4KTUA

Bovine trypsin in complex with microviridin j at ph 6.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Harnessing the evolvability of tricyclic microviridins to dissect protease-inhibitor interactions.
pubmed doi rcsb
source organism Microcystis aeruginosa mrc
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA02
2ZG0H 2ZDKA 3RXDA 4OS7A 5F03A 1O3BA 2IPHA 1EOJA 1FY4A 4CRCA 1MTVA 3A82A 2VIDA 3SV2H 1TA6A 1C5XB 1SQTA 1GI2A 1UK2A 1AVWA 2OC7A 5F8XA 1JIRA 3UQOA 1KLIH 1L2EA 3ZZDA 1GJDB 1LVMA 3SUGA 2THFB 5EU8A 2VIVA 1CU1A 1FY3A 1MTWA 1XUGA 3SHAH 1OKXA 5JBTA 1SGFA 1L4DA 1S6HA 3PO1B 3U8OH 3U9AH 3URDA 2D26C 1FAKH 2ZDAH 1F5RA 1UVTH 5E0GA 4ZKNU 4WH6A 3VB7A 2FOCA 2CF9H 2ODPA 2P3FH 2VWOA 3T2NA 2FOHA 1FMGA 3W94A 4LXBH 3BV9B 4A5TS 5A8YA 1QJ1B 2H5DA 4R0IA 1Y3XA 1F0UA 2ANMH 5GCHF 3FAOA 1PQ5A 1N1LA 1EOLA 5CHAB 4FUFA 1TB6H 1AO5A 4B76A 4ZXYH 4MNXA 4CR5A 3MH6A 1UMAH 2G55A 2ZPQA 4INKA 3M7UA 1IQLA 4X2VA 1GCDA 2GCHG 3PO1C 1GHBF 3OTJE 1GHVH 3BG4C 3GYLB 4K60A 3NPSA 1QBOA 2QXIA 1YC0A 2H9HA 2ZGXH 1GJCB 1BTZA 1V2LT 1Z8JB 3SUDA 1P09A 4XFQA 1IQHA 1EAIA 1E37B 3FFGA 1N8OB 3K65B 1SOZA 1TIOA 3QLPH 3RMLH 1BBRE 1HJ8A 2GTBA 1LTOA 2BXUH 2C4FH 1GBBA 2ZEBA 3KQCA 4ZKRU 1GHZA 2IN2A 1D6RA 1F5LA 2SGAA 4NCYA 3ZVEA 3GY6A 1W0YH 2ZTYA 5GJ4B 2JH6D 2A5IA 4O97A 1FPCH 1P2JA 3STIA 5EW1H 2GKVE 3QTOH 4AFUA 5TCCA 2AMPA 1ZMJA 1BTYA 2GV6A 1ETRH 4MPWA 1P10A 5CHAC 4A7IB 1ZRKA 2ZPRA 2Y7ZA 1WV7H 3LGVA 1SR5C 5HXFA 4NA7A 3SN8A 2FMJA 1VCQA 4R8TB 2OBOA 3JZ1B 3SV9A 1XUFA 3TPIZ 3RXQA 4RN6A 1EQ9A 4TPYA 4BAOB 1GVKB 1SGCA 5DP9A 1P11E 3MNSA 5ETXA 3KL6A 1SGTA 1DS2E 2ZC9H 5HYOA 4WMEA 2D1JA 1GI7B 4B73A 1C1WH 5AVDA 4UFGH 5DP4A 1K1PA 2BD2A 5FBEA 3RXSA 2UWLA 8KME2 2PTNA 2GDDA 2PW8H 1D3DB 3BIVH 1BOQA 1MH0A 3I77A 3M7TA 5DP8A 1AFEH 1LHCH 1WQSA 1A5GH 1TRMA 1O2UA 1UTKA 3L3TA 4BTTB 1IQMA 3UNSA 1OWJA 3O8RA 1BTXA 3F1SB 1LHFH 1EP6A 1V2TT 4JZDH 1QB9A 1UK4A 4H6TA 1VCPA 2NWNA 5DKMA 2BY8X 4OGYA 1CA0B 2AIQA 2J94A 4DT7B 4LZ4B 1H4WA 3DHKH 1C2EA 5CE1A 4UONA 5JPMH 2F9NA 3MHWU 1C9TA 3SJ9A 1Z8IB 1DY9A 1ARCA 4Y10E 1BTWA 1XKBC 1GBKA 1XMNB 2BLOA 3O8DA 2EI6A 3SJOA 1OP0A 2ZO3H 3RM2H 3PLKA 2AH4X 2ZU4A 5TJXA 1ESBA 5L2ZH 1W10U 1PQ8A 2GZ7A 3T28A 1P2IA 1VITH 4JYVH 3PWBA 4WY3A 1ELBA 4AOQA 2C8XB 1RJXB 3VB3A 3EGKH 1DPOA 3E16B 1K22H 3QWCH 4WWYA 5LPEA 3BTEE 1C5YB 1OPHB 1SGYE 5DGJA 1SGRE 1VGCC 3RXGA 1V2JT 5L30H 1EJNA 4CHAC 3Q3KA 2ZDLA 1SGDE 1DITH 3M3VA 1BIOA 2ZHFH 3VXFH 1UVUH 1V2OT 2OD3B 3NK8A 4Q80A 2XC4A 2CJIA 2BY7X 2F9UA 3GY5A 4NFEA 2UUYA 3MNBA 4VGCB 4E7RG 1NPMA 2A45B 4I8LA 4NIXA 1ZR0A 1UCYH 1TQ7B 2JH0D 2P8OB 5EQSA 3LIWA 3E1XB 1BRCE 1A5HA 2Q6DA 1DWDH 1F92A 2ZDVH 3EYDA 2BY9X 5DK1A 4LZ1H 3SORA 3B9FH 1AB9C 1TMUH 3LJOA 1O3AA 4X8UH 2FZZA 2O8MA 2WPHS 4X1RU 3RXVA 2BX3A 4A1VA 2V35A 1UVOA 2BQWB 1SSXA 3GDSA 3V3MA 1P2NA 1B7XB 1FY8E 3ZZ5A 4RSPA 1QA0A 1MKWK 3M5OA 1HUTH 3LPRA 1V2QT 1HAGE 1GHYH 4ZH8A 3VEQB 2IOTA 1C1SA 2GZ8A 2VIWA 4XBCA 4GHQA 4BANB 1C2GA 3F9FA 1K1LA 2H9TH 4K1EA 3UQVA 2FWWA 2P59A 4JK5A 4Q7YA 1O3FA 1VCWA 2J9NA 2H2ZA 3IWMA 1PPZA 1BCUH 1G37A 4A92A 1FXYA 3Q76A 3O8CA 3ZVDA 3MOCA 3UOPA 4M7GA 2OC8A 3S9AA 2PFEA 3SQHE 1P05A 3RXAA 3E0NB 4DCDA 1P12E 1KDQA 4NZQA 2F9OA 3HK3B 3A8CA 4CREA 3VGCC 1RXPA 1SBWA 2BY6X 1SMFE 1TA2A 3GY7A 4Z0KA 1BJVA 1L1GA 3ZZ7A 1C5LH 4AN7A 1EXFA 4YESB 1VGCB 1EZQA 3GY4A 3ZZBA 4ABFA 2STAE 2FYRA 3D49H 1CE5A 4WMDA 5DP3A 1EZXC 1C2DA 3TJUA 3ZVFA 4YM9A 4NFFA 2Z9IA 2ZTXA 1Q3XA 1V2MT 2O8TA 1THRH 1QIXB 4ABEA 4CRGA 1HAIH 1PPHE 1YF4A 2BD8A 1B0EA 3A8BA 5FPYA 3TNSA 1FAXA 2DUCA 3S69A 3CENA 1Z7KA 1HGTH 3SZNA 1CGJE 3N7OA 1SC8U 1TX6A 1V2WT 4U30A 1MZDA 1Y3UA 1IHTH 1O2WA 1U6QA 1PFXC 3ZZAA 1C1TA 3STJA 1P03A 1QL8A 4INLA 2EA3A 2ZHEH 5FXLA 3PTBA 1GWAA 1GI8B 2BDAA 1NRQH 3QDZB 1K1IA 5A0BA 5G4BA 1FIZA 1H9IE 2VB0A 3LC5A 1AVGH 2G52A 1O37A 1G30B 2HNTE 5JB8S 5J4QA 4Q7ZA 2QXJA 1XUHA 3PV4A 5GPIB 2OQ5A 4RKJB 4DGJA 1C2MA 1TNIA 1GL1A 1C1MA 1TBQH 1K21H 2P16A 1SG8B 5C3NA 1RS0A 4LK4A 2Y80A 3R3GB 2OXSA 1CBWC 2ANWA 3R0FA 1G3EA 2Z9GA 1YLDA 5JB9S 2ALPA 1QB1A 1FONA 2RCEA 3DD2H 5A0CA 2GDEH 3KEEA 1NFWA 1BTPA 2B5TB 1GJ4H 1GBEA 1TYNA 2GMTC 5E2OA 1YM0A 2ZNKH 3DT0H 3ZYDA 1PPEE 3A7YA 1ZGIA 5T6FA 1QJ6B 2KAIA 1BMLA 4MQAA 2Z7FE 1A0HB 3QN7A 1PQ7A 2WYGA 3ITIA 1BJUA 2LNCA 4TPIZ 1C5SA 4UFEH 1O3HA 4ESTE 3E90B 3TK6A 3ATLA 3PROA 1MD7A 2VH6A 4FU7A 1G36A 2ZU2A 2P94A 4INHA 2BQ6B 4CBOA 1SFQB 1FY5A 1GDNA 2RA3A 3JZ2B 1OYTH 3FZDA 4U01A 5DP7A 4VGCC 1LO6A 3OY5U 1WBGB 3ZV8A 4JZFH 1CHOG 4YLUA 3ZV9A 2F83A 2SFAA 3ZZ9A 2VH0A 3QZQA 2NU2E 1C5RA 1C2JA 3PLPA 1DVAH 1PPCE 1FY1A 2QXGA 3LGUA 3ENSB 4J2YB 5A2MH 1IAUA 2Y5HA 4DVAU 3AVZA 2UWPA 3EQ0H 4CBNA 2TPIZ 1IQGA 1AQ7A 4FVDA 2G00A 2QC2A 2ALVA 2ZA5A 2A0QB 1EATA 1ZJKA 3P6ZB 3RXEA 1GBFA 1BHXF 3MNXA 2PHBA 3BIUH 3A7WA 1J8AA 6GCHG 4KTUA 2CF8H 4A1XA 3GICB 2VVCA 4HFPB 1SL3A 3URCA 1HFDA 1DICA 1P06A 1A1RA 1GI1A 3O8BA 1KXAA 1V3XA 5EGMA 3RXLA 1PQAA 3DA9B 3TGJE 5GIBA 4NZLA 7ESTE 1TNJA 2RDLA 1HLTH 3VXEH 1JIMA 1AWHB 1W13U 1D4PB 1DUAA 1UHBA 1Y3WA 3AW1A 2ZDNA 2Q1JA 2A7JA 4PROA 1O5AB 2Y5GA 1GBLA 2JETC 1TGTA 3SNEA 5EW2H 1YCPH 3GYMA 4IBLH 1MTNB 1AKSB 1TRYA 4O3UA 1J16A 1T4UH 2BVXH 1QNJA 4SGAE 3BSQA 5HMAA 1S0QA 1EASA 1H8DH 1TGSZ 2XYAA 5EPYA 4U32A 1S81A 2CN0H 1T32A 3SV6A 1CT4E 2FOMB 3MO3A 8ESTE 3MH7A 2EI8A 5IYTA 1GG6B 3EDXB 1NRSH 1OWIA 2FI4E 1UJ1A 1QA7A 3F6UH 1GJAB 1KYNA 1CO7E 1SPJA 5T6GA 1QQ4A 2GT7A 1DXWA 2OTVA 4ZAEA 4D9QA 1BMAA 3U8RH 1IQFA 1DY8A 1UVSH 2G5VA 2ZFPH 3M37A 1V2ST 3A83A 4AFQA 1O34A 2GVFA 2ZHDA 8GCHG 3RXFA 2WV4A 2AMQA 1VITG 1EUFA 3UTUH 4HTCH 1SGIB 3A81A 1HIAB 1LMWB 3D62A 5L6NH 3HGNA 3F68H 2C8YB 2PGQB 3HPTB 1D3PB 4D7GA 2A1DB 2ZTZA 1C5UA 1SQOA 3QZRA 4CRFA 1HAVA 1CT0E 3A87A 1GI4A 1A5IA 1W7GH 4I8KA 3OX7U 1BHXB 4TYDA 4XBBA 1J17T 1GJBB 4X8SH 3VB6A 1QHRB 1DWBH 3OYPA 2LPRA 5SGAE 4CH2B 1YPEH 4YZUA 3UWJH 2WV5A 2OBQA 5GXPA 2UUFB 1O5BB 4DIHH 2ZKSA 1O3PB 1FUJA 4K8YA 4MPXA 5JYIA 1BQYA 1QBVH 3OY6U 1C1QA 1KY9A 5JDUB 1FN6A 2WINI 3H5CB 2O9QA 2G4TA 5F6MA 2VIOA 1AZZA 4ZHLU 1MBQA 1GJ5H 4XE4A 1SI5H 1O31A 1C5VA 1AHTH 4B75A 2FODA 4IMQA 2ZU5A 1THSH 1NTPA 5DJ7A 3M61U 4AGJA 1PPGE 1FQ3A 1TABE 3A7ZA 2F91A 8LPRA 2CXVA 4FXGH 1WU1A 2GCTB 1IQIA 1QFKH 1RTKA 2AGIX 5A8ZA 2J2UA 4FU9A 3UFAA 3MWIU 3GY2A 1K2I1 3TU7H 4Y8ZA 1QURH 3HATH 1AUTC 5LPRA 4WMFA 4YTAA 2Q6GA 3QTVH 2BD9A 3U69H 3RLYH 3SGAE 3LT3A 4AB9A 2DE9A 3ODDA 3TVJB 1JOUB 2CHAC 1HRTH 1TGNA 3ATIA 3HKIB 4WH8A 4BAMB 4NIYA 5EODA 3RLWH 1C4U2 3UY9A 1JWTA 3QK1A 2OP9A 4J1YA 1C2LA 2JH5D 1S82A 1HB0B 2SGEE 1GGDB 4AG1A 1A61H 1S0RA 2FX6A 2V3OH 3LGTA 1FPHH 1XXFA 4KGAA 3FZZA 1KXEA 2YNAA 3U8TH 4AB8A 5ESBA 2FLBH 2Q6FA 3SI3H 1E38B 1ESTA 1BBRK 2W3IA 3CS0A 3SU2A 1AZ8A 1T8LA 2OC0A 1TNLA 4ABIA 5HM9A 1DANH 3LGIA 4AGKA 2R2MB 4FUDA 1AD8H 1DSTA 3NKKA 4IN1A 4WJG2 4X1PU 3HGPA 2WPKS 3RXOA 3M35A 2BX4A 5K0HA 1MQ6A 2GD4B 1KXDA 1JBUH 3NXPA 1B0FA 4Y0YE 4KKDA 1OWHA 2HRVA 1P3EA 2FDAA 3PMHB 3BTHE 3FVFB 4LOYH 1HNEE 2OLGA 1EB2A 3ZYEA 4CRBA 1ZSJA 1O3IA 3MO9A 1GHWH 1O2GH 2P3TB 1HV7A 1T8MA 4THNH 3ZZ6A 1C9PA 1UO6A 1K1NA 1O2NA 4NGAH 1YCPK 1A4WH 1TMTH 1KXBA 2JKHA 1FN8A 1HAOH 3MO6A 2VGCC 2HVXA 2FM2A 3F9GA 4ISHH 3ZZ3A 3RU4D 1GVZA 4B74A 1D9IA 2SGPE 1SGEE 4NSYA 3TK5A 4FU8A 3Q3YA 3DUXH 1EPTB 3TGIE 1NZQH 1BTHH 1UHBB 3GCHC 1TNKA 1BITA 3GOVB 2FI5E 2AFQB 3UWIA 1ETSH 1TAWA 2YOLA 5EQRA 3RXMA 2SGDE 4FUHA 2D8WA 2BLWA 4ZMAH 2AGGX 1GI9B 5EG4A 1FLEE 3K6YA 2C93B 2FOBA 2PLXA 2NU0E 1ABIH 1FIWA 1BA8B 1E36B 1GHBG 1BMNH 1OS8A 1OP2A 1QL7A 1SGFG 1LVBA 1THPB 4D76A 4ZKSU 3MFJA 2XBXA 4DG4A 2J92A 3P8GA 4SGBE 5CMXH 1Z8GA 1NRRH 1ZHRA 3RXTA 3QGNB 2XWAA 1OWKA 3A89A 3U1IB 1LPKB 4A6LA 1LHDH 2GMTB 2FIRH 1H8IH 2BHGA 2FTLE 4E7NA 3LDXH 2M5TA 1GGDC 4I8HA 5A8XA 2QIQA 3RXRA 1EAXA 2ASUB 5E0JA 1V2NT 1G9IE 1F0SA 1RFNA 1UTMA 3GISB 1MCVA 3Q00A 4Y7AA 3AAUA 1NRNH 4OS4A 3A80A 3RUOA 3D23A 1G32B 1HJ9A 1YKTA 4B71A 1YYY1 3E91A 1EAUA 1ZGVA 2QV1A 4HZHA 4NA8A 4JMYA 4XSKU 1A0LA 1NROH 2Y7XA 1FDPA 1GCTC 1V6DA 1DUEA 2BM2A 3T62A 2SNVA 1QRWA 5I46H 1RIWC 3TK9A 1O3MA 1TFXA 1QCPA 1DLKB 3G01A 2EEKA 3H7OA 1XVMA 2VWNA 1LKAA 2A7CA 1ZPZA 4AYVB 3A88A 4JYTA 2CGAA 3ZZ4A 1A7SA 1AIXH 2V6NA 2ZCLP 2FXRA 1SLVB 5ABWA 1DM4B 3ZVAA 1ABJH 1J14A 4ABHA 3D65E 1C5OH 2BD7A 1HJAB 1LHEH 3P8OA 1P2MA 3VB4A 1MKXH 1KSNA 1SQAA 2VINA 1BBRH 2ZF0H 3SJIA 2HGTH 5A0AE 1TQ0B 5B6OA 3KGPA 1GMCF 5IDKA 2XTTB 4NIWA 4A1TA 2XBWA 2ZI2H 1GHAG 4UDWH 3GY3A 2EC9H 3UNQA 4GAWA 4RKOB 1EAWA 5AFYH 3RXKA 1AUJA 4ABAA 1ELEE 3CS7A 1WTHD 2BMGB 2BZ6H 5DPAA 3EA7A 1NRPH 1PPFE 2BY5X 1PYTC 3SGBE 1QBNA 3ZVBA 2A4GA 3RXBA 3PMJA 5F8TA 3C1KA 1Q31A 2H9EH 3A8AA 7LPRA 1Y5UT 1LDTT 1SGQE 4I8GA 1O5FH 1MZAA 2ZQ1A 2Z3DA 2ZU3A 3ATKA 1VITF 4AG2A 1YPMH 3BG8A 3GY8A 1O3DA 2QN5T 5C1UA 3U1JB 2HOBA 1LKBA 1NC6A 2BDBA 3VFEA 8GCHF 4BXSA 1QRXA 1NFYA 3T26A 1C2HA 1AE8H 2TGDA 4ZKOU 5JBCS 1S5SA 1Y3YA 2B0FA 3UREA 3QUMP 3ZZCA 1MCTA 2FOAA 3MMGA 4WF8A 5EXLA 1S84A 1JXPA 1ELFA 1GDUA 2FPZA 1ZTKA 4FUCA 5C2ZA 1UK3A 3RP2A 2GP9B 2QCYA 4NG9H 1P0SH 1WQVH 1IHSH 2AS9A 3BTQE 1HAYB 2GZ9A 2ZPSA 4Y79A 5ESTE 6CHAC 3S9CA 1SLXB 1GCTB 1ZYOA 2AEIH 2Z9KA 4JZIA 3A85A 1ACBE 2OINA 1FJSA 4JYUH 1WYKA 1DX5M 1XVOA 1H9HE 1E0FD 2QA9E 1GMDG 1GL0E 1MU8B 1GJ7B 3TJOA 2G51A 2GT8A 2AGEX 2K1QA 4YO9A 3UNRA 1K1OA 1FI8A 1MKWH 3S7HB 3RXCA 4ABGA 3SNAA 2IJOB 3NZIA 4D7FA 1QR3E 1TALA 4DW2U 1AFQB 2F3CE 3ELAH 1O5DH 3SNCA 4I8JA 4YOJA 2BDGA 1TGBA 4B2CA 1AVXA 3KQDA 5TCAA 4GPGA 2PUQH 3V7TA 1E34B 3ESTA 3M5NA 2BTCE 1O3KA 2EI7A 6GCHF 4O03A 1P3CA 2ZDMA 4MPUA 3RC6A 4BNRA 2O8WA 3SQEE 1C5NH 4Q7XA 5K7RA 4MNVA 2GV7A 1HCGA 2SGFE 4AZ2B 2ZECA 4Y6DA 4FVBA 3KQEA 2BDCA 5FCKA 1CVWH 1ANBA 2R3UA 2QY0B 3DFJA 1YPGH 3E3TA 2WUCA 3L33A 1TRNA 2OQUA 4Y71A 2OC1A 2A5KA 9LPRA 1Z1IA 1AI8H 1BDAA 1J15A 1SHHB 1DFPA 4GLYA 2FI3E 1CHOF 1XXDA 2SGQE 4K8BA 4DOQA 3ATWA 1QY6A 1YP9A 4O3TA 7GCHF 1OP8A 2VVUA 1MTNC 1TPSA 1PJPA 4AFSA 2V3HH 2BYAX 3EA9A 4MPVA 4ISOA 1ZZZA 1O5EH 1C1PA 3KCGH 3K6ZA 2ZWLH 2F9BH 5PTPA 2VGCB 1T4VH 2FTMA 2BB4A 3C27B 2W3KA 4GCHF 3QX5H 4AORA 2FOEA 4K1TA 4NSVA 1GBCA 2QXHA 1HAPH 2XWBI 2HLCA 1A2CH 1G2LA 2CHAB 3E0PB 2PKSB 1VZQH 1L1JA 4X2WA 3I78A 3TJNA 4TY6A 3WY8A 1WSSH 5DG6A 3T5FH 1C5QA 4UE7H 2XNIA 1K9OE 2ZCHP 1SLWB 2BD5A 2WPLS 3KN2A 3SV8A 1O3NA 4NIVA 1YGCH 1C5ZB 2TBSA 3SUEA 1OYQA 3T27A 3ZZ8A 2VWLA 3V0XA 1SB1H 3LH3A 3RMOH 3PTNA 2Y82A 2AIPA 2TGPZ 4X2XA 3EAJA 3MH5A 4Y76A 3RMMH 4BOHA 1DWCH 2Y6TA 3M3SA 3DFLA 1AMHA 1ZPCA 4ABDA 4JZ1A 3SJ8A 1KDQB 4IC6A 2W7SA 3TH3H 1MTSA 4YOIA 1JMOH 3V13A 5FPTA 1HXFH 1O32A 2HPPH 1Z1JA 2PV9B 3PYHA 1S83A 1ELAA 1C5PA 3M3TA 4KTSA 6CHAB 1EJAA 1V2UT 1EB1H 3SI4H 3RC4A 1TBRH 2ZQ2A 3RC5A 4F49A 1ZSKA 2VVVA 1L4ZA 1YPHE 2ZFFH 3OSYA 1MAXA 3AASA 1ELTA 3EE0B 3M36A 1P01A 5C5NA 1UTNA 1K1MA 1O2ZA 1QQUA 2R2WU 1PYTD 2BVRH 2OCVB 2R9PA 3M5MA 3KHVA 1W8BH 1O5CB 1ZHMA 3ODFA 2WPIS 4X6NA 1A3BH 1KIGH 1RTFB 3IITA 3K2UA 2NU3E 2ZCKP 2UWOA 3FANA 1O2RA 1V2RT 4TY7A 3LJJA 4UEHH 2Z6BD 1O3GA 2AERH 1DT2A 1DE7H 3MI4A 1TNGA 4Z6AH 2TIOA 3OU0A 4OS5A 2FX4A 1O2OA 3M5LA 1W11U 1A0JA 1FV9A 1GDQA 2ZHWH 2ZFTA 1NN6A 3NUMA 3LGYA 1YPKH 2BXTH 4D8NA 1JRSA 1O36A 1FZZA 1TX8A 4KTCA 3SU3A 1AGJA 1O2PA 1ZMNA 1ZPBA 2FYQA 3S9BA 1F2SE 2G4UA 4X6MA 3MU4A 1BTUA 1O2JA 2VNTA 1EKBB 1L1NA 2PUXB 1ARBA 1BMMH 1GHXH 4MG3A 2ZZUH 1V2VT 2ZIQH 1NFXA 1MQ5A 3SGQE 3RXUA 1DWEH 3IG6B 1Z71A 3T29A 5C5OA 3RM0H 1GBIA 1AU8A 2DE8A 1TOMH 4K5ZA 4X1NU 1UTOA 1Q2WA 1TMBH 1C2IA 1CA8B 4FUBA 4QT8C 5DO4H 1Y59T 2O8LA 4I32A 1WCZA 5AHGH 1NO9H 3TLOA 5L2YH 3GCHB 3BF6H 2PKAA 1A46H 2FS8A 4OGXA 1AE5A 2HWLB 1V2KT 1C1RA 4ZHMU 2R0LA 4B2AA 2AYWA 1Z6JH 1CT2E 3HKJB 1LPZB 1TONA 1BZXE 1HJAC 1UTLM 2BLQA 4BAKB 2ANYA 4WVPE 3BG4B 2J34A 5F8ZA 3BEFB 1KTSB 5A09A 1IQNA 1CGIE 2FOFA 4YT7H 3NWUA 3A7TA 3GCTF 1G2MA 1O2IA 1ORFA 3ZVGA 3M7QA 1ZLRA 2FS9A 1O2YA 3PMBB 1O3JA 4I33A 4TWWA 1C4V2 1N6YA 1O2LA 1AFQC 4KELA 4TWYA 1CGHA 3SU4A 4ABBA 1RIWB 4KP0A 1IQKA 3S7KB 4MLFB 2QF0A 3UR6A 3BTTE 4BAHB 1KXCA 1NY22 2TGTA 2PGBB 3FP7E 4I7YH 3VB5A 1ELVA 5FHTA 3RXHA 3LOXA 2BQ7B 3RDZA 1NT1A 2XCNA 4X8TH 2QF3A 2R3YA 1O2XA 2XBYA 1IQJA 1T8OA 2A2QH 2W26A 1SOTA 4JZEH 4E06H 4X6PA 3BTWE 1YPHC 2BZAA 2Z3EA 1YCPM 1N6XA 5T6DA 1EP5A 1OWDA 5I25A 5BRRE 1TPOA 4AYYB 1KTTB 3PMAB 2C8WB 2V0BA 2HNTC 2ANKH 1HAZB 1P2KA 1ELCA 2VIQA 3P95A 4X0WU 1NESE 1HAXB 1GG6C 1C1UH 3GDVA 5FBIA 1Z6EA 1RRKA 2A7HA 4U2WA 1Z8RA 2VWMA 4K1SA 1T31A 3PLBA 2PTCE 2PKSC 1ID5H 2C3SA 1O2VA 2P93A 3KF2A 1GBHA 2FO9A 3ATMA 1AB9B 2UUKB 4FUIA 1EPTC 3UIRA 2A4QA 9ESTA 2BVSH 1G3DA 1M9UA 3BTGE 1ANEA 2BOKA 1WAYB 1BRBE 5EQQA 1TOCB 3GCTG 3L6PA 4Y11E 3AAVA 1KLJH 1IQEA 3B23B 1GJ8B 4AX9H 4O9VA 3SNDA 2W7UA 2ZFRH 1KLTA 1TPPA 3P92A 4H42U 1DDJA 3HK6B 3GDUA 2B9LA 2ZU1A 1QTFA 4Y0ZE 1O30A 1UTJA 3W95A 2RG3A 1XUJA 5FAHA 3RU4T 5C1XA 4MVNA 1DSUA 3SHCH 6LPRA 1S85A 3TIUA 3TH2H 1LCYA 1ZMLA 1HBTH 3S0NA 1TE0A 1W0ZU 3TITA 3QGJA 3F9HA 4OS6A 3I29A 5C67A 1ELDE 2XC5A 1TWXB 5E2PA 1HDTH 3VGCB 1K1JA 2A4RA 2WYJA 2B7DH 3TJVA 3GCOA 5AF9H 2HPQH 3KIDU 1MD8A 1INCA 1N8OC 1VR1H 1AKSA 3RXIA 1HAVB 1NU9A 5C1YA 1V2PT 3SJKA 1AY6H 4K2YA 1TBZH 1Y3VA 4JK6A 1PPBH 2ZGJA 2UUJB 3F9EA 4DJZB 2CV3A 2P3UB 1CA0C 1LHGH 1XUKA 1YLCA 1YPJH 3LH1A 3P8FA 3FP6E 1W7XH 1FNIA 2JETB 1TNHA 1MAYA 4ZROA 1HAHH 2VIPA 4MNWA 2QYIA 2ZHQH 3A7VA 3PM3A 1P02A 5C20A 5H4IB 1CQQA 2G8TA 1NS3A 2BDHA 3SUFA 2ZFSA 2PSXA 2Y5FA 1GI6A 1UCYE 2GCHF 2HNTF 1C5TA 1DLEA 3T25A 1ANDA 1EPTA 1OOKB 3BTFE 1XUIA 5HGGA 5EXNA 1C1VH 1LQEA 4X2YA 1GI0A 4CRDA 1C1OA 1TPAE 1MKXK 2P8OC 2Z9LA 4D9RA 2ODQA 2PR3A 2ZP0H 5GCHG 1KXFA 4AFZA 3A7XA 1LQDB 3SU1A 4BAQB 2CMYA 2OUAA 1OX1A 3P8NA 3SBKA 3EA8A 1ESAA 1P8VC 1SGPE 3P17H 1XX9A 4GUXA 2ODYB 4FUGA 1YPLH 2C8ZB 2WPJS 4DURA 1CBWB 1LVOA 1VJ9U 4GVUA 3FP8E 4BTUB 1O2SA 4OS2A 5FPSA 1JRTA 1O3CA 3TH4H 1GPZA 3U98H 4NA9H 2BD4A 3VPKA 2NU4E 3MU1A 3MU8A 2J95A 1X7AC 1SVPA 4K69A 4ZXXH 5J4SA 1GBTA 2G5NA 4UFDH 4I31A 4UFFH 4WXIA 3MU0A 3BEIB 1TLDA 2FOGA 1CSOE 1F5KU 1QRZA 1G3BA 1T7CA 1D6WA 1TGCA 1C2FA 4DY7B 1O2MA 1QJ7B 1ZHPA 4GCHG 1GI5A 2A31A 2H5CA 4HI3A 1HYLA 4H4FA 3SV7A 3MYWA 4K3JA 4BTIB 4B2BA 1MBMA 1ZSLA 1A3EH 3LU9B 5LH8A 1WUNH 2RA0A 4X8VH 5LGOA 5E0HA 4CHAB 1P57B 7GCHG 1H9LB 1OSSA 1NM6A 1GJ6A 3SOSA 1P04A 3MTYA 2BD3A 1EZSC 2SNWA 2BDYA 1K28D 4YT6H 1T8NA 1WTGH 2I6QA 1G3CA 2ZGHA 1XKAC 2P95A 2A4OA 3SU5A 3UOUA 1O33A 4X1SU 1GBJA 1F0TA 2ESTE 5FX5A 4IC5A 3LKWA 3SU6A 1O2KA 2FESH 1B5GH 2PKAB 1UTPA 4GSOA 4MDSA 4XDEA 1TX7A 5AFZH 1C5MD 1HIAA 2I6SA 1VJAU 5JBAS 1GBAA 3GCNA 5JBBS 1F0RA 2G81E 2XCFA 1XM1A 4CH8B 1C2KA 1O2HA 1SLUB 1EZUC 4ABJA 3LONA 2KAIB 1NU7B 1RGQA 1Y8TA 2C90B 2H6MA 2ULLA 1O35A 3RMNH 1HXEH 1RTLA 2GX4A 5EXMA 4IW4E 1BRAA 1NFUA 4NWKA 1QGFA 2GGVB 3RXJA 3SW2B 1W14U 2AMDA 2XRCA 3SU0A 1P2OA 4FUEA 3V12A 3KNXA 1O3LA 1O3OA 3A8DA 1UTQA 3BTME 2Y81A 3MH4A 5E8EH 1GMHG 2H1UA 4HGCA 1ZJDA 4X6OA 3KQBA 1AN1E 3BEUA 1GBMA 2HALA 1O39A 1GMDF 1GI3A 5HM2A 3PB1E 1C4Y2 3UR9A 1L0ZA 1H1BA 1O3EA 1ZRBA 2A2XH 1O2QA 1QL9A 1RD3B 4IGDA 1O2TA 1WOFA 6ESTA 2O8UA 2Z9JA 2D2DA 1D3TB 1SGNE 5GDSH 4Y8YA 4ZHAA 4B1TA 1AWFH 4GHTA 1P2QA 4YOGA 5FX6A 5EOKA 2FP7B 5LPFA 1ANCA 1CHGA 3SNBA 2W5EA 2XW9A 1YBWA 3MU5A 4YLQH 1SHYA 2F9VA 2STBE 2TGAA 5EPNA 4ISIH 1MTUA 1GJ9B 3Q3XA 2B8OH 1EJMA 2F9PA 1O5GH 5T3HA 2GCTC 3H7TA 3BN9A 4Y7BA 1Y5AT 1SFIA 3CP7A 3UPEA 1S6FA 1W2KH 1ZTJA 5GWZA 4DIIH 2PSYA 2YNBA 1GMHF 1ELGA 2PWXA 2A32A 1O0DH 2XXLA 1ETTH 2R0KA 4JCNA 4H6SB 5DP6A 4OS1A 2WPMS 1F7ZA 3PWCA 4BXWA 1GVLA 2XBVA 2FEQH 3B8JA 7KMEH 4X1QU 1MU6B 3MNCA 1BRUP 3Q77A 1LPGB 4MTBA 3QO6A 5DP5A 1QB6A 1W3CA 4IS5A 3A84A 4UD9H 1P9UA 3P70B 1EX3A 2BOHB 1LVYA 1MUEB 3TGKE 1IOEA 1C5WB 4Y8XA 1UCYK 1ZTLA 2XC0A 1GHAF 2BLVA 3K9XB 3BTDE 1GMCG 1OXGA 3RXPA 3RU4E 3LC3A 1O38A 2Z94A 2FLRH 1E35B 3UUZA 4ZUHA 2ZFQH 2Z3CA 1J9CH 5BPEA 4F4OC 2QAAA 4IMZA 4XOJA 1BT7A 2NU1E 4CR9A 5FCRA 2WUBA 4E05H 4Q2KA 4IN2A 3E6PH 1GBDA 2ILNA 1OWEA 3LGWA 2J38A 2J4IA 3AW0A 3ZVCA 2VJ1A 1Y5BT 4ASHA 4CRAA 4FUJA 1BB0B 1DOJA 1BUIA 2A5AA 3TNTA 4ISNA 1ZOMA 2TRMA 1W12U 3A86A 1HPGA 4ISLA 3E8LA 2QGRA 4NWLA 3NCLA 1P9SA 4MNYA 1DXPA 1UVPA 1C1NA 4XBDA 1MMJN 3SO3A 2ZGBH 2ZGCA 2VU8E 4WXVA 1D3QB 3BTKE 2BDIA
chains in the Genus database with same CATH superfamily
2ZG0H 2ZDKA 3RXDA 4OS7A 5F03A 1O3BA 2IPHA 1EOJA 1FY4A 4CRCA 1MTVA 4RT0A 3A82A 2VIDA 3SV2H 1TA6A 1C5XB 1SQTA 1GI2A 1UK2A 1AVWA 2OC7A 5F8XA 1JIRA 3UQOA 1KLIH 1L2EA 3ZZDA 1GJDB 2KZ4A 1LVMA 3SUGA 2THFB 5EU8A 2VIVA 1CU1A 1FY3A 1MTWA 1XUGA 3SHAH 4P00A 1OKXA 5JBTA 1SGFA 1L4DA 1S6HA 3PO1B 3U8OH 3U9AH 3URDA 2D26C 1FAKH 2ZDAH 1F5RA 1UVTH 5E0GA 4ZKNU 4WH6A 3VB7A 2FOCA 2CF9H 2ODPA 2P3FH 2VWOA 3T2NA 2FOHA 1FMGA 3W94A 4LXBH 3BV9B 4A5TS 5A8YA 1QJ1B 2H5DA 4R0IA 1Y3XA 1F0UA 2ANMH 5GCHF 3FAOA 1PQ5A 1N1LA 1EOLA 5CHAB 4FUFA 1TB6H 1AO5A 4B76A 5T1VA 4ZXYH 4MNXA 4CR5A 3MH6A 1UMAH 3N7EA 2G55A 2ZPQA 4INKA 3M7UA 1IQLA 4X2VA 1GCDA 2GCHG 3PO1C 1GHBF 3OTJE 1GHVH 3BG4C 3GYLB 4K60A 3NPSA 1QBOA 2QXIA 1YC0A 2H9HA 2ZGXH 1GJCB 1BTZA 1V2LT 1Z8JB 3SUDA 1P09A 4XFQA 1IQHA 1EAIA 1E37B 3FFGA 1N8OB 3K65B 1SOZA 1TIOA 4Z1MD 3QLPH 3RMLH 1BBRE 1HJ8A 2GTBA 1LTOA 2BXUH 2C4FH 1GBBA 2ZEBA 3KQCA 4ZKRU 1GHZA 2IN2A 1D6RA 1F5LA 2SGAA 4NCYA 3ZVEA 3GY6A 1W0YH 2ZTYA 5GJ4B 2JH6D 2A5IA 4O97A 1FPCH 1P2JA 3STIA 5EW1H 2GKVE 3QTOH 4AFUA 5TCCA 2AMPA 1ZMJA 1BTYA 2GV6A 1ETRH 4MPWA 1P10A 5CHAC 4A7IB 1ZRKA 2ZPRA 2Y7ZA 1WV7H 3LGVA 1SR5C 5HXFA 4NA7A 2YMSD 3ZIAD 3SN8A 2FMJA 1VCQA 4R8TB 2OBOA 5EJLA 3JZ1B 3SV9A 1XUFA 3TPIZ 3RXQA 4RT1A 2W6JD 4RN6A 1EQ9A 4TPYA 4BAOB 1GVKB 1SGCA 5DP9A 1P11E 3MNSA 5ETXA 3KL6A 1SGTA 1DS2E 2ZC9H 5HYOA 4WMEA 2D1JA 4XRNA 1GI7B 4B73A 1C1WH 5AVDA 4UFGH 5DP4A 1K1PA 2BD2A 5FBEA 3RXSA 2UWLA 8KME2 2PTNA 2GDDA 2PW8H 1D3DB 3BIVH 1BOQA 1MH0A 3KYGA 3I77A 3M7TA 3PV5A 5DP8A 1AFEH 1LHCH 1WQSA 1A5GH 1TRMA 1O2UA 1UTKA 3L3TA 3FOAA 4BTTB 1IQMA 3UNSA 1OWJA 3O8RA 1BTXA 3F1SB 1LHFH 1EP6A 1V2TT 3EE7A 2CK3D 4JZDH 1QB9A 1UK4A 4H6TA 1VCPA 2NWNA 5DKMA 2BY8X 4OGYA 1CA0B 2AIQA 2J94A 4DT7B 4LZ4B 1H4WA 3DHKH 1C2EA 5CE1A 4UONA 5JPMH 2F9NA 3MHWU 1C9TA 3SJ9A 1Z8IB 1DY9A 1ARCA 4Y10E 1BTWA 1XKBC 1GBKA 3FO8D 1XMNB 2BLOA 3O8DA 2EI6A 3SJOA 1OP0A 2ZO3H 3RM2H 3PLKA 2AH4X 2ZU4A 5TJXA 1ESBA 5L2ZH 1W10U 1PQ8A 2GZ7A 3T28A 1P2IA 1VITH 4JYVH 4B6EA 3PWBA 4WY3A 1ELBA 4AOQA 2C8XB 1RJXB 3VB3A 3EGKH 1DPOA 3E16B 1K22H 3QWCH 4WWYA 5LPEA 3BTEE 1C5YB 1OPHB 1SGYE 2F4LA 5DGJA 1SGRE 1VGCC 3RXGA 1V2JT 2V7QD 5L30H 1EJNA 4CHAC 3Q3KA 2ZDLA 1SGDE 1DITH 3M3VA 1BIOA 2ZHFH 3VXFH 1UVUH 1V2OT 2OD3B 3NK8A 4Q80A 2XC4A 2CJIA 2BY7X 2F9UA 3GY5A 4NFEA 2UUYA 3MNBA 4VGCB 4E7RG 1NPMA 2A45B 2WV9A 4I8LA 4NIXA 1ZR0A 1UCYH 1TQ7B 2JH0D 2P8OB 5EQSA 3LIWA 3E1XB 1BRCE 5KGOA 1A5HA 2Q6DA 1DWDH 1F92A 2ZDVH 3EYDA 2BY9X 3PRDA 2JJ1D 5DK1A 4XD7D 4LZ1H 3SORA 3B9FH 1AB9C 1TMUH 3LJOA 1O3AA 4X8UH 2FZZA 2O8MA 2WPHS 4X1RU 3RXVA 2BX3A 4A1VA 2KCAA 2V35A 1UVOA 2BQWB 1SSXA 3GDSA 3V3MA 1P2NA 1B7XB 1FY8E 3ZZ5A 3AK5A 4RSPA 1QA0A 1MKWK 3M5OA 1HUTH 3LPRA 1V2QT 1HAGE 1GHYH 4ZH8A 3VEQB 2IOTA 1C1SA 3F0PA 2GZ8A 2VIWA 4XBCA 4GHQA 4BANB 1C2GA 3F9FA 1K1LA 2H9TH 4K1EA 3UQVA 2FWWA 2P59A 4JK5A 4Q7YA 1O3FA 1VCWA 2J9NA 2H2ZA 3IWMA 1PPZA 1BCUH 1G37A 4A92A 1FXYA 3Q76A 2KR7A 3O8CA 3ZVDA 3MOCA 3UOPA 4M7GA 2OC8A 3S9AA 2PFEA 3SQHE 1P05A 3RXAA 3E0NB 4DCDA 1P12E 1KDQA 4NZQA 2F9OA 3HK3B 3A8CA 4CREA 3VGCC 1RXPA 1SBWA 2BY6X 1SMFE 1TA2A 3GY7A 4Z0KA 1BJVA 1L1GA 3ZZ7A 1C5LH 4AN7A 1EXFA 4YESB 1VGCB 1EZQA 3GY4A 3ZZBA 2QE7D 2STAE 2FYRA 3D49H 1CE5A 4WMDA 4ABFA 5DP3A 1EZXC 1C2DA 3TJUA 3ZVFA 4YM9A 4NFFA 2Z9IA 2ZTXA 1Q3XA 1V2MT 2O8TA 1THRH 1QIXB 4ABEA 4CRGA 1HAIH 1PPHE 1YF4A 2BD8A 1B0EA 4P02A 3W1EA 3A8BA 5FPYA 3TNSA 1FAXA 2DUCA 3S69A 2L6OA 3CENA 1Z7KA 1HGTH 3SZNA 1CGJE 1COWD 1SC8U 1E1RD 1TX6A 1V2WT 1MZDA 3N7OA 4U30A 1Y3UA 1VKYA 1IHTH 1O2WA 1U6QA 1PFXC 3ZZAA 1EFRD 1C1TA 3STJA 1P03A 1QL8A 4INLA 2EA3A 2ZHEH 5FXLA 3PTBA 1GWAA 1GI8B 2BDAA 1NRQH 3QDZB 1K1IA 5A0BA 5G4BA 1FIZA 1H9IE 2VB0A 3LC5A 1AVGH 2G52A 1O37A 1G30B 2HNTE 5JB8S 5J4QA 4Q7ZA 2QXJA 1XUHA 3PV4A 5GPIB 2OQ5A 4RKJB 4DGJA 1C2MA 2P16A 1GL1A 1C1MA 1TBQH 1K21H 1TNIA 1SG8B 5C3NA 1RS0A 1KMHB 4LK4A 1SQRA 2Y80A 3R3GB 3OAAD 2OXSA 1CBWC 2ANWA 3R0FA 1G3EA 2Z9GA 1YLDA 5JB9S 2ALPA 1QB1A 1FONA 2RCEA 3DD2H 5A0CA 2GDEH 3KEEA 1NFWA 1BTPA 1QZ8A 2B5TB 1GJ4H 1GBEA 1TYNA 4F48B 2GMTC 5E2OA 1YM0A 2ZNKH 3DT0H 1UW7A 3ZYDA 1PPEE 3A7YA 1ZGIA 5T6FA 1QJ6B 2KAIA 1BMLA 4MQAA 4TT3D 2Z7FE 1A0HB 3QN7A 1PQ7A 2WYGA 3ITIA 1BJUA 2LNCA 4TPIZ 1C5SA 4UFEH 1O3HA 4ESTE 3E90B 3TK6A 3ATLA 3PROA 1MD7A 2VH6A 5CDFE 4FU7A 1G36A 2ZU2A 2P94A 4INHA 2BQ6B 4CBOA 1SFQB 1FY5A 1GDNA 2RA3A 3JZ2B 1OYTH 3FZDA 4U01A 5DP7A 4VGCC 1LO6A 2KCPA 3OY5U 1WBGB 3ZV8A 4JZFH 1CHOG 4YLUA 3OEED 3ZV9A 2XNDD 2F83A 2SFAA 3ZZ9A 2VH0A 3QZQA 2NU2E 1C5RA 1C2JA 3PLPA 1DVAH 1PPCE 1FY1A 2QXGA 3LGUA 3ENSB 4J2YB 5A2MH 1IAUA 2Y5HA 4DVAU 3AVZA 2UWPA 3EQ0H 4CBNA 1WDIA 5HKKD 2TPIZ 2L74A 1IQGA 1AQ7A 4FVDA 2G00A 2QC2A 2ALVA 2ZA5A 2A0QB 1EATA 1ZJKA 3P6ZB 3RXEA 1GBFA 1BHXF 3MNXA 2PHBA 3BIUH 3A7WA 1J8AA 6GCHG 4KTUA 2CF8H 4A1XA 3GICB 2VVCA 4HFPB 1SL3A 3URCA 1HFDA 1DICA 1P06A 1A1RA 1GI1A 3O8BA 1KXAA 1V3XA 5EGMA 3RXLA 1PQAA 3DA9B 3TGJE 5GIBA 4NZLA 7ESTE 1TNJA 2RDLA 1HLTH 3VXEH 1JIMA 1AWHB 1W13U 1D4PB 1DUAA 1UHBA 1Y3WA 3AW1A 2ZDNA 2Q1JA 2A7JA 4PROA 1NBME 1O5AB 2Y5GA 4Q4LA 1GBLA 2JETC 1TGTA 3SNEA 5EW2H 1YCPH 3GYMA 1H8HD 4IBLH 1MTNB 1AKSB 1TRYA 3KQ5A 4O3UA 1J16A 1T4UH 2BVXH 1QNJA 4SGAE 3BSQA 5HMAA 2KFWA 1S0QA 1EASA 1H8DH 1TGSZ 2XYAA 5EPYA 4U32A 3DCLA 1S81A 2CN0H 1T32A 5C17A 3SV6A 1CT4E 2FOMB 3MO3A 8ESTE 3MH7A 2EI8A 5IYTA 1GG6B 3EDXB 1NRSH 1OWIA 2FI4E 1UJ1A 1QA7A 3F6UH 1GJAB 1KYNA 1CO7E 1SPJA 5T6GA 4Q63A 1QQ4A 2GT7A 2RDEA 1DXWA 2OTVA 4ZAEA 4D9QA 1BMAA 3U8RH 1IQFA 1DY8A 1UVSH 2G5VA 2ZFPH 3M37A 1V2ST 3A83A 4AFQA 1O34A 2GVFA 2ZHDA 8GCHG 3RXFA 2WV4A 2AMQA 1VITG 1EUFA 3UTUH 4HTCH 1SGIB 3A81A 1HIAB 1LMWB 3D62A 5L6NH 2HVYB 3HGNA 3F68H 2C8YB 2PGQB 3HPTB 1D3PB 4D7GA 2A1DB 2ZTZA 1C5UA 1SQOA 3QZRA 4CRFA 1HAVA 1CT0E 3A87A 1GI4A 1A5IA 1W7GH 1YLNA 4I8KA 3OX7U 1BHXB 4TYDA 5KECA 4XBBA 1J17T 1GJBB 4X8SH 3VB6A 1QHRB 1DWBH 3OYPA 2LPRA 5SGAE 4CH2B 1YPEH 4YZUA 5EJZA 3UWJH 2WV5A 2OBQA 5GXPA 2UUFB 1O5BB 4DIHH 5F53A 5HIYA 2ZKSA 1O3PB 1FUJA 4K8YA 4MPXA 5JYIA 1BQYA 1QBVH 3OY6U 1C1QA 1KY9A 5JDUB 2KCYA 1FN6A 2WINI 3H5CB 2O9QA 2G4TA 5F6MA 2VIOA 1AZZA 4ZHLU 2YMSB 1MBQA 1GJ5H 4XE4A 1SI5H 1O31A 1C5VA 1AHTH 3OEHD 4FETA 4B75A 2FODA 4IMQA 2ZU5A 1THSH 1NTPA 5DJ7A 3DSPA 3M61U 4AGJA 1PPGE 1FQ3A 1TABE 3A7ZA 2F91A 2WZQA 8LPRA 2CXVA 4FXGH 1WU1A 2GCTB 1IQIA 1QFKH 1RTKA 2AGIX 5A8ZA 2J2UA 3FKSD 4FU9A 3UFAA 3MWIU 3GY2A 1K2I1 3TU7H 4Y8ZA 3F0OA 1QURH 3HATH 1AUTC 5LPRA 4WMFA 4YTAA 2Q6GA 2K8IA 3QTVH 2BD9A 3U69H 3RLYH 3SGAE 3LT3A 4AB9A 2DE9A 3ODDA 3TVJB 1JOUB 2CHAC 1HRTH 1TGNA 3ATIA 3HKIB 4WH8A 2OK5A 4BAMB 4NIYA 5EODA 3RLWH 1C4U2 3UY9A 1JWTA 3QK1A 2OP9A 4J1YA 1C2LA 2JH5D 1S82A 1HB0B 2SGEE 1GGDB 4AG1A 1A61H 1S0RA 2FX6A 2V3OH 3LGTA 1FPHH 1XXFA 4KGAA 3FZZA 1KXEA 2YNAA 3U8TH 4AB8A 5ESBA 4ZCNA 2FLBH 2Q6FA 3SI3H 1E38B 1ESTA 1BBRK 2W3IA 3CS0A 3SU2A 1AZ8A 1T8LA 2OC0A 1TNLA 4ABIA 5HM9A 1DANH 3LGIA 4AGKA 2R2MB 3N99A 4FUDA 1AD8H 1DSTA 3NKKA 4IN1A 4WJG2 5C0TA 4X1PU 3HGPA 2WPKS 3RXOA 3M35A 2BX4A 5K0HA 1MQ6A 5GNDA 2GD4B 1W0KD 1KXDA 1JBUH 3NXPA 1B0FA 4Y0YE 4KKDA 1OWHA 2HRVA 1P3EA 2FDAA 3PMHB 3BTHE 3FVFB 4LOYH 1HNEE 2OLGA 1EB2A 2WSSD 3ZYEA 4CRBA 1ZSJA 1O3IA 1MABB 3MO9A 1GHWH 1O2GH 2P3TB 1HV7A 1T8MA 4THNH 3ZZ6A 1C9PA 1UO6A 1K1NA 2J98A 1O2NA 4NGAH 1YCPK 1TMTH 1A4WH 1KXBA 2JKHA 1FN8A 1HAOH 3MO6A 2VGCC 2HVXA 2FM2A 3F9GA 4ISHH 3ZZ3A 3RU4D 1GVZA 4B74A 1D9IA 2SGPE 1SGEE 4NSYA 4AC9A 3TK5A 4FU8A 3Q3YA 3DUXH 1EPTB 3TGIE 1NZQH 1BTHH 1UHBB 3GCHC 1TNKA 1BITA 3GOVB 2FI5E 2AFQB 3UWIA 1ETSH 1TAWA 2YOLA 5EQRA 3RXMA 2SGDE 4FUHA 2D8WA 2BLWA 4ZMAH 2AGGX 1GI9B 5EG4A 1FLEE 3K6YA 2C93B 2FOBA 2PLXA 2NU0E 1ABIH 2PP6A 1FIWA 1BA8B 1E36B 4ACAA 1GHBG 1BMNH 1OS8A 1OP2A 1QL7A 1SGFG 1LVBA 1THPB 4D76A 4ZKSU 1BMFD 3MFJA 2XBXA 4DG4A 2J92A 3P8GA 4SGBE 5CMXH 1Z8GA 1NRRH 1ZHRA 3RXTA 2F43B 3QGNB 2XWAA 1OWKA 3A89A 3U1IB 1LPKB 4A6LA 1LHDH 2GMTB 2FIRH 1H8IH 2BHGA 2FTLE 4E7NA 3LDXH 1SKYE 2M5TA 1GGDC 4I8HA 5A8XA 2QIQA 3RXRA 3WWFA 1EAXA 2ASUB 5E0JA 1V2NT 1G9IE 1F0SA 1RFNA 1UTMA 3GISB 1MCVA 3Q00A 4Y7AA 3AAUA 1NRNH 4OS4A 3A80A 3RUOA 3D23A 1G32B 1HJ9A 1YKTA 4B71A 1YYY1 3E91A 1EAUA 1ZGVA 2QV1A 4HZHA 4NA8A 4JMYA 4XSKU 1A0LA 1NROH 3KYFA 5KEDA 2Y7XA 1FDPA 1GCTC 1V6DA 1DUEA 2BM2A 3T62A 2SNVA 1QRWA 5I46H 1RIWC 3TK9A 1O3MA 1TFXA 1QCPA 1DLKB 3G01A 2WPDD 2EEKA 3H7OA 1XVMA 2VWNA 1LKAA 2A7CA 1ZPZA 4AYVB 3A88A 4F55A 4JYTA 2CGAA 3ZZ4A 1A7SA 1AIXH 2V6NA 2ZCLP 2FXRA 1SLVB 5ABWA 1DM4B 3ZVAA 1ABJH 1J14A 4ABHA 3D65E 1C5OH 2BD7A 1HJAB 1LHEH 3P8OA 1P2MA 3VB4A 1MKXH 1KSNA 1SQAA 2VINA 1BBRH 2ZF0H 3SJIA 2HGTH 5A0AE 1TQ0B 5B6OA 4ASUD 2JJ2D 3KGPA 1GMCF 5IDKA 2XTTB 4NIWA 4A1TA 2XBWA 2ZI2H 1GHAG 4UDWH 3GY3A 2EC9H 3UNQA 4GAWA 4RKOB 1EAWA 5AFYH 3RXKA 1AUJA 4ABAA 1ELEE 3CS7A 1WTHD 2BMGB 2BZ6H 5DPAA 3EA7A 1NRPH 1PPFE 2BY5X 1PYTC 3SGBE 1QBNA 3ZVBA 2A4GA 3RXBA 3PMJA 5F8TA 3C1KA 1Q31A 2H9EH 3A8AA 7LPRA 1Y5UT 1LDTT 1SGQE 4I8GA 1O5FH 1MZAA 2ZQ1A 2Z3DA 3WWBA 2ZU3A 3ATKA 5HIZA 1VITF 4AG2A 4FOUC 1YPMH 3BG8A 3GY8A 1O3DA 2QN5T 5B6LA 5C1UA 2HOBA 3U1JB 1LKBA 1NC6A 2BDBA 3VFEA 8GCHF 4TSFD 4BXSA 3PRBA 4DT4A 1QRXA 1NFYA 3T26A 1C2HA 1AE8H 2TGDA 4ZKOU 5JBCS 1S5SA 1Y3YA 2B0FA 3UREA 3QUMP 3ZZCA 1MCTA 2FOAA 2J5UA 3MMGA 4WF8A 5EXLA 2KCOA 2KX4A 1S84A 1JXPA 1ELFA 1GDUA 2FPZA 1ZTKA 4FUCA 5C2ZA 1UK3A 3RP2A 2GP9B 2QCYA 4NG9H 1P0SH 1WQVH 1IHSH 2AS9A 3BTQE 1HAYB 2GZ9A 5C0UA 2ZPSA 4Y79A 5ESTE 6CHAC 3S9CA 1SLXB 1GCTB 1ZYOA 2AEIH 2Z9KA 4JZIA 3A85A 1ACBE 2OINA 1FJSA 4JYUH 1WYKA 1DX5M 1XVOA 1H9HE 1E0FD 2QA9E 1GMDG 1GL0E 1MU8B 1GJ7B 3TJOA 2G51A 3U28C 2GT8A 2AGEX 2K1QA 4YO9A 3UNRA 1K1OA 1FI8A 1MKWH 3S7HB 3RXCA 4ABGA 3SNAA 2IJOB 3NZIA 4D7FA 1QR3E 2XOKD 1TALA 4DW2U 1AFQB 2F3CE 3ELAH 1O5DH 3SNCA 4I8JA 4YOJA 2BDGA 1TGBA 4B2CA 1AVXA 3KQDA 5TCAA 4GPGA 2PUQH 3V7TA 1E34B 3ESTA 3M5NA 2BTCE 1O3KA 2EI7A 6GCHF 4O03A 1P3CA 2ZDMA 4MPUA 3RC6A 3PV2A 2O8WA 3SQEE 4BNRA 1C5NH 4Q7XA 5K7RA 4MNVA 2GV7A 1HCGA 2SGFE 4AZ2B 2ZECA 4Y6DA 4FVBA 3KQEA 2BDCA 5FCKA 1CVWH 2GJGA 1ANBA 2R3UA 2QY0B 3DFJA 1YPGH 3E3TA 2WUCA 3L33A 1TRNA 2OQUA 4Y71A 2OC1A 2A5KA 9LPRA 1Z1IA 1AI8H 1BDAA 1J15A 1SHHB 1DFPA 4GLYA 2FI3E 1CHOF 1XXDA 2SGQE 4K8BA 4DOQA 3ATWA 1QY6A 1YP9A 4O3TA 7GCHF 1OP8A 2VVUA 1MTNC 1TPSA 1PJPA 4AFSA 2V3HH 2BYAX 3EA9A 4MPVA 4ISOA 1ZZZA 3F2FA 1O5EH 1C1PA 3KCGH 3K6ZA 2ZWLH 2F9BH 5PTPA 2VGCB 1K0HA 1T4VH 2FTMA 2BB4A 3C27B 2W3KA 4GCHF 3QX5H 4ACBA 4AORA 2FOEA 4K1TA 4NSVA 1GBCA 2QXHA 1HAPH 2XWBI 2HLCA 1A2CH 1G2LA 3N7DA 2CHAB 3E0PB 2PKSB 1VZQH 1L1JA 4X2WA 3I78A 3TJNA 4TY6A 3WY8A 1WSSH 5DG6A 3T5FH 1C5QA 4UE7H 2XNIA 1K9OE 2ZCHP 1SLWB 2BD5A 2WPLS 3KN2A 3SV8A 1O3NA 4NIVA 1YGCH 1C5ZB 2TBSA 3SUEA 1OYQA 3T27A 3ZZ8A 2VWLA 3V0XA 1SB1H 3LH3A 3RMOH 3PTNA 2Y82A 2AIPA 2TGPZ 4X2XA 3EAJA 3MH5A 4Y76A 3RMMH 4BOHA 1DWCH 2Y6TA 3M3SA 3DFLA 1AMHA 1ZPCA 4ABDA 4JZ1A 3SJ8A 1KDQB 4IC6A 2W7SA 3TH3H 1MTSA 4YOIA 1JMOH 3V13A 5FPTA 4YXWD 3H09A 1HXFH 1O32A 2HPPH 1Z1JA 2PV9B 3PYHA 1S83A 1ELAA 1C5PA 3M3TA 4KTSA 6CHAB 1EJAA 1V2UT 1EB1H 3SI4H 3RC4A 1TBRH 2ZQ2A 3RC5A 4F49A 1ZSKA 2VVVA 1L4ZA 1YPHE 4RI0A 2ZFFH 3OSYA 1MAXA 3AASA 1ELTA 3EE0B 3M36A 1P01A 5FL7D 5C5NA 1UTNA 1K1MA 1O2ZA 1QQUA 2R2WU 1PYTD 2BVRH 2OCVB 2R9PA 3M5MA 3KHVA 1W8BH 1O5CB 3OTPA 1ZHMA 3ODFA 2WPIS 4X6NA 1A3BH 1KIGH 1RTFB 1FX0B 3IITA 3K2UA 2NU3E 2ZCKP 2UWOA 3FANA 1O2RA 1V2RT 4TY7A 3LJJA 4UEHH 2Z6BD 1O3GA 2AERH 1DT2A 1DE7H 3MI4A 1TNGA 4Z6AH 2TIOA 3OU0A 4OS5A 2FX4A 1O2OA 3M5LA 1W11U 1A0JA 1FV9A 1GDQA 2ZHWH 4HG6A 2ZFTA 1NN6A 3NUMA 3LGYA 1YPKH 2BXTH 4D8NA 1JRSA 1O36A 1FZZA 1TX8A 4KTCA 3SU3A 1AGJA 1O2PA 1ZMNA 1ZPBA 2FYQA 3S9BA 1F2SE 2G4UA 4X6MA 3MU4A 1BTUA 1O2JA 2VNTA 1EKBB 1L1NA 2PUXB 1ARBA 1BMMH 1GHXH 4MG3A 2ZZUH 1V2VT 2ZIQH 1NFXA 1MQ5A 3SGQE 3RXUA 1DWEH 3IG6B 1Z71A 3T29A 5C5OA 3RM0H 1GBIA 1AU8A 2DE8A 2QF4A 4B6FA 1TOMH 4K5ZA 4X1NU 5DN6D 1UTOA 1Q2WA 1TMBH 1C2IA 1CA8B 4FUBA 4QT8C 5DO4H 1Y59T 2O8LA 4I32A 1WCZA 5AHGH 1NO9H 3TLOA 5L2YH 3GCHB 3BF6H 2PKAA 1A46H 2FS8A 2EY4C 4OGXA 1AE5A 2HWLB 1V2KT 1C1RA 4ZHMU 2R0LA 4B2AA 2AYWA 1Z6JH 1CT2E 3HKJB 1LPZB 1TONA 1BZXE 1HJAC 1UTLM 2BLQA 4BAKB 2ANYA 4WVPE 2K0QA 3BG4B 2J34A 5F8ZA 3BEFB 1KTSB 5A09A 1IQNA 1CGIE 2FOFA 4YT7H 3NWUA 3A7TA 2V3MA 3OFND 3GCTF 1G2MA 1O2IA 1ORFA 3SYJA 3F2HA 3ZVGA 3M7QA 1ZLRA 2FS9A 1O2YA 3PMBB 1O3JA 4I33A 4TWWA 1C4V2 1N6YA 1O2LA 1AFQC 4KELA 4TWYA 1CGHA 3SU4A 4ABBA 1RIWB 4KP0A 1IQKA 3S7KB 4MLFB 2QF0A 3UR6A 3BTTE 4BAHB 1KXCA 1NY22 2TGTA 2PGBB 3FP7E 4I7YH 3VB5A 1ELVA 5FHTA 3RXHA 3LOXA 2BQ7B 3RDZA 1NT1A 2XCNA 4X8TH 2QF3A 2R3YA 1O2XA 2XBYA 1IQJA 1T8OA 2A2QH 2W26A 1SOTA 4JZEH 4E06H 4X6PA 3BTWE 1YPHC 2BZAA 2Z3EA 1YCPM 1N6XA 5T6DA 1EP5A 1OWDA 5I25A 5BRRE 1TPOA 4AYYB 1KTTB 3PMAB 2C8WB 2V0BA 2HNTC 2ANKH 1HAZB 1P2KA 1ELCA 2VIQA 3P95A 3UB0A 4X0WU 1NESE 2QF5A 1HAXB 1GG6C 1C1UH 3GDVA 1E79D 5FBIA 1Z6EA 1RRKA 2A7HA 4U2WA 1Z8RA 2VWMA 4K1SA 1T31A 3PLBA 2PTCE 2PKSC 1ID5H 2C3SA 1O2VA 2P93A 3KF2A 1GBHA 2FO9A 3ATMA 1AB9B 2EQNA 2UUKB 4FUIA 1EPTC 3UIRA 2A4QA 9ESTA 2BVSH 1G3DA 1M9UA 1E1QD 3BTGE 1ANEA 5CHBA 2BOKA 1WAYB 1BRBE 5EQQA 1TOCB 3GCTG 3L6PA 4Y11E 3AAVA 1KLJH 1IQEA 3B23B 1GJ8B 4AX9H 2KM0A 4O9VA 3SNDA 2W7UA 2ZFRH 1KLTA 1TPPA 3P92A 4H42U 1DDJA 3HK6B 3GDUA 2B9LA 2ZU1A 1QTFA 4Y0ZE 1O30A 1UTJA 3W95A 2RG3A 1XUJA 5FAHA 3RU4T 5C1XA 4MVNA 1DSUA 2YMSC 3SHCH 6LPRA 1S85A 3TIUA 3TH2H 1LCYA 1ZMLA 1HBTH 3S0NA 1TE0A 1W0ZU 3TITA 3QGJA 3F9HA 4OS6A 3I29A 5C67A 1ELDE 2XC5A 1TWXB 5E2PA 1HDTH 3VGCB 1K1JA 2A4RA 2WYJA 2B7DH 3TJVA 1S6LA 2LELA 3GCOA 5AF9H 2HPQH 2J98B 3KIDU 1MD8A 1INCA 1N8OC 1VR1H 1AKSA 3CNRA 3RXIA 1HAVB 1NU9A 5C1YA 1V2PT 3SJKA 1AY6H 4K2YA 1TBZH 1Y3VA 4JK6A 3DSGA 1PPBH 2ZGJA 2UUJB 3F9EA 4DJZB 2CV3A 2P3UB 1CA0C 1LHGH 3FN8A 1XUKA 1YLCA 1YPJH 3LH1A 3P8FA 3FP6E 1W7XH 1FNIA 2JETB 1TNHA 4M9FA 1MAYA 4ZROA 1HAHH 2VIPA 4MNWA 2QYIA 2ZHQH 3A7VA 3PM3A 1P02A 5C20A 5H4IB 1CQQA 2G8TA 1NS3A 2BDHA 3SUFA 2ZFSA 2PSXA 2Y5FA 1GI6A 1UCYE 2GCHF 2HNTF 1C5TA 1DLEA 3T25A 1ANDA 1EPTA 1OOKB 3BTFE 1XUIA 5HGGA 5EXNA 1C1VH 1LQEA 4X2YA 1GI0A 3F3BA 4CRDA 1C1OA 1TPAE 1MKXK 2P8OC 2Z9LA 4D9RA 2ODQA 2PR3A 2ZP0H 5GCHG 1KXFA 3WW7A 1OHHD 4AFZA 3A7XA 1LQDB 3SU1A 4BAQB 2CMYA 2OUAA 1OX1A 2W6ID 3P8NA 3SBKA 3EA8A 1ESAA 1P8VC 1SGPE 2IJD1 3P17H 1XX9A 4GUXA 2ODYB 4FUGA 1YPLH 2C8ZB 2WPJS 4DURA 1CBWB 1LVOA 1VJ9U 4GVUA 3FP8E 4BTUB 1O2SA 3MQKC 5EIYA 4OS2A 3NRLA 5FPSA 1JRTA 1O3CA 3TH4H 1GPZA 3U98H 4NA9H 2BD4A 3VPKA 2NU4E 3MU1A 3MU8A 2J95A 1X7AC 1SVPA 4K69A 3VG8A 5C94A 4ZXXH 5J4SA 1GBTA 2G5NA 4UFDH 4I31A 4UFFH 5EJ1A 4WXIA 3MU0A 3BEIB 1TLDA 2FOGA 1CSOE 1F5KU 1QRZA 2AHME 1G3BA 1T7CA 1D6WA 1TGCA 1C2FA 3DSOA 4DY7B 1O2MA 1QJ7B 1ZHPA 4GCHG 1GI5A 2A31A 2H5CA 4HI3A 1HYLA 4H4FA 3SV7A 3MYWA 4K3JA 4BTIB 4B2BA 1MBMA 1ZSLA 1A3EH 3LU9B 5LH8A 1WUNH 2RA0A 4X8VH 5LGOA 5E0HA 4CHAB 1P57B 7GCHG 1H9LB 1OSSA 1NM6A 1GJ6A 3SOSA 1P04A 3MTYA 2BD3A 1EZSC 2SNWA 2BDYA 1K28D 4YT6H 1T8NA 1WTGH 4OM9A 2I6QA 1G3CA 2ZGHA 1XKAC 2P95A 2A4OA 3SU5A 3UOUA 1O33A 4X1SU 1GBJA 1F0TA 2ESTE 5FX5A 4IC5A 3LKWA 3SU6A 1O2KA 2FESH 1B5GH 2PKAB 1UTPA 4GSOA 4MDSA 4XDEA 1TX7A 5AFZH 1C5MD 1HIAA 2I6SA 1VJAU 5JBAS 1H8ED 1GBAA 3GCNA 2RFKC 5JBBS 1F0RA 2G81E 2XCFA 1XM1A 4CH8B 1C2KA 1O2HA 1SLUB 2WHXA 1EZUC 4ABJA 3LONA 2KAIB 1NU7B 1RGQA 1Y8TA 2C90B 2H6MA 2ULLA 1O35A 3RMNH 1HXEH 1RTLA 2GX4A 5EXMA 4IW4E 1BRAA 1NFUA 4NWKA 2LP6A 1QGFA 2GGVB 3RXJA 3SW2B 1W14U 2J97A 2AMDA 2XRCA 3SU0A 1P2OA 4FUEA 3V12A 3KNXA 1O3LA 1O3OA 3A8DA 1UTQA 2JDID 3BTME 2Y81A 3MH4A 5E8EH 1GMHG 2H1UA 4HGCA 1ZJDA 4X6OA 3KQBA 1AN1E 3BEUA 1GBMA 2HALA 1O39A 1GMDF 1GI3A 5HM2A 3PB1E 1C4Y2 3UR9A 1L0ZA 1H1BA 1O3EA 1ZRBA 2A2XH 2JIZD 1NBMD 1O2QA 1QL9A 1RD3B 4IGDA 3SZEA 1O2TA 1WOFA 6ESTA 2O8UA 2Z9JA 2D2DA 1D3TB 1SGNE 5GDSH 1W0JD 4Y8YA 5IK2D 4ZHAA 4B1TA 1AWFH 4GHTA 1P2QA 4YOGA 5FX6A 5DSFA 5EOKA 2FP7B 5LPFA 1ANCA 1CHGA 3SNBA 2W5EA 2XW9A 1YBWA 3MU5A 3GS9A 1YWUA 4YLQH 1WXRA 1SHYA 2F9VA 2STBE 2TGAA 5EPNA 4ISIH 1MTUA 1GJ9B 3Q3XA 2B8OH 1EJMA 2F9PA 1O5GH 5T3HA 2GCTC 3H7TA 3BN9A 2IPQX 4Y7BA 1Y5AT 1SFIA 3CP7A 3UPEA 1S6FA 1W2KH 1ZTJA 5GWZA 4DIIH 2PSYA 2YNBA 2M2AA 1GMHF 3UAIC 1ELGA 2PWXA 2A32A 3OE7D 1O0DH 2XXLA 1ETTH 2R0KA 4JCNA 4H6SB 5DP6A 4OS1A 2WPMS 1F7ZA 3PWCA 4BXWA 4I86A 1GVLA 2XBVA 2FEQH 3B8JA 7KMEH 4X1QU 1MU6B 3MNCA 1BRUP 3Q77A 3F2GA 1LPGB 4MTBA 3QO6A 5DP5A 1QB6A 1W3CA 2HLDD 4IS5A 3A84A 4UD9H 1P9UA 3P70B 1EX3A 2BOHB 1LVYA 1MUEB 3TGKE 1IOEA 1C5WB 4Y8XA 1UCYK 1ZTLA 2XC0A 1GHAF 2BLVA 3K9XB 3BTDE 1GMCG 1OXGA 3RXPA 3RU4E 3LC3A 1O38A 2Z94A 2FLRH 1E35B 3UUZA 4ZUHA 2ZFQH 2Z3CA 1J9CH 5BPEA 4F4OC 2QAAA 4IMZA 4XOJA 1BT7A 2NU1E 4CR9A 5FCRA 2WUBA 4E05H 4Q2KA 4IN2A 3E6PH 1GBDA 2ILNA 1OWEA 2VBCA 3LGWA 2J38A 2J4IA 3AW0A 3ZVCA 2VJ1A 1Y5BT 4ASHA 4CRAA 4FUJA 1BB0B 1DOJA 1BUIA 2A5AA 3TNTA 4ISNA 1ZOMA 2TRMA 1W12U 3A86A 1HPGA 4ISLA 3E8LA 2QGRA 4NWLA 3NCLA 1P9SA 4MNYA 1DXPA 1UVPA 1C1NA 4XBDA 1YY3A 1MMJN 3SO3A 2ZGBH 2ZGCA 2VU8E 4WXVA 1D3QB 3BTKE 2BDIA
chains in the Genus database with same CATH topology
2ZG0H 2ZDKA 3RXDA 4OS7A 5F03A 1O3BA 2IPHA 1EOJA 1FY4A 4CRCA 1MTVA 3A82A 2VIDA 3SV2H 1TA6A 1C5XB 1SQTA 1GI2A 1UK2A 1AVWA 2OC7A 5F8XA 1JIRA 3UQOA 1KLIH 1L2EA 3ZZDA 1GJDB 1LVMA 3SUGA 2THFB 5EU8A 2VIVA 1CU1A 1FY3A 1MTWA 1XUGA 3SHAH 1OKXA 5JBTA 1SGFA 1L4DA 1S6HA 3PO1B 3U8OH 3U9AH 3URDA 2D26C 1FAKH 2ZDAH 1F5RA 1UVTH 5E0GA 4ZKNU 4WH6A 3VB7A 2FOCA 2CF9H 2ODPA 2P3FH 2VWOA 3T2NA 2FOHA 1FMGA 3W94A 4LXBH 3BV9B 4A5TS 5A8YA 1QJ1B 2H5DA 4R0IA 1Y3XA 1F0UA 2ANMH 5GCHF 3FAOA 1PQ5A 1N1LA 1EOLA 5CHAB 4FUFA 1TB6H 1AO5A 4B76A 4ZXYH 4MNXA 4CR5A 3MH6A 1UMAH 2G55A 2ZPQA 4INKA 3M7UA 1IQLA 4X2VA 1GCDA 2GCHG 3PO1C 1GHBF 3OTJE 1GHVH 3BG4C 3GYLB 4K60A 3NPSA 1QBOA 2QXIA 1YC0A 2H9HA 2ZGXH 1GJCB 1BTZA 1V2LT 1Z8JB 3SUDA 1P09A 4XFQA 1IQHA 1EAIA 1E37B 3FFGA 1N8OB 3K65B 1SOZA 1TIOA 3QLPH 3RMLH 1BBRE 1HJ8A 2GTBA 1LTOA 2BXUH 2C4FH 1GBBA 2ZEBA 3KQCA 4ZKRU 1GHZA 2IN2A 1D6RA 1F5LA 2SGAA 4NCYA 3ZVEA 3GY6A 1W0YH 2ZTYA 5GJ4B 2JH6D 2A5IA 4O97A 1FPCH 1P2JA 3STIA 5EW1H 2GKVE 3QTOH 4AFUA 5TCCA 2AMPA 1ZMJA 1BTYA 2GV6A 1ETRH 4MPWA 1P10A 5CHAC 4A7IB 1ZRKA 2ZPRA 2Y7ZA 1WV7H 3LGVA 1SR5C 5HXFA 4NA7A 3SN8A 2FMJA 1VCQA 4R8TB 2OBOA 3JZ1B 3SV9A 1XUFA 3TPIZ 3RXQA 4RN6A 1EQ9A 4TPYA 4BAOB 1GVKB 1SGCA 5DP9A 1P11E 3MNSA 5ETXA 3KL6A 1SGTA 1DS2E 2ZC9H 5HYOA 4WMEA 2D1JA 1GI7B 4B73A 1C1WH 5AVDA 4UFGH 5DP4A 1K1PA 2BD2A 5FBEA 3RXSA 2UWLA 8KME2 2PTNA 2GDDA 2PW8H 1D3DB 3BIVH 1BOQA 1MH0A 3I77A 3M7TA 5DP8A 1AFEH 1LHCH 1WQSA 1A5GH 1TRMA 1O2UA 1UTKA 3L3TA 4BTTB 1IQMA 3UNSA 1OWJA 3O8RA 1BTXA 3F1SB 1LHFH 1EP6A 1V2TT 4JZDH 1QB9A 1UK4A 4H6TA 1VCPA 2NWNA 5DKMA 2BY8X 4OGYA 1CA0B 2AIQA 2J94A 4DT7B 4LZ4B 1H4WA 3DHKH 1C2EA 5CE1A 4UONA 5JPMH 2F9NA 3MHWU 1C9TA 3SJ9A 1Z8IB 1DY9A 1ARCA 4Y10E 1BTWA 1XKBC 1GBKA 1XMNB 2BLOA 3O8DA 2EI6A 3SJOA 1OP0A 2ZO3H 3RM2H 3PLKA 2AH4X 2ZU4A 5TJXA 1ESBA 5L2ZH 1W10U 1PQ8A 2GZ7A 3T28A 1P2IA 1VITH 4JYVH 3PWBA 4WY3A 1ELBA 4AOQA 2C8XB 1RJXB 3VB3A 3EGKH 1DPOA 3E16B 1K22H 3QWCH 4WWYA 5LPEA 3BTEE 1C5YB 1OPHB 1SGYE 5DGJA 1SGRE 1VGCC 3RXGA 1V2JT 5L30H 1EJNA 4CHAC 3Q3KA 2ZDLA 1SGDE 1DITH 3M3VA 1BIOA 2ZHFH 3VXFH 1UVUH 1V2OT 2OD3B 3NK8A 4Q80A 2XC4A 2CJIA 2BY7X 2F9UA 3GY5A 4NFEA 2UUYA 3MNBA 4VGCB 4E7RG 1NPMA 2A45B 4I8LA 4NIXA 1ZR0A 1UCYH 1TQ7B 2JH0D 2P8OB 5EQSA 3LIWA 3E1XB 1BRCE 1A5HA 2Q6DA 1DWDH 1F92A 2ZDVH 3EYDA 2BY9X 5DK1A 4LZ1H 3SORA 3B9FH 1AB9C 1TMUH 3LJOA 1O3AA 4X8UH 2FZZA 2O8MA 2WPHS 4X1RU 3RXVA 2BX3A 4A1VA 2V35A 1UVOA 2BQWB 1SSXA 3GDSA 3V3MA 1P2NA 1B7XB 1FY8E 3ZZ5A 4RSPA 1QA0A 1MKWK 3M5OA 1HUTH 3LPRA 1V2QT 1HAGE 1GHYH 4ZH8A 3VEQB 2IOTA 1C1SA 2GZ8A 2VIWA 4XBCA 4GHQA 4BANB 1C2GA 3F9FA 1K1LA 2H9TH 4K1EA 3UQVA 2FWWA 2P59A 4JK5A 4Q7YA 1O3FA 1VCWA 2J9NA 2H2ZA 3IWMA 1PPZA 1BCUH 1G37A 4A92A 1FXYA 3Q76A 3O8CA 3ZVDA 3MOCA 3UOPA 4M7GA 2OC8A 3S9AA 2PFEA 3SQHE 1P05A 3RXAA 3E0NB 4DCDA 1P12E 1KDQA 4NZQA 2F9OA 3HK3B 3A8CA 4CREA 3VGCC 1RXPA 1SBWA 2BY6X 1SMFE 1TA2A 3GY7A 4Z0KA 1BJVA 1L1GA 3ZZ7A 1C5LH 4AN7A 1EXFA 4YESB 1VGCB 1EZQA 3GY4A 3ZZBA 4ABFA 2STAE 2FYRA 3D49H 1CE5A 4WMDA 5DP3A 1EZXC 1C2DA 3TJUA 3ZVFA 4YM9A 4NFFA 2Z9IA 2ZTXA 1Q3XA 1V2MT 2O8TA 1THRH 1QIXB 4ABEA 4CRGA 1HAIH 1PPHE 1YF4A 2BD8A 1B0EA 3A8BA 5FPYA 3TNSA 1FAXA 2DUCA 3S69A 3CENA 1Z7KA 1HGTH 3SZNA 1CGJE 3N7OA 1SC8U 1TX6A 1V2WT 4U30A 1MZDA 1Y3UA 1IHTH 1O2WA 1U6QA 1PFXC 3ZZAA 1C1TA 3STJA 1P03A 1QL8A 4INLA 2EA3A 2ZHEH 5FXLA 3PTBA 1GWAA 1GI8B 2BDAA 1NRQH 3QDZB 1K1IA 5A0BA 5G4BA 1FIZA 1H9IE 2VB0A 3LC5A 1AVGH 2G52A 1O37A 1G30B 2HNTE 5JB8S 5J4QA 4Q7ZA 2QXJA 1XUHA 3PV4A 5GPIB 2OQ5A 4RKJB 4DGJA 1C2MA 1TNIA 1GL1A 1C1MA 1TBQH 1K21H 2P16A 1SG8B 5C3NA 1RS0A 4LK4A 2Y80A 3R3GB 2OXSA 1CBWC 2ANWA 3R0FA 1G3EA 2Z9GA 1YLDA 5JB9S 2ALPA 1QB1A 1FONA 2RCEA 3DD2H 5A0CA 2GDEH 3KEEA 1NFWA 1BTPA 2B5TB 1GJ4H 1GBEA 1TYNA 2GMTC 5E2OA 1YM0A 2ZNKH 3DT0H 3ZYDA 1PPEE 3A7YA 1ZGIA 5T6FA 1QJ6B 2KAIA 1BMLA 4MQAA 2Z7FE 1A0HB 3QN7A 1PQ7A 2WYGA 3ITIA 1BJUA 2LNCA 4TPIZ 1C5SA 4UFEH 1O3HA 4ESTE 3E90B 3TK6A 3ATLA 3PROA 1MD7A 2VH6A 4FU7A 1G36A 2ZU2A 2P94A 4INHA 2BQ6B 4CBOA 1SFQB 1FY5A 1GDNA 2RA3A 3JZ2B 1OYTH 3FZDA 4U01A 5DP7A 4VGCC 1LO6A 3OY5U 1WBGB 3ZV8A 4JZFH 1CHOG 4YLUA 3ZV9A 2F83A 2SFAA 3ZZ9A 2VH0A 3QZQA 2NU2E 1C5RA 1C2JA 3PLPA 1DVAH 1PPCE 1FY1A 2QXGA 3LGUA 3ENSB 4J2YB 5A2MH 1IAUA 2Y5HA 4DVAU 3AVZA 2UWPA 3EQ0H 4CBNA 2TPIZ 1IQGA 1AQ7A 4FVDA 2G00A 2QC2A 2ALVA 2ZA5A 2A0QB 1EATA 1ZJKA 3P6ZB 3RXEA 1GBFA 1BHXF 3MNXA 2PHBA 3BIUH 3A7WA 1J8AA 6GCHG 4KTUA 2CF8H 4A1XA 3GICB 2VVCA 4HFPB 1SL3A 3URCA 1HFDA 1DICA 1P06A 1A1RA 1GI1A 3O8BA 1KXAA 1V3XA 5EGMA 3RXLA 1PQAA 3DA9B 3TGJE 5GIBA 4NZLA 7ESTE 1TNJA 2RDLA 1HLTH 3VXEH 1JIMA 1AWHB 1W13U 1D4PB 1DUAA 1UHBA 1Y3WA 3AW1A 2ZDNA 2Q1JA 2A7JA 4PROA 1O5AB 2Y5GA 1GBLA 2JETC 1TGTA 3SNEA 5EW2H 1YCPH 3GYMA 4IBLH 1MTNB 1AKSB 1TRYA 4O3UA 1J16A 1T4UH 2BVXH 1QNJA 4SGAE 3BSQA 5HMAA 1S0QA 1EASA 1H8DH 1TGSZ 2XYAA 5EPYA 4U32A 1S81A 2CN0H 1T32A 3SV6A 1CT4E 2FOMB 3MO3A 8ESTE 3MH7A 2EI8A 5IYTA 1GG6B 3EDXB 1NRSH 1OWIA 2FI4E 1UJ1A 1QA7A 3F6UH 1GJAB 1KYNA 1CO7E 1SPJA 5T6GA 1QQ4A 2GT7A 1DXWA 2OTVA 4ZAEA 4D9QA 1BMAA 3U8RH 1IQFA 1DY8A 1UVSH 2G5VA 2ZFPH 3M37A 1V2ST 3A83A 4AFQA 1O34A 2GVFA 2ZHDA 8GCHG 3RXFA 2WV4A 2AMQA 1VITG 1EUFA 3UTUH 4HTCH 1SGIB 3A81A 1HIAB 1LMWB 3D62A 5L6NH 3HGNA 3F68H 2C8YB 2PGQB 3HPTB 1D3PB 4D7GA 2A1DB 2ZTZA 1C5UA 1SQOA 3QZRA 4CRFA 1HAVA 1CT0E 3A87A 1GI4A 1A5IA 1W7GH 4I8KA 3OX7U 1BHXB 4TYDA 4XBBA 1J17T 1GJBB 4X8SH 3VB6A 1QHRB 1DWBH 3OYPA 2LPRA 5SGAE 4CH2B 1YPEH 4YZUA 3UWJH 2WV5A 2OBQA 5GXPA 2UUFB 1O5BB 4DIHH 2ZKSA 1O3PB 1FUJA 4K8YA 4MPXA 5JYIA 1BQYA 1QBVH 3OY6U 1C1QA 1KY9A 5JDUB 1FN6A 2WINI 3H5CB 2O9QA 2G4TA 5F6MA 2VIOA 1AZZA 4ZHLU 1MBQA 1GJ5H 4XE4A 1SI5H 1O31A 1C5VA 1AHTH 4B75A 2FODA 4IMQA 2ZU5A 1THSH 1NTPA 5DJ7A 3M61U 4AGJA 1PPGE 1FQ3A 1TABE 3A7ZA 2F91A 8LPRA 2CXVA 4FXGH 1WU1A 2GCTB 1IQIA 1QFKH 1RTKA 2AGIX 5A8ZA 2J2UA 4FU9A 3UFAA 3MWIU 3GY2A 1K2I1 3TU7H 4Y8ZA 1QURH 3HATH 1AUTC 5LPRA 4WMFA 4YTAA 2Q6GA 3QTVH 2BD9A 3U69H 3RLYH 3SGAE 3LT3A 4AB9A 2DE9A 3ODDA 3TVJB 1JOUB 2CHAC 1HRTH 1TGNA 3ATIA 3HKIB 4WH8A 4BAMB 4NIYA 5EODA 3RLWH 1C4U2 3UY9A 1JWTA 3QK1A 2OP9A 4J1YA 1C2LA 2JH5D 1S82A 1HB0B 2SGEE 1GGDB 4AG1A 1A61H 1S0RA 2FX6A 2V3OH 3LGTA 1FPHH 1XXFA 4KGAA 3FZZA 1KXEA 2YNAA 3U8TH 4AB8A 5ESBA 2FLBH 2Q6FA 3SI3H 1E38B 1ESTA 1BBRK 2W3IA 3CS0A 3SU2A 1AZ8A 1T8LA 2OC0A 1TNLA 4ABIA 5HM9A 1DANH 3LGIA 4AGKA 2R2MB 4FUDA 1AD8H 1DSTA 3NKKA 4IN1A 4WJG2 4X1PU 3HGPA 2WPKS 3RXOA 3M35A 2BX4A 5K0HA 1MQ6A 2GD4B 1KXDA 1JBUH 3NXPA 1B0FA 4Y0YE 4KKDA 1OWHA 2HRVA 1P3EA 2FDAA 3PMHB 3BTHE 3FVFB 4LOYH 1HNEE 2OLGA 1EB2A 3ZYEA 4CRBA 1ZSJA 1O3IA 3MO9A 1GHWH 1O2GH 2P3TB 1HV7A 1T8MA 4THNH 3ZZ6A 1C9PA 1UO6A 1K1NA 1O2NA 4NGAH 1YCPK 1A4WH 1TMTH 1KXBA 2JKHA 1FN8A 1HAOH 3MO6A 2VGCC 2HVXA 2FM2A 3F9GA 4ISHH 3ZZ3A 3RU4D 1GVZA 4B74A 1D9IA 2SGPE 1SGEE 4NSYA 3TK5A 4FU8A 3Q3YA 3DUXH 1EPTB 3TGIE 1NZQH 1BTHH 1UHBB 3GCHC 1TNKA 1BITA 3GOVB 2FI5E 2AFQB 3UWIA 1ETSH 1TAWA 2YOLA 5EQRA 3RXMA 2SGDE 4FUHA 2D8WA 2BLWA 4ZMAH 2AGGX 1GI9B 5EG4A 1FLEE 3K6YA 2C93B 2FOBA 2PLXA 2NU0E 1ABIH 1FIWA 1BA8B 1E36B 1GHBG 1BMNH 1OS8A 1OP2A 1QL7A 1SGFG 1LVBA 1THPB 4D76A 4ZKSU 3MFJA 2XBXA 4DG4A 2J92A 3P8GA 4SGBE 5CMXH 1Z8GA 1NRRH 1ZHRA 3RXTA 3QGNB 2XWAA 1OWKA 3A89A 3U1IB 1LPKB 4A6LA 1LHDH 2GMTB 2FIRH 1H8IH 2BHGA 2FTLE 4E7NA 3LDXH 2M5TA 1GGDC 4I8HA 5A8XA 2QIQA 3RXRA 1EAXA 2ASUB 5E0JA 1V2NT 1G9IE 1F0SA 1RFNA 1UTMA 3GISB 1MCVA 3Q00A 4Y7AA 3AAUA 1NRNH 4OS4A 3A80A 3RUOA 3D23A 1G32B 1HJ9A 1YKTA 4B71A 1YYY1 3E91A 1EAUA 1ZGVA 2QV1A 4HZHA 4NA8A 4JMYA 4XSKU 1A0LA 1NROH 2Y7XA 1FDPA 1GCTC 1V6DA 1DUEA 2BM2A 3T62A 2SNVA 1QRWA 5I46H 1RIWC 3TK9A 1O3MA 1TFXA 1QCPA 1DLKB 3G01A 2EEKA 3H7OA 1XVMA 2VWNA 1LKAA 2A7CA 1ZPZA 4AYVB 3A88A 4JYTA 2CGAA 3ZZ4A 1A7SA 1AIXH 2V6NA 2ZCLP 2FXRA 1SLVB 5ABWA 1DM4B 3ZVAA 1ABJH 1J14A 4ABHA 3D65E 1C5OH 2BD7A 1HJAB 1LHEH 3P8OA 1P2MA 3VB4A 1MKXH 1KSNA 1SQAA 2VINA 1BBRH 2ZF0H 3SJIA 2HGTH 5A0AE 1TQ0B 5B6OA 3KGPA 1GMCF 5IDKA 2XTTB 4NIWA 4A1TA 2XBWA 2ZI2H 1GHAG