4KTUA

Bovine trypsin in complex with microviridin j at ph 6.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Harnessing the evolvability of tricyclic microviridins to dissect protease-inhibitor interactions.
pubmed doi rcsb
source organism Microcystis aeruginosa mrc
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA02
1MTNC 3URCA 1GG6C 1S5SA 1LHDH 2ZGCA 5HYOA 1O5AB 3BTFE 2SGEE 1N1LA 2UUJB 1CHOG 3PM3A 3SBKA 1GJBB 1O2QA 4U01A 6ESTA 1UTJA 2QF0A 1LHGH 1LQDB 3SJIA 1YF4A 1MAXA 4MVNA 1ELVA 4UFEH 1CBWB 2EEKA 4K3JA 4FUDA 1HNEE 3V13A 3SNBA 2VGCC 2V3HH 1A2CH 1HYLA 5JBCS 2C4FH 2FOGA 1FJSA 1B0EA 1A5HA 1EZXC 5FAHA 3UPEA 3EYDA 1GGDC 2P93A 2FESH 2A7CA 2FTMA 4Y0ZE 1DXPA 1HIAB 1TGSZ 2QV1A 3GCNA 1ANBA 1XKBC 3LH3A 4BAOB 4X0WU 4CRCA 1HUTH 1FIWA 1G3EA 3QUMP 4INLA 1AUJA 6LPRA 3A7XA 1H9IE 5TCAA 2R2WU 1QJ6B 3K6YA 1BB0B 1ZMNA 3BEIB 5TJXA 3ZVFA 2BQ7B 3ODFA 3ZZ4A 4NG9H 4ABGA 1FNIA 2OXSA 5FPSA 2XBVA 1O3OA 5EXNA 1BBRK 3AVZA 3UR9A 1E37B 3RXVA 4GHQA 2Y81A 4MQAA 1TNKA 3RXBA 1CO7E 4UFFH 1HAVA 1UTMA 2F9OA 1V2RT 1S0RA 2SFAA 1LVMA 3EA7A 1GMDF 2EA3A 1NZQH 1NU9A 1FPHH 3RXEA 4UDWH 4BNRA 1K2I1 2OC0A 3LGTA 1O3AA 2LPRA 4IW4E 1MZAA 3V7TA 4BAKB 4D8NA 4DGJA 2ZGXH 1N6XA 1XX9A 2TPIZ 2ESTE 3GCHB 1XUIA 1V2TT 1UVUH 2BHGA 3T29A 3V0XA 3KQCA 4GAWA 1U6QA 3A7WA 1C1NA 1IQEA 5DP6A 2WV4A 1NT1A 1TGCA 1CU1A 2FO9A 1ZTJA 4IBLH 1P2IA 3NCLA 3LT3A 1QY6A 1IQKA 1C2IA 3LJOA 1YCPM 1TOCB 4Y7AA 5GPIB 1ETRH 4O97A 1O2HA 4NSYA 4B73A 1E34B 5E0HA 5C1XA 3AW0A 3TH2H 3MNCA 1MH0A 3E90B 3GCTF 3ZZ9A 1GHYH 4NFFA 3O8RA 3U98H 3ZVDA 3ZVAA 2WPJS 1TNIA 3RUOA 1PYTD 1GHAG 1JOUB 1EKBB 2UUFB 1P0SH 4VGCC 4AGKA 3MNSA 2PGQB 1SLUB 1WQVH 1LO6A 2BD7A 2ZDVH 3N7OA 1EAXA 1KTSB 5FBIA 2AGEX 5EW1H 1YPKH 3G01A 1XUGA 4CHAB 4K60A 4AB9A 3SW2B 1QBVH 1SMFE 7ESTE 1C2HA 2Q6FA 1DPOA 3RMLH 1ZHRA 1SGPE 1UTQA 3MU5A 1BTHH 1O2VA 2A4RA 2PSXA 2VIVA 1GHBG 4K8YA 4NIVA 3A85A 1PPFE 5FX5A 1MKWK 1GI8B 1C2KA 2QY0B 3FP6E 1WTHD 3RU4D 1FI8A 1G9IE 2H5CA 4MNYA 2GMTC 1ZSKA 2H2ZA 5F8ZA 5GXPA 1H9LB 2B8OH 1WQSA 1Y3UA 5EPYA 4X8UH 1TALA 1ARCA 2VU8E 2GDDA 2ZZUH 1HAPH 1C1RA 1THPB 4H4FA 2BY9X 4I8KA 4WWYA 4X8VH 3WY8A 2AIQA 2V6NA 2ZG0H 4A5TS 3ATLA 4B2BA 2QXIA 4OS4A 2ZF0H 2BMGB 3SHAH 2R3UA 1BA8B 3BIUH 2GT7A 4ZXXH 1CQQA 3A8CA 1CHOF 1J16A 1AKSA 2NU3E 2HNTF 4UD9H 2ZDAH 2ZFTA 3A84A 3MO6A 4OS6A 1QB6A 3P17H 1QQUA 3CP7A 5FPTA 2UWLA 3SUGA 3B9FH 4AYVB 2ANMH 1JRSA 8GCHF 1RIWC 3S7HB 1SGFA 1A5GH 5CE1A 4UFGH 1MBQA 1DM4B 1C1WH 1TPOA 2QXJA 3LOXA 4D76A 4OS1A 3MU0A 3P8NA 2ZEBA 3TH4H 3GY7A 1QGFA 1OOKB 4KELA 5LPRA 2OC7A 2Y5HA 4X1SU 1KDQB 4DIHH 5E0JA 3TJOA 1TWXB 2C90B 2G5VA 5T3HA 1KSNA 1AN1E 1W0YH 5EU8A 1Y8TA 8ESTE 2BVRH 7GCHF 3LC3A 3S7KB 4Y11E 1B7XB 1PJPA 1UCYE 1RTLA 1XKAC 1TOMH 2G00A 2KAIB 1O3JA 2BYAX 2RDLA 3EQ0H 1TYNA 2XCNA 3SOSA 3HGNA 5IYTA 5JBAS 3O8DA 1SHHB 1QRXA 2HALA 3CENA 3Q76A 4NWLA 1ABJH 3E0PB 1TRMA 2FI3E 1CGJE 1V2VT 5J4QA 2ZHWH 2HPPH 2A4GA 2FI5E 3DT0H 3UFAA 1SI5H 3BN9A 4NA9H 2F9VA 1NFWA 2EI7A 1O2GH 3SHCH 2C8WB 1MQ6A 1QR3E 1P2OA 4I31A 4J1YA 1L1GA 2C8YB 3UR6A 2H9HA 1BRBE 3VPKA 3DHKH 2OBQA 2AFQB 3OYPA 1TPAE 1P9UA 2BQWB 2CGAA 3SGAE 2BDGA 3QWCH 3LU9B 3MNBA 3ZYDA 2PKSB 1HLTH 2TIOA 1SQOA 2FX4A 1D3DB 1A0HB 1WUNH 1V6DA 5AF9H 3SJOA 4B74A 1MTVA 1TRNA 1QA0A 3SQHE 1ZJDA 4F4OC 5FBEA 2TGTA 2CN0H 2AGIX 3W94A 4HTCH 4X6NA 1SQAA 5ESBA 1NFXA 1FZZA 2WV5A 4KTSA 1NFUA 5K7RA 2BLWA 4DW2U 1YPEH 1GHAF 4K5ZA 1Z8GA 2PFEA 1LPGB 1SL3A 2BOHB 1AFQC 3SU5A 2IN2A 2V35A 1AQ7A 1FAXA 1EPTB 2FTLE 1G3CA 8KME2 5TCCA 1LHCH 1GPZA 2P8OB 1DLEA 1FIZA 1W3CA 1P2JA 1KXFA 2XW9A 2AERH 3SU1A 2ILNA 2G52A 2QC2A 1ESTA 1XUJA 3SI4H 2ZGJA 2ULLA 1D6WA 1O2MA 1DWCH 1GHBF 1F2SE 2D26C 2J2UA 4CBNA 1FN6A 3TK6A 3UTUH 1UK2A 1ZRKA 3GY5A 4DT7B 2A45B 1PPCE 3QO6A 4H42U 2W7SA 1VJAU 2JETB 4D9QA 1Z6EA 1TA6A 1GI5A 5C3NA 1DUAA 3L33A 1BITA 9LPRA 3H7TA 2IJOB 3RXOA 1UHBB 2XC5A 1SVPA 1FLEE 3S9BA 4D9RA 2Z94A 3ITIA 1TIOA 4AG2A 3ZZAA 1QQ4A 1YLDA 5FXLA 1HAGE 1WOFA 4CRDA 3SJ8A 1CBWC 2J9NA 2W7UA 2BD5A 1EATA 1PPEE 2WUCA 4ZKNU 1P3CA 1DUEA 4ZKOU 1QURH 3P8FA 1LMWB 1FV9A 1MCVA 2TBSA 1LHFH 2NU0E 1D9IA 1T8MA 2J94A 2UWOA 1ZGVA 4D7GA 2PV9B 1IQIA 4NA8A 2F9UA 4WJG2 1BDAA 1GWAA 5LH8A 4Q7ZA 4X2XA 2QN5T 2GCTB 1EAWA 4Y79A 1T8LA 2ZO3H 1C1MA 1A3EH 1O2TA 2ANKH 2AIPA 1HAZB 3HATH 5L2YH 1OWEA 2V3OH 5JDUB 2CF8H 3O8CA 4X8TH 1A1RA 4E7RG 1OXGA 3NZIA 4X2VA 3MH7A 2BD4A 3P6ZB 1RTKA 4I8JA 1JBUH 1P04A 1DOJA 1A3BH 2BXTH 3QZRA 1GBAA 3M5NA 3RP2A 1ANDA 2Y5GA 2GTBA 2O9QA 1TNJA 1AMHA 1TNHA 1G30B 1EJNA 4JZ1A 4Y0YE 2Y82A 2FWWA 1JIRA 2FYQA 1MBMA 2B0FA 1GJ4H 4I8HA 2RA0A 1YPGH 5BPEA 3GCHC 3LJJA 3Q77A 2R9PA 5J4SA 4I32A 1SQTA 1C4V2 4INKA 2Y5FA 4MG3A 3EDXB 1AE8H 2FM2A 2PTNA 4NIXA 2FOAA 1DT2A 4B71A 5HGGA 2JH6D 3UNRA 2PUQH 3F1SB 4FUIA 2SNWA 2A7HA 3BTHE 4A6LA 3ZVEA 2ALVA 3JZ2B 2SNVA 2BDIA 1CGHA 4BXSA 3KQEA 3LPRA 3E8LA 3SUDA 1K1MA 2J38A 4FUHA 1G2MA 1J8AA 3U1JB 2Z9IA 1NRPH 3PLKA 4AB8A 1GI0A 1V2PT 1ARBA 1DY8A 3RXJA 2H9EH 1IQFA 3IG6B 4IN2A 4LOYH 4ZMAH 4KGAA 2VWMA 1C5QA 4YO9A 1EQ9A 5DP5A 2OC1A 5E2OA 5F8TA 4QT8C 1HGTH 4ABEA 2B9LA 2ZGHA 2JH0D 1ANCA 2P3UB 3BTME 4X1QU 1GBJA 2WPIS 3FZZA 3KL6A 1BMMH 4CHAC 5EODA 1ELAA 1CGIE 4ABJA 1BMNH 1XVOA 2OTVA 3D23A 1O2XA 4YTAA 3RC5A 5FHTA 1P01A 1V2JT 1AGJA 1RS0A 2XBXA 1MZDA 1NRRH 3IITA 3QK1A 1CA0B 1FONA 2BLQA 1B0FA 4H6SB 3RC4A 2VWOA 3U8TH 1AUTC 4E05H 2B5TB 2ZWLH 1KIGH 3LH1A 2QYIA 5EW2H 3UNQA 1EUFA 3UWJH 4XOJA 1JIMA 3SI3H 1GBKA 1SGQE 4J2YB 1S85A 4IMZA 3PYHA 4U2WA 3ZVCA 4AFZA 1FUJA 2HWLB 3VB6A 1OWIA 3F6UH 1C2DA 3ZYEA 3VGCB 1PQ5A 1QB1A 4NIYA 1AD8H 3MFJA 5E0GA 1ZPZA 1DITH 3B23B 2G51A 2ODPA 8GCHG 4NWKA 2ANWA 3TK9A 4CH2B 1C5MD 3NK8A 3RXLA 3SNAA 4ZHAA 1EP5A 2O8TA 1QHRB 3RXUA 4A92A 1MU8B 3PTNA 1NS3A 1EZQA 1NM6A 1S6HA 2HNTC 1KLJH 4WMFA 1C1VH 1O3PB 1TX8A 5JB8S 2VIWA 1DFPA 1WV7H 3SV9A 2K1QA 2Y6TA 3GY8A 3RXGA 5C2ZA 1XUHA 1EX3A 5A0BA 1P11E 2G8TA 3OTJE 1AVXA 5E8EH 3RLWH 1ZRBA 2BLOA 4YOJA 5C5NA 7GCHG 2XNIA 4OS5A 2GZ8A 1TLDA 2BD8A 3E1XB 3MHWU 3T25A 3M36A 3ZZ8A 1AI8H 2BXUH 2ZFPH 3VEQB 1L4DA 2V0BA 1BRCE 4FVDA 4E06H 3P70B 2THFB 4OS2A 1FN8A 1D3PB 1JXPA 4RKJB 3M7TA 1UK4A 1S0QA 5K0HA 1OPHB 4LZ4B 1BBRH 5A0CA 1C5NH 1GDUA 2CV3A 2FS8A 3BEFB 1GI9B 1UTKA 2G55A 4JZFH 3TJVA 5F6MA 4X8SH 4Z6AH 3PB1E 4TWYA 1GHWH 4AN7A 1P2MA 2I6SA 3E3TA 4BAMB 1A61H 1HV7A 2Q6DA 3LKWA 4Y7BA 1VITG 1TBZH 1DSTA 3T62A 2F9BH 1PQAA 4ABHA 1AB9B 1O3BA 1TNLA 1YKTA 4MPWA 1RTFB 4WH8A 4CR5A 1GHVH 1AY6H 2W3KA 3PWCA 1XVMA 1C5RA 3U1IB 1ELBA 3DUXH 3TPIZ 4GUXA 4BTIB 4A1XA 1ZSLA 1UVTH 4B2CA 3LGWA 2OP9A 3KF2A 3RXTA 4TPIZ 1H4WA 5FX6A 3TH3H 3GCOA 1O2OA 1P2NA 1EASA 1LVBA 1ZMLA 1OS8A 2QIQA 1DWBH 1BTPA 2R2MB 4BXWA 1GDQA 2VJ1A 1VJ9U 1HB0B 1MTUA 5AHGH 2J95A 3HKIB 1KLIH 3ATIA 2DUCA 1KXBA 1IHSH 1V2LT 3I77A 4O03A 1HIAA 3ZZBA 2PKSC 2GDEH 5HM9A 3M3TA 4IS5A 2GV6A 5EXMA 2P94A 3R0FA 3OU0A 1V2UT 2ZQ1A 2VWLA 1O3MA 1RFNA 3C1KA 3QTOH 4DY7B 1PPBH 1KTTB 1YPHE 1O36A 1RGQA 1ELFA 1THSH 1KXDA 3F9GA 2FYRA 2RA3A 4CRGA 5EPNA 5AFZH 3HK3B 3CS0A 1Z71A 5G4BA 2AMDA 4JZEH 1XMNB 2WPKS 1MKWH 1EPTC 3HK6B 1QCPA 1SC8U 2RCEA 2ZDNA 5FPYA 1VR1H 5A09A 2P8OC 1P2QA 2TGAA 2ZU3A 5C1YA 1V2WT 4ZAEA 4Y6DA 1EB2A 1O3CA 4ZUHA 1DVAH 2ZU1A 3MMGA 1KY9A 1QL8A 3NXPA 1SSXA 1AZ8A 3LC5A 1IOEA 4GHTA 3AAVA 3K2UA 1UTOA 3A7ZA 3RLYH 1UJ1A 1WAYB 1SPJA 4MPUA 5AFYH 1TRYA 1O3LA 1GBBA 1Q3XA 1Y3VA 2JETC 3UREA 1P8VC 4MPVA 3I29A 4CRAA 4NZLA 1UCYK 1NN6A 2XC4A 1HPGA 1O2KA 2ZNKH 5ETXA 1C1SA 2OLGA 1DXWA 1C9TA 1G3BA 1NRQH 1NRNH 2BZ6H 1PQ7A 5A8ZA 2ZPSA 4AZ2B 1W11U 2BOKA 5E2PA 1K21H 1C9PA 5JYIA 1A46H 4K1SA 2O8LA 1ELEE 1H8IH 1ZHPA 1B5GH 2FXRA 2R0LA 4BTUB 4ABAA 1C2JA 1FY4A 1K1OA 1YPJH 1TAWA 4XDEA 4ABBA 4AORA 2ZGBH 1P05A 4Q80A 2BY6X 1WSSH 1C4Y2 1NC6A 3AASA 1YCPK 1L1NA 4MPXA 1C5WB 1YGCH 1BJVA 5F8XA 4ESTE 2G4TA 2ZU5A 1TPPA 3ENSB 2GCTC 2STBE 3U9AH 3K9XB 2P16A 1P12E 1V2MT 3GDVA 1EOJA 1GJ9B 1ZOMA 4BOHA 4LXBH 3A7YA 2RG3A 1C1PA 2WPLS 2ZU2A 3L6PA 3GYLB 1SLVB 3ATMA 1TMTH 4B76A 1GBMA 2OQ5A 3TGJE 3BTEE 4CBOA 1ELTA 3RXAA 1BHXB 1BQYA 1H8DH 1CT0E 3D65E 1T32A 3P95A 2A5IA 5C5OA 1DWEH 2AGGX 3SGQE 1S81A 1O2NA 3STIA 4THNH 1C5TA 4DCDA 2F3CE 1OWKA 1BHXF 1GBLA 2SGDE 4WVPE 3PLBA 1T7CA 5GCHF 3RXQA 2A5AA 1TFXA 3SU3A 7LPRA 1A0LA 3HGPA 3QX5H 2ZU4A 4MNXA 1FY5A 1QTFA 4H6TA 1VITF 1F92A 3AAUA 6CHAB 1GBCA 2ZKSA 3GY6A 5DJ7A 1O2IA 3D49H 2FZZA 1TMUH 2Q1JA 2HLCA 4AFSA 3GDUA 1E38B 3ATWA 2ASUB 1QFKH 1O3FA 1P3EA 3TJNA 1H9HE 2QGRA 4ISHH 3ZZ6A 3EA8A 3UUZA 1CE5A 2OC8A 3RXFA 2BM2A 4MLFB 3D62A 1YC0A 1PPGE 1IQGA 5DP7A 4RN6A 4RKOB 1ESBA 1F5KU 4CREA 1P02A 3QN7A 1DICA 1EZUC 3SNCA 1HJ9A 1LKBA 1Z8IB 1HJAB 2OCVB 3RXSA 1J15A 2SGPE 1Y3WA 1O35A 1O2SA 1ABIH 2BD2A 5GWZA 1LVYA 1AHTH 3QTVH 4X1RU 1NTPA 2TGPZ 1ZZZA 1ETSH 1KDQA 1MKXK 1VGCB 3M7UA 4Y71A 1EAUA 1KLTA 3PMHB 3VB3A 5T6GA 3S9CA 1BTYA 2AS9A 1C5XB 3F9HA 1C5LH 4XE4A 1TE0A 5F03A 4INHA 3K65B 1XM1A 1AO5A 1GJ5H 1ZTKA 1LPZB 5CMXH 1G37A 5L2ZH 3UQOA 1DLKB 2FOFA 2GCHG 2H1UA 2ZDLA 5A8XA 4YESB 1J9CH 3UNSA 1FXYA 4UE7H 2ZDKA 4SGAE 2KAIA 1UTLM 3NPSA 1K1PA 1MCTA 3P8GA 1GJ7B 4R0IA 5EXLA 1CA0C 2BQ6B 3RDZA 1TNGA 5DP8A 3ZVBA 1C5PA 1GJ8B 4YOGA 2QAAA 5GDSH 3LONA 2PLXA 1ZMJA 2Z3DA 1OYQA 1C5VA 4CRFA 1CSOE 2QCYA 4JYUH 1D4PB 2W5EA 1K9OE 1GI6A 1TQ7B 5JBTA 4XBDA 4NFEA 5T6FA 1ZR0A 3VGCC 2VVCA 4ZKSU 2BZAA 4I7YH 3Q3YA 5DPAA 1C2LA 4NCYA 2SGQE 4GLYA 1PYTC 1AIXH 4NIWA 1NY22 1MD7A 2VIOA 2VIDA 2NU2E 2JKHA 1J14A 1Z7KA 4Y8ZA 1HCGA 1SGCA 3ZVGA 1BT7A 2W3IA 2BTCE 5BRRE 4NSVA 5LPEA 5EQQA 4FU7A 5HXFA 4Y8YA 3M5OA 4X6PA 1T4UH 2UWPA 3S0NA 3DFJA 1D6RA 1SGIB 5FCKA 2O8WA 2ZFQH 2GKVE 2JH5D 4JK5A 4BTTB 1C4U2 3TIUA 1C5ZB 3URDA 1GL1A 2Z9JA 1S6FA 1SGEE 1HDTH 2TRMA 2VIQA 2GZ9A 1D3QB 1EPTA 2C3SA 1TPSA 3Q3KA 5C20A 1HAOH 3M5MA 1GMHG 4GVUA 1GBEA 1GJDB 4R8TB 3ZZ3A 2VWNA 1BTXA 3EAJA 5EOKA 1Y3XA 4AX9H 1ZTLA 1BTUA 2BLVA 1Z8RA 1F5RA 1LTOA 4MNWA 1OP2A 2FI4E 2AMPA 1THRH 3QDZB 3TGKE 1HAXB 2WYJA 2BDCA 4KTCA 1BZXE 3ZV9A 3A81A 4FUFA 1MTSA 3E16B 4ISNA 2ODYB 4DG4A 4ZHMU 4DJZB 3QLPH 2NWNA 1CA8B 2PW8H 1AB9C 9ESTA 5DKMA 1ETTH 1UHBA 3L3TA 3M3SA 3M5LA 5FCRA 3BSQA 1F5LA 1F0SA 2Z3CA 4O9VA 4XSKU 3SU2A 2XRCA 1VCPA 1O2UA 4K1TA 3ZZ7A 1DE7H 4AG1A 2F83A 4YLQH 3BTKE 1BTZA 2ZQ2A 1ZJKA 1O3GA 4DIIH 1BRUP 1EB1H 1O5EH 2AEIH 1SFQB 1O3IA 2FS9A 3KNXA 1GVLA 1H1BA 1SGFG 2CHAB 2PGBB 3T28A 2VH0A 4FU9A 1GI3A 1UVPA 2GV7A 4X2YA 1L4ZA 3M7QA 5DO4H 4E7NA 1C5YB 4FUJA 3SN8A 5LGOA 4YT7H 1GCTB 2FPZA 3GY4A 1MMJN 1O3EA 2Z9GA 2FEQH 3A7TA 3A83A 1UO6A 2A4OA 1VCQA 1EXFA 1F0TA 3QZQA 3T26A 1W10U 2CXVA 1C1OA 4X2WA 2WINI 2UUKB 2ALPA 5L6NH 2BX4A 1KXAA 2FIRH 1F0RA 1TGNA 2ZDMA 3BG8A 1DWDH 4JZDH 1SBWA 1Q2WA 1MD8A 1HAVB 4MNVA 3A8BA 1EOLA 5EG4A 1DANH 1C2EA 4X6OA 1O2WA 4X6MA 1O2ZA 1HAHH 2QA9E 3LGVA 4LK4A 4ABFA 1O5FH 2A5KA 3STJA 4ABDA 5EQRA 2P95A 2Z7FE 4MTBA 2ZP0H 1TGBA 3SNDA 1L0ZA 2GZ7A 1MQ5A 4WH6A 2Z9KA 2ZHQH 1O30A 1Y59T 2D2DA 1LVOA 4GSOA 4JCNA 1SOZA 4NGAH 4WXIA 2GCHF 4FUGA 1NRSH 1FAKH 2C93B 3LGUA 1W12U 3RM0H 1TBQH 1W14U 4U30A 1OKXA 1TA2A 1XUFA 1C2GA 4IGDA 2OUAA 3MO3A 1JMOH 3PMAB 1J17T 3PWBA 1UK3A 4KTUA 3MH5A 3K6ZA 4NA7A 2ANYA 1PFXC 2BY8X 2FDAA 1N8OB 1AFEH 1CHGA 1QJ7B 1A0JA 1RD3B 3FP7E 1FY3A 2ZTZA 1T8NA 1W8BH 3DFLA 1O38A 2OINA 1NO9H 5CHAB 3RXMA 2CJIA 2ODQA 1OWDA 2O8MA 1Y3YA 1O5CB 1DS2E 1E0FD 1O2YA 4Y8XA 3W95A 4AGJA 2PR3A 4ZH8A 5H4IB 1BIOA 2A2QH 3SJKA 1O2LA 4ABIA 3BTTE 3RU4E 2XXLA 3RM2H 1IHTH 3M3VA 2PKAA 1C5SA 3UWIA 4GCHG 3TJUA 2A4QA 4HZHA 1QBNA 3P8OA 2ZPQA 4K2YA 4YM9A 4U32A 2BDYA 4Y10E 2A31A 3M35A 3V12A 4CH8B 1ACBE 1S82A 1BCUH 3TU7H 3HKJB 2BVXH 4SGBE 1QIXB 1BMAA 1QB9A 4HFPB 5GCHG 2W26A 3BF6H 1YPMH 1NESE 1ZSJA 4ISLA 1WU1A 1K1JA 3FP8E 3SO3A 4CR9A 2LNCA 3UQVA 1OP8A 1QRZA 3PO1B 1FQ3A 1OWJA 3SUEA 2XTTB 3FANA 1GI2A 1LCYA 2BY7X 3UOUA 5JB9S 1GJCB 1ZPCA 1O3NA 2BY5X 2P3FH 3QGJA 1ZGIA 1GMHF 3TVJB 1KXCA 1O2PA 2A1DB 4FU8A 4ZHLU 5GJ4B 1EP6A 3OY5U 1YPLH 1NPMA 1TX6A 3ZZDA 3F9EA 3BG4B 3A80A 2PSYA 3A8DA 1CT2E 1SLWB 2NU4E 4XBCA 1F7ZA 1W0ZU 2A7JA 2D1JA 2YNAA 4YLUA 1HXFH 1TBRH 1GBHA 2F9NA 1G36A 6CHAC 1GI4A 4JZIA 1L2EA 2UUYA 3A82A 1GBTA 1AKSB 1SB1H 3BTQE 3UY9A 1XXDA 1QL9A 5EGMA 1BBRE 1Z6JH 1XXFA 3M37A 1FDPA 3FVFB 1DY9A 2ZCKP 3IWMA 3KCGH 1YYY1 4ISIH 1O33A 2YNBA 1ZPBA 1PQ8A 1BJUA 1NU7B 1ELDE 5DP3A 1Q31A 3UIRA 4A1VA 1UVOA 3T2NA 3KQDA 3ESTA 3E0NB 1T4VH 2ZFSA 4B75A 3A87A 5LPFA 1HJAC 4IC6A 3OX7U 3SU0A 5PTPA 1P57B 1W2KH 4X1PU 3F9FA 3SQEE 3SUFA 2R0KA 2VVUA 1RRKA 4Q7YA 2GVFA 1LQEA 3NWUA 2NU1E 3ELAH 1VGCC 2WYGA 1W13U 1SOTA 2ZECA 2XBYA 3DA9B 1WCZA 1MTNB 3MU1A 3KHVA 4BANB 1GG6B 1XUKA 2XWAA 1MTWA 1UVSH 2FODA 1Y5AT 2BDHA 2HNTE 2O8UA 5C1UA 1PPZA 3RXDA 1GDNA 1OWHA 4B1TA 1FY8E 1DDJA 3TNTA 3EA9A 3PLPA 1BMLA 5JPMH 1HJ8A 1GMCF 3C27B 2BX3A 1IQMA 2FX6A 3O8BA 2VGCB 4Y76A 1UMAH 1VITH 3PV4A 1NROH 1K28D 1WYKA 1GVZA 2J4IA 3F68H 3VFEA 1QA7A 1MU6B 1UCYH 5DP9A 2VH6A 1INCA 1O2RA 2J34A 1GGDB 3LGYA 4IC5A 1K1LA 5HM2A 3PMJA 8LPRA 2BD9A 4FUBA 1GJ6A 4B2AA 3T27A 3SV2H 5HMAA 5C67A 3HPTB 3I78A 3NUMA 1EAIA 1AE5A 3GICB 1M9UA 5DP4A 4FXGH 3RU4T 3V3MA 1SHYA 4WMEA 2VVVA 2EI8A 4M7GA 1L1JA 2WPHS 4I33A 2GT8A 1TQ0B 2VB0A 1Y5BT 1AU8A 3EGKH 2ZHFH 1W7GH 1CT4E 4BAQB 2AMQA 4TY6A 2A0QB 4FUEA 4XBBA 1S83A 2CF9H 1SGRE 1GBFA 2XWBI 4GPGA 1IQLA 1YCPH 3BTDE 2ZTXA 3SV7A 2FMJA 2H6MA 2VINA 1P10A 1HXEH 3PTBA 1SGDE 4XFQA 2P3TB 3MTYA 3SORA 1P9SA 3AW1A 1O2JA 1QNJA 4IN1A 4GCHF 2ZHDA 1IQJA 5GIBA 2G81E 3GISB 1O34A 3RXRA 3SNEA 4JYVH 2FOHA 4KP0A 1ORFA 3A89A 1RJXB 1O5GH 1K22H 1SR5C 1GCDA 1TX7A 3FFGA 4ZROA 3QGNB 4K69A 1O3DA 3T5FH 2Z3EA 2PTCE 3PMBB 3GY2A 3MH4A 3MI4A 1QJ1B 3MO9A 1TMBH 3Q3XA 1O39A 1V3XA 2F9PA 2H9TH 3ODDA 4O3UA 5IDKA 3TK5A 1IAUA 4ZKRU 2FOCA 4NZQA 1O5DH 1ID5H 4D7FA 1F0UA 3R3GB 1GHXH 1FPCH 2Z9LA 3RXCA 1WBGB 1TGTA 3TITA 3E6PH 1Z1JA 2A2XH 2G5NA 2Q6GA 3LGIA 4YOIA 2OD3B 4VGCB 5T6DA 4A7IB 1EJMA 1DX5M 3MU8A 3FAOA 1IQNA 4ZXYH 4WXVA 2HPQH 4OS7A 1C1QA 2DE9A 1SG8B 3VXFH 6GCHG 4FVBA 3RMNH 2CHAC 4RSPA 2Y7ZA 3GYMA 1P06A 3U69H 1FY1A 1TABE 1V2QT 3ATKA 2ZFRH 2ZIQH 4YT6H 4WMDA 3MOCA 1YBWA 4UEHH 4JMYA 1GCTC 1LPKB 1E35B 5I46H 1O5BB 2ZC9H 1MKXH 3MH6A 5DG6A 1G3DA 1ELGA 1GI1A 1A7SA 3SV6A 2GD4B 1D3TB 4TWWA 3UOPA 2GMTB 4PROA 4JYTA 5DK1A 1YP9A 2PWXA 1BTWA 1O3HA 3RC6A 2A32A 3GOVB 4WY3A 4I8GA 2FLRH 1JRTA 3A8AA 1EJAA 1X7AC 1FMGA 1HAIH 2IOTA 3A86A 3TGIE 1QRWA 2ZFFH 1HFDA 3S69A 1YM0A 1HRTH 4DVAU 1QL7A 1VZQH 3PROA 4AFUA 4I8LA 1V2NT 2CMYA 3MNXA 2GP9B 1YLCA 1GL0E 1HBTH 2WPMS 1OYTH 1TB6H 4X1NU 4AFQA 1ANEA 2C8XB 4YZUA 5B6OA 1UTPA 2ZHEH 2BB4A 5A0AE 4AOQA 4A1TA 2IPHA 1EZSC 3RXIA 1G2LA 1OP0A 4F49A 2FOBA 4ASHA 3LDXH 3SJ9A 2XYAA 5AVDA 2BDAA 3VXEH 4UONA 1C1TA 3BEUA 3Q00A 2DE8A 3FZDA 1BRAA 3KEEA 1NFYA 3ZZ5A 2OQUA 1RIWB 1RXPA 5ABWA 1SFIA 2PHBA 1ZYOA 3VB4A 2M5TA 3KIDU 1GVKB 3GDSA 1N8OC 1AZZA 1AWHB 1TONA 1Z1IA 1N6YA 3SU6A 4ISOA 2EI6A 4MDSA 4O3TA 2HVXA 1ESAA 5CHAC 2Y7XA 1ZHMA 1LHEH 3BV9B 4Q7XA 1AVGH 2AH4X 2ZPRA 3BIVH 4KKDA 1A4WH 3KQBA 4UFDH 2H5DA 1WTGH 1GBIA 1BOQA 5I25A 1ELCA 1GMDG 2HRVA 5DGJA 3E91A 3BTGE 2ZA5A 2TGDA 2VNTA 4TPYA 1C2MA 3OSYA 2R3YA 4HI3A 2ZCHP 2OBOA 5ESTE 2C8ZB 2AYWA 3OY6U 3KGPA 3RXHA 2QXGA 3H5CB 1O0DH 2ZCLP 1AVWA 2B7DH 3BTWE 2HGTH 5L30H 4Z0KA 1K1IA 1V2OT 2PUXB 2BDBA 3A88A 2I6QA 3NKKA 3SV8A 1MUEB 2GGVB 2STAE 2GX4A 1GJAB 4OGXA 3SU4A 3U8RH 1CVWH 1O31A 3CS7A 3EE0B 4HGCA 3U8OH 3RMOH 3RXKA 3PO1C 1VCWA 2BVSH 1SGYE 4BAHB 2XC0A 1GBDA 1KYNA 1QBOA 4TY7A 3SGBE 1S84A 1P09A 1T8OA 2P59A 4JK6A 3GCTG 1DSUA 3JZ1B 1PPHE 3ZZCA 1HAYB 1OX1A 2SGAA 3BG4C 1LKAA 2Z6BD 3LIWA 2HOBA 2FP7B 3TLOA 2YOLA 4K1EA 1LDTT 1UTNA 5EQSA 4K8BA 2ZI2H 1C2FA 3B8JA 1C1UH 1GI7B 3GY3A 4OGYA 3RXPA 4FUCA 2EC9H 2FOMB 2D8WA 3M61U 1BUIA 2BD3A 1AFQB 1O37A 2QXHA 2WUBA 1P2KA 4IMQA 1JWTA 2ZTYA 3MYWA 5A2MH 2J92A 1AWFH 3RMMH 4WF8A 4CRBA 1KXEA 1SGTA 5JBBS 4AYYB 1GHZA 1MAYA 6GCHF 2F91A 3SZNA 5A8YA 2PKAB 7KMEH 4LZ1H 1V2KT 1O32A 1OSSA 2SGFE 2XBWA 3TNSA 4DURA 3DD2H 3KN2A 1Y5UT 1T31A 1G32B 1SLXB 4DOQA 2FOEA 1C5UA 1Z8JB 2G4UA 3P92A 1IQHA 1GMCG 1E36B 3H7OA 1SGNE 4TYDA 1P03A 3A7VA 1O3KA 1K1NA 3VB5A 2VIPA 1W7XH 3S9AA 5SGAE 3MU4A 1ZLRA 2Y80A 4Q2KA 2QF3A 3VB7A 3MWIU 3ZV8A 1A5IA 1V2ST 2FLBH 1C5OH 1YPHC 2XCFA
chains in the Genus database with same CATH superfamily
1MTNC 3URCA 1GG6C 1S5SA 1LHDH 2ZGCA 5HYOA 1O5AB 3BTFE 2SGEE 1N1LA 1OHHD 2UUJB 1CHOG 3PM3A 3SBKA 1GJBB 2QE7D 1O2QA 4U01A 6ESTA 1UTJA 2QF0A 1LHGH 1LQDB 3SJIA 5IK2D 1YF4A 1MAXA 4MVNA 1ELVA 4UFEH 1CBWB 2KM0A 1W0KD 2EEKA 4K3JA 4FUDA 1HNEE 3V13A 3WWFA 3SNBA 2VGCC 2V3HH 1A2CH 1HYLA 4FOUC 5JBCS 2C4FH 3ZIAD 2FOGA 1FJSA 1B0EA 1A5HA 1EZXC 5FAHA 2F43B 3UPEA 3EYDA 1GGDC 2P93A 2FESH 2A7CA 2FTMA 4Y0ZE 1DXPA 1HIAB 1TGSZ 2J5UA 2QV1A 3GCNA 1ANBA 1XKBC 3LH3A 4BAOB 4X0WU 4CRCA 1HUTH 1FIWA 1G3EA 3QUMP 4INLA 1AUJA 6LPRA 3WW7A 3A7XA 1H9IE 5TCAA 2R2WU 1QJ6B 3K6YA 1BB0B 1ZMNA 3BEIB 5TJXA 3ZVFA 2BQ7B 3ODFA 3ZZ4A 4NG9H 4ABGA 1FNIA 2OXSA 5C0UA 5FPSA 2XBVA 1O3OA 5EXNA 1BBRK 3OFND 3AVZA 3UR9A 3N7EA 1E37B 3RXVA 4GHQA 2Y81A 3F2FA 4MQAA 1TNKA 3RXBA 4FETA 1CO7E 3FOAA 4UFFH 1HAVA 1UTMA 2F9OA 1V2RT 1S0RA 2SFAA 1LVMA 3EA7A 1GMDF 3PV5A 2EA3A 1NZQH 1NU9A 1FPHH 3RXEA 4UDWH 4BNRA 1K2I1 2OC0A 3LGTA 1O3AA 2LPRA 4IW4E 1MZAA 3V7TA 4BAKB 4D8NA 4DGJA 2ZGXH 1N6XA 1XX9A 2TPIZ 2ESTE 3GCHB 1XUIA 1V2TT 1UVUH 2BHGA 3T29A 3V0XA 3KQCA 4GAWA 3OAAD 5C17A 1U6QA 3A7WA 4OM9A 1C1NA 1IQEA 5DP6A 2WV4A 1NT1A 1TGCA 1CU1A 2FO9A 1ZTJA 4IBLH 1P2IA 3NCLA 3LT3A 1QY6A 1IQKA 1C2IA 3LJOA 1YCPM 1TOCB 4Y7AA 5GPIB 1ETRH 4O97A 1O2HA 2K8IA 4NSYA 4B73A 1E34B 5E0HA 5C1XA 3AW0A 3TH2H 3MNCA 1MH0A 3E90B 3GCTF 3ZZ9A 1GHYH 4NFFA 3O8RA 3U98H 3ZVDA 3ZVAA 2WPJS 1TNIA 3RUOA 1PYTD 1GHAG 1JOUB 1EKBB 3N99A 2UUFB 1P0SH 4VGCC 4AGKA 3MNSA 2PGQB 1SLUB 1WQVH 1LO6A 2BD7A 2ZDVH 3N7OA 1EAXA 1KTSB 5FBIA 2AGEX 2YMSD 5EW1H 2AHME 5FL7D 1YPKH 3G01A 1XUGA 4CHAB 4K60A 4AB9A 3SW2B 1QBVH 1SMFE 3W1EA 7ESTE 1C2HA 2Q6FA 1DPOA 3RMLH 1ZHRA 1SGPE 1UTQA 3MU5A 1BTHH 1O2VA 2A4RA 2PSXA 2QF4A 2VIVA 1GHBG 4P00A 4K8YA 4NIVA 3A85A 1PPFE 5FX5A 1MKWK 1GI8B 1C2KA 3KYFA 2QY0B 2CK3D 3FP6E 1WTHD 3RU4D 1FI8A 1G9IE 2H5CA 4MNYA 2GMTC 1ZSKA 2H2ZA 5F8ZA 5GXPA 1H9LB 2B8OH 1WQSA 1Y3UA 5EPYA 4X8UH 1TALA 1ARCA 2VU8E 2GDDA 3EE7A 2ZZUH 1HAPH 1C1RA 1THPB 4H4FA 2BY9X 4I8KA 4WWYA 4X8VH 3WY8A 2AIQA 2V6NA 2ZG0H 5DN6D 4A5TS 3ATLA 4B2BA 2QXIA 4OS4A 2ZF0H 2BMGB 3SHAH 2R3UA 1BA8B 3BIUH 2GT7A 2KFWA 4ZXXH 1CQQA 1W0JD 4XRNA 3A8CA 1CHOF 4P02A 1J16A 1AKSA 2NU3E 2HNTF 4UD9H 1UW7A 2ZDAH 2XNDD 2ZFTA 3A84A 3MO6A 4OS6A 3OTPA 1QB6A 3P17H 1QQUA 3CP7A 5FPTA 2UWLA 3SUGA 3B9FH 4AYVB 2ANMH 1JRSA 8GCHF 1RIWC 3S7HB 1SGFA 1A5GH 3N7DA 5CE1A 4UFGH 1MBQA 1DM4B 1C1WH 1TPOA 2QXJA 3LOXA 4D76A 4OS1A 3MU0A 3P8NA 2ZEBA 3TH4H 3GY7A 1QGFA 1OOKB 4KELA 5LPRA 2OC7A 2Y5HA 4X1SU 1KDQB 4DIHH 5E0JA 3TJOA 1TWXB 2C90B 2G5VA 5T3HA 1KSNA 1AN1E 1W0YH 5EU8A 1Y8TA 8ESTE 2BVRH 7GCHF 3LC3A 3S7KB 2KCOA 4Y11E 1B7XB 1E1RD 1PJPA 1UCYE 1RTLA 1XKAC 1TOMH 2G00A 2KAIB 1O3JA 2BYAX 2RDLA 3EQ0H 1TYNA 2XCNA 3SOSA 3HGNA 5IYTA 5JBAS 3O8DA 1SHHB 1QRXA 2HALA 3CENA 3Q76A 4NWLA 1ABJH 3E0PB 1TRMA 2FI3E 1CGJE 1V2VT 5J4QA 2ZHWH 2HPPH 2A4GA 2FI5E 3DT0H 3UFAA 1SI5H 3BN9A 4NA9H 2F9VA 1NFWA 2EI7A 1O2GH 3SHCH 2C8WB 1MQ6A 1QR3E 1P2OA 4I31A 4J1YA 1L1GA 2C8YB 3UR6A 2H9HA 1BRBE 3VPKA 3DHKH 2OBQA 2AFQB 2PP6A 3OYPA 1TPAE 1P9UA 2BQWB 2CGAA 3SGAE 2BDGA 3QWCH 3LU9B 3MNBA 3ZYDA 2PKSB 1HLTH 1NBME 2TIOA 1SQOA 2WPDD 2FX4A 1D3DB 1A0HB 1WUNH 1V6DA 5AF9H 3SJOA 4B74A 1MTVA 1TRNA 1QA0A 3SQHE 1ZJDA 4F4OC 5FBEA 2TGTA 2CN0H 1WXRA 2AGIX 3W94A 4HTCH 4X6NA 1SQAA 5ESBA 1NFXA 1FZZA 2WV5A 4KTSA 1NFUA 5K7RA 2BLWA 4DW2U 1YPEH 1GHAF 4K5ZA 1Z8GA 2PFEA 1LPGB 1SL3A 2BOHB 1AFQC 3SU5A 2IN2A 1EFRD 2V35A 1AQ7A 1FAXA 1EPTB 2FTLE 1G3CA 8KME2 5TCCA 1LHCH 1GPZA 2P8OB 1DLEA 1FIZA 1W3CA 1P2JA 1KXFA 2XW9A 2AERH 3SU1A 2ILNA 2G52A 1H8ED 2QC2A 1ESTA 1XUJA 3SI4H 2OK5A 2ZGJA 2ULLA 1D6WA 1O2MA 1DWCH 1GHBF 5DSFA 1F2SE 2D26C 2J2UA 4CBNA 1FN6A 3TK6A 3UTUH 1UK2A 1ZRKA 3GY5A 4DT7B 2A45B 1PPCE 3QO6A 4H42U 2W7SA 1VJAU 2JETB 4D9QA 1Z6EA 1TA6A 1GI5A 5C3NA 1DUAA 3L33A 1BITA 9LPRA 3H7TA 1YLNA 2IJOB 3RXOA 1UHBB 2XC5A 1SVPA 1FLEE 3S9BA 1WDIA 4D9RA 2Z94A 3ITIA 1TIOA 4AG2A 3ZZAA 1QQ4A 1YLDA 5FXLA 1HAGE 1WOFA 4CRDA 3SJ8A 1CBWC 2J9NA 2W7UA 2BD5A 1EATA 1PPEE 2WUCA 4ZKNU 1P3CA 1DUEA 2KZ4A 3F2GA 4ZKOU 1QURH 2J97A 3P8FA 1LMWB 4TSFD 1FV9A 1MCVA 2TBSA 1LHFH 2NU0E 1D9IA 1T8MA 2J94A 2UWOA 1ZGVA 4D7GA 2PV9B 1IQIA 4NA8A 2F9UA 4WJG2 1BDAA 4RT0A 1GWAA 5LH8A 4Q7ZA 4X2XA 2QN5T 2GCTB 1EAWA 4Y79A 1T8LA 2ZO3H 1C1MA 1A3EH 1O2TA 2ANKH 2AIPA 1HAZB 3HATH 5L2YH 1OWEA 2V3OH 5JDUB 2CF8H 2RDEA 3O8CA 4X8TH 1A1RA 4E7RG 1OXGA 3NZIA 4X2VA 4B6FA 3MH7A 2BD4A 3P6ZB 1RTKA 4I8JA 1JBUH 1P04A 1DOJA 4ACAA 1NBMD 1A3BH 2BXTH 3QZRA 1GBAA 3M5NA 3RP2A 1ANDA 2Y5GA 2GTBA 2O9QA 1TNJA 1AMHA 1TNHA 1G30B 1EJNA 4JZ1A 4Y0YE 2Y82A 2FWWA 1JIRA 2FYQA 1MBMA 2B0FA 1GJ4H 4I8HA 2RA0A 1YPGH 5BPEA 3GCHC 3LJJA 3Q77A 2R9PA 5J4SA 4I32A 1SQTA 1C4V2 4INKA 2Y5FA 4MG3A 3EDXB 1AE8H 2FM2A 2PTNA 4NIXA 2FOAA 1DT2A 4B71A 5HGGA 2JH6D 3UNRA 2PUQH 3F1SB 4FUIA 2SNWA 2A7HA 3BTHE 4A6LA 3ZVEA 2ALVA 3JZ2B 2SNVA 2BDIA 1CGHA 2KCAA 4BXSA 3KQEA 3LPRA 3E8LA 3SUDA 1K1MA 2J38A 4FUHA 1G2MA 1J8AA 3U1JB 2Z9IA 1NRPH 3PLKA 4AB8A 1GI0A 1V2PT 1ARBA 1DY8A 3RXJA 2EY4C 2H9EH 1IQFA 4ACBA 3IG6B 4IN2A 4LOYH 3U28C 4KGAA 4ZMAH 3DSPA 2VWMA 1H8HD 1C5QA 4YO9A 1EQ9A 5DP5A 2OC1A 5E2OA 5F8TA 3UB0A 5EIYA 4QT8C 1BMFD 1HGTH 4ABEA 2B9LA 2ZGHA 2JH0D 1ANCA 2P3UB 3BTME 4X1QU 1GBJA 2WPIS 3FZZA 3KL6A 1BMMH 4CHAC 5EODA 1ELAA 1CGIE 4ABJA 1BMNH 1XVOA 2OTVA 3D23A 1O2XA 4YTAA 3RC5A 5FHTA 1P01A 1V2JT 1AGJA 2J98B 1RS0A 2XBXA 1MZDA 1NRRH 3IITA 3QK1A 1CA0B 1FONA 2BLQA 1B0FA 4H6SB 3RC4A 2VWOA 3U8TH 1AUTC 4E05H 2B5TB 2ZWLH 1KIGH 3LH1A 2QYIA 5EW2H 3UNQA 1EUFA 3UWJH 4XOJA 1JIMA 3SI3H 1GBKA 1SGQE 4J2YB 1S85A 4IMZA 3PYHA 4U2WA 3ZVCA 4AFZA 1FUJA 2HWLB 3VB6A 1OWIA 3F6UH 1C2DA 3ZYEA 3VGCB 1PQ5A 1QB1A 4NIYA 1AD8H 3MFJA 5E0GA 1ZPZA 4XD7D 1DITH 3B23B 2G51A 2ODPA 8GCHG 4NWKA 2ANWA 3TK9A 4CH2B 2K0QA 1C5MD 3NK8A 3RXLA 4YXWD 3SNAA 4ZHAA 1EP5A 2O8TA 1QHRB 3RXUA 4A92A 1MU8B 3PTNA 1NS3A 1EZQA 1NM6A 1S6HA 3WWBA 2HNTC 1KLJH 4WMFA 1C1VH 1O3PB 1TX8A 5JB8S 2VIWA 2YMSB 1DFPA 1WV7H 3SV9A 2K1QA 2Y6TA 3GY8A 3RXGA 5C2ZA 1XUHA 1EX3A 5A0BA 1P11E 2G8TA 3OTJE 1AVXA 5E8EH 3RLWH 1ZRBA 2BLOA 2KCYA 4YOJA 5C5NA 7GCHG 2XNIA 4OS5A 2GZ8A 1TLDA 1YWUA 2BD8A 3E1XB 3MHWU 3T25A 3M36A 3ZZ8A 1AI8H 2BXUH 2ZFPH 3VEQB 1L4DA 2V0BA 1BRCE 4FVDA 4E06H 3P70B 2THFB 4OS2A 1FN8A 1D3PB 1JXPA 4RKJB 3M7TA 1UK4A 1S0QA 5K0HA 1OPHB 4LZ4B 1BBRH 5A0CA 1C5NH 1GDUA 2CV3A 2FS8A 3BEFB 1GI9B 1UTKA 2G55A 4JZFH 3TJVA 5F6MA 4X8SH 4Z6AH 3PB1E 4TWYA 1GHWH 4AN7A 1P2MA 2I6SA 3E3TA 3F3BA 4BAMB 1A61H 1HV7A 2Q6DA 3LKWA 4Y7BA 1VITG 1TBZH 1DSTA 3T62A 2F9BH 5C94A 1PQAA 4ABHA 1AB9B 1O3BA 1TNLA 1YKTA 4MPWA 2HLDD 1RTFB 4WH8A 4CR5A 1GHVH 1AY6H 2W3KA 3PWCA 3PRDA 2LELA 3OE7D 1XVMA 1C5RA 3U1IB 1ELBA 3DUXH 3TPIZ 4GUXA 4BTIB 4A1XA 1ZSLA 1UVTH 4B2CA 3LGWA 2OP9A 3KF2A 3RXTA 4TPIZ 1H4WA 5FX6A 3TH3H 3GCOA 1O2OA 1P2NA 1EASA 1LVBA 1ZMLA 1OS8A 2QIQA 1DWBH 1BTPA 2R2MB 4BXWA 1GDQA 2VJ1A 1VJ9U 1HB0B 2XOKD 1MTUA 1COWD 5AHGH 5C0TA 2J95A 3HKIB 1KLIH 3ATIA 2DUCA 1KXBA 1IHSH 1V2LT 3I77A 4O03A 1HIAA 3ZZBA 2PKSC 2GDEH 5HM9A 3M3TA 3FO8D 4IS5A 2GV6A 5EXMA 2P94A 2V7QD 3R0FA 4HG6A 3OU0A 1V2UT 2ZQ1A 2VWLA 1O3MA 1RFNA 3C1KA 3QTOH 4DY7B 1PPBH 1KTTB 1YPHE 1O36A 1RGQA 1ELFA 2L74A 1THSH 4F55A 1KXDA 3F9GA 5HKKD 2FYRA 2RA3A 4CRGA 5EPNA 5AFZH 3HK3B 3CS0A 3PRBA 1Z71A 5G4BA 2AMDA 4JZEH 1XMNB 2WPKS 3DSOA 1MKWH 1EPTC 3HK6B 1QCPA 1SC8U 2RCEA 2ZDNA 5FPYA 1VR1H 4ZCNA 2P8OC 5A09A 1P2QA 2TGAA 2ZU3A 5C1YA 1V2WT 4ZAEA 4Y6DA 1EB2A 1O3CA 4ZUHA 1DVAH 2ZU1A 3MMGA 1KY9A 1QL8A 3NXPA 1SSXA 1AZ8A 3LC5A 1IOEA 4GHTA 3AAVA 3K2UA 1UTOA 2L6OA 3A7ZA 3RLYH 1UJ1A 1WAYB 1SPJA 4MPUA 5AFYH 1TRYA 1O3LA 1GBBA 1Q3XA 1Y3VA 2JETC 3UREA 1P8VC 4MPVA 3I29A 4CRAA 4NZLA 1UCYK 1NN6A 2XC4A 3GS9A 1HPGA 1O2KA 2ZNKH 5ETXA 1C1SA 2OLGA 1DXWA 1C9TA 1G3BA 1NRQH 1NRNH 2BZ6H 1PQ7A 5A8ZA 2ZPSA 4AZ2B 1W11U 2BOKA 5E2PA 1E1QD 1K21H 1C9PA 5JYIA 1A46H 4K1SA 2O8LA 1ELEE 1H8IH 1ZHPA 1B5GH 2FXRA 2R0LA 4BTUB 4ABAA 1C2JA 1FY4A 1K1OA 2JJ1D 1YPJH 1TAWA 4XDEA 4ABBA 4AORA 2ZGBH 1P05A 4Q80A 2BY6X 1WSSH 3NRLA 1C4Y2 1NC6A 3AASA 1YCPK 1L1NA 4MPXA 1C5WB 1YGCH 1BJVA 5F8XA 4ESTE 2G4TA 2ZU5A 1TPPA 3ENSB 2GCTC 2STBE 4ASUD 3U9AH 3K9XB 2P16A 1P12E 1V2MT 3GDVA 1EOJA 1GJ9B 1ZOMA 4BOHA 4LXBH 3A7YA 2RG3A 1C1PA 2WPLS 2QF5A 2ZU2A 3L6PA 3GYLB 1SLVB 3ATMA 1TMTH 4B76A 1GBMA 2OQ5A 3TGJE 3BTEE 4CBOA 1ELTA 1S6LA 5KEDA 3RXAA 1BHXB 1BQYA 1H8DH 1CT0E 1KMHB 3D65E 1T32A 3P95A 2A5IA 5C5OA 1DWEH 2AGGX 3SGQE 1S81A 1O2NA 3STIA 4THNH 1C5TA 4DCDA 4I86A 2F3CE 1OWKA 1BHXF 4Z1MD 1GBLA 2SGDE 4WVPE 3PLBA 1T7CA 2EQNA 5GCHF 3RXQA 2A5AA 1TFXA 3SU3A 7LPRA 1A0LA 3HGPA 3QX5H 2ZU4A 4MNXA 1FY5A 1QTFA 4H6TA 1VITF 1F92A 3AAUA 3DSGA 6CHAB 1GBCA 2LP6A 2ZKSA 3GY6A 5DJ7A 1O2IA 3D49H 2FZZA 1TMUH 2Q1JA 2HLCA 4AFSA 3GDUA 1E38B 3ATWA 2ASUB 3OEHD 1QFKH 1O3FA 1P3EA 3TJNA 1H9HE 2QGRA 4ISHH 3ZZ6A 3EA8A 3UUZA 1CE5A 2OC8A 3RXFA 2BM2A 4MLFB 3D62A 1YC0A 1PPGE 1IQGA 5DP7A 4RN6A 4RKOB 1ESBA 1F5KU 4CREA 1P02A 3QN7A 1DICA 1EZUC 3SNCA 1HJ9A 1LKBA 1Z8IB 1HJAB 2OCVB 3RXSA 1J15A 4DT4A 2JIZD 2SGPE 1Y3WA 1O35A 1O2SA 1ABIH 2BD2A 5GWZA 1LVYA 4Q4LA 1AHTH 3QTVH 4X1RU 1NTPA 2TGPZ 1ZZZA 1ETSH 1KDQA 1MKXK 1VGCB 3M7UA 4Y71A 5CHBA 1EAUA 1KLTA 3PMHB 3VB3A 5T6GA 3S9CA 1BTYA 2AS9A 1C5XB 3F9HA 1C5LH 1VKYA 4XE4A 1TE0A 5F03A 4INHA 3K65B 1XM1A 1AO5A 1GJ5H 1ZTKA 1LPZB 5CMXH 1G37A 5L2ZH 3UQOA 1DLKB 2FOFA 2GCHG 2H1UA 2ZDLA 5A8XA 4YESB 1J9CH 3UNSA 1FXYA 4UE7H 2ZDKA 4SGAE 2KAIA 1UTLM 3NPSA 1K1PA 1MCTA 3P8GA 1GJ7B 4R0IA 5EXLA 3FN8A 1CA0C 2BQ6B 3RDZA 1TNGA 5DP8A 3ZVBA 1C5PA 1GJ8B 4YOGA 2QAAA 5GDSH 3LONA 2PLXA 1ZMJA 2Z3DA 1OYQA 1C5VA 4CRFA 1CSOE 2QCYA 4JYUH 1D4PB 2W5EA 1K9OE 1GI6A 1TQ7B 5JBTA 4XBDA 4NFEA 5T6FA 1ZR0A 3VGCC 2VVCA 4ZKSU 2BZAA 4I7YH 3Q3YA 5DPAA 1C2LA 4NCYA 2SGQE 4GLYA 3KYGA 1PYTC 1AIXH 4NIWA 1NY22 1MD7A 2VIOA 2VIDA 2NU2E 2JKHA 1J14A 1Z7KA 4Y8ZA 1HCGA 1SGCA 1SKYE 3ZVGA 1BT7A 2W3IA 2BTCE 5BRRE 4NSVA 5LPEA 2YMSC 5EQQA 4FU7A 5HXFA 4Y8YA 3MQKC 3M5OA 4X6PA 1T4UH 2UWPA 3S0NA 3DFJA 1D6RA 1SGIB 5FCKA 2O8WA 2ZFQH 2GKVE 2JH5D 4JK5A 4BTTB 1C4U2 3TIUA 1C5ZB 3URDA 1GL1A 2JDID 2Z9JA 1S6FA 1SGEE 1HDTH 2TRMA 2VIQA 2GZ9A 1D3QB 1EPTA 2C3SA 1TPSA 3Q3KA 5C20A 1HAOH 3M5MA 1GMHG 4GVUA 1GBEA 1GJDB 4R8TB 3ZZ3A 2VWNA 1BTXA 3EAJA 5EOKA 1Y3XA 4AX9H 5HIZA 1ZTLA 1BTUA 2BLVA 1Z8RA 1F5RA 4F48B 1LTOA 4MNWA 1OP2A 2FI4E 2AMPA 1THRH 3QDZB 3TGKE 1HAXB 2WYJA 2BDCA 3H09A 4KTCA 1BZXE 3ZV9A 5B6LA 3A81A 4FUFA 1MTSA 3E16B 4ISNA 2ODYB 4DG4A 4ZHMU 4DJZB 3QLPH 2NWNA 1CA8B 2PW8H 1AB9C 9ESTA 5DKMA 1ETTH 1UHBA 3L3TA 3M3SA 3M5LA 5FCRA 2V3MA 3BSQA 1F5LA 1F0SA 2Z3CA 4O9VA 4XSKU 3SU2A 3DCLA 2XRCA 1VCPA 1O2UA 4K1TA 3ZZ7A 1DE7H 4AG1A 2F83A 4YLQH 3BTKE 1FX0B 1BTZA 2ZQ2A 1ZJKA 1O3GA 4DIIH 1BRUP 1EB1H 1O5EH 2AEIH 1E79D 1SFQB 1O3IA 2FS9A 3KNXA 1GVLA 1H1BA 1SGFG 2CHAB 2PGBB 3T28A 2VH0A 4FU9A 1GI3A 1UVPA 1YY3A 2GV7A 4X2YA 1L4ZA 3M7QA 5DO4H 4E7NA 1C5YB 2IJD1 4FUJA 3SN8A 5LGOA 4YT7H 1GCTB 2FPZA 3GY4A 1MMJN 1O3EA 2Z9GA 2FEQH 3A7TA 3A83A 1UO6A 2A4OA 1QZ8A 4Q63A 1VCQA 1EXFA 1F0TA 3QZQA 3T26A 1W10U 2CXVA 1C1OA 4X2WA 2WINI 2UUKB 2ALPA 5L6NH 2BX4A 1KXAA 2FIRH 1F0RA 1TGNA 2ZDMA 3BG8A 1DWDH 4JZDH 1SBWA 1Q2WA 1MD8A 1HAVB 2WHXA 4MNVA 2GJGA 3A8BA 1EOLA 5EG4A 1DANH 1C2EA 4X6OA 1O2WA 4X6MA 1O2ZA 1HAHH 2QA9E 3LGVA 4LK4A 4ABFA 1O5FH 2A5KA 3STJA 4ABDA 5EQRA 2P95A 2Z7FE 4MTBA 2ZP0H 1TGBA 3SNDA 1L0ZA 2GZ7A 1MQ5A 4WH6A 2Z9KA 2ZHQH 1O30A 1Y59T 2D2DA 1LVOA 4GSOA 4JCNA 1SOZA 4NGAH 4WXIA 2GCHF 4FUGA 1NRSH 1FAKH 2C93B 3LGUA 1W12U 3RM0H 1TBQH 1W14U 3CNRA 4U30A 1OKXA 1TA2A 1XUFA 1C2GA 4IGDA 2OUAA 3MO3A 1JMOH 3PMAB 1J17T 3PWBA 1UK3A 4KTUA 3MH5A 3K6ZA 2VBCA 4NA7A 2ANYA 1PFXC 2BY8X 2FDAA 1N8OB 1AFEH 1CHGA 1QJ7B 1A0JA 1RD3B 3FP7E 1FY3A 2ZTZA 1T8NA 1W8BH 3DFLA 1O38A 2OINA 1NO9H 5CHAB 3RXMA 2CJIA 2ODQA 1OWDA 2O8MA 1Y3YA 1O5CB 1DS2E 1E0FD 1O2YA 4Y8XA 3W95A 4AGJA 2PR3A 4ZH8A 5H4IB 1BIOA 2A2QH 3SJKA 1O2LA 4ABIA 3BTTE 3RU4E 2XXLA 3RM2H 1IHTH 3M3VA 2PKAA 1C5SA 3UWIA 1MABB 4GCHG 2A4QA 4HZHA 5GNDA 3TJUA 1QBNA 3P8OA 2ZPQA 2HVYB 4K2YA 4YM9A 4U32A 2BDYA 4Y10E 2A31A 3M35A 3V12A 4CH8B 1ACBE 1S82A 1BCUH 3TU7H 3HKJB 2BVXH 4SGBE 1QIXB 1BMAA 1QB9A 4HFPB 5GCHG 2W26A 3BF6H 1YPMH 1NESE 1ZSJA 4ISLA 2J98A 1WU1A 1K1JA 3FP8E 3SO3A 4CR9A 2LNCA 3UQVA 1OP8A 1QRZA 3PO1B 1FQ3A 1OWJA 3SUEA 2XTTB 3FANA 1GI2A 1LCYA 2BY7X 3UOUA 5JB9S 1GJCB 1ZPCA 1O3NA 2BY5X 2P3FH 3QGJA 1ZGIA 1GMHF 3TVJB 1KXCA 1O2PA 2A1DB 4FU8A 4ZHLU 5GJ4B 1EP6A 2W6JD 3OY5U 1YPLH 1NPMA 1TX6A 3ZZDA 3F9EA 3BG4B 4RI0A 3A80A 2PSYA 3A8DA 1CT2E 1SLWB 2NU4E 4XBCA 1F7ZA 1W0ZU 2A7JA 2D1JA 2YNAA 4TT3D 4YLUA 2RFKC 1HXFH 1TBRH 1K0HA 1GBHA 2F9NA 1G36A 6CHAC 1GI4A 4JZIA 1L2EA 2UUYA 3A82A 1GBTA 1AKSB 1SB1H 5F53A 3BTQE 3UY9A 1XXDA 1QL9A 5EGMA 1BBRE 1Z6JH 1XXFA 5CDFE 3M37A 1FDPA 3FVFB 1DY9A 2ZCKP 3IWMA 3KCGH 1YYY1 4ISIH 3PV2A 1O33A 2YNBA 1ZPBA 1PQ8A 1BJUA 1NU7B 1ELDE 5DP3A 5EJLA 4AC9A 1Q31A 3UIRA 4A1VA 1UVOA 3T2NA 3KQDA 3ESTA 3E0NB 1T4VH 2ZFSA 4B75A 3A87A 5LPFA 2WZQA 1HJAC 4IC6A 3OX7U 3SU0A 5PTPA 1P57B 1W2KH 4X1PU 3F9FA 3SQEE 3SUFA 2R0KA 2VVUA 1RRKA 4Q7YA 2GVFA 1LQEA 3FKSD 3NWUA 2NU1E 3ELAH 1VGCC 2WYGA 1W13U 1SOTA 2ZECA 2XBYA 3DA9B 4M9FA 3F0PA 1WCZA 1MTNB 3MU1A 3KHVA 3SZEA 1GG6B 1XUKA 4BANB 2XWAA 1MTWA 1UVSH 2FODA 1Y5AT 2BDHA 2HNTE 2O8UA 5C1UA 1PPZA 3RXDA 1GDNA 1OWHA 4B1TA 1FY8E 2WV9A 1DDJA 3TNTA 3EA9A 3PLPA 1BMLA 5T1VA 5JPMH 1HJ8A 1GMCF 3C27B 2BX3A 1IQMA 2FX6A 3O8BA 2VGCB 4Y76A 1UMAH 1VITH 3PV4A 1NROH 1K28D 1WYKA 1GVZA 2J4IA 3F68H 3VFEA 1QA7A 1MU6B 1UCYH 5DP9A 2VH6A 1INCA 1O2RA 2J34A 1GGDB 3LGYA 4IC5A 1K1LA 5HM2A 3PMJA 8LPRA 2BD9A 4FUBA 1GJ6A 4B2AA 3T27A 3SV2H 5EJ1A 5HMAA 5C67A 3HPTB 3I78A 3NUMA 1EAIA 1AE5A 3GICB 1M9UA 5DP4A 4B6EA 4FXGH 3RU4T 3V3MA 1SHYA 4WMEA 2VVVA 2EI8A 4M7GA 1L1JA 2WPHS 4I33A 2GT8A 1TQ0B 2VB0A 1Y5BT 1AU8A 3EGKH 2ZHFH 1W7GH 1CT4E 4BAQB 2AMQA 4TY6A 2A0QB 4FUEA 4XBBA 1S83A 2CF9H 1SGRE 1GBFA 2XWBI 4GPGA 1IQLA 1YCPH 3BTDE 2ZTXA 3SV7A 2FMJA 2H6MA 2VINA 1P10A 1HXEH 3PTBA 1SGDE 4XFQA 2P3TB 3MTYA 3SORA 1P9SA 3AW1A 1O2JA 1QNJA 4IN1A 4GCHF 2ZHDA 1IQJA 5GIBA 2G81E 3GISB 1O34A 3RXRA 3SNEA 4JYVH 2FOHA 4KP0A 1ORFA 3A89A 1RJXB 1O5GH 1K22H 1SR5C 1GCDA 1TX7A 3FFGA 4ZROA 3QGNB 4K69A 1O3DA 5EJZA 2Z3EA 3T5FH 2PTCE 3PMBB 3GY2A 3MH4A 3MI4A 1QJ1B 3MO9A 1TMBH 3Q3XA 1O39A 1V3XA 2F9PA 2H9TH 3ODDA 4O3UA 5IDKA 3TK5A 1IAUA 4ZKRU 2FOCA 4NZQA 3AK5A 3VG8A 1O5DH 1ID5H 4D7FA 1F0UA 3R3GB 1GHXH 2KR7A 1FPCH 2Z9LA 3RXCA 1WBGB 1TGTA 3TITA 3E6PH 1Z1JA 2A2XH 2G5NA 2Q6GA 3LGIA 4YOIA 2OD3B 4RT1A 4VGCB 5T6DA 4A7IB 1EJMA 1DX5M 3MU8A 3FAOA 1IQNA 5KGOA 4ZXYH 4WXVA 2HPQH 4OS7A 1C1QA 2DE9A 1SG8B 3VXFH 6GCHG 4FVBA 3RMNH 2CHAC 4RSPA 2Y7ZA 3GYMA 1P06A 3U69H 1FY1A 1TABE 1V2QT 3ATKA 2KCPA 2M2AA 2ZFRH 2ZIQH 4WMDA 3MOCA 4YT6H 1YBWA 5HIYA 4UEHH 4JMYA 1GCTC 1LPKB 1E35B 5I46H 1O5BB 2ZC9H 1MKXH 3MH6A 5DG6A 1G3DA 1ELGA 1GI1A 1A7SA 3SV6A 2GD4B 1D3TB 4TWWA 3UOPA 2GMTB 4PROA 4JYTA 5DK1A 1YP9A 2PWXA 1BTWA 1O3HA 3RC6A 2A32A 3GOVB 4WY3A 4I8GA 2FLRH 1JRTA 3A8AA 1EJAA 1X7AC 1FMGA 1HAIH 2IOTA 3A86A 3TGIE 1QRWA 2ZFFH 1HFDA 3SYJA 3S69A 1YM0A 1HRTH 4DVAU 1QL7A 1VZQH 3PROA 4AFUA 4I8LA 1V2NT 2CMYA 3MNXA 2GP9B 1YLCA 1GL0E 1HBTH 2WPMS 1OYTH 1TB6H 4X1NU 4AFQA 3F2HA 1ANEA 2C8XB 4YZUA 5B6OA 1UTPA 2ZHEH 2BB4A 5A0AE 4AOQA 4A1TA 2IPHA 1EZSC 3RXIA 1G2LA 1OP0A 4F49A 2FOBA 4ASHA 3LDXH 3SJ9A 2XYAA 5AVDA 2BDAA 2W6ID 3VXEH 4UONA 1C1TA 3BEUA 3Q00A 2DE8A 3FZDA 1BRAA 3KEEA 1NFYA 3ZZ5A 2OQUA 1RIWB 1RXPA 5ABWA 1SFIA 2PHBA 1ZYOA 3VB4A 2M5TA 3KIDU 1GVKB 3GDSA 1N8OC 1AZZA 1AWHB 1TONA 1Z1IA 1N6YA 3SU6A 4ISOA 2EI6A 4MDSA 4O3TA 2HVXA 1ESAA 5CHAC 2Y7XA 1ZHMA 1LHEH 3BV9B 4Q7XA 1AVGH 2AH4X 3F0OA 2ZPRA 3BIVH 4KKDA 1A4WH 3KQBA 4UFDH 2H5DA 1WTGH 1GBIA 1BOQA 2F4LA 5I25A 1ELCA 1GMDG 2HRVA 5DGJA 3E91A 3BTGE 2ZA5A 2TGDA 2VNTA 4TPYA 1C2MA 3OSYA 2R3YA 4HI3A 2ZCHP 2OBOA 5ESTE 2C8ZB 2AYWA 3OY6U 3KGPA 3RXHA 2QXGA 3H5CB 1O0DH 2ZCLP 1AVWA 2B7DH 3BTWE 2HGTH 5L30H 4Z0KA 1K1IA 1V2OT 2PUXB 2BDBA 3A88A 2I6QA 3NKKA 3SV8A 1MUEB 2GGVB 2STAE 2GX4A 1GJAB 4OGXA 3SU4A 3U8RH 1CVWH 1O31A 3CS7A 3EE0B 4HGCA 3U8OH 3RMOH 3RXKA 3PO1C 2IPQX 1VCWA 2BVSH 1SGYE 4BAHB 2XC0A 1GBDA 1KYNA 1QBOA 3OEED 4TY7A 3SGBE 1S84A 1P09A 1T8OA 2JJ2D 2P59A 4JK6A 3GCTG 1DSUA 3JZ1B 1PPHE 3ZZCA 1HAYB 1OX1A 2SGAA 3BG4C 2WSSD 1LKAA 2Z6BD 1SQRA 3LIWA 2HOBA 2FP7B 3TLOA 2YOLA 4K1EA 1LDTT 1UTNA 5EQSA 4K8BA 2ZI2H 1C2FA 3B8JA 1C1UH 1GI7B 3GY3A 4OGYA 3RXPA 3UAIC 4FUCA 2EC9H 2FOMB 2D8WA 3M61U 1BUIA 2BD3A 1AFQB 1O37A 2QXHA 2WUBA 1P2KA 4IMQA 1JWTA 2ZTYA 3MYWA 5A2MH 2J92A 1AWFH 3RMMH 4WF8A 4CRBA 1KXEA 1SGTA 5JBBS 4AYYB 1GHZA 1MAYA 6GCHF 2F91A 3SZNA 5A8YA 2PKAB 7KMEH 4LZ1H 1V2KT 1O32A 1OSSA 2KX4A 2SGFE 2XBWA 3TNSA 4DURA 3DD2H 3KN2A 1Y5UT 1T31A 1G32B 1SLXB 4DOQA 5KECA 2FOEA 1C5UA 1Z8JB 3KQ5A 2G4UA 3P92A 1IQHA 1GMCG 1E36B 3H7OA 1SGNE 4TYDA 1P03A 3A7VA 1O3KA 1K1NA 3VB5A 2VIPA 1W7XH 3S9AA 5SGAE 3MU4A 1ZLRA 2Y80A 4Q2KA 2QF3A 3VB7A 3MWIU 3ZV8A 1A5IA 1V2ST 2FLBH 1C5OH 1YPHC 2XCFA
chains in the Genus database with same CATH topology
1MTNC 3URCA 1GG6C 1S5SA 1LHDH 2ZGCA 5HYOA 1O5AB 3BTFE 2SGEE 1N1LA 2UUJB 1CHOG 3PM3A 3SBKA 1GJBB 1O2QA 4U01A 6ESTA 1UTJA 2QF0A 1LHGH 1LQDB 3SJIA 1YF4A 1MAXA 4MVNA 1ELVA 4UFEH 1CBWB 2EEKA 4K3JA 4FUDA 1HNEE 3V13A 3SNBA 2VGCC 2V3HH 1A2CH 1HYLA 5JBCS 2C4FH 2FOGA 1FJSA 1B0EA 1A5HA 1EZXC 5FAHA 3UPEA 3EYDA 1GGDC 2P93A 2FESH 2A7CA 2FTMA 4Y0ZE 1DXPA 1HIAB 1TGSZ 2QV1A 3GCNA 1ANBA 1XKBC 3LH3A 4BAOB 4X0WU 4CRCA 1HUTH 1FIWA 1G3EA 3QUMP 4INLA 1AUJA 6LPRA 3A7XA 1H9IE 5TCAA 2R2WU 1QJ6B 3K6YA 1BB0B 1ZMNA 3BEIB 5TJXA 3ZVFA 2BQ7B 3ODFA 3ZZ4A 4NG9H 4ABGA 1FNIA 2OXSA 5FPSA 2XBVA 1O3OA 5EXNA 1BBRK 3AVZA 3UR9A 1E37B 3RXVA 4GHQA 2Y81A 4MQAA 1TNKA 3RXBA 1CO7E 4UFFH 1HAVA 1UTMA 2F9OA 1V2RT 1S0RA 2SFAA 1LVMA 3EA7A 1GMDF 2EA3A 1NZQH 1NU9A 1FPHH 3RXEA 4UDWH 4BNRA 1K2I1 2OC0A 3LGTA 1O3AA 2LPRA 4IW4E 1MZAA 3V7TA 4BAKB 4D8NA 4DGJA 2ZGXH 1N6XA 1XX9A 2TPIZ 2ESTE 3GCHB 1XUIA 1V2TT 1UVUH 2BHGA 3T29A 3V0XA 3KQCA 4GAWA 1U6QA 3A7WA 1C1NA 1IQEA 5DP6A 2WV4A 1NT1A 1TGCA 1CU1A 2FO9A 1ZTJA 4IBLH 1P2IA 3NCLA 3LT3A 1QY6A 1IQKA 1C2IA 3LJOA 1YCPM 1TOCB 4Y7AA 5GPIB 1ETRH 4O97A 1O2HA 4NSYA 4B73A 1E34B 5E0HA 5C1XA 3AW0A 3TH2H 3MNCA 1MH0A 3E90B 3GCTF 3ZZ9A 1GHYH 4NFFA 3O8RA 3U98H 3ZVDA 3ZVAA 2WPJS 1TNIA 3RUOA 1PYTD 1GHAG 1JOUB 1EKBB 2UUFB 1P0SH 4VGCC 4AGKA 3MNSA 2PGQB 1SLUB 1WQVH 1LO6A 2BD7A 2ZDVH 3N7OA 1EAXA 1KTSB 5FBIA 2AGEX 5EW1H 1YPKH 3G01A 1XUGA 4CHAB 4K60A 4AB9A 3SW2B 1QBVH 1SMFE 7ESTE 1C2HA 2Q6FA 1DPOA 3RMLH 1ZHRA 1SGPE 1UTQA 3MU5A 1BTHH 1O2VA 2A4RA 2PSXA 2VIVA 1GHBG 4K8YA 4NIVA 3A85A 1PPFE 5FX5A 1MKWK 1GI8B 1C2KA 2QY0B 3FP6E 1WTHD 3RU4D 1FI8A 1G9IE 2H5CA 4MNYA 2GMTC 1ZSKA 2H2ZA 5F8ZA 5GXPA 1H9LB 2B8OH 1WQSA 1Y3UA 5EPYA 4X8UH 1TALA 1ARCA 2VU8E 2GDDA 2ZZUH 1HAPH 1C1RA 1THPB 4H4FA 2BY9X 4I8KA 4WWYA 4X8VH 3WY8A 2AIQA 2V6NA 2ZG0H 4A5TS 3ATLA 4B2BA 2QXIA 4OS4A 2ZF0H 2BMGB 3SHAH 2R3UA 1BA8B 3BIUH 2GT7A 4ZXXH 1CQQA 3A8CA 1CHOF 1J16A 1AKSA 2NU3E 2HNTF 4UD9H 2ZDAH 2ZFTA 3A84A 3MO6A 4OS6A 1QB6A 3P17H 1QQUA 3CP7A 5FPTA 2UWLA 3SUGA 3B9FH 4AYVB 2ANMH 1JRSA 8GCHF 1RIWC 3S7HB 1SGFA 1A5GH 5CE1A 4UFGH 1MBQA 1DM4B 1C1WH 1TPOA 2QXJA 3LOXA 4D76A 4OS1A 3MU0A 3P8NA 2ZEBA 3TH4H 3GY7A 1QGFA 1OOKB 4KELA 5LPRA 2OC7A 2Y5HA 4X1SU 1KDQB 4DIHH 5E0JA 3TJOA 1TWXB 2C90B 2G5VA 5T3HA 1KSNA 1AN1E 1W0YH 5EU8A 1Y8TA 8ESTE 2BVRH 7GCHF 3LC3A 3S7KB 4Y11E 1B7XB 1PJPA 1UCYE 1RTLA 1XKAC 1TOMH 2G00A 2KAIB 1O3JA 2BYAX 2RDLA 3EQ0H 1TYNA 2XCNA 3SOSA 3HGNA 5IYTA 5JBAS 3O8DA 1SHHB 1QRXA 2HALA 3CENA 3Q76A 4NWLA 1ABJH 3E0PB 1TRMA 2FI3E 1CGJE 1V2VT 5J4QA 2ZHWH 2HPPH 2A4GA 2FI5E 3DT0H 3UFAA 1SI5H 3BN9A 4NA9H 2F9VA 1NFWA 2EI7A 1O2GH 3SHCH 2C8WB 1MQ6A 1QR3E 1P2OA 4I31A 4J1YA 1L1GA 2C8YB 3UR6A 2H9HA 1BRBE 3VPKA 3DHKH 2OBQA 2AFQB 3OYPA 1TPAE 1P9UA 2BQWB 2CGAA 3SGAE 2BDGA 3QWCH 3LU9B 3MNBA 3ZYDA 2PKSB 1HLTH 2TIOA 1SQOA 2FX4A 1D3DB 1A0HB 1WUNH 1V6DA 5AF9H 3SJOA 4B74A 1MTVA 1TRNA 1QA0A 3SQHE 1ZJDA 4F4OC 5FBEA 2TGTA 2CN0H 2AGIX 3W94A 4HTCH 4X6NA 1SQAA 5ESBA 1NFXA 1FZZA 2WV5A 4KTSA 1NFUA 5K7RA 2BLWA 4DW2U 1YPEH 1GHAF 4K5ZA 1Z8GA 2PFEA 1LPGB 1SL3A 2BOHB 1AFQC 3SU5A 2IN2A 2V35A 1AQ7A 1FAXA 1EPTB 2FTLE 1G3CA 8KME2 5TCCA 1LHCH 1GPZA 2P8OB 1DLEA 1FIZA 1W3CA 1P2JA 1KXFA 2XW9A 2AERH 3SU1A 2ILNA 2G52A 2QC2A 1ESTA 1XUJA 3SI4H 2ZGJA 2ULLA 1D6WA 1O2MA 1DWCH 1GHBF 1F2SE 2D26C 2J2UA 4CBNA 1FN6A 3TK6A 3UTUH 1UK2A 1ZRKA 3GY5A 4DT7B 2A45B 1PPCE 3QO6A 4H42U 2W7SA 1VJAU 2JETB 4D9QA 1Z6EA 1TA6A 1GI5A 5C3NA 1DUAA 3L33A 1BITA 9LPRA 3H7TA 2IJOB 3RXOA 1UHBB 2XC5A 1SVPA 1FLEE 3S9BA 4D9RA 2Z94A 3ITIA 1TIOA 4AG2A 3ZZAA 1QQ4A 1YLDA 5FXLA 1HAGE 1WOFA 4CRDA 3SJ8A 1CBWC 2J9NA 2W7UA 2BD5A 1EATA 1PPEE 2WUCA 4ZKNU 1P3CA 1DUEA 4ZKOU 1QURH 3P8FA 1LMWB 1FV9A 1MCVA 2TBSA 1LHFH 2NU0E 1D9IA 1T8MA 2J94A 2UWOA 1ZGVA 4D7GA 2PV9B 1IQIA 4NA8A 2F9UA 4WJG2 1BDAA 1GWAA 5LH8A 4Q7ZA 4X2XA 2QN5T 2GCTB 1EAWA 4Y79A 1T8LA 2ZO3H 1C1MA 1A3EH 1O2TA 2ANKH 2AIPA 1HAZB 3HATH 5L2YH 1OWEA 2V3OH 5JDUB 2CF8H 3O8CA 4X8TH 1A1RA 4E7RG 1OXGA 3NZIA 4X2VA 3MH7A 2BD4A 3P6ZB 1RTKA 4I8JA 1JBUH 1P04A 1DOJA 1A3BH 2BXTH 3QZRA 1GBAA 3M5NA 3RP2A 1ANDA 2Y5GA 2GTBA 2O9QA 1TNJA 1AMHA 1TNHA 1G30B 1EJNA 4JZ1A 4Y0YE 2Y82A 2FWWA 1JIRA 2FYQA 1MBMA 2B0FA 1GJ4H 4I8HA 2RA0A 1YPGH 5BPEA 3GCHC 3LJJA 3Q77A 2R9PA 5J4SA 4I32A 1SQTA 1C4V2 4INKA 2Y5FA 4MG3A 3EDXB 1AE8H 2FM2A 2PTNA 4NIXA 2FOAA 1DT2A 4B71A 5HGGA 2JH6D 3UNRA 2PUQH 3F1SB 4FUIA 2SNWA 2A7HA 3BTHE 4A6LA 3ZVEA 2ALVA 3JZ2B 2SNVA 2BDIA 1CGHA 4BXSA 3KQEA 3LPRA 3E8LA 3SUDA 1K1MA 2J38A 4FUHA 1G2MA 1J8AA 3U1JB 2Z9IA 1NRPH 3PLKA 4AB8A 1GI0A 1V2PT 1ARBA 1DY8A 3RXJA 2H9EH 1IQFA 3IG6B 4IN2A 4LOYH 4ZMAH 4KGAA 2VWMA 1C5QA 4YO9A 1EQ9A 5DP5A 2OC1A 5E2OA 5F8TA 4QT8C 1HGTH 4ABEA 2B9LA 2ZGHA 2JH0D 1ANCA 2P3UB 3BTME 4X1QU 1GBJA 2WPIS 3FZZA 3KL6A 1BMMH 4CHAC 5EODA 1ELAA 1CGIE 4ABJA 1BMNH 1XVOA 2OTVA 3D23A 1O2XA 4YTAA 3RC5A 5FHTA 1P01A 1V2JT 1AGJA 1RS0A 2XBXA 1MZDA 1NRRH 3IITA 3QK1A 1CA0B 1FONA 2BLQA 1B0FA 4H6SB 3RC4A 2VWOA 3U8TH 1AUTC 4E05H 2B5TB 2ZWLH 1KIGH 3LH1A 2QYIA 5EW2H 3UNQA 1EUFA 3UWJH 4XOJA 1JIMA 3SI3H 1GBKA 1SGQE 4J2YB 1S85A 4IMZA 3PYHA 4U2WA 3ZVCA 4AFZA 1FUJA 2HWLB 3VB6A 1OWIA 3F6UH 1C2DA 3ZYEA 3VGCB 1PQ5A 1QB1A 4NIYA 1AD8H 3MFJA 5E0GA 1ZPZA 1DITH 3B23B 2G51A 2ODPA 8GCHG 4NWKA 2ANWA 3TK9A 4CH2B 1C5MD 3NK8A 3RXLA 3SNAA 4ZHAA 1EP5A 2O8TA 1QHRB 3RXUA 4A92A 1MU8B 3PTNA 1NS3A 1EZQA 1NM6A 1S6HA 2HNTC 1KLJH 4WMFA 1C1VH 1O3PB 1TX8A 5JB8S 2VIWA 1DFPA 1WV7H 3SV9A 2K1QA 2Y6TA 3GY8A 3RXGA 5C2ZA 1XUHA 1EX3A 5A0BA 1P11E 2G8TA 3OTJE 1AVXA 5E8EH 3RLWH 1ZRBA 2BLOA 4YOJA 5C5NA 7GCHG 2XNIA 4OS5A 2GZ8A 1TLDA 2BD8A 3E1XB 3MHWU 3T25A 3M36A 3ZZ8A 1AI8H 2BXUH 2ZFPH 3VEQB 1L4DA 2V0BA 1BRCE 4FVDA 4E06H 3P70B 2THFB 4OS2A 1FN8A 1D3PB 1JXPA 4RKJB 3M7TA 1UK4A 1S0QA 5K0HA 1OPHB 4LZ4B 1BBRH 5A0CA 1C5NH 1GDUA 2CV3A 2FS8A 3BEFB 1GI9B 1UTKA 2G55A 4JZFH 3TJVA 5F6MA 4X8SH 4Z6AH 3PB1E 4TWYA 1GHWH 4AN7A 1P2MA 2I6SA 3E3TA 4BAMB 1A61H 1HV7A 2Q6DA 3LKWA 4Y7BA 1VITG 1TBZH 1DSTA 3T62A 2F9BH 1PQAA 4ABHA 1AB9B 1O3BA 1TNLA 1YKTA 4MPWA 1RTFB 4WH8A 4CR5A 1GHVH 1AY6H 2W3KA 3PWCA 1XVMA 1C5RA 3U1IB 1ELBA 3DUXH 3TPIZ 4GUXA 4BTIB 4A1XA 1ZSLA 1UVTH 4B2CA 3LGWA 2OP9A 3KF2A 3RXTA 4TPIZ 1H4WA 5FX6A 3TH3H 3GCOA 1O2OA 1P2NA 1EASA 1LVBA 1ZMLA 1OS8A 2QIQA 1DWBH 1BTPA 2R2MB 4BXWA 1GDQA 2VJ1A 1VJ9U 1HB0B 1MTUA 5AHGH 2J95A 3HKIB 1KLIH 3ATIA 2DUCA 1KXBA 1IHSH 1V2LT 3I77A 4O03A 1HIAA 3ZZBA 2PKSC 2GDEH 5HM9A 3M3TA 4IS5A 2GV6A 5EXMA 2P94A 3R0FA 3OU0A 1V2UT 2ZQ1A 2VWLA 1O3MA 1RFNA 3C1KA 3QTOH 4DY7B 1PPBH 1KTTB 1YPHE 1O36A 1RGQA 1ELFA 1THSH 1KXDA 3F9GA 2FYRA 2RA3A 4CRGA 5EPNA 5AFZH 3HK3B 3CS0A 1Z71A 5G4BA 2AMDA 4JZEH 1XMNB 2WPKS 1MKWH 1EPTC 3HK6B 1QCPA 1SC8U 2RCEA 2ZDNA 5FPYA 1VR1H 5A09A 2P8OC 1P2QA 2TGAA 2ZU3A 5C1YA 1V2WT 4ZAEA 4Y6DA 1EB2A 1O3CA 4ZUHA 1DVAH 2ZU1A 3MMGA 1KY9A 1QL8A 3NXPA 1SSXA 1AZ8A 3LC5A 1IOEA 4GHTA 3AAVA 3K2UA 1UTOA 3A7ZA 3RLYH 1UJ1A 1WAYB 1SPJA 4MPUA 5AFYH 1TRYA 1O3LA 1GBBA 1Q3XA 1Y3VA 2JETC 3UREA 1P8VC 4MPVA 3I29A 4CRAA 4NZLA 1UCYK 1NN6A 2XC4A 1HPGA 1O2KA 2ZNKH 5ETXA 1C1SA 2OLGA 1DXWA 1C9TA 1G3BA 1NRQH 1NRNH 2BZ6H 1PQ7A 5A8ZA 2ZPSA 4AZ2B 1W11U 2BOKA 5E2PA 1K21H 1C9PA 5JYIA 1A46H 4K1SA 2O8LA 1ELEE 1H8IH 1ZHPA 1B5GH 2FXRA 2R0LA 4BTUB 4ABAA 1C2JA 1FY4A 1K1OA 1YPJH 1TAWA 4XDEA 4ABBA 4AORA 2ZGBH 1P05A 4Q80A 2BY6X 1WSSH 1C4Y2 1NC6A 3AASA 1YCPK 1L1NA 4MPXA 1C5WB 1YGCH 1BJVA 5F8XA 4ESTE 2G4TA 2ZU5A 1TPPA 3ENSB 2GCTC 2STBE 3U9AH 3K9XB 2P16A 1P12E 1V2MT 3GDVA 1EOJA 1GJ9B 1ZOMA 4BOHA 4LXBH 3A7YA 2RG3A 1C1PA 2WPLS 2ZU2A 3L6PA 3GYLB 1SLVB 3ATMA 1TMTH 4B76A 1GBMA 2OQ5A 3TGJE 3BTEE 4CBOA 1ELTA 3RXAA 1BHXB 1BQYA 1H8DH 1CT0E 3D65E 1T32A 3P95A 2A5IA 5C5OA 1DWEH 2AGGX 3SGQE 1S81A 1O2NA 3STIA 4THNH 1C5TA 4DCDA 2F3CE 1OWKA 1BHXF 1GBLA 2SGDE 4WVPE 3PLBA 1T7CA 5GCHF 3RXQA 2A5AA 1TFXA 3SU3A 7LPRA 1A0LA 3HGPA 3QX5H 2ZU4A 4MNXA 1FY5A 1QTFA 4H6TA 1VITF 1F92A 3AAUA 6CHAB 1GBCA 2ZKSA 3GY6A 5DJ7A 1O2IA 3D49H 2FZZA 1TMUH 2Q1JA 2HLCA 4AFSA 3GDUA 1E38B 3ATWA 2ASUB 1QFKH 1O3FA