4KTUA

Bovine trypsin in complex with microviridin j at ph 6.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Harnessing the evolvability of tricyclic microviridins to dissect protease-inhibitor interactions.
pubmed doi rcsb
source organism Microcystis aeruginosa mrc
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA02
4MPUA 4HI3A 3LH1A 1KTSB 1DXWA 4K3JA 3SNEA 3TNTA 3BG4C 2YNAA 4R8TB 2ZHEH 1P2KA 4X1PU 1WV7H 4O03A 2KAIB 1V2UT 1YPHC 3K6ZA 3OTJE 2BDCA 2AIQA 3Q77A 1UVOA 4NZLA 3SV9A 1V2VT 1O5DH 2Q6DA 3TPIZ 5GDSH 3RXPA 1KSNA 4X6NA 1T8OA 3GY6A 1GMCG 3HPTB 1VZQH 1XUIA 1F5KU 1GBIA 1W0YH 3E0PB 4E7NA 3D65E 1P3CA 4Y11E 4FUCA 2VU8E 2FOGA 4ISLA 2W7SA 1GJDB 5DO4H 2WPHS 1JIMA 2BVRH 1IQHA 1ID5H 2F9UA 4DIIH 1NRRH 3LGIA 4JZFH 4D7FA 1LDTT 1CHOF 1ZRKA 3LOXA 2O8MA 4YOJA 1WSSH 4ZHAA 3L6PA 1GHZA 1W7GH 4ZMAH 1C5RA 5K7RA 1ANCA 1OWHA 2VH6A 4UDWH 1O3OA 3Q3XA 1AVXA 1EOLA 2GCTC 1FPCH 1GHVH 3H7TA 1QJ1B 1Q31A 2B5TB 2VGCB 4JYUH 2BD7A 5LGOA 1NFUA 3A7VA 1ZHMA 1SGPE 3U1IB 5L2YH 4D9RA 2G4TA 4X2VA 3UNQA 1CT4E 1AKSB 4XFQA 2FZZA 3KIDU 1GVZA 1WCZA 1SL3A 3M3VA 1NN6A 4XOJA 1W11U 1SG8B 1J16A 1CGHA 3KNXA 1LKBA 1IQKA 3D62A 1IQJA 2BYAX 3TJNA 1VR1H 4WVPE 2D26C 1V2KT 1HJ9A 1MAXA 1UTNA 1ZHPA 2BY7X 1XXFA 3OX7U 1TPPA 1AMHA 3TJUA 2VVCA 3RC5A 3M61U 2B0FA 5GCHG 3SN8A 1V2RT 1BA8B 1EATA 1YLDA 3SHAH 4U30A 1C9TA 2R3UA 1WU1A 8GCHF 1AWHB 1OYTH 2J4IA 1U6QA 2Q6FA 4A6LA 2VJ1A 2P8OB 1QQUA 5EQQA 3DUXH 4H42U 1XM1A 4CRAA 1GI7B 5DPAA 1RRKA 3ESTA 4ISOA 2QXHA 4KKDA 1BTPA 3H5CB 2V35A 3MU4A 1DICA 1VJ9U 1PPBH 4JK6A 1QRXA 2PKAA 2BY9X 4YO9A 1A3EH 3LKWA 3RXTA 1TE0A 1BRAA 1UTLM 1MQ5A 2ZFPH 1ZJKA 2ZECA 2XW9A 2P3UB 1ELDE 2QCYA 2F91A 2P16A 5EU8A 1QA7A 2ZGJA 4YM9A 1SB1H 3SV8A 2QF0A 1TNKA 4O3UA 1A5HA 1O2GH 1MD8A 1DANH 2SGDE 4WXIA 1GJAB 2OBQA 3MFJA 1GBFA 3MH6A 3MYWA 3M35A 3WY8A 4NGAH 1HAIH 4R0IA 2ZFFH 2ZPSA 1C2IA 1GJ7B 1V2OT 2JH6D 1F0SA 1Y3UA 3SJIA 1O3PB 1W3CA 1BTUA 5DJ7A 2PW8H 1ZRBA 4YOIA 4FUEA 3U9AH 4MLFB 4CHAB 2RG3A 2PTNA 1ZMJA 3SU0A 2BZ6H 5EODA 2HRVA 1E34B 1GVKB 4CH8B 1JRSA 1Y3VA 2ODYB 3TIUA 1C9PA 2D1JA 3BTHE 6LPRA 1P9UA 1Z7KA 3T2NA 3GCTG 2PKSC 1TMTH 1BMAA 1GBKA 2J34A 2ZGXH 3URCA 1F0UA 1BOQA 2GKVE 3A82A 4Y8ZA 4BTTB 1O2QA 3O8RA 1W13U 2AERH 3BF6H 5FX5A 1D3TB 1T31A 4AFSA 3LJJA 1V2PT 5F8TA 2FPZA 5G4BA 4GHTA 1ZTLA 4ZKSU 2FP7B 1NTPA 5HGGA 4RSPA 4BAQB 4KP0A 1O3DA 1GHAG 3GY2A 1BT7A 4GCHF 1XKAC 3ZZ8A 2PSYA 2IOTA 4A5TS 2RDLA 6ESTA 2QYIA 3A8AA 4OS4A 2OC0A 3RXLA 2RA3A 1ABJH 3T27A 4OS7A 1LVOA 1K1LA 1QA0A 1D3QB 1SPJA 4F49A 1NFYA 2GV6A 1Z71A 4CRFA 4MNWA 2Y7ZA 1CE5A 2OC8A 2ZQ1A 3UQOA 6CHAC 4Y8XA 1C1QA 1KIGH 2ILNA 1Q3XA 1C1OA 3A87A 1Z8IB 4MVNA 1A0LA 3QDZB 5DP8A 4UONA 2BX3A 1YBWA 3CENA 3PMAB 1VJAU 3B8JA 2W3KA 1S82A 2Y7XA 1K1IA 1W14U 5EQSA 2BD4A 4X8TH 2Y82A 3O8DA 1BB0B 4WWYA 4NSVA 2ZCKP 1UTKA 2GZ9A 3EGKH 1Y3YA 1YCPH 1Z6EA 1LQEA 4BOHA 4ABDA 1BMLA 3E1XB 3V3MA 2VNTA 1CU1A 1O0DH 3GY8A 4NA9H 1TX7A 1LMWB 1UHBB 1V2ST 3BSQA 2R2WU 1BBRE 1TIOA 3TJOA 5FPSA 2ZHWH 3MOCA 3RLYH 1S0RA 3SJ9A 2CHAC 2FLRH 4NZQA 1O30A 1O3BA 1BQYA 3UR9A 3E0NB 2ZQ2A 3W94A 1TMUH 4Y0YE 4K1EA 1ARCA 4FU9A 1T7CA 4DT7B 1EPTA 1FONA 4A7IB 1FAXA 2ZCLP 1GHXH 5JB9S 3HGNA 1C1RA 3KEEA 2CF8H 5EXNA 2XBXA 2BD9A 3L3TA 1BRUP 1E38B 1C1SA 1GJ5H 3SI4H 1J9CH 3ZZ3A 2XCNA 2FM2A 4NWKA 3EYDA 1NRQH 2ZI2H 3U8OH 2QN5T 5DP3A 4K2YA 5PTPA 3ZYDA 1C2EA 1DXPA 3HKJB 1UK3A 1YPEH 1PYTC 2OXSA 3S0NA 3FP8E 2ZA5A 1QNJA 2O8LA 1EB2A 1G3CA 3DHKH 3R0FA 1BTYA 1UVPA 8KME2 2UWLA 1CGIE 2ZU5A 1YPKH 3C1KA 1GG6C 3F9HA 2JH5D 2G81E 2XCFA 3QTOH 6CHAB 1O36A 2Y5GA 5A8YA 2VINA 1KLIH 3BTFE 5HXFA 1MTNC 2C8XB 3QUMP 2HPPH 1DY8A 2YOLA 1W12U 1ELAA 1GDNA 1GDQA 2ANKH 3I77A 1O3NA 2DE8A 1UVTH 1ANBA 2G8TA 1EJAA 3PWBA 1BZXE 1KDQB 3F6UH 5J4SA 6GCHG 2ZNKH 2VWOA 3GY4A 3SHCH 2Z9KA 3RXKA 2AYWA 1A0HB 2BX4A 1XVMA 3VB5A 1HRTH 1Z6JH 1TPOA 1L4DA 2P3FH 3TGIE 2ZPRA 3OY5U 5FBEA 5H4IB 2ZGHA 3OY6U 2ODQA 5FBIA 2OUAA 3SBKA 1DWEH 3EQ0H 1AB9C 1NRNH 4WJG2 1ANEA 2SNVA 4ZKRU 1ABIH 1C2DA 1SFQB 1LKAA 3BIVH 1UVUH 5FCRA 1Y59T 1XUFA 1B5GH 5T6FA 5JDUB 1O2NA 1KXCA 3UWIA 4KTSA 2A5KA 4IMZA 1THPB 4MPWA 5I46H 1O2IA 4AB8A 2F9PA 1FIZA 1EP5A 1QHRB 2FS8A 2XC0A 3RM0H 3R3GB 1LHGH 2A7CA 1GBBA 2Z9JA 3ZVBA 1FY8E 5GWZA 5A0BA 4NFFA 1HAVB 9LPRA 1P3EA 1C2JA 1TQ7B 1BTXA 1OP0A 1C5QA 3VPKA 3LU9B 4A1VA 1A4WH 3PO1B 2BQWB 3SQHE 3V13A 1HGTH 1Y5BT 1GG6B 2FMJA 1HJAC 2BDBA 1C5OH 1HXEH 3AW0A 4AB9A 1DWDH 4BTUB 3LC3A 1MTNB 5LPRA 1ESBA 3A7ZA 2QF3A 2BQ7B 1O3GA 1L2EA 2PTCE 1ZPZA 1KLTA 3Q3KA 5DP5A 2LPRA 1P8VC 4Y0ZE 2FYRA 4ASHA 3UPEA 1Z1IA 4FXGH 2UWOA 2GCHF 4Z0KA 1P2OA 4GVUA 3P8NA 4FU8A 3E90B 4Q7ZA 2XBWA 1J8AA 4GLYA 4YLUA 2ZDVH 1M9UA 5BPEA 3F68H 5A0AE 1O5CB 1GBTA 4U2WA 3RC4A 3BTDE 1OKXA 1TGCA 1GBDA 1EP6A 1O5AB 2BD8A 2FOAA 4MNVA 4WH8A 1HUTH 1XMNB 3LT3A 1C5LH 1F2SE 3LC5A 1UMAH 1O5BB 5A2MH 1ELCA 3ZZ9A 1TPSA 5JB8S 1HIAA 3NZIA 2VIVA 1A3BH 3SGQE 2VIPA 1SGDE 5C1UA 4XBDA 1WQSA 5T3HA 2CGAA 1O5EH 1KXEA 1NO9H 2ZDMA 2PFEA 1ZSJA 4AFZA 3SV6A 1VITF 3GCOA 1JXPA 1MU6B 3ATMA 3UOUA 1GBAA 3K9XB 3K6YA 1QRWA 3SUGA 1IQMA 2Z3EA 3VXEH 1WTGH 3SNDA 3RP2A 2ZZUH 1BITA 3UWJH 3VB4A 4AGKA 3TU7H 2PUQH 5HM9A 1HJ8A 1SQOA 2PSXA 1X7AC 3T28A 1TRNA 4JZEH 3ZVDA 1TB6H 2V0BA 2VGCC 1EX3A 1EUFA 3MMGA 1S6HA 3NK8A 3LJOA 1SBWA 5I25A 2VIDA 5FPTA 4Y71A 1QRZA 1LPZB 2F9BH 1O2RA 1TQ0B 1ZTKA 9ESTA 1EZXC 1P0SH 3BN9A 5FX6A 1YPMH 4UD9H 2ASUB 5K0HA 1QBNA 3RMMH 4X8VH 3FZDA 7GCHG 1BJUA 2WPKS 3PMBB 1E0FD 2F83A 5EG4A 1CT2E 3TLOA 2V3OH 2AGGX 1F0RA 5CHAB 1ZJDA 4WMEA 3BTTE 1OX1A 4B74A 1SI5H 2XBVA 2EEKA 2BQ6B 1NROH 2BLQA 1NS3A 1VCWA 4K69A 3MNXA 1AUTC 1C5VA 5L2ZH 1EKBB 1LHEH 3CS0A 4AZ2B 1DLEA 1P2NA 3ZYEA 2A2QH 2BB4A 3PYHA 4E05H 1ESTA 5CMXH 1V6DA 1GMDF 1IAUA 2GZ7A 2P8OC 5CE1A 1C2GA 2OD3B 4FUDA 1ZSKA 4LZ4B 1HXFH 1A5IA 1DX5M 1O3LA 4WY3A 2IJOB 2UUYA 4LK4A 3RXAA 1MH0A 2P94A 3MU0A 4FUIA 5J4QA 4ISIH 1QIXB 4DCDA 1L0ZA 1KLJH 2VIQA 1TNJA 1UCYE 1JWTA 1QJ7B 1GHBF 2PGQB 3ZV9A 1MCTA 1C2FA 3SNAA 4Q80A 4K5ZA 3GYLB 3VB7A 2HVXA 3ATLA 4MDSA 5E0GA 1L1JA 4B2CA 3MO6A 3K2UA 1MU8B 2ANMH 1GBHA 1O2WA 1MTWA 2CN0H 4ABGA 1AN1E 1GI0A 1SFIA 1EOJA 1GMCF 2B9LA 2BOHB 2C4FH 2J95A 1T8LA 2TGAA 1O2PA 2FESH 1O2HA 1K1JA 2A5IA 2SFAA 3P6ZB 3MNSA 1N8OC 1E37B 1C1VH 3RMNH 4FUBA 1ZLRA 4OS6A 3LH3A 1DS2E 3SU1A 4GHQA 3DFJA 1A0JA 1A61H 1K1NA 2AMPA 1GBMA 3HK6B 2ZC9H 1GBEA 3TH3H 1MTUA 2PV9B 4CHAC 3A88A 1EZQA 2A4GA 2GX4A 3KCGH 1C5PA 5FAHA 1KXDA 1O3EA 1CQQA 4IW4E 3U98H 3BEFB 1L4ZA 1EJMA 1DPOA 2VWMA 3SJKA 3FVFB 1N6XA 1OS8A 1W8BH 5HM2A 1QY6A 5LH8A 1FMGA 1FXYA 2ZU1A 3E3TA 1HAYB 1UTPA 1V2NT 2HNTE 1FN8A 1W0ZU 3GCHB 4TYDA 3EA8A 1H8IH 2F9OA 3S9AA 1AHTH 2SGEE 1C5SA 1B0EA 1O39A 4RKOB 1TWXB 4VGCB 1HPGA 1S81A 4AG1A 3BV9B 2B7DH 2QGRA 3H7OA 3GDSA 3EA9A 1T8MA 2ALPA 1C4V2 1PYTD 2AGIX 4CRBA 5L6NH 4Y7BA 4GSOA 1O2LA 1RJXB 4O97A 4ABAA 1P9SA 1V2QT 3B23B 4RN6A 3RXBA 4WF8A 2EA3A 2OCVB 5C1XA 2RCEA 1SGIB 3TGJE 1CGJE 1PPZA 1YKTA 3U8TH 1QL9A 4IN2A 3SOSA 2ZFTA 2JETB 3A81A 1JMOH 3N7OA 4ZH8A 1TPAE 4ABEA 2OP9A 1OPHB 1ZSLA 5ESTE 2C93B 4KGAA 2TRMA 2Y5HA 3ATWA 1GI4A 5FPYA 1PPEE 2A45B 3VB6A 2ZDLA 4LZ1H 4DJZB 3O8BA 2HPQH 1HAHH 3ZZ4A 1O2JA 4A1TA 5IYTA 2ESTE 4X1QU 1YC0A 3FAOA 3KQBA 1C1PA 2W7UA 1WOFA 2XRCA 1P05A 1N8OB 3GY7A 1O2OA 1UTMA 1YPLH 2NU3E 5B6OA 2ZTZA 5F03A 1C2KA 1XX9A 3RU4E 3ZV8A 1GJ8B 2XWAA 3M5MA 3A8DA 3RMOH 2OQUA 2FX4A 1GI6A 1LHFH 2BMGB 4WH6A 3RC6A 2A7HA 1AFQB 3BTGE 3SGAE 1UTOA 1V3XA 1S5SA 4Y6DA 1HBTH 4DG4A 1TA6A 5F6MA 3A8BA 1C5TA 1RXPA 1MCVA 1PQ7A 4SGAE 1BTWA 3KF2A 4ISNA 3OSYA 1QBOA 4YT7H 1XUKA 5FHTA 1MKWH 1A2CH 3TH4H 1C5MD 5A0CA 2KAIA 2GVFA 1JBUH 2GT7A 2WINI 4GCHG 1Z8JB 4XBBA 2C8WB 2WUCA 4AX9H 5C5NA 3ZVAA 8LPRA 4FU7A 3SI3H 3UIRA 5JBCS 4JZDH 1SGRE 4I8JA 3TNSA 3RXHA 1OWDA 1P04A 1O3IA 1BDAA 1O2ZA 3QGJA 2D8WA 2GMTC 3TITA 2ZHFH 4AGJA 1BBRH 3SZNA 3DD2H 3UNSA 2BY8X 1HAZB 1P2IA 3BTKE 2F3CE 1QB1A 4YESB 1D3PB 2GZ8A 4X2YA 1GHAF 1SGCA 3AASA 3M7TA 3MO9A 3ZZBA 4KTCA 1AGJA 2BD5A 1LO6A 1HAGE 4H4FA 4MNYA 2Q6GA 1GMHF 5EQRA 2BDAA 2FLBH 3UR6A 1V2MT 1WUNH 1C4Y2 3SQEE 1D4PB 1QQ4A 2QXGA 1GPZA 2IPHA 1TOMH 1EAIA 4TWWA 4ZROA 4QT8C 1TX8A 1C5NH 1SHYA 1P01A 2R0KA 1KXBA 2NU1E 1AE5A 1WBGB 1TGTA 1AKSA 5C2ZA 1UCYK 4NIWA 1SGYE 3BTQE 5GJ4B 3RDZA 3TVJB 1EQ9A 3SU3A 3RXFA 1LPKB 5DP7A 5DP6A 3ODDA 3UQVA 3ZZCA 5GXPA 3F9FA 1HAOH 1VCPA 1BUIA 4H6TA 1P2MA 2XC4A 4ABIA 1AO5A 1XUHA 4Z6AH 3P95A 1TBQH 1O37A 3M37A 1UVSH 1NRPH 1GDUA 3SO3A 1RTKA 3OU0A 2F9NA 1AVGH 1ETSH 1PPGE 1D6WA 3SU4A 3TGKE 2H1UA 3RXCA 3GDUA 1IOEA 2G5NA 4B76A 1ELFA 2YNBA 2PUXB 1ZYOA 4YOGA 2NU2E 5AFYH 1B7XB 1GVLA 1EAUA 1RIWB 2A1DB 2FWWA 4UEHH 1W7XH 2GMTB 2FTLE 3V0XA 4INLA 2STBE 3MH4A 1O32A 4SGBE 3PO1C 4JCNA 4Y7AA 1FDPA 1O35A 1WTHD 1XXDA 3LONA 2I6SA 3QTVH 1V2JT 2HWLB 2ZO3H 1W10U 2HNTF 1AD8H 2H9TH 3W95A 4BAHB 1JRTA 2A32A 3TK6A 2BXUH 1A7SA 3IWMA 3KHVA 3VXFH 1TGBA 1DE7H 3URDA 2H9HA 4MG3A 1P2JA 1GWAA 3PTBA 1GCTB 1FI8A 1O31A 3IG6B 3ZZ5A 3E6PH 1OOKB 1H9LB 4X1NU 3RXMA 1KY9A 1AZ8A 2ZDNA 1EZSC 1ZPBA 1O5FH 1QURH 3HGPA 2G51A 3DFLA 2VWLA 2VIOA 4ABFA 5T6DA 1NZQH 3S9BA 3V7TA 1FY3A 1O3FA 4MQAA 3P70B 1N1LA 1SLXB 3DA9B 1TNLA 3GYMA 2JKHA 3ATIA 1V2TT 1INCA 3RXQA 3NCLA 3FP6E 3ZZAA 1ZZZA 1K1PA 1O2TA 3I78A 3A85A 5EXMA 2OBOA 5TCAA 3EE0B 3GY5A 1HFDA 1YPGH 2CJIA 4MNXA 4IC5A 2ZKSA 2ZTYA 4YT6H 3SW2B 3GICB 4ZHLU 3LIWA 3MU1A 4YTAA 2P59A 5A8ZA 1O2UA 2FS9A 2BXTH 3SGBE 2GTBA 3PWCA 4OGYA 1QJ6B 3LDXH 3ZVCA 1UTJA 4KELA 5DP4A 3MTYA 2A4RA 4XDEA 2OTVA 5JBBS 1QFKH 1ELGA 2F9VA 4GPGA 2SGAA 1O2VA 1ESAA 1Y3WA 2B8OH 3F9EA 2P93A 1GHYH 4BAKB 4FUFA 4XSKU 2BOKA 3NUMA 4M7GA 2CXVA 1Z1JA 4JZIA 3RU4T 2Z7FE 1RGQA 3RXJA 5A8XA 2OC1A 1VGCC 2PGBB 2VB0A 1SLWB 4OS5A 1MKXK 4RKJB 1O2SA 1C5XB 2FOHA 4KTUA 4TPYA 1TGNA 1DUEA 3Q3YA 4D76A 3NXPA 1AI8H 2H5CA 1OP2A 3LGTA 1BTZA 2Z9GA 4K8BA 5CHAC 3QLPH 3EDXB 1TYNA 2GDDA 4IBLH 1O2YA 1LTOA 3K65B 2GCHG 1BRBE 2AIPA 3ENSB 1BJVA 2FOBA 1P11E 3G01A 4AFUA 1AFEH 3ATKA 1SC8U 3PLKA 2IN2A 1GJ6A 5C3NA 1K9OE 4B75A 3A7XA 5AF9H 2PLXA 3ZZDA 1ETTH 1THRH 1NRSH 4Y8YA 1C1MA 2QC2A 1PPHE 5F8ZA 3RXUA 2GD4B 1UHBA 1D6RA 7ESTE 4ZXXH 1G3BA 2R0LA 2GGVB 1N6YA 3F1SB 1OP8A 1T8NA 2Y5FA 2J2UA 4FUGA 1ANDA 5GIBA 3RXOA 1P10A 4JK5A 4BXWA 2C8ZB 4HGCA 2EC9H 1PQ8A 2O9QA 5EW1H 1ACBE 4E06H 5DGJA 1EAXA 3SV2H 4I32A 2VIWA 1HLTH 2PKAB 4UFGH 2SNWA 4FVDA 3S69A 5EW2H 3GDVA 2ZIQH 3RXDA 5LPEA 1C5YB 4GAWA 2A4QA 2PR3A 1DLKB 1EJNA 4IN1A 3ZVFA 2G5VA 4FUJA 5A09A 3JZ2B 2WUBA 2FOMB 1G3EA 2XYAA 1O34A 4I8HA 2FXRA 1LPGB 2Z9IA 1GGDB 1C4U2 3KN2A 1Q2WA 1OWKA 1GI3A 3T29A 4D8NA 4B2BA 2ZGBH 3UY9A 2ZF0H 4XE4A 4CRCA 3BTEE 1LVYA 1VGCB 3UOPA 3ZVGA 3RXVA 3AAVA 2ZHQH 1G30B 4B71A 2FI5E 2XXLA 1P03A 2R2MB 1IQFA 1TALA 4K1TA 3ZZ6A 1LHCH 3HK3B 1OXGA 1PFXC 4J1YA 5L30H 3PMHB 2FI3E 1MBMA 5C1YA 5DKMA 1SGTA 1DWBH 1VCQA 3QX5H 1TABE 1KDQA 1TA2A 2JH0D 1QGFA 1ZGVA 3GCHC 4CBNA 3PM3A 1DOJA 2G00A 2ANYA 1KTTB 4AORA 3AVZA 3FFGA 2XTTB 1RTLA 4NCYA 3TK9A 3PTNA 3M7UA 4VGCC 1GMDG 2AGEX 3E8LA 4X0WU 1DUAA 1FY5A 1ZHRA 2G55A 4BTIB 2AMQA 3CP7A 4OS1A 1BRCE 1FNIA 1LHDH 1UO6A 3LGYA 2NU0E 2ZFRH 1GHBG 1O3HA 3SUEA 1C1WH 1FIWA 1FV9A 1YCPK 2ZEBA 4AYVB 1Z8RA 1YM0A 4NFEA 1QB6A 4THNH 2HALA 1CHOG 1FY1A 2JETC 1K28D 2O8UA 4UE7H 3EA7A 4JMYA 4K60A 4J2YB 1DSUA 4D9QA 3BTWE 1ARBA 8ESTE 3RM2H 5E0HA 4X8UH 5ETXA 2STAE 1TMBH 4U01A 1SOTA 1MD7A 4DIHH 1RTFB 1GHWH 1PQ5A 1V2WT 1NU9A 3S7KB 1DDJA 1HAVA 1PPCE 4HZHA 1GI5A 1NFWA 1GJ9B 1O5GH 1GJCB 1CVWH 4A1XA 2ZDKA 4ZKNU 2Y81A 1GI1A 5DG6A 3D23A 3T5FH 2ZCHP 4AFQA 2BM2A 3UREA 5GPIB 1AFQC 2QXIA 3PMJA 4NWLA 2QY0B 4LOYH 5C67A 1QCPA 5BRRE 3U8RH 2WYGA 3IITA 3FANA 1FLEE 1NC6A 4DW2U 3U69H 1XUJA 1ZMNA 1S6FA 4LXBH 2GP9B 1GBLA 5DP9A 3KL6A 8GCHG 4CR5A 5EXLA 1GL1A 3RXGA 1UK2A 1P09A 4NIVA 2ZFQH 3VB3A 1Z8GA 1LVMA 2AFQB 1O33A 1DFPA 4DURA 2FX6A 1EPTB 1S83A 5AVDA 3SJOA 1RFNA 4BANB 2W5EA 3TJVA 3BG4B 3A7YA 2Z6BD 3PB1E 1GL0E 3MU8A 1BMNH 1L1GA 4B2AA 2BHGA 4BXSA 2C3SA 2A2XH 1GJ4H 3PV4A 5GCHF 1MKXH 1G3DA 1RD3B 1TBRH 4XBCA 4CH2B 3DT0H 1BMMH 4AN7A 2BLOA 3VFEA 3OYPA 1YYY1 4IGDA 1LCYA 1J15A 3UUZA 2W26A 2H5DA 1YP9A 1G2MA 3U1JB 5HMAA 2SGPE 2UWPA 3ODFA 1AUJA 5DK1A 5JBTA 1E35B 1OWIA 1HAPH 1TNGA 1UTQA 2QV1A 5JPMH 2ZDAH 2Z9LA 4NIXA 1S85A 4I8KA 1FN6A 5FXLA 1CA0C 3BIUH 1YCPM 1ORFA 4F4OC 1FUJA 2BDGA 4Y10E 2Y80A 2BY5X 1OYQA 3HKIB 4INHA 5JBAS 4Y76A 1A5GH 3SUFA 1ELTA 3SORA 5EPNA 3KQEA 1SGFG 2R9PA 7KMEH 3RU4D 3BEIB 2M5TA 3AAUA 1H9IE 1D9IA 2WV5A 3Q00A 1XVOA 2Z94A 1O38A 2FI4E 3KQDA 2V3HH 1SLVB 1W2KH 3QK1A 1O3JA 2GCTB 1CBWC 2VH0A 1ETRH 2O8TA 1YLCA 2G52A 2WYJA 4JYTA 4K8YA 5T6GA 3M7QA 5EGMA 1NM6A 1J17T 1SVPA 2A0QB 2K1QA 1ZR0A 3CS7A 3MH7A 1XKBC 1HYLA 1O2XA 3LGVA 4AG2A 1UJ1A 3P8FA 5IDKA 1O3AA 1MQ6A 2C8YB 3BG8A 1ELVA 4DGJA 4ESTE 5E2PA 1FY4A 1IHSH 1TRMA 1VITH 2GDEH 1FZZA 1NU7B 3LGWA 2P3TB 1HCGA 3KQCA 2ZGCA 4X2XA 1E36B 4X8SH 1D3DB 3TK5A 1P12E 2W3IA 3GCTF 3QZRA 1GI2A 1RIWC 1WAYB 1G32B 3MHWU 3M5OA 1SLUB 2FOEA 3O8CA 4ZAEA 1TNHA 5EPYA 1XUGA 3T62A 4WXVA 2OINA 1TRYA 3STIA 2AEIH 1EXFA 1F5LA 4CRGA 1SR5C 1AIXH 2O8WA 3MNCA 4FUHA 4NA8A 3RUOA 1P02A 4IS5A 1CO7E 4I33A 1G37A 5TCCA 3UFAA 2ZWLH 3A86A 1IQLA 1F0TA 2OQ5A 1GMHG 2Z3CA 1GCTC 1LVBA 3GY3A 1HNEE 3M3TA 4B1TA 2BY6X 1C5WB 5AFZH 1DWCH 1QTFA 2A7JA 1IQIA 1G2LA 4DOQA 1CA0B 4B73A 2J94A 3TH2H 2OLGA 3RLWH 5HYOA 2EI7A 5C5OA 4I31A 4CBOA 4JYVH 2HLCA 1Y5AT 3VEQB 2H2ZA 4Q7YA 3M3SA 1KYNA 4NA7A 3L33A 2P95A 2FOCA 1GCDA 3RMLH 2ALVA 1ELBA 4INKA 1O3KA 4X1RU 3UTUH 3BTME 5ABWA 3LGUA 1Y3XA 2Q1JA 2FODA 2BDIA 3QGNB 2FYQA 5F8XA 1OSSA 1MMJN 4CR9A 1CBWB 4IMQA 2THFB 1OWEA 2UUKB 1BCUH 2J9NA 4TWYA 3SNBA 2HNTC 1SGNE 3HATH 2D2DA 1IQGA 4D7GA 2XWBI 2AH4X 3E16B 1EZUC 2J92A 1AVWA 2WPIS 4BNRA 2VWNA 1HIAB 2GV7A 3QN7A 1QBVH 1TGSZ 1FAKH 3NPSA 4X6PA 2ZPQA 2CMYA 3RXIA 4X6MA 3GISB 2PKSB 2PWXA 4ABBA 2ANWA 2ZFSA 3LPRA 1DM4B 3M5NA 2SGFE 1AWFH 1NESE 1HDTH 1AY6H 1O3CA 2HGTH 3A80A 2XC5A 2FO9A 3S9CA 3QZQA 4NG9H 2FTMA 4K1SA 1BTHH 1G36A 1O2MA 5AHGH 2Y6TA 2AS9A 3SU2A 1IHTH 3C27B 5LPFA 2RA0A 4Y79A 3JZ1B 1MUEB 1EASA 1MAYA 3MNBA 2WPMS 2BDHA 4X1SU 1GI9B 3SV7A 4UFEH 5JYIA 3STJA 1QL8A 2J38A 1TLDA 3GCNA 4ZKOU 2TIOA 2ZU2A 3QO6A 2TGTA 4JZ1A 2A31A 4E7RG 1NFXA 2XBYA 5E0JA 1C1TA 1BIOA 1Y8TA 2BLVA 4OS2A 2XNIA 1H9HE 1K21H 1ELEE 1EB1H 2C90B 4UFFH 2ZU4A 1CT0E 1SOZA 4WMDA 1HAXB 1H8DH 6GCHF 4ZHMU 2FIRH 4IC6A 1NY22 3M36A 3FP7E 1THSH 2A5AA 2ULLA 1GBJA 1YPHE 4I8GA 3ELAH 4BAOB 1BHXF 1QB9A 1TAWA 1SHHB 2QXJA 1H4WA 4ABJA 1G9IE 4TY7A 2ZTXA 1KXFA 1DT2A 3A7WA 1SGEE 2CHAB 2ODPA 3ZVEA 1K1OA 1V2LT 1T32A 3VGCC 3M5LA 4DVAU 3T26A 1J14A 2BD2A 3P8OA 2BVSH 1ZMLA 1H1BA 1JIRA 3SUDA 1FPHH 2I6QA 4Q7XA 4WMFA 3F9GA 5SGAE 1B0FA 1YF4A 2ZP0H 1AZZA 1MZDA 1GGDC 4MTBA 2OC7A 1SGQE 3A8CA 3BEUA 4U32A 4I8LA 1SQAA 1SMFE 2HOBA 4A92A 2TGPZ 1UK4A 1C2HA 1O3MA 1SQTA 1SGFA 4GUXA 1NT1A 2A4OA 3RXSA 2QA9E 1C2LA 1T4VH 1OWJA 2V6NA 4AYYB 1TOCB 1P06A 2VVUA 3MH5A 5EOKA 1BHXB 1GJBB 3MI4A 1AQ7A 4NSYA 4X2WA 2BZAA 2BVXH 1NPMA 1DVAH 1QR3E 4YLQH 3P8GA 1HV7A 4O3TA 4Q2KA 1TONA 1EAWA 1C5UA 4I7YH 4HTCH 2NWNA 1DITH 1K22H 3MO3A 1YGCH 1MZAA 4YZUA 1S84A 1GBCA 2FDAA 4PROA 3Q76A 1IQNA 4AOQA 3SU6A 1TNIA 4ISHH 1SSXA 2R3YA 2EI6A 2WPJS 3ZZ7A 4ZXYH 5E8EH 1HB0B 1CSOE 2H9EH 3SJ8A 1O2KA 2AMDA 4NIYA 3QWCH 2TBSA 1QL7A 4MPVA 2QIQA 3AW1A 5ESBA 2BTCE 1A46H 2VVVA 1K2I1 4DY7B 4O9VA 3SNCA 3ITIA 3S7HB 1VITG 1C2MA 2UUFB 1C1NA 3RXEA 3NWUA 1C5ZB 4TY6A 2NU4E 3MWIU 1F7ZA 2TPIZ 1WQVH 2ZHDA 3PLBA 1AB9B 1FJSA 1TX6A 3A84A 1ZPCA 3RXRA 4CRDA 3KGPA 3NKKA 3VGCB 3E91A 4BAMB 2CV3A 3FZZA 1IQEA 2BLWA 3I29A 1DSTA 1KXAA 2DUCA 2TGDA 2ZG0H 1C1UH 3EAJA 3PROA 1GI8B 1L1NA 4H6SB 1A1RA 1Y5UT 1TBZH 4HFPB 1T4UH 1F5RA 3P17H 1S0QA 1MKWK 3P92A 1CHGA 2WPLS 3UNRA 5C20A 1YPJH 1ZOMA 3A89A 4UFDH 4ABHA 1ZTJA 3A83A 3SU5A 1JOUB 3B9FH 2GT8A 1UCYH 3D49H 1MTSA 3T25A 2G4UA 1CA8B 1WYKA 2FEQH 7LPRA 1K1MA 1PQAA 2SGQE 1AU8A 2DE9A 2H6MA 1LQDB 2CF9H 2FOFA 4TPIZ 1DY9A 3V12A 1BBRK 2EI8A 1ZGIA 1TFXA 4MPXA 5TJXA 2Z3DA 2QAAA 1P57B 4CREA 1MBQA 2LNCA 2WV4A 1MTVA 2BD3A 1FQ3A 1HJAB 3PLPA 1P2QA 1RS0A 2UUJB 4FVBA 5E2OA 4ZUHA 3GOVB 3MU5A 4OGXA 5FCKA 4X6OA 2PHBA 2ZU3A 3A7TA 7GCHF 1AE8H 1F92A 2BDYA 1PJPA 1PPFE 1EPTC
chains in the Genus database with same CATH superfamily
2RFKC 4MPUA 4HI3A 3LH1A 1KTSB 1DXWA 4K3JA 3SNEA 3TNTA 3BG4C 2YNAA 4R8TB 2ZHEH 1P2KA 4X1PU 1WV7H 4O03A 2KAIB 1V2UT 1YPHC 3K6ZA 3OTJE 2BDCA 2AIQA 3Q77A 1UVOA 4NZLA 3SV9A 5EJ1A 1V2VT 2KCAA 1O5DH 2Q6DA 3TPIZ 4B6EA 5GDSH 3RXPA 1KSNA 4X6NA 1T8OA 3GY6A 1GMCG 3HPTB 1VZQH 1XUIA 1F5KU 1GBIA 1W0YH 3E0PB 4E7NA 3D65E 1P3CA 4Y11E 4FUCA 2VU8E 2FOGA 4ISLA 2W7SA 3DCLA 1GJDB 5DO4H 2WPHS 1JIMA 2BVRH 1IQHA 1ID5H 2F9UA 4DIIH 1NRRH 2J97A 3LGIA 4JZFH 4D7FA 1LDTT 1CHOF 3N7EA 4FETA 1ZRKA 3LOXA 5HKKD 2O8MA 4YOJA 1WSSH 4ZHAA 4AC9A 3L6PA 1GHZA 1W7GH 4ZMAH 1C5RA 5KGOA 1ANCA 5K7RA 1OWHA 2VH6A 4UDWH 1O3OA 3Q3XA 1AVXA 1EOLA 2GCTC 1FPCH 1GHVH 3H7TA 1QJ1B 3PRBA 1Q31A 2B5TB 2VGCB 4JYUH 2BD7A 5LGOA 1NFUA 3A7VA 1ZHMA 1SGPE 3U1IB 5L2YH 4D9RA 2G4TA 4X2VA 3UNQA 1CT4E 1AKSB 4XFQA 2FZZA 3KIDU 1GVZA 1WCZA 3F0PA 1SL3A 3M3VA 4RT0A 1NN6A 4XOJA 1W11U 1SG8B 1J16A 1CGHA 3KNXA 1LKBA 1IQKA 3D62A 1IQJA 2BYAX 3TJNA 1VR1H 4WVPE 2D26C 1V2KT 1HJ9A 1MAXA 1UTNA 1ZHPA 2BY7X 1XXFA 3OX7U 1TPPA 2V7QD 1AMHA 3OE7D 3TJUA 2VVCA 3RC5A 3M61U 2B0FA 5GCHG 3SN8A 1V2RT 1BA8B 1EATA 1YLDA 3SHAH 4U30A 1C9TA 2R3UA 1WU1A 8GCHF 1AWHB 1OYTH 2J4IA 1U6QA 2Q6FA 4A6LA 2VJ1A 2P8OB 1QQUA 5EQQA 3DUXH 4H42U 1XM1A 4CRAA 1GI7B 5DPAA 1RRKA 3ESTA 4ISOA 2QXHA 4KKDA 1BTPA 3H5CB 2V35A 3MU4A 1DICA 1VJ9U 1PPBH 4JK6A 1QRXA 2PKAA 2BY9X 4YO9A 1A3EH 3LKWA 3RXTA 1TE0A 1BRAA 1UTLM 2LELA 1MQ5A 2ZFPH 1ZJKA 2ZECA 5HIZA 2XW9A 2P3UB 1ELDE 2QCYA 2F91A 2P16A 5EU8A 1QA7A 2ZGJA 1KMHB 4YM9A 1SB1H 3SV8A 2QF0A 1TNKA 4O3UA 1A5HA 1O2GH 1MD8A 1DANH 2SGDE 4WXIA 1GJAB 2OBQA 3MFJA 1GBFA 3MH6A 3MYWA 3M35A 3WY8A 4NGAH 1HAIH 2WZQA 4R0IA 2ZFFH 2ZPSA 1C2IA 1GJ7B 1V2OT 2JH6D 1F0SA 1Y3UA 3SJIA 2KR7A 1O3PB 1W3CA 1BTUA 5DJ7A 2PW8H 1ZRBA 4YOIA 4FUEA 3U9AH 1W0KD 4MLFB 4CHAB 2RG3A 2PTNA 1ZMJA 3SU0A 2BZ6H 5EODA 2HRVA 1E34B 1GVKB 4CH8B 1JRSA 1Y3VA 2ODYB 3TIUA 1C9PA 2D1JA 3BTHE 6LPRA 1P9UA 1Z7KA 3T2NA 3GCTG 2PKSC 1TMTH 1BMAA 1GBKA 2J34A 1H8ED 2ZGXH 3URCA 1F0UA 1BOQA 2GKVE 3A82A 4Y8ZA 4BTTB 1O2QA 3O8RA 1W13U 2AERH 3BF6H 2JJ1D 1D3TB 1T31A 5FX5A 4AFSA 3LJJA 1V2PT 5F8TA 2FPZA 5G4BA 4GHTA 1ZTLA 4ZKSU 2FP7B 1NTPA 5HGGA 2YMSC 4RSPA 4BAQB 4KP0A 2IJD1 1O3DA 1GHAG 3GY2A 1BT7A 2J98B 4GCHF 1XKAC 3ZZ8A 2PSYA 2IOTA 4A5TS 2RDLA 6ESTA 2QYIA 3A8AA 4OS4A 2OC0A 3RXLA 2RA3A 1ABJH 3T27A 3FOAA 4OS7A 1LVOA 1K1LA 1QA0A 1D3QB 1SPJA 4F49A 1NFYA 2GV6A 1Z71A 4CRFA 4MNWA 2Y7ZA 1CE5A 2OC8A 2ZQ1A 3UQOA 6CHAC 4Y8XA 1C1QA 1KIGH 2ILNA 1Q3XA 1C1OA 3A87A 1Z8IB 3NRLA 4MVNA 1A0LA 3QDZB 2PP6A 5DP8A 4UONA 2BX3A 1YBWA 3CENA 3PMAB 1VJAU 3B8JA 2W3KA 1S82A 2Y7XA 1K1IA 1W14U 5EQSA 2BD4A 4X8TH 2Y82A 3OAAD 3O8DA 1BB0B 4WWYA 4NSVA 2ZCKP 1UTKA 2GZ9A 3EGKH 1Y3YA 1YCPH 1Z6EA 1LQEA 4BOHA 4ABDA 1BMLA 3E1XB 2K0QA 3V3MA 2VNTA 1CU1A 1O0DH 3GY8A 4NA9H 1TX7A 1LMWB 1UHBB 1V2ST 3BSQA 2R2WU 1BBRE 1TIOA 3TJOA 5FPSA 2ZHWH 3MOCA 3RLYH 1S0RA 3SJ9A 2CHAC 1VKYA 2FLRH 4NZQA 1O30A 1O3BA 1BQYA 3F2HA 3PV5A 3UR9A 3E0NB 2ZQ2A 3W94A 1TMUH 4Y0YE 4DT4A 4K1EA 1ARCA 4FU9A 1T7CA 4DT7B 1EPTA 1FONA 4A7IB 1FAXA 2ZCLP 1GHXH 5JB9S 3HGNA 1C1RA 3KEEA 2CF8H 5EXNA 2XBXA 2BD9A 3L3TA 1BRUP 1E38B 1C1SA 1GJ5H 3SI4H 2L74A 1J9CH 4B6FA 3ZZ3A 2XCNA 2FM2A 4NWKA 1E79D 3EYDA 1NRQH 2ZI2H 3U8OH 2QN5T 5DP3A 4K2YA 5PTPA 3ZYDA 1C2EA 1DXPA 3HKJB 1UK3A 1YPEH 1PYTC 2OXSA 3S0NA 3FP8E 2ZA5A 1QNJA 2O8LA 1EB2A 1G3CA 3DHKH 3R0FA 1BTYA 1UVPA 8KME2 2UWLA 1CGIE 2ZU5A 1YPKH 3C1KA 1GG6C 3F9HA 2JH5D 2G81E 2XCFA 3QTOH 6CHAB 1O36A 2Y5GA 5A8YA 2VINA 1KLIH 3BTFE 5HXFA 1MTNC 2C8XB 3QUMP 2HPPH 1DY8A 2YOLA 1W12U 1ELAA 1GDNA 1GDQA 2ANKH 3I77A 1O3NA 2DE8A 1UVTH 1ANBA 2G8TA 1EJAA 3PWBA 1BZXE 1KDQB 3F6UH 5J4SA 3PRDA 6GCHG 2ZNKH 2VWOA 3GY4A 3SHCH 4Z1MD 5EJZA 2Z9KA 3DSPA 3RXKA 1BMFD 2AYWA 5C0UA 1A0HB 2BX4A 1XVMA 3VB5A 1HRTH 1Z6JH 1TPOA 1L4DA 2P3FH 3TGIE 2ZPRA 3OY5U 5FBEA 3F3BA 5H4IB 2ZGHA 3OY6U 2ODQA 5FBIA 2OUAA 3SBKA 3OEHD 1DWEH 3EQ0H 1AB9C 1NRNH 2KM0A 4WJG2 1ANEA 2SNVA 4ZKRU 1ABIH 1C2DA 1SFQB 1LKAA 3BIVH 1UVUH 5FCRA 4Q63A 1Y59T 1XUFA 1B5GH 1NBME 5T6FA 5JDUB 3GS9A 1O2NA 3ZIAD 1KXCA 2F4LA 3UWIA 4KTSA 2A5KA 4IMZA 1THPB 3KYGA 4MPWA 5I46H 1O2IA 4YXWD 4AB8A 2F9PA 1FIZA 1EP5A 1QHRB 2FS8A 2XC0A 2JJ2D 3RM0H 3R3GB 1LHGH 2A7CA 1GBBA 2Z9JA 3ZVBA 1FY8E 5GWZA 5A0BA 4NFFA 1HAVB 9LPRA 1P3EA 1C2JA 1TQ7B 1BTXA 1OP0A 1C5QA 3VPKA 3LU9B 4A1VA 1A4WH 3PO1B 2BQWB 3SQHE 3V13A 1HGTH 1Y5BT 1WXRA 1GG6B 3DSGA 2FMJA 1HJAC 2BDBA 1C5OH 1HXEH 3AW0A 4AB9A 1DWDH 4BTUB 3LC3A 1MTNB 5LPRA 1ESBA 3A7ZA 2QF3A 4Q4LA 2BQ7B 1O3GA 1L2EA 2PTCE 3F2FA 1ZPZA 1KLTA 3Q3KA 5DP5A 2LPRA 1P8VC 4Y0ZE 2FYRA 4ASHA 3UPEA 1Z1IA 4FXGH 2UWOA 2GCHF 4Z0KA 1P2OA 4GVUA 3P8NA 4FU8A 3E90B 4Q7ZA 2XBWA 1J8AA 4GLYA 1MABB 2ZDVH 4YLUA 1M9UA 5BPEA 3F68H 5DN6D 5A0AE 1O5CB 1GBTA 4U2WA 3RC4A 3BTDE 1OKXA 1TGCA 1GBDA 1EP6A 1O5AB 2BD8A 2FOAA 4MNVA 4WH8A 1HUTH 1XMNB 3LT3A 1C5LH 1F2SE 3LC5A 1UMAH 1O5BB 5A2MH 1ELCA 3ZZ9A 1TPSA 5JB8S 1HIAA 3DSOA 3NZIA 2VIVA 1A3BH 3SGQE 2VIPA 2QE7D 3H09A 1SGDE 5C1UA 4XBDA 1WQSA 5T3HA 2CGAA 1O5EH 1KXEA 1NO9H 2ZDMA 2PFEA 1ZSJA 4AFZA 3SV6A 1VITF 3GCOA 1COWD 1JXPA 2WV9A 1MU6B 3ATMA 3UOUA 1GBAA 3K9XB 3K6YA 1QRWA 3SUGA 1IQMA 2Z3EA 3VXEH 1WTGH 3SNDA 3RP2A 2ZZUH 1BITA 3UWJH 3VB4A 4AGKA 3TU7H 2PUQH 5HM9A 1HJ8A 1SQOA 2PSXA 1X7AC 3T28A 1TRNA 4JZEH 3ZVDA 1TB6H 2V0BA 2VGCC 1EX3A 1EUFA 3MMGA 1S6HA 3NK8A 3LJOA 1SBWA 5I25A 2VIDA 5FPTA 4Y71A 1QRZA 1LPZB 2F9BH 1O2RA 1TQ0B 1ZTKA 9ESTA 1EZXC 1P0SH 3BN9A 5FX6A 1YPMH 4UD9H 2ASUB 5K0HA 1QBNA 3RMMH 4X8VH 3FZDA 7GCHG 1BJUA 2WPKS 3PMBB 1E0FD 2F83A 5C94A 5EG4A 1CT2E 3TLOA 2V3OH 2AGGX 1F0RA 5CHAB 1ZJDA 4WMEA 3BTTE 1OX1A 4B74A 1SI5H 2XBVA 2EEKA 2BQ6B 1NROH 2BLQA 1NS3A 1VCWA 4K69A 3MNXA 1AUTC 1C5VA 5L2ZH 1EKBB 1LHEH 3CS0A 4AZ2B 3FO8D 3OFND 1DLEA 1P2NA 3ZYEA 2A2QH 2BB4A 2YMSD 3PYHA 4E05H 1ESTA 5CMXH 1V6DA 1GMDF 1IAUA 2GZ7A 2P8OC 5CE1A 1C2GA 2OD3B 5KECA 4FUDA 1ZSKA 4LZ4B 1HXFH 1A5IA 1DX5M 1O3LA 4WY3A 2IJOB 2UUYA 4LK4A 3RXAA 1MH0A 2P94A 3MU0A 4FUIA 5J4QA 4ISIH 1QIXB 4DCDA 2KCPA 1L0ZA 1KLJH 2VIQA 1TNJA 1UCYE 1JWTA 1QJ7B 2V3MA 1GHBF 3WWFA 2PGQB 3ZV9A 1MCTA 1C2FA 3SNAA 4Q80A 4K5ZA 3GYLB 3VB7A 2HVXA 3ATLA 4MDSA 5E0GA 1L1JA 4B2CA 3MO6A 3K2UA 1MU8B 2ANMH 1GBHA 1O2WA 1MTWA 2CN0H 4ABGA 2GJGA 1AN1E 1GI0A 1SFIA 1EOJA 1GMCF 2B9LA 2BOHB 2C4FH 2J95A 1T8LA 2TGAA 1O2PA 2FESH 1O2HA 1K1JA 2A5IA 2SFAA 3P6ZB 3MNSA 4RI0A 1N8OC 1E37B 1C1VH 3RMNH 4FUBA 1ZLRA 4OS6A 3LH3A 1DS2E 3SU1A 4GHQA 3DFJA 1A0JA 1A61H 1K1NA 2AMPA 1GBMA 3HK6B 2ZC9H 1GBEA 3TH3H 1MTUA 2PV9B 4CHAC 3A88A 1EZQA 2A4GA 2GX4A 3KCGH 1C5PA 5FAHA 1KXDA 1O3EA 1CQQA 4IW4E 3U98H 3BEFB 1L4ZA 1EJMA 1DPOA 2VWMA 3SJKA 3FVFB 1N6XA 1OS8A 1W8BH 5HM2A 1QY6A 5LH8A 1FMGA 1FXYA 2ZU1A 3E3TA 1HAYB 1UTPA 1V2NT 2HNTE 1FN8A 1W0ZU 3GCHB 4TYDA 3EA8A 1H8IH 2F9OA 3S9AA 1AHTH 2SGEE 1E1QD 1C5SA 1B0EA 1O39A 4RKOB 1TWXB 2KX4A 4VGCB 1HPGA 1S81A 4AG1A 3BV9B 2B7DH 2QGRA 3H7OA 3GDSA 3EA9A 2F43B 1T8MA 2ALPA 1C4V2 1PYTD 2AGIX 4CRBA 5L6NH 4Y7BA 4GSOA 1O2LA 1RJXB 4O97A 4ABAA 1P9SA 1V2QT 2AHME 3B23B 3AK5A 4RN6A 3RXBA 4WF8A 2EA3A 2OCVB 5C1XA 2RCEA 1SGIB 1W0JD 3TGJE 1CGJE 1PPZA 1YKTA 3U8TH 1QL9A 4IN2A 3SOSA 2ZFTA 2JETB 3A81A 1JMOH 3N7OA 4ZH8A 1TPAE 4ABEA 2OP9A 1OPHB 1ZSLA 5ESTE 2C93B 4KGAA 2TRMA 2Y5HA 3ATWA 1GI4A 5FPYA 1PPEE 2A45B 3VB6A 2ZDLA 4LZ1H 4DJZB 3O8BA 2HPQH 1HAHH 3ZZ4A 1O2JA 4A1TA 5IYTA 2ESTE 4X1QU 1YC0A 3FAOA 3KQBA 1C1PA 2W7UA 5GNDA 1WOFA 2XRCA 1P05A 1N8OB 3GY7A 1O2OA 1UTMA 1YPLH 2NU3E 5B6OA 2ZTZA 5F03A 1C2KA 1XX9A 3RU4E 3ZV8A 1GJ8B 2XWAA 3M5MA 3A8DA 3RMOH 1QZ8A 2OQUA 2FX4A 4ZCNA 1GI6A 4HG6A 1LHFH 2BMGB 4WH6A 3RC6A 2A7HA 1AFQB 3BTGE 3SGAE 1UTOA 1V3XA 1S5SA 4Y6DA 1HBTH 4DG4A 1TA6A 5F6MA 3A8BA 1C5TA 1RXPA 1MCVA 1PQ7A 4SGAE 5T1VA 1BTWA 3KF2A 4ISNA 3OSYA 2HVYB 1QBOA 4YT7H 1XUKA 5FHTA 1MKWH 1A2CH 3TH4H 1C5MD 5A0CA 2KAIA 2GVFA 4ACAA 1JBUH 2GT7A 2WINI 4GCHG 1Z8JB 4XBBA 2C8WB 2WUCA 4AX9H 5C5NA 3ZVAA 8LPRA 4FU7A 3SI3H 1UW7A 3UIRA 5JBCS 4JZDH 1SGRE 4I8JA 3TNSA 3RXHA 1OWDA 1P04A 1O3IA 1BDAA 1O2ZA 3QGJA 2D8WA 2GMTC 5HIYA 3TITA 2ZHFH 4AGJA 5EIYA 1BBRH 3SZNA 3DD2H 3UNSA 2BY8X 1HAZB 1P2IA 3BTKE 4XD7D 2F3CE 1QB1A 4YESB 1D3PB 2GZ8A 4X2YA 1GHAF 1SGCA 3AASA 3M7TA 3MO9A 3ZZBA 4KTCA 1AGJA 2BD5A 1LO6A 3PV2A 1HAGE 4H4FA 4MNYA 2Q6GA 1GMHF 5EQRA 2BDAA 2FLBH 3UR6A 1V2MT 1WUNH 1C4Y2 3SQEE 1D4PB 1WDIA 3FKSD 1QQ4A 2QXGA 1GPZA 2IPHA 1TOMH 1EAIA 2EQNA 4TWWA 4ZROA 3OTPA 4QT8C 1TX8A 1C5NH 1SHYA 1P01A 2R0KA 1KXBA 2NU1E 4ACBA 1AE5A 1WBGB 1TGTA 1AKSA 5C2ZA 1UCYK 4NIWA 1SGYE 3BTQE 5GJ4B 3RDZA 3TVJB 2W6ID 1EQ9A 3SU3A 3RXFA 1LPKB 5DP7A 5DP6A 3ODDA 3UQVA 3ZZCA 5GXPA 3F9FA 3U28C 1HAOH 1VCPA 1BUIA 4H6TA 1P2MA 3FN8A 2XC4A 4ABIA 1AO5A 1XUHA 4TT3D 4Z6AH 3P95A 1TBQH 4F48B 1O37A 3M37A 1UVSH 1NRPH 1GDUA 3SO3A 5EJLA 1RTKA 3OU0A 2F9NA 1AVGH 1ETSH 1OHHD 1PPGE 1D6WA 3SU4A 3TGKE 2H1UA 3RXCA 3GDUA 1IOEA 2G5NA 4B76A 1ELFA 2YNBA 2PUXB 3VG8A 1ZYOA 4YOGA 2NU2E 5AFYH 1B7XB 1GVLA 1EAUA 1RIWB 2A1DB 2FWWA 4UEHH 1W7XH 2GMTB 2FTLE 3V0XA 4INLA 2STBE 3MH4A 1O32A 2K8IA 4SGBE 3PO1C 4JCNA 4Y7AA 1FDPA 1O35A 1WTHD 1XXDA 3LONA 2I6SA 3QTVH 1V2JT 2HWLB 2ZO3H 1W10U 2HNTF 1AD8H 2H9TH 3W95A 4BAHB 1JRTA 2A32A 3TK6A 2BXUH 1A7SA 3IWMA 3KHVA 3VXFH 1TGBA 1DE7H 3URDA 2H9HA 4MG3A 2KFWA 1P2JA 1GWAA 3PTBA 1GCTB 1FI8A 1O31A 3IG6B 3ZZ5A 3E6PH 1OOKB 1H9LB 3N7DA 2J5UA 4X1NU 3RXMA 1KY9A 1AZ8A 1E1RD 2ZDNA 1EZSC 3KYFA 1ZPBA 1O5FH 1QURH 3HGPA 2G51A 3DFLA 2VWLA 2VIOA 1S6LA 5T6DA 4ABFA 1NZQH 3S9BA 3V7TA 1FY3A 1O3FA 4MQAA 3P70B 1N1LA 2M2AA 2XNDD 1SLXB 3DA9B 1TNLA 3GYMA 3KQ5A 2JKHA 3ATIA 1V2TT 1INCA 3RXQA 3NCLA 3FP6E 3ZZAA 1ZZZA 1K1PA 1O2TA 3I78A 3A85A 5EXMA 2OBOA 5TCAA 3EE0B 1NBMD 2VBCA 3GY5A 1HFDA 1YPGH 2CJIA 4MNXA 4IC5A 2ZKSA 2ZTYA 4YT6H 3SW2B 3WWBA 3GICB 4ZHLU 3LIWA 3MU1A 4YTAA 2P59A 5A8ZA 1O2UA 2FS9A 2BXTH 3SGBE 2GTBA 3PWCA 4OGYA 1QJ6B 3LDXH 3ZVCA 1UTJA 4KELA 5DP4A 3MTYA 2A4RA 4XDEA 2OTVA 5JBBS 1QFKH 1ELGA 2F9VA 4GPGA 2SGAA 1O2VA 1ESAA 1Y3WA 2B8OH 3F9EA 2P93A 1GHYH 4BAKB 4FUFA 4XSKU 2BOKA 3NUMA 4M7GA 2CXVA 1Z1JA 4JZIA 3RU4T 2Z7FE 1RGQA 3RXJA 5A8XA 2OC1A 1VGCC 2PGBB 2VB0A 1SLWB 4OS5A 1MKXK 2KCOA 4RKJB 1O2SA 1C5XB 2FOHA 4KTUA 2WSSD 4TPYA 1TGNA 1DUEA 3Q3YA 4D76A 3NXPA 1AI8H 2H5CA 1OP2A 3F2GA 3LGTA 1BTZA 2Z9GA 4K8BA 5CHAC 3QLPH 2QF5A 3EDXB 1TYNA 2GDDA 4IBLH 1O2YA 1LTOA 3K65B 2GCHG 1BRBE 2AIPA 3ENSB 1BJVA 2FOBA 1P11E 3G01A 4AFUA 1AFEH 3ATKA 1SC8U 3PLKA 2IN2A 1GJ6A 5C3NA 1K9OE 4B75A 3A7XA 5AF9H 2RDEA 3F0OA 2PLXA 3ZZDA 1ETTH 1THRH 1NRSH 4Y8YA 1C1MA 2QC2A 1PPHE 5F8ZA 3RXUA 2GD4B 1UHBA 1D6RA 7ESTE 4ZXXH 1G3BA 2R0LA 2GGVB 1N6YA 3F1SB 1OP8A 1T8NA 2Y5FA 2J2UA 4FUGA 1ANDA 5GIBA 3RXOA 1P10A 4JK5A 4BXWA 2C8ZB 4HGCA 2EC9H 1PQ8A 2O9QA 5EW1H 1ACBE 4E06H 5C17A 2HLDD 5DGJA 1EAXA 3SV2H 4I32A 4P02A 2VIWA 1HLTH 2PKAB 4M9FA 4UFGH 5DSFA 2SNWA 4FVDA 3S69A 5EW2H 3GDVA 2ZIQH 3RXDA 5LPEA 1C5YB 4GAWA 2A4QA 2PR3A 1DLKB 1EJNA 4IN1A 3ZVFA 2G5VA 4FUJA 5A09A 4I86A 3JZ2B 2WUBA 2FOMB 1G3EA 2XYAA 1O34A 4I8HA 2FXRA 1LPGB 2Z9IA 1GGDB 1C4U2 3KN2A 2JIZD 1Q2WA 1OWKA 1GI3A 3T29A 4D8NA 4B2BA 2ZGBH 3UY9A 2ZF0H 4XE4A 4CRCA 3BTEE 1LVYA 1VGCB 3UOPA 3ZVGA 3RXVA 3AAVA 2ZHQH 1G30B 4B71A 2FI5E 2XXLA 1P03A 2R2MB 1IQFA 1TALA 4K1TA 3ZZ6A 1LHCH 3HK3B 1OXGA 1PFXC 4J1YA 5L30H 3PMHB 2FI3E 1MBMA 5C1YA 5DKMA 1SGTA 1DWBH 1VCQA 3QX5H 1TABE 1KDQA 1TA2A 3SYJA 2JH0D 1QGFA 1ZGVA 3GCHC 4CBNA 3PM3A 1DOJA 5C0TA 2G00A 2ANYA 1KTTB 4AORA 3AVZA 3FFGA 2XTTB 1RTLA 4NCYA 3TK9A 3PTNA 3M7UA 4VGCC 1GMDG 2AGEX 3E8LA 4X0WU 1DUAA 1FY5A 3CNRA 1ZHRA 2G55A 4BTIB 2AMQA 3CP7A 3N99A 4OS1A 1BRCE 1FNIA 1LHDH 1UO6A 3LGYA 2NU0E 2ZFRH 1GHBG 1O3HA 3SUEA 1C1WH 1FIWA 1FV9A 1YCPK 2ZEBA 4AYVB 1Z8RA 1YM0A 4P00A 4NFEA 1QB6A 4THNH 3EE7A 2HALA 1CHOG 1FY1A 2JETC 1K28D 2O8UA 4UE7H 3EA7A 4JMYA 4K60A 3W1EA 4J2YB 1DSUA 4D9QA 3BTWE 1ARBA 8ESTE 3RM2H 5E0HA 4X8UH 5ETXA 2STAE 1TMBH 4U01A 1SOTA 1MD7A 4DIHH 1RTFB 4XRNA 1GHWH 1PQ5A 1V2WT 5F53A 1NU9A 3S7KB 2WPDD 1DDJA 1HAVA 1PPCE 4HZHA 1GI5A 1NFWA 1GJ9B 1O5GH 1GJCB 1CVWH 4A1XA 2ZDKA 4ZKNU 2Y81A 1YWUA 1GI1A 5DG6A 5B6LA 3D23A 3T5FH 2ZCHP 4AFQA 2BM2A 3UREA 5GPIB 1AFQC 2QXIA 3PMJA 4NWLA 2QY0B 4LOYH 5C67A 1QCPA 5BRRE 3U8RH 2WYGA 3IITA 3FANA 1FLEE 2KZ4A 1NC6A 4DW2U 3U69H 1XUJA 1ZMNA 1S6FA 4LXBH 2GP9B 1GBLA 5DP9A 3KL6A 8GCHG 5CDFE 4CR5A 5EXLA 1GL1A 3RXGA 1UK2A 1P09A 4NIVA 2ZFQH 3VB3A 1Z8GA 1LVMA 2AFQB 1O33A 1DFPA 4DURA 2FX6A 1EPTB 1S83A 5AVDA 3SJOA 1RFNA 4BANB 2W5EA 3UAIC 3TJVA 3BG4B 3A7YA 2Z6BD 3PB1E 1GL0E 3MU8A 1BMNH 3WW7A 1L1GA 4B2AA 2BHGA 4BXSA 2C3SA 2A2XH 1GJ4H 3PV4A 5GCHF 1MKXH 1G3DA 1RD3B 1TBRH 4XBCA 4CH2B 3DT0H 1BMMH 4AN7A 2BLOA 3VFEA 3OYPA 1YYY1 4IGDA 5FL7D 1LCYA 1J15A 3UUZA 2W26A 2H5DA 4ASUD 1YP9A 1G2MA 3U1JB 5HMAA 2SGPE 2UWPA 3ODFA 1AUJA 5DK1A 5JBTA 1E35B 1OWIA 1HAPH 1TNGA 1UTQA 2QV1A 5JPMH 2ZDAH 2Z9LA 4NIXA 1S85A 4I8KA 1FN6A 5FXLA 1CA0C 5CHBA 3BIUH 1YCPM 1ORFA 4F4OC 1FUJA 2BDGA 4Y10E 2Y80A 2BY5X 1OYQA 3HKIB 4INHA 5JBAS 4Y76A 1A5GH 3SUFA 1ELTA 3SORA 5EPNA 3KQEA 1SGFG 2R9PA 7KMEH 3RU4D 3BEIB 2M5TA 3AAUA 1H9IE 1D9IA 2WV5A 3Q00A 1XVOA 2Z94A 1O38A 2FI4E 3KQDA 2V3HH 1SLVB 1W2KH 3QK1A 1O3JA 2GCTB 1CBWC 2VH0A 1ETRH 2O8TA 1YLCA 2G52A 2WYJA 4JYTA 4K8YA 5T6GA 3M7QA 5EGMA 1NM6A 1J17T 1SVPA 2A0QB 2K1QA 1ZR0A 3CS7A 3MH7A 1XKBC 1HYLA 1O2XA 3LGVA 4AG2A 1UJ1A 3P8FA 5IDKA 1O3AA 5KEDA 1MQ6A 2C8YB 3BG8A 1ELVA 4DGJA 4ESTE 5E2PA 1FY4A 1IHSH 1TRMA 3SZEA 1VITH 2GDEH 1FZZA 1NU7B 3LGWA 2P3TB 1HCGA 3KQCA 2ZGCA 4X2XA 1E36B 4X8SH 1D3DB 3TK5A 1P12E 2W3IA 3GCTF 3QZRA 1GI2A 1RIWC 1WAYB 1G32B 3MHWU 3M5OA 1SLUB 2FOEA 3O8CA 4ZAEA 1TNHA 5EPYA 1XUGA 3T62A 4WXVA 2OINA 1TRYA 3STIA 2AEIH 1EXFA 1F5LA 4CRGA 1SR5C 1AIXH 2O8WA 3MNCA 4FUHA 4NA8A 3RUOA 1P02A 4IS5A 1CO7E 4I33A 1G37A 1SKYE 5TCCA 3UFAA 2ZWLH 3A86A 1IQLA 1F0TA 2OQ5A 2OK5A 1GMHG 2Z3CA 4FOUC 1GCTC 1LVBA 3GY3A 1HNEE 3M3TA 4B1TA 2BY6X 1C5WB 5AFZH 1DWCH 1QTFA 2A7JA 1IQIA 1G2LA 4DOQA 1CA0B 4B73A 2J94A 3TH2H 2OLGA 3RLWH 5HYOA 2EI7A 5C5OA 4I31A 4OM9A 4CBOA 1H8HD 4JYVH 2HLCA 1Y5AT 3VEQB 2H2ZA 4Q7YA 3M3SA 1KYNA 4NA7A 3L33A 2P95A 2FOCA 1GCDA 3RMLH 2ALVA 1ELBA 4INKA 1O3KA 4X1RU 3UTUH 3BTME 5ABWA 3LGUA 1Y3XA 2Q1JA 2FODA 2BDIA 3QGNB 2FYQA 5F8XA 1OSSA 1MMJN 4CR9A 1CBWB 4IMQA 2THFB 1OWEA 2UUKB 1YY3A 1BCUH 2J9NA 4TWYA 3SNBA 1SQRA 2HNTC 1SGNE 3HATH 2D2DA 1IQGA 4D7GA 2XWBI 2AH4X 3E16B 1EZUC 3OEED 2J92A 1AVWA 2WPIS 4BNRA 2VWNA 1HIAB 1K0HA 2GV7A 3QN7A 1QBVH 1TGSZ 1FAKH 3NPSA 4X6PA 2ZPQA 2CMYA 3RXIA 4X6MA 3GISB 2PKSB 2PWXA 4ABBA 2ANWA 2ZFSA 3LPRA 1DM4B 3M5NA 2SGFE 1AWFH 1NESE 1HDTH 1AY6H 1O3CA 2HGTH 3A80A 2XC5A 2FO9A 3S9CA 2YMSB 3QZQA 4NG9H 2FTMA 4K1SA 1BTHH 1G36A 1O2MA 5AHGH 2Y6TA 2AS9A 3SU2A 1IHTH 3C27B 5LPFA 2RA0A 4Y79A 3JZ1B 1MUEB 1EASA 1EFRD 1MAYA 3MNBA 2WPMS 2BDHA 4X1SU 1GI9B 3SV7A 4UFEH 5JYIA 3STJA 2W6JD 1QL8A 2J38A 1TLDA 3GCNA 4ZKOU 2TIOA 2ZU2A 3QO6A 2TGTA 4JZ1A 2A31A 4E7RG 1NFXA 2XBYA 5E0JA 1C1TA 2CK3D 1BIOA 1Y8TA 2BLVA 4OS2A 2XNIA 1H9HE 1K21H 1ELEE 1EB1H 2C90B 4UFFH 1FX0B 2ZU4A 1CT0E 1SOZA 3UB0A 4WMDA 1HAXB 1H8DH 6GCHF 4ZHMU 2FIRH 2KCYA 2LP6A 4IC6A 1NY22 3M36A 3FP7E 1THSH 2A5AA 2L6OA 2ULLA 1GBJA 1YPHE 4I8GA 3ELAH 4BAOB 1BHXF 1QB9A 1TAWA 1SHHB 2QXJA 1H4WA 4ABJA 1G9IE 4TY7A 2ZTXA 1KXFA 1DT2A 3A7WA 1SGEE 2CHAB 2ODPA 3ZVEA 1K1OA 1V2LT 1T32A 3VGCC 3M5LA 4DVAU 3T26A 1J14A 2BD2A 3P8OA 2BVSH 1ZMLA 1H1BA 1JIRA 3SUDA 1FPHH 2I6QA 4Q7XA 2J98A 4WMFA 3F9GA 5SGAE 1B0FA 1YF4A 2ZP0H 1AZZA 1MZDA 1GGDC 4MTBA 2OC7A 1SGQE 3A8CA 3MQKC 3BEUA 4U32A 4I8LA 1SQAA 1SMFE 2HOBA 4A92A 2TGPZ 1UK4A 1C2HA 1O3MA 1SQTA 1SGFA 4GUXA 1NT1A 2A4OA 3RXSA 2QA9E 1C2LA 1T4VH 1OWJA 2V6NA 4AYYB 1TOCB 1P06A 2VVUA 3MH5A 5EOKA 1BHXB 1GJBB 3MI4A 1AQ7A 4NSYA 4X2WA 2BZAA 2BVXH 1NPMA 1DVAH 1QR3E 4YLQH 3P8GA 1HV7A 2JDID 4O3TA 4Q2KA 1TONA 1EAWA 1C5UA 4I7YH 4HTCH 2NWNA 1DITH 1K22H 2XOKD 3MO3A 1YGCH 1MZAA 4YZUA 1S84A 1GBCA 2FDAA 4PROA 3Q76A 1IQNA 4AOQA 3SU6A 1TNIA 4ISHH 1SSXA 2R3YA 2EI6A 2WPJS 3ZZ7A 4ZXYH 5E8EH 1HB0B 1CSOE 2H9EH 4F55A 3SJ8A 1O2KA 2AMDA 4NIYA 3QWCH 2TBSA 1QL7A 4MPVA 2QIQA 3AW1A 5ESBA 2BTCE 1A46H 2VVVA 1K2I1 4DY7B 4O9VA 3SNCA 3ITIA 3S7HB 1VITG 1C2MA 2UUFB 1C1NA 3RXEA 1YLNA 3NWUA 1C5ZB 4TY6A 2WHXA 2NU4E 3MWIU 1F7ZA 2TPIZ 1WQVH 2ZHDA 3PLBA 1AB9B 1FJSA 1TX6A 3A84A 1ZPCA 3RXRA 4CRDA 3KGPA 3NKKA 3VGCB 3E91A 4BAMB 2EY4C 2CV3A 3FZZA 1IQEA 2BLWA 3I29A 1DSTA 1KXAA 2DUCA 2TGDA 2ZG0H 1C1UH 3EAJA 3PROA 1GI8B 1L1NA 4H6SB 1A1RA 1Y5UT 1TBZH 4RT1A 4HFPB 1T4UH 1F5RA 3P17H 1S0QA 1MKWK 3P92A 1CHGA 2WPLS 3UNRA 5C20A 1YPJH 1ZOMA 3A89A 4UFDH 4ABHA 1ZTJA 5IK2D 3A83A 3SU5A 1JOUB 3B9FH 2GT8A 1UCYH 3D49H 1MTSA 3T25A 2G4UA 1CA8B 1WYKA 2FEQH 7LPRA 1K1MA 1PQAA 4TSFD 2SGQE 1AU8A 2DE9A 2H6MA 1LQDB 2CF9H 2FOFA 4TPIZ 1DY9A 3V12A 1BBRK 2EI8A 1ZGIA 1TFXA 4MPXA 5TJXA 2Z3DA 2QAAA 1P57B 4CREA 1MBQA 2QF4A 2LNCA 2WV4A 1MTVA 2BD3A 1FQ3A 1HJAB 3PLPA 1P2QA 1RS0A 2UUJB 4FVBA 5E2OA 4ZUHA 3GOVB 3MU5A 4OGXA 5FCKA 4X6OA 2PHBA 2ZU3A 3A7TA 7GCHF 2IPQX 1AE8H 1F92A 2BDYA 1PJPA 1PPFE 1EPTC
chains in the Genus database with same CATH topology
4MPUA 4HI3A 3LH1A 1KTSB 1DXWA 4K3JA 3SNEA 3TNTA 3BG4C 2YNAA 4R8TB 2ZHEH 1P2KA 4X1PU 1WV7H 4O03A 2KAIB 1V2UT 1YPHC 3K6ZA 3OTJE 2BDCA 2AIQA 3Q77A 1UVOA 4NZLA 3SV9A 1V2VT 1O5DH 2Q6DA 3TPIZ 5GDSH 3RXPA 1KSNA 4X6NA 1T8OA 3GY6A 1GMCG 3HPTB 1VZQH 1XUIA 1F5KU 1GBIA 1W0YH 3E0PB 4E7NA 3D65E 1P3CA 4Y11E 4FUCA 2VU8E 2FOGA 4ISLA 2W7SA 1GJDB 5DO4H 2WPHS 1JIMA 2BVRH 1IQHA 1ID5H 2F9UA 4DIIH 1NRRH 3LGIA 4JZFH 4D7FA 1LDTT 1CHOF 1ZRKA 3LOXA 2O8MA 4YOJA 1WSSH 4ZHAA 3L6PA 1GHZA 1W7GH 4ZMAH 1C5RA 5K7RA 1ANCA 1OWHA 2VH6A 4UDWH 1O3OA 3Q3XA 1AVXA 1EOLA 2GCTC 1FPCH 1GHVH 3H7TA 1QJ1B 1Q31A 2B5TB 2VGCB 4JYUH 2BD7A 5LGOA 1NFUA 3A7VA 1ZHMA 1SGPE 3U1IB 5L2YH 4D9RA 2G4TA 4X2VA 3UNQA 1CT4E 1AKSB 4XFQA 2FZZA 3KIDU 1GVZA 1WCZA 1SL3A 3M3VA 1NN6A 4XOJA 1W11U 1SG8B 1J16A 1CGHA 3KNXA 1LKBA 1IQKA 3D62A 1IQJA 2BYAX 3TJNA 1VR1H 4WVPE 2D26C 1V2KT 1HJ9A 1MAXA 1UTNA 1ZHPA 2BY7X 1XXFA 3OX7U 1TPPA 1AMHA 3TJUA 2VVCA 3RC5A 3M61U 2B0FA 5GCHG 3SN8A 1V2RT 1BA8B 1EATA 1YLDA 3SHAH 4U30A 1C9TA 2R3UA 1WU1A 8GCHF 1AWHB 1OYTH 2J4IA 1U6QA 2Q6FA 4A6LA 2VJ1A 2P8OB 1QQUA 5EQQA 3DUXH 4H42U 1XM1A 4CRAA 1GI7B 5DPAA 1RRKA 3ESTA 4ISOA 2QXHA 4KKDA 1BTPA 3H5CB 2V35A 3MU4A 1DICA 1VJ9U 1PPBH 4JK6A 1QRXA 2PKAA 2BY9X 4YO9A 1A3EH 3LKWA 3RXTA 1TE0A 1BRAA 1UTLM 1MQ5A 2ZFPH 1ZJKA 2ZECA 2XW9A 2P3UB 1ELDE 2QCYA 2F91A 2P16A 5EU8A 1QA7A 2ZGJA 4YM9A 1SB1H 3SV8A 2QF0A 1TNKA 4O3UA 1A5HA 1O2GH 1MD8A 1DANH 2SGDE 4WXIA 1GJAB 2OBQA 3MFJA 1GBFA 3MH6A 3MYWA 3M35A 3WY8A 4NGAH 1HAIH 4R0IA 2ZFFH 2ZPSA 1C2IA 1GJ7B 1V2OT 2JH6D 1F0SA 1Y3UA 3SJIA 1O3PB 1W3CA 1BTUA 5DJ7A 2PW8H 1ZRBA 4YOIA 4FUEA 3U9AH 4MLFB 4CHAB 2RG3A 2PTNA 1ZMJA 3SU0A 2BZ6H 5EODA 2HRVA 1E34B 1GVKB 4CH8B 1JRSA 1Y3VA 2ODYB 3TIUA 1C9PA 2D1JA 3BTHE 6LPRA 1P9UA 1Z7KA 3T2NA 3GCTG 2PKSC 1TMTH 1BMAA 1GBKA 2J34A 2ZGXH 3URCA 1F0UA 1BOQA 2GKVE 3A82A 4Y8ZA 4BTTB 1O2QA 3O8RA 1W13U 2AERH 3BF6H 5FX5A 1D3TB 1T31A 4AFSA 3LJJA 1V2PT 5F8TA 2FPZA 5G4BA 4GHTA 1ZTLA 4ZKSU 2FP7B 1NTPA 5HGGA 4RSPA 4BAQB 4KP0A 1O3DA 1GHAG 3GY2A 1BT7A 4GCHF 1XKAC 3ZZ8A 2PSYA 2IOTA 4A5TS 2RDLA 6ESTA 2QYIA 3A8AA 4OS4A 2OC0A 3RXLA 2RA3A 1ABJH 3T27A 4OS7A 1LVOA 1K1LA 1QA0A 1D3QB 1SPJA 4F49A 1NFYA 2GV6A 1Z71A 4CRFA 4MNWA 2Y7ZA 1CE5A 2OC8A 2ZQ1A 3UQOA 6CHAC 4Y8XA 1C1QA 1KIGH 2ILNA 1Q3XA 1C1OA 3A87A 1Z8IB 4MVNA 1A0LA 3QDZB 5DP8A 4UONA 2BX3A 1YBWA 3CENA 3PMAB 1VJAU 3B8JA 2W3KA 1S82A 2Y7XA 1K1IA 1W14U 5EQSA 2BD4A 4X8TH 2Y82A 3O8DA 1BB0B 4WWYA 4NSVA 2ZCKP 1UTKA 2GZ9A 3EGKH 1Y3YA 1YCPH 1Z6EA 1LQEA 4BOHA 4ABDA 1BMLA 3E1XB 3V3MA 2VNTA 1CU1A 1O0DH 3GY8A 4NA9H 1TX7A 1LMWB 1UHBB 1V2ST 3BSQA 2R2WU 1BBRE 1TIOA 3TJOA 5FPSA 2ZHWH 3MOCA 3RLYH 1S0RA 3SJ9A 2CHAC 2FLRH 4NZQA 1O30A 1O3BA 1BQYA 3UR9A 3E0NB 2ZQ2A 3W94A 1TMUH 4Y0YE 4K1EA 1ARCA 4FU9A 1T7CA 4DT7B 1EPTA 1FONA 4A7IB 1FAXA 2ZCLP 1GHXH 5JB9S 3HGNA 1C1RA 3KEEA 2CF8H 5EXNA 2XBXA 2BD9A 3L3TA 1BRUP 1E38B 1C1SA 1GJ5H 3SI4H 1J9CH 3ZZ3A 2XCNA 2FM2A 4NWKA 3EYDA 1NRQH 2ZI2H 3U8OH 2QN5T 5DP3A 4K2YA 5PTPA 3ZYDA 1C2EA 1DXPA 3HKJB 1UK3A 1YPEH 1PYTC 2OXSA 3S0NA 3FP8E 2ZA5A 1QNJA 2O8LA 1EB2A 1G3CA 3DHKH 3R0FA 1BTYA 1UVPA 8KME2 2UWLA 1CGIE 2ZU5A 1YPKH 3C1KA 1GG6C 3F9HA 2JH5D 2G81E 2XCFA 3QTOH 6CHAB 1O36A 2Y5GA 5A8YA 2VINA 1KLIH 3BTFE 5HXFA 1MTNC 2C8XB 3QUMP 2HPPH 1DY8A 2YOLA 1W12U 1ELAA 1GDNA 1GDQA 2ANKH 3I77A 1O3NA 2DE8A 1UVTH 1ANBA 2G8TA 1EJAA 3PWBA 1BZXE 1KDQB 3F6UH 5J4SA 6GCHG 2ZNKH 2VWOA 3GY4A 3SHCH 2Z9KA 3RXKA 2AYWA 1A0HB 2BX4A 1XVMA 3VB5A 1HRTH 1Z6JH 1TPOA 1L4DA 2P3FH 3TGIE 2ZPRA 3OY5U 5FBEA 5H4IB 2ZGHA 3OY6U 2ODQA 5FBIA 2OUAA 3SBKA 1DWEH 3EQ0H 1AB9C 1NRNH 4WJG2 1ANEA 2SNVA 4ZKRU 1ABIH 1C2DA 1SFQB 1LKAA 3BIVH 1UVUH 5FCRA 1Y59T 1XUFA 1B5GH 5T6FA 5JDUB 1O2NA 1KXCA 3UWIA 4KTSA 2A5KA 4IMZA 1THPB 4MPWA 5I46H 1O2IA 4AB8A 2F9PA 1FIZA 1EP5A 1QHRB 2FS8A 2XC0A 3RM0H 3R3GB 1LHGH 2A7CA 1GBBA 2Z9JA 3ZVBA 1FY8E 5GWZA 5A0BA 4NFFA 1HAVB 9LPRA 1P3EA 1C2JA 1TQ7B 1BTXA 1OP0A 1C5QA 3VPKA 3LU9B 4A1VA 1A4WH 3PO1B 2BQWB 3SQHE 3V13A 1HGTH 1Y5BT 1GG6B 2FMJA 1HJAC 2BDBA 1C5OH 1HXEH 3AW0A 4AB9A 1DWDH 4BTUB 3LC3A 1MTNB 5LPRA 1ESBA 3A7ZA 2QF3A 2BQ7B 1O3GA 1L2EA 2PTCE 1ZPZA 1KLTA 3Q3KA 5DP5A 2LPRA 1P8VC 4Y0ZE 2FYRA 4ASHA 3UPEA 1Z1IA 4FXGH 2UWOA 2GCHF 4Z0KA 1P2OA 4GVUA 3P8NA 4FU8A 3E90B 4Q7ZA 2XBWA 1J8AA 4GLYA 4YLUA 2ZDVH 1M9UA 5BPEA 3F68H 5A0AE 1O5CB 1GBTA 4U2WA 3RC4A 3BTDE 1OKXA 1TGCA 1GBDA 1EP6A 1O5AB 2BD8A 2FOAA 4MNVA 4WH8A 1HUTH 1XMNB 3LT3A 1C5LH 1F2SE 3LC5A 1UMAH 1O5BB 5A2MH 1ELCA 3ZZ9A 1TPSA 5JB8S 1HIAA 3NZIA 2VIVA 1A3BH 3SGQE 2VIPA 1SGDE 5C1UA 4XBDA 1WQSA 5T3HA 2CGAA 1O5EH 1KXEA 1NO9H 2ZDMA 2PFEA 1ZSJA 4AFZA 3SV6A 1VITF 3GCOA 1JXPA 1MU6B 3ATMA 3UOUA 1GBAA 3K9XB 3K6YA 1QRWA 3SUGA 1IQMA 2Z3EA 3VXEH 1WTGH 3SNDA 3RP2A 2ZZUH 1BITA 3UWJH 3VB4A 4AGKA 3TU7H 2PUQH 5HM9A 1HJ8A 1SQOA 2PSXA 1X7AC 3T28A 1TRNA 4JZEH 3ZVDA 1TB6H 2V0BA 2VGCC 1EX3A 1EUFA 3MMGA 1S6HA 3NK8A 3LJOA 1SBWA 5I25A 2VIDA 5FPTA 4Y71A 1QRZA 1LPZB 2F9BH 1O2RA 1TQ0B 1ZTKA 9ESTA 1EZXC 1P0SH 3BN9A 5FX6A 1YPMH 4UD9H 2ASUB 5K0HA 1QBNA 3RMMH 4X8VH 3FZDA 7GCHG 1BJUA 2WPKS 3PMBB 1E0FD 2F83A 5EG4A 1CT2E 3TLOA 2V3OH 2AGGX 1F0RA 5CHAB 1ZJDA 4WMEA 3BTTE 1OX1A 4B74A 1SI5H 2XBVA 2EEKA 2BQ6B 1NROH 2BLQA 1NS3A 1VCWA 4K69A 3MNXA 1AUTC 1C5VA 5L2ZH 1EKBB 1LHEH 3CS0A 4AZ2B 1DLEA 1P2NA 3ZYEA 2A2QH 2BB4A 3PYHA 4E05H 1ESTA 5CMXH 1V6DA 1GMDF 1IAUA 2GZ7A 2P8OC 5CE1A 1C2GA 2OD3B 4FUDA 1ZSKA 4LZ4B 1HXFH 1A5IA 1DX5M 1O3LA 4WY3A 2IJOB 2UUYA 4LK4A 3RXAA 1MH0A 2P94A 3MU0A 4FUIA 5J4QA 4ISIH 1QIXB 4DCDA 1L0ZA 1KLJH 2VIQA 1TNJA 1UCYE 1JWTA 1QJ7B 1GHBF 2PGQB 3ZV9A 1MCTA 1C2FA 3SNAA 4Q80A 4K5ZA 3GYLB 3VB7A 2HVXA 3ATLA 4MDSA 5E0GA 1L1JA 4B2CA 3MO6A 3K2UA 1MU8B 2ANMH 1GBHA 1O2WA 1MTWA 2CN0H 4ABGA 1AN1E 1GI0A 1SFIA 1EOJA 1GMCF 2B9LA 2BOHB 2C4FH 2J95A 1T8LA 2TGAA 1O2PA 2FESH 1O2HA 1K1JA 2A5IA 2SFAA 3P6ZB 3MNSA 1N8OC 1E37B 1C1VH 3RMNH 4FUBA 1ZLRA 4OS6A 3LH3A 1DS2E 3SU1A 4GHQA 3DFJA 1A0JA 1A61H 1K1NA 2AMPA 1GBMA 3HK6B 2ZC9H 1GBEA 3TH3H 1MTUA 2PV9B 4CHAC 3A88A 1EZQA 2A4GA 2GX4A 3KCGH 1C5PA 5FAHA 1KXDA 1O3EA 1CQQA 4IW4E 3U98H 3BEFB 1L4ZA 1EJMA 1DPOA 2VWMA 3SJKA 3FVFB 1N6XA 1OS8A 1W8BH 5HM2A 1QY6A 5LH8A 1FMGA 1FXYA 2ZU1A 3E3TA 1HAYB 1UTPA 1V2NT 2HNTE 1FN8A 1W0ZU 3GCHB 4TYDA 3EA8A 1H8IH 2F9OA 3S9AA 1AHTH 2SGEE 1C5SA 1B0EA 1O39A 4RKOB 1TWXB 4VGCB 1HPGA 1S81A 4AG1A 3BV9B 2B7DH 2QGRA 3H7OA 3GDSA 3EA9A 1T8MA 2ALPA 1C4V2 1PYTD 2AGIX 4CRBA 5L6NH 4Y7BA 4GSOA 1O2LA 1RJXB 4O97A 4ABAA 1P9SA 1V2QT 3B23B 4RN6A 3RXBA 4WF8A 2EA3A 2OCVB 5C1XA 2RCEA 1SGIB 3TGJE 1CGJE 1PPZA 1YKTA 3U8TH 1QL9A 4IN2A 3SOSA 2ZFTA 2JETB 3A81A 1JMOH 3N7OA 4ZH8A 1TPAE 4ABEA 2OP9A 1OPHB 1ZSLA 5ESTE 2C93B 4KGAA 2TRMA 2Y5HA 3ATWA 1GI4A 5FPYA 1PPEE 2A45B 3VB6A 2ZDLA 4LZ1H 4DJZB 3O8BA 2HPQH 1HAHH 3ZZ4A 1O2JA 4A1TA 5IYTA 2ESTE 4X1QU 1YC0A 3FAOA 3KQBA 1C1PA 2W7UA 1WOFA 2XRCA 1P05A 1N8OB 3GY7A 1O2OA 1UTMA 1YPLH 2NU3E 5B6OA 2ZTZA 5F03A 1C2KA 1XX9A 3RU4E 3ZV8A 1GJ8B 2XWAA 3M5MA 3A8DA 3RMOH 2OQUA 2FX4A 1GI6A 1LHFH 2BMGB 4WH6A 3RC6A 2A7HA 1AFQB 3BTGE 3SGAE 1UTOA 1V3XA 1S5SA 4Y6DA 1HBTH 4DG4A 1TA6A 5F6MA 3A8BA 1C5TA 1RXPA 1MCVA 1PQ7A 4SGAE 1BTWA 3KF2A 4ISNA 3OSYA 1QBOA 4YT7H 1XUKA 5FHTA 1MKWH 1A2CH 3TH4H 1C5MD 5A0CA 2KAIA 2GVFA 1JBUH 2GT7A 2WINI 4GCHG 1Z8JB 4XBBA 2C8WB 2WUCA 4AX9H 5C5NA 3ZVAA 8LPRA 4FU7A 3SI3H 3UIRA 5JBCS 4JZDH 1SGRE 4I8JA 3TNSA 3RXHA 1OWDA 1P04A 1O3IA 1BDAA 1O2ZA 3QGJA 2D8WA 2GMTC 3TITA 2ZHFH 4AGJA 1BBRH 3SZNA 3DD2H 3UNSA 2BY8X 1HAZB 1P2IA 3BTKE 2F3CE 1QB1A 4YESB 1D3PB 2GZ8A 4X2YA 1GHAF 1SGCA 3AASA 3M7TA 3MO9A 3ZZBA 4KTCA 1AGJA 2BD5A 1LO6A 1HAGE 4H4FA 4MNYA 2Q6GA 1GMHF 5EQRA 2BDAA 2FLBH 3UR6A 1V2MT 1WUNH 1C4Y2 3SQEE 1D4PB 1QQ4A 2QXGA 1GPZA 2IPHA 1TOMH 1EAIA 4TWWA 4ZROA 4QT8C 1TX8A 1C5NH 1SHYA 1P01A 2R0KA 1KXBA 2NU1E 1AE5A 1WBGB 1TGTA 1AKSA 5C2ZA 1UCYK 4NIWA 1SGYE 3BTQE 5GJ4B 3RDZA 3TVJB 1EQ9A 3SU3A 3RXFA 1LPKB 5DP7A 5DP6A 3ODDA 3UQVA 3ZZCA 5GXPA 3F9FA 1HAOH 1VCPA 1BUIA 4H6TA 1P2MA 2XC4A 4ABIA 1AO5A 1XUHA 4Z6AH 3P95A 1TBQH 1O37A 3M37A 1UVSH </