4KTUA

Bovine trypsin in complex with microviridin j at ph 6.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Harnessing the evolvability of tricyclic microviridins to dissect protease-inhibitor interactions.
pubmed doi rcsb
source organism Microcystis aeruginosa mrc
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA02
2BDYA 1XKBC 3EA7A 1K1MA 1BRAA 1O5EH 3M5MA 2BD3A 3HGNA 2M5TA 1O3MA 1O2KA 2P93A 4AORA 1O3FA 2SGPE 2ZGXH 1TGCA 5DP8A 2BY7X 1EXFA 1IQLA 1W3CA 3A7XA 1O33A 4HFPB 1MTVA 4MG3A 1OYQA 3LGTA 2OUAA 3SUFA 1LMWB 1P0SH 2H2ZA 2SGDE 1W2KH 2FOCA 3PWCA 3RU4D 2BOKA 3F9HA 1T4UH 4ABGA 1O36A 3SV2H 1QHRB 1EKBB 2ZPRA 3M5LA 3JZ2B 1SGRE 4ZH8A 2TGDA 3SHAH 1FY3A 1UK2A 4WXIA 1A0HB 2BX3A 4SGAE 3U8RH 2IOTA 5DG6A 3Q76A 3GYMA 1GI0A 1E34B 2ANMH 2QXHA 4RKJB 1IQGA 4IC5A 1AWFH 4NA8A 3U8TH 2SNWA 5DP7A 1F5KU 2A1DB 3G01A 2G55A 1CBWB 1GVZA 1GGDC 1NU7B 1ZTJA 4QT8C 2FX6A 4Y11E 2F9VA 3ZYDA 5AVDA 4A6LA 2TGTA 1TBZH 1D3DB 5F6MA 1A61H 2JH0D 1Q3XA 3QDZB 1HAIH 3ENSB 4CBNA 6CHAB 3RMMH 1DS2E 2WYJA 1UCYE 5IDKA 4JZIA 1P10A 1UK3A 3R0FA 3H7TA 4ASHA 3SV8A 3QGNB 1ZHMA 1LVBA 1UTNA 4ZROA 2FX4A 2PKSC 3CS7A 2AYWA 2P3TB 1UHBA 1YPMH 3TJUA 4ZUHA 1EUFA 1ABIH 1GHBG 4HI3A 1Z1IA 4AB9A 3ZZ7A 3GY2A 1GBAA 4CHAB 1O3GA 2Z3CA 5A0CA 4UONA 1BTZA 2NWNA 4OS6A 4D8NA 1KSNA 4YESB 3TPIZ 1AB9B 2CXVA 1D9IA 2QC2A 1ZSJA 5EU8A 3UR9A 1GHYH 5TCAA 2WV4A 5TJXA 1GBMA 1MZAA 3QZQA 5DO4H 4ZHAA 4A1TA 1NFWA 5LPRA 1GMHF 4AX9H 4MPUA 1QTFA 3FP7E 5FXLA 3MNSA 2GCTC 2A5KA 2G4TA 2OBOA 2P59A 2FOHA 2HNTF 1J16A 3KCGH 1DSUA 1P57B 3LONA 2FYQA 3SNDA 2Z9JA 1CA8B 1Y3VA 1BHXB 1MTUA 5HYOA 1O2XA 3Q3KA 4B71A 3RC6A 4ZAEA 2A32A 1NY22 2AMDA 3SU6A 2Z9GA 1VCPA 2OQUA 4IS5A 1SQAA 2VIPA 4FUEA 1WV7H 4PROA 1C5MD 2BHGA 3TU7H 1EZUC 1NRRH 2F9OA 3RP2A 2PUXB 4WWYA 1NS3A 1EPTA 2PGQB 4Z0KA 5GCHG 2ASUB 4OGXA 6GCHF 3M3TA 2ZQ2A 1OWJA 2R3YA 1ARBA 2CN0H 5DP3A 5H4IB 1C5QA 4ABAA 2ZZUH 3VB3A 2TGPZ 3NXPA 1A3EH 2VJ1A 5DP6A 5K7RA 1THSH 2BQ6B 4WF8A 1L1NA 1HUTH 1YF4A 1C1OA 1T7CA 2P94A 2PLXA 1EZQA 1F92A 3SI3H 3PROA 4Y79A 5EXMA 5C5NA 1HJ9A 1TNKA 3ZZCA 1TMUH 5C1XA 3ITIA 4JYVH 4CRCA 3GY4A 3E0NB 1GJCB 3K6ZA 4NIYA 2FS8A 1GJBB 2J94A 3U9AH 2BY9X 4F4OC 5AF9H 1KXFA 1C1RA 1SI5H 2ULLA 4Q7YA 2B8OH 2ZIQH 2VVUA 1P9UA 2WPKS 1C1QA 1UVUH 2XC0A 3BTFE 3PYHA 3Q3YA 4ABBA 1G2LA 1O31A 3UFAA 1F0TA 3KN2A 3AASA 3ODDA 1O2ZA 4GHQA 1TNGA 2BX4A 2WPLS 1AHTH 2THFB 1V2JT 2FIRH 4AYYB 1Y59T 3C1KA 2XBXA 4R0IA 2I6SA 3SGAE 1CHOG 2BLOA 2ZKSA 3SN8A 1CGIE 3MNXA 2BY8X 3PV4A 3ZZ6A 3HPTB 4I31A 5E2PA 2XTTB 1UTKA 2TGAA 3FP8E 2GT7A 1MQ5A 2O8TA 3GISB 1O2UA 3RC4A 4HGCA 4LXBH 1O2VA 4H4FA 2NU2E 4NA7A 1C4V2 3ZZDA 2UUYA 1FLEE 1SFIA 3M5NA 5K0HA 1MBQA 1HFDA 2FOAA 3W95A 4IN1A 1SVPA 1IQKA 1THRH 2OINA 3UNRA 1C2EA 1V2PT 3UWIA 1P01A 1NPMA 1CGHA 2W7SA 2BTCE 2HPQH 4DVAU 3D49H 1V2OT 1KXDA 3GCOA 2WV5A 4YM9A 1W14U 3TK5A 1F2SE 3IITA 3LH3A 1F7ZA 2G51A 4CBOA 2AGEX 1E36B 4CH2B 2FWWA 1L2EA 1PPBH 3R3GB 1DLEA 3FP6E 1O34A 3LU9B 1VCQA 1FI8A 3MNBA 4X8VH 1ZRBA 1XMNB 1BJVA 2XWBI 3RXKA 1ELCA 2ZA5A 1FONA 1JIRA 2Y80A 5GDSH 1HAZB 1GHXH 1AD8H 1P11E 1AFQB 1Y8TA 3BTKE 1N8OC 1RIWC 1F0RA 5EXLA 2R0LA 1ACBE 1EOJA 1C2KA 1FIZA 1S81A 2YNAA 2BY5X 1T8OA 2HVXA 3W94A 1SGEE 5JBAS 5DPAA 2FYRA 1LHFH 1O3PB 3RMLH 2FI5E 2H5CA 1S0QA 1UTLM 4O03A 1PQ8A 1GBDA 4XOJA 1C5RA 2OTVA 2A4RA 3BEIB 1A5IA 1P05A 4YT6H 3SU1A 2ZECA 2PUQH 4Y8YA 1A4WH 1TMBH 5CMXH 1BITA 1MTNB 1UHBB 1DICA 3U69H 1A0LA 1SR5C 2VH6A 3SUEA 2FESH 2J95A 1G3EA 4TY6A 4J1YA 1K1PA 4ZXXH 2ZEBA 2H9EH 3ZZ9A 1TX6A 2UWOA 1AGJA 1GJAB 2JH6D 3CS0A 3JZ1B 1BIOA 2Y82A 2H9TH 1C1NA 2KAIB 4WJG2 5DJ7A 1PYTD 2VGCC 2VINA 4NIXA 1SBWA 4WY3A 3SO3A 3M7UA 5EPNA 1BTHH 2CV3A 3RXJA 1SFQB 1AKSA 1SLVB 3P6ZB 2FOEA 2OCVB 1RXPA 4I8GA 1ELEE 1SGPE 2ALPA 3MO6A 1ZOMA 2VWNA 3A81A 3UNSA 2GCTB 2D8WA 4U32A 3BEUA 3F9EA 4SGBE 3CP7A 1QJ7B 1KLJH 3WY8A 1G32B 1SLUB 1LVMA 4B2AA 3LGIA 1D4PB 1Y3YA 4ABJA 2J34A 1WQSA 1ELGA 2H1UA 1P2QA 4ZHLU 3EA8A 1BMMH 1TGBA 1UTMA 1XUKA 1BTPA 1E35B 2TPIZ 1NN6A 1NRQH 1P03A 4JZFH 1SGNE 2A31A 2EI8A 1NO9H 2VIQA 3OSYA 1AZZA 3FANA 1HYLA 1P3CA 2QIQA 4WMDA 1DXWA 1SG8B 3PMBB 3VXFH 1TNHA 1C4U2 1BCUH 4CR5A 1HAOH 2JH5D 2UWPA 4NSVA 3ZVBA 4TWYA 1C5YB 2RA3A 4NG9H 4X1RU 3V3MA 1ZTLA 1AVGH 2Z9LA 4GAWA 1QRZA 1L4ZA 1SQOA 1TBRH 8GCHF 5DKMA 2P3UB 3B8JA 3P8NA 1O3EA 3TITA 1BQYA 2ESTE 8KME2 5I25A 2ZC9H 1YLCA 1O2YA 1AMHA 2WPIS 4CH8B 1C5OH 4AZ2B 5LH8A 4BANB 1G3CA 1BRCE 1NRSH 1PPFE 3LT3A 3S7KB 1QB1A 2YOLA 2J38A 1G30B 2ZFPH 1WBGB 1IQFA 3LGVA 1XUJA 1KXCA 2C8WB 1FAXA 4X6MA 2J9NA 1WTHD 4I32A 1C2DA 1KXEA 5HM2A 1OYTH 1SLXB 1OS8A 1P2JA 1FV9A 4MVNA 1ZSKA 3RXUA 3SJOA 4B73A 1T8MA 4D9RA 3ZV8A 5EQRA 7LPRA 1SGFG 2ZDLA 3M3VA 2WYGA 4UE7H 4B75A 3ATKA 1ZPZA 1XUGA 1SGCA 1NRNH 2ZCKP 3M61U 1ELAA 1FY5A 1P12E 4OS1A 3SOSA 3PTNA 1WAYB 2OC1A 2FLRH 2ANYA 1OWIA 4LOYH 1T31A 1HLTH 1SGYE 1O32A 4O9VA 3EE0B 3NWUA 4O97A 2Z94A 2XC5A 1ZYOA 4DGJA 5ESBA 1UK4A 1MTNC 1ZPBA 2ZO3H 3GCTF 3GDVA 2P16A 1SHYA 3AAUA 5C20A 1NFXA 3A8AA 2FZZA 3UREA 4B74A 1MUEB 1E38B 3K6YA 2FI4E 1IQHA 1ETTH 1O5CB 3RXCA 4KGAA 1W13U 1K1IA 1G3DA 1GI2A 1KXBA 2PSYA 5SGAE 1P06A 2ZQ1A 4IBLH 1GWAA 2BMGB 1UVSH 5HM9A 1CT0E 2ZTZA 1GMDF 1N8OB 3VB4A 2Q1JA 4H6SB 4JZDH 3A7VA 3A88A 2WUBA 2ALVA 1PYTC 3E90B 2ZHWH 4NZLA 4A92A 3OYPA 2Y5FA 3I77A 4YO9A 3ZVAA 4R8TB 4K69A 2ZG0H 5FHTA 3RXVA 1XVMA 5GJ4B 3KF2A 1B0FA 1Q2WA 3GY3A 1EAXA 1ZMNA 3SQEE 4AFQA 4FUBA 2HWLB 1VJ9U 4XBDA 5JB8S 3SU0A 1KYNA 2A7CA 3RC5A 6GCHG 2V3HH 4X1NU 2B9LA 1QQUA 3F6UH 2HPPH 4K8YA 5JB9S 1EOLA 2G52A 2JKHA 3VB5A 1FIWA 1T32A 4ESTE 1KLIH 2BZAA 1QBNA 2F9PA 3M3SA 3ZZ8A 4WXVA 4X2XA 4MNVA 5FCRA 1THPB 1LPZB 1EQ9A 2Z3DA 4Y10E 3LDXH 1YPLH 1IOEA 2G4UA 8GCHG 1W7XH 1O2OA 3QTVH 5FBEA 4ZKRU 5BPEA 1C9PA 1H8DH 3SUGA 1WU1A 1KLTA 1FN6A 3T26A 4LZ4B 1EX3A 1V3XA 3S7HB 1KDQB 2ZHEH 1MZDA 4E7NA 3GY7A 3ZZ5A 2PR3A 4WH8A 3GY6A 2J92A 1HAVA 4DT7B 1C2GA 2C90B 3A84A 3TIUA 1L1JA 4D7GA 1LVOA 2W3KA 1EPTC 1GHZA 1VITG 2FOGA 1LHEH 3S69A 3RXTA 3SJ8A 1BTUA 4GPGA 3NK8A 3SJIA 7ESTE 4XDEA 4MPWA 1K1NA 1TOCB 2RDLA 1LKBA 9LPRA 4ISOA 2O8MA 1HJAB 1LO6A 1TPOA 2A45B 4IGDA 2BVSH 1IAUA 1ZGVA 1SSXA 1HV7A 4K2YA 1A5GH 3A8CA 4NWKA 3NCLA 1GPZA 1BTYA 2C93B 1A5HA 2GMTC 1PQAA 1Z71A 2PKAA 1G37A 1ZZZA 1TGTA 3ZZ3A 3S9BA 2GDDA 3VEQB 1GHBF 1C5WB 1UTOA 4THNH 2XCNA 3ZZBA 3FFGA 2P8OC 4BAHB 3MMGA 3AW0A 4AFZA 3M7TA 1MU8B 2FI3E 4O3TA 3UUZA 1OWKA 1O30A 1HAGE 2VWMA 2V6NA 1GI7B 1CA0C 1LHCH 1SGDE 2FM2A 1HAVB 1WQVH 2XYAA 3F9GA 1C1MA 2H5DA 3GY5A 1O3NA 1HAPH 1WYKA 2BD9A 1V2RT 1ETRH 3BG4B 1TPSA 3AW1A 1EJAA 4HZHA 4FUGA 1E37B 1U6QA 4IW4E 2I6QA 3P17H 3P70B 9ESTA 3BTTE 1AY6H 1FJSA 1A2CH 2Q6FA 5I46H 6ESTA 1XVOA 1ABJH 1TX8A 3IWMA 4GUXA 1K21H 3HKIB 2O8WA 2CHAB 1VZQH 1W7GH 3VGCC 2QF0A 3HK3B 2P8OB 1L1GA 1GJ7B 3PTBA 4NIVA 3BTME 2GDEH 3T25A 1ID5H 1VJAU 1Y3XA 1GBLA 4ABEA 1QBOA 1V6DA 3CENA 1FN8A 3SU4A 1BBRE 1IQMA 1P2NA 4MQAA 1QBVH 1GJ6A 1T4VH 5JBCS 1XKAC 1ELBA 4I8JA 4O3UA 3RXFA 3ZVDA 1ANEA 1QL8A 8LPRA 3SV6A 1GI5A 5JPMH 1UMAH 1FUJA 2XXLA 2FMJA 2CJIA 2ZDKA 4GCHF 2YNBA 1FPCH 1RFNA 1RS0A 1HBTH 2UUKB 5AFZH 1NU9A 2AH4X 3NPSA 2W3IA 5CE1A 3KNXA 1TIOA 2A7JA 4X2VA 1S84A 2J4IA 2G81E 2AS9A 1FMGA 3O8DA 4ZKNU 4M7GA 2FOBA 5FAHA 5JBBS 2A2XH 1NESE 1MMJN 1RD3B 2PKSB 1UCYK 1IQJA 1MH0A 1WUNH 1D3PB 1O38A 1N1LA 5C5OA 1OX1A 4FU7A 4ZKSU 4BXSA 1N6YA 1XXDA 3MU4A 3F68H 4XBBA 1WSSH 3KEEA 5C67A 3RXAA 4YTAA 2ODQA 3ODFA 4DIIH 5EW2H 5T6DA 1DFPA 1F0SA 1ANBA 3A87A 1Y3WA 3M36A 3KQDA 1BZXE 1GI9B 1C1WH 1HJ8A 1VGCC 1RGQA 1T8NA 2XBVA 3QUMP 3BIVH 1GBCA 3DUXH 1SB1H 1V2TT 3O8BA 1OP2A 2ZDMA 2BYAX 2ZTYA 3B9FH 1FNIA 3RMNH 4MTBA 1EATA 2VIDA 2A5AA 2ZNKH 3VB6A 1YYY1 3LGUA 4NZQA 4I8HA 4WMFA 2ZU4A 3V7TA 1ELTA 4DY7B 1C5LH 4NFEA 1IHSH 3A86A 2A7HA 4YLQH 2ANWA 4MNYA 1LQDB 1LCYA 3E1XB 2V3OH 1LVYA 2LNCA 5C1YA 3S9AA 2PW8H 2VIOA 1ANDA 2ZGHA 3TLOA 5DP9A 1SHHB 1P3EA 2DE8A 2VWOA 3GCHB 1DLKB 2AIQA 1Q31A 5TCCA 3K2UA 3SGQE 4LZ1H 2AMPA 3SJ9A 2ZFSA 1QL9A 2W26A 1H9IE 4BAMB 1GI4A 4KTUA 3D62A 1GDQA 1YCPM 2AIPA 1W8BH 1QURH 1AB9C 1ELDE 2BXTH 1YPJH 1GBJA 2FTMA 2DUCA 1B5GH 2WPMS 1O5BB 4ZHMU 1NTPA 4UFEH 1RTKA 2GX4A 3MFJA 4JMYA 1O2LA 3SU2A 4AFSA 4FU8A 1SC8U 5FPTA 2QA9E 1GBBA 1EAIA 1S0RA 5J4SA 3RXOA 2RA0A 4OS2A 3SV7A 1GBEA 2ZCHP 1GBFA 1S6FA 2BB4A 1ESTA 2ZFRH 1W0ZU 3KQCA 5L2ZH 1Z8IB 2D26C 2C8YB 1C2LA 1C1TA 5PTPA 3Q00A 3KL6A 1F5RA 2PV9B 1DE7H 1PQ5A 1GCTC 3OY5U 2Y7ZA 3LKWA 3V0XA 1MCVA 2GKVE 2HALA 4ZMAH 1V2LT 2G00A 4K3JA 2BVXH 2SGAA 1C5XB 1MKWH 1RTLA 1QL7A 1FY4A 3D65E 2F9UA 2BDAA 4E05H 1HJAC 3N7OA 3SGBE 1YCPK 2XNIA 1WOFA 2XC4A 4NCYA 3A83A 3O8CA 1YBWA 5L6NH 1O3HA 1VITF 2C3SA 1C1PA 1TB6H 5ESTE 1HNEE 2AGGX 4KKDA 4UDWH 1X7AC 1H8IH 3P92A 1GBIA 3LJOA 4GSOA 5ETXA 1O2SA 4BTTB 7KMEH 2Z9KA 2GZ9A 3MI4A 1AKSB 4A1XA 3HATH 2PKAB 2HNTC 1SGQE 5C3NA 2IJOB 4FXGH 1DY9A 2XWAA 2OXSA 1CGJE 3T29A 5FX6A 2WPHS 1Z6JH 1EZXC 1P02A 4INKA 2FEQH 3MU5A 1YLDA 1C2IA 3ATLA 4UEHH 3GDUA 2QXIA 1GJDB 1DUEA 4B2BA 3RXBA 3T5FH 1BRBE 1O5GH 1C5TA 1V2UT 3Q3XA 1K22H 2SNVA 4X8UH 4FUFA 1ESAA 5B6OA 3H5CB 1V2ST 3MU1A 3SU5A 2G8TA 5L30H 3QTOH 4K1EA 3LGYA 4GLYA 1JIMA 5CHAB 1TRMA 2BXUH 2BQWB 3UR6A 3P8FA 3LC5A 4CRFA 1O3CA 1DUAA 2QAAA 2QXJA 4E7RG 4BTUB 1BBRK 2A4GA 1QR3E 1DSTA 1AIXH 3LGWA 1YKTA 3KQEA 5F8TA 3RXPA 1NFYA 1ZJDA 3PLBA 1DWEH 1SLWB 2PFEA 3GCHC 1QRXA 3A7ZA 3L3TA 1O5AB 2PWXA 3LH1A 4VGCB 3Q77A 3K65B 3OX7U 3EGKH 1S5SA 3TH4H 5A2MH 4Y76A 2BDCA 1CHGA 3RXDA 3RLYH 4GHTA 4FVDA 4Y0ZE 3SORA 1CU1A 5EG4A 3TK9A 4K5ZA 3ESTA 2Y81A 5GCHF 2Z3EA 4NSYA 3BSQA 4AGKA 1GVKB 1DANH 1O2GH 3GOVB 5EQQA 3FZDA 2KAIA 2GV7A 4X0WU 2A5IA 1NT1A 3DFJA 1OSSA 4ABIA 1C9TA 2OBQA 4U2WA 1HDTH 5JYIA 1OOKB 4CHAC 1J8AA 1TWXB 1JRTA 1QNJA 1SMFE 4NA9H 2GV6A 1O3KA 2B0FA 4YLUA 3RM0H 1GDNA 2W7UA 4UFGH 1Y5BT 5EPYA 1K1LA 3D23A 2F91A 1ZTKA 2STAE 2BDHA 3SNEA 2W5EA 4TWWA 3RU4E 3FVFB 1BJUA 1DM4B 3SNAA 1BOQA 3U8OH 1P8VC 4MLFB 3UQOA 1YPHE 5E0GA 1PJPA 2ZHQH 3T62A 1OWDA 4ABDA 1LHDH 2QCYA 2OC8A 1C5SA 2DE9A 3SNBA 8ESTE 4FVBA 4OS4A 1D6WA 1EP5A 2F83A 4FUCA 1GGDB 1O2RA 2UWLA 1T8LA 1TOMH 1HAXB 2FLBH 3MH7A 1TQ0B 1BT7A 1LTOA 1HCGA 4TYDA 1OWEA 1RRKA 2XRCA 3GY8A 2Y5HA 1DX5M 3UWJH 3ZVCA 3P95A 1TA2A 1RTFB 2ZHFH 3T28A 4BNRA 3GCTG 4XFQA 1EJMA 1VITH 3MH5A 3PO1B 1UVPA 1HGTH 1UTJA 1GG6C 1GCTB 3EYDA 1VR1H 2IN2A 5AFYH 5EGMA 1D3TB 1QY6A 4Y8ZA 2FS9A 1FPHH 1A3BH 3VGCB 1AWHB 2NU3E 2CHAC 1GHWH 1CO7E 1E0FD 1HRTH 1FY8E 2VNTA 2ZFFH 4ISHH 1D6RA 3MO9A 3ZZAA 3EAJA 3I78A 1LPKB 4BTIB 1A1RA 1N6XA 4ABHA 1UTQA 1H9HE 2VIWA 1CQQA 5EQSA 1S82A 5J4QA 4RKOB 1QB6A 4IMQA 4X2WA 1GJ4H 2ZCLP 3NUMA 3TJNA 4ISLA 4I33A 5LPFA 4BAKB 5G4BA 4TY7A 1C1SA 1TNJA 1JBUH 2GGVB 1EP6A 1MU6B 1GMHG 2F9NA 2QY0B 2OP9A 1AUTC 4YZUA 7GCHG 2HGTH 2V35A 4WMEA 4D76A 6LPRA 2BLWA 1TX7A 2H6MA 3U98H 2NU1E 3MOCA 1EB1H 2ZHDA 3BG8A 2FDAA 1ORFA 1GMCG 2VB0A 3VXEH 3BTGE 1HAHH 1O0DH 1O2PA 3BTQE 1O3OA 1GDUA 5HGGA 1FZZA 3SU3A 1O3AA 1MAXA 1HXEH 2VU8E 3S9CA 4X1SU 2BD8A 2P95A 4I7YH 4TPIZ 1KDQA 1ZRKA 1YCPH 5DGJA 1O5FH 2VVCA 3L6PA 1IHTH 4AOQA 3C27B 1OXGA 1V2KT 2Q6GA 1WTGH 4K1SA 3KGPA 2O8UA 4FUJA 3KQBA 2ZU2A 2PHBA 1DXPA 3HK6B 3PMHB 4KTCA 5F8ZA 1BRUP 3TGJE 2HLCA 3GYLB 1GBKA 2VGCB 4MNXA 1W12U 2A4QA 2RCEA 1QQ4A 1RJXB 3ATIA 1NM6A 3QO6A 5CHAC 2QXGA 4CRAA 2OC7A 1YC0A 1YP9A 4MPVA 1W0YH 3QWCH 3V12A 1JOUB 2BDIA 1Y3UA 3SZNA 1QA7A 3LIWA 1MD8A 1BMLA 2R9PA 1V2VT 3MH4A 1NROH 3ATWA 4KTSA 3A8DA 1MKWK 1QB9A 1XXFA 3EA9A 4A1VA 3BEFB 2GVFA 5HMAA 1C2MA 1O39A 1F0UA 3QGJA 1ESBA 2SGQE 4GVUA 1MCTA 1QCPA 1TE0A 3UOUA 1UTPA 3F9FA 3AVZA 1BBRH 1K28D 1C2HA 2NU0E 3SJKA 1GL1A 4FUIA 2K1QA 1C2FA 1INCA 2AMQA 1BUIA 3DT0H 3VPKA 2TRMA 1BA8B 2Y5GA 4DJZB 5JDUB 2BOHB 2A0QB 1OKXA 1RIWB 1AI8H 2C8XB 1AFQC 2J2UA 3UOPA 4X2YA 4X6NA 1P2KA 2AEIH 1A7SA 4CRGA 5A8YA 1YPHC 1B0EA 1J9CH 4CREA 2C4FH 2FXRA 1P2MA 1O5DH 4JZ1A 1C1UH 3E8LA 1PPZA 1GHAF 3EQ0H 4B1TA 1QJ6B 1WCZA 3BTEE 1V2MT 3S0NA 2BD2A 4FUDA 2A2QH 3PWBA 1HIAA 3T2NA 1W11U 5A0BA 3M5OA 2XBWA 1QGFA 3QZRA 4BOHA 2CF9H 1BHXF 3AAVA 2BLVA 5C2ZA 3URDA 1IQIA 3H7OA 4A7IB 1BMAA 1TPAE 1ELFA 1BDAA 4DW2U 1MTWA 1GHVH 1K2I1 2OC0A 2ZU3A 2AFQB 2FOFA 3LPRA 4NIWA 1ELVA 1OWHA 2ZP0H 2PSXA 4I8LA 2D1JA 3RXRA 4DOQA 5DP5A 1K1OA 1L0ZA 1JRSA 2XCFA 4X1QU 1CVWH 3MO3A 1O2TA 2EI6A 1CSOE 2ZGBH 3A7TA 3RXMA 4ABFA 1C5NH 3UQVA 3GDSA 1ZMLA 1CA0B 3U1IB 3FAOA 2O8LA 4NWLA 2Y6TA 2GT8A 1TAWA 2GCHG 4UFFH 1UO6A 1Y5UT 1HAYB 1G3BA 3TJOA 4INLA 4U30A 2GD4B 1HPGA 3UNQA 2CGAA 4JYUH 2SFAA 4BAQB 1Z8JB 1CT4E 4MDSA 2TIOA 2PTCE 1DY8A 1XUFA 2Z6BD 5DP4A 1KXAA 1SOTA 4Y0YE 3MU0A 2GMTB 5BRRE 3M7QA 3OU0A 2BDGA 1A46H 1O2HA 1DPOA 1J15A 3E6PH 3GICB 2GP9B 1EASA 2WPJS 1EAUA 5A8XA 1DWDH 1SGIB 1TA6A 4K60A 4IMZA 1O35A 3UPEA 2QN5T 2BM2A 1TONA 2STBE 3ZV9A 1AVWA 1UCYH 1TGSZ 3KHVA 4AGJA 4WVPE 1C5UA 5F8XA 3L33A 3PMJA 1AUJA 1JMOH 4H6TA 4NGAH 3RU4T 3TJVA 2G5VA 2ANKH 4KP0A 2V0BA 3A82A 5FBIA 2EC9H 2JETC 4Y6DA 2ZGCA 3O8RA 1LDTT 3ZZ4A 1G2MA 5FPSA 1PPHE 1DWCH 5T6GA 2FP7B 4X8TH 1O2QA 1ZGIA 2LPRA 3ELAH 3MH6A 2FODA 2CMYA 1Z1JA 1TNLA 5JBTA 5GWZA 5A8ZA 4TPYA 3RXSA 5A09A 1ETSH 5FCKA 2FOMB 2HRVA 2B7DH 2BD4A 1H9LB 3QK1A 4BAOB 1V2NT 4DURA 1W10U 3LJJA 2BY6X 2EI7A 1CHOF 2HOBA 1TALA 1DITH 3BF6H 3SW2B 3E91A 1XX9A 1P9SA 2EA3A 1GI6A 1C4Y2 1KIGH 2ZU5A 4OS5A 1AN1E 4IN2A 5F03A 1QIXB 5FX5A 1KTSB 3RUOA 4RN6A 1MTSA 2R2WU 3SNCA 3A80A 4KELA 1GI8B 3F1SB 1O2NA 1Y5AT 2NU4E 3SV9A 5FPYA 1GJ5H 3A89A 4HTCH 2ZTXA 1HB0B 3UY9A 1GJ9B 3MYWA 2HNTE 1O2JA 2WUCA 4ISNA 4Q7ZA 1YPGH 1V2QT 2FPZA 3RXEA 3RXQA 2GZ8A 3BV9B 2IPHA 1TFXA 2WINI 5E0JA 4AFUA 1A0JA 2CF8H 1JWTA 4XSKU 1TYNA 3STJA 4CR9A 1BTWA 1D3QB 3TVJB 3DD2H 1C5PA 1QA0A 5E8EH 1V2WT 1LKAA 2BDBA 2R2MB 1AE8H 1C1VH 5T6FA 2UUFB 3LC3A 2VWLA 1O3JA 3RDZA 1IQNA 2FTLE 2C8ZB 3ZYEA 1ZLRA 1SPJA 2ZI2H 1NRPH 3PLKA 3BG4C 3MNCA 4D9QA 1DVAH 1FDPA 1TRYA 3RLWH 2ZWLH 1MAYA 2ODPA 3BN9A 4NFFA 4Y7AA 2ZF0H 3HGPA 4B76A 1YPKH 1SL3A 1OP8A 4CRBA 1KTTB 4A5TS 2BVRH 1K9OE 2EEKA 2SGEE 1EZSC 4YT7H 1K1JA 1OP0A 3QLPH 2VH0A 1TQ7B 1PQ7A 3DFLA 3ZVFA 1AE5A 1O3BA 3RXGA 4I8KA 2Q6DA 4RSPA 1F5LA 3PO1C 1J14A 3DA9B 2ZFQH 2JETB 2BLQA 3P8OA 3RXLA 1G36A 1PPCE 3LOXA 3URCA 3UIRA 4YOGA 1KY9A 2R0KA 3GCNA 2Z9IA 3HKJB 3TGIE 5HXFA 1CBWC 3A85A 3I29A 3OY6U 1P09A 2A4OA 3DHKH 4AG1A 1S85A 2VVVA 1PPEE 1DT2A 4AYVB 1TRNA 1GJ8B 1TBQH 4UFDH 3MWIU 1ZHPA 4X6PA 1NZQH 4JCNA 2P3FH 3MHWU 4XBCA 4Y7BA 3RM2H 1DOJA 4WH6A 1C2JA 4JK5A 4IC6A 1SGFA 1TLDA 1EJNA 1YGCH 2F3CE 1L4DA 1M9UA 1XUIA 4X8SH 3FZZA 3BTDE 1GHAG 5E2OA 1ZJKA 1LPGB 3NZIA 3TNTA 2ZDNA 1C5VA 1TPPA 1SGTA 4X1PU 3ATMA 1FAKH 4DCDA 4Y71A 5ABWA 3KIDU 5A0AE 1Z8GA 5GIBA 2QYIA 7GCHF 1GMDG 2F9BH 4F49A 1B7XB 3SBKA 4YOIA 5C1UA 1UJ1A 3B23B 3RMOH 4J2YB 4DIHH 4OS7A 2GTBA 3VFEA 3UTUH 1GL0E 4JZEH 1AVXA 2OQ5A 3NKKA 1UVOA 3BIUH 1C5ZB 1ZR0A 1ZSLA 1AQ7A 1FXYA 3TH3H 5GXPA 1QJ1B 4Z6AH 3QX5H 2ZDVH 4Y8XA 1QRWA 2OLGA 1TMTH 3BTWE 4DG4A 4MNWA 1OPHB 2D2DA 3A7WA 5EW1H 2AGIX 2QGRA 2ZU1A 2QF3A 4H42U 1O2MA 5AHGH 3K9XB 3OTJE 1EB2A 1GCDA 3U1JB 1GG6B 3PMAB 2B5TB 5T3HA 2GCHF 1GMCF 3SHCH 2ODYB 2ZFTA 2ZDAH 4GCHG 1ZHRA 1ZMJA 4MPXA 3E3TA 1XUHA 1BB0B 4X6OA 3RXHA 1Z8RA 4U01A 4AN7A 5LGOA 3STIA 3TGKE 3P8GA 1PFXC 3ZVEA 1CE5A 1YM0A 1ARCA 1Z7KA 1IQEA 1QFKH 2OD3B 5EOKA 1S83A 3PM3A 1VGCB 1TGNA 1ANCA 1EPTB 1TNIA 3A8BA 4K1TA 1UVTH 3E0PB 1HXFH 1GVLA 1BMNH 5IYTA 4B2CA 1O2WA 2AERH 1J17T 1ZPCA 3RXIA 2VIVA 1HIAB 4XE4A 2BD5A 3QN7A 4Q7XA 1FQ3A 1GI3A 1MKXH 1S6HA 1YPEH 2XBYA 4AB8A 1NFUA 4FU9A 2G5NA 1G9IE 2BZ6H 3TK6A 2ZPSA 1H1BA 3TH2H 2RG3A 3BTHE 1AO5A 3V13A 1EAWA 4JK6A 1NC6A 1LQEA 1AFEH 1Z6EA 4OGYA 1MKXK 1GBHA 2GZ7A 1O3DA 1VCWA 1GBTA 1TABE 1XM1A 2BD7A 2ZGJA 4CRDA 3T27A 6CHAC 2Z7FE 3M35A 2ZPQA 2O9QA 3PLPA 1GI1A 3SUDA 4ZXYH 1FY1A 4Q80A 5DK1A 1SOZA 4Q2KA 1AZ8A 1SQTA 4ISIH 4D7FA 4JYTA 1LHGH 1MQ6A 5E0HA 5L2YH 4INHA 2TBSA 1O3LA 2Y7XA 1DDJA 4ZKOU 1P2IA 1P2OA 3SQHE 3MTYA 3PB1E 4E06H 1JXPA 2PGBB 2BQ7B 1O3IA 5LPEA 1O37A 5EODA 2PTNA 3MU8A 4FUHA 3ZVGA 3M37A 2QV1A 2UUJB 3VB7A 2XW9A 4UD9H 4YOJA 1BTXA 1PPGE 4K8BA 2H9HA 3SI4H 1MBMA 1P04A 4VGCC 1AU8A 2ILNA 4AG2A 3A7YA 2SGFE 3EDXB 3TNSA 1O2IA 3E16B 4LK4A 1CT2E 1H4WA 5EXNA 2R3UA 2FO9A 5GPIB 1MD7A 4BXWA 3IG6B 1DWBH
chains in the Genus database with same CATH superfamily
2BDYA 1XKBC 3EA7A 1K1MA 1BRAA 1O5EH 3M5MA 2BD3A 3HGNA 2M5TA 1O3MA 1O2KA 2P93A 4AORA 1O3FA 2SGPE 2ZGXH 1TGCA 5DP8A 2BY7X 1EXFA 1IQLA 1W3CA 3A7XA 1O33A 4HFPB 1MTVA 4MG3A 4XRNA 1OYQA 3LGTA 2OUAA 2EY4C 3SUFA 1LMWB 1P0SH 2H2ZA 2SGDE 1W2KH 2FOCA 3PWCA 5C0TA 3RU4D 2KCAA 2BOKA 3F9HA 1T4UH 4ABGA 1O36A 3SV2H 1QHRB 1EKBB 2ZPRA 3M5LA 3JZ2B 1SGRE 4ZH8A 2TGDA 3SHAH 1FY3A 1UK2A 4WXIA 1A0HB 2BX3A 4SGAE 3EE7A 3U8RH 2IOTA 5DG6A 3Q76A 3GYMA 1GI0A 1E34B 2ANMH 2QXHA 4RKJB 1IQGA 4IC5A 1AWFH 4NA8A 3U8TH 2SNWA 5DP7A 1F5KU 2A1DB 3G01A 2G55A 1CBWB 1GVZA 2KR7A 1GGDC 1NU7B 1ZTJA 4QT8C 2FX6A 4Y11E 2F9VA 3ZYDA 5AVDA 4A6LA 2TGTA 1TBZH 1D3DB 5F6MA 1A61H 2JH0D 1Q3XA 3OEHD 4M9FA 3UAIC 3QDZB 1HAIH 3ENSB 4CBNA 6CHAB 3RMMH 1DS2E 2WYJA 1UCYE 5IDKA 4JZIA 1P10A 1UK3A 2K0QA 2KCYA 2WV9A 3R0FA 2WPDD 3H7TA 4ASHA 3SV8A 3QGNB 1ZHMA 1LVBA 1UTNA 4ZROA 2FX4A 2PKSC 3CS7A 2AYWA 2P3TB 1UHBA 1YPMH 3TJUA 4ZUHA 1EUFA 1ABIH 1GHBG 4HI3A 1Z1IA 4AB9A 3ZZ7A 3GY2A 1GBAA 4CHAB 1O3GA 2Z3CA 5A0CA 4YXWD 4UONA 1BTZA 2NWNA 4OS6A 4D8NA 1KSNA 4YESB 3TPIZ 1AB9B 2CXVA 1D9IA 2QC2A 1ZSJA 5EU8A 3UR9A 1GHYH 5TCAA 2WV4A 5TJXA 1GBMA 1MZAA 3QZQA 5DO4H 4ZHAA 4A1TA 1NFWA 5LPRA 1GMHF 4AX9H 4MPUA 1QTFA 3FP7E 5FXLA 3MNSA 2GCTC 2A5KA 2G4TA 2OBOA 2P59A 2FOHA 2HNTF 1J16A 3KCGH 1DSUA 1P57B 3LONA 2FYQA 3SNDA 2Z9JA 1CA8B 1Y3VA 2RFKC 1BHXB 1MTUA 5HYOA 3WWBA 1O2XA 2QE7D 3Q3KA 4B71A 3RC6A 3DSGA 4ZAEA 2A32A 1NY22 2AMDA 3SU6A 2Z9GA 1VCPA 2OQUA 4IS5A 1SQAA 2VIPA 4FUEA 1WV7H 4PROA 1C5MD 2BHGA 3TU7H 1EZUC 1NRRH 2F9OA 3RP2A 4B6FA 2PUXB 4WWYA 1NS3A 1EPTA 2PGQB 4Z0KA 5GCHG 2ASUB 4OGXA 2YMSD 4P02A 3M3TA 6GCHF 2ZQ2A 1OWJA 2R3YA 1ARBA 2CN0H 5DP3A 5H4IB 1C5QA 4ABAA 2ZZUH 3VB3A 2TGPZ 3NXPA 1A3EH 2VJ1A 5DP6A 5K7RA 1THSH 2BQ6B 1WDIA 4WF8A 1L1NA 1HUTH 2W6ID 1YF4A 1C1OA 1T7CA 2P94A 2PLXA 1EZQA 1F92A 3SI3H 3PROA 4Y79A 5EXMA 5C5NA 1HJ9A 1TNKA 3ZZCA 1TMUH 5C1XA 3ITIA 4JYVH 4CRCA 3GY4A 3E0NB 1GJCB 3K6ZA 4NIYA 2FS8A 1GJBB 2J94A 3U9AH 2BY9X 4F4OC 5AF9H 1KXFA 1C1RA 1SI5H 2ULLA 4Q7YA 2B8OH 2ZIQH 2VVUA 1P9UA 2WPKS 1C1QA 1UVUH 2XC0A 3BTFE 3PYHA 3Q3YA 4ABBA 1G2LA 1O31A 3UFAA 1F0TA 3KN2A 3AASA 3ODDA 1O2ZA 4GHQA 1TNGA 2IJD1 2BX4A 2WPLS 1AHTH 2THFB 1V2JT 2FIRH 4P00A 4AYYB 1Y59T 3C1KA 1S6LA 2XBXA 4R0IA 2I6SA 3SGAE 1CHOG 2BLOA 3DSPA 2ZKSA 3SN8A 4TT3D 1CGIE 3MNXA 2BY8X 3PV4A 3ZZ6A 3HPTB 4I31A 5E2PA 2XTTB 1UTKA 2TGAA 3FP8E 2V3MA 2GT7A 1MQ5A 2O8TA 3GISB 1O2UA 2OK5A 2J5UA 3RC4A 4HGCA 4LXBH 1O2VA 4Q4LA 4H4FA 2NU2E 4NA7A 1C4V2 3ZZDA 2UUYA 1FLEE 1SFIA 3M5NA 5K0HA 1MBQA 1HFDA 2FOAA 3W95A 1FX0B 4IN1A 1SVPA 1IQKA 1THRH 2OINA 4TSFD 3UNRA 3KYFA 1C2EA 1V2PT 1BMFD 1P01A 3UWIA 5KEDA 1NPMA 1CGHA 2W7SA 2BTCE 2HPQH 4DVAU 3D49H 1V2OT 1KXDA 3GCOA 2WV5A 4YM9A 1W14U 3TK5A 1F2SE 3IITA 3LH3A 1F7ZA 2G51A 2JJ2D 4CBOA 2AGEX 1E36B 4CH2B 4F55A 1KMHB 2FWWA 1L2EA 1PPBH 3R3GB 1DLEA 3FP6E 1O34A 3LU9B 3PRBA 1VCQA 1FI8A 3MNBA 4X8VH 1ZRBA 1XMNB 1BJVA 2XWBI 3RXKA 1ELCA 2ZA5A 1FONA 1JIRA 2Y80A 5GDSH 1HAZB 1GHXH 1AD8H 1P11E 1AFQB 1Y8TA 3BTKE 1N8OC 1RIWC 1F0RA 5EXLA 3F0OA 2R0LA 1ACBE 2KCOA 1EOJA 1C2KA 1FIZA 1S81A 2YNAA 2BY5X 1T8OA 2HVXA 3W94A 1SGEE 5JBAS 1H8ED 2FYRA 1LHFH 1O3PB 5DPAA 3RMLH 2FI5E 2H5CA 1S0QA 1UTLM 4O03A 1PQ8A 1GBDA 1OHHD 4XOJA 1C5RA 2OTVA 2A4RA 3BEIB 1A5IA 1P05A 4YT6H 3SU1A 2ZECA 2PUQH 4Y8YA 1A4WH 1TMBH 5CMXH 1BITA 1MTNB 1UHBB 1DICA 3U69H 1A0LA 1SR5C 2VH6A 3SUEA 2M2AA 2FESH 2J95A 5C17A 1G3EA 2WHXA 4TY6A 4J1YA 1K1PA 4ZXXH 2ZEBA 2H9EH 3ZZ9A 1TX6A 2UWOA 1AGJA 1GJAB 2KX4A 2JH6D 3CS0A 3JZ1B 1BIOA 2Y82A 2H9TH 4FETA 5EJLA 1C1NA 2KAIB 3DSOA 4ZCNA 4WJG2 5DJ7A 1PYTD 2VGCC 2VINA 4NIXA 1SBWA 4WY3A 3SO3A 3M7UA 5EPNA 1BTHH 2CV3A 3RXJA 1SFQB 1AKSA 1SLVB 3P6ZB 2FOEA 2OCVB 1RXPA 4I8GA 1ELEE 1SGPE 2ALPA 3MO6A 1ZOMA 2VWNA 3A81A 3UNSA 3VG8A 2GCTB 2D8WA 4U32A 3BEUA 3F9EA 4SGBE 3CP7A 1QJ7B 1KLJH 3WY8A 1G32B 1SLUB 1LVMA 4B2AA 3LGIA 1D4PB 1Y3YA 4ABJA 2J34A 1WQSA 1ELGA 2H1UA 1P2QA 4ZHLU 3EA8A 1BMMH 1TGBA 1UTMA 1XUKA 1BTPA 1E35B 2TPIZ 1NN6A 1NRQH 1P03A 4JZFH 1SGNE 2A31A 2QF4A 2EI8A 1NO9H 2VIQA 3OSYA 1AZZA 2YMSB 3FANA 3ZIAD 1HYLA 1P3CA 2QIQA 4WMDA 1DXWA 1SG8B 3PMBB 4HG6A 1TNHA 3VXFH 1C4U2 1BCUH 4CR5A 1HAOH 2JH5D 2UWPA 4NSVA 3ZVBA 4TWYA 1C5YB 2RA3A 3F3BA 4NG9H 4X1RU 4FOUC 3V3MA 1ZTLA 4I86A 1AVGH 2VBCA 2Z9LA 4GAWA 1QRZA 1L4ZA 1SQOA 1TBRH 8GCHF 5DKMA 2P3UB 3B8JA 3P8NA 1O3EA 3TITA 1BQYA 2ESTE 8KME2 5I25A 2ZC9H 1YLCA 1O2YA 1AMHA 2WPIS 4CH8B 1C5OH 4AZ2B 5LH8A 4BANB 1G3CA 1BRCE 1NRSH 1PPFE 3LT3A 3S7KB 1QB1A 2YOLA 2J38A 1G30B 2ZFPH 1WBGB 1IQFA 3LGVA 2L6OA 1XUJA 1KXCA 2C8WB 1FAXA 4X6MA 2J9NA 1WTHD 4I32A 1C2DA 1KXEA 5HM2A 1OYTH 1SLXB 1OS8A 1P2JA 1FV9A 4MVNA 1ZSKA 3RXUA 3SJOA 4B73A 1T8MA 4D9RA 3ZV8A 5EQRA 7LPRA 1SGFG 2ZDLA 3M3VA 2WYGA 4UE7H 4B75A 3ATKA 1ZPZA 1XUGA 1SGCA 1NRNH 2ZCKP 3M61U 1ELAA 1FY5A 1P12E 4OS1A 3SOSA 3PTNA 1WAYB 2OC1A 2FLRH 2ANYA 1OWIA 4LOYH 1T31A 1HLTH 1SGYE 1O32A 4O9VA 3EE0B 2GJGA 3NWUA 4O97A 2Z94A 2XC5A 1ZYOA 4DGJA 5ESBA 1UK4A 1MTNC 1ZPBA 2ZO3H 3GCTF 3GDVA 2P16A 1SHYA 3AAUA 5C20A 1NFXA 3A8AA 2FZZA 3UREA 4B74A 1MUEB 1E38B 3K6YA 2FI4E 1IQHA 1ETTH 1O5CB 3RXCA 5CDFE 4KGAA 1W13U 1K1IA 1G3DA 1GI2A 1KXBA 2PSYA 5SGAE 1P06A 2ZQ1A 4IBLH 1GWAA 2BMGB 1UVSH 5HM9A 1CT0E 2ZTZA 1GMDF 1N8OB 2J97A 3VB4A 2Q1JA 4H6SB 4JZDH 3A7VA 3A88A 2WUBA 2ALVA 1PYTC 3E90B 2ZHWH 4NZLA 4A92A 3OYPA 2Y5FA 3I77A 4YO9A 3ZVAA 4R8TB 4K69A 4Q63A 2ZG0H 5FHTA 3RXVA 3WW7A 1XVMA 5GJ4B 3KF2A 1B0FA 1Q2WA 3GY3A 1EAXA 1ZMNA 3SQEE 4AFQA 4FUBA 2HWLB 1VJ9U 4XBDA 5JB8S 3SU0A 1KYNA 2A7CA 3RC5A 6GCHG 2V3HH 4X1NU 2B9LA 1QQUA 3F6UH 2HPPH 4K8YA 2QF5A 5JB9S 1EOLA 2G52A 2JKHA 3VB5A 1FIWA 1T32A 4ESTE 1KLIH 2BZAA 1QBNA 2F9PA 3M3SA 3ZZ8A 4WXVA 4X2XA 4MNVA 5FCRA 1THPB 1LPZB 1EQ9A 2Z3DA 4Y10E 3LDXH 1YPLH 1IOEA 2G4UA 8GCHG 1W7XH 1O2OA 3QTVH 5FBEA 4ZKRU 5BPEA 1C9PA 1H8DH 3SUGA 1WU1A 1KLTA 1FN6A 2AHME 3T26A 4LZ4B 1EX3A 1V3XA 3S7HB 1KDQB 2ZHEH 1W0KD 1MZDA 4E7NA 3GY7A 3ZZ5A 2PR3A 4WH8A 3GY6A 2J92A 2J98A 1HAVA 4DT7B 1C2GA 2C90B 3A84A 3TIUA 1L1JA 4D7GA 1LVOA 2W3KA 3FN8A 1EPTC 1GHZA 1VITG 2FOGA 1LHEH 3S69A 3RXTA 3SJ8A 1BTUA 4GPGA 3NK8A 3SJIA 7ESTE 4XDEA 4MPWA 1K1NA 1TOCB 2RDLA 1LKBA 9LPRA 4ISOA 2O8MA 1HJAB 1LO6A 1TPOA 2A45B 4IGDA 2BVSH 1IAUA 1ZGVA 1SSXA 1HV7A 4K2YA 1A5GH 3A8CA 4NWKA 3NCLA 1GPZA 1BTYA 2C93B 1A5HA 2GMTC 1PQAA 1Z71A 2PKAA 5F53A 1G37A 1ZZZA 1TGTA 3ZZ3A 3S9BA 2GDDA 3VEQB 1GHBF 1C5WB 1UTOA 4THNH 2XCNA 3ZZBA 3FFGA 2P8OC 4BAHB 3MMGA 3GS9A 3AW0A 4AFZA 3M7TA 1MU8B 2FI3E 4O3TA 3UUZA 1OWKA 1O30A 1HAGE 2VWMA 2V6NA 1GI7B 1CA0C 1LHCH 1SGDE 2FM2A 1HAVB 1WQVH 2XYAA 3F9GA 1C1MA 2H5DA 3GY5A 1E79D 1O3NA 1HAPH 1WYKA 2BD9A 1V2RT 1ETRH 3BG4B 1TPSA 3AW1A 1EJAA 4HZHA 4FUGA 1E37B 1U6QA 3F2FA 4IW4E 2I6QA 3P17H 3P70B 9ESTA 3BTTE 1AY6H 1FJSA 1A2CH 2Q6FA 5I46H 6ESTA 1XVOA 1ABJH 1TX8A 3IWMA 4GUXA 1K21H 3HKIB 2O8WA 2CHAB 1SKYE 1VZQH 1W7GH 3VGCC 2QF0A 3HK3B 2P8OB 1L1GA 1GJ7B 3PTBA 4NIVA 3BTME 2GDEH 3T25A 1ID5H 5EJZA 1VJAU 1Y3XA 1GBLA 4ABEA 1MABB 1QBOA 1V6DA 3CENA 1FN8A 3SU4A 1BBRE 1IQMA 1P2NA 4MQAA 1QBVH 1GJ6A 1T4VH 5JBCS 1XKAC 1ELBA 4I8JA 4O3UA 3RXFA 3ZVDA 1ANEA 1QL8A 5HIZA 8LPRA 3SV6A 1GI5A 5JPMH 1UMAH 1FUJA 2XXLA 2FMJA 2CJIA 2ZDKA 4GCHF 2YNBA 3PRDA 1FPCH 1RFNA 1RS0A 1HBTH 2UUKB 5AFZH 1NU9A 2AH4X 3NPSA 2W3IA 5CE1A 3KNXA 1TIOA 2A7JA 4X2VA 1S84A 2J4IA 2G81E 2AS9A 1FMGA 3O8DA 4ZKNU 4M7GA 2FOBA 5FAHA 5JBBS 2A2XH 1NESE 1MMJN 1RD3B 2PKSB 1UCYK 1IQJA 1MH0A 1WUNH 1D3PB 1O38A 1N1LA 5C5OA 1OX1A 4FU7A 4ZKSU 4BXSA 1N6YA 1XXDA 3MU4A 3F68H 4XBBA 1WSSH 3KEEA 5C67A 3RXAA 4YTAA 2ODQA 3ODFA 4DIIH 5EW2H 5T6DA 1DFPA 1F0SA 1ANBA 3A87A 1Y3WA 3M36A 3KQDA 3OTPA 1BZXE 1GI9B 1C1WH 1HJ8A 1VGCC 1RGQA 1T8NA 2XBVA 3QUMP 3BIVH 1GBCA 3DUXH 1SB1H 1V2TT 2L74A 3O8BA 1OP2A 2ZDMA 2BYAX 2ZTYA 3B9FH 1FNIA 3RMNH 4MTBA 2RDEA 1EATA 2VIDA 4AC9A 4ACAA 2A5AA 2ZNKH 3VB6A 1YYY1 3LGUA 4NZQA 4I8HA 2WSSD 5IK2D 4WMFA 2ZU4A 3V7TA 1ELTA 4DY7B 1C5LH 1K0HA 4NFEA 1IHSH 3A86A 2A7HA 4YLQH 2ANWA 4MNYA 1LQDB 1LCYA 2KM0A 3E1XB 2V3OH 1LVYA 2LNCA 5C1YA 3S9AA 2PW8H 2VIOA 1ANDA 2ZGHA 3TLOA 5DP9A 1SHHB 1P3EA 2DE8A 2JJ1D 2VWOA 3GCHB 1DLKB 2AIQA 1Q31A 5TCCA 3K2UA 3SGQE 4LZ1H 2AMPA 3SJ9A 2ZFSA 1QL9A 2W26A 3UB0A 3OFND 1H9IE 4BAMB 1GI4A 4KTUA 3D62A 1GDQA 1YCPM 2AIPA 1W8BH 1QURH 1AB9C 1ELDE 2BXTH 1YPJH 1GBJA 2FTMA 2DUCA 1B5GH 2WPMS 1O5BB 4ZHMU 1NTPA 4UFEH 1RTKA 2GX4A 3MFJA 4JMYA 1O2LA 3SU2A 4AFSA 4FU8A 1SC8U 5FPTA 2QA9E 1GBBA 1EAIA 1S0RA 5J4SA 3RXOA 4RT0A 2RA0A 4OS2A 3SV7A 1GBEA 2ZCHP 1GBFA 1S6FA 2BB4A 1ESTA 2ZFRH 1W0ZU 3KQCA 5L2ZH 1Z8IB 2D26C 2EQNA 2C8YB 1C2LA 1C1TA 5PTPA 3Q00A 1YY3A 3KL6A 1F5RA 2PV9B 1DE7H 1PQ5A 1GCTC 3OY5U 2Y7ZA 3LKWA 5GNDA 3V0XA 1MCVA 3U28C 2GKVE 2HALA 4ZMAH 1V2LT 2G00A 4K3JA 2BVXH 2SGAA 1C5XB 1MKWH 1RTLA 1QL7A 1FY4A 3D65E 2F9UA 2BDAA 4E05H 1HJAC 3N7OA 3SGBE 1YCPK 2XNIA 1WOFA 2XC4A 4NCYA 3A83A 3FOAA 3O8CA 1YBWA 5L6NH 5HKKD 1COWD 1O3HA 1VITF 2C3SA 1C1PA 1TB6H 4DT4A 1EFRD 2LP6A 1HNEE 5ESTE 2AGGX 4KKDA 4UDWH 1X7AC 1H8IH 3FO8D 3P92A 1GBIA 3LJOA 4GSOA 5ETXA 1O2SA 4BTTB 7KMEH 2Z9KA 2GZ9A 3MI4A 1AKSB 4A1XA 2PP6A 3HATH 2PKAB 2HNTC 3H09A 1SGQE 5C3NA 2IJOB 3F0PA 4FXGH 1DY9A 2XWAA 2OXSA 1CGJE 3T29A 5FX6A 2WPHS 1Z6JH 1EZXC 1P02A 4INKA 2FEQH 3MU5A 1YLDA 3WWFA 1C2IA 3ATLA 4UEHH 3GDUA 2QXIA 1GJDB 1DUEA 4B2BA 3RXBA 3T5FH 1BRBE 1O5GH 1C5TA 1V2UT 3Q3XA 1K22H 2SNVA 4X8UH 4FUFA 1ESAA 5B6OA 2F4LA 3H5CB 1V2ST 3MU1A 3SU5A 2G8TA 5L30H 4RT1A 3QTOH 4K1EA 3LGYA 4GLYA 1JIMA 5CHAB 2HVYB 1TRMA 2BXUH 2BQWB 3UR6A 3P8FA 3LC5A 4CRFA 1O3CA 1DUAA 2QAAA 2QXJA 4E7RG 4BTUB 1BBRK 2A4GA 1QR3E 1DSTA 1AIXH 3LGWA 1YKTA 3KQEA 5F8TA 3RXPA 4B6EA 1NFYA 1ZJDA 3PLBA 2KZ4A 1DWEH 1SLWB 2PFEA 3GCHC 1UW7A 1QRXA 3A7ZA 3L3TA 1O5AB 2PWXA 3LH1A 3SZEA 4VGCB 3Q77A 3K65B 3OX7U 3EGKH 1S5SA 3TH4H 5A2MH 4Y76A 2BDCA 1CHGA 3RXDA 3RLYH 4GHTA 4FVDA 4Y0ZE 3SORA 1CU1A 5EG4A 3TK9A 4K5ZA 3ESTA 2Y81A 5GCHF 2Z3EA 4NSYA 1YWUA 3BSQA 4AGKA 1GVKB 1DANH 1O2GH 3GOVB 5EQQA 3FZDA 2KAIA 3F2GA 2GV7A 4X0WU 2A5IA 1NT1A 3DFJA 1OSSA 4ABIA 1C9TA 2OBQA 4U2WA 1HDTH 5JYIA 1OOKB 4CHAC 1J8AA 1TWXB 1JRTA 1QNJA 1SMFE 4NA9H 2GV6A 1O3KA 2B0FA 4YLUA 3RM0H 1GDNA 2W7UA 4UFGH 1Y5BT 5EPYA 1K1LA 3D23A 2F91A 1ZTKA 2STAE 2BDHA 3SNEA 2W5EA 4TWWA 3RU4E 3FVFB 1BJUA 1DM4B 3SNAA 2IPQX 1WXRA 1BOQA 3U8OH 1P8VC 4MLFB 3UQOA 3KQ5A 1YPHE 5E0GA 1PJPA 2ZHQH 3T62A 1OWDA 4ABDA 1LHDH 2QCYA 5B6LA 2OC8A 1C5SA 2DE9A 3SNBA 8ESTE 4FVBA 4OS4A 1D6WA 1EP5A 2F83A 4FUCA 2UWLA 1GGDB 1O2RA 1T8LA 1TOMH 1HAXB 2FLBH 3MH7A 1TQ0B 1BT7A 1LTOA 1HCGA 4TYDA 2K8IA 1OWEA 1RRKA 2XRCA 2WZQA 3GY8A 2Y5HA 1DX5M 3OEED 3UWJH 3ZVCA 3P95A 1TA2A 1RTFB 2ZHFH 3T28A 4BNRA 3GCTG 4XFQA 1EJMA 5EJ1A 1VITH 3MH5A 3PO1B 1UVPA 1HGTH 1UTJA 1GG6C 3N7DA 1GCTB 3EYDA 1VR1H 2IN2A 5AFYH 5EGMA 1D3TB 1QY6A 4Y8ZA 2FS9A 1FPHH 1A3BH 3VGCB 1AWHB 2NU3E 2CHAC 1GHWH 1CO7E 1E0FD 1HRTH 1FY8E 2VNTA 2W6JD 2ZFFH 4ISHH 1D6RA 3MO9A 3ZZAA 3EAJA 3I78A 1LPKB 4BTIB 1A1RA 1N6XA 4ABHA 1UTQA 1H9HE 2VIWA 2J98B 1CQQA 5EQSA 1S82A 5J4QA 4RKOB 1QB6A 4IMQA 4X2WA 1GJ4H 2ZCLP 3NUMA 5KGOA 3TJNA 4ISLA 4I33A 5LPFA 4BAKB 5G4BA 4TY7A 1C1SA 1TNJA 1JBUH 2KCPA 2GGVB 1EP6A 1MU6B 1GMHG 2F9NA 2QY0B 2OP9A 1AUTC 4YZUA 5HIYA 7GCHG 2HGTH 2V35A 4WMEA 4D76A 6LPRA 2BLWA 1TX7A 2H6MA 3U98H 2NU1E 3MOCA 1EB1H 2ZHDA 3BG8A 2FDAA 1NBME 1ORFA 1GMCG 2VB0A 3VXEH 3BTGE 1HAHH 1O0DH 1O2PA 3BTQE 1O3OA 1GDUA 5HGGA 1FZZA 3N7EA 1O3AA 3SU3A 1MAXA 1HXEH 2VU8E 3S9CA 4X1SU 2BD8A 2P95A 4I7YH 4TPIZ 2XOKD 1KDQA 1ZRKA 1YCPH 5DGJA 1O5FH 2VVCA 3L6PA 1IHTH 4AOQA 3C27B 1OXGA 1V2KT 2Q6GA 1WTGH 4K1SA 3KGPA 1NBMD 2O8UA 4FUJA 1E1QD 3KQBA 2ZU2A 2PHBA 1DXPA 3HK6B 3PMHB 4KTCA 5F8ZA 1BRUP 3TGJE 2HLCA 3GYLB 1GBKA 1YLNA 2VGCB 4MNXA 1W12U 2A4QA 2RCEA 1QQ4A 4ACBA 1RJXB 3ATIA 1NM6A 3QO6A 5CHAC 2QXGA 4CRAA 2OC7A 3OAAD 1YC0A 1YP9A 4MPVA 1W0YH 3QWCH 3V12A 1JOUB 2BDIA 3CNRA 1Y3UA 3SZNA 1QA7A 3LIWA 1MD8A 1BMLA 2R9PA 1V2VT 3MH4A 2V7QD 1NROH 3ATWA 4KTSA 3A8DA 1MKWK 1QB9A 1XXFA 3EA9A 4A1VA 3BEFB 2GVFA 5HMAA 1C2MA 1O39A 4ASUD 1F0UA 3QGJA 1ESBA 2SGQE 4GVUA 1MCTA 5FL7D 1QCPA 1TE0A 3UOUA 1UTPA 3F9FA 3AVZA 1BBRH 1K28D 1C2HA 2NU0E 3SJKA 1GL1A 4FUIA 2K1QA 1C2FA 1INCA 2AMQA 1BUIA 3DT0H 3VPKA 2TRMA 1E1RD 1BA8B 2Y5GA 4DJZB 5JDUB 2BOHB 2A0QB 1OKXA 1RIWB 1AI8H 2C8XB 1AFQC 2J2UA 3UOPA 4X2YA 4X6NA 1P2KA 2AEIH 1A7SA 4CRGA 5A8YA 1YPHC 1B0EA 1J9CH 4CREA 2C4FH 2FXRA 1P2MA 1O5DH 2JIZD 4JZ1A 1C1UH 3E8LA 1PPZA 1GHAF 3EQ0H 4B1TA 1QJ6B 1WCZA 3BTEE 1V2MT 3S0NA 2BD2A 4FUDA 2A2QH 3PWBA 1HIAA 3T2NA 1W11U 5A0BA 3M5OA 2XBWA 1QGFA 1W0JD 3QZRA 4BOHA 2CF9H 1BHXF 3AAVA 2BLVA 5C2ZA 3URDA 1IQIA 3H7OA 4A7IB 1BMAA 1TPAE 1ELFA 1BDAA 4DW2U 1MTWA 1GHVH 1K2I1 2OC0A 3KYGA 2ZU3A 2AFQB 2FOFA 3LPRA 4NIWA 1ELVA 1OWHA 2ZP0H 2PSXA 4I8LA 2D1JA 3RXRA 4DOQA 5DP5A 2XNDD 1K1OA 1L0ZA 1JRSA 2XCFA 4X1QU 1CVWH 3MO3A 1O2TA 2EI6A 1CSOE 2ZGBH 3A7TA 3RXMA 4ABFA 1C5NH 3UQVA 3GDSA 1ZMLA 1CA0B 3U1IB 3FAOA 2O8LA 4NWLA 1VKYA 2Y6TA 2GT8A 1TAWA 2GCHG 4RI0A 4UFFH 1UO6A 1Y5UT 1HAYB 1G3BA 3SYJA 3TJOA 4INLA 4U30A 2GD4B 1HPGA 3UNQA 2CGAA 4JYUH 2SFAA 4BAQB 1Z8JB 1CT4E 4MDSA 2TIOA 2PTCE 1DY8A 1XUFA 2Z6BD 5DP4A 1KXAA 1SOTA 4Y0YE 3MU0A 2GMTB 5BRRE 3F2HA 3M7QA 3OU0A 2BDGA 1A46H 1O2HA 1DPOA 1J15A 3E6PH 3GICB 2GP9B 1EASA 2WPJS 1EAUA 5A8XA 1DWDH 1SGIB 1TA6A 4K60A 4IMZA 5KECA 1O35A 3UPEA 2QN5T 2BM2A 1TONA 2STBE 3ZV9A 1AVWA 1UCYH 1TGSZ 3KHVA 4AGJA 4WVPE 1C5UA 5F8XA 3L33A 3PMJA 1AUJA 1JMOH 4H6TA 4NGAH 3RU4T 3TJVA 2G5VA 2ANKH 4KP0A 2V0BA 3A82A 5FBIA 2EC9H 2JETC 4Y6DA 2ZGCA 3O8RA 1LDTT 3ZZ4A 1G2MA 5FPSA 1PPHE 1DWCH 5T6GA 2FP7B 4X8TH 1O2QA 1ZGIA 2LPRA 3ELAH 3MH6A 2FODA 2CMYA 1Z1JA 1TNLA 5JBTA 5GWZA 5A8ZA 4TPYA 3RXSA 5A09A 1ETSH 5FCKA 2FOMB 2HRVA 2B7DH 2BD4A 1H9LB 3QK1A 4BAOB 1V2NT 2JDID 4DURA 1W10U 3LJJA 2BY6X 2EI7A 1CHOF 2HOBA 1TALA 1DITH 3BF6H 3SW2B 3E91A 1XX9A 1P9SA 2EA3A 1GI6A 1C4Y2 1KIGH 2ZU5A 4OS5A 1AN1E 4IN2A 5F03A 1QIXB 5FX5A 1KTSB 3RUOA 4RN6A 1MTSA 2R2WU 3SNCA 3A80A 4KELA 1GI8B 1QZ8A 3F1SB 1O2NA 1Y5AT 2NU4E 5DN6D 5FPYA 1GJ5H 3A89A 3SV9A 4HTCH 2ZTXA 1HB0B 4Z1MD 3UY9A 1GJ9B 3MYWA 2HNTE 1O2JA 2WUCA 4ISNA 4Q7ZA 1YPGH 1V2QT 2FPZA 3RXEA 3PV5A 1H8HD 3RXQA 2GZ8A 3BV9B 2F43B 2IPHA 5C0UA 1TFXA 2WINI 5E0JA 4AFUA 1A0JA 2CF8H 1JWTA 4XSKU 1TYNA 3STJA 4CR9A 1BTWA 1D3QB 3TVJB 4F48B 3DD2H 1C5PA 1QA0A 5E8EH 1V2WT 1LKAA 2R2MB 2BDBA 1AE8H 1C1VH 5T6FA 2UUFB 3LC3A 2VWLA 1O3JA 3RDZA 1IQNA 2FTLE 2C8ZB 3ZYEA 1ZLRA 1SPJA 2ZI2H 1NRPH 3PLKA 3BG4C 3MNCA 4D9QA 1DVAH 1FDPA 1TRYA 3RLWH 2ZWLH 1MAYA 2ODPA 3BN9A 3MQKC 4NFFA 4Y7AA 2ZF0H 3N99A 3HGPA 4B76A 1YPKH 1SL3A 1OP8A 4CRBA 1KTTB 5T1VA 4A5TS 2BVRH 1K9OE 2EEKA 2SGEE 1EZSC 4YT7H 1K1JA 1OP0A 3QLPH 2VH0A 1TQ7B 1PQ7A 3DFLA 3ZVFA 1AE5A 1O3BA 3RXGA 4I8KA 2Q6DA 4RSPA 1F5LA 3PO1C 1J14A 3DA9B 2ZFQH 2JETB 2BLQA 3P8OA 3RXLA 1G36A 1PPCE 3LOXA 3URCA 3UIRA 4YOGA 1KY9A 2R0KA 3GCNA 2Z9IA 3HKJB 3TGIE 2LELA 5HXFA 1CBWC 3A85A 3I29A 3OY6U 1P09A 2A4OA 3DHKH 4AG1A 1S85A 2VVVA 1PPEE 1DT2A 2KFWA 4OM9A 4AYVB 1TRNA 1GJ8B 1TBQH 4UFDH 3MWIU 3FKSD 1ZHPA 4X6PA 1NZQH 4JCNA 2P3FH 3MHWU 4XBCA 4Y7BA 3RM2H 1DOJA 4WH6A 1C2JA 4JK5A 4IC6A 1SGFA 1TLDA 1EJNA 1YGCH 2F3CE 1L4DA 1M9UA 3W1EA 1XUIA 4X8SH 3FZZA 3BTDE 3AK5A 1GHAG 5E2OA 1ZJKA 3PV2A 1LPGB 3NZIA 3TNTA 2ZDNA 1C5VA 1TPPA 1SGTA 4X1PU 3ATMA 4XD7D 1FAKH 4DCDA 4Y71A 5ABWA 1SQRA 3KIDU 5A0AE 1Z8GA 5EIYA 5GIBA 2QYIA 7GCHF 1GMDG 2F9BH 4F49A 1B7XB 3SBKA 4YOIA 5C1UA 1UJ1A 2YMSC 3B23B 3RMOH 4J2YB 4DIHH 4OS7A 2GTBA 3VFEA 3UTUH 1GL0E 4JZEH 1AVXA 2OQ5A 3NKKA 1UVOA 3BIUH 1C5ZB 1ZR0A 2HLDD 1ZSLA 1AQ7A 1FXYA 3TH3H 5GXPA 1QJ1B 4Z6AH 3QX5H 2ZDVH 4Y8XA 1QRWA 2OLGA 1TMTH 3BTWE 4DG4A 4MNWA 1OPHB 2D2DA 3A7WA 5EW1H 2AGIX 2QGRA 2ZU1A 2QF3A 4H42U 1O2MA 5AHGH 3K9XB 3OTJE 1EB2A 1GCDA 3U1JB 1GG6B 3PMAB 2B5TB 5T3HA 2GCHF 1GMCF 3SHCH 2ODYB 2ZFTA 2ZDAH 3NRLA 1ZHRA 1ZMJA 4GCHG 4MPXA 3E3TA 1XUHA 1BB0B 4X6OA 3RXHA 1Z8RA 4U01A 4AN7A 5LGOA 3STIA 3TGKE 3P8GA 1PFXC 3ZVEA 1CE5A 1YM0A 1ARCA 1Z7KA 1IQEA 1QFKH 2OD3B 5EOKA 1S83A 3PM3A 1VGCB 3DCLA 1TGNA 1ANCA 1EPTB 1TNIA 3A8BA 4K1TA 1UVTH 3E0PB 1HXFH 1GVLA 1BMNH 5IYTA 4B2CA 1O2WA 2CK3D 2AERH 1J17T 1ZPCA 3RXIA 2VIVA 5C94A 1HIAB 4XE4A 2BD5A 3QN7A 4Q7XA 1FQ3A 1GI3A 1MKXH 1S6HA 1YPEH 2XBYA 4AB8A 1NFUA 4FU9A 2G5NA 1G9IE 2BZ6H 3TK6A 2ZPSA 1H1BA 3TH2H 2RG3A 3BTHE 1AO5A 3V13A 1EAWA 4JK6A 1NC6A 1LQEA 1AFEH 1Z6EA 4OGYA 1MKXK 1GBHA 2GZ7A 1O3DA 1VCWA 1GBTA 1TABE 1XM1A 2BD7A 2ZGJA 4CRDA 3T27A 6CHAC 2Z7FE 3M35A 2ZPQA 2O9QA 3PLPA 1GI1A 3SUDA 4ZXYH 1FY1A 4Q80A 5DK1A 1SOZA 4Q2KA 1AZ8A 1SQTA 4ISIH 4D7FA 4JYTA 1LHGH 1MQ6A 5E0HA 5L2YH 4INHA 2TBSA 1O3LA 2Y7XA 1DDJA 4ZKOU 1P2IA 1P2OA 3SQHE 5DSFA 3MTYA 3PB1E 4E06H 1JXPA 2PGBB 2BQ7B 1O3IA 5LPEA 3OE7D 1O37A 5EODA 2PTNA 3MU8A 4FUHA 3ZVGA 3M37A 2QV1A 2UUJB 3VB7A 2XW9A 4UD9H 4YOJA 1BTXA 1PPGE 4K8BA 5CHBA 2H9HA 3SI4H 1MBMA 1P04A 4VGCC 1AU8A 2ILNA 4AG2A 3A7YA 2SGFE 3EDXB 3TNSA 1O2IA 3E16B 4LK4A 1CT2E 1H4WA 5EXNA 2R3UA 2FO9A 5GPIB 1MD7A 4BXWA 3IG6B 1DWBH
chains in the Genus database with same CATH topology
2BDYA 1XKBC 3EA7A 1K1MA 1BRAA 1O5EH 3M5MA 2BD3A 3HGNA 2M5TA 1O3MA 1O2KA 2P93A 4AORA 1O3FA 2SGPE 2ZGXH 1TGCA 5DP8A 2BY7X 1EXFA 1IQLA 1W3CA 3A7XA 1O33A 4HFPB 1MTVA 4MG3A 1OYQA 3LGTA 2OUAA 3SUFA 1LMWB 1P0SH 2H2ZA 2SGDE 1W2KH 2FOCA 3PWCA 3RU4D 2BOKA 3F9HA 1T4UH 4ABGA 1O36A 3SV2H 1QHRB 1EKBB 2ZPRA 3M5LA 3JZ2B 1SGRE 4ZH8A 2TGDA 3SHAH 1FY3A 1UK2A 4WXIA 1A0HB 2BX3A 4SGAE 3U8RH 2IOTA 5DG6A 3Q76A 3GYMA 1GI0A 1E34B 2ANMH 2QXHA 4RKJB 1IQGA 4IC5A 1AWFH 4NA8A 3U8TH 2SNWA 5DP7A 1F5KU 2A1DB 3G01A 2G55A 1CBWB 1GVZA 1GGDC 1NU7B 1ZTJA 4QT8C 2FX6A 4Y11E 2F9VA 3ZYDA 5AVDA 4A6LA 2TGTA 1TBZH 1D3DB 5F6MA 1A61H 2JH0D 1Q3XA 3QDZB 1HAIH 3ENSB 4CBNA 6CHAB 3RMMH 1DS2E 2WYJA 1UCYE 5IDKA 4JZIA 1P10A 1UK3A 3R0FA 3H7TA 4ASHA 3SV8A 3QGNB 1ZHMA 1LVBA 1UTNA 4ZROA 2FX4A 2PKSC 3CS7A 2AYWA 2P3TB 1UHBA 1YPMH 3TJUA 4ZUHA 1EUFA 1ABIH 1GHBG 4HI3A 1Z1IA 4AB9A 3ZZ7A 3GY2A 1GBAA 4CHAB 1O3GA 2Z3CA 5A0CA 4UONA 1BTZA 2NWNA 4OS6A 4D8NA 1KSNA 4YESB 3TPIZ 1AB9B 2CXVA 1D9IA 2QC2A 1ZSJA 5EU8A 3UR9A 1GHYH 5TCAA 2WV4A 5TJXA 1GBMA 1MZAA 3QZQA 5DO4H 4ZHAA 4A1TA 1NFWA 5LPRA 1GMHF 4AX9H 4MPUA 1QTFA 3FP7E 5FXLA 3MNSA 2GCTC 2A5KA 2G4TA 2OBOA 2P59A 2FOHA 2HNTF 1J16A 3KCGH 1DSUA 1P57B 3LONA 2FYQA 3SNDA 2Z9JA 1CA8B 1Y3VA 1BHXB 1MTUA 5HYOA 1O2XA 3Q3KA 4B71A 3RC6A 4ZAEA 2A32A 1NY22 2AMDA 3SU6A 2Z9GA 1VCPA 2OQUA 4IS5A 1SQAA 2VIPA 4FUEA 1WV7H 4PROA 1C5MD 2BHGA 3TU7H 1EZUC 1NRRH 2F9OA 3RP2A 2PUXB 4WWYA 1NS3A 1EPTA 2PGQB 4Z0KA 5GCHG 2ASUB 4OGXA 6GCHF 3M3TA 2ZQ2A 1OWJA 2R3YA 1ARBA 2CN0H 5DP3A 5H4IB 1C5QA 4ABAA 2ZZUH 3VB3A 2TGPZ 3NXPA 1A3EH 2VJ1A 5DP6A 5K7RA 1THSH 2BQ6B 4WF8A 1L1NA 1HUTH 1YF4A 1C1OA 1T7CA 2P94A 2PLXA 1EZQA 1F92A 3SI3H 3PROA 4Y79A 5EXMA 5C5NA 1HJ9A 1TNKA 3ZZCA 1TMUH 5C1XA 3ITIA 4JYVH 4CRCA 3GY4A 3E0NB 1GJCB 3K6ZA 4NIYA 2FS8A 1GJBB 2J94A 3U9AH 2BY9X 4F4OC 5AF9H 1KXFA 1C1RA 1SI5H 2ULLA 4Q7YA 2B8OH 2ZIQH 2VVUA 1P9UA 2WPKS 1C1QA 1UVUH 2XC0A 3BTFE 3PYHA 3Q3YA 4ABBA 1G2LA 1O31A 3UFAA 1F0TA 3KN2A 3AASA 3ODDA 1O2ZA 4GHQA 1TNGA 2BX4A 2WPLS 1AHTH 2THFB 1V2JT 2FIRH 4AYYB 1Y59T 3C1KA 2XBXA 4R0IA 2I6SA 3SGAE 1CHOG 2BLOA 2ZKSA 3SN8A 1CGIE 3MNXA 2BY8X 3PV4A 3ZZ6A 3HPTB 4I31A 5E2PA 2XTTB 1UTKA 2TGAA 3FP8E 2GT7A 1MQ5A 2O8TA 3GISB 1O2UA 3RC4A 4HGCA 4LXBH 1O2VA 4H4FA 2NU2E 4NA7A 1C4V2 3ZZDA 2UUYA 1FLEE 1SFIA 3M5NA 5K0HA 1MBQA 1HFDA 2FOAA 3W95A 4IN1A 1SVPA 1IQKA 1THRH 2OINA 3UNRA 1C2EA 1V2PT 3UWIA 1P01A 1NPMA 1CGHA 2W7SA 2BTCE 2HPQH 4DVAU 3D49H 1V2OT 1KXDA 3GCOA 2WV5A 4YM9A 1W14U 3TK5A 1F2SE 3IITA 3LH3A 1F7ZA 2G51A 4CBOA 2AGEX 1E36B 4CH2B 2FWWA 1L2EA 1PPBH 3R3GB 1DLEA 3FP6E 1O34A 3LU9B 1VCQA 1FI8A 3MNBA 4X8VH 1ZRBA 1XMNB 1BJVA 2XWBI 3RXKA 1ELCA 2ZA5A 1FONA 1JIRA 2Y80A 5GDSH 1HAZB 1GHXH 1AD8H 1P11E 1AFQB 1Y8TA 3BTKE 1N8OC 1RIWC 1F0RA 5EXLA 2R0LA 1ACBE 1EOJA 1C2KA 1FIZA 1S81A 2YNAA 2BY5X 1T8OA 2HVXA 3W94A 1SGEE 5JBAS 5DPAA 2FYRA 1LHFH 1O3PB 3RMLH 2FI5E 2H5CA 1S0QA 1UTLM 4O03A 1PQ8A 1GBDA 4XOJA 1C5RA 2OTVA 2A4RA 3BEIB 1A5IA 1P05A 4YT6H 3SU1A 2ZECA 2PUQH 4Y8YA 1A4WH 1TMBH 5CMXH 1BITA 1MTNB 1UHBB 1DICA 3U69H 1A0LA 1SR5C 2VH6A 3SUEA 2FESH 2J95A 1G3EA 4TY6A 4J1YA 1K1PA 4ZXXH 2ZEBA 2H9EH 3ZZ9A 1TX6A 2UWOA 1AGJA 1GJAB 2JH6D 3CS0A 3JZ1B 1BIOA 2Y82A 2H9TH 1C1NA 2KAIB 4WJG2 5DJ7A 1PYTD 2VGCC 2VINA 4NIXA 1SBWA 4WY3A 3SO3A 3M7UA 5EPNA 1BTHH 2CV3A 3RXJA 1SFQB 1AKSA 1SLVB 3P6ZB 2FOEA 2OCVB 1RXPA 4I8GA 1ELEE 1SGPE 2ALPA 3MO6A 1ZOMA 2VWNA 3A81A 3UNSA 2GCTB 2D8WA 4U32A 3BEUA 3F9EA 4SGBE 3CP7A 1QJ7B 1KLJH 3WY8A 1G32B 1SLUB 1LVMA 4B2AA 3LGIA 1D4PB 1Y3YA 4ABJA 2J34A 1WQSA 1ELGA 2H1UA 1P2QA 4ZHLU 3EA8A 1BMMH 1TGBA 1UTMA 1XUKA 1BTPA 1E35B 2TPIZ 1NN6A 1NRQH 1P03A 4JZFH 1SGNE 2A31A 2EI8A 1NO9H 2VIQA 3OSYA 1AZZA 3FANA 1HYLA 1P3CA 2QIQA 4WMDA 1DXWA 1SG8B 3PMBB 3VXFH 1TNHA 1C4U2 1BCUH 4CR5A 1HAOH 2JH5D 2UWPA 4NSVA 3ZVBA 4TWYA 1C5YB 2RA3A 4NG9H 4X1RU 3V3MA 1ZTLA 1AVGH 2Z9LA 4GAWA 1QRZA 1L4ZA 1SQOA 1TBRH 8GCHF 5DKMA 2P3UB 3B8JA 3P8NA 1O3EA 3TITA 1BQYA 2ESTE 8KME2 5I25A 2ZC9H 1YLCA 1O2YA 1AMHA 2WPIS 4CH8B 1C5OH 4AZ2B 5LH8A 4BANB 1G3CA 1BRCE 1NRSH 1PPFE 3LT3A 3S7KB 1QB1A 2YOLA 2J38A 1G30B 2ZFPH 1WBGB 1IQFA 3LGVA 1XUJA 1KXCA 2C8WB 1FAXA 4X6MA 2J9NA 1WTHD 4I32A 1C2DA 1KXEA 5HM2A 1OYTH 1SLXB 1OS8A 1P2JA 1FV9A 4MVNA 1ZSKA 3RXUA 3SJOA 4B73A 1T8MA 4D9RA 3ZV8A 5EQRA 7LPRA 1SGFG 2ZDLA 3M3VA 2WYGA 4UE7H 4B75A 3ATKA 1ZPZA 1XUGA 1SGCA 1NRNH 2ZCKP 3M61U 1ELAA 1FY5A 1P12E 4OS1A 3SOSA 3PTNA 1WAYB 2OC1A 2FLRH 2ANYA 1OWIA 4LOYH 1T31A 1HLTH 1SGYE 1O32A 4O9VA 3EE0B 3NWUA 4O97A 2Z94A 2XC5A 1ZYOA 4DGJA 5ESBA 1UK4A 1MTNC 1ZPBA 2ZO3H 3GCTF 3GDVA 2P16A 1SHYA 3AAUA 5C20A 1NFXA 3A8AA 2FZZA 3UREA 4B74A 1MUEB 1E38B 3K6YA 2FI4E 1IQHA 1ETTH 1O5CB 3RXCA 4KGAA 1W13U 1K1IA 1G3DA 1GI2A 1KXBA 2PSYA 5SGAE 1P06A 2ZQ1A 4IBLH 1GWAA 2BMGB 1UVSH 5HM9A 1CT0E 2ZTZA 1GMDF 1N8OB 3VB4A 2Q1JA 4H6SB 4JZDH 3A7VA 3A88A 2WUBA 2ALVA 1PYTC 3E90B 2ZHWH 4NZLA 4A92A 3OYPA 2Y5FA 3I77A 4YO9A 3ZVAA 4R8TB 4K69A 2ZG0H 5FHTA 3RXVA 1XVMA 5GJ4B 3KF2A 1B0FA 1Q2WA 3GY3A 1EAXA 1ZMNA 3SQEE 4AFQA 4FUBA 2HWLB 1VJ9U 4XBDA 5JB8S 3SU0A 1KYNA 2A7CA 3RC5A 6GCHG 2V3HH 4X1NU 2B9LA 1QQUA 3F6UH 2HPPH 4K8YA 5JB9S 1EOLA 2G52A 2JKHA 3VB5A 1FIWA 1T32A 4ESTE 1KLIH 2BZAA 1QBNA 2F9PA 3M3SA 3ZZ8A 4WXVA 4X2XA 4MNVA 5FCRA 1THPB 1LPZB 1EQ9A 2Z3DA 4Y10E 3LDXH 1YPLH 1IOEA 2G4UA 8GCHG 1W7XH 1O2OA 3QTVH 5FBEA 4ZKRU 5BPEA 1C9PA 1H8DH 3SUGA 1WU1A 1KLTA 1FN6A 3T26A 4LZ4B 1EX3A 1V3XA 3S7HB 1KDQB 2ZHEH 1MZDA 4E7NA 3GY7A 3ZZ5A 2PR3A 4WH8A 3GY6A 2J92A 1HAVA 4DT7B 1C2GA 2C90B 3A84A 3TIUA 1L1JA 4D7GA 1LVOA 2W3KA 1EPTC 1GHZA 1VITG 2FOGA 1LHEH 3S69A 3RXTA 3SJ8A 1BTUA 4GPGA 3NK8A 3SJIA 7ESTE 4XDEA 4MPWA 1K1NA 1TOCB 2RDLA 1LKBA 9LPRA 4ISOA 2O8MA 1HJAB 1LO6A 1TPOA 2A45B 4IGDA 2BVSH 1IAUA 1ZGVA 1SSXA 1HV7A 4K2YA 1A5GH 3A8CA 4NWKA 3NCLA 1GPZA 1BTYA 2C93B 1A5HA 2GMTC 1PQAA 1Z71A 2PKAA 1G37A 1ZZZA 1TGTA 3ZZ3A 3S9BA 2GDDA 3VEQB 1GHBF 1C5WB 1UTOA 4THNH 2XCNA 3ZZBA 3FFGA 2P8OC 4BAHB 3MMGA 3AW0A 4AFZA 3M7TA 1MU8B 2FI3E 4O3TA 3UUZA 1OWKA 1O30A 1HAGE 2VWMA 2V6NA 1GI7B 1CA0C 1LHCH 1SGDE 2FM2A 1HAVB 1WQVH 2XYAA 3F9GA 1C1MA 2H5DA 3GY5A 1O3NA 1HAPH 1WYKA 2BD9A 1V2RT 1ETRH 3BG4B 1TPSA 3AW1A 1EJAA 4HZHA 4FUGA 1E37B 1U6QA 4IW4E 2I6QA 3P17H 3P70B 9ESTA 3BTTE 1AY6H 1FJSA 1A2CH 2Q6FA 5I46H 6ESTA 1XVOA 1ABJH 1TX8A 3IWMA 4GUXA 1K21H 3HKIB 2O8WA 2CHAB 1VZQH 1W7GH 3VGCC 2QF0A 3HK3B 2P8OB 1L1GA 1GJ7B 3PTBA 4NIVA 3BTME 2GDEH 3T25A 1ID5H 1VJAU 1Y3XA 1GBLA 4ABEA 1QBOA 1V6DA 3CENA 1FN8A 3SU4A 1BBRE 1IQMA 1P2NA 4MQAA 1QBVH 1GJ6A 1T4VH 5JBCS 1XKAC 1ELBA 4I8JA 4O3UA 3RXFA 3ZVDA 1ANEA 1QL8A 8LPRA 3SV6A 1GI5A 5JPMH 1UMAH 1FUJA 2XXLA 2FMJA 2CJIA 2ZDKA 4GCHF 2YNBA 1FPCH 1RFNA 1RS0A 1HBTH 2UUKB 5AFZH 1NU9A 2AH4X 3NPSA 2W3IA 5CE1A 3KNXA 1TIOA 2A7JA 4X2VA 1S84A 2J4IA 2G81E 2AS9A 1FMGA 3O8DA 4ZKNU 4M7GA 2FOBA 5FAHA 5JBBS 2A2XH 1NESE 1MMJN 1RD3B 2PKSB 1UCYK 1IQJA 1MH0A 1WUNH 1D3PB 1O38A 1N1LA 5C5OA 1OX1A 4FU7A 4ZKSU 4BXSA 1N6YA 1XXDA 3MU4A 3F68H 4XBBA 1WSSH 3KEEA 5C67A 3RXAA 4YTAA 2ODQA 3ODFA 4DIIH 5EW2H 5T6DA 1DFPA 1F0SA 1ANBA 3A87A 1Y3WA 3M36A 3KQDA 1BZXE 1GI9B 1C1WH 1HJ8A 1VGCC 1RGQA 1T8NA 2XBVA 3QUMP 3BIVH 1GBCA 3DUXH 1SB1H 1V2TT 3O8BA 1OP2A 2ZDMA 2BYAX 2ZTYA 3B9FH 1FNIA 3RMNH 4MTBA 1EATA 2VIDA 2A5AA 2ZNKH 3VB6A 1YYY1 3LGUA 4NZQA 4I8HA 4WMFA 2ZU4A 3V7TA 1ELTA 4DY7B 1C5LH 4NFEA 1IHSH 3A86A 2A7HA 4YLQH 2ANWA 4MNYA 1LQDB 1LCYA 3E1XB 2V3OH 1LVYA 2LNCA 5C1YA 3S9AA 2PW8H 2VIOA 1ANDA 2ZGHA 3TLOA 5DP9A 1SHHB 1P3EA 2DE8A 2VWOA 3GCHB 1DLKB 2AIQA 1Q31A 5TCCA 3K2UA 3SGQE 4LZ1H 2AMPA 3SJ9A 2ZFSA 1QL9A 2W26A 1H9IE 4BAMB 1GI4A 4KTUA 3D62A 1GDQA 1YCPM 2AIPA 1W8BH 1QURH 1AB9C 1ELDE 2BXTH 1YPJH 1GBJA 2FTMA 2DUCA 1B5GH 2WPMS 1O5BB 4ZHMU 1NTPA 4UFEH 1RTKA 2GX4A 3MFJA 4JMYA 1O2LA 3SU2A 4AFSA 4FU8A 1SC8U 5FPTA 2QA9E 1GBBA 1EAIA 1S0RA 5J4SA 3RXOA 2RA0A 4OS2A 3SV7A 1GBEA 2ZCHP 1GBFA 1S6FA 2BB4A 1ESTA 2ZFRH 1W0ZU 3KQCA 5L2ZH 1Z8IB 2D26C 2C8YB 1C2LA 1C1TA 5PTPA 3Q00A 3KL6A 1F5RA 2PV9B 1DE7H 1PQ5A 1GCTC 3OY5U 2Y7ZA 3LKWA 3V0XA