4KTUA

Bovine trypsin in complex with microviridin j at ph 6.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Harnessing the evolvability of tricyclic microviridins to dissect protease-inhibitor interactions.
pubmed doi rcsb
source organism Microcystis aeruginosa mrc
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ktuA02
2UUYA 2Z3DA 3RXGA 1ZHMA 2J94A 2QC2A 1YCPH 4ZKSU 1O2RA 5LPFA 1FN8A 1GBLA 1LVMA 1O3FA 1O2GH 1XX9A 2R3UA 4ISOA 4DT7B 3SGAE 3FFGA 1ANBA 2ZQ2A 1SGYE 2VINA 1JIRA 1K1PA 1QFKH 1P9UA 2OQUA 1CBWB 1C4V2 3P17H 4AB9A 4U01A 2BZ6H 1AVGH 4FU7A 4UFEH 2FESH 3U8OH 1O35A 3CS0A 3ENSB 2SNVA 1OOKB 1NFUA 2RG3A 4GCHG 2EA3A 4ABGA 1ZHPA 4UD9H 5LGOA 2VWLA 5JBAS 2FLRH 1PQAA 5F8XA 3Q3XA 1J9CH 5E0JA 2GZ7A 5FPYA 5C67A 1OWHA 1N6XA 2QIQA 2VGCC 4NIVA 1ZTLA 5T3HA 2Q6DA 1O3NA 4JZDH 1SQOA 3BTQE 2GCHF 1RS0A 1GI9B 2FOEA 1GBMA 3A7ZA 1CT2E 1QCPA 2WUCA 3ZYEA 1GHBG 2OUAA 3RDZA 4IBLH 1C1SA 3AAUA 1IQKA 2LPRA 5DP8A 2JH0D 1TPSA 4VGCC 3D65E 4X8TH 1G3EA 1SSXA 4JZIA 3ZVFA 1GJ5H 2FI3E 1ZSJA 1DUEA 1YP9A 4OS4A 1T31A 2EC9H 1QR3E 4GPGA 1VZQH 2ANMH 4GUXA 1UO6A 1CA0B 2H5DA 2H9EH 1HJ9A 4MQAA 5EW1H 1D3DB 1L2EA 1MTVA 1THPB 3ATWA 4Q7XA 1Q3XA 1O32A 3LGTA 3OY5U 3PROA 4ASHA 1NZQH 4BAKB 5ETXA 5DO4H 2AIQA 5F6MA 3RXJA 8KME2 1ZLRA 1AE5A 1O3CA 1SC8U 5DP5A 3Q3KA 4X6MA 4GHTA 3K6ZA 5L2YH 2ZPRA 3KF2A 2ZGHA 4Y0YE 1AWHB 4DJZB 1WYKA 1Z71A 2PV9B 3IWMA 3WY8A 2F9BH 3E8LA 3TJUA 3B9FH 3DA9B 2GP9B 2O8WA 3QTOH 6ESTA 1WOFA 1KIGH 1N8OC 3VGCC 1NS3A 2ZU5A 1THSH 5EU8A 1O5DH 3GY8A 1PPEE 2VWNA 3Q77A 4BXWA 2VWMA 4R8TB 1CE5A 4UONA 2A2QH 1EJMA 4TWYA 3T62A 4LZ4B 1FDPA 1TNHA 1UCYH 2UWOA 1C5UA 4Y71A 5HM2A 3VB3A 3RU4E 1TB6H 1M9UA 2AFQB 2G52A 1LHGH 2PW8H 3ATLA 3GISB 3LGVA 3PLKA 1C2EA 3E91A 4VGCB 1UTPA 3SHCH 3F9FA 2FOMB 4WH6A 1O2VA 1GJCB 4NA8A 2KAIA 3AASA 3OU0A 3PMJA 1J15A 5GXPA 3BTTE 4NSYA 1C2GA 2G4UA 4GLYA 2IN2A 1A3EH 2FLBH 2VIDA 2G8TA 2GGVB 3SU3A 3M5OA 1K1MA 3NKKA 4JCNA 2FO9A 1V2PT 4JZ1A 5EODA 1CGHA 8GCHG 6CHAC 2RA0A 2BXUH 1AD8H 1D3QB 3ZYDA 1UTKA 1MCTA 1NRSH 4Y0ZE 3ZVCA 2Y7XA 1EAWA 2BY9X 2SNWA 3CP7A 1V2UT 1IOEA 1YPLH 3R0FA 5EPNA 3K6YA 4MDSA 1P2QA 2F83A 3P8NA 1W10U 4MNVA 5PTPA 1LO6A 3ZVAA 2IJOB 1D3PB 2AGIX 4X6OA 5EW2H 4O3TA 6LPRA 3T5FH 4ABDA 2Z7FE 3NK8A 3S7KB 3UNQA 1E34B 2CF9H 3GCHB 2FMJA 1TPOA 1OYTH 3I29A 1AHTH 4ZKRU 1TYNA 1K1OA 1BBRK 1NPMA 2H6MA 3VGCB 1MU6B 5T6DA 2WPMS 3BN9A 1BRAA 4AYVB 9ESTA 1TQ7B 3NUMA 3SU6A 1OP0A 2J38A 4OS7A 4D7FA 3E6PH 1CGJE 3RC4A 5FBIA 4NIWA 4YLQH 1LKBA 3EQ0H 1O2LA 1F2SE 4KKDA 3SI4H 1C5ZB 1FY3A 4ABJA 3TLOA 4NWLA 1SFIA 1AI8H 2F3CE 5JPMH 2A7HA 2XCNA 4GAWA 3SN8A 2TGAA 4K1SA 4I32A 2NWNA 2GX4A 3FZDA 1GHAF 1O2WA 2GVFA 3A7VA 1MD8A 3HKIB 2ZI2H 3TK9A 1JOUB 5L2ZH 3EA7A 4A1XA 3SNAA 2V0BA 2BLQA 1PPCE 3EDXB 2F9PA 4WVPE 1TGNA 1DS2E 1TBQH 1QBVH 2QXGA 4SGBE 3UWJH 1QQUA 1S83A 3BG4C 4X6PA 5AHGH 3UY9A 2GZ9A 3GY7A 4ISHH 4X1QU 1EPTA 2A7CA 2ZTXA 5I46H 1P57B 2JH6D 4CRAA 1EZUC 1GPZA 1SLVB 3VB6A 1EOJA 3GICB 1ZPBA 1LVYA 5LPEA 1HBTH 1W8BH 5DG6A 4YOIA 1EQ9A 1Y3VA 4KTCA 1ELBA 3MTYA 3SHAH 4PROA 3S9CA 4ABHA 2VIVA 3I78A 3GCOA 4X8UH 1TRYA 1OS8A 3M3VA 4X2VA 3A8DA 3TGIE 2IPHA 1C2FA 2ZU1A 1TFXA 1F0TA 2ZFTA 3Q76A 1UTQA 2GTBA 4AB8A 3RXIA 2Z9JA 3NXPA 2AMQA 1LKAA 3B8JA 1HIAA 5HXFA 1HDTH 4BAOB 4Y8XA 3PTBA 2FS8A 1TGBA 1UHBB 1TRMA 5C5OA 2P3FH 3SNDA 4X1NU 1DITH 1HCGA 1ARCA 2GDDA 1BIOA 5LH8A 1QQ4A 1AB9C 5BPEA 2PUQH 1GWAA 1S0RA 1HFDA 3F9GA 1GCDA 1K1IA 2W5EA 3RU4T 3LDXH 3H5CB 1ELAA 2HNTF 1GJ8B 1EZSC 2VVUA 4ZHMU 3QK1A 1SFQB 1ESTA 3U8TH 1DICA 1FZZA 4LOYH 1O3EA 4BOHA 5JBTA 2BDIA 4YOJA 3PO1B 2XRCA 5JB8S 1Z8JB 2BYAX 2IOTA 4WF8A 5CMXH 3DUXH 4Y8ZA 1V2NT 1Y3YA 3GYLB 4Z0KA 2WPIS 3BIVH 1JWTA 2ZFPH 1AO5A 3R3GB 1HYLA 4MPXA 4AFSA 4AGJA 2OP9A 2FX4A 1J14A 4WY3A 3KQDA 2YOLA 2FOCA 1CT0E 3FAOA 5A2MH 5GPIB 1V2QT 1XUKA 1ARBA 1FUJA 3UNRA 1PFXC 2CN0H 3A7TA 1HJAC 4JYUH 2PSXA 1O3IA 1GBKA 1DANH 4NZLA 5CHAB 3LGIA 1C1QA 3OYPA 1CHGA 3TJOA 1FONA 1MU8B 1GI3A 3LONA 3D62A 5DP7A 1O2PA 5EQSA 1U6QA 1NRQH 3ZVGA 2WPKS 1EAXA 1Z8GA 4CRGA 2PKSB 1VITH 1MQ6A 1FY8E 2GZ8A 2A45B 1QRXA 2BHGA 3EA8A 2PWXA 4X2YA 3O8DA 2GDEH 2AIPA 1G3DA 4INKA 2ZQ1A 1EB1H 1H9LB 1YLDA 3PWBA 1GG6C 5F8ZA 1EATA 2WV5A 1A2CH 1O3AA 2UWPA 8LPRA 1AZZA 1GI0A 2FOGA 1A46H 1T8NA 1TNGA 4B76A 4AOQA 1NRNH 2P93A 3TU7H 1SLXB 1NM6A 2CF8H 5FXLA 3U1JB 1P8VC 2PKAB 4ZUHA 1ZMJA 3S7HB 1V2MT 1QB1A 1C9PA 5EXMA 1FV9A 2OTVA 1P2IA 4K2YA 3QWCH 1EXFA 3MNCA 1DOJA 1O31A 1QBOA 4A1TA 2TRMA 2C90B 1OYQA 5E0GA 1YGCH 3ZVEA 4FXGH 5HYOA 1DXPA 4MLFB 4ESTE 4WXVA 3HKJB 4CHAB 1MTSA 1GHAG 3PLPA 1O2KA 1O3BA 1KY9A 1XXFA 2HVXA 4X1RU 3GY6A 1HJAB 4WMFA 3K9XB 1O2XA 1O2UA 1ZRKA 1G2MA 3ZV8A 1BHXB 1SGQE 2ZFQH 1NRPH 1QB6A 1ACBE 1C4Y2 2QYIA 1BTXA 1ZMNA 1A1RA 4DG4A 5IYTA 1BMNH 1P11E 1BA8B 2F91A 2ALPA 1RTKA 1GGDB 2D8WA 4UFGH 2R9PA 4FUJA 3RXFA 4F4OC 1DDJA 1TOCB 3EE0B 2PGBB 1C2DA 1E38B 5JDUB 1H9IE 4CH8B 3IITA 3SI3H 1WAYB 1C5MD 1FNIA 1HAHH 3N7OA 3STIA 4Z6AH 1UK2A 1FY1A 1G32B 3TNTA 1EUFA 4K60A 2TGPZ 4K69A 4ZKOU 1GG6B 4WJG2 1GBCA 1GVLA 1UMAH 1Z1JA 4ZHAA 2XWBI 1OWDA 1GCTB 2XBVA 3A7XA 4K8BA 1L1JA 3OY6U 4ISNA 4YOGA 1AFQC 3MO6A 4X1SU 2ZDVH 4E7RG 3F68H 1MUEB 1XUJA 1XUGA 3PMHB 4RN6A 2BVXH 3DHKH 4A92A 1XUFA 1KXFA 5EGMA 3M37A 3O8CA 3M35A 1D6WA 2C4FH 4XFQA 4D8NA 4ZMAH 3SU0A 1GJ7B 4CRCA 5HMAA 1HAGE 1SGCA 4B2CA 1LQDB 1UK3A 2Y5FA 2P8OC 3M3TA 1EP6A 1O2OA 1NFXA 2ZDLA 3M36A 2ZCHP 1JXPA 1F0RA 3M61U 3L6PA 1V2ST 4TPIZ 5DP3A 1GMHG 1P9SA 3BTKE 1XKAC 3MH7A 1GBIA 1DLKB 4DW2U 1QY6A 5C5NA 1O5GH 1NN6A 2P59A 1OWEA 1TIOA 2G5NA 1IQFA 4NA7A 1MKWH 2ZHFH 5FBEA 4BAMB 2GCTB 2OBQA 3SU4A 1YCPK 1SPJA 3HATH 1ANEA 1QJ7B 4MPUA 4NZQA 2ZU2A 3SO3A 2NU3E 1GI8B 2ZHWH 1DFPA 3OTJE 1G37A 1GHVH 1S84A 3ATKA 3TNSA 3LGUA 2XCFA 1EKBB 1CO7E 2HPQH 1HLTH 1O2YA 2BD7A 4E7NA 1Y3WA 1FMGA 1GVKB 1SGTA 3D23A 3ZZ3A 1GJ4H 1DPOA 3TPIZ 1SLUB 2XBYA 1HAYB 4Y79A 3SV6A 3C1KA 1QA0A 1ETRH 3PLBA 2QN5T 4LZ1H 1FAKH 3ODDA 5FCRA 2Y5HA 1DVAH 2Y80A 1SL3A 3K2UA 2FYQA 3UFAA 4ZROA 4UDWH 1DXWA 2A5KA 1YYY1 1NO9H 2J95A 2P8OB 5EXNA 2CXVA 1EAUA 3T28A 1LHDH 1TPPA 2BLWA 1C1PA 1EX3A 1WQVH 3JZ2B 5T6GA 1W2KH 1PQ8A 1TBZH 1ZR0A 1FAXA 4B1TA 4B71A 3SBKA 1GI4A 2A5AA 4X8VH 1K2I1 1THRH 2TPIZ 2JH5D 4MG3A 1QRWA 1O0DH 2OQ5A 1C5PA 3LC3A 4JYVH 2JKHA 5EG4A 1T4UH 3PV4A 2XBXA 1HJ8A 3DT0H 1B0FA 1C2LA 1SHHB 2PGQB 3RXTA 1O2QA 4SGAE 1FY4A 1SGNE 2ZF0H 2ZZUH 3VEQB 3LIWA 5JYIA 1WCZA 2AMDA 1F92A 5FHTA 3P6ZB 5GIBA 1C5XB 1E35B 2OD3B 1SOTA 4IMZA 3ZZ4A 3ZVDA 3QO6A 4WMEA 3I77A 4DCDA 2BY5X 3RXLA 2AEIH 1Y5UT 3W94A 4U2WA 2VGCB 3FVFB 4X2XA 3RXMA 2PTCE 5H4IB 3A89A 3JZ1B 1ZPCA 1BMMH 2Z6BD 1HAXB 1MKXH 4I7YH 5FX5A 3TH2H 1LHCH 4H6TA 3W95A 1H8DH 2CJIA 4A5TS 3OX7U 1GBEA 3VXEH 3BF6H 3FP7E 4TPYA 1VCWA 3HGPA 4DY7B 1SR5C 2SGEE 2BDHA 3B23B 1AY6H 1VJAU 2PLXA 1EASA 2ZIQH 3MU8A 3BTME 4FUCA 1BDAA 1GL0E 4BNRA 1ORFA 1EAIA 1UCYK 4ZXXH 2H5CA 4GSOA 3D49H 5DKMA 3A87A 1TBRH 4IN2A 4X2WA 2EI6A 5AVDA 3QX5H 2EEKA 1FI8A 2QV1A 1V2TT 4UEHH 4ABIA 1V2OT 3GDVA 1W12U 2QF0A 1ZSLA 1C4U2 4AZ2B 1A61H 1TGTA 2AERH 2XC5A 3AAVA 1P02A 1YPHC 4AX9H 1C5NH 1VCQA 3RMNH 4H42U 4XE4A 3F1SB 2YNBA 2KAIB 2AMPA 2Z3CA 1RIWC 3AVZA 1C9TA 2PHBA 4ABAA 2CHAC 2B9LA 2P3UB 1YLCA 1BMLA 3MYWA 3UWIA 3LJOA 1FIZA 3TGJE 1EJNA 2SFAA 4I8HA 4J1YA 1ELCA 4OS6A 3RP2A 4NFFA 3A80A 3RXEA 2Z9GA 3A8CA 4CRBA 2D2DA 3E16B 3T29A 1EPTC 3M5NA 1NU9A 2FYRA 3KQBA 1N8OB 5E2OA 1LTOA 1P12E 1MQ5A 1AGJA 2BX3A 2VH0A 4K3JA 1C1TA 4ABEA 2BQ6B 1SQTA 2UUJB 2HLCA 3RU4D 1W13U 2GMTC 3VPKA 1O2SA 4CBNA 4CR9A 3TJNA 1NFYA 2FODA 2VU8E 3ITIA 1IHSH 1O38A 4CREA 1AFEH 1P3EA 2BD8A 4ZH8A 4IC6A 3SUDA 3VXFH 3MH5A 4TYDA 2Q6FA 1WSSH 1UVPA 4DURA 2M5TA 1ZMLA 2FTLE 1O2IA 1SB1H 3SJIA 2I6QA 2R2WU 5GJ4B 6CHAB 1C5OH 3KHVA 3MO9A 3QLPH 2BM2A 1Z8IB 1A3BH 3URCA 1TAWA 3RMMH 1OPHB 4A6LA 3UREA 2ZP0H 1QIXB 7LPRA 1GDQA 3A7YA 3FP6E 2HRVA 3BIUH 5ESTE 3RXRA 4AN7A 1LHEH 1LHFH 3STJA 2ZDKA 2Z94A 1N6YA 1KDQA 1DUAA 4AFZA 1Q2WA 2SGQE 4BAQB 2CHAB 1VITF 4Y11E 1OKXA 2JETC 1A0HB 3M7UA 4IS5A 4XDEA 1Y3UA 2TIOA 1ZSKA 4YT6H 1GMDG 2ILNA 1ZOMA 1HUTH 4DIHH 2FDAA 4YM9A 4YTAA 1W7XH 1GJDB 1WBGB 2ZNKH 3GDUA 1P3CA 4YO9A 2BVRH 1C1RA 1EPTB 2HNTC 4KTSA 1AKSB 1S6HA 3BTEE 3LH3A 2PFEA 1RGQA 1WU1A 2G00A 1UHBA 1AU8A 1SQAA 1TGCA 1V2WT 2TBSA 3SNCA 1O3KA 4Y7AA 4BAHB 4BTTB 4MTBA 1W0YH 2TGDA 2GV6A 2R2MB 1F5KU 4IMQA 2FI5E 2AS9A 3SUFA 4FVBA 4NSVA 1L4DA 4QT8C 4O3UA 4AG2A 1T8LA 1L0ZA 4ZAEA 4CR5A 1GHYH 1MTNC 2C93B 3TH4H 5C1XA 4R0IA 2BVSH 3MNSA 3SU5A 2OXSA 5GDSH 1QRZA 3EYDA 3V3MA 2Y82A 2WV4A 1Q31A 4AG1A 1K1NA 2ZU4A 3HPTB 1HIAB 5A09A 1QB9A 1TMBH 2A1DB 4I8JA 4FVDA 1NT1A 2F9UA 2G51A 1C2KA 3BG4B 5HM9A 1UVTH 2C8WB 3UR9A 2RDLA 2ZFFH 1O3DA 5JBCS 1O2TA 4CRFA 1Z7KA 3CS7A 1CHOG 1OWIA 1GMHF 1JRSA 1EOLA 4XBCA 1WTHD 1T4VH 1SGFA 2ZA5A 2PSYA 3RXCA 1IQEA 5FPSA 1E36B 1DLEA 3P8OA 3SU1A 3ZZ5A 2AH4X 1O39A 2VVVA 1CA8B 1PQ7A 1BBRE 3A7WA 1SOZA 3SV8A 3LGWA 3ATMA 1UTMA 4WXIA 3ZZ8A 1BJUA 4IN1A 4E05H 1QNJA 2NU1E 2PTNA 4TY6A 3MOCA 1XUIA 2P95A 1RJXB 4ISLA 3A8BA 2ODYB 1NU7B 1ID5H 9LPRA 1YPGH 1HAVB 1KLTA 2R0LA 2FI4E 1OP8A 1NROH 2C8ZB 2R0KA 1Y59T 2ZO3H 4X0WU 3RM0H 3GOVB 3BEIB 1NY22 1XVMA 1PJPA 1AB9B 3ZZ6A 5EQRA 3LT3A 2J92A 1MTNB 2P94A 1DE7H 2EI7A 1Z6EA 2GT8A 3LKWA 3KN2A 3MU0A 1SGDE 1KYNA 1ZGVA 1QJ1B 4NFEA 1DX5M 1ELTA 4UFFH 1P10A 1P0SH 1ELFA 2V3OH 2THFB 5A0BA 1C1UH 1DSTA 1O33A 3GCTF 1AWFH 2ZEBA 4AFQA 1OWKA 2OINA 1W3CA 3T26A 5DP4A 4Y8YA 1PYTC 2W3KA 4AGKA 3MI4A 5TCAA 1KLJH 1HAPH 1NFWA 2ESTE 1AUTC 1ETTH 2V6NA 2Y7ZA 3E3TA 3KIDU 4H6SB 1MAYA 4HI3A 2ZDMA 3P70B 4FUBA 3MH4A 5L6NH 1GL1A 2Z9IA 3T27A 4CBOA 1TNJA 3P95A 2FEQH 3GY4A 1YC0A 1TNKA 2H1UA 1QTFA 2SGDE 2ZGXH 1PQ5A 4WWYA 2H9HA 2O8TA 4TWWA 2ZPSA 1V2RT 1C1WH 1HB0B 2HOBA 3SQHE 5DK1A 1D4PB 1VJ9U 4B2BA 1ELEE 2ODQA 2Q6GA 1HGTH 4RKJB 1MMJN 1TABE 5C2ZA 3SW2B 1YCPM 3CENA 1ZRBA 1BQYA 2ZGCA 1KLIH 3HK6B 1GDNA 3EA9A 2F9OA 1BMAA 1FIWA 3DFJA 3QZRA 4K1EA 3UNSA 1W0ZU 1BTUA 2QAAA 1IQHA 1DWDH 2VB0A 3SUGA 2Z9KA 3Q3YA 2ASUB 3RC5A 1O3PB 1YBWA 4DVAU 2HPPH 2BD2A 1O2ZA 1EB2A 1VITG 2WUBA 1SBWA 4D7GA 1FXYA 3QGJA 1VGCC 1B5GH 1XM1A 3M7TA 3ZZCA 3OSYA 3KQCA 1TWXB 1NESE 3PMBB 3P8FA 1A5HA 2I6SA 1K21H 1GJAB 2BD5A 3GY3A 4AFUA 2VNTA 6GCHF 1W11U 1YPHE 1O5CB 1O2MA 3MNXA 1X7AC 2BB4A 2STBE 1TLDA 3QDZB 5EXLA 5C1YA 3ZV9A 1CBWC 5F8TA 2YNAA 1C1NA 3F9EA 1C5WB 4FUEA 3UIRA 1C2HA 1J17T 1AUJA 2V35A 3BV9B 3A81A 1QL8A 3U8RH 2ZGJA 1Y5AT 1CGIE 1C1MA 1ZPZA 2F9VA 2QXIA 3LOXA 3ATIA 3M5MA 2ZDAH 1AIXH 3RXQA 1TONA 1P05A 3GCNA 1HNEE 4I31A 1TALA 2GT7A 1LQEA 1QL9A 4NGAH 1P03A 3UOUA 1EJAA 5CE1A 2CV3A 3KNXA 4Y76A 1Z1IA 3SQEE 4I8LA 3ODFA 3RMLH 1FPHH 1OX1A 1SGFG 1GI6A 1QGFA 4DGJA 1GMCG 1XMNB 1ESAA 2BD3A 1IQIA 1ESBA 1P09A 5E8EH 2BQWB 3MWIU 1KXAA 3QTVH 2BDAA 2ZECA 1C2JA 1MCVA 1QJ6B 2SGPE 1TE0A 1YM0A 2O9QA 3E1XB 3U69H 2FOFA 2FOHA 4Y7BA 3RXDA 4Q7ZA 3SV9A 1XXDA 4NCYA 1MBMA 1CA0C 3O8RA 1GBTA 2W3IA 3KQEA 5AF9H 1RTFB 1XVOA 1ZTJA 1CU1A 2V3HH 1BRBE 2A4GA 2G55A 1MKWK 2QY0B 1B0EA 1O34A 3LJJA 1A0JA 1N1LA 2QXJA 3BTWE 3Q00A 1CSOE 3QGNB 3K65B 1E0FD 3BTHE 4U32A 1INCA 2STAE 3M3SA 1K1JA 1QURH 1LMWB 1BTHH 3U1IB 1LPKB 1AFQB 2B5TB 4I8GA 3RXBA 1PPFE 1SLWB 1O37A 4BXSA 2BOHB 3BSQA 1O3MA 1ANDA 1L4ZA 1O2HA 5EOKA 5IDKA 3F6UH 1E37B 4HFPB 3ZZAA 2ANWA 1ZTKA 1LVBA 1ELGA 1TA2A 1T32A 3UTUH 2HNTE 1KSNA 1YPJH 1BRUP 1FJSA 3KL6A 1JMOH 2FOAA 4JZEH 3PB1E 3GCTG 3MO3A 5A0AE 1AQ7A 5GCHF 1GMDF 3ZZ7A 3TVJB 3AW0A 4FU9A 4UFDH 3TITA 1O5BB 4OS1A 4UE7H 4XBBA 2PR3A 1QA7A 4YLUA 2A5IA 4MNYA 1JBUH 1O3HA 1S5SA 3LPRA 1GI5A 1GI7B 2W7SA 4NA9H 2BOKA 1DY8A 5T6FA 1VCPA 4RKOB 1O3JA 2FWWA 4M7GA 2TGTA 2UWLA 5A8XA 4MNXA 1NC6A 1GBHA 2WYGA 3PYHA 2K1QA 3SZNA 3LH1A 2BDGA 4FUHA 4IW4E 4B73A 2Z9LA 1LDTT 3LC5A 2ZGBH 2EI8A 2OCVB 2GV7A 1UVOA 1V2KT 4Q80A 2W26A 2HALA 2H2ZA 3ZZDA 1GBAA 2ANYA 1QBNA 1HAZB 1AVXA 2HWLB 2RCEA 4J2YB 4KTUA 3VB4A 4Q7YA 3TK6A 1QHRB 4U30A 2OC0A 4O9VA 3T2NA 4K1TA 1Z6JH 3H7OA 5SGAE 2ZG0H 1KXCA 1AE8H 3SV7A 3KEEA 4B74A 1CHOF 2B0FA 4ZHLU 3EGKH 1J16A 1C5VA 3GCHC 4FUFA 1MKXK 2RA3A 3L33A 3RUOA 1MD7A 2B7DH 2ZKSA 2VVCA 5HGGA 4MPVA 3TH3H 1TA6A 6GCHG 1K1LA 4DOQA 5DGJA 3KCGH 2ZU3A 3SGQE 4HTCH 4GVUA 5C20A 3M7QA 2QXHA 1B7XB 1YF4A 4YESB 4KGAA 4ZXYH 3SJKA 1HXFH 5ABWA 5GWZA 4FU8A 2FIRH 1RRKA 3HK3B 4CRDA 1BTWA 2J34A 1ELVA 1G9IE 3A88A 3HGNA 3MNBA 1LPZB 4HGCA 3T25A 2A7JA 5LPRA 1C1VH 1BITA 2A4OA 1ANCA 4FUIA 2VIWA 1BB0B 3MU4A 1JRTA 3DFLA 3QUMP 1A7SA 1HPGA 1HRTH 1DM4B 2BDCA 4BTUB 3A82A 1W7GH 2FS9A 1G36A 1ZJDA 2J2UA 4AORA 4ISIH 1MZAA 5L30H 1V6DA 3TIUA 2DUCA 2VH6A 4ABFA 2VWOA 1ETSH 1G3CA 4HZHA 3L3TA 1S6FA 4NWKA 1RTLA 1YPKH 5TCCA 1C2IA 5DJ7A 1C2MA 2UUKB 5I25A 1KXDA 1H4WA 1O5EH 1BBRH 4WMDA 1SG8B 1F0SA 4RSPA 1GBFA 1P2OA 4BANB 1K28D 1S81A 2XXLA 4MNWA 1CT4E 3MH6A 1DWCH 5DP6A 5BRRE 1V2LT 1SMFE 1NTPA 2FXRA 3NCLA 4WH8A 5ESBA 1D3TB 2BXTH 3FZZA 5E2PA 2BDBA 1GJBB 2AGGX 4ABBA 1BRCE 2FP7B 1HXEH 1QL7A 3RXPA 1OSSA 1RD3B 2XTTB 1S0QA 2ZC9H 1SVPA 2P16A 2NU2E 1TX8A 4D9RA 1ABIH 4NG9H 2BTCE 1UTNA 2VIOA 2BY6X 3NWUA 4A1VA 1Z8RA 3V12A 2BDYA 3RXHA 5B6OA 2Y5GA 4THNH 5J4QA 3SUEA 4XOJA 1MZDA 2C3SA 3GYMA 4JK6A 1IQNA 4Y10E 1G30B 4JMYA 1F7ZA 2VJ1A 4CH2B 1RIWB 3A86A 3BTFE 1O3LA 2D26C 2ZCLP 3A83A 2XYAA 1PYTD 3PO1C 2G5VA 1WUNH 1DT2A 4K8YA 1G2LA 2R3YA 5GCHG 3RC6A 1P2MA 1JIMA 1P06A 2CMYA 2GCHG 5DPAA 3RXUA 4JK5A 2OC1A 1BZXE 1YPEH 1AKSA 1IQMA 1UTOA 1MBQA 2H9TH 4O03A 2FPZA 2A2XH 1AZ8A 1SGIB 1ZJKA 1WQSA 1UTJA 2BY7X 3PMAB 5FPTA 1SGPE 3PTNA 3S9AA 1AMHA 3BG8A 1O2NA 3ELAH 1KDQB 1K22H 3MU5A 3SORA 1SGEE 5DP9A 2AYWA 3RXSA 4B75A 4YT7H 2ZTYA 1UCYE 1KTTB 2DE8A 2GMTB 4INLA 3SGBE 1O3OA 1O5FH 2GD4B 7GCHF 5CHAC 3BEUA 1KTSB 2F9NA 1PPBH 1T8MA 1WV7H 1GI2A 4AYYB 1HV7A 1TNIA 2QF3A 1C5LH 3SOSA 1TRNA 1TX7A 3PWCA 2XW9A 4YZUA 3PM3A 4OS5A 1HAIH 1EZQA 3V0XA 4NIXA 2XNIA 1EP5A 5AFYH 1IAUA 2BMGB 5FCKA 2PKSC 3LU9B 1GMCF 4TY7A 2AGEX 1BTPA 2XC4A 1UK4A 3TJVA 1PPGE 4BTIB 5JB9S 4Y6DA 4D76A 5E0HA 4KP0A 2ZWLH 1EZXC 1MTWA 3NPSA 4D9QA 1K9OE 2GKVE 3M5LA 3P8GA 1P2KA 4X6NA 3S69A 1DSUA 3O8BA 2XC0A 1RFNA 1SGRE 2JETB 5F03A 2PUXB 2QCYA 2UUFB 3RLYH 4I33A 3RLWH 1MH0A 1GJ6A 3MMGA 2OLGA 2XWAA 1LVOA 4X8SH 1BCUH 1TOMH 1P04A 1BOQA 5G4BA 1YPMH 3KGPA 5EQQA 3QN7A 1HAVA 3UOPA 5C3NA 2ZHQH 3QZQA 4MVNA 1UVSH 3GDSA 1UTLM 5A8YA 4IC5A 1BTYA 1BUIA 1GHXH 2Y6TA 2ZFSA 1BT7A 3RXKA 1GI1A 4CHAC 3URDA 1FPCH 1J8AA 1H8IH 2Q1JA 1FLEE 2A4QA 3P92A 1OWJA 2ZFRH 1ZGIA 3MHWU 1IQJA 1O3GA 7ESTE 1GHZA 1GBBA 5C1UA 4GCHF 3VB5A 5FAHA 1BJVA 3MFJA 1AVWA 1BTZA 1V2VT 1F0UA 1F5RA 1UJ1A 1PPHE 4H4FA 4JYTA 3EAJA 2WPHS 2ZCKP 4Q2KA 1RXPA 2SGFE 2P3TB 1NRRH 1ELDE 3H7TA 2BY8X 5TJXA 1TPAE 1GGDC 2BQ7B 1S82A 1LCYA 3FANA 4XSKU 2PKAA 4O97A 1IQLA 2OC8A 3ZZBA 1P2NA 3RXAA 1WTGH 3UUZA 1GDUA 1MTUA 3SNBA 3C27B 4K5ZA 2ALVA 1BHXF 3GY5A 1GHBF 4F49A 2J9NA 2FTMA 2A4RA 2WYJA 4FUDA 3UQVA 3SJ8A 3V7TA 1KXEA 7KMEH 1Y5BT 1D9IA 3V13A 1FY5A 2D1JA 3ZVBA 3GY2A 4FUGA 4B2AA 4LK4A 1GBJA 1L1GA 1H1BA 1GCTC 3SNEA 1PPZA 2VIPA 1C5TA 1V2JT 3IG6B 1TNLA 1TMTH 4IGDA 2CGAA 4OS2A 5JBBS 2OC7A 1W14U 2B8OH 1CQQA 1SHYA 2C8XB 1VR1H 2NU0E 3U98H 1TQ0B 4MPWA 3SV2H 2ZTZA 5FX6A 3BTDE 4OGXA 1C1OA 3RM2H 3LGYA 2A31A 2Y81A 1FN6A 1TX6A 4LXBH 1F5LA 2J4IA 1C5YB 1GHWH 2O8LA 3S0NA 5K0HA 1L1NA 1UVUH 3A8AA 2ANKH 3E0PB 3UQOA 1HAOH 3VB7A 3NZIA 4A7IB 5EPYA 1O30A 2FX6A 4I8KA 4OGYA 2BLVA 1GVZA 3VFEA 1O36A 3ESTA 1AN1E 2ZPQA 1A5GH 3A85A 2VIQA 1TMUH 2ULLA 1A0LA 4KELA 1DWBH 5AFZH 1V3XA 2C8YB 2A32A 2GCTC 5A8ZA 1LPGB 3UR6A 4X1PU 4NIYA 3G01A 2W7UA 5K7RA 3E90B 4XBDA 2LNCA 2XBWA 3RMOH 1O5AB 1G3BA 7GCHG 1TGSZ 3SJOA 2BD4A 2O8MA 2BX4A 1ZYOA 3DD2H 8ESTE 2Z3EA 3BEFB 2ZHDA 1ZZZA 1IHTH 2ZDNA 3A84A 3BTGE 1CVWH 1MAXA 3AW1A 3SJ9A 1C5QA 1C5SA 8GCHF 2QA9E 1S85A 3MU1A 3ZZ9A 1P01A 3F9HA 3RXOA 2A0QB 2QGRA 2NU4E 1FQ3A 1Y3XA 1ABJH 1D6RA 2FM2A 4INHA 2OBOA 2ODPA 1O2JA 2WINI 2WPLS 1OP2A 3S9BA 3TGKE 1IQGA 1T8OA 5J4SA 1A4WH 2G4TA 1XUHA 2BZAA 2G81E 2BD9A 2HGTH 2FOBA 3RXVA 4DIIH 1DWEH 5A0CA 2DE9A 2BLOA 1A5IA 1ZHRA 2FZZA 4E06H 1P2JA 3U9AH 1C5RA 1XKBC 1Y8TA 3UPEA 1DY9A 1KXBA 3E0NB 1SI5H 2WPJS 1VGCB 1YKTA 2SGAA 1H9HE 4JZFH 3SU2A 3TK5A 2ZHEH 1OXGA 1T7CA 3FP8E 4GHQA 1GBDA 4ZKNU 1GJ9B 2O8UA
chains in the Genus database with same CATH superfamily
2UUYA 2Z3DA 3RXGA 1ZHMA 2J94A 2QC2A 1YCPH 4ZKSU 1O2RA 5LPFA 1FN8A 4DT4A 1GBLA 1LVMA 1O3FA 1O2GH 1XX9A 2R3UA 4ISOA 4DT7B 3SGAE 3FFGA 1ANBA 2ZQ2A 1WXRA 1SGYE 2VINA 1JIRA 1K1PA 1QFKH 1P9UA 5C0TA 2OQUA 1CBWB 1C4V2 3P17H 4AB9A 4U01A 2BZ6H 1AVGH 4FU7A 4UFEH 2FESH 3U8OH 1O35A 3CS0A 3ENSB 2SNVA 1OOKB 1NFUA 4FETA 2RG3A 4GCHG 2EA3A 4ABGA 1ZHPA 4UD9H 5LGOA 2VWLA 5HIYA 5JBAS 2FLRH 1PQAA 5F8XA 3Q3XA 1J9CH 5E0JA 2GZ7A 3DSPA 5FPYA 5C67A 1OWHA 1N6XA 2QIQA 2VGCC 4NIVA 1ZTLA 5T3HA 2Q6DA 1O3NA 4JZDH 1E79D 1SQOA 3BTQE 2GCHF 1GI9B 2FOEA 1GBMA 3A7ZA 1CT2E 1QCPA 2WUCA 3ZYEA 1GHBG 2OUAA 3RDZA 4IBLH 1C1SA 3AAUA 1IQKA 2LPRA 5DP8A 2JH0D 1TPSA 4VGCC 3D65E 4X8TH 1G3EA 1SSXA 4JZIA 3ZVFA 1GJ5H 2FI3E 1ZSJA 1DUEA 1YP9A 4OS4A 1T31A 2EC9H 1QR3E 4GPGA 1VZQH 2ANMH 4GUXA 1UO6A 1CA0B 2H5DA 2H9EH 1HJ9A 4MQAA 5EW1H 1D3DB 1L2EA 1MTVA 1THPB 3ATWA 5CDFE 4Q7XA 1Q3XA 1O32A 3LGTA 3OY5U 3PROA 4ASHA 1NZQH 4BAKB 5ETXA 3N7DA 5DO4H 2AIQA 5F6MA 3RXJA 8KME2 1ZLRA 1AE5A 1O3CA 1SC8U 5DP5A 3Q3KA 4X6MA 4GHTA 3K6ZA 5L2YH 2ZPRA 3KF2A 2ZGHA 4Y0YE 1AWHB 4DJZB 1WYKA 1Z71A 2PV9B 3IWMA 3WY8A 2F9BH 2LP6A 3E8LA 3TJUA 3B9FH 3DA9B 2GP9B 2O8WA 3QTOH 6ESTA 1WOFA 5CHBA 1KIGH 1N8OC 3VGCC 1NS3A 2ZU5A 1THSH 3DCLA 1O5DH 5EU8A 3GY8A 1PPEE 2VWNA 3Q77A 4BXWA 2VWMA 4R8TB 1CE5A 4UONA 2A2QH 1EJMA 4TWYA 3T62A 4LZ4B 1FDPA 1TNHA 1UCYH 2UWOA 1C5UA 4Y71A 5HM2A 3VB3A 3RU4E 1TB6H 1M9UA 2AFQB 2G52A 1LHGH 2PW8H 3ATLA 3GISB 3LGVA 3PLKA 4M9FA 1C2EA 3E91A 4VGCB 1UTPA 3SHCH 3F9FA 2FOMB 4WH6A 1O2VA 1GJCB 4NA8A 2KAIA 3AASA 3OU0A 3PMJA 1J15A 5B6LA 5GXPA 3BTTE 4NSYA 1C2GA 2G4UA 4GLYA 2IN2A 1A3EH 2FLBH 2VIDA 2G8TA 2GGVB 3SU3A 3M5OA 1K1MA 3NKKA 4JCNA 2FO9A 1V2PT 4JZ1A 5EODA 1CGHA 8GCHG 6CHAC 2RA0A 2BXUH 1AD8H 1D3QB 3ZYDA 1UTKA 1MCTA 1NRSH 4Y0ZE 3ZVCA 2Y7XA 4B6EA 4Z1MD 1EAWA 2BY9X 2SNWA 3CP7A 1V2UT 1IOEA 4F48B 1YPLH 3R0FA 5EPNA 3K6YA 4MDSA 1P2QA 2F83A 3P8NA 1W10U 4MNVA 5PTPA 1LO6A 3ZVAA 2IJOB 1D3PB 2AGIX 4X6OA 5EW2H 4O3TA 6LPRA 3T5FH 4ABDA 2Z7FE 3NK8A 3S7KB 3UNQA 1E34B 2CF9H 3GCHB 2FMJA 1TPOA 1OYTH 3I29A 1AHTH 4ZKRU 1TYNA 1K1OA 1BBRK 1NPMA 2H6MA 3VGCB 1MU6B 5T6DA 2WPMS 3BN9A 1BRAA 4AYVB 9ESTA 1TQ7B 3NUMA 3SU6A 1OP0A 2J38A 4OS7A 4D7FA 3E6PH 1CGJE 3RC4A 5FBIA 4NIWA 4YLQH 1LKBA 3EQ0H 1O2LA 1F2SE 4KKDA 3SI4H 1C5ZB 1FY3A 4ABJA 3TLOA 4NWLA 1SFIA 1AI8H 2F3CE 5JPMH 2A7HA 2XCNA 4GAWA 3SN8A 2TGAA 4K1SA 4I32A 3ZIAD 2NWNA 2GX4A 3FZDA 1GHAF 1O2WA 2GVFA 3A7VA 1MD8A 3HKIB 2ZI2H 3TK9A 1JOUB 5L2ZH 3EA7A 4A1XA 3SNAA 2V0BA 3H09A 2BLQA 1PPCE 4XD7D 3EDXB 2F9PA 4WVPE 1TGNA 1DS2E 4YXWD 1TBQH 2KM0A 1QBVH 1QZ8A 2QXGA 4SGBE 3UWJH 1QQUA 1S83A 3BG4C 4X6PA 5AHGH 3UY9A 2GZ9A 3GY7A 4ISHH 4X1QU 1EPTA 2A7CA 2ZTXA 5I46H 1P57B 2JH6D 4CRAA 1EZUC 1GPZA 1SLVB 3VB6A 1EOJA 3GICB 1ZPBA 1LVYA 5LPEA 1HBTH 1W8BH 5DG6A 4YOIA 5HKKD 2F4LA 1EQ9A 1Y3VA 1WDIA 4KTCA 1ELBA 3MTYA 3SHAH 4PROA 3S9CA 4ABHA 2VIVA 3I78A 3GCOA 4Q63A 4X8UH 1TRYA 1OS8A 3M3VA 4X2VA 3A8DA 3TGIE 2IPHA 1YY3A 1C2FA 2ZU1A 1TFXA 1F0TA 2ZFTA 3Q76A 1UTQA 2GTBA 4AB8A 3RXIA 2Z9JA 3NXPA 2AMQA 1LKAA 3B8JA 1HIAA 5HXFA 1HDTH 4BAOB 2L6OA 4Y8XA 3PTBA 2FS8A 1TGBA 1UHBB 3OFND 1TRMA 5C5OA 2P3FH 3SNDA 4X1NU 1DITH 1HCGA 1ARCA 2GDDA 1BIOA 5LH8A 1QQ4A 1AB9C 5BPEA 2PUQH 1GWAA 1S0RA 1HFDA 3F9GA 1GCDA 1K1IA 2W5EA 3RU4T 3LDXH 3H5CB 1ELAA 2HNTF 1GJ8B 1EZSC 2VVUA 4ZHMU 3QK1A 1SFQB 1ESTA 3U8TH 1DICA 1FZZA 4LOYH 1O3EA 3F3BA 4BOHA 5JBTA 2BDIA 4YOJA 3PO1B 2XRCA 5JB8S 1Z8JB 2BYAX 2IOTA 2KX4A 4WF8A 5CMXH 3DUXH 4Y8ZA 1V2NT 1Y3YA 3GYLB 4Z0KA 2WPIS 3BIVH 1JWTA 2ZFPH 1AO5A 3R3GB 3N7EA 1HYLA 4MPXA 4AFSA 4AGJA 2OP9A 2FX4A 2IPQX 1J14A 4WY3A 3KQDA 2YOLA 2FOCA 1CT0E 3FAOA 5A2MH 5GPIB 1V2QT 1XUKA 1ARBA 1FUJA 3UNRA 2J98A 1PFXC 2CN0H 3A7TA 1HJAC 4JYUH 2PSXA 1O3IA 1GBKA 1DANH 4NZLA 5CHAB 3LGIA 1C1QA 3OYPA 1CHGA 3TJOA 1FONA 1MU8B 1GI3A 3LONA 3D62A 5DP7A 1O2PA 4ACAA 5EQSA 1U6QA 1NRQH 3ZVGA 2WPKS 1EAXA 1Z8GA 4CRGA 2PKSB 1VITH 1MQ6A 1FY8E 2GZ8A 2A45B 1QRXA 2BHGA 3EA8A 3EE7A 2PWXA 3F2HA 4X2YA 3O8DA 2GDEH 2AIPA 1G3DA 4INKA 2ZQ1A 1EB1H 1H9LB 1YLDA 2JDID 3PWBA 1GG6C 3F2GA 5F8ZA 1EATA 2WV5A 3PRDA 1A2CH 1O3AA 2UWPA 8LPRA 1AZZA 1GI0A 2FOGA 2KFWA 1A46H 1T8NA 1TNGA 4B76A 4AOQA 1NRNH 2P93A 3TU7H 1SLXB 1NM6A 2CF8H 5FXLA 3U1JB 1P8VC 2PKAB 4ZUHA 1ZMJA 3S7HB 1V2MT 1QB1A 1C9PA 5EXMA 1FV9A 2OTVA 1P2IA 4K2YA 5F53A 3QWCH 1EXFA 3MNCA 1DOJA 1O31A 1QBOA 4A1TA 2TRMA 2C90B 1OYQA 5E0GA 1YGCH 3ZVEA 4FXGH 5HYOA 1DXPA 4MLFB 4ESTE 4WXVA 3HKJB 4CHAB 1MTSA 1GHAG 3PLPA 1O2KA 1O3BA 1KY9A 1XXFA 2HVXA 4X1RU 3GY6A 1HJAB 1BMFD 4WMFA 3K9XB 1O2XA 1O2UA 1ZRKA 1G2MA 3ZV8A 1BHXB 1SGQE 4RT0A 2ZFQH 1NRPH 1QB6A 1ACBE 1C4Y2 3DSOA 2WPDD 2QYIA 1BTXA 1SQRA 1ZMNA 1A1RA 4DG4A 5IYTA 1BMNH 1P11E 1BA8B 2F91A 2ALPA 1RTKA 1GGDB 5KEDA 2D8WA 4UFGH 2R9PA 4FUJA 3RXFA 4F4OC 1DDJA 1TOCB 3EE0B 2PGBB 1C2DA 1E38B 5JDUB 1H9IE 4CH8B 3IITA 3SI3H 1WAYB 1C5MD 1FNIA 1HAHH 3N7OA 3STIA 4Z6AH 1UK2A 1FY1A 1G32B 3TNTA 1EUFA 4K60A 2TGPZ 4K69A 3N99A 1GG6B 4WJG2 4ZKOU 2GJGA 1GBCA 1GVLA 1UMAH 1Z1JA 4ZHAA 2XWBI 2W6JD 1OWDA 1GCTB 2XBVA 3A7XA 4K8BA 1L1JA 3OY6U 4ISNA 4YOGA 1AFQC 3MO6A 4X1SU 2ZDVH 4E7RG 3F68H 1MUEB 1XUJA 1XUGA 3W1EA 3PMHB 4RN6A 2BVXH 3DHKH 4A92A 1XUFA 1KXFA 5EGMA 3M37A 3O8CA 3M35A 1D6WA 2C4FH 4XFQA 4D8NA 4ZMAH 3SU0A 1GJ7B 4CRCA 5HMAA 1HAGE 1SGCA 3PV5A 1LQDB 1OHHD 4B2CA 1UK3A 2Y5FA 2P8OC 3M3TA 1EP6A 1O2OA 1NFXA 2ZDLA 1YLNA 3M36A 2ZCHP 1JXPA 1F0RA 3M61U 3L6PA 1V2ST 4TPIZ 5DP3A 1GMHG 1P9SA 3BTKE 1XKAC 3MH7A 1GBIA 1DLKB 4DW2U 1QY6A 5C5NA 1O5GH 4P02A 1NN6A 4OM9A 2P59A 1OWEA 1TIOA 2G5NA 2VBCA 1IQFA 4NA7A 1MKWH 2ZHFH 5FBEA 4BAMB 2GCTB 2OBQA 3SU4A 1YCPK 1SPJA 3HATH 1ANEA 1QJ7B 2WSSD 4MPUA 4NZQA 2ZU2A 4ACBA 3SO3A 2NU3E 1GI8B 2ZHWH 1DFPA 3OTJE 1G37A 2XOKD 1GHVH 5KGOA 1S84A 3ATKA 3TNSA 3WWFA 3LGUA 2XCFA 2HLDD 1EKBB 1CO7E 2HPQH 1HLTH 1O2YA 2BD7A 4E7NA 1Y3WA 1FMGA 1GVKB 1SGTA 3D23A 3ZZ3A 1GJ4H 1DPOA 3NRLA 3TPIZ 1SLUB 2XBYA 1HAYB 2IJD1 2KZ4A 4Y79A 3SV6A 3C1KA 1QA0A 1ETRH 3PLBA 2QN5T 4LZ1H 1FAKH 2KR7A 3ODDA 5FCRA 2Y5HA 1DVAH 2Y80A 1SL3A 3K2UA 2FYQA 3UFAA 4ZROA 4UDWH 1DXWA 2A5KA 1YYY1 1NO9H 2J95A 2P8OB 5EXNA 2CXVA 1EAUA 3T28A 1LHDH 1TPPA 2BLWA 1C1PA 1EX3A 1WQVH 3JZ2B 5T6GA 1W2KH 1PQ8A 1TBZH 1E1QD 1ZR0A 1FAXA 4XRNA 4B1TA 4B71A 3SBKA 1GI4A 2A5AA 4X8VH 1K2I1 1THRH 2TPIZ 2JH5D 4MG3A 1QRWA 1O0DH 2OQ5A 1C5PA 3LC3A 4JYVH 2JKHA 5EG4A 1T4UH 3PV4A 2XBXA 1HJ8A 3DT0H 1B0FA 1C2LA 1SHHB 2HVYB 2PGQB 3RXTA 1O2QA 4SGAE 1FY4A 1SGNE 2ZF0H 2ZZUH 3VEQB 5C94A 3LIWA 5JYIA 1WCZA 2AMDA 1F92A 5FHTA 1NBME 3P6ZB 5GIBA 1C5XB 1E35B 2OD3B 1SOTA 4IMZA 3ZZ4A 3ZVDA 3QO6A 4WMEA 3I77A 4DCDA 2BY5X 3RXLA 2AEIH 1Y5UT 3W94A 4RT1A 4U2WA 2VGCB 3FVFB 4X2XA 3RXMA 2PTCE 5H4IB 3A89A 4TSFD 2O8UA 3JZ1B 1ZPCA 1BMMH 2Z6BD 1HAXB 1MKXH 4I7YH 5FX5A 3TH2H 1LHCH 4H6TA 3W95A 1H8DH 2CJIA 4A5TS 3OX7U 1GBEA 3VXEH 1UW7A 4TT3D 4HG6A 3BF6H 3FP7E 4TPYA 1VCWA 3HGPA 4DY7B 1SR5C 2SGEE 2BDHA 3B23B 1AY6H 1VJAU 2PLXA 1EASA 2ZIQH 3MU8A 3BTME 4FUCA 1BDAA 1GL0E 4BNRA 1ORFA 1EAIA 1UCYK 4ZXXH 2H5CA 4GSOA 3D49H 5DKMA 3A87A 1TBRH 4IN2A 4X2WA 2EI6A 5AVDA 3F0PA 3QX5H 2EEKA 1FI8A 2QV1A 1V2TT 4UEHH 4ABIA 1V2OT 3GDVA 1W12U 2QF0A 1ZSLA 1C4U2 4AZ2B 1A61H 1TGTA 2AERH 2XC5A 2KCOA 1P02A 1FX0B 3AAVA 1H8HD 1YPHC 4AX9H 1C5NH 1VCQA 3RMNH 4H42U 4XE4A 3F1SB 1H8ED 2YNBA 2KAIB 2AMPA 2Z3CA 1RIWC 3AVZA 1C9TA 2PHBA 4ABAA 2CHAC 2B9LA 2P3UB 2L74A 1YLCA 1BMLA 1NBMD 3MYWA 3UWIA 3LJOA 4ZCNA 1FIZA 3TGJE 1EJNA 2SFAA 4I8HA 4J1YA 1ELCA 4OS6A 3RP2A 4NFFA 3A80A 3RXEA 2Z9GA 3A8CA 4CRBA 2D2DA 3E16B 3T29A 1EPTC 3M5NA 1NU9A 2FYRA 3KQBA 1E1RD 1N8OB 5E2OA 1LTOA 1P12E 4AC9A 1MQ5A 1AGJA 2BX3A 2VH0A 4K3JA 1C1TA 4ABEA 2BQ6B 1SQTA 2UUJB 2HLCA 3RU4D 1W13U 2GMTC 3VPKA 1O2SA 4CBNA 4CR9A 3TJNA 1NFYA 2FODA 2VU8E 1VKYA 3ITIA 1IHSH 1O38A 4CREA 1AFEH 1P3EA 2BD8A 4ZH8A 4IC6A 3SUDA 3VXFH 2KCYA 3MH5A 4TYDA 2Q6FA 1WSSH 1UVPA 4DURA 2M5TA 1ZMLA 2FTLE 1O2IA 1SB1H 3SJIA 5EIYA 2I6QA 2R2WU 5GJ4B 6CHAB 1C5OH 3KHVA 3MO9A 3QLPH 2BM2A 1Z8IB 1A3BH 3URCA 1TAWA 4F55A 3RMMH 1OPHB 4A6LA 3UREA 2ZP0H 1QIXB 7LPRA 1GDQA 3A7YA 3FP6E 2HRVA 3BIUH 5ESTE 3RXRA 4AN7A 1LHEH 1LHFH 3STJA 2ZDKA 2Z94A 1N6YA 1KDQA 1DUAA 4AFZA 1Q2WA 2SGQE 4BAQB 2CHAB 1VITF 4Y11E 1OKXA 2JETC 1A0HB 3M7UA 4IS5A 4XDEA 1Y3UA 2TIOA 1ZSKA 4YT6H 1GMDG 2ILNA 1ZOMA 1HUTH 4DIHH 2FDAA 4YM9A 4YTAA 1W7XH 1GJDB 1WBGB 2ZNKH 3GDUA 1P3CA 4YO9A 2BVRH 1C1RA 1EPTB 2HNTC 4KTSA 1AKSB 1S6HA 3BTEE 3LH3A 2PFEA 1RGQA 1WU1A 2G00A 1UHBA 1AU8A 1SQAA 1TGCA 1V2WT 2TBSA 3SNCA 4ASUD 1O3KA 4Y7AA 1W0KD 4BAHB 4BTTB 4MTBA 1W0YH 2K8IA 2TGDA 2GV6A 2R2MB 1F5KU 4IMQA 2FI5E 2AS9A 3SUFA 4FVBA 4NSVA 1L4DA 4QT8C 3OTPA 4O3UA 4AG2A 1T8LA 1L0ZA 4ZAEA 4CR5A 3F0OA 1GHYH 1MTNC 2C93B 3TH4H 5C1XA 4R0IA 2BVSH 3MNSA 3SU5A 2OXSA 3OE7D 5GDSH 1QRZA 3EYDA 3V3MA 2Y82A 2WV4A 1Q31A 4AG1A 1K1NA 2ZU4A 3HPTB 1HIAB 5A09A 1QB9A 1TMBH 2A1DB 4I8JA 4FVDA 3AK5A 1NT1A 2F9UA 2G51A 1C2KA 3F2FA 3BG4B 5HM9A 1UVTH 2C8WB 3UR9A 2RDLA 2ZFFH 1O3DA 2YMSC 5JBCS 1O2TA 4CRFA 1Z7KA 3CS7A 1CHOG 1OWIA 1GMHF 1JRSA 3KYFA 1EOLA 4XBCA 1WTHD 1T4VH 1SGFA 2ZA5A 2PSYA 3RXCA 1IQEA 3FN8A 5FPSA 1E36B 1DLEA 3P8OA 3SU1A 3ZZ5A 2AH4X 5DSFA 1O39A 2VVVA 1CA8B 1PQ7A 1BBRE 3A7WA 1SOZA 3SV8A 3LGWA 5HIZA 3ATMA 1UTMA 4WXIA 3ZZ8A 1BJUA 4IN1A 4E05H 1QNJA 2NU1E 2PTNA 4TY6A 3MOCA 1XUIA 2P95A 1RJXB 3FKSD 4ISLA 3A8BA 2ODYB 1NU7B 1ID5H 5EJLA 9LPRA 1YPGH 1HAVB 1KLTA 2R0LA 2FI4E 1OP8A 1NROH 2C8ZB 2R0KA 1Y59T 2ZO3H 4X0WU 3RM0H 2OK5A 2QF5A 3GOVB 3BEIB 1NY22 1XVMA 1PJPA 1AB9B 3ZZ6A 5EQRA 3LT3A 2J92A 1MTNB 2P94A 1DE7H 2EI7A 1Z6EA 2GT8A 3LKWA 3KN2A 3MU0A 1SGDE 1KYNA 1ZGVA 1QJ1B 4NFEA 1DX5M 1ELTA 4UFFH 1P10A 1P0SH 1ELFA 2V3OH 2THFB 5A0BA 1C1UH 1DSTA 1O33A 3GCTF 1AWFH 2ZEBA 4AFQA 1OWKA 2OINA 1W3CA 1EFRD 3T26A 5DP4A 4Y8YA 1PYTC 2W3KA 4AGKA 3MI4A 5TCAA 1KLJH 1HAPH 1NFWA 2ESTE 2YMSB 5C17A 1AUTC 1ETTH 2V6NA 2Y7ZA 3E3TA 3KIDU 4H6SB 1MAYA 1YWUA 2ZDMA 4HI3A 2V3MA 3P70B 4FUBA 3MH4A 5L6NH 1GL1A 2Z9IA 3T27A 4CBOA 1TNJA 3P95A 2FEQH 5DN6D 3GY4A 1YC0A 2QF4A 1TNKA 2H1UA 1QTFA 2SGDE 2ZGXH 1PQ5A 4WWYA 2H9HA 2O8TA 4TWWA 2ZPSA 1V2RT 1C1WH 1HB0B 2HOBA 3WWBA 3SQHE 5DK1A 1D4PB 1VJ9U 4B2BA 1ELEE 2ODQA 2Q6GA 1HGTH 4RKJB 1MMJN 1TABE 5C2ZA 3SW2B 1YCPM 3CENA 1ZRBA 1BQYA 2ZGCA 1KLIH 2AHME 3HK6B 1GDNA 3EA9A 2F9OA 1BMAA 1FIWA 3DFJA 3QZRA 4K1EA 3UNSA 1W0ZU 1BTUA 2QAAA 1IQHA 1DWDH 2VB0A 3SUGA 2Z9KA 3Q3YA 2ASUB 3RC5A 1O3PB 1YBWA 4DVAU 2HPPH 2BD2A 1O2ZA 1EB2A 1VITG 2WUBA 1SBWA 4D7GA 1FXYA 3QGJA 1VGCC 1B5GH 1XM1A 3M7TA 3ZZCA 3OSYA 3KQCA 1TWXB 1NESE 1W0JD 3PMBB 3P8FA 1A5HA 2I6SA 1K21H 1GJAB 2BD5A 3GY3A 4AFUA 2JJ2D 2VNTA 6GCHF 1W11U 1YPHE 1O5CB 1O2MA 3MNXA 1X7AC 2BB4A 2STBE 1TLDA 3QDZB 5EXLA 5C1YA 3KYGA 3ZV9A 1CBWC 5F8TA 2YNAA 1C1NA 3F9EA 1C5WB 4FUEA 3UIRA 1C2HA 1J17T 1AUJA 2V35A 3BV9B 3A81A 1QL8A 3U8RH 2ZGJA 1Y5AT 1CGIE 1C1MA 1ZPZA 2F9VA 2QXIA 3LOXA 3ATIA 3M5MA 2WHXA 2ZDAH 4Q4LA 1AIXH 3RXQA 1TONA 1P05A 3GCNA 1HNEE 4I31A 1TALA 2GT7A 1LQEA 1QL9A 4NGAH 1P03A 3UOUA 1EJAA 5EJ1A 5CE1A 2CV3A 3KNXA 4Y76A 1Z1IA 3SQEE 4I8LA 3ODFA 3RMLH 1FPHH 1OX1A 1SGFG 1GI6A 1QGFA 2PP6A 4DGJA 1GMCG 1XMNB 1ESAA 2BD3A 1IQIA 1ESBA 1P09A 5E8EH 2BQWB 3MWIU 1KXAA 3QTVH 2BDAA 2ZECA 1C2JA 1MCVA 4P00A 1QJ6B 2SGPE 3SYJA 1TE0A 1YM0A 2O9QA 3FO8D 3E1XB 3U69H 2FOFA 2FOHA 4Y7BA 3RXDA 4Q7ZA 3SV9A 1XXDA 4NCYA 1MBMA 1CA0C 3O8RA 1GBTA 2W3IA 3KQEA 5AF9H 1RTFB 3OAAD 1XVOA 1ZTJA 1CU1A 2V3HH 1BRBE 2A4GA 2G55A 1MKWK 2QY0B 1B0EA 1O34A 3LJJA 1A0JA 1N1LA 2QXJA 3BTWE 3Q00A 1CSOE 3QGNB 3K65B 1E0FD 3BTHE 4U32A 1INCA 2STAE 3M3SA 1KMHB 1K1JA 1QURH 1LMWB 1BTHH 3U1IB 1LPKB 1AFQB 2B5TB 4I8GA 3RXBA 1PPFE 1SLWB 1O37A 4BXSA 2BOHB 3VG8A 3BSQA 1O3MA 1ANDA 1L4ZA 1O2HA 5EOKA 5IDKA 3F6UH 1E37B 4HFPB 3ZZAA 2ANWA 1ZTKA 2M2AA 1LVBA 1ELGA 1TA2A 1T32A 3UTUH 2HNTE 2KCPA 1KSNA 4I86A 1YPJH 1BRUP 1FJSA 3KL6A 1JMOH 2FOAA 4JZEH 3PB1E 3GCTG 3MO3A 5A0AE 1AQ7A 5GCHF 1GMDF 3ZZ7A 3TVJB 2WZQA 3AW0A 4FU9A 4UFDH 3TITA 1O5BB 4OS1A 4UE7H 4XBBA 2PR3A 1QA7A 4YLUA 2A5IA 4MNYA 1JBUH 1O3HA 2LELA 1S5SA 3LPRA 3WW7A 1GI5A 1GI7B 2W7SA 4NA9H 2BOKA 1DY8A 5T6FA 1VCPA 4RKOB 1O3JA 2FWWA 4M7GA 2TGTA 2UWLA 5A8XA 4MNXA 1NC6A 4B6FA 1GBHA 2WYGA 3PYHA 2K1QA 4FOUC 3SZNA 5GNDA 3LH1A 2BDGA 4FUHA 4IW4E 4B73A 2Z9LA 1LDTT 3LC5A 2ZGBH 2KCAA 2EI8A 2OCVB 2GV7A 1UVOA 1V2KT 4Q80A 2W26A 2HALA 2H2ZA 3ZZDA 1GBAA 2ANYA 1QBNA 1HAZB 1AVXA 2HWLB 2RCEA 4J2YB 3UAIC 4KTUA 3VB4A 4Q7YA 3TK6A 1QHRB 4U30A 2OC0A 4O9VA 3T2NA 4K1TA 1Z6JH 3H7OA 5SGAE 2ZG0H 1KXCA 1AE8H 3SV7A 3KEEA 4B74A 1CHOF 2B0FA 4ZHLU 3EGKH 1J16A 1C5VA 3DSGA 3GCHC 4FUFA 1MKXK 2RA3A 3L33A 3RUOA 1MD7A 2B7DH 2ZKSA 2VVCA 5HGGA 5T1VA 4MPVA 3TH3H 1TA6A 6GCHG 1K1LA 4DOQA 5DGJA 3KCGH 2ZU3A 3SGQE 4HTCH 4GVUA 5C20A 3M7QA 2QXHA 1B7XB 1YF4A 4YESB 4KGAA 4ZXYH 3SJKA 1HXFH 5ABWA 5GWZA 4FU8A 2FIRH 1RRKA 3HK3B 4CRDA 1BTWA 2J34A 1ELVA 1G9IE 3A88A 3HGNA 3MNBA 1LPZB 4HGCA 3T25A 2A7JA 5LPRA 1C1VH 1BITA 2A4OA 1ANCA 4FUIA 2VIWA 1BB0B 3MU4A 1JRTA 3DFLA 3QUMP 1A7SA 1HPGA 1HRTH 1DM4B 2BDCA 4BTUB 3A82A 1W7GH 2FS9A 1G36A 1ZJDA 2J2UA 4AORA 4ISIH 1MZAA 2YMSD 5L30H 3FOAA 1V6DA 3TIUA 2DUCA 2VH6A 2JIZD 4ABFA 2VWOA 1ETSH 1G3CA 4HZHA 3L3TA 1S6FA 4NWKA 1RTLA 1YPKH 2RDEA 5TCCA 1C2IA 5DJ7A 1C2MA 2UUKB 5I25A 1KXDA 1H4WA 1O5EH 1BBRH 4WMDA 1SG8B 1F0SA 4RSPA 1GBFA 1P2OA 4BANB 1K28D 1S81A 2XXLA 4MNWA 1CT4E 3MH6A 1DWCH 5DP6A 5BRRE 1V2LT 1SMFE 1NTPA 2FXRA 3NCLA 4WH8A 5ESBA 3KQ5A 1D3TB 2BXTH 3FZZA 5E2PA 2BDBA 1GJBB 2AGGX 4ABBA 1BRCE 2FP7B 1HXEH 1QL7A 3RXPA 1OSSA 4RI0A 1RD3B 2XTTB 1S0QA 2ZC9H 1SVPA 2P16A 2NU2E 1TX8A 4D9RA 1ABIH 2K0QA 2F43B 4NG9H 2BTCE 1UTNA 2VIOA 2BY6X 5KECA 3NWUA 4A1VA 1Z8RA 3V12A 2BDYA 3RXHA 5B6OA 2Y5GA 4THNH 5J4QA 3SUEA 4XOJA 1MZDA 2C3SA 3GYMA 4JK6A 1IQNA 4Y10E 1G30B 4JMYA 1F7ZA 2VJ1A 4CH2B 1RIWB 3A86A 3BTFE 3CNRA 1O3LA 2D26C 2ZCLP 3A83A 2XYAA 1PYTD 3PO1C 2G5VA 1WUNH 1DT2A 4K8YA 1G2LA 2R3YA 5GCHG 3RC6A 1P2MA 1JIMA 1P06A 2CMYA 2GCHG 5DPAA 3RXUA 4JK5A 2OC1A 1BZXE 1YPEH 1AKSA 1IQMA 1UTOA 3GS9A 1MBQA 2H9TH 4O03A 2FPZA 2A2XH 1AZ8A 1SGIB 1ZJKA 1WQSA 1UTJA 2BY7X 3PMAB 5FPTA 1SGPE 3PTNA 3S9AA 1AMHA 3BG8A 1O2NA 3ELAH 1KDQB 1K22H 3MU5A 3MQKC 3SORA 1SGEE 5DP9A 2AYWA 3RXSA 4B75A 4YT7H 2ZTYA 1UCYE 1KTTB 2DE8A 2GMTB 4INLA 3SGBE 1O3OA 1O5FH 2GD4B 7GCHF 5CHAC 3BEUA 1KTSB 2F9NA 1PPBH 1T8MA 1WV7H 2JJ1D 1GI2A 4AYYB 1HV7A 1TNIA 2QF3A 1C5LH 3SOSA 1TRNA 1TX7A 3PWCA 2XW9A 4YZUA 3PM3A 4OS5A 1HAIH 1EZQA 3V0XA 4NIXA 2XNIA 1EP5A 5AFYH 1IAUA 2BMGB 5FCKA 2PKSC 3LU9B 1GMCF 4TY7A 2AGEX 1BTPA 2XC4A 1UK4A 3TJVA 1PPGE 2XNDD 4BTIB 5JB9S 4Y6DA 4D76A 5E0HA 4KP0A 2ZWLH 1EZXC 1MTWA 3NPSA 4D9QA 1K9OE 2GKVE 3M5LA 3P8GA 1P2KA 4X6NA 3S69A 1DSUA 3O8BA 2XC0A 1RFNA 1SGRE 2JETB 5F03A 2PUXB 2QCYA 2UUFB 3RLYH 4I33A 3RLWH 1MH0A 1GJ6A 3MMGA 2OLGA 2XWAA 1LVOA 4X8SH 1BCUH 1TOMH 1P04A 1BOQA 5G4BA 1YPMH 3KGPA 5EQQA 3QN7A 1HAVA 3UOPA 5C3NA 2ZHQH 3QZQA 4MVNA 3PRBA 1UVSH 3GDSA 5IK2D 1UTLM 5A8YA 4IC5A 1BTYA 1BUIA 1GHXH 2Y6TA 2ZFSA 1BT7A 3RXKA 1GI1A 4CHAC 3URDA 1FPCH 1J8AA 1H8IH 2Q1JA 1FLEE 2A4QA 3P92A 5EJZA 1OWJA 2ZFRH 1ZGIA 3MHWU 1IQJA 1O3GA 7ESTE 1GHZA 1GBBA 5C1UA 4GCHF 3VB5A 5FAHA 1BJVA 2J98B 3MFJA 1AVWA 1BTZA 1V2VT 1F0UA 1F5RA 2EQNA 1UJ1A 1PPHE 4H4FA 4JYTA 5C0UA 3EAJA 2WPHS 2ZCKP 4Q2KA 1RXPA 2SGFE 2P3TB 1NRRH 1ELDE 3H7TA 2BY8X 5TJXA 1TPAE 1GGDC 2BQ7B 1S82A 1LCYA 3FANA 4XSKU 1SKYE 2PKAA 4O97A 1IQLA 2OC8A 3ZZBA 1P2NA 3RXAA 5FL7D 1WTGH 3UUZA 1GDUA 1MTUA 3SNBA 3C27B 4K5ZA 2ALVA 1BHXF 3GY5A 1GHBF 4F49A 2J9NA 2FTMA 2A4RA 2WYJA 4FUDA 3UQVA 3SJ8A 3V7TA 1KXEA 7KMEH 1Y5BT 1D9IA 3V13A 1FY5A 2D1JA 3ZVBA 3GY2A 4FUGA 1COWD 4B2AA 4LK4A 1GBJA 1L1GA 1H1BA 1GCTC 3SNEA 1PPZA 2VIPA 1C5TA 3UB0A 1V2JT 3IG6B 1TNLA 1TMTH 4IGDA 2CGAA 4OS2A 5JBBS 2OC7A 1W14U 2B8OH 1CQQA 3PV2A 1SHYA 2C8XB 1VR1H 2NU0E 3U98H 1TQ0B 4MPWA 3SV2H 2ZTZA 5FX6A 3BTDE 4OGXA 1C1OA 3RM2H 1K0HA 3LGYA 2A31A 2J97A 1MABB 2Y81A 1FN6A 1TX6A 4LXBH 1F5LA 2J4IA 2QE7D 1C5YB 1GHWH 2O8LA 3S0NA 5K0HA 1L1NA 1UVUH 3A8AA 2ANKH 3E0PB 3UQOA 1HAOH 3VB7A 3NZIA 4A7IB 5EPYA 1O30A 2FX6A 4I8KA 4OGYA 2BLVA 1GVZA 3VFEA 1O36A 3ESTA 1AN1E 2ZPQA 1A5GH 3A85A 2VIQA 2J5UA 1S6LA 1TMUH 2ULLA 1A0LA 4KELA 1DWBH 5AFZH 3SZEA 1V3XA 2C8YB 2A32A 2GCTC 5A8ZA 1LPGB 3UR6A 4X1PU 4NIYA 3G01A 2W7UA 5K7RA 3E90B 4XBDA 2LNCA 2W6ID 2XBWA 3RMOH 1O5AB 1G3BA 7GCHG 2V7QD 3OEHD 1TGSZ 3SJOA 2BD4A 2O8MA 2BX4A 1ZYOA 3DD2H 8ESTE 2Z3EA 3BEFB 2ZHDA 1ZZZA 1IHTH 2ZDNA 3A84A 3BTGE 1CVWH 1MAXA 3AW1A 3SJ9A 1C5QA 1C5SA 8GCHF 2QA9E 1S85A 3MU1A 3ZZ9A 1P01A 3F9HA 3RXOA 3OEED 3U28C 2A0QB 2QGRA 2NU4E 1FQ3A 1Y3XA 1ABJH 1D6RA 2FM2A 4INHA 2OBOA 2ODPA 1O2JA 2WINI 2WPLS 1OP2A 3S9BA 3TGKE 1IQGA 1T8OA 5J4SA 1A4WH 2G4TA 1XUHA 2BZAA 2G81E 2BD9A 2HGTH 2FOBA 3RXVA 4DIIH 1DWEH 5A0CA 2RFKC 2DE9A 2BLOA 2EY4C 1A5IA 1ZHRA 2FZZA 4E06H 1P2JA 3U9AH 2CK3D 1C5RA 1XKBC 1Y8TA 2WV9A 3UPEA 1DY9A 1KXBA 3E0NB 1SI5H 2WPJS 1VGCB 1YKTA 2SGAA 1H9HE 4JZFH 3SU2A 3TK5A 2ZHEH 1OXGA 1T7CA 3FP8E 4GHQA 1GBDA 4ZKNU 1GJ9B 1RS0A
chains in the Genus database with same CATH topology
2UUYA 2Z3DA 3RXGA 1ZHMA 2J94A 2QC2A 1YCPH 4ZKSU 1O2RA 5LPFA 1FN8A 1GBLA 1LVMA 1O3FA 1O2GH 1XX9A 2R3UA 4ISOA 4DT7B 3SGAE 3FFGA 1ANBA 2ZQ2A 1SGYE 2VINA 1JIRA 1K1PA 1QFKH 1P9UA 2OQUA 1CBWB 1C4V2 3P17H 4AB9A 4U01A 2BZ6H 1AVGH 4FU7A 4UFEH 2FESH 3U8OH 1O35A 3CS0A 3ENSB 2SNVA 1OOKB 1NFUA 2RG3A 4GCHG 2EA3A 4ABGA 1ZHPA 4UD9H 5LGOA 2VWLA 5JBAS 2FLRH 1PQAA 5F8XA 3Q3XA 1J9CH 5E0JA 2GZ7A 5FPYA 5C67A 1OWHA 1N6XA 2QIQA 2VGCC 4NIVA 1ZTLA 5T3HA 2Q6DA 1O3NA 4JZDH 1SQOA 3BTQE 2GCHF 1RS0A 1GI9B 2FOEA 1GBMA 3A7ZA 1CT2E 1QCPA 2WUCA 3ZYEA 1GHBG 2OUAA 3RDZA 4IBLH 1C1SA 3AAUA 1IQKA 2LPRA 5DP8A 2JH0D 1TPSA 4VGCC 3D65E 4X8TH 1G3EA 1SSXA 4JZIA 3ZVFA 1GJ5H 2FI3E 1ZSJA 1DUEA 1YP9A 4OS4A 1T31A 2EC9H 1QR3E 4GPGA 1VZQH 2ANMH 4GUXA 1UO6A 1CA0B 2H5DA 2H9EH 1HJ9A 4MQAA 5EW1H 1D3DB 1L2EA 1MTVA 1THPB 3ATWA 4Q7XA 1Q3XA 1O32A 3LGTA 3OY5U 3PROA 4ASHA 1NZQH 4BAKB 5ETXA 5DO4H 2AIQA 5F6MA 3RXJA 8KME2 1ZLRA 1AE5A 1O3CA 1SC8U 5DP5A 3Q3KA 4X6MA 4GHTA 3K6ZA 5L2YH 2ZPRA 3KF2A 2ZGHA 4Y0YE 1AWHB 4DJZB 1WYKA 1Z71A 2PV9B 3IWMA 3WY8A 2F9BH 3E8LA 3TJUA 3B9FH 3DA9B 2GP9B 2O8WA 3QTOH 6ESTA 1WOFA 1KIGH 1N8OC 3VGCC 1NS3A 2ZU5A 1THSH 5EU8A 1O5DH 3GY8A 1PPEE 2VWNA 3Q77A 4BXWA 2VWMA 4R8TB 1CE5A 4UONA 2A2QH 1EJMA 4TWYA 3T62A 4LZ4B 1FDPA 1TNHA 1UCYH 2UWOA 1C5UA 4Y71A 5HM2A 3VB3A 3RU4E 1TB6H 1M9UA 2AFQB 2G52A 1LHGH 2PW8H 3ATLA 3GISB 3LGVA 3PLKA 1C2EA 3E91A 4VGCB 1UTPA 3SHCH 3F9FA 2FOMB 4WH6A 1O2VA 1GJCB 4NA8A 2KAIA 3AASA 3OU0A 3PMJA 1J15A 5GXPA 3BTTE 4NSYA 1C2GA 2G4UA 4GLYA 2IN2A 1A3EH 2FLBH 2VIDA 2G8TA 2GGVB 3SU3A 3M5OA 1K1MA 3NKKA 4JCNA 2FO9A 1V2PT 4JZ1A 5EODA 1CGHA 8GCHG 6CHAC 2RA0A 2BXUH 1AD8H 1D3QB 3ZYDA 1UTKA 1MCTA 1NRSH 4Y0ZE 3ZVCA 2Y7XA 1EAWA 2BY9X 2SNWA 3CP7A 1V2UT 1IOEA 1YPLH 3R0FA 5EPNA 3K6YA 4MDSA 1P2QA 2F83A 3P8NA 1W10U 4MNVA 5PTPA 1LO6A 3ZVAA 2IJOB 1D3PB 2AGIX 4X6OA 5EW2H 4O3TA 6LPRA 3T5FH 4ABDA 2Z7FE 3NK8A 3S7KB 3UNQA 1E34B 2CF9H 3GCHB 2FMJA 1TPOA 1OYTH 3I29A 1AHTH 4ZKRU 1TYNA 1K1OA 1BBRK 1NPMA 2H6MA 3VGCB 1MU6B 5T6DA 2WPMS 3BN9A 1BRAA 4AYVB 9ESTA 1TQ7B 3NUMA 3SU6A 1OP0A 2J38A 4OS7A 4D7FA 3E6PH 1CGJE 3RC4A 5FBIA 4NIWA 4YLQH 1LKBA 3EQ0H 1O2LA 1F2SE 4KKDA 3SI4H 1C5ZB 1FY3A 4ABJA 3TLOA 4NWLA 1SFIA 1AI8H 2F3CE 5JPMH 2A7HA 2XCNA 4GAWA 3SN8A 2TGAA 4K1SA 4I32A 2NWNA 2GX4A 3FZDA 1GHAF 1O2WA 2GVFA 3A7VA 1MD8A 3HKIB 2ZI2H 3TK9A 1JOUB 5L2ZH 3EA7A 4A1XA 3SNAA 2V0BA 2BLQA 1PPCE 3EDXB 2F9PA 4WVPE 1TGNA 1DS2E 1TBQH 1QBVH 2QXGA 4SGBE 3UWJH 1QQUA 1S83A 3BG4C 4X6PA 5AHGH 3UY9A 2GZ9A 3GY7A 4ISHH 4X1QU 1EPTA 2A7CA 2ZTXA 5I46H 1P57B 2JH6D 4CRAA 1EZUC 1GPZA 1SLVB 3VB6A 1EOJA 3GICB 1ZPBA 1LVYA 5LPEA 1HBTH 1W8BH 5DG6A 4YOIA 1EQ9A 1Y3VA 4KTCA 1ELBA 3MTYA 3SHAH 4PROA 3S9CA 4ABHA 2VIVA 3I78A 3GCOA 4X8UH 1TRYA 1OS8A 3M3VA 4X2VA 3A8DA 3TGIE 2IPHA 1C2FA 2ZU1A 1TFXA 1F0TA 2ZFTA 3Q76A 1UTQA 2GTBA 4AB8A 3RXIA 2Z9JA 3NXPA 2AMQA 1LKAA 3B8JA 1HIAA 5HXFA 1HDTH 4BAOB 4Y8XA 3PTBA 2FS8A 1TGBA 1UHBB 1TRMA 5C5OA 2P3FH 3SNDA 4X1NU 1DITH 1HCGA 1ARCA 2GDDA 1BIOA 5LH8A 1QQ4A 1AB9C 5BPEA 2PUQH 1GWAA 1S0RA 1HFDA 3F9GA 1GCDA 1K1IA 2W5EA 3RU4T 3LDXH 3H5CB 1ELAA 2HNTF 1GJ8B 1EZSC 2VVUA 4ZHMU 3QK1A 1SFQB 1ESTA 3U8TH 1DICA 1FZZA 4LOYH 1O3EA 4BOHA 5JBTA 2BDIA 4YOJA 3PO1B 2XRCA 5JB8S 1Z8JB 2BYAX 2IOTA 4WF8A 5CMXH 3DUXH 4Y8ZA 1V2NT 1Y3YA 3GYLB 4Z0KA 2WPIS 3BIVH 1JWTA 2ZFPH 1AO5A 3R3GB 1HYLA 4MPXA 4AFSA 4AGJA 2OP9A 2FX4A 1J14A 4WY3A 3KQDA 2YOLA 2FOCA 1CT0E 3FAOA 5A2MH 5GPIB 1V2QT 1XUKA 1ARBA 1FUJA 3UNRA 1PFXC 2CN0H 3A7TA 1HJAC 4JYUH 2PSXA 1O3IA 1GBKA 1DANH 4NZLA 5CHAB 3LGIA 1C1QA 3OYPA 1CHGA 3TJOA 1FONA 1MU8B 1GI3A 3LONA 3D62A 5DP7A 1O2PA 5EQSA 1U6QA 1NRQH 3ZVGA 2WPKS 1EAXA 1Z8GA 4CRGA 2PKSB 1VITH 1MQ6A 1FY8E 2GZ8A 2A45B 1QRXA 2BHGA 3EA8A 2PWXA 4X2YA 3O8DA 2GDEH 2AIPA 1G3DA 4INKA 2ZQ1A 1EB1H 1H9LB 1YLDA 3PWBA 1GG6C 5F8ZA 1EATA 2WV5A 1A2CH 1O3AA 2UWPA 8LPRA 1AZZA 1GI0A 2FOGA 1A46H 1T8NA 1TNGA 4B76A 4AOQA 1NRNH 2P93A 3TU7H 1SLXB 1NM6A 2CF8H 5FXLA 3U1JB 1P8VC 2PKAB 4ZUHA 1ZMJA 3S7HB 1V2MT 1QB1A 1C9PA 5EXMA 1FV9A 2OTVA 1P2IA 4K2YA 3QWCH 1EXFA 3MNCA 1DOJA 1O31A 1QBOA 4A1TA 2TRMA 2C90B 1OYQA 5E0GA 1YGCH 3ZVEA 4FXGH 5HYOA 1DXPA 4MLFB 4ESTE 4WXVA 3HKJB 4CHAB 1MTSA 1GHAG 3PLPA 1O2KA 1O3BA 1KY9A 1XXFA 2HVXA 4X1RU 3GY6A 1HJAB 4WMFA 3K9XB 1O2XA 1O2UA 1ZRKA 1G2MA 3ZV8A 1BHXB 1SGQE 2ZFQH 1NRPH 1QB6A 1ACBE 1C4Y2 2QYIA 1BTXA 1ZMNA 1A1RA 4DG4A 5IYTA 1BMNH 1P11E 1BA8B 2F91A 2ALPA 1RTKA 1GGDB 2D8WA 4UFGH 2R9PA 4FUJA 3RXFA 4F4OC 1DDJA 1TOCB 3EE0B 2PGBB 1C2DA 1E38B 5JDUB 1H9IE 4CH8B 3IITA 3SI3H 1WAYB 1C5MD 1FNIA 1HAHH 3N7OA 3STIA 4Z6AH 1UK2A 1FY1A 1G32B 3TNTA 1EUFA 4K60A 2TGPZ 4K69A 4ZKOU 1GG6B 4WJG2 1GBCA 1GVLA 1UMAH 1Z1JA 4ZHAA 2XWBI 1OWDA 1GCTB 2XBVA 3A7XA 4K8BA 1L1JA 3OY6U 4ISNA 4YOGA 1AFQC 3MO6A 4X1SU 2ZDVH 4E7RG 3F68H 1MUEB 1XUJA 1XUGA 3PMHB 4RN6A 2BVXH 3DHKH 4A92A 1XUFA 1KXFA 5EGMA 3M37A 3O8CA 3M35A 1D6WA 2C4FH 4XFQA 4D8NA 4ZMAH 3SU0A 1GJ7B 4CRCA 5HMAA 1HAGE 1SGCA 4B2CA 1LQDB 1UK3A 2Y5FA 2P8OC 3M3TA 1EP6A 1O2OA 1NFXA 2ZDLA 3M36A 2ZCHP 1JXPA 1F0RA 3M61U 3L6PA 1V2ST 4TPIZ 5DP3A 1GMHG 1P9SA 3BTKE 1XKAC 3MH7A 1GBIA 1DLKB 4DW2U 1QY6A 5C5NA 1O5GH 1NN6A 2P59A 1OWEA 1TIOA 2G5NA 1IQFA 4NA7A 1MKWH 2ZHFH 5FBEA 4BAMB 2GCTB 2OBQA 3SU4A 1YCPK 1SPJA 3HATH 1ANEA 1QJ7B 4MPUA 4NZQA 2ZU2A 3SO3A 2NU3E 1GI8B 2ZHWH 1DFPA 3OTJE 1G37A 1GHVH 1S84A 3ATKA 3TNSA 3LGUA 2XCFA 1EKBB 1CO7E 2HPQH 1HLTH 1O2YA 2BD7A 4E7NA 1Y3WA 1FMGA 1GVKB 1SGTA 3D23A 3ZZ3A 1GJ4H 1DPOA 3TPIZ 1SLUB 2XBYA 1HAYB 4Y79A 3SV6A 3C1KA 1QA0A 1ETRH 3PLBA 2QN5T 4LZ1H 1FAKH 3ODDA 5FCRA 2Y5HA 1DVAH 2Y80A 1SL3A 3K2UA 2FYQA 3UFAA 4ZROA 4UDWH 1DXWA 2A5KA 1YYY1 1NO9H 2J95A 2P8OB 5EXNA 2CXVA 1EAUA 3T28A 1LHDH 1TPPA 2BLWA 1C1PA 1EX3A 1WQVH 3JZ2B 5T6GA 1W2KH 1PQ8A 1TBZH 1ZR0A 1FAXA 4B1TA 4B71A 3SBKA 1GI4A 2A5AA 4X8VH 1K2I1 1THRH 2TPIZ 2JH5D 4MG3A 1QRWA 1O0DH 2OQ5A 1C5PA 3LC3A 4JYVH 2JKHA 5EG4A 1T4UH 3PV4A 2XBXA 1HJ8A 3DT0H 1B0FA 1C2LA 1SHHB 2PGQB 3RXTA 1O2QA 4SGAE 1FY4A 1SGNE 2ZF0H 2ZZUH 3VEQB 3LIWA 5JYIA 1WCZA 2AMDA 1F92A 5FHTA 3P6ZB 5GIBA 1C5XB 1E35B 2OD3B 1SOTA 4IMZA 3ZZ4A 3ZVDA 3QO6A 4WMEA 3I77A 4DCDA 2BY5X 3RXLA 2AEIH 1Y5UT 3W94A 4U2WA 2VGCB 3FVFB 4X2XA 3RXMA 2PTCE 5H4IB 3A89A 3JZ1B 1ZPCA 1BMMH 2Z6BD 1HAXB 1MKXH 4I7YH 5FX5A 3TH2H 1LHCH 4H6TA 3W95A 1H8DH 2CJIA 4A5TS 3OX7U 1GBEA 3VXEH 3BF6H 3FP7E 4TPYA 1VCWA 3HGPA 4DY7B 1SR5C 2SGEE 2BDHA 3B23B 1AY6H 1VJAU 2PLXA 1EASA 2ZIQH 3MU8A 3BTME 4FUCA 1BDAA 1GL0E 4BNRA 1ORFA 1EAIA 1UCYK 4ZXXH 2H5CA 4GSOA 3D49H 5DKMA 3A87A 1TBRH 4IN2A 4X2WA 2EI6A 5AVDA 3QX5H 2EEKA 1FI8A 2QV1A 1V2TT 4UEHH 4ABIA 1V2OT 3GDVA 1W12U 2QF0A 1ZSLA 1C4U2 4AZ2B 1A61H 1TGTA 2AERH 2XC5A 3AAVA 1P02A 1YPHC 4AX9H 1C5NH 1VCQA 3RMNH 4H42U 4XE4A 3F1SB 2YNBA 2KAIB 2AMPA 2Z3CA 1RIWC 3AVZA 1C9TA 2PHBA 4ABAA 2CHAC 2B9LA 2P3UB 1YLCA 1BMLA 3MYWA 3UWIA 3LJOA 1FIZA 3TGJE 1EJNA 2SFAA 4I8HA 4J1YA 1ELCA 4OS6A 3RP2A 4NFFA 3A80A 3RXEA 2Z9GA 3A8CA 4CRBA 2D2DA 3E16B 3T29A 1EPTC 3M5NA 1NU9A 2FYRA 3KQBA 1N8OB 5E2OA 1LTOA 1P12E 1MQ5A 1AGJA 2BX3A 2VH0A 4K3JA 1C1TA 4ABEA 2BQ6B 1SQTA 2UUJB 2HLCA 3RU4D 1W13U 2GMTC 3VPKA 1O2SA 4CBNA 4CR9A 3TJNA 1NFYA 2FODA 2VU8E 3ITIA 1IHSH 1O38A 4CREA 1AFEH 1P3EA 2BD8A 4ZH8A 4IC6A 3SUDA 3VXFH 3MH5A 4TYDA 2Q6FA 1WSSH 1UVPA 4DURA 2M5TA 1ZMLA 2FTLE 1O2IA 1SB1H 3SJIA 2I6QA 2R2WU 5GJ4B 6CHAB 1C5OH 3KHVA 3MO9A 3QLPH 2BM2A 1Z8IB 1A3BH 3URCA 1TAWA 3RMMH 1OPHB 4A6LA 3UREA 2ZP0H 1QIXB 7LPRA 1GDQA 3A7YA 3FP6E 2HRVA 3BIUH 5ESTE 3RXRA 4AN7A 1LHEH 1LHFH 3STJA 2ZDKA 2Z94A 1N6YA 1KDQA 1DUAA 4AFZA 1Q2WA 2SGQE 4BAQB 2CHAB 1VITF 4Y11E 1OKXA 2JETC 1A0HB 3M7UA 4IS5A 4XDEA 1Y3UA 2TIOA 1ZSKA 4YT6H 1GMDG 2ILNA 1ZOMA 1HUTH 4DIHH 2FDAA 4YM9A 4YTAA 1W7XH 1GJDB 1WBGB 2ZNKH 3GDUA 1P3CA 4YO9A 2BVRH 1C1RA 1EPTB 2HNTC 4KTSA 1AKSB 1S6HA 3BTEE 3LH3A 2PFEA 1RGQA 1WU1A 2G00A 1UHBA 1AU8A 1SQAA 1TGCA 1V2WT 2TBSA 3SNCA 1O3KA 4Y7AA 4BAHB 4BTTB 4MTBA 1W0YH 2TGDA 2GV6A 2R2MB 1F5KU 4IMQA 2FI5E 2AS9A 3SUFA 4FVBA 4NSVA 1L4DA 4QT8C 4O3UA 4AG2A 1T8LA 1L0ZA 4ZAEA </