4KTNA

Dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor ((3s)-1-[2-(pyrido[2,3-b]pyrazin-7-ylsulfanyl)-9h-pyrimido[4,5-b]indol-4-yl]pyrrolidin-3-amine)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
210
structure length
193
Chain Sequence
GLEAVRKRPGMYIGSTSGEGLHHLVWEIVDNSIDEALAGFAKSIQVIIEPDDSITVIDDGRGIPVGIQAKTGRPAVETVFTVLHGVGSSVVNALSTSLDVRVYKDGKVYYQEYRRGAVVDDLKVIEETDRHGTTVHFIPDPEIFTETTVYDFDKLATRVRELAFLNRGLHISIEDRREGQEDKKEYHYEGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B
publication title A new class of type iia topoisomerase inhibitors with broad-spectrum antibacterial activity
rcsb
source organism Enterococcus faecalis
molecule tags Isomerase/isomerase inhibitor
total genus 60
structure length 193
sequence length 210
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2013-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4ktnA00
4XCLA 4XE2A 2YEGA 4LWFA 3EKOA 3U67A 1AH6A 2CGFA 3EHHA 2O1VA 5GGZA 4CWFA 2WERA 4YKTA 1NHHA 3EHJA 2QF6A 4JASA 4EFTA 4EGIA 2H55A 4JAUA 3A0WA 5J71A 2XABA 4R3AA 2XHTA 3HEKA 3T0ZA 3H4LA 2YI6A 1JM6A 4P8OA 5F3KA 1TIDA 2YGFA 4B7PA 4U7OA 1OSFA 3Q5KA 3TZ5A 4ZKIA 3A0ZA 3DGEA 3VHAA 1I58A 4H81A 2QG2A 3TTZA 3R91A 1B3QA 3D2RA 2YKJA 2CCTA 3FT8A 2HCHA 2BU8A 5BODA 3BM9A 2XDXA 4AWOA 1YERA 4MBCA 4XKKA 4MPNA 4EGKA 4AWQA 4R3MA 5M4PA 4U7NA 2JKIA 4QPKA 2VCIA 1H7SA 2YE6A 1BGQA 1UYKA 2ZDXA 4EM7A 1YC4A 4KFGA 5D7RA 4V26A 3RLRA 4XC0A 3VHCA 4L90A 1S14A 3IEDA 3K97A 1I5AA 4L91A 4O0BA 4O05A 2AKPA 1I59A 2CH4A 3EHFA 4E01A 4PRVA 1KIJA 2WI2A 3T10A 2WEQA 3R4NA 1QYEA 4HZ5A 3PEJA 3HYYA 3FT5A 5M4EA 4EMVA 4KTNA 4KSHA 4WUDA 3D36A 1YSRA 1NHJA 1Y4SA 4URLA 2YEFA 3ZM7A 2K5BA 3B27A 1YETA 3G7BA 3ZXOA 2IWXA 2BYIA 3A0XA 5D6QA 2WEPA 3FV5A 2YE3A 3GIEA 4U93A 4YKQA 4HZ0A 4K4OA 1THNA 3VHDA 4NH7A 2YK9A 4URMA 1AMWA 1PVGA 2CCUA 2XDKA 3RLQA 2BU6A 2O1WA 1UYHA 3RLPA 3CGZA 5IDMA 4YKWA 2IORA 1UYGA 2PNRA 2ESAA 4I5SA 2C2AA 1QZRA 1TBWA 4PL9A 3BMYA 2YKEA 5C93A 4XIRA 2YEHA 4HYPA 5D7CA 2BSMA 2BU7A 1BYQA 4CWTA 2CCSA 3PEHA 4KQVA 4BQGA 2YE4A 3VADA 2XJJA 1ZW9A 1YT1A 2XHXA 3TUHA 3NMQA 2XD6A 1MX0A 2YKBA 4WUCA 1B62A 4MPEA 4W7TA 5IDJA 1B63A 3Q5JA 3TZ4A 2WI3A 2FXSA 3A0YA 3INWA 4GQTA 1UYFA 1UYIA 2ZBKB 5FNDA 3H80A 2XDUA 3INXA 4JQLA 4KP4A 4GGLA 1GJVA 2ZDYA 3ZKDA 2YI7A 4O09A 1I5BA 1Y8NA 2XCMA 4BAEA 3R4OA 3R4MA 2BZ5A 2YE8A 4XIPA 1Z5CA 1TILA 3C0EA 4GEEA 4HY1A 2XDSA 1UY6A 1UY7A 4NH8A 4B6CA 3B24A 4FCQA 2Q8FA 3EHGA 5IN9A 2XJXA 1YSZA 3QTFA 4AS9A 5J6AA 4MP2A 2YGEA 5CPHA 3LNUA 4P7AA 2IWSA 3GIGB 3HHUA 2O1UA 2YK2A 4MP7A 3TZ0A 2VCJA 4DZYA 2YE5A 3OPDA 4CE2A 3Q5LA 1UYCA 3OWBA 2XX2A 1QY8A 4FMTA 4H7QA 2YEJA 4XTJA 3A0RA 4E00A 1EI1A 3B25A 2XJGA 5M4MA 2YI0A 1R62A 2VW5A 1ZWHA 3CGYA 5FNFA 1UYEA 4PU9A 1MU5A 4Q20A 4GFNA 4ASAA 4LWGA 1YT2A 5M4HA 4YKUA 1Z59A 2YE2A 4WUBA 2YEBA 4JAVA 2WI4A 2YE7A 2HG1A 4X9LA 4CWNA 4ASFA 5BOCA 5F5RA 4CWPA 3G75A 2H8MA 1Y4UA 4GCZA 4CWSA 4EFUA 2ZKJA 4XITA 4R1FA 1Z5BA 2VWCA 2WI1A 3QDDA 1U2OA 5M4KA 3CRKA 4MB9A 1AM1A 4XCJA 3B28A 5CTYA 1BKNA 1TC6A 3CRLA 2BYHA 1S16A 3HZ5A 4HYMA 1L0OA 4BIUA 3O2FA 4LWHA 1BXDA 2HKJA 4CWOA 2IOPA 4XIQA 3TZ2A 1UY9A 3D0BA 2BREA 2QG0A 1UY8A 2FWZA 1Y8PA 3JZ3A 2YEIA 5D6PA 2XHRA 1GKZA 4KSGA 1H7UA 1UYDA 2BU5A 2BTZA 1YC3A 3EKRA 3O0IA 4HXWA 1YS3A 1I5CA 4ZVIA 1YT0A 3U2DA 4LWIA 2WI7A 4FCRA 4EEHA 4XDMA 4YKXA 5L3JA 2YEAA 2YJWA 3ZKBA 3A0TA 3T1KA 4BIZA 5CTWA 3MNRP 5CF0A 2GFDA 3HZ1A 4YKZA 1U0ZA 2YEEA 4MPCA 1AJ6A 1I5DA 3WQ9A 2WI5A 1ID0A 4BQJA 4LP0A 4PRXA 3GIFA 2Q8GA 4XD8A 2XK2A 1Y8OA 5M4NA 4L94A 4ASBA 2Q2EB 4YKYA 1AH8A 2BT0A 2IOQA 2WI6A 1TH8A 1ZXNA 2JJCA 1UYMA 1ZXMA 2XX4A 3K99A 1A4HA 1UYLA 2EXLA 4LWEA 4XKOA 4CE1A 3LPSA 1KZNA 5CTUA 3WHAA 3O6OA 3OW6A 2Q8IA 4H85A 3RKZA 1TC0A 4CWQA 3CWVA 2YECA 4UROA 4MOTA 2E0AA 2XX5A 2YI5A 3GIGA 4HXZA 1YC1A 1Z5AA 5D7DA 2BU2A 2BRCA 2CG9A 2XDLA 4DUHA 4FCPA 2FWYA 4QPJA 1YESA 3HYZA 4I3HA 2YJXA 4L93A 2YEDA 4ASGA 4FPPA 4LPBA 2FYPA 1US7A 4O04A 2YE9A 3OMUA 4AWPA 1EA6A 4CWRA 4BXIA 3C11A 3G7EA 2IWUA 3B26A 3R4PA 3K98A 4O07A 4GT8A 2YKCA 2GQPA 4V25A 3U2KA 4NH9A 3ZXQA 5FWKA 5FNCA 4XKAA 2Q8HA 4URNA 3R92A 4E02A 4CE3A 2YGAA 3T0HA 5CTXA 3OWDA 4L8ZA 2QFOA 4HY6A 3T2SA 4EGHA 2UWDA 1GKXA 1NHIA 3K60A 3SL2A 3KE6A 2YKIA 4YKRA
chains in the Genus database with same CATH superfamily
4XCLA 4XE2A 2YEGA 4LWFA 3EKOA 3U67A 1AH6A 2CGFA 3EHHA 2O1VA 5GGZA 4CWFA 2WERA 4YKTA 1NHHA 3EHJA 2QF6A 4JASA 4EFTA 2C1GA 4EGIA 2H55A 4JAUA 3S5TA 3A0WA 5J71A 2XABA 4R3AA 2XHTA 3HEKA 3T0ZA 3H4LA 2YI6A 1JM6A 4P8OA 5F3KA 1TIDA 2YGFA 4B7PA 4U7OA 1OSFA 3Q5KA 3TZ5A 4ZKIA 3A0ZA 3DGEA 3VHAA 1I58A 4H81A 2QG2A 3TTZA 3R91A 1B3QA 3D2RA 2YKJA 2CCTA 3FT8A 2HCHA 2BU8A 5BODA 3BM9A 2XDXA 4AWOA 1YERA 4MBCA 4XKKA 4MPNA 4EGKA 4AWQA 4R3MA 5M4PA 4U7NA 2JKIA 4QPKA 2VCIA 1H7SA 2YE6A 1BGQA 1UYKA 2ZDXA 4EM7A 1YC4A 4KFGA 5D7RA 4V26A 3RLRA 4XC0A 3VHCA 4L90A 1S14A 3IEDA 3K97A 1I5AA 4L91A 4O0BA 4O05A 2AKPA 1I59A 2CH4A 3EHFA 4E01A 4PRVA 1KIJA 2WI2A 3T10A 2WEQA 3R4NA 1QYEA 4HZ5A 3PEJA 3HYYA 3FT5A 5M4EA 4EMVA 4KTNA 4KSHA 4WUDA 3D36A 1YSRA 1NHJA 1Y4SA 4URLA 2YEFA 3ZM7A 2K5BA 3B27A 4E72A 1YETA 3G7BA 3ZXOA 2IWXA 2BYIA 3A0XA 5D6QA 2WEPA 3FV5A 2YE3A 3GIEA 4U93A 4YKQA 4HZ0A 4K4OA 1THNA 3VHDA 4NH7A 2YK9A 4URMA 1AMWA 1PVGA 2CCUA 2XDKA 3RLQA 2BU6A 2O1WA 1UYHA 3RLPA 3CGZA 5IDMA 4YKWA 2IORA 1UYGA 2PNRA 2ESAA 4I5SA 2C2AA 1QZRA 1TBWA 4PL9A 3BMYA 2YKEA 5C93A 4XIRA 2YEHA 4HYPA 5D7CA 2BSMA 2BU7A 1BYQA 4CWTA 2CCSA 3PEHA 4KQVA 4BQGA 2YE4A 3VADA 2XJJA 1ZW9A 1YT1A 2XHXA 3TUHA 3NMQA 2XD6A 1MX0A 2YKBA 4WUCA 1B62A 4MPEA 4W7TA 5IDJA 1B63A 3Q5JA 3TZ4A 2WI3A 2FXSA 3A0YA 3INWA 4GQTA 1UYFA 1UYIA 2ZBKB 5FNDA 3H80A 2XDUA 3INXA 4JQLA 4KP4A 2HHIA 4GGLA 1GJVA 2ZDYA 3ZKDA 2YI7A 4O09A 3LMMA 1I5BA 1Y8NA 2XCMA 4BAEA 3R4OA 3R4MA 2BZ5A 2YE8A 4XIPA 1Z5CA 1TILA 3C0EA 4GEEA 4HY1A 2XDSA 1UY6A 1UY7A 4NH8A 4B6CA 3B24A 4FCQA 2Q8FA 3EHGA 5IN9A 2XJXA 1YSZA 3QTFA 4AS9A 5J6AA 4MP2A 2YGEA 5CPHA 3LNUA 4P7AA 2IWSA 3GIGB 3HHUA 2O1UA 2C1IA 2YK2A 4MP7A 3TZ0A 2VCJA 4DZYA 2YE5A 3OPDA 4CE2A 3Q5LA 1UYCA 3OWBA 2XX2A 1QY8A 4FMTA 4H7QA 2YEJA 4XTJA 3A0RA 4E00A 1EI1A 3B25A 2XJGA 5M4MA 2YI0A 1R62A 2VW5A 1ZWHA 3CGYA 5FNFA 1UYEA 4PU9A 1MU5A 4Q20A 4GFNA 4ASAA 4LWGA 1YT2A 5M4HA 4YKUA 1Z59A 2YE2A 4WUBA 2YEBA 4JAVA 2WI4A 2YE7A 2HG1A 4X9LA 4CWNA 4ASFA 5BOCA 5F5RA 4CWPA 3G75A 2H8MA 1Y4UA 4GCZA 4CWSA 4EFUA 2ZKJA 4XITA 4R1FA 1Z5BA 2VWCA 2WI1A 3QDDA 1U2OA 5M4KA 3CRKA 4MB9A 1AM1A 4XCJA 3B28A 5CTYA 1BKNA 1TC6A 3CRLA 2BYHA 1S16A 3HZ5A 4HYMA 1L0OA 4BIUA 3O2FA 4LWHA 1BXDA 2HKJA 4CWOA 2IOPA 4XIQA 3TZ2A 1UY9A 3D0BA 1IXMA 2BREA 2QG0A 1UY8A 2FWZA 1Y8PA 3JZ3A 2YEIA 5D6PA 2XHRA 1GKZA 4KSGA 1H7UA 1UYDA 2BU5A 2BTZA 1YC3A 3EKRA 3O0IA 4HXWA 1YS3A 1I5CA 4ZVIA 1YT0A 3U2DA 4LWIA 2WI7A 4FCRA 4EEHA 4XDMA 4YKXA 5L3JA 2YEAA 2YJWA 3ZKBA 3A0TA 3T1KA 4BIZA 5CTWA 3MNRP 5CF0A 2GFDA 3HZ1A 4YKZA 1U0ZA 2YEEA 4MPCA 1AJ6A 1I5DA 3WQ9A 2WI5A 1ID0A 4BQJA 4LP0A 4PRXA 3GIFA 2Q8GA 4XD8A 2XK2A 1Y8OA 5M4NA 4L94A 4ASBA 2Q2EB 4YKYA 1AH8A 2BT0A 2IOQA 2WI6A 1TH8A 1ZXNA 1F51A 2JJCA 1UYMA 1ZXMA 2XX4A 3K99A 1A4HA 1UYLA 2EXLA 4LWEA 4XKOA 4CE1A 3LPSA 1KZNA 5CTUA 3WHAA 3O6OA 3OW6A 2Q8IA 4H85A 3RKZA 1TC0A 4CWQA 3CWVA 2YECA 4UROA 4MOTA 2E0AA 2XX5A 2YI5A 3GIGA 4HXZA 1YC1A 1Z5AA 5D7DA 2BU2A 2BRCA 2CG9A 2XDLA 4DUHA 4FCPA 2FWYA 4QPJA 1YESA 3HYZA 4I3HA 2FTKA 2YJXA 4L93A 2YEDA 4ASGA 4FPPA 4LPBA 2FYPA 1US7A 4O04A 2YE9A 3OMUA 4AWPA 1EA6A 4CWRA 4BXIA 3C11A 3G7EA 2IWUA 3B26A 3R4PA 3K98A 4O07A 4GT8A 2YKCA 2GQPA 4V25A 5JENA 3U2KA 4NH9A 3CYGA 3ZXQA 5FWKA 5FNCA 4XKAA 2Q8HA 4URNA 3R92A 4E02A 4CE3A 2YGAA 3T0HA 5CTXA 3OWDA 4L8ZA 2QFOA 4HY6A 3T2SA 4EGHA 2UWDA 1GKXA 1NHIA 3K60A 3SL2A 3KE6A 2YKIA 4YKRA
chains in the Genus database with same CATH topology
4XCLA 4XE2A 2YEGA 4LWFA 3EKOA 3U67A 1AH6A 2CGFA 3EHHA 2O1VA 5GGZA 4CWFA 2WERA 4YKTA 1NHHA 3EHJA 2QF6A 4JASA 4EFTA 4EGIA 2H55A 4JAUA 3A0WA 5J71A 2XABA 4R3AA 2XHTA 3HEKA 3T0ZA 3H4LA 2YI6A 1JM6A 4P8OA 5F3KA 1TIDA 2YGFA 4B7PA 4U7OA 1OSFA 3Q5KA 3TZ5A 4ZKIA 3A0ZA 3DGEA 3VHAA 1I58A 4H81A 2QG2A 3TTZA 3R91A 1B3QA 3D2RA 2YKJA 2CCTA 3FT8A 2HCHA 2BU8A 5BODA 3BM9A 2XDXA 4AWOA 1YERA 4MBCA 4XKKA 4MPNA 4EGKA 4AWQA 4R3MA 5M4PA 4U7NA 2JKIA 4QPKA 2VCIA 1H7SA 2YE6A 1BGQA 1UYKA 2ZDXA 4EM7A 1YC4A 4KFGA 5D7RA 4V26A 3RLRA 4XC0A 3VHCA 4L90A 1S14A 3IEDA 3K97A 1I5AA 4L91A 4O0BA 4O05A 2AKPA 1I59A 2CH4A 3EHFA 4E01A 4PRVA 1KIJA 2WI2A 3T10A 2WEQA 3R4NA 1QYEA 4HZ5A 3PEJA 3HYYA 3FT5A 5M4EA 4EMVA 4KTNA 4KSHA 4WUDA 3D36A 1YSRA 1NHJA 1Y4SA 4URLA 2YEFA 3ZM7A 2K5BA 3B27A 1YETA 3G7BA 3ZXOA 2IWXA 2BYIA 3A0XA 5D6QA 2WEPA 3FV5A 2YE3A 3GIEA 4U93A 4YKQA 4HZ0A 4K4OA 1THNA 3VHDA 4NH7A 2YK9A 4URMA 1AMWA 1PVGA 2CCUA 2XDKA 3RLQA 2BU6A 2O1WA 1UYHA 3RLPA 3CGZA 5IDMA 4YKWA 2IORA 1UYGA 2PNRA 2ESAA 4I5SA 2C2AA 1QZRA 1TBWA 4PL9A 3BMYA 2YKEA 5C93A 4XIRA 2YEHA 4HYPA 5D7CA 2BSMA 2BU7A 1BYQA 4CWTA 2CCSA 3PEHA 4KQVA 4BQGA 2YE4A 3VADA 2XJJA 1ZW9A 1YT1A 2XHXA 3TUHA 3NMQA 2XD6A 1MX0A 2YKBA 4WUCA 1B62A 4MPEA 4W7TA 5IDJA 1B63A 3Q5JA 3TZ4A 2WI3A 2FXSA 3A0YA 3INWA 4GQTA 1UYFA 1UYIA 2ZBKB 5FNDA 3H80A 2XDUA 3INXA 4JQLA 4KP4A 4GGLA 1GJVA 2ZDYA 3ZKDA 2YI7A 4O09A 1I5BA 1Y8NA 2XCMA 4BAEA 3R4OA 3R4MA 2BZ5A 2YE8A 4XIPA 1Z5CA 1TILA 3C0EA 4GEEA 4HY1A 2XDSA 1UY6A 1UY7A 4NH8A 4B6CA 3B24A 4FCQA 2Q8FA 3EHGA 5IN9A 2XJXA 1YSZA 3QTFA 4AS9A 5J6AA 4MP2A 2YGEA 5CPHA 3LNUA 4P7AA 2IWSA 3GIGB 3HHUA 2O1UA 2YK2A 4MP7A 3TZ0A 2VCJA 4DZYA 2YE5A 3OPDA 4CE2A 3Q5LA 1UYCA 3OWBA 2XX2A 1QY8A 4FMTA 4H7QA 2YEJA 4XTJA 3A0RA 4E00A 1EI1A 3B25A 2XJGA 5M4MA 2YI0A 1R62A 2VW5A 1ZWHA 3CGYA 5FNFA 1UYEA 4PU9A 1MU5A 4Q20A 4GFNA 4ASAA 4LWGA 1YT2A 5M4HA 4YKUA 1Z59A 2YE2A 4WUBA 2YEBA 4JAVA 2WI4A 2YE7A 2HG1A 4X9LA 4CWNA 4ASFA 5BOCA 5F5RA 4CWPA 3G75A 2H8MA 1Y4UA 4GCZA 4CWSA 4EFUA 2ZKJA 4XITA 4R1FA 1Z5BA 2VWCA 2WI1A 3QDDA 1U2OA 5M4KA 3CRKA 4MB9A 1AM1A 4XCJA 3B28A 5CTYA 1BKNA 1TC6A 3CRLA 2BYHA 1S16A 3HZ5A 4HYMA 1L0OA 4BIUA 3O2FA 4LWHA 1BXDA 2HKJA 4CWOA 2IOPA 4XIQA 3TZ2A 1UY9A 3D0BA 2BREA 2QG0A 1UY8A 2FWZA 1Y8PA 3JZ3A 2YEIA 5D6PA 2XHRA 1GKZA 4KSGA 1H7UA 1UYDA 2BU5A 2BTZA 1YC3A 3EKRA 3O0IA 4HXWA 1YS3A 1I5CA 4ZVIA 1YT0A 3U2DA 4LWIA 2WI7A 4FCRA 4EEHA 4XDMA 4YKXA 5L3JA 2YEAA 2YJWA 3ZKBA 3A0TA 3T1KA 4BIZA 5CTWA 3MNRP 5CF0A 2GFDA 3HZ1A 4YKZA 1U0ZA 2YEEA 4MPCA 1AJ6A 1I5DA 3WQ9A 2WI5A 1ID0A 4BQJA 4LP0A 4PRXA 3GIFA 2Q8GA 4XD8A 2XK2A 1Y8OA 5M4NA 4L94A 4ASBA 2Q2EB 4YKYA 1AH8A 2BT0A 2IOQA 2WI6A 1TH8A 1ZXNA 2JJCA 1UYMA 1ZXMA 2XX4A 3K99A 1A4HA 1UYLA 2EXLA 4LWEA 4XKOA 4CE1A 3LPSA 1KZNA 5CTUA 3WHAA 3O6OA 3OW6A 2Q8IA 4H85A 3RKZA 1TC0A 4CWQA 3CWVA 2YECA 4UROA 4MOTA 2E0AA 2XX5A 2YI5A 3GIGA 4HXZA 1YC1A 1Z5AA 5D7DA 2BU2A 2BRCA 2CG9A 2XDLA 4DUHA 4FCPA 2FWYA 4QPJA 1YESA 3HYZA 4I3HA 2YJXA 4L93A 2YEDA 4ASGA 4FPPA 4LPBA 2FYPA 1US7A 4O04A 2YE9A 3OMUA 4AWPA 1EA6A 4CWRA 4BXIA 3C11A 3G7EA 2IWUA 3B26A 3R4PA 3K98A 4O07A 4GT8A 2YKCA 2GQPA 4V25A 3U2KA 4NH9A 3ZXQA 5FWKA 5FNCA 4XKAA 2Q8HA 4URNA 3R92A 4E02A 4CE3A 2YGAA 3T0HA 5CTXA 3OWDA 4L8ZA 2QFOA 4HY6A 3T2SA 4EGHA 2UWDA 1GKXA 1NHIA 3K60A 3SL2A 3KE6A 2YKIA 4YKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XCL A;  4XE2 A;  2YEG A;  4LWF A;  3EKO A;  3U67 A;  1AH6 A;  2CGF A;  3EHH A;  2O1V A;  5GGZ A;  4CWF A;  2WER A;  4YKT A;  1NHH A;  3EHJ A;  2QF6 A;  4JAS A;  4EFT A;  4EGI A;  2H55 A;  4JAU A;  3A0W A;  5J71 A;  2XAB A;  4R3A A;  2XHT A;  3HEK A;  3T0Z A;  3H4L A;  2YI6 A;  1JM6 A;  4P8O A;  5F3K A;  1TID A;  2YGF A;  4B7P A;  4U7O A;  1OSF A;  3Q5K A;  3TZ5 A;  4ZKI A;  3A0Z A;  3DGE A;  3VHA A;  1I58 A;  4H81 A;  2QG2 A;  3TTZ A;  3R91 A;  1B3Q A;  3D2R A;  2YKJ A;  2CCT A;  3FT8 A;  2HCH A;  2BU8 A;  5BOD A;  3BM9 A;  2XDX A;  4AWO A;  1YER A;  4MBC A;  4XKK A;  4MPN A;  4EGK A;  4AWQ A;  4R3M A;  5M4P A;  4U7N A;  2JKI A;  4QPK A;  2VCI A;  1H7S A;  2YE6 A;  1BGQ A;  1UYK A;  2ZDX A;  4EM7 A;  1YC4 A;  4KFG A;  5D7R A;  4V26 A;  3RLR A;  4XC0 A;  3VHC A;  4L90 A;  1S14 A;  3IED A;  3K97 A;  1I5A A;  4L91 A;  4O0B A;  4O05 A;  2AKP A;  1I59 A;  2CH4 A;  3EHF A;  4E01 A;  4PRV A;  1KIJ A;  2WI2 A;  3T10 A;  2WEQ A;  3R4N A;  1QYE A;  4HZ5 A;  3PEJ A;  3HYY A;  3FT5 A;  5M4E A;  4EMV A;  4KTN A;  4KSH A;  4WUD A;  3D36 A;  1YSR A;  1NHJ A;  1Y4S A;  4URL A;  2YEF A;  3ZM7 A;  2K5B A;  3B27 A;  1YET A;  3G7B A;  3ZXO A;  2IWX A;  2BYI A;  3A0X A;  5D6Q A;  2WEP A;  3FV5 A;  2YE3 A;  3GIE A;  4U93 A;  4YKQ A;  4HZ0 A;  4K4O A;  1THN A;  3VHD A;  4NH7 A;  2YK9 A;  4URM A;  1AMW A;  1PVG A;  2CCU A;  2XDK A;  3RLQ A;  2BU6 A;  2O1W A;  1UYH A;  3RLP A;  3CGZ A;  5IDM A;  4YKW A;  2IOR A;  1UYG A;  2PNR A;  2ESA A;  4I5S A;  2C2A A;  1QZR A;  1TBW A;  4PL9 A;  3BMY A;  2YKE A;  5C93 A;  4XIR A;  2YEH A;  4HYP A;  5D7C A;  2BSM A;  2BU7 A;  1BYQ A;  4CWT A;  2CCS A;  3PEH A;  4KQV A;  4BQG A;  2YE4 A;  3VAD A;  2XJJ A;  1ZW9 A;  1YT1 A;  2XHX A;  3TUH A;  3NMQ A;  2XD6 A;  1MX0 A;  2YKB A;  4WUC A;  1B62 A;  4MPE A;  4W7T A;  5IDJ A;  1B63 A;  3Q5J A;  3TZ4 A;  2WI3 A;  2FXS A;  3A0Y A;  3INW A;  4GQT A;  1UYF A;  1UYI A;  2ZBK B;  5FND A;  3H80 A;  2XDU A;  3INX A;  4JQL A;  4KP4 A;  4GGL A;  1GJV A;  2ZDY A;  3ZKD A;  2YI7 A;  4O09 A;  1I5B A;  1Y8N A;  2XCM A;  4BAE A;  3R4O A;  3R4M A;  2BZ5 A;  2YE8 A;  4XIP A;  1Z5C A;  1TIL A;  3C0E A;  4GEE A;  4HY1 A;  2XDS A;  1UY6 A;  1UY7 A;  4NH8 A;  4B6C A;  3B24 A;  4FCQ A;  2Q8F A;  3EHG A;  5IN9 A;  2XJX A;  1YSZ A;  3QTF A;  4AS9 A;  5J6A A;  4MP2 A;  2YGE A;  5CPH A;  3LNU A;  4P7A A;  2IWS A;  3GIG B;  3HHU A;  2O1U A;  2YK2 A;  4MP7 A;  3TZ0 A;  2VCJ A;  4DZY A;  2YE5 A;  3OPD A;  4CE2 A;  3Q5L A;  1UYC A;  3OWB A;  2XX2 A;  1QY8 A;  4FMT A;  4H7Q A;  2YEJ A;  4XTJ A;  3A0R A;  4E00 A;  1EI1 A;  3B25 A;  2XJG A;  5M4M A;  2YI0 A;  1R62 A;  2VW5 A;  1ZWH A;  3CGY A;  5FNF A;  1UYE A;  4PU9 A;  1MU5 A;  4Q20 A;  4GFN A;  4ASA A;  4LWG A;  1YT2 A;  5M4H A;  4YKU A;  1Z59 A;  2YE2 A;  4WUB A;  2YEB A;  4JAV A;  2WI4 A;  2YE7 A;  2HG1 A;  4X9L A;  4CWN A;  4ASF A;  5BOC A;  5F5R A;  4CWP A;  3G75 A;  2H8M A;  1Y4U A;  4GCZ A;  4CWS A;  4EFU A;  2ZKJ A;  4XIT A;  4R1F A;  1Z5B A;  2VWC A;  2WI1 A;  3QDD A;  1U2O A;  5M4K A;  3CRK A;  4MB9 A;  1AM1 A;  4XCJ A;  3B28 A;  5CTY A;  1BKN A;  1TC6 A;  3CRL A;  2BYH A;  1S16 A;  3HZ5 A;  4HYM A;  1L0O A;  4BIU A;  3O2F A;  4LWH A;  1BXD A;  2HKJ A;  4CWO A;  2IOP A;  4XIQ A;  3TZ2 A;  1UY9 A;  3D0B A;  2BRE A;  2QG0 A;  1UY8 A;  2FWZ A;  1Y8P A;  3JZ3 A;  2YEI A;  5D6P A;  2XHR A;  1GKZ A;  4KSG A;  1H7U A;  1UYD A;  2BU5 A;  2BTZ A;  1YC3 A;  3EKR A;  3O0I A;  4HXW A;  1YS3 A;  1I5C A;  4ZVI A;  1YT0 A;  3U2D A;  4LWI A;  2WI7 A;  4FCR A;  4EEH A;  4XDM A;  4YKX A;  5L3J A;  2YEA A;  2YJW A;  3ZKB A;  3A0T A;  3T1K A;  4BIZ A;  5CTW A;  3MNR P;  5CF0 A;  2GFD A;  3HZ1 A;  4YKZ A;  1U0Z A;  2YEE A;  4MPC A;  1AJ6 A;  1I5D A;  3WQ9 A;  2WI5 A;  1ID0 A;  4BQJ A;  4LP0 A;  4PRX A;  3GIF A;  2Q8G A;  4XD8 A;  2XK2 A;  1Y8O A;  5M4N A;  4L94 A;  4ASB A;  2Q2E B;  4YKY A;  1AH8 A;  2BT0 A;  2IOQ A;  2WI6 A;  1TH8 A;  1ZXN A;  2JJC A;  1UYM A;  1ZXM A;  2XX4 A;  3K99 A;  1A4H A;  1UYL A;  2EXL A;  4LWE A;  4XKO A;  4CE1 A;  3LPS A;  1KZN A;  5CTU A;  3WHA A;  3O6O A;  3OW6 A;  2Q8I A;  4H85 A;  3RKZ A;  1TC0 A;  4CWQ A;  3CWV A;  2YEC A;  4URO A;  4MOT A;  2E0A A;  2XX5 A;  2YI5 A;  3GIG A;  4HXZ A;  1YC1 A;  1Z5A A;  5D7D A;  2BU2 A;  2BRC A;  2CG9 A;  2XDL A;  4DUH A;  4FCP A;  2FWY A;  4QPJ A;  1YES A;  3HYZ A;  4I3H A;  2YJX A;  4L93 A;  2YED A;  4ASG A;  4FPP A;  4LPB A;  2FYP A;  1US7 A;  4O04 A;  2YE9 A;  3OMU A;  4AWP A;  1EA6 A;  4CWR A;  4BXI A;  3C11 A;  3G7E A;  2IWU A;  3B26 A;  3R4P A;  3K98 A;  4O07 A;  4GT8 A;  2YKC A;  2GQP A;  4V25 A;  3U2K A;  4NH9 A;  3ZXQ A;  5FWK A;  5FNC A;  4XKA A;  2Q8H A;  4URN A;  3R92 A;  4E02 A;  4CE3 A;  2YGA A;  3T0H A;  5CTX A;  3OWD A;  4L8Z A;  2QFO A;  4HY6 A;  3T2S A;  4EGH A;  2UWD A;  1GKX A;  1NHI A;  3K60 A;  3SL2 A;  3KE6 A;  2YKI A;  4YKR A; 
#chains in the Genus database with same CATH topology
 4XCL A;  4XE2 A;  2YEG A;  4LWF A;  3EKO A;  3U67 A;  1AH6 A;  2CGF A;  3EHH A;  2O1V A;  5GGZ A;  4CWF A;  2WER A;  4YKT A;  1NHH A;  3EHJ A;  2QF6 A;  4JAS A;  4EFT A;  2C1G A;  4EGI A;  2H55 A;  4JAU A;  3S5T A;  3A0W A;  5J71 A;  2XAB A;  4R3A A;  2XHT A;  3HEK A;  3T0Z A;  3H4L A;  2YI6 A;  1JM6 A;  4P8O A;  5F3K A;  1TID A;  2YGF A;  4B7P A;  4U7O A;  1OSF A;  3Q5K A;  3TZ5 A;  4ZKI A;  3A0Z A;  3DGE A;  3VHA A;  1I58 A;  4H81 A;  2QG2 A;  3TTZ A;  3R91 A;  1B3Q A;  3D2R A;  2YKJ A;  2CCT A;  3FT8 A;  2HCH A;  2BU8 A;  5BOD A;  3BM9 A;  2XDX A;  4AWO A;  1YER A;  4MBC A;  4XKK A;  4MPN A;  4EGK A;  4AWQ A;  4R3M A;  5M4P A;  4U7N A;  2JKI A;  4QPK A;  2VCI A;  1H7S A;  2YE6 A;  1BGQ A;  1UYK A;  2ZDX A;  4EM7 A;  1YC4 A;  4KFG A;  5D7R A;  4V26 A;  3RLR A;  4XC0 A;  3VHC A;  4L90 A;  1S14 A;  3IED A;  3K97 A;  1I5A A;  4L91 A;  4O0B A;  4O05 A;  2AKP A;  1I59 A;  2CH4 A;  3EHF A;  4E01 A;  4PRV A;  1KIJ A;  2WI2 A;  3T10 A;  2WEQ A;  3R4N A;  1QYE A;  4HZ5 A;  3PEJ A;  3HYY A;  3FT5 A;  5M4E A;  4EMV A;  4KTN A;  4KSH A;  4WUD A;  3D36 A;  1YSR A;  1NHJ A;  1Y4S A;  4URL A;  2YEF A;  3ZM7 A;  2K5B A;  3B27 A;  4E72 A;  1YET A;  3G7B A;  3ZXO A;  2IWX A;  2BYI A;  3A0X A;  5D6Q A;  2WEP A;  3FV5 A;  2YE3 A;  3GIE A;  4U93 A;  4YKQ A;  4HZ0 A;  4K4O A;  1THN A;  3VHD A;  4NH7 A;  2YK9 A;  4URM A;  1AMW A;  1PVG A;  2CCU A;  2XDK A;  3RLQ A;  2BU6 A;  2O1W A;  1UYH A;  3RLP A;  3CGZ A;  5IDM A;  4YKW A;  2IOR A;  1UYG A;  2PNR A;  2ESA A;  4I5S A;  2C2A A;  1QZR A;  1TBW A;  4PL9 A;  3BMY A;  2YKE A;  5C93 A;  4XIR A;  2YEH A;  4HYP A;  5D7C A;  2BSM A;  2BU7 A;  1BYQ A;  4CWT A;  2CCS A;  3PEH A;  4KQV A;  4BQG A;  2YE4 A;  3VAD A;  2XJJ A;  1ZW9 A;  1YT1 A;  2XHX A;  3TUH A;  3NMQ A;  2XD6 A;  1MX0 A;  2YKB A;  4WUC A;  1B62 A;  4MPE A;  4W7T A;  5IDJ A;  1B63 A;  3Q5J A;  3TZ4 A;  2WI3 A;  2FXS A;  3A0Y A;  3INW A;  4GQT A;  1UYF A;  1UYI A;  2ZBK B;  5FND A;  3H80 A;  2XDU A;  3INX A;  4JQL A;  4KP4 A;  2HHI A;  4GGL A;  1GJV A;  2ZDY A;  3ZKD A;  2YI7 A;  4O09 A;  3LMM A;  1I5B A;  1Y8N A;  2XCM A;  4BAE A;  3R4O A;  3R4M A;  2BZ5 A;  2YE8 A;  4XIP A;  1Z5C A;  1TIL A;  3C0E A;  4GEE A;  4HY1 A;  2XDS A;  1UY6 A;  1UY7 A;  4NH8 A;  4B6C A;  3B24 A;  4FCQ A;  2Q8F A;  3EHG A;  5IN9 A;  2XJX A;  1YSZ A;  3QTF A;  4AS9 A;  5J6A A;  4MP2 A;  2YGE A;  5CPH A;  3LNU A;  4P7A A;  2IWS A;  3GIG B;  3HHU A;  2O1U A;  2C1I A;  2YK2 A;  4MP7 A;  3TZ0 A;  2VCJ A;  4DZY A;  2YE5 A;  3OPD A;  4CE2 A;  3Q5L A;  1UYC A;  3OWB A;  2XX2 A;  1QY8 A;  4FMT A;  4H7Q A;  2YEJ A;  4XTJ A;  3A0R A;  4E00 A;  1EI1 A;  3B25 A;  2XJG A;  5M4M A;  2YI0 A;  1R62 A;  2VW5 A;  1ZWH A;  3CGY A;  5FNF A;  1UYE A;  4PU9 A;  1MU5 A;  4Q20 A;  4GFN A;  4ASA A;  4LWG A;  1YT2 A;  5M4H A;  4YKU A;  1Z59 A;  2YE2 A;  4WUB A;  2YEB A;  4JAV A;  2WI4 A;  2YE7 A;  2HG1 A;  4X9L A;  4CWN A;  4ASF A;  5BOC A;  5F5R A;  4CWP A;  3G75 A;  2H8M A;  1Y4U A;  4GCZ A;  4CWS A;  4EFU A;  2ZKJ A;  4XIT A;  4R1F A;  1Z5B A;  2VWC A;  2WI1 A;  3QDD A;  1U2O A;  5M4K A;  3CRK A;  4MB9 A;  1AM1 A;  4XCJ A;  3B28 A;  5CTY A;  1BKN A;  1TC6 A;  3CRL A;  2BYH A;  1S16 A;  3HZ5 A;  4HYM A;  1L0O A;  4BIU A;  3O2F A;  4LWH A;  1BXD A;  2HKJ A;  4CWO A;  2IOP A;  4XIQ A;  3TZ2 A;  1UY9 A;  3D0B A;  1IXM A;  2BRE A;  2QG0 A;  1UY8 A;  2FWZ A;  1Y8P A;  3JZ3 A;  2YEI A;  5D6P A;  2XHR A;  1GKZ A;  4KSG A;  1H7U A;  1UYD A;  2BU5 A;  2BTZ A;  1YC3 A;  3EKR A;  3O0I A;  4HXW A;  1YS3 A;  1I5C A;  4ZVI A;  1YT0 A;  3U2D A;  4LWI A;  2WI7 A;  4FCR A;  4EEH A;  4XDM A;  4YKX A;  5L3J A;  2YEA A;  2YJW A;  3ZKB A;  3A0T A;  3T1K A;  4BIZ A;  5CTW A;  3MNR P;  5CF0 A;  2GFD A;  3HZ1 A;  4YKZ A;  1U0Z A;  2YEE A;  4MPC A;  1AJ6 A;  1I5D A;  3WQ9 A;  2WI5 A;  1ID0 A;  4BQJ A;  4LP0 A;  4PRX A;  3GIF A;  2Q8G A;  4XD8 A;  2XK2 A;  1Y8O A;  5M4N A;  4L94 A;  4ASB A;  2Q2E B;  4YKY A;  1AH8 A;  2BT0 A;  2IOQ A;  2WI6 A;  1TH8 A;  1ZXN A;  1F51 A;  2JJC A;  1UYM A;  1ZXM A;  2XX4 A;  3K99 A;  1A4H A;  1UYL A;  2EXL A;  4LWE A;  4XKO A;  4CE1 A;  3LPS A;  1KZN A;  5CTU A;  3WHA A;  3O6O A;  3OW6 A;  2Q8I A;  4H85 A;  3RKZ A;  1TC0 A;  4CWQ A;  3CWV A;  2YEC A;  4URO A;  4MOT A;  2E0A A;  2XX5 A;  2YI5 A;  3GIG A;  4HXZ A;  1YC1 A;  1Z5A A;  5D7D A;  2BU2 A;  2BRC A;  2CG9 A;  2XDL A;  4DUH A;  4FCP A;  2FWY A;  4QPJ A;  1YES A;  3HYZ A;  4I3H A;  2FTK A;  2YJX A;  4L93 A;  2YED A;  4ASG A;  4FPP A;  4LPB A;  2FYP A;  1US7 A;  4O04 A;  2YE9 A;  3OMU A;  4AWP A;  1EA6 A;  4CWR A;  4BXI A;  3C11 A;  3G7E A;  2IWU A;  3B26 A;  3R4P A;  3K98 A;  4O07 A;  4GT8 A;  2YKC A;  2GQP A;  4V25 A;  5JEN A;  3U2K A;  4NH9 A;  3CYG A;  3ZXQ A;  5FWK A;  5FNC A;  4XKA A;  2Q8H A;  4URN A;  3R92 A;  4E02 A;  4CE3 A;  2YGA A;  3T0H A;  5CTX A;  3OWD A;  4L8Z A;  2QFO A;  4HY6 A;  3T2S A;  4EGH A;  2UWD A;  1GKX A;  1NHI A;  3K60 A;  3SL2 A;  3KE6 A;  2YKI A;  4YKR A; 
#chains in the Genus database with same CATH homology
 4XCL A;  4XE2 A;  2YEG A;  4LWF A;  3EKO A;  3U67 A;  1AH6 A;  2CGF A;  3EHH A;  2O1V A;  5GGZ A;  4CWF A;  2WER A;  4YKT A;  1NHH A;  3EHJ A;  2QF6 A;  4JAS A;  4EFT A;  4EGI A;  2H55 A;  4JAU A;  3A0W A;  5J71 A;  2XAB A;  4R3A A;  2XHT A;  3HEK A;  3T0Z A;  3H4L A;  2YI6 A;  1JM6 A;  4P8O A;  5F3K A;  1TID A;  2YGF A;  4B7P A;  4U7O A;  1OSF A;  3Q5K A;  3TZ5 A;  4ZKI A;  3A0Z A;  3DGE A;  3VHA A;  1I58 A;  4H81 A;  2QG2 A;  3TTZ A;  3R91 A;  1B3Q A;  3D2R A;  2YKJ A;  2CCT A;  3FT8 A;  2HCH A;  2BU8 A;  5BOD A;  3BM9 A;  2XDX A;  4AWO A;  1YER A;  4MBC A;  4XKK A;  4MPN A;  4EGK A;  4AWQ A;  4R3M A;  5M4P A;  4U7N A;  2JKI A;  4QPK A;  2VCI A;  1H7S A;  2YE6 A;  1BGQ A;  1UYK A;  2ZDX A;  4EM7 A;  1YC4 A;  4KFG A;  5D7R A;  4V26 A;  3RLR A;  4XC0 A;  3VHC A;  4L90 A;  1S14 A;  3IED A;  3K97 A;  1I5A A;  4L91 A;  4O0B A;  4O05 A;  2AKP A;  1I59 A;  2CH4 A;  3EHF A;  4E01 A;  4PRV A;  1KIJ A;  2WI2 A;  3T10 A;  2WEQ A;  3R4N A;  1QYE A;  4HZ5 A;  3PEJ A;  3HYY A;  3FT5 A;  5M4E A;  4EMV A;  4KTN A;  4KSH A;  4WUD A;  3D36 A;  1YSR A;  1NHJ A;  1Y4S A;  4URL A;  2YEF A;  3ZM7 A;  2K5B A;  3B27 A;  1YET A;  3G7B A;  3ZXO A;  2IWX A;  2BYI A;  3A0X A;  5D6Q A;  2WEP A;  3FV5 A;  2YE3 A;  3GIE A;  4U93 A;  4YKQ A;  4HZ0 A;  4K4O A;  1THN A;  3VHD A;  4NH7 A;  2YK9 A;  4URM A;  1AMW A;  1PVG A;  2CCU A;  2XDK A;  3RLQ A;  2BU6 A;  2O1W A;  1UYH A;  3RLP A;  3CGZ A;  5IDM A;  4YKW A;  2IOR A;  1UYG A;  2PNR A;  2ESA A;  4I5S A;  2C2A A;  1QZR A;  1TBW A;  4PL9 A;  3BMY A;  2YKE A;  5C93 A;  4XIR A;  2YEH A;  4HYP A;  5D7C A;  2BSM A;  2BU7 A;  1BYQ A;  4CWT A;  2CCS A;  3PEH A;  4KQV A;  4BQG A;  2YE4 A;  3VAD A;  2XJJ A;  1ZW9 A;  1YT1 A;  2XHX A;  3TUH A;  3NMQ A;  2XD6 A;  1MX0 A;  2YKB A;  4WUC A;  1B62 A;  4MPE A;  4W7T A;  5IDJ A;  1B63 A;  3Q5J A;  3TZ4 A;  2WI3 A;  2FXS A;  3A0Y A;  3INW A;  4GQT A;  1UYF A;  1UYI A;  2ZBK B;  5FND A;  3H80 A;  2XDU A;  3INX A;  4JQL A;  4KP4 A;  4GGL A;  1GJV A;  2ZDY A;  3ZKD A;  2YI7 A;  4O09 A;  1I5B A;  1Y8N A;  2XCM A;  4BAE A;  3R4O A;  3R4M A;  2BZ5 A;  2YE8 A;  4XIP A;  1Z5C A;  1TIL A;  3C0E A;  4GEE A;  4HY1 A;  2XDS A;  1UY6 A;  1UY7 A;  4NH8 A;  4B6C A;  3B24 A;  4FCQ A;  2Q8F A;  3EHG A;  5IN9 A;  2XJX A;  1YSZ A;  3QTF A;  4AS9 A;  5J6A A;  4MP2 A;  2YGE A;  5CPH A;  3LNU A;  4P7A A;  2IWS A;  3GIG B;  3HHU A;  2O1U A;  2YK2 A;  4MP7 A;  3TZ0 A;  2VCJ A;  4DZY A;  2YE5 A;  3OPD A;  4CE2 A;  3Q5L A;  1UYC A;  3OWB A;  2XX2 A;  1QY8 A;  4FMT A;  4H7Q A;  2YEJ A;  4XTJ A;  3A0R A;  4E00 A;  1EI1 A;  3B25 A;  2XJG A;  5M4M A;  2YI0 A;  1R62 A;  2VW5 A;  1ZWH A;  3CGY A;  5FNF A;  1UYE A;  4PU9 A;  1MU5 A;  4Q20 A;  4GFN A;  4ASA A;  4LWG A;  1YT2 A;  5M4H A;  4YKU A;  1Z59 A;  2YE2 A;  4WUB A;  2YEB A;  4JAV A;  2WI4 A;  2YE7 A;  2HG1 A;  4X9L A;  4CWN A;  4ASF A;  5BOC A;  5F5R A;  4CWP A;  3G75 A;  2H8M A;  1Y4U A;  4GCZ A;  4CWS A;  4EFU A;  2ZKJ A;  4XIT A;  4R1F A;  1Z5B A;  2VWC A;  2WI1 A;  3QDD A;  1U2O A;  5M4K A;  3CRK A;  4MB9 A;  1AM1 A;  4XCJ A;  3B28 A;  5CTY A;  1BKN A;  1TC6 A;  3CRL A;  2BYH A;  1S16 A;  3HZ5 A;  4HYM A;  1L0O A;  4BIU A;  3O2F A;  4LWH A;  1BXD A;  2HKJ A;  4CWO A;  2IOP A;  4XIQ A;  3TZ2 A;  1UY9 A;  3D0B A;  2BRE A;  2QG0 A;  1UY8 A;  2FWZ A;  1Y8P A;  3JZ3 A;  2YEI A;  5D6P A;  2XHR A;  1GKZ A;  4KSG A;  1H7U A;  1UYD A;  2BU5 A;  2BTZ A;  1YC3 A;  3EKR A;  3O0I A;  4HXW A;  1YS3 A;  1I5C A;  4ZVI A;  1YT0 A;  3U2D A;  4LWI A;  2WI7 A;  4FCR A;  4EEH A;  4XDM A;  4YKX A;  5L3J A;  2YEA A;  2YJW A;  3ZKB A;  3A0T A;  3T1K A;  4BIZ A;  5CTW A;  3MNR P;  5CF0 A;  2GFD A;  3HZ1 A;  4YKZ A;  1U0Z A;  2YEE A;  4MPC A;  1AJ6 A;  1I5D A;  3WQ9 A;  2WI5 A;  1ID0 A;  4BQJ A;  4LP0 A;  4PRX A;  3GIF A;  2Q8G A;  4XD8 A;  2XK2 A;  1Y8O A;  5M4N A;  4L94 A;  4ASB A;  2Q2E B;  4YKY A;  1AH8 A;  2BT0 A;  2IOQ A;  2WI6 A;  1TH8 A;  1ZXN A;  2JJC A;  1UYM A;  1ZXM A;  2XX4 A;  3K99 A;  1A4H A;  1UYL A;  2EXL A;  4LWE A;  4XKO A;  4CE1 A;  3LPS A;  1KZN A;  5CTU A;  3WHA A;  3O6O A;  3OW6 A;  2Q8I A;  4H85 A;  3RKZ A;  1TC0 A;  4CWQ A;  3CWV A;  2YEC A;  4URO A;  4MOT A;  2E0A A;  2XX5 A;  2YI5 A;  3GIG A;  4HXZ A;  1YC1 A;  1Z5A A;  5D7D A;  2BU2 A;  2BRC A;  2CG9 A;  2XDL A;  4DUH A;  4FCP A;  2FWY A;  4QPJ A;  1YES A;  3HYZ A;  4I3H A;  2YJX A;  4L93 A;  2YED A;  4ASG A;  4FPP A;  4LPB A;  2FYP A;  1US7 A;  4O04 A;  2YE9 A;  3OMU A;  4AWP A;  1EA6 A;  4CWR A;  4BXI A;  3C11 A;  3G7E A;  2IWU A;  3B26 A;  3R4P A;  3K98 A;  4O07 A;  4GT8 A;  2YKC A;  2GQP A;  4V25 A;  3U2K A;  4NH9 A;  3ZXQ A;  5FWK A;  5FNC A;  4XKA A;  2Q8H A;  4URN A;  3R92 A;  4E02 A;  4CE3 A;  2YGA A;  3T0H A;  5CTX A;  3OWD A;  4L8Z A;  2QFO A;  4HY6 A;  3T2S A;  4EGH A;  2UWD A;  1GKX A;  1NHI A;  3K60 A;  3SL2 A;  3KE6 A;  2YKI A;  4YKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...