4KTNA

Dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor ((3s)-1-[2-(pyrido[2,3-b]pyrazin-7-ylsulfanyl)-9h-pyrimido[4,5-b]indol-4-yl]pyrrolidin-3-amine)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
210
structure length
193
Chain Sequence
b'GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title A new class of type iia topoisomerase inhibitors with broad-spectrum antibacterial activity
rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
total genus 60
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4ktnA00
2Q2EB 3Q5KA 2GQPA 3C0EA 4H81A 3HZ5A 4XD8A 5CTYA 2ZDYA 1QY8A 4MPNA 4YKZA 5GGZA 4E02A 4ZKIA 2YEEA 2YEDA 4CWOA 4MPEA 3OPDA 4O0BA 4U93A 4FMTA 2IOPA 4DUHA 3H4LA 4O04A 1A4HA 1THNA 1YT0A 4BAEA 3RLPA 5M4NA 1H7UA 5CF0A 4EGKA 2YI6A 4HY1A 4HZ0A 5M4EA 4UROA 4ASGA 3IEDA 4V26A 4E00A 3EKRA 1BKNA 1TIDA 1ZWHA 3CGZA 4MOTA 1OSFA 1Y4SA 4LWFA 3G75A 2WI4A 2HG1A 2XDKA 3CRKA 3D36A 1UYEA 1UYDA 2WI6A 2XHTA 2WEPA 3U2KA 1YERA 3BMYA 4H7QA 5D7RA 4EGIA 3GIGA 3H80A 3ZXOA 1Z5CA 5IN9A 1S14A 4LP0A 2Q8IA 2BRCA 4BQJA 3HZ1A 4LWIA 4XTJA 3HHUA 4MP7A 5D6PA 4XIQA 3EHHA 2YI5A 3K60A 4FCQA 4GT8A 2BU8A 3TTZA 4XITA 3FT8A 3ZXQA 1AH8A 1YT1A 2XDLA 4XKOA 4CE2A 4URLA 2YJXA 1UYGA 1UYKA 2YKEA 2YEBA 2H8MA 4XC0A 2YI0A 4EFUA 2ZKJA 4L8ZA 2YE4A 1R62A 2BU2A 1YESA 4JASA 3LNUA 2XHRA 4FPPA 4NH8A 3R4OA 2XJXA 3EKOA 2BU6A 4URMA 4YKYA 1AH6A 3HEKA 3A0XA 1TBWA 3WQ9A 3KE6A 4FCRA 2XHXA 3EHFA 4GFNA 4GCZA 4LWEA 3PEHA 3R91A 4KSHA 3B26A 5FWKA 1UYCA 4V25A 2XDXA 1B63A 3R4MA 1UY7A 4GEEA 3TZ2A 1AJ6A 3CGYA 3R92A 5J71A 3VADA 4CWPA 1YC4A 2WI5A 3MNRP 4ASFA 4KP4A 5CTUA 2QF6A 4WUBA 5CPHA 1GKZA 2BYHA 2Q8HA 3EHJA 4YKTA 5L3JA 2UWDA 1YSZA 4PRXA 2AKPA 4E01A 4XKAA 1BGQA 3JZ3A 4EGHA 4YKQA 3TUHA 2Q8GA 4CWFA 3O6OA 5FNDA 4R3AA 1BYQA 4AWPA 3OWBA 4O05A 2VWCA 2WI3A 3RKZA 4CE1A 3ZKBA 3T10A 4LWHA 4QPKA 1UY6A 2YEAA 2XX2A 1YC1A 4KQVA 2JKIA 3U67A 3PEJA 1Y8NA 4XDMA 3FV5A 1UYFA 5CTXA 1GJVA 1ZXMA 3D0BA 4JAVA 4JAUA 2XCMA 3TZ5A 5M4HA 3ZKDA 2BTZA 4R1FA 4H85A 1JM6A 3B25A 4L91A 4KSGA 3DGEA 2YEJA 1EA6A 3OW6A 2YJWA 4JQLA 2VCJA 3Q5JA 4L93A 2ZDXA 2BT0A 3D2RA 4XE2A 2VCIA 4PU9A 3VHAA 2QG0A 2K5BA 2XDSA 3TZ4A 1ID0A 1UY9A 4Q20A 2YEGA 1QYEA 1L0OA 2O1WA 2FWZA 4CE3A 2YGFA 1KIJA 4EMVA 3OWDA 2XJJA 2YKCA 2YKIA 2QFOA 5D7CA 1US7A 1AMWA 3U2DA 4BQGA 2YK2A 4PRVA 2PNRA 2HCHA 1YT2A 2YI7A 3VHCA 1Y8PA 3GIGB 4R3MA 3INWA 3T0ZA 4YKUA 5BOCA 2IWSA 1EI1A 2JJCA 1UYHA 3QDDA 4HYPA 1NHJA 2XABA 2BU7A 2HKJA 3OMUA 2CCUA 3A0ZA 1B62A 2ESAA 4L94A 4B6CA 1NHIA 2BYIA 2FXSA 5IDJA 4ZVIA 1YETA 4EEHA 4AWQA 3A0YA 4EM7A 3Q5LA 1I5BA 3A0RA 1TC6A 4XCJA 3INXA 4PL9A 2YE6A 2WI7A 3FT5A 1ZXNA 4U7NA 3GIFA 2XX5A 3G7EA 1AM1A 4HXZA 1UY8A 3G7BA 1QZRA 2O1UA 4K4OA 1TILA 3R4NA 3RLQA 3ZM7A 3K97A 3T0HA 2YEFA 3VHDA 5FNFA 2BZ5A 2VW5A 2YEIA 1BXDA 2IWXA 2YE7A 4GQTA 4CWNA 5D7DA 3NMQA 2XJGA 2YE3A 5CTWA 3A0WA 4B7PA 1Z59A 2GFDA 4MPCA 3K99A 2CH4A 3GIEA 3BM9A 2BREA 3HYYA 5J6AA 4AS9A 2XK2A 3B27A 2YK9A 2YE5A 4ASBA 1PVGA 1U0ZA 1ZW9A 3HYZA 3C11A 2H55A 1MU5A 3RLRA 4KTNA 3TZ0A 4YKRA 2XDUA 4BXIA 4QPJA 1NHHA 4WUCA 3B24A 5F5RA 2YGAA 2WEQA 2YE8A 4HXWA 4W7TA 4EFTA 4LWGA 1YC3A 2ZBKB 4O07A 4CWTA 2YECA 2BSMA 2WI2A 1YS3A 1YSRA 4CWSA 2YE9A 4I3HA 4BIZA 1I5CA 5M4PA 3SL2A 2E0AA 4MP2A 2C2AA 1I59A 4XCLA 3EHGA 4NH7A 4FCPA 2YKBA 2IWUA 1Z5BA 3O2FA 4XKKA 4HZ5A 3K98A 4MB9A 1UYMA 1GKXA 3R4PA 1U2OA 4HYMA 3CWVA 3T1KA 4HY6A 4L90A 5IDMA 3O0IA 2CCSA 3CRLA 2YE2A 2IORA 3LPSA 1I58A 2FWYA 2O1VA 2WERA 4XIRA 4CWRA 1Y8OA 2EXLA 2FYPA 5M4MA 5D6QA 1Z5AA 4GGLA 4AWOA 3A0TA 2IOQA 4YKWA 1B3QA 4XIPA 4I5SA 1S16A 2CG9A 1TC0A 1KZNA 4URNA 5C93A 4U7OA 2CGFA 4KFGA 3QTFA 2YGEA 1I5AA 1MX0A 1Y4UA 4P8OA 1I5DA 4ASAA 1UYIA 1UYLA 5BODA 2XD6A 4NH9A 2CCTA 1H7SA 5FNCA 2QG2A 2WI1A 4WUDA 5M4KA 4X9LA 2BU5A 2YKJA 4LPBA 3B28A 4YKXA 4DZYA 3T2SA 5F3KA 4O09A 4MBCA 4CWQA 2Q8FA 1TH8A 3WHAA 4P7AA 4BIUA 2XX4A 2YEHA
chains in the Genus database with same CATH superfamily
2Q2EB 3Q5KA 2GQPA 3C0EA 4H81A 3HZ5A 4XD8A 5CTYA 2ZDYA 1QY8A 4MPNA 4YKZA 5GGZA 4E02A 4ZKIA 2YEEA 2YEDA 4CWOA 4MPEA 3OPDA 4O0BA 4U93A 4FMTA 2IOPA 4DUHA 3H4LA 4O04A 1A4HA 1THNA 1YT0A 4BAEA 3RLPA 5M4NA 1H7UA 5CF0A 4EGKA 2YI6A 4HY1A 4HZ0A 5M4EA 4UROA 4ASGA 3IEDA 4V26A 4E00A 3EKRA 1BKNA 1TIDA 1ZWHA 3CGZA 4MOTA 1OSFA 2HHIA 1IXMA 1Y4SA 4LWFA 3G75A 2WI4A 2HG1A 2XDKA 3CRKA 3D36A 1UYEA 1UYDA 2WI6A 3S5TA 2XHTA 2WEPA 3U2KA 1YERA 3BMYA 4H7QA 5D7RA 4EGIA 3GIGA 3H80A 3ZXOA 1Z5CA 5IN9A 1S14A 4LP0A 2Q8IA 2BRCA 4BQJA 3HZ1A 4LWIA 4XTJA 3HHUA 4MP7A 5D6PA 4XIQA 3EHHA 2YI5A 3K60A 4FCQA 4GT8A 2BU8A 3TTZA 4XITA 3FT8A 3ZXQA 1AH8A 1YT1A 2XDLA 4XKOA 4CE2A 4URLA 2YJXA 1UYGA 1UYKA 2YKEA 2YEBA 2H8MA 4XC0A 2YI0A 4EFUA 2ZKJA 4L8ZA 2YE4A 1R62A 2BU2A 1YESA 4JASA 3LNUA 2XHRA 4FPPA 4NH8A 3R4OA 2XJXA 3EKOA 2BU6A 4URMA 4YKYA 1AH6A 3HEKA 3A0XA 1TBWA 3WQ9A 3KE6A 4FCRA 2XHXA 3EHFA 4GFNA 3LMMA 4GCZA 4LWEA 3PEHA 3R91A 4KSHA 3B26A 5FWKA 1UYCA 4V25A 2XDXA 1B63A 3R4MA 1UY7A 4GEEA 3TZ2A 1AJ6A 3CGYA 3R92A 5J71A 3VADA 4CWPA 1YC4A 2WI5A 3MNRP 4ASFA 4KP4A 5CTUA 2QF6A 4WUBA 5CPHA 1GKZA 2BYHA 2Q8HA 3EHJA 4YKTA 5L3JA 2UWDA 1YSZA 4PRXA 2AKPA 4E01A 4XKAA 1BGQA 3JZ3A 4EGHA 4YKQA 3TUHA 2Q8GA 4CWFA 3O6OA 5FNDA 4R3AA 1BYQA 4AWPA 3OWBA 4O05A 2VWCA 2WI3A 3RKZA 5JENA 4CE1A 3ZKBA 3T10A 4LWHA 4QPKA 1UY6A 3CYGA 2YEAA 2XX2A 1YC1A 4KQVA 2JKIA 3U67A 3PEJA 1Y8NA 4XDMA 3FV5A 1UYFA 5CTXA 1GJVA 1ZXMA 3D0BA 4JAVA 4JAUA 2XCMA 3TZ5A 5M4HA 3ZKDA 2BTZA 4R1FA 4H85A 1JM6A 3B25A 4L91A 4KSGA 3DGEA 2YEJA 1EA6A 3OW6A 2YJWA 4JQLA 2VCJA 3Q5JA 4L93A 2ZDXA 2BT0A 3D2RA 4XE2A 2VCIA 4PU9A 3VHAA 2QG0A 2K5BA 2XDSA 3TZ4A 1ID0A 1UY9A 4Q20A 2YEGA 1QYEA 1L0OA 2O1WA 2FWZA 4CE3A 2YGFA 1KIJA 4EMVA 3OWDA 2XJJA 2YKCA 2YKIA 2QFOA 5D7CA 1US7A 1AMWA 3U2DA 4BQGA 2YK2A 4PRVA 2PNRA 2HCHA 1YT2A 2YI7A 3VHCA 1Y8PA 3GIGB 4R3MA 3INWA 3T0ZA 4YKUA 5BOCA 2IWSA 1EI1A 2JJCA 1UYHA 3QDDA 4HYPA 1NHJA 2XABA 2BU7A 2HKJA 3OMUA 2CCUA 3A0ZA 1B62A 2ESAA 4L94A 4B6CA 1NHIA 2BYIA 2FXSA 5IDJA 4ZVIA 1YETA 4EEHA 4AWQA 3A0YA 4EM7A 3Q5LA 1I5BA 3A0RA 1TC6A 4XCJA 3INXA 4PL9A 2YE6A 2WI7A 3FT5A 1ZXNA 4U7NA 3GIFA 2XX5A 3G7EA 1AM1A 4HXZA 1UY8A 3G7BA 1QZRA 2O1UA 4K4OA 1TILA 3R4NA 3RLQA 3ZM7A 3K97A 3T0HA 2YEFA 3VHDA 5FNFA 2BZ5A 2VW5A 2YEIA 1BXDA 2IWXA 2YE7A 4GQTA 4CWNA 5D7DA 3NMQA 2XJGA 2YE3A 5CTWA 3A0WA 4B7PA 1Z59A 2GFDA 4MPCA 3K99A 2CH4A 3GIEA 3BM9A 2BREA 3HYYA 5J6AA 4AS9A 2XK2A 3B27A 2YK9A 2YE5A 4ASBA 1PVGA 1U0ZA 1ZW9A 3HYZA 3C11A 2H55A 1MU5A 3RLRA 4KTNA 3TZ0A 4YKRA 2XDUA 4BXIA 4QPJA 1NHHA 4WUCA 3B24A 5F5RA 2YGAA 2WEQA 2YE8A 4HXWA 4W7TA 4EFTA 4LWGA 1YC3A 2ZBKB 4O07A 4CWTA 2YECA 2BSMA 2WI2A 1YS3A 1YSRA 4CWSA 2C1GA 2YE9A 4I3HA 4BIZA 1I5CA 5M4PA 2C1IA 3SL2A 2E0AA 4MP2A 2C2AA 1I59A 4XCLA 3EHGA 4NH7A 4FCPA 2YKBA 2IWUA 1Z5BA 3O2FA 4XKKA 4HZ5A 3K98A 4MB9A 1UYMA 4E72A 1GKXA 3R4PA 1U2OA 4HYMA 3CWVA 3T1KA 4HY6A 4L90A 5IDMA 3O0IA 1F51A 2CCSA 2FTKA 3CRLA 2YE2A 2IORA 3LPSA 1I58A 2FWYA 2O1VA 2WERA 4XIRA 4CWRA 1Y8OA 2EXLA 2FYPA 5M4MA 5D6QA 1Z5AA 4GGLA 4AWOA 3A0TA 2IOQA 4YKWA 1B3QA 4XIPA 4I5SA 1S16A 2CG9A 1TC0A 1KZNA 4URNA 5C93A 4U7OA 2CGFA 4KFGA 3QTFA 2YGEA 1I5AA 1MX0A 1Y4UA 4P8OA 1I5DA 4ASAA 1UYIA 1UYLA 5BODA 2XD6A 4NH9A 2CCTA 1H7SA 5FNCA 2QG2A 2WI1A 4WUDA 5M4KA 4X9LA 2BU5A 2YKJA 4LPBA 3B28A 4YKXA 4DZYA 3T2SA 5F3KA 4O09A 4MBCA 4CWQA 2Q8FA 1TH8A 3WHAA 4P7AA 4BIUA 2XX4A 2YEHA
chains in the Genus database with same CATH topology
2Q2EB 3Q5KA 2GQPA 3C0EA 4H81A 3HZ5A 4XD8A 5CTYA 2ZDYA 1QY8A 4MPNA 4YKZA 5GGZA 4E02A 4ZKIA 2YEEA 2YEDA 4CWOA 4MPEA 3OPDA 4O0BA 4U93A 4FMTA 2IOPA 4DUHA 3H4LA 4O04A 1A4HA 1THNA 1YT0A 4BAEA 3RLPA 5M4NA 1H7UA 5CF0A 4EGKA 2YI6A 4HY1A 4HZ0A 5M4EA 4UROA 4ASGA 3IEDA 4V26A 4E00A 3EKRA 1BKNA 1TIDA 1ZWHA 3CGZA 4MOTA 1OSFA 1Y4SA 4LWFA 3G75A 2WI4A 2HG1A 2XDKA 3CRKA 3D36A 1UYEA 1UYDA 2WI6A 2XHTA 2WEPA 3U2KA 1YERA 3BMYA 4H7QA 5D7RA 4EGIA 3GIGA 3H80A 3ZXOA 1Z5CA 5IN9A 1S14A 4LP0A 2Q8IA 2BRCA 4BQJA 3HZ1A 4LWIA 4XTJA 3HHUA 4MP7A 5D6PA 4XIQA 3EHHA 2YI5A 3K60A 4FCQA 4GT8A 2BU8A 3TTZA 4XITA 3FT8A 3ZXQA 1AH8A 1YT1A 2XDLA 4XKOA 4CE2A 4URLA 2YJXA 1UYGA 1UYKA 2YKEA 2YEBA 2H8MA 4XC0A 2YI0A 4EFUA 2ZKJA 4L8ZA 2YE4A 1R62A 2BU2A 1YESA 4JASA 3LNUA 2XHRA 4FPPA 4NH8A 3R4OA 2XJXA 3EKOA 2BU6A 4URMA 4YKYA 1AH6A 3HEKA 3A0XA 1TBWA 3WQ9A 3KE6A 4FCRA 2XHXA 3EHFA 4GFNA 4GCZA 4LWEA 3PEHA 3R91A 4KSHA 3B26A 5FWKA 1UYCA 4V25A 2XDXA 1B63A 3R4MA 1UY7A 4GEEA 3TZ2A 1AJ6A 3CGYA 3R92A 5J71A 3VADA 4CWPA 1YC4A 2WI5A 3MNRP 4ASFA 4KP4A 5CTUA 2QF6A 4WUBA 5CPHA 1GKZA 2BYHA 2Q8HA 3EHJA 4YKTA 5L3JA 2UWDA 1YSZA 4PRXA 2AKPA 4E01A 4XKAA 1BGQA 3JZ3A 4EGHA 4YKQA 3TUHA 2Q8GA 4CWFA 3O6OA 5FNDA 4R3AA 1BYQA 4AWPA 3OWBA 4O05A 2VWCA 2WI3A 3RKZA 4CE1A 3ZKBA 3T10A 4LWHA 4QPKA 1UY6A 2YEAA 2XX2A 1YC1A 4KQVA 2JKIA 3U67A 3PEJA 1Y8NA 4XDMA 3FV5A 1UYFA 5CTXA 1GJVA 1ZXMA 3D0BA 4JAVA 4JAUA 2XCMA 3TZ5A 5M4HA 3ZKDA 2BTZA 4R1FA 4H85A 1JM6A 3B25A 4L91A 4KSGA 3DGEA 2YEJA 1EA6A 3OW6A 2YJWA 4JQLA 2VCJA 3Q5JA 4L93A 2ZDXA 2BT0A 3D2RA 4XE2A 2VCIA 4PU9A 3VHAA 2QG0A 2K5BA 2XDSA 3TZ4A 1ID0A 1UY9A 4Q20A 2YEGA 1QYEA 1L0OA 2O1WA 2FWZA 4CE3A 2YGFA 1KIJA 4EMVA 3OWDA 2XJJA 2YKCA 2YKIA 2QFOA 5D7CA 1US7A 1AMWA 3U2DA 4BQGA 2YK2A 4PRVA 2PNRA 2HCHA 1YT2A 2YI7A 3VHCA 1Y8PA 3GIGB 4R3MA 3INWA 3T0ZA 4YKUA 5BOCA 2IWSA 1EI1A 2JJCA 1UYHA 3QDDA 4HYPA 1NHJA 2XABA 2BU7A 2HKJA 3OMUA 2CCUA 3A0ZA 1B62A 2ESAA 4L94A 4B6CA 1NHIA 2BYIA 2FXSA 5IDJA 4ZVIA 1YETA 4EEHA 4AWQA 3A0YA 4EM7A 3Q5LA 1I5BA 3A0RA 1TC6A 4XCJA 3INXA 4PL9A 2YE6A 2WI7A 3FT5A 1ZXNA 4U7NA 3GIFA 2XX5A 3G7EA 1AM1A 4HXZA 1UY8A 3G7BA 1QZRA 2O1UA 4K4OA 1TILA 3R4NA 3RLQA 3ZM7A 3K97A 3T0HA 2YEFA 3VHDA 5FNFA 2BZ5A 2VW5A 2YEIA 1BXDA 2IWXA 2YE7A 4GQTA 4CWNA 5D7DA 3NMQA 2XJGA 2YE3A 5CTWA 3A0WA 4B7PA 1Z59A 2GFDA 4MPCA 3K99A 2CH4A 3GIEA 3BM9A 2BREA 3HYYA 5J6AA 4AS9A 2XK2A 3B27A 2YK9A 2YE5A 4ASBA 1PVGA 1U0ZA 1ZW9A 3HYZA 3C11A 2H55A 1MU5A 3RLRA 4KTNA 3TZ0A 4YKRA 2XDUA 4BXIA 4QPJA 1NHHA 4WUCA 3B24A 5F5RA 2YGAA 2WEQA 2YE8A 4HXWA 4W7TA 4EFTA 4LWGA 1YC3A 2ZBKB 4O07A 4CWTA 2YECA 2BSMA 2WI2A 1YS3A 1YSRA 4CWSA 2YE9A 4I3HA 4BIZA 1I5CA 5M4PA 3SL2A 2E0AA 4MP2A 2C2AA 1I59A 4XCLA 3EHGA 4NH7A 4FCPA 2YKBA 2IWUA 1Z5BA 3O2FA 4XKKA 4HZ5A 3K98A 4MB9A 1UYMA 1GKXA 3R4PA 1U2OA 4HYMA 3CWVA 3T1KA 4HY6A 4L90A 5IDMA 3O0IA 2CCSA 3CRLA 2YE2A 2IORA 3LPSA 1I58A 2FWYA 2O1VA 2WERA 4XIRA 4CWRA 1Y8OA 2EXLA 2FYPA 5M4MA 5D6QA 1Z5AA 4GGLA 4AWOA 3A0TA 2IOQA 4YKWA 1B3QA 4XIPA 4I5SA 1S16A 2CG9A 1TC0A 1KZNA 4URNA 5C93A 4U7OA 2CGFA 4KFGA 3QTFA 2YGEA 1I5AA 1MX0A 1Y4UA 4P8OA 1I5DA 4ASAA 1UYIA 1UYLA 5BODA 2XD6A 4NH9A 2CCTA 1H7SA 5FNCA 2QG2A 2WI1A 4WUDA 5M4KA 4X9LA 2BU5A 2YKJA 4LPBA 3B28A 4YKXA 4DZYA 3T2SA 5F3KA 4O09A 4MBCA 4CWQA 2Q8FA 1TH8A 3WHAA 4P7AA 4BIUA 2XX4A 2YEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2E B;  3Q5K A;  2GQP A;  3C0E A;  4H81 A;  3HZ5 A;  4XD8 A;  5CTY A;  2ZDY A;  1QY8 A;  4MPN A;  4YKZ A;  5GGZ A;  4E02 A;  4ZKI A;  2YEE A;  2YED A;  4CWO A;  4MPE A;  3OPD A;  4O0B A;  4U93 A;  4FMT A;  2IOP A;  4DUH A;  3H4L A;  4O04 A;  1A4H A;  1THN A;  1YT0 A;  4BAE A;  3RLP A;  5M4N A;  1H7U A;  5CF0 A;  4EGK A;  2YI6 A;  4HY1 A;  4HZ0 A;  5M4E A;  4URO A;  4ASG A;  3IED A;  4V26 A;  4E00 A;  3EKR A;  1BKN A;  1TID A;  1ZWH A;  3CGZ A;  4MOT A;  1OSF A;  1Y4S A;  4LWF A;  3G75 A;  2WI4 A;  2HG1 A;  2XDK A;  3CRK A;  3D36 A;  1UYE A;  1UYD A;  2WI6 A;  2XHT A;  2WEP A;  3U2K A;  1YER A;  3BMY A;  4H7Q A;  5D7R A;  4EGI A;  3GIG A;  3H80 A;  3ZXO A;  1Z5C A;  5IN9 A;  1S14 A;  4LP0 A;  2Q8I A;  2BRC A;  4BQJ A;  3HZ1 A;  4LWI A;  4XTJ A;  3HHU A;  4MP7 A;  5D6P A;  4XIQ A;  3EHH A;  2YI5 A;  3K60 A;  4FCQ A;  4GT8 A;  2BU8 A;  3TTZ A;  4XIT A;  3FT8 A;  3ZXQ A;  1AH8 A;  1YT1 A;  2XDL A;  4XKO A;  4CE2 A;  4URL A;  2YJX A;  1UYG A;  1UYK A;  2YKE A;  2YEB A;  2H8M A;  4XC0 A;  2YI0 A;  4EFU A;  2ZKJ A;  4L8Z A;  2YE4 A;  1R62 A;  2BU2 A;  1YES A;  4JAS A;  3LNU A;  2XHR A;  4FPP A;  4NH8 A;  3R4O A;  2XJX A;  3EKO A;  2BU6 A;  4URM A;  4YKY A;  1AH6 A;  3HEK A;  3A0X A;  1TBW A;  3WQ9 A;  3KE6 A;  4FCR A;  2XHX A;  3EHF A;  4GFN A;  4GCZ A;  4LWE A;  3PEH A;  3R91 A;  4KSH A;  3B26 A;  5FWK A;  1UYC A;  4V25 A;  2XDX A;  1B63 A;  3R4M A;  1UY7 A;  4GEE A;  3TZ2 A;  1AJ6 A;  3CGY A;  3R92 A;  5J71 A;  3VAD A;  4CWP A;  1YC4 A;  2WI5 A;  3MNR P;  4ASF A;  4KP4 A;  5CTU A;  2QF6 A;  4WUB A;  5CPH A;  1GKZ A;  2BYH A;  2Q8H A;  3EHJ A;  4YKT A;  5L3J A;  2UWD A;  1YSZ A;  4PRX A;  2AKP A;  4E01 A;  4XKA A;  1BGQ A;  3JZ3 A;  4EGH A;  4YKQ A;  3TUH A;  2Q8G A;  4CWF A;  3O6O A;  5FND A;  4R3A A;  1BYQ A;  4AWP A;  3OWB A;  4O05 A;  2VWC A;  2WI3 A;  3RKZ A;  4CE1 A;  3ZKB A;  3T10 A;  4LWH A;  4QPK A;  1UY6 A;  2YEA A;  2XX2 A;  1YC1 A;  4KQV A;  2JKI A;  3U67 A;  3PEJ A;  1Y8N A;  4XDM A;  3FV5 A;  1UYF A;  5CTX A;  1GJV A;  1ZXM A;  3D0B A;  4JAV A;  4JAU A;  2XCM A;  3TZ5 A;  5M4H A;  3ZKD A;  2BTZ A;  4R1F A;  4H85 A;  1JM6 A;  3B25 A;  4L91 A;  4KSG A;  3DGE A;  2YEJ A;  1EA6 A;  3OW6 A;  2YJW A;  4JQL A;  2VCJ A;  3Q5J A;  4L93 A;  2ZDX A;  2BT0 A;  3D2R A;  4XE2 A;  2VCI A;  4PU9 A;  3VHA A;  2QG0 A;  2K5B A;  2XDS A;  3TZ4 A;  1ID0 A;  1UY9 A;  4Q20 A;  2YEG A;  1QYE A;  1L0O A;  2O1W A;  2FWZ A;  4CE3 A;  2YGF A;  1KIJ A;  4EMV A;  3OWD A;  2XJJ A;  2YKC A;  2YKI A;  2QFO A;  5D7C A;  1US7 A;  1AMW A;  3U2D A;  4BQG A;  2YK2 A;  4PRV A;  2PNR A;  2HCH A;  1YT2 A;  2YI7 A;  3VHC A;  1Y8P A;  3GIG B;  4R3M A;  3INW A;  3T0Z A;  4YKU A;  5BOC A;  2IWS A;  1EI1 A;  2JJC A;  1UYH A;  3QDD A;  4HYP A;  1NHJ A;  2XAB A;  2BU7 A;  2HKJ A;  3OMU A;  2CCU A;  3A0Z A;  1B62 A;  2ESA A;  4L94 A;  4B6C A;  1NHI A;  2BYI A;  2FXS A;  5IDJ A;  4ZVI A;  1YET A;  4EEH A;  4AWQ A;  3A0Y A;  4EM7 A;  3Q5L A;  1I5B A;  3A0R A;  1TC6 A;  4XCJ A;  3INX A;  4PL9 A;  2YE6 A;  2WI7 A;  3FT5 A;  1ZXN A;  4U7N A;  3GIF A;  2XX5 A;  3G7E A;  1AM1 A;  4HXZ A;  1UY8 A;  3G7B A;  1QZR A;  2O1U A;  4K4O A;  1TIL A;  3R4N A;  3RLQ A;  3ZM7 A;  3K97 A;  3T0H A;  2YEF A;  3VHD A;  5FNF A;  2BZ5 A;  2VW5 A;  2YEI A;  1BXD A;  2IWX A;  2YE7 A;  4GQT A;  4CWN A;  5D7D A;  3NMQ A;  2XJG A;  2YE3 A;  5CTW A;  3A0W A;  4B7P A;  1Z59 A;  2GFD A;  4MPC A;  3K99 A;  2CH4 A;  3GIE A;  3BM9 A;  2BRE A;  3HYY A;  5J6A A;  4AS9 A;  2XK2 A;  3B27 A;  2YK9 A;  2YE5 A;  4ASB A;  1PVG A;  1U0Z A;  1ZW9 A;  3HYZ A;  3C11 A;  2H55 A;  1MU5 A;  3RLR A;  4KTN A;  3TZ0 A;  4YKR A;  2XDU A;  4BXI A;  4QPJ A;  1NHH A;  4WUC A;  3B24 A;  5F5R A;  2YGA A;  2WEQ A;  2YE8 A;  4HXW A;  4W7T A;  4EFT A;  4LWG A;  1YC3 A;  2ZBK B;  4O07 A;  4CWT A;  2YEC A;  2BSM A;  2WI2 A;  1YS3 A;  1YSR A;  4CWS A;  2YE9 A;  4I3H A;  4BIZ A;  1I5C A;  5M4P A;  3SL2 A;  2E0A A;  4MP2 A;  2C2A A;  1I59 A;  4XCL A;  3EHG A;  4NH7 A;  4FCP A;  2YKB A;  2IWU A;  1Z5B A;  3O2F A;  4XKK A;  4HZ5 A;  3K98 A;  4MB9 A;  1UYM A;  1GKX A;  3R4P A;  1U2O A;  4HYM A;  3CWV A;  3T1K A;  4HY6 A;  4L90 A;  5IDM A;  3O0I A;  2CCS A;  3CRL A;  2YE2 A;  2IOR A;  3LPS A;  1I58 A;  2FWY A;  2O1V A;  2WER A;  4XIR A;  4CWR A;  1Y8O A;  2EXL A;  2FYP A;  5M4M A;  5D6Q A;  1Z5A A;  4GGL A;  4AWO A;  3A0T A;  2IOQ A;  4YKW A;  1B3Q A;  4XIP A;  4I5S A;  1S16 A;  2CG9 A;  1TC0 A;  1KZN A;  4URN A;  5C93 A;  4U7O A;  2CGF A;  4KFG A;  3QTF A;  2YGE A;  1I5A A;  1MX0 A;  1Y4U A;  4P8O A;  1I5D A;  4ASA A;  1UYI A;  1UYL A;  5BOD A;  2XD6 A;  4NH9 A;  2CCT A;  1H7S A;  5FNC A;  2QG2 A;  2WI1 A;  4WUD A;  5M4K A;  4X9L A;  2BU5 A;  2YKJ A;  4LPB A;  3B28 A;  4YKX A;  4DZY A;  3T2S A;  5F3K A;  4O09 A;  4MBC A;  4CWQ A;  2Q8F A;  1TH8 A;  3WHA A;  4P7A A;  4BIU A;  2XX4 A;  2YEH A; 
#chains in the Genus database with same CATH topology
 2Q2E B;  3Q5K A;  2GQP A;  3C0E A;  4H81 A;  3HZ5 A;  4XD8 A;  5CTY A;  2ZDY A;  1QY8 A;  4MPN A;  4YKZ A;  5GGZ A;  4E02 A;  4ZKI A;  2YEE A;  2YED A;  4CWO A;  4MPE A;  3OPD A;  4O0B A;  4U93 A;  4FMT A;  2IOP A;  4DUH A;  3H4L A;  4O04 A;  1A4H A;  1THN A;  1YT0 A;  4BAE A;  3RLP A;  5M4N A;  1H7U A;  5CF0 A;  4EGK A;  2YI6 A;  4HY1 A;  4HZ0 A;  5M4E A;  4URO A;  4ASG A;  3IED A;  4V26 A;  4E00 A;  3EKR A;  1BKN A;  1TID A;  1ZWH A;  3CGZ A;  4MOT A;  1OSF A;  2HHI A;  1IXM A;  1Y4S A;  4LWF A;  3G75 A;  2WI4 A;  2HG1 A;  2XDK A;  3CRK A;  3D36 A;  1UYE A;  1UYD A;  2WI6 A;  3S5T A;  2XHT A;  2WEP A;  3U2K A;  1YER A;  3BMY A;  4H7Q A;  5D7R A;  4EGI A;  3GIG A;  3H80 A;  3ZXO A;  1Z5C A;  5IN9 A;  1S14 A;  4LP0 A;  2Q8I A;  2BRC A;  4BQJ A;  3HZ1 A;  4LWI A;  4XTJ A;  3HHU A;  4MP7 A;  5D6P A;  4XIQ A;  3EHH A;  2YI5 A;  3K60 A;  4FCQ A;  4GT8 A;  2BU8 A;  3TTZ A;  4XIT A;  3FT8 A;  3ZXQ A;  1AH8 A;  1YT1 A;  2XDL A;  4XKO A;  4CE2 A;  4URL A;  2YJX A;  1UYG A;  1UYK A;  2YKE A;  2YEB A;  2H8M A;  4XC0 A;  2YI0 A;  4EFU A;  2ZKJ A;  4L8Z A;  2YE4 A;  1R62 A;  2BU2 A;  1YES A;  4JAS A;  3LNU A;  2XHR A;  4FPP A;  4NH8 A;  3R4O A;  2XJX A;  3EKO A;  2BU6 A;  4URM A;  4YKY A;  1AH6 A;  3HEK A;  3A0X A;  1TBW A;  3WQ9 A;  3KE6 A;  4FCR A;  2XHX A;  3EHF A;  4GFN A;  3LMM A;  4GCZ A;  4LWE A;  3PEH A;  3R91 A;  4KSH A;  3B26 A;  5FWK A;  1UYC A;  4V25 A;  2XDX A;  1B63 A;  3R4M A;  1UY7 A;  4GEE A;  3TZ2 A;  1AJ6 A;  3CGY A;  3R92 A;  5J71 A;  3VAD A;  4CWP A;  1YC4 A;  2WI5 A;  3MNR P;  4ASF A;  4KP4 A;  5CTU A;  2QF6 A;  4WUB A;  5CPH A;  1GKZ A;  2BYH A;  2Q8H A;  3EHJ A;  4YKT A;  5L3J A;  2UWD A;  1YSZ A;  4PRX A;  2AKP A;  4E01 A;  4XKA A;  1BGQ A;  3JZ3 A;  4EGH A;  4YKQ A;  3TUH A;  2Q8G A;  4CWF A;  3O6O A;  5FND A;  4R3A A;  1BYQ A;  4AWP A;  3OWB A;  4O05 A;  2VWC A;  2WI3 A;  3RKZ A;  5JEN A;  4CE1 A;  3ZKB A;  3T10 A;  4LWH A;  4QPK A;  1UY6 A;  3CYG A;  2YEA A;  2XX2 A;  1YC1 A;  4KQV A;  2JKI A;  3U67 A;  3PEJ A;  1Y8N A;  4XDM A;  3FV5 A;  1UYF A;  5CTX A;  1GJV A;  1ZXM A;  3D0B A;  4JAV A;  4JAU A;  2XCM A;  3TZ5 A;  5M4H A;  3ZKD A;  2BTZ A;  4R1F A;  4H85 A;  1JM6 A;  3B25 A;  4L91 A;  4KSG A;  3DGE A;  2YEJ A;  1EA6 A;  3OW6 A;  2YJW A;  4JQL A;  2VCJ A;  3Q5J A;  4L93 A;  2ZDX A;  2BT0 A;  3D2R A;  4XE2 A;  2VCI A;  4PU9 A;  3VHA A;  2QG0 A;  2K5B A;  2XDS A;  3TZ4 A;  1ID0 A;  1UY9 A;  4Q20 A;  2YEG A;  1QYE A;  1L0O A;  2O1W A;  2FWZ A;  4CE3 A;  2YGF A;  1KIJ A;  4EMV A;  3OWD A;  2XJJ A;  2YKC A;  2YKI A;  2QFO A;  5D7C A;  1US7 A;  1AMW A;  3U2D A;  4BQG A;  2YK2 A;  4PRV A;  2PNR A;  2HCH A;  1YT2 A;  2YI7 A;  3VHC A;  1Y8P A;  3GIG B;  4R3M A;  3INW A;  3T0Z A;  4YKU A;  5BOC A;  2IWS A;  1EI1 A;  2JJC A;  1UYH A;  3QDD A;  4HYP A;  1NHJ A;  2XAB A;  2BU7 A;  2HKJ A;  3OMU A;  2CCU A;  3A0Z A;  1B62 A;  2ESA A;  4L94 A;  4B6C A;  1NHI A;  2BYI A;  2FXS A;  5IDJ A;  4ZVI A;  1YET A;  4EEH A;  4AWQ A;  3A0Y A;  4EM7 A;  3Q5L A;  1I5B A;  3A0R A;  1TC6 A;  4XCJ A;  3INX A;  4PL9 A;  2YE6 A;  2WI7 A;  3FT5 A;  1ZXN A;  4U7N A;  3GIF A;  2XX5 A;  3G7E A;  1AM1 A;  4HXZ A;  1UY8 A;  3G7B A;  1QZR A;  2O1U A;  4K4O A;  1TIL A;  3R4N A;  3RLQ A;  3ZM7 A;  3K97 A;  3T0H A;  2YEF A;  3VHD A;  5FNF A;  2BZ5 A;  2VW5 A;  2YEI A;  1BXD A;  2IWX A;  2YE7 A;  4GQT A;  4CWN A;  5D7D A;  3NMQ A;  2XJG A;  2YE3 A;  5CTW A;  3A0W A;  4B7P A;  1Z59 A;  2GFD A;  4MPC A;  3K99 A;  2CH4 A;  3GIE A;  3BM9 A;  2BRE A;  3HYY A;  5J6A A;  4AS9 A;  2XK2 A;  3B27 A;  2YK9 A;  2YE5 A;  4ASB A;  1PVG A;  1U0Z A;  1ZW9 A;  3HYZ A;  3C11 A;  2H55 A;  1MU5 A;  3RLR A;  4KTN A;  3TZ0 A;  4YKR A;  2XDU A;  4BXI A;  4QPJ A;  1NHH A;  4WUC A;  3B24 A;  5F5R A;  2YGA A;  2WEQ A;  2YE8 A;  4HXW A;  4W7T A;  4EFT A;  4LWG A;  1YC3 A;  2ZBK B;  4O07 A;  4CWT A;  2YEC A;  2BSM A;  2WI2 A;  1YS3 A;  1YSR A;  4CWS A;  2C1G A;  2YE9 A;  4I3H A;  4BIZ A;  1I5C A;  5M4P A;  2C1I A;  3SL2 A;  2E0A A;  4MP2 A;  2C2A A;  1I59 A;  4XCL A;  3EHG A;  4NH7 A;  4FCP A;  2YKB A;  2IWU A;  1Z5B A;  3O2F A;  4XKK A;  4HZ5 A;  3K98 A;  4MB9 A;  1UYM A;  4E72 A;  1GKX A;  3R4P A;  1U2O A;  4HYM A;  3CWV A;  3T1K A;  4HY6 A;  4L90 A;  5IDM A;  3O0I A;  1F51 A;  2CCS A;  2FTK A;  3CRL A;  2YE2 A;  2IOR A;  3LPS A;  1I58 A;  2FWY A;  2O1V A;  2WER A;  4XIR A;  4CWR A;  1Y8O A;  2EXL A;  2FYP A;  5M4M A;  5D6Q A;  1Z5A A;  4GGL A;  4AWO A;  3A0T A;  2IOQ A;  4YKW A;  1B3Q A;  4XIP A;  4I5S A;  1S16 A;  2CG9 A;  1TC0 A;  1KZN A;  4URN A;  5C93 A;  4U7O A;  2CGF A;  4KFG A;  3QTF A;  2YGE A;  1I5A A;  1MX0 A;  1Y4U A;  4P8O A;  1I5D A;  4ASA A;  1UYI A;  1UYL A;  5BOD A;  2XD6 A;  4NH9 A;  2CCT A;  1H7S A;  5FNC A;  2QG2 A;  2WI1 A;  4WUD A;  5M4K A;  4X9L A;  2BU5 A;  2YKJ A;  4LPB A;  3B28 A;  4YKX A;  4DZY A;  3T2S A;  5F3K A;  4O09 A;  4MBC A;  4CWQ A;  2Q8F A;  1TH8 A;  3WHA A;  4P7A A;  4BIU A;  2XX4 A;  2YEH A; 
#chains in the Genus database with same CATH homology
 2Q2E B;  3Q5K A;  2GQP A;  3C0E A;  4H81 A;  3HZ5 A;  4XD8 A;  5CTY A;  2ZDY A;  1QY8 A;  4MPN A;  4YKZ A;  5GGZ A;  4E02 A;  4ZKI A;  2YEE A;  2YED A;  4CWO A;  4MPE A;  3OPD A;  4O0B A;  4U93 A;  4FMT A;  2IOP A;  4DUH A;  3H4L A;  4O04 A;  1A4H A;  1THN A;  1YT0 A;  4BAE A;  3RLP A;  5M4N A;  1H7U A;  5CF0 A;  4EGK A;  2YI6 A;  4HY1 A;  4HZ0 A;  5M4E A;  4URO A;  4ASG A;  3IED A;  4V26 A;  4E00 A;  3EKR A;  1BKN A;  1TID A;  1ZWH A;  3CGZ A;  4MOT A;  1OSF A;  1Y4S A;  4LWF A;  3G75 A;  2WI4 A;  2HG1 A;  2XDK A;  3CRK A;  3D36 A;  1UYE A;  1UYD A;  2WI6 A;  2XHT A;  2WEP A;  3U2K A;  1YER A;  3BMY A;  4H7Q A;  5D7R A;  4EGI A;  3GIG A;  3H80 A;  3ZXO A;  1Z5C A;  5IN9 A;  1S14 A;  4LP0 A;  2Q8I A;  2BRC A;  4BQJ A;  3HZ1 A;  4LWI A;  4XTJ A;  3HHU A;  4MP7 A;  5D6P A;  4XIQ A;  3EHH A;  2YI5 A;  3K60 A;  4FCQ A;  4GT8 A;  2BU8 A;  3TTZ A;  4XIT A;  3FT8 A;  3ZXQ A;  1AH8 A;  1YT1 A;  2XDL A;  4XKO A;  4CE2 A;  4URL A;  2YJX A;  1UYG A;  1UYK A;  2YKE A;  2YEB A;  2H8M A;  4XC0 A;  2YI0 A;  4EFU A;  2ZKJ A;  4L8Z A;  2YE4 A;  1R62 A;  2BU2 A;  1YES A;  4JAS A;  3LNU A;  2XHR A;  4FPP A;  4NH8 A;  3R4O A;  2XJX A;  3EKO A;  2BU6 A;  4URM A;  4YKY A;  1AH6 A;  3HEK A;  3A0X A;  1TBW A;  3WQ9 A;  3KE6 A;  4FCR A;  2XHX A;  3EHF A;  4GFN A;  4GCZ A;  4LWE A;  3PEH A;  3R91 A;  4KSH A;  3B26 A;  5FWK A;  1UYC A;  4V25 A;  2XDX A;  1B63 A;  3R4M A;  1UY7 A;  4GEE A;  3TZ2 A;  1AJ6 A;  3CGY A;  3R92 A;  5J71 A;  3VAD A;  4CWP A;  1YC4 A;  2WI5 A;  3MNR P;  4ASF A;  4KP4 A;  5CTU A;  2QF6 A;  4WUB A;  5CPH A;  1GKZ A;  2BYH A;  2Q8H A;  3EHJ A;  4YKT A;  5L3J A;  2UWD A;  1YSZ A;  4PRX A;  2AKP A;  4E01 A;  4XKA A;  1BGQ A;  3JZ3 A;  4EGH A;  4YKQ A;  3TUH A;  2Q8G A;  4CWF A;  3O6O A;  5FND A;  4R3A A;  1BYQ A;  4AWP A;  3OWB A;  4O05 A;  2VWC A;  2WI3 A;  3RKZ A;  4CE1 A;  3ZKB A;  3T10 A;  4LWH A;  4QPK A;  1UY6 A;  2YEA A;  2XX2 A;  1YC1 A;  4KQV A;  2JKI A;  3U67 A;  3PEJ A;  1Y8N A;  4XDM A;  3FV5 A;  1UYF A;  5CTX A;  1GJV A;  1ZXM A;  3D0B A;  4JAV A;  4JAU A;  2XCM A;  3TZ5 A;  5M4H A;  3ZKD A;  2BTZ A;  4R1F A;  4H85 A;  1JM6 A;  3B25 A;  4L91 A;  4KSG A;  3DGE A;  2YEJ A;  1EA6 A;  3OW6 A;  2YJW A;  4JQL A;  2VCJ A;  3Q5J A;  4L93 A;  2ZDX A;  2BT0 A;  3D2R A;  4XE2 A;  2VCI A;  4PU9 A;  3VHA A;  2QG0 A;  2K5B A;  2XDS A;  3TZ4 A;  1ID0 A;  1UY9 A;  4Q20 A;  2YEG A;  1QYE A;  1L0O A;  2O1W A;  2FWZ A;  4CE3 A;  2YGF A;  1KIJ A;  4EMV A;  3OWD A;  2XJJ A;  2YKC A;  2YKI A;  2QFO A;  5D7C A;  1US7 A;  1AMW A;  3U2D A;  4BQG A;  2YK2 A;  4PRV A;  2PNR A;  2HCH A;  1YT2 A;  2YI7 A;  3VHC A;  1Y8P A;  3GIG B;  4R3M A;  3INW A;  3T0Z A;  4YKU A;  5BOC A;  2IWS A;  1EI1 A;  2JJC A;  1UYH A;  3QDD A;  4HYP A;  1NHJ A;  2XAB A;  2BU7 A;  2HKJ A;  3OMU A;  2CCU A;  3A0Z A;  1B62 A;  2ESA A;  4L94 A;  4B6C A;  1NHI A;  2BYI A;  2FXS A;  5IDJ A;  4ZVI A;  1YET A;  4EEH A;  4AWQ A;  3A0Y A;  4EM7 A;  3Q5L A;  1I5B A;  3A0R A;  1TC6 A;  4XCJ A;  3INX A;  4PL9 A;  2YE6 A;  2WI7 A;  3FT5 A;  1ZXN A;  4U7N A;  3GIF A;  2XX5 A;  3G7E A;  1AM1 A;  4HXZ A;  1UY8 A;  3G7B A;  1QZR A;  2O1U A;  4K4O A;  1TIL A;  3R4N A;  3RLQ A;  3ZM7 A;  3K97 A;  3T0H A;  2YEF A;  3VHD A;  5FNF A;  2BZ5 A;  2VW5 A;  2YEI A;  1BXD A;  2IWX A;  2YE7 A;  4GQT A;  4CWN A;  5D7D A;  3NMQ A;  2XJG A;  2YE3 A;  5CTW A;  3A0W A;  4B7P A;  1Z59 A;  2GFD A;  4MPC A;  3K99 A;  2CH4 A;  3GIE A;  3BM9 A;  2BRE A;  3HYY A;  5J6A A;  4AS9 A;  2XK2 A;  3B27 A;  2YK9 A;  2YE5 A;  4ASB A;  1PVG A;  1U0Z A;  1ZW9 A;  3HYZ A;  3C11 A;  2H55 A;  1MU5 A;  3RLR A;  4KTN A;  3TZ0 A;  4YKR A;  2XDU A;  4BXI A;  4QPJ A;  1NHH A;  4WUC A;  3B24 A;  5F5R A;  2YGA A;  2WEQ A;  2YE8 A;  4HXW A;  4W7T A;  4EFT A;  4LWG A;  1YC3 A;  2ZBK B;  4O07 A;  4CWT A;  2YEC A;  2BSM A;  2WI2 A;  1YS3 A;  1YSR A;  4CWS A;  2YE9 A;  4I3H A;  4BIZ A;  1I5C A;  5M4P A;  3SL2 A;  2E0A A;  4MP2 A;  2C2A A;  1I59 A;  4XCL A;  3EHG A;  4NH7 A;  4FCP A;  2YKB A;  2IWU A;  1Z5B A;  3O2F A;  4XKK A;  4HZ5 A;  3K98 A;  4MB9 A;  1UYM A;  1GKX A;  3R4P A;  1U2O A;  4HYM A;  3CWV A;  3T1K A;  4HY6 A;  4L90 A;  5IDM A;  3O0I A;  2CCS A;  3CRL A;  2YE2 A;  2IOR A;  3LPS A;  1I58 A;  2FWY A;  2O1V A;  2WER A;  4XIR A;  4CWR A;  1Y8O A;  2EXL A;  2FYP A;  5M4M A;  5D6Q A;  1Z5A A;  4GGL A;  4AWO A;  3A0T A;  2IOQ A;  4YKW A;  1B3Q A;  4XIP A;  4I5S A;  1S16 A;  2CG9 A;  1TC0 A;  1KZN A;  4URN A;  5C93 A;  4U7O A;  2CGF A;  4KFG A;  3QTF A;  2YGE A;  1I5A A;  1MX0 A;  1Y4U A;  4P8O A;  1I5D A;  4ASA A;  1UYI A;  1UYL A;  5BOD A;  2XD6 A;  4NH9 A;  2CCT A;  1H7S A;  5FNC A;  2QG2 A;  2WI1 A;  4WUD A;  5M4K A;  4X9L A;  2BU5 A;  2YKJ A;  4LPB A;  3B28 A;  4YKX A;  4DZY A;  3T2S A;  5F3K A;  4O09 A;  4MBC A;  4CWQ A;  2Q8F A;  1TH8 A;  3WHA A;  4P7A A;  4BIU A;  2XX4 A;  2YEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...