4I5BB 4LKCB 3UBXI 2N4IA 2LE9A 1K2DB 2OMZB 5AG9A 3V7MA 4IHOA 3DC0A 1KTDB 2BVEA 1C16B 2XQYK 4M02A 5KSAC 2DLHA 2H1XA 4QUOA 4I4WA 4KKPA 2ICCA 1FN4B 3GI8H 2PCYA 2JKJA 2ESVB 2WXGA 1LO2H 1T6BX 2P4AB 3NJMA 1E5ZA 3QFGA 3E6HB 3WNKA 5J12B 4FQ1L 4I48B 4XN1A 5H8DA 4CVWA 1KSRA 4MQXD 4RGMC 5CBAA 5JR1H 1GYWA 7CGTA 1EEYA 3DECA 2F7RA 5TF0A 3WN5A 2UY6A 3AMLA 4YDMA 1IM9D 2HUEA 1RJZB 4BK5A 4RIRB 1G7HB 3UJJL 3PGFL 2V7HA 4KJQD 3MRPB 1JZHA 4H1LB 2I32A 4IMKC 5D9SA 3MBWA 1QASA 3WSQH 1HHHA 3ZO0A 4N2KA 1CDYA 1GL4B 1ONQB 4JFED 2CGRL 3FTGB 1AZNA 4IS6A 4EPSA 1JYWA 3IJSA 3S5LB 1MCSA 2I85A 1ZA6B 1TENA 3CPUA 5GJTL 4KTGA 3INOA 4YPGB 1U3HB 2E0PA 3MOAL 3RA7H 1TTBA 3S3BB 4TNWK 2R0KH 5CEZH 5J89A 1UJ3C 1I7RB 4I0PA 1NKRA 2DQUL 4NJAL 1H8NA 1O5DT 1ODAA 2APXA 1MHEA 3DUHA 3L3JA 5I8CA 2J8UE 1D7DA 4KRPD 1PNDA 3FDWA 3SGJC 2H2SC 2F74B 4UINH 4Q9QL 4XP1L 3W82A 2KUTA 4PG9A 1FZOB 3I9AA 3TVMB 1E9OB 2FWSA 4I18C 3HNSL 1WFUA 2A6JB 2MSPA 1BF5A 4HIJA 4OZHB 1MI5D 3FQ1A 3HN8A 5KJ7E 4PJIF 5E1AB 3CHQA 5DI8B 2QPEB 1Q9WA 4OCRL 4OSUH 1A7PH 4H1LG 1CE1H 4HG4J 1NC2D 5D1ZB 2XVLA 3BKCH 5I73C 3IDYB 4WNQA 3P3SA 3PGCA 4WLCA 1WWBX 1X4XA 1R24B 1I8LA 3GMOA 1NSNH 3IGLA 3QIUA 5EMYA 4G8FA 3S5LG 1N6VA 4JO2L 5IQOA 5CGYD 3DPBB 3G7TA 4ZMWA 3N50A 1Q1JH 5C97A 4HPHA 5K9OA 1C1EH 2DBLH 4EO5A 2Q86B 3MRDB 2ADFH 5M94B 3ILPA 4YDKL 5ACMA 1ORSA 3V4VA 3FS9A 2DEWX 4XODA 1RUPL 3FOLB 1T2JA 1GKEA 1PS3A 1U8QB 3K4DA 3P0VL 2CBMA 2ILLA 2HLAB 3KWWB 5IB3B 3KJ6L 1ASPA 1CIUA 1KTRL 4PJAE 1N4XH 4WHYG 1KPRB 3FO1A 1R3JB 4JG0H 1P9MA 3UP6A 2KC0A 1BQRA 2DOCA 1VIWA 5AZEH 4AVHA 3V4LA 5AYQA 4P04A 2VDQB 4ZUVA 5BOPA 4KTDH 1NDMA 5ES4B 1P5UB 1Z6JT 3CNKA 5D7IA 5KSAA 1RIUL 1RZKL 1HNGA 3RWFB 3T1FA 2WLIB 3D39E 2EH8L 2NYZA 4IOSD 1A3LL 3O2VL 4OZIA 3K6IA 5I1KH 4DESA 1RU9L 1NIDA 3D0AA 1VACA 3ARWA 3UTPE 2B39A 1HQ4A 2A6KA 5CJ5A 1NCUA 4YFLF 3SDYH 4AL8L 5MHSE 4FCAA 4GW1B 1F90L 5KBDA 2A2QT 1CFQB 1IIKA 1S7RA 2Q87A 3F2LA 4ZODA 4IMKA 1JSYA 3EH1A 3OD3A 3U6RA 4E9TA 3EO9H 1S7SA 2RQ8A 5BO1L 1MFEL 4JFHD 3ZN6A 1ORQA 3LXBA 4P99A 4XI5C 2E5EA 2E7LA 3O6FD 1RFDH 1KCUH 3SE6A 3CDZA 3VFOB 2C1OA 4JRWA 1ET8A 4P49A 3TV3L 4N24A 1CGSH 3TYFB 3FSVA 4D2NA 3B2DC 3WLBB 4D0CB 1IEBB 1JGUL 2J72A 1CURA 1PYWA 1Y6NR 3T0EB 3FO0L 1ACYL 4NZFA 1UJ3A 3D69A 3JV6B 1MRCL 3G3LA 2X4OB 2DIJA 2Y1ZA 2BC4A 2V2WB 1J5OH 3MA7A 3SGJA 3VD2A 4HHWA 4WIQA 1N8ZB 2BK8A 2O5NA 2QHRL 3CFBA 4I18A 4K7PH 3EF7A 1G9HA 1MVUB 1NAKH 4OZGB 2EAEA 3ZRFC 2QGCA 2BNQB 2FX7H 1KYOK 4U6YA 1HZHH 4XVTL 5CINH 4CW1A 1GSKA 2JK5A 1NICA 1T5XA 3D06A 1HL8A 5ADPH 4WKZB 3D0VB 5F1OB 4FMKA 2IDUA 3SDXA 3CVIH 5C3LD 3N91A 3O6KL 2VDPB 4LPCA 3D08A 2Z3FA 4BSVB 4PWFA 2AXFB 3F7LA 3FRUA 4OGXH 1JGEB 1U8LA 2JQZA 5HGDA 3MAWA 1AFVH 2APTA 3WO3B 1CIDA 1IILE 2VZOA 4FKKA 2J55A 2IADA 3HG1D 1FUNA 1MDAA 3F84A 4N9GB 3IT8D 4IRJA 1XEUA 3C08L 3ZW3A 4GFTB 1Q9OA 3WEOA 2G3XA 3N1FC 4RWYL 3BSZA 3TH3T 2VQ1A 4W1TA 1HOCB 3FB7A 1H6EA 1QSFA 1IC5H 3H3KA 4ELKB 4PJFB 5ICZA 1WFOA 4HWBL 5KJRH 4RFEA 2YEZB 2IVFC 3SBQA 3SDAD 3EJSA 3UZQA 5JW4M 4A38A 2KZ1B 1QLFB 1Z32X 2EXWD 4DQOH 5JW4N 3C8KA 2CMRH 4N8CL 4ZX5A 2P8LB 5F7NC 3WFCL 2JKIS 3IJEA 4LLWA 3ARGB 2GUOA 1EBAA 4X5LA 3U1SH 4C56A 4N0YL 2FWOB 5F1NA 3KG5A 1FYTE 4N90E 4P5TD 1ZK5A 1OW0C 3KYAA 3BYYA 4A7GA 1MXDA 5CGTA 3ZDXE 1IBGH 3EJTA 4BK4A 2EIZB 4U7KA 4Y89A 4BA8A 1ZMYA 5HHQA 5B1AB 1T1YA 2AABH 1CGWA 4QWWD 1VGKA 5GJSL 3UFIA 2C1PA 3C5ZD 4MA7L 2DQEH 2VO8A 3GXPA 3JV4B 5B7MA 4RA0C 1B4LA 1U2HA 4IRSA 4GNKB 4F8OA 1RLWA 2ZKYA 5ACZB 2KZWA 3BO8A 1GS7A 1WH0A 4KMTL 3BHBB 5F72S 3V0IA 4AJVA 5T1KA 2VYRE 4FHKA 4UT6H 5FKAB 2YBRA 3AQXA 3LZFL 3CBRA 3OKOA 3R8BB 1WBYB 2CGYA 4ZPVA 2ATKA 2XBDA 2R9HC 2GTZB 3QNXA 2B0SL 1P1ZB 3LS5H 3SJVD 3FMGH 1EV2E 3LNFA 1O7VA 4M1DH 4ZMAT 1NGPH 1A7QL 1BQHG 1CD0A 1I1AC 2HJLB 5ICXB 1ZLSL 4BUQA 1PDKA 3CE1A 4NKIL 4ZAKB 2YPLD 4Y2LA 1FQ9C 1TJIL 2DI8A 2WXRA 2X4PA 1FH2A 3BMVA 3DJ9A 1XGUB 4LE8A 3U7YL 4HC1L 5HDQL 4UT6A 2CIKB 1EJOH 4ZTEA 4JY6A 5G4NA 1QEXA 1YMHB 2ODIA 2EKSA 2GHWB 3NESA 1U58B 5JOFB 1U8PB 4YXHH 1DANT 3KGTA 3ML9A 2AVFA 3HLAA 1WT5C 1UH2A 4HYTB 4OU3A 4UT7L 2J8HA 3ABKB 1BWMA 2OMYB 4H44C 4V2CB 3P4MA 5A16A 2YUVA 2G2RB 2CRIA 4POYA 4JQVC 3JZYA 5TH2B 2ZKXA 2IWKA 2IQAA 2O30A 2HLFD 4QO1A 1S3KL 2EXYC 5B7FA 4PRPB 3LZQA 1G7MB 3MNZB 4X6CE 1S7XB 2HJKA 4RRPA 4G1EA 1LEKA 5H35A 3GB7A 2WXIA 3VXTB 2ZOOA 3K46A 1AO7B 5DYFA 1GGTA 1QFWH 1N0LA 4L5FL 2NY4D 3RNKA 1GXEA 4Y1AB 1JD7A 2C9UA 2HYMA 2B15A 1BJ8A 1SY6L 3MRRA 1NCIA 1DJYA 5GIRB 3CC5A 4KNTA 4XPTH 1F1AA 2WYZA 4E0RB 4OZFH 5ANHA 1SJMA 4XOEA 1RJLA 1F4XH 4N1EA 1UB5A 2DEXX 5T33L 4WW2B 4F2EA 4GT7A 3O8XD 1OTTC 4QY8A 4FRWA 2NSXA 5ITFB 3CC1A 5FYKL 1XB3A 5D2LE 1OW0A 4HV8B 3MLXL 3H2QA 3T3PE 5D71H 2F53B 3O2WL 4HKJA 5J9PB 2DKMA 3NCMA 3QHTC 3GIVB 5HPMB 2FEDC 3JYCA 3BPNC 4AUUA 4HISA 2YIHA 2XWJA 3Q3GA 5EBLB 5MI0B 4IKJA 1HS6A 3L4TA 4JK0D 1UT9A 1A6TA 1YQVL 1G1CA 5CEXB 1CFVH 5JHBA 3ZU8A 1HFUA 5C0GA 3UTPD 5EZOL 3BT2L 3LN5A 1YUHA 4QRRA 3D4ZA 1WHPA 3G5VA 5F0JB 3N5AA 5LCVL 1FL6A 2OK0L 4U2YA 5CJQH 2SODB 1UWEL 3NIDB 4OT1H 4HMDA 4UNUA 2NXYC 3BDYL 5D72H 2JB6B 3TWCH 5D8JH 3WNLA 5JHLH 4XC3H 5TJWK 3T8MA 3WNOA 2YAPA 2R7EB 4ODHH 1AC6A 4LHUA 2Z35A 3H9YA 3ROOB 3GZOA 1FFQA 3ZT6A 1J1XL 4NZTH 5I1JL 3QJQB 4WK2B 4XNAA 4ZMZA 2J21A 3TBTB 4U1IA 1CYWA 3TNNB 2FYYB 2H1LM 4K3EL 4RZKA 5E5MB 2C9QA 1SDDB 3EBAA 2ZWKA 1K9TA 3L3OC 4XP5H 2W5PA 5ICYB 4OJAA 4KXDA 3W0WE 4OLYH 2E7MA 2NNFA 1ADWA 4P9HC 4JY5H 1BM3H 1Y6KR 3NJXA 3O3DA 3FQNB 2ZX8A 4O58H 4G7YL 4XHJC 2D03L 2HN7B 1DJXA 3Q7JA 1JP5A 4P46A 3HZVB 3QG6B 5DF0A 3OB0H 2XVGA 1WT5A 1FZKA 4OUUA 4Y19E 3QXUA 4XB7A 3B7SA 3KAAA 4ZOCA 5EPMA 4FYSA 1SBSL 3H8NA 5F88B 3SGDI 1UD2A 1PCSA 2ICWJ 3RIKA 3KPQA 4AZ8B 1IT9L 3L5XL 5F0MB 4EI5C 4Y4KB 5C3IA 2YD3A 4N1HB 1U4EA 1AGCB 3VFVB 2MWCA 3R1GL 1OCWL 3IDIB 4HD5A 4WDIA 1J8HB 5C0AE 3I3EA 4GRWE 5KYYA 2XQYA 2XG5A 4OCWH 4C47A 4JPKL 3DHUA 1G84A 2EDXA 3PWPE 4LXFA 2XN2A 4PJ7B 1KXQE 3BZDA 4Z3JA 1J9RA 2Q6WB 3TA3C 3MRLB 3PWLA 4DH2A 5IIEB 4PRNB 4MB1A 4QOKB 4PEEA 4FX5A 5JXEA 3T4AC 5E2WL 4GMTH 3D07A 3FCSB 1XD0A 3PIQB 3L1EA 4OM1H 1AGEA 4BH7B 4EJ1C 2E56A 5AOKA 3CV5A 1I85C 1BWWA 3B7RL 1VADA 3NZ8A 4F7MB 2AQ2A 4F8LA 1UWGL 4C83B 1J9QA 2AJZA 5BPPA 2DIBA 2BVYA 4WK0B 4HOXA 1KEGH 2DWYA 1IC7H 3HZMA 4POUB 4YHOH 1IEAA 1A1NA 5KYWA 1II4E 5FA3A 4F7PB 5J1TC 3P0YL 4K71B 1CCZA 1FYTD 4N90D 4FXKB 5E6ZA 3N41F 2EE2A 5F0LB 2BHFA 4OD3L 4POZC 3S35L 1BJ1J 1EXGA 1FLRL 4JM4L 5IJKA 2HFFA 2VN7A 3SPCA 1NL0H 1ET5A 5CCJA 1DJHA 1SZNA 2DJ4A 2JKLA 5EBMB 1YYMH 2AK1L 4ADJA 3FN0L 3OPUA 5E70A 2Y3NA 4D8PB 1PD1A 2A6IB 3F04A 2XZCL 4EIZC 5FM8A 1JZ7A 1FVCA 4W4OA 3PWVB 4PCSA 4YK4C 2FD6L 3BWZA 5EOQL 1S9XA 1IE5A 4P9HH 1Q90A 2C8NA 5EH1A 5CLWA 5EBGA 1AZBA 4ADIA 1WD8A 2C4FT 4K5PA 4MZIA 3WLWC 3UO1L 3FO2B 3HVNA 5HD8D 1IBHA 4XTRC 1N3NB 3SO3B 2WVTA 1N59A 4AYFB 1OGAA 4YC2C 4KJYA 4PVBA 2N59A 4MDIA 4F5CE 3L3OA 4M6NL 1TJXA 3ARDA 2Y22A 1R19A 4MVBC 4LSRL 1W9XA 3NRQA 1MPAH 1P7BA 1A3RH 4DN3L 1B0RB 2IF7A 5I0VA 1H3XA 3LRHA 4Y1TA 1FL5B 3D0LA 5ITBL 3L1FA 3ULAB 3WNIA 1S5IH 3FCTB 3LRGA 5BZWB 3GJFB 1AE6L 4MDJB 4JHAL 4NN5C 3PGFH 2IPKA 1MZZA 4PJXB 5KTEH 5E08L 5KWYC 2D2CC 3V6FB 4CU7A 2YMOA 2ZOLA 5C6PB 3NABH 4JX0A 2R23B 4QTHA 1OO2A 4G82A 2CH8A 1KPUB 4LSUH 4F9LC 4BDVA 5BRZB 1X5LA 4L9LB 1M2VB 4WWNA 3RL2A 3DX1A 1HI6A 2WVSA 3V4PH 1MHCB 1ZHBB 3FH7A 1OCOB 8CGTA 4H8QA 3EBHA 1XZ0A 5HHOA 5KVGH 1NEUA 3STBA 3LKRA 1EEZB 4DCQA 1A8ZA 3SE9L 5KBLA 3A6CH 4XAWL 3T8XA 3GSQA 4ETQA 1XSIA 4TPRH 3TOPA 1XH0A 3D52A 3EYQC 2DQUH 5J06A 3L7EB 1YN7B 3QNYA 2XV2A 3ROLA 4Q9QH 1E4JA 4XP1H 2GI0A 4HDIA 4PRIE 2V5YA 2R0ZL 3ZTDC 1DLFH 2DLGA 5LBGA 4ODXA 3PWUB 3TIEB 1I85A 5IHWA 4K0OA 2Y1AA 3D85D 1NQBA 4NLHA 5EORL 5GRZA 3TO2A 2DBJA 1OSPL 1QP1A 2EZ0C 5BMFH 3EO0B 4BFFA 1AG6A 3QUYD 4XPAH 3D05A 2F5AH 5ETUB 1KXVC 5I1IL 3ARBB 3U30C 3BZEA 2HX8A 1X6NA 2W60B 1KGUA 2ZX9A 3QIWD 4GMSL 2XWDA 3RDJA 2EADA 2QDVA 2X4SB 1GRWA 3WKYA 1G43A 4AC2A 4L8CB 2BP0A 1XL6A 4A2GA 4JJOA 3KPRB 3QR1A 1R3HB 5D1XB 1TTAA 2W88A 5E8OA 5IF0A 4NPKA 4P07A 5D1QD 4GW4B 4JANB 1FA4A 1EGJH 4MRCA 4ZMLA 3IDNA 3PWJB 3U9UB 2VJ8A 4YDKH 4TRPL 1FZJB 3KYMA 2DQMA 4NIKB 4G70B 4AK1A 4QXWA 2YPKB 3HE6D 1XZWA 1GS8A 3FTVA 2CDGB 3OKKB 3AW5A 1M1XB 3KJ6H 1YJDL 4WFFE 5I0YA 3G08B 5BQDA 5PCYA 3RX5A 3FONB 3GRWH 5SWSB 3ZKQD 5DS8B 4Z3GA 5D5MB 3W1ZA 3HB3D 4AT6B 1WZ1H 3S6CA 4LPXA 4XWOC 2EDFA 4ACTA 1UUSA 3IKCB 3O2DL 5E0QA 1JNLL 1XR9B 1NDGB 1J8KA 3AU0A 1RIUH 3RGVD 2ZSWB 4FXGC 5E5UB 5I1DB 1P53A 1FRGL 1SVCP 1EERB 4LL9A 2EH8H 5D7SL 1A5FL 2Q8BL 3PWNB 3MNWA 4GI9A 4ES9A 3PHQB 5DDHA 3BGFB 5FUZH 4N2AA 3I6SA 4JRYE 3VRJA 5F7KC 1WUNT 4YNYB 1OOAA 3NA9L 3QDGE 2ZKMX 3W0WD 4Y5YC 5AZ2H 3AWEA 1GGCH 4OCMC 2H1PL 2XPZA 5JHDE 2XWBB 2BZCA 4Z1PA 1P2CA 3NG5A 1JRHL 5K5YA 2J1KA 5CD3B 2AAAA 2X1QA 4FG6D 4YEEA 3RFRA 3DBXA 1GY2A 1Z9NA 1ZT4B 1EZVX 4Y19D 2QLVB 1EBPA 1CFBA 1NMAH 3BKJH 1B9KA 5DRNB 5KVFE 1JD9A 1H3UA 5JPNA 5KVEE 3FHEA 1LYQA 3UTZA 1A2YA 4WTQA 4UT9L 4R97C 2F54A 4B60A 1JGUH 4BHUI 3GLAA 4DP6X 2KBGA 4UUJA 1N2RB 1RZFL 5JA9A 4NQDB 2V33A 1ZPLA 4X99A 3HS8A 2IWGA 1U8MB 3OHMB 5C0AD 5B3JE 1ROWA 1RP8A 2X1XR 4UQCA 2BVTA 1JUFA 1KCBA 2KL6A 3V95A 3PWPD 1A02N 1UATA 1JOIA 2LT9A 4PUBL 2YGOA 2VQUA 2YARA 5F3BB 1E4XL 3TPUB 1CDJA 2EINB 3DHJA 1UXSB 5DHVB 2OTUA 3GSNH 3II2A 4JO3H 4JO1L 3APCA 4G7QB 4NJ9L 4R0LC 2YZ1A 5TK4A 4AYSA 1INDH 2PYEA 3IJHB 1KXVA 1U95B 2CKBL 4GAJL 3FTYA 5HDBF 5KYUA 5TPWL 2VDMH 3O6KH 5E5LA 2GCYB 3DI2B 2AFNA 3CU7A 3VE0A 3L7FA 4FCHA 1P6AB 1WEJL 5BS0A 2V5TA 1Z3GH 4NCC2 5FF6A 2F08A 4TUJB 4N2CA 1YEJL 2MEJB 4HHAA 5AVXB 5C0RL 4P2AA 1RY7B 3L95B 5GS1A 3PY9A 3LMJH 5CKAA 1KCVH 1I8IB 3JUZA 2OXHB 5DRXA 3FZUD 3H9ZA 5DJ6A 5K39A 5A2IH 4KTYA 4JG9A 4XRCB 4OBRA 1OAKL 2QKIC 1NZRA 1X5YA 2XQ0A 2XQBL 4YHML 4PN6A 3G5ZA 2JNZA 5DSCB 1DVFB 3BP6B 5IW3A 5KVDE 1P5VA 3V8CA 3AAZB 1FJ1B 4MRBA 1M42A 1UVQB 3POHA 3IVKA 2VAAB 5C0IB 2BIHA 4UBDC 5IMKB 4AG4L 2EVJA 2HFGH 2VDNH 4OFYD 4YIQA 1ZV9A 2V5RA 3D34A 2YD6A 3S9DB 3Q2VA 2RFXA 3Q8BA 3CXFA 4B9GA 3UTSE 4I2XE 3T08A 3MJ8B 3QEQA 2XI9A 1F86A 1ESOA 4S1RL 3V6ZA 1MCRA 1F6LL 3F7YB 1CBJA 3H9SB 4QHLA 4FXGA 4KJWC 2WO2B 4GKSB 2HFEB 2FDBP 5H4YA 3TO4D 4KY1L 2IGFL 3BP7A 4HWBA 4KH9A 1M1SA 4JFYA 3SE4C 5K69A 1FNGB 3O9WD 4XH2B 1AOZA 3M17A 3V55A 1G6RL 4KVCL 2AJUL 1MCEA 2IV9A 3IXTB 2H32B 3F5WA 2HCZX 3QR2A 4Y0GA 5I6XB 5GJSH 1AZUA 2G2NA 1FF5A 3BVVA 4I7ZC 4Z95H 4YHPB 2OMNA 1Q38A 3QUKA 4KROD 1AZRA 2XKNA 3ZTJG 3RL1B 4B9FA 4CN6A 2HRPH 4HS3B 5IWLC 3STLA 3IJYA 5EUOB 1MWAB 2BINA 5IM7A 2YGPA 2JIXD 1A9BA 2EDMA 2PW1A 2DQIL 1NCBL 4JRYA 2BSBA 2IDCA 4DGVH 3KW7A 1TKWB 4DT2A 4FG2A 5C08E 5T5FL 4QNPE 2CU9A 4HQQL 1C9SA 4TSBL 3WE6A 1UWXH 1OP3H 3X1NA 5JHDA 1D5ZB 3CZGA 4HIEB 1QBLH 4LOUC 3QRLA 4NKIH 5BJTB 3OLIA 1TJIH 4J8RB 4ZW6A 3EH2A 3Q8AA 1DBBL 4JPQA 4YXLL 1AJ7H 1HL4A 1CK0L 4HC1H 1B6UA 3FT3B 3G6JB 3U7YH 4YHLL 2OULB 1SHXA 4C4KO 4MJIA 1XIWC 3DROB 3JT0A 3PQYE 4CGUB 3VXUD 5EZJB 1QLEH 2YSTA 1QRKA 1H8LA 5GISH 3RBGA 3ZYOA 4Z6AT 2YBGA 3ZE0F 1T6VN 4XB3A 3VMOA 4JFEB 4PRID 1AXSB 1CE6B 3B2UC 4NENB 3HNTL 1MRFH 1U8NB 3E38A 4UNVA 2YQBA 4WI6A 2UWEB 3VW3H 1YDPA 1CXIA 4HZLB 1FLTX 4HC1A 4J6IA 2IDQA 5KSUB 3VQMA 1FAKT 2BWIA 4ZQKA 3T2NL 4JM2D 2F7OA 1T20A 3VFNA 3RAJH 2WMPB 3FFDA 1ZS8A 5JIPA 5JPMC 1OXYA 4NDMA 2CLZA 3LXUX 5TE4L 2JMRA 4I0KA 2QKIA 3DX6B 3H53A 3C09B 3VFTA 4KOBA 1COBA 1WA1X 2HRLA 4OGZA 2AXGB 3SKJL 3KZ8A 1JJUA 2IDFA 4FQXD 3QW9A 4TQEL 5EEYA 1K4DA 1DBML 3AREB 1RZJH 5EG6C 4MZRA 1NAML 2PR9A 5AVWB 5F7DB 3SKNB 4FFWD 4HSAC 3FBQA 3NJGA 4URKA 1NFIA 4MBRA 1UA6L 2F58L 3K0YA 1Q0YH 3U2IA 2DJUA 4P5MB 3MGOB 4PJGE 4K23H 3V0GA 4ZX3A 1BG9A 3VD7A 4WFFD 2QBWA 4LSQL 1FL3B 1RXLA 5T33H 4EN3D 2WN3A 5J8OA 3JWNE 5IBTL 4XGZA 2CUHA 4KI1A 4CMHB 3QJHA 1YZZA 3ESPA 3O41A 4JM0A 1KGIA 3VI4A 2DM2A 3WMPA 1SY6A 1YN6A 2UXFA 4CC4A 4ANUA 1LNUA 4Q58C 3RX9A 2FJGB 3ZMNA 1BHGA 2W65B 3E1F1 1GAFH 3NFNA 5BW7C 1NUDA 5MEQA 2RCSL 3UTSA 3QFJB 2L04A 3NIFB 5IZ7A 4UZGA 1BPVA 4N0FB 1NGZA 2O6CA 1FZMA 5E8NB 1FVDA 4LSDA 1XO8A 2WOYA 3MO1B 1GMIA 4PJ8C 4CN1A 5FV2A 5EZOH 2NY3B 3BT2H 4JKNA 2MTPA 4LQFH 1I3GL 4WGWB 4A68A 3C5XA 4IM8A 3IETB 1K8DB 2DQDH 5I8KL 2OK0H 5IWLA 2RTTA 3BSHA 5TD4A 1MAML 2BIMA 3CPLA 3BDYH 1M71B 2ZUWA 4PP2B 3CFJA 5IB2B 3PJSA 3SBWC 2CCLA 1AP2A 1BGXH 2FLBT 4XMKH 1GZQA 3LHPH 3T6XA 5DVOA 3UG5A 2VOTA 3ZKXC 3QQNA 3HN3A 4OQTA 3FB6A 5DD6A 1W91A 4Q6KA 5GRVL 1AQDA 5I1JH 5IW6B 4M6ML 1KDIA 3BE1H 1TZGL 1OP9A 3EXLA 1Z9OA 3LB6D 5G2NA 5LCVA 3MLUH 1J12A 2QQKL 3OZLA 4BV1A 2E4TA 3GSRB 4QR7A 3L17A 4Q9CA 3AC0A 4BD4A 3QXAB 5C70A 1P4BH 3C6SB 2EXTA 2F15A 4IS6B 4LPVA 1T4WA 4P2OC 2D03H 3DGDA 1RHFA 2DLIA 2H2PD 2XIDA 4OLXL 4RDQF 2R1XA 1QSZA 2VLJA 2ZYRA 5GRXG 4LP8A 4WUUA 2PP7A 2W8CA 3JTTB 4FXLA 1MLCA 4AE1A 5I8CB 3KLHD 2R8SH 4L3EA 3MODL 5G4OA 3VCLB 2EIJB 2COVD 4PG9B 3QIBD 2LU7A 1U92A 3R1GH 5JPMA 4U1LA 4ZS6C 2GAZA 4GQ9L 4HIJB 1A6UL 1DFBH 4XXCC 2AKRA 1FO0B 3MCYA 4TM9A 1I31A 1NFDE 3ZUCA 2JWYA 3TL5A 4XZ4A 3QYNA 1EFXA 5FOBA 1KACB 1KB9J 3CFEA 3PGCB 3QUHA 3TBVB 2W92A 2QQNL 5K9KA 1EO8H 3QIUB 3LQZB 2VZ3A 4WV1C 5AW8B 6CGTA 3MRKA 4XMLL 2N0MA 2AC0A 1MF2L 4X8JA 3Q9PA 4HULB 2FO4A 1UGKA 4K3HA 3ILPB 3BVXA 1ORSB 1L3WA 5I74C 3PL6A 1B2YA 1HCYA 3MMEA 4OIAA 4OLWL 4U6TA 3LS4L 5AZUA 4U1NB 3VFPB 1P4LA 4O51A 1CF8H 4X4ZA 3HR5A 1A6AA 2QTEA 3DBSA 4KK6D 4OB5H 3NMEA 3JVFC 3VI3E 5ADOL 3ZK0A 5HYJE 4YSPA 3K6FA 5FA4A 5CP7A 2UVEA 2X12A 4CC1A 4PGCA 2E76C 2IANE 4Y2DD 1S7WA 4YH6A 4BXSV 4HMCA 3BT0A 4OD3H 4P5KB 4PJ8A 3BQUA 1UURA 1UXWA 1FLRH 4JM4H 1L9RA 5E4IA 2V2XA 5GRVK 3SDAB 5D7IB 1E7UA 3NAAH 2CO7B 3HE7C 1AAJA 2EE9A 5CWSA 1XGTB 3F01A 1NGWA 3GJEA 1MCOH 3GI9L 3PNWB 1IM3A 4CGTA 5K1VA 1Q4NX 3SYPA 4OZIB 3PAYA 1XAKA 2WKOA 4JPWH 1VACB 1MVFA 2QLYA 2G60H 3SBWA 3ELQA 3SB3A 4G9FA 2H0EA 1G7PB 4AM0Q 2V9UA 8PAZA 3PHAA 3T6ZA 1MCWM 2B20A 5T1MB 4ODVL 1S7RB 2CO1A 1I75A 4ODBD 2ZF8A 5IHLB 1A14H 4PGEB 2L7JA 4ONFH 1ED3A 3IFLL 3M88A 4MS6A 2R2HA 4RAUA 3C5ZB 1YJDC 5DEFA 5C08D 5TF1L 5IJVA 2F1BA 1X3DA 4M6NH 1KYFA 5CSZA 4S0TD 5L4MA 3QCVL 2OJ1A 8FABB 1OZUA 4P2OA 4XNQB 3IXAA 3NCFB 1BD2A 2WKLA 1CLCA 1IFHH 3WFZA 5IQ7L 4NZ8A 2K8QA 1HCVA 3HMWH 1QACA 2W07B 4PTUB 5ITBH 3SY0A 4ZD3L 4MYWB 3CVDA 5INCA 2ZXQA 1PYWB 1XQ4A 1E28B 2AEIT 4UMGA 3UJIH 4WI0A 3UX9B 5EEUA 3PQYD 2J43A 4K4KA 1TQCC 4NQCE 4ONGL 1DBKH 3D69B 4XPFL 5LXGL 4AQEA 1OB1B 2B14A 2AJVH 4YX2H 2A73A 2BC4B 2GJPA 4O4YL 1LWJA 3QUXC 5J0BA 3C2SA 1MIMH 3TJHC 4M1CD 3CFBB 1UT1A 2DW5A 2QSQA 4OCSH 1F5WA 3CUPA 1T0OA 3GTTA 3QI9C 5GRJL 3LKSB 3MRIA 3VXSD 3WFBL 2L7EA 1B4RA 4JE4B 2GEEA 3ZZ1A 4CW1B 1DUYB 3SE9H 3DX7A 1T5XB 2L4OA 5A1AA 2OMXB 3P9MA 5CEZE 2XN9E 1XDTT 2AMGA 1L4IA 2OSWA 4GT0A 3ULUF 2A4ZA 3M1BB 4KFZC 5IP4A 4Z3IA 3HCVB 5KS9E 2P8PA 3AM8A 2P5WE 2NPLX 3S37L 4WV1A 1ZY9A 1QOKA 2NZ9D 2R0ZH 3E8UL 1RZPA 5E0FA 2UX6A 5BOZG 1O0VA 4HLZH 3F7QA 4F2ME 5EORH 5FYJL 2VL4A 3N42B 4LAQL 1SXZA 2IADB 4JE0A 4ES8A 4IRJB 4Z7UF 1T1WA 1Q9OB 2D0GA 5E9NA 2R0WL 3L9RA 3SGEH 5I1IH 2GFBA 1O7DC 3EOTH 1OB0A 1RUAH 2VQ1B 4MLIA 4RFNC 2IFGA 4NHCH 3FB7B 5DLLA 3ILEA 3RHWF 2Z6FA 1KN4L 1HSBB 1FH5H 5DQJA 3VXQA 3MYJA 4NN6B 1I1FA 2YMTA 2BCKB 3MROB 5KSBA 2AAVA 4TL5A 5F21B 4CADB 4UDUB 3QULA 2CUAA 2BHYA 2HVJA 4LBAA 2NY4B 1MH5A 4X6BA 3FRPA 5LBVA 3C8KB 1UQSA 1RHHA 4Y5VB 1ZT7B 4UQ3B 4AJWA 2AQQA 5I5IA 4Y5XB 5IUSA 2MKLC 3I85A 3VG0H 3IJEB 4FJYA 4HGMA 3QO0B 3HE7A 5IROC 4ACPA 1YEFL 3L2LA 2Y7QB 1DCEA 2BFVL 3WTTA 1YJDH 2JKTM 1MJ7H 2XFGB 1UD3A 2D3LA 5DYOA 3VI3A 5DK3A 3S96B 5LBSL 1QFWI 4PFEA 3MGTA 1T1YB 3O2DH 1UOLA 1U3YA 4LQ1A 2NXZB 2C1PB 4OVUA 5JDSA 3KYOA 5EB9A 1NUGA 1TLKA 5EWIL 3IEAA 4WHTA 2J8OA 3D39B 2PXYD 4W6XB 4ZFGL 1A5FH 5EO9B 1B4TA 3MVSA 4XX1G 1YY8B 2YN3A 5I6OA 5T1KB 3UACA 3DSNB 4FQIH 3KPMA 1KEML 4LLYA 2A83A 1GZPA 2X7LA 4NUGL 1YNTA 3OKOB 3D4YA 4K7PX 5C0FA 2OCFD 4ZPVB 3HS0B 3QNXB 5LGHH 4QI3A 3OSVA 2GJJA 2MCG1 3HIZA 3QHZH 3Q1SL 2VNCA 4HUMB 1PDKB 4ICWA 2Y69B 2ID5A 3MTRA 3QUXA 3L5JA 1OANA 1UUNA 2X4PB 4GYBA 1KT2B 4D8OA 2X1WL 3VD1A 1UZGA 5FGRA 3QI9A 1FG2A 3IE9A 3CD4A 4MJJA 1ZLDA 2EKSB 3QPQD 3B9KD 2NNAA 4L4JA 1CFNA 4H5SB 3NJNA 4MCYB 4O2EB 5DRZA 3W9EB 2I9TA 3KXFE 3QWOA 1P7KB 4PWKA 1BAWA 1O6VA 2BS9A 4N0CD 4Y4HA 4BZYA 1AQ8A 1U8OA 3MJGX 1NGQH 1MUJB 4J8QA 5A16B 4PV1C 3IDGA 4DGUA 2LFEA 5AL0A 4PUBH 4RFOL 5BVPH 2ZXGA 3P9LA 4YDJA 5CCKH 4QO1B 2X10A 3QDME 4UT9A 5B8CB 4X4XA 4FAAB 3WFHB 4OKVA 5I1CH 3I9GL 1CR9L 4NJ9H 5KOMC 3WNNA 1Q0XH 2HJKB 5JIHA 2C9XA 3GKWL 2CKBH 2R39A 4G1EB 4GAJH 5H35B 3U4EA 1A3QA 1S9WB 5EA0L 2BNRE 4OZGF 1IQDA 5KS9A 3LSOA 2J2ZA 3RNKB 1WEJH 2Y9RT 4R7DA 4WFHE 5T3XH 1PLAA 1ETZA 4QJ3B 4M3JA 3KHOA 4DPAX 1RJLB 2C3VA 5L9DL 1UB5B 2CKBA 4ODTL 1QRNE 1GJUA 3VXPA 1KTKE 2XQBH 4KKAC 3D3VD 2QV2A 4KZ0A 3BWUF 2G30A 2LHAA 5M95B 1JZ6A 2YR3A 2Q1EA 2D73A 2XTJE 3ISRA 1JXKA 3OJDB 4G7VH 3ULSA 4PV8B 4Y2NA 3TXAA 3CHPA 3C6LD 3GQFA 1OD7A 1B2WH 2PR4L 1PG7W 32C2B 3VXMA 3X13B 1JPSL 1M6OB 1BFOB 4PJFF 1SNRA 3TA4D 1NLDL 3MNVB 4HKZA 3LN5B 4Z78A 1FYTB 4QRRB 5AAPA 4FTVE 1U4FA 2DMBA 3ZIMA 2FGWL 3RPBA 2DWEA 4F15B 1SJEA 3ZDXB 2BVOA 3FUKA 4HJGA 4FKHA 1UADC 4FF9A 1JHLL 2LV4A 4WF7A 4ZXBA 3SE8L 4YE0A 1NKGA 4AYID 4W9HC 4UQBA 2Z35B 3C60C 3EYOA 4PLKD 1K5NA 2X9YA 4LLQB 1LXMA 4V1DA 4YSRA 2HVBA 4F58L 5I6LA 4YZFE 3BAXA 4U1IB 1YSOA 1T89C 4FYRA 4LPTA 3VFMA 3PLYA 2N3JA 3UBXG 4AYEC 1VGEH 3DK0A 2MPAL 4GINA 5GGVL 3AS3A 3P54A 1G6RA 4FFVD 4P2QA 5I1EH 4BFGA 2I25N 4XP4H 5IB1B 4NQCD 1A65A 2UV3A 2WINB 1DUZA 3VD9A 2X0VA 1XF2B 1YECH 1NCBH 5FYLH 4PSRA 1X7QA 4I0PD 3V0VA 5HGBA 4XP6L 5BV7H 2DAVA 4P46B 5T5FH 2DQCH 3MX0B 4GBXC 2DI9A 3DIFA 2XDHA 4BGLA 4TSBH 3FUDA 5DVLA 1R34A 1FZKB 3OXRB 4G72B 5EPMB 3FUIA 4KTEH 5B38B 2VXTL 2VMJA 3S4SA 3LNGA 1T0MA 2BS71 3PNRB 3JTSB 4MCNA 4ZW7A 3KPQB 4AV4A 2JE8A 3EZ8A 5ID0B 4PJEE 5CEZD 3AXLA 3CTTA 2XN9D 4XPHL 2J6EH 5K9JH 3BPCB 1CQKA 5GGTL 2FB4L 3SZKC 4MMZC 2HRHA 1SDAB 4RVBA 2P5WD 1KIPA 4I3SL 4Y16B 4KZEL 4GXUM 4KKCC 3UZVA 3MRJA 3NACL 3IB4A 4JPVL 4LP4A 5FYKU 3ZHFA 4AGOA 3GIZL 4KKZA 1KBBA 4FNPA 3G6AA 2EE0A 5LDSA 3H1ZA 3C6EA 4KO6A 2IG2L 3T2NH 4GAYA 3T0BA 2BSSA 5TE7L 4R3SB 2JKNA 3EYFA 1AGEB 4NZRH 5EUKA 1USQA 4X6CB 1DVSA 4XNZC 4KKBD 3MR9A 5LNGA 1KIUA 5GGUA 1OCRB 3NZ8B 3H55A 2Z4TA 2FUQA 4YSDA 4S1QH 1RZ7H 1T2QL 3ILQC 3L54A 4HUWA 1A6ZB 3D85B 5K9QG 4PIRF 5MP6L 4JDVB 4PY8I 1TTFA 5DJDB 3FUEA 1NAMH 1XGZA 1ZHKA 3EFFA 1YNKH 3BP4B 5C0JA 4WI8A 3VJ6B 5J7CC 1WPCA 2BO0A 3LKQB 4J3XA 4UAOC 5DLMH 3ULVL 2I5YL 1A1NB 2A5UA 2BRRL 2NY0B 3NDYE 2G0LA 5E1QA 2F58H 2Y0SA 2XNAA 1BOGB 2GIYA 1JVKA 3LIZL 3QBTB 2IEPA 4LSQH 4W9IC 3KGUA 5DJYA 2VXUL 1RVFL 3NA4A 5H37G 3P2DA 3BPLC 5D2LB 1FNEA 4PRAA 1CD8A 3RX8A 5ISZA 3T3PB 1ASOA 4P23A 3ZHLA 3LH2L 2H4EA 4LHJB 5FGBC 3VTAA 4E9WA 2W0FB 4LASH 1BVNP 1TPXC 4HJIA 3BZ4A 3S5ZA 4OF7A 4ESKA 1H9DA 3C60A 2A9AA 5DO2C 4Z5RB 5IB4B 1VLXA 4PYHA 2BX5A 4TVPH 3HB3B 1I3GH 1IAIH 3HZKA 2Q5BA 3FUFA 1N59B 1T89A 1QWUA 4EXPX 2KI6A 4NN7B 4ORGA 4QJ5B 1MAMH 3HPJA 3OLDA 3OAZK 3ARDB 2E9IA 4QAWA 2C9RA 2YAQA 5JZ7C 1G9NH 1UD5A 2ZAHA 4KK8C 5G5DB 5L6YH 1B0WA 1BLNA 1KZQA 3FB5A 1ZLWK 4GBXA 3D0LB 2IH9A 2H2SD 4G7SB 4YHZL 3B56A 3L3DA 4W6WB 3PP3K 2NUTA 4MSWA 2FJHA 4YLQT 5F7WC 1LJMA 2A6DB 2YUWA 3J2PA 3KXFD 4EXKA 2A4CA 2BNUA 4APQD 4HIHA 1BA9A 2YA0A 4MMZA 1E9PA 2J5LC 2VDRL 1WWAX 2FX9L 2APVA 2WUBL 4KV5E 2ZUVA 3RKDD 5GQBA 2PPCA 3QUZD 4EDXB 3B3IA 1BYNA 4JUTA 4Y19B 5IEHA 4BGDA 3RP1A 3VSTA 4Z0BL 4HPYH 4HH8A 5H94A 2Y6SC 3LRSA 1IO4C 4F27A 3V0WH 2XXGA 3GBNL 3QNYB 1JXFA 2Q3XA 1UTDA 4NFCA 3E3QC 2D3VA 4M62L 3H2PA 2XA8L 5SX5H 2BNRD 3OMAB 3V9EA 1IGFH 3PHSA 3WY4A 3Q8FA 3JSSA 2FR4A 5C0AB 1OL0A 5F7YC 4K5OA 3ZRSA 4B95C 2BJML 4EI6A 3ESVF 3NEXA 2R4SL 1RI8A 1RAMA 1WCQA 3RWHA 3WKNA 3O6LH 5DC2A 2CBTA 2WWNA 3ETSA 4Y4FC 3CFKA 3T6VA 2XN1A 1QRND 1WAAF 2G75A 2RGSA 3B7UX 1RJCA 3LEYL 4MA1C 2PWDA 5F9OL 1R5VB 2CO3A 1LP9F 4Q74A 4LFHD 3KJ4B 2AVGA 3BAKA 2CK2A 5DD3L 1U3ZA 2VMDA 4G8GA 1RPKA 1BSIA 4AENB 2XTJD 3KYMB 5F7HA 3LQAC 5EO0A 2Z1PA 4WTWA 2AANA 4YDZA 1MEXL 4QPEA 4DUWA 1CXHA 1NKOA 4X7FC 4L1SA 2HG5A 4NQXA 4S10A 5ESAA 1LDPL 5F97E 2VQ4A 3PFQA 4ELMA 1SGKA 2AEPL 1DQIA 4M6OH 1YPZF 4FTVD 3O6MH 4FFZL 5FM5O 2E75C 4MNGE 2DQHH 1FHNA 4HJJL 4GG6A 2OA9A 5DZPA 2K6WA 1HU8A 2ENJA 1OZTG 3Q8CA 4PJDA 2ZONA 1F58H 3U0TB 4Q4EA 1GZHA 2VDLH 3UGEA 3TCXA 3TS8A 4FN0A 2BSTB 1WA0X 3V5HA 5A7EA 2IIJA 2JQAA 3TNMA 3FT1A 4UQAA 1BG1A 3KR3H 1CXLA 4RESB 5J13B 3NCWA 4M43L 2EILB 4XMTA 1JXDA 1NCHA 2AXJA 3CVHH 3M8OL 2A77H 3UJTL 4GO9A 2CJUL 2WP3T 3O9WB 3RJDA 3OAWA 4ODVH 3QZNA 2OCCB 3C75A 3O3AA 5DEJA 4ZUSA 1TETH 2GT9B 1V8HA 3BKMH 2QPSA 3RTQA 4E9VA 1QVOA 1P2CB 2OMVB 5TF1H 2X87A 2QHLA 4OAWA 4DZBA 1QW8A 3QCVH 3DBXB 1MXGA 5E1IA 1VPOL 1RULH 3FU9A 3DVGB 2X4RB 1LO4L 2JTYA 3EOYG 5JPNB 4JZNB 3JTBA 3UTZB 2WPGA 1S8DA 3CX5K 3WIHL 2JIXB 3EJRA 1W0VA 4M00A 2AV7B 5BZDA 1QUNA 5DRWA 5LXGH 1K6QH 3UAEA 1L7IH 2CNZA 2FTAA 1DQML 3P3YA 3RX7A 3V4UL 3FUHA 1DLHA 1UB6A 5FK9A 4YSQA 5E2UL 4XNXL 1A4KA 12E8H 2WLKA 5DJAA 1ETA1 1HCZA 1W2KT 5KUKA 3WFBH 4PJXF 5I19L 3ESOA 5KVGE 2OTUB 1NPNA 1SBBA 2F0CA 4LDOB 1R5WB 3HAEA 1TCMA 3FT2A 3PUUA 2VKXA 1CI3M 3LQAH 5DUPH 3L3IA 4HUVB 5CMAB 5KYUB 1CTMA 4M7ZB 1YYLH 4Y4FA 3VE0B 1EZVY 3L7FB 3KD4A 1KGCE 4TS6A 1WSST 4PRIB 5BS0B 3RVUD 1XH1A 3S37H 2VDQL 3IWVA 3FU0A 3QT2A 2V6HA 4F7TA 3AY2A 5A2AA 4HHAB 4EF3A 5GS1B 2GYSA 5CCGE 1A6WL 1HDMB 5DJ6B 1OVZA 1LD9B 4U6HB 2WXFA 2ZP9A 1E6JL 1USZA 2CRYA 4FZ8L 2EECA 4K3JL 2DB8A 1A22B 2I7SA 1K4CA 1T7YA 4GI6A 5EFIB 2JFCA 4RGNC 5EU4A 4A6YH 3VWJC 2E6JA 2R1YB 4X98B 4IMLA 5KSVA 1SJHA 4CJ1A 4K07A 2G5BA 4FQXB 5F1SA 2RFXB 3GSWB 1QR1B 3S98A 1F02I 3S97C 3SD2A 3QEQB 2I27N 1XCWA 2ADGB 4M8QB 3PG2A 3V6ZB 3B4NA 4IBVA 4LSTH 3ASWA 2V3FA 1HKLH 2WQ8A 3VWKB 2PUQT 4QHLB 1PZUB 5H2BA 1NCOA 4I77H 4F91B 1CUOA 3RHWK 4ZX4A 1FPTH 4JHWH 2FYVA 5IQLA 3BRGC 1KJ2H 4IQHA 4QGYA 1KB5L 4HZAA 5B4MD 4RMRA 1I1AD 2P7TB 1DQDH 2IPUG 4KOCA 5E6ID 3HUJE 1AIZA 3F5WB 1UOVA 3QUMB 3WDJA 1QHPA 5GS0L 2ICEA 5ESQA 2YJQA 4WAFA 1CFTA 4RWHA 1JERA 5E9DE 4ENEC 3QUKB 4HS8L 2XKNB 3L3HA 2GC4C 4QRSB 1KFAL 4OLVH 4GQRA 5LKNA 1UZ6F 2Q7AA 3C5JA 5LBSA 1HL5A 4EDWH 2P5EA 2YMXL 4OIIL 4PJHE 4NUGH 1ACZA 4G43B 3OLEA 3N9GL 2PW1B 3D8MA 4FI8A 3AACA 4JRYB 3UPAA 4AGNA 1UXMA 2VDPL 4XBEL 1PEZA 4PR5A 1IGCH 1MFCL 3QDGB 3MRFB 5T1DH 5JUEH 3B3BA 2XV6B 1DHKA 1KCLA 1AH1A 4U1MA 1UD8A 2VERN 1CLYL 2CALA 5JHDB 1NCTA 2LTQC 1U8JB 2EXYD 4JFZH 4BFBD 5A40E 5JA8B