4KU4A

Crystal structure of a ras-like protein from cryphonectria parasitica in complex with gdp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
189
structure length
171
Chain Sequence
AGKITDKIAMLGEGGVGKTSLTVNLTKHVFSETYDPTLEDSYRRQCVIDGIPSHLEILDTAGALREQWIRQNELFVIVFDVTRRSSFEAAERLFEEVIQTKRKLDEPFAPSLVVLVGNKCDLDTRREVGTLEGSSLAKKLGCGFVETSAKLGTNVEEAFFSVVRADRRRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-3 from Cryphonectria parasitica
publication title Crystal Structure of a Ras-like Protein from Cryphonectria parasitica in Complex with GDP
rcsb
source organism Cryphonectria parasitica
molecule tags Signaling protein
total genus 61
structure length 171
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ku4A00
3RVBA 2FN4A 3QKRA 4GP6A 2HJVA 3AEZA 5KTYA 4Z54A 4P4SB 5LD2C 5AJXA 3ADDA 2PT5A 1D9ZA 5FPHA 4DLYA 3OZXA 3SS8A 2JATA 3EW9A 5B58C 4I99A 1Z2CA 3QVUA 3REFA 1G291 2FPMA 4IVRA 2W83A 3AVOA 1SVKA 4KFUA 4TTRA 1W36C 1BOFA 2ZS8A 1E9DA 2JGNA 1CR0A 2QSYA 3L8ZA 1VG0B 4PZYA 3PUYA 4KVAA 3ZZ0A 4QM7A 1N6NA 2PZFA 3CNLA 2QSZA 4KHZA 3ZIAD 1KO1A 3QXCA 1BYIA 2R6CA 4IRUB 5E7MA 3VR2A 1E2HA 2VPPA 2X2EA 3N70A 1Q1EA 3NXSA 4GI7A 2WKQA 3FGNA 4GMXA 5K8IA 1VECA 4IHQA 3ZLJA 2ZJ5A 3HPRA 2EQBA 1P9RA 1ANKA 3OFND 2FSIA 4PPFA 3TMKA 4L9SA 1MABA 4HB2A 2RMKA 3GMTA 4QFMA 3MMPA 1G8PA 5KHOC 2ZI5A 1RJ9B 4LK2A 2ATVA 4RD0A 3O8CA 2XB2A 1M74A 4OI4A 1XJ0A 2ZAOA 3SI7A 4DIDA 2IYSA 5G40A 3FFBA 3ZS8A 1Q3TA 1JPJA 4AD8A 1Z06A 4B35A 2FA9A 4MUBA 2ZPTX 1SULA 1KK0A 3CRMA 3KJHA 5HKKD 2JASA 2PJRA 3Q5EA 4DDWA 1E9EA 4AY2A 4GSYA 2NO6A 1KKLA 4AI6A 1T3SA 1LB1B 3A1TA 5AR1A 2BBTA 3NG1A 4TYYA 1QHXA 2BBWA 1GSIA 3GFPA 5HZHA 4DB2A 3GFOA 1KK3A 5FTNA 4TWZA 3IEVA 1L4YA 2RB4A 5J5CA 2V9PA 3IBYA 3C41J 1CLUA 2WPDD 5JHHB 3EWAA 1X1SA 3LWNA 4B74A 2XZPA 1QZXA 3TSWA 3B6EA 1ZW6A 1Z0JA 2ZSEA 4Q9IA 5JJKA 3ZIAA 5KNDA 3PEUA 2WM9B 4GOKA 4RJLA 1YZNA 5DGXA 3U7GA 1T0JB 2REBA 2GVZC 3CWQA 3H2YA 3KL4A 4S2EA 3PVSA 3SFZA 4D4LA 5B64A 1YR8A 3GLIE 5G3ZA 2Q6TA 4C0HA 4LJ7A 4A4DA 3N2IA 4TMKA 3DM5A 1F60A 1UJ2A 2G1JA 2PBRA 1G7SA 1SVWA 4NONA 4ZDJA 3THWA 1E9BA 3W8RA 3C15C 4CEHB 1SXJC 1OFUX 4NBSA 3KTAA 3RS2A 1J70A 3CRRA 3LA6A 3QPVA 1OPXA 3K0SA 3KX2A 3CF2A 1QHHA 2F55A 1YRBA 1IXZA 5JWOA 1NG1A 3A4MA 4HLUC 1XPUA 1BH2A 1G7TA 3FHCB 4M9ZA 1G3QA 3PFIA 4A36A 2YWHA 3FWYA 3RHFA 4FI3C 2GZHA 4P4SA 3BC1A 4QJ3A 5FBWB 3OIUA 2EFHB 2IXGA 2PEZA 4U00A 3EZ2A 4EAQA 3WRXC 3TUJC 3QVVA 1G8HA 1WBDA 2FPKA 3T1OA 2QPOA 1XFAA 2AXNA 3WYFA 3B1YA 4ESVA 5TDHA 1KSHA 4IVPA 4LSGA 3SHWA 2ZI6A 4KODA 2P3SA 3R9XA 4KU4A 2GXAA 3PV0A 3KXKA 4P4UA 2ZXUA 1KYIA 3IQXA 3P4YA 4F91B 4HDOB 4BFZA 1N6HA 4M1OA 4QGAA 4PR0A 1CJMA 1E1QD 1BMFD 1IM2A 4KSBA 1XP8A 4C9BA 4DDUA 1EG7A 4XD7A 5CITA 4B3CA 4D4MA 3RYTC 1UFQA 2ORIA 1MRSA 1G6OA 5E95A 3CBQA 4UNQA 2FDCA 4PFSA 3TAHA 4PSAA 2XOKA 4BFUA 4HB3A 2VQSA 3TW8B 4EKDA 4D4JA 2ECKA 2VTKA 1F5NA 4BQSA 1N5LA 2YOGA 3SBDA 3U3OA 1AK2A 1Z6XA 5DSZA 5B2ZA 1Z3IX 2ZJ2A 3AVUA 2ERXA 4Q9LA 4RZUA 1EK0A 4OHXA 1G5RA 4UKDA 1HT2E 1A5TA 3C5CA 4NE2A 4POAA 2X1VA 3I61A 1S3SA 3O8BA 3QBTA 3MWLA 2XTNA 3QXHA 2OBLA 4PC6A 4W5HA 1ZD9A 2V7QD 2RKOA 1I4DD 1UAAA 2GJSA 2ZTSA 1IHUA 3TQFA 3I92A 5EZ5A 3F5FA 1YZQA 3U3RA 4EQ6B 4OQXA 1XCMA 3B60A 2WICA 4M9XA 4C0AC 1KAGA 5DI9A 2O0HA 1FQJA 4MGZR 2XNDA 4LUCA 1NY6A 2VP9A 4DLUA 4O25A 3NTUA 3D7MA 1E96A 2WWGA 3QKTA 4X8MA 4ZV4A 3A1WA 4OK3A 2OFWA 3K70D 3VKGA 2F1HA 1W4AA 2WSSD 2IW3A 1UEJA 1DBSA 1JALA 4JSYA 3KKNA 2W2XA 2ZI7A 4KITB 1ZC4A 2IYYA 3KKQA 1VIAA 2HXSA 1GILA 2R6DA 2QGNA 4JVMA 1ESNA 1HQYE 4KAXA 3AVVA 5KUTA 3KJIA 4G1UC 3TSZA 4Q9HA 1LF0A 2XAUA 2CE2X 1FUKA 1E79D 1DAGA 5JEEA 4X8HA 1VCOA 3RLFA 2D2FA 3CB4A 1EFUA 4WZ6A 4CEHA 1FUUA 5JRJA 5LDDC 2OESA 4HLQB 2KI5A 1KNQA 721PA 2QPAA 2V4ZA 2R8RA 3B82A 4ZDKA 1LW7A 4KCGA 1RW4A 2XTZA 5FH9A 1P5ZB 2LCFA 4CEJB 4Y0VA 3QE0A 4MA4A 4D0GA 3AB3A 4LHZA 4QBGB 2V1XA 2ZRLA 5EZ6B 2C03A 1OXXK 1N6KA 5KSYA 1IXSB 2EYQA 1US8A 3NC0C 2IL1A 5IHPA 4G5SA 4LJ4A 3A1UA 4KFRA 2VIIA 4BGDA 1M6NA 4NCIA 4M53A 3R9IA 2JLWA 3K8YA 4B32A 3GJ5A 2H5EA 3DOEA 3E2IA 2DYKA 4NDZA 4YMSA 4B48A 4NU0A 1W36B 2O8BB 1CRPA 2IS6A 3CW2A 2MMCA 1XEFA 4BFSA 4OKSA 1FP6A 3O8DA 1PLLA 3ZS9A 4JLJA 1T91A 5DE3A 5DYIA 1R0ZA 2R6GA 2WSSA 1UBEA 2V55B 5J4KA 2DBYA 1EFRA 1OKKD 1N5JA 2DHRA 1OLOA 5BN4A 2CCGA 2QP3A 1OFHA 2G77B 4EJSC 3PUXA 1AJEA 4TMZA 4US2R 2OCAA 4G0NA 2W0MA 5EXPA 4QGHA 3BORA 3ZDQA 3EC1A 4QBIA 1IBRA 4TQAA 3EZ7A 1E79A 1NMXA 5AUOB 3EPLA 2OSBA 3EZ6A 3CO5A 3FYHA 2VP5A 3QUSA 2GJKA 4XJXA 1SVIA 2ZJAA 2ZRAA 2WSMA 2R65A 5J40A 4C0SA 2XNSA 4AYWA 4GZLA 2KSQA 1Z29A 1E9FA 2WJJA 3L8YA 1F6BA 4PSKA 3W5JA 3WBKA 4DLXA 4UJ5A 3B1XA 1YJ5A 1G16A 4ARZA 1GL6A 3IUYA 1LS6A 3WRYC 2O0JA 2NOAA 4PO1A 5HCIA 3B1ZA 3B2EA 2NGRA 3KKOA 4H1UA 3RRZA 1KNXA 3A4LA 2VP6A 3S1AB 4PX9A 1JNYA 4EQ6A 5C2JB 4DUGA 3U5ZB 3OEEA 1HE8B 2ZI3A 1UPTA 4ZI3A 3UIEA 5CJ2A 4E22A 2O8CB 5EE9A 4OK6A 4R7ZA 1RVDA 2JLRA 4D26A 2WIAA 5EJEA 1GRRA 2IYQA 2QROA 3ZVLA 2P6UA 1GKUB 4FINA 3TUZC 1VYVA 2FNAA 5TY0A 2W6JD 5FI1B 4V0OA 1XTKA 4EPXA 3QF4B 3EARA 3NHAA 3QXJA 1W5SA 2QL6A 1AKYA 3FMIA 3DO6A 3FMPB 4PQRA 3H0KA 4P31A 2JDID 1K5GA 1NSFA 3UG6A 4YMTA 2V3CC 5FFMA 3I62A 4QJ4A 3L0OA 1GVNB 1W4CA 3D8BA 1D8TA 4YQFA 1TPZA 2WHXA 5KNCA 3QG5A 5FPKA 2GZAA 2ZM5A 2FZLA 1XNJA 1XBTA 3KXIA 4LHWA 2GTPA 4RCYA 4W9MC 1WMSA 4BLRA 1N0WA 4P3YA 2CHGA 3M4YA 4HUQB 3THYB 2P65A 1SXJB 5TARA 1HV8A 3R9WA 1Z28A 4AURA 4PAQA 1EXMA 4ILEA 4Z1MD 4B6EA 5IK2A 1ZD1A 1E2PA 1G64A 1QG4A 5BYJA 5TXGA 4CEJA 1HURA 1VKJA 1NBMA 5JECA 4PC7A 1KK2A 3AP1A 2GA8A 4M1WA 4YDHB 5FL7D 2YV5A 2GKSA 4JLPA 4JSTA 3VR5A 5JEDA 1M34E 2ZJ8A 1QHNA 3LFUA 1AZSC 2JLSA 3UATA 4B2PA 1KO8A 3FB4A 3EASA 1ZNXA 2VF8A 2OBNA 3OAAD 4OQMA 1LVGA 2HT6A 2ERYA 3CH4B 3OIWA 4DCVA 2BIFA 3U60B 2OEPA 2ZYUX 2WBLC 3UANA 1G3IA 2CXXA 2O8BA 4Q9JA 2KWIA 3FVQA 4B3GA 1IOZA 4FIDA 4IDOA 4OHVA 4PAMA 1HA3A 3T34A 1SVLA 1P9WA 2G0NA 4GPTA 2JA1A 1TL7C 3K0CC 4MYUA 3KJEA 4XWKA 4ON9A 2DR3A 2VHQA 2GCNA 4DEXA 3GLGB 1VG9B 4AKGA 2WWFA 4NPHA 4R2HA 4C7OB 3CR8A 2X8AA 1MO3A 2C04A 4G5QA 3KXLA 1T0HB 3L2OB 1ZNYA 4Q4JA 2QQEA 1X8KA 3M6AA 4WZAE 1KZ7B 1U0LA 4PXAA 5FTKA 4BRUA 3KQNA 1TQ4A 1LNZA 1XWIA 4PC3A 4IW3B 2CEAA 3LVQE 4JMPA 5KU1A 1SVSA 4RFVA 2QI9C 1WBBA 1XEXB 4TYPA 5FPSA 5KDOA 4NL4H 4GT1A 1RE0A 2FJUA 4ABYA 2IF2A 1Z08A 2GXUA 1K8RA 4FCWA 5CLLA 1E1RD 4ZIRA 1AS0A 2VLIA 3BXZA 1XD8A 5FL7A 4AK9A 1MO6A 5J4YA 5HTKA 4A2WA 4OI0A 3S1AA 2QM7A 2W0SA 4HAYA 3L0IB 4CZ2A 5FUVA 2YWEA 3P27A 3NBXX 2IHYA 3LBHA 5HE8A 3OAAA 2Z83A 3RC3A 4BLPA 4PPNA 5E3HA 2O8CA 3NH9A 4HZIA 1N5IA 4JLKA 3KZ1E 5SZIA 3U2QA 1GAJA 2ZITA 3LLMA 3CNNA 4URWR 3FHTA 3UK6A 4LC1A 4FWTA 1XTIA 3ND9A 2EFEB 3BERA 1MO5A 1W0KA 1G7CA 4AIIA 1NJFA 5EUQB 3I1FA 1A2KC 1YZLA 2ZRBA 1J8MF 1P3JA 2ZUDA 4Q7KA 1OB2A 5JZVA 3LD9A 2J45A 1Z2AA 4GP7A 4B33A 1X86B 3ZVRA 1Q3HA 1Z0KA 2QMHA 2HUPA 1QVAA 1T8TA 4UNSA 3THYA 4HUQA 4Q48A 1SXJA 4DCUA 4IEEA 2V1UA 3U3MA 1X8LA 1E2DA 1G9XA 2QE7D 1DAKA 3SZRA 1XTRA 1SKYE 2OCBA 3AVWA 1W0JD 5F9FA 3TIFA 1P2SA 1SZPA 1V43A 4HLUA 2BWJA 4QL3A 1P61B 4C2TA 3HWSA 3CF6R 3LQRA 4TLAA 1XDBA 1DTSA 3OIYA 1WQ1R 3P20A 3K70C 3F0TA 1E1RA 3IGFA 4HAUA 4NCHA 4UNNA 1S1CA 1CIPA 2R62A 2WJVA 3SJCA 3U7EB 3X1DA 4B44A 1S1MA 3W6OA 2XGJA 2PEYA 1Z22A 1E98A 3A1VA 4PPQA 5H68A 1KO5A 2AK3A 1K6MA 2WKPA 2GZDA 4HB0A 4DCNA 4XTCS 4HLDA 2ZUCA 4OQLA 1XZPA 4LYJA 1DO0A 1JJ7A 1FP7A 3GLHB 3LNCA 2VHTA 2F9LA 2IUSA 4F92B 5JLJA 2A78A 2IYWA 1KMQA 4LYHA 1KKMA 1LY1A 5LPNA 4Q1BA 1CU1A 3CKLA 4TL6A 4ZDWA 2PLRA 2HXYA 2BCGY 4FD2A 1JPNA 4L5BA 2GF0A 4ZO4A 4A2PA 4EJSB 5GADl 1G6HA 2OLKA 2QMOA 5A5GA 4MH0R 1OE0A 2NO1A 5JMTA 4AKIA 4UXIA 5DISB 1E69A 3QPWA 3K09C 3CF0A 2AR7A 2OE2A 4RZ3A 3R7WA 3LXRA 4E07A 1YKSA 2CVFA 1XEXA 1NI3A 3AP2A 4CIDA 2NPIA 5L3QB 3THOA 4FXPA 4V0LA 3ZJYA 4RD4A 4EPWA 2ONJA 2G9NA 5SZJA 3Q9LA 2JLUA 1W4BA 2WMNB 4F4CA 2F9MA 1GRNA 1A2BA 2GCOA 4M1KA 5DN6D 3IEUA 3WP0A 2OILA 1JXMA 4JT4A 4Q4HB 2R2AA 4DSNA 4YMUA 2ZR9A 1WRBA 5JFGA 1CRQA 1KI1A 1OSNA 3LW8A 4HSEA 1MH1A 1ZUIA 2ZVQX 4QHTA 4WIAA 5K8UA 3O8RA 2XTMA 1Q1QA 2XX3A 4MGKR 4M9SA 3NKVA 4G5OA 4ERNA 1KDRA 4AG5A 3AVTA 1IY2A 3AH8A 1U94A 2O52A 5JJLA 3HYTA 2ZRJA 2QZ4A 3QEJA 4M1SA 3EPHA 1GRQA 4D0NA 4LHXA 4J0QA 1EFTA 4A0FA 3CONA 4DB4A 3DKVA 3UWOA 1T3LA 2ZREA 1OXSC 4GRAA 4MITA 5D3QA 3RDPA 4R9UC 4KLZA 1ETUA 2J59A 2EU8A 4KV9A 3EZ9A 4DVGA 1T6NA 2RGBA 1NN3A 2ZRCA 3W9YA 1EWQA 1ZYUA 1GNRA 4M8NE 4PZLA 5KPDA 3BS4A 2VP4A 2BBSA 4NYJQ 1KDTA 1FMJA 1UF9A 4LBZA 5B57C 1R5OA 5JI3E 2W2TA 2KBFA 1N6RA 4CDGA 2IEYA 5FPYA 1CJTC 4TSFD 3BH0A 3DMNA 2Z0MA 2GK6A 4KJZA 4M2LA 4AC9A 3MWJA 4P4TA 2OZEA 5L3SB 3TVDA 4ASUD 1UBCA 3SJAA 2X77A 2QGZA 2CNWD 1G4AE 3QKSA 4GNKA 4C2UA 4DC9A 1U98A 3NIBA 5FBVB 2ZU0C 2QM8A 4MRSA 4XSGA 2A5GA 1Q1ZA 4LJAA 4PO9A 2WWIA 2C96A 3C8UA 1OT3A 1A4RA 3ND8A 2IYTA 4IDNA 3K0FB 2HYDA 3MD0A 1AN0A 4XWAA 4BLOA 1KZGB 1U0HC 4US0R 2J0SA 2FEMA 4YXWA 4JLAA 5G41A 3W5IA 3GLHA 3X1XA 1OW3B 1FTSA 4RD6A 4O2RA 4DEYA 4LBVA 4ITRC 1GNQA 3UPUA 2WIBA 2V6JA 2O8EB 2VRWA 1ZU5A 1RRGA 1U8AA 3NH6A 5J4HA 2OG2A 4EPRA 3RNLA 4EJSA 4M21A 1SVMA 3SFVA 3LO5A 1A82A 3K1JA 2ZQ5A 4A6XA 1S2MA 4KXFB 1B0UA 1E0SA 3TQCA 3AV0B 2GXSA 1FOEB 1TQ2A 3GQBA 3ZYCA 4B2LA 4CRWB 5BXQC 1E2EA 3X1YA 1A7JA 2IEZA 3QBVA 3VMFA 1E94E 1S9HA 2ZRNA 4BPBA 1MRNA 4JL8A 1CTQA 4M22A 2VSXA 3C4JA 3ECCA 4DZZA 2YYZA 1AZTA 5L3QA 3KQKA 4Q03A 3GLGE 1TU3A 1U90A 3OEHD 5LB2A 3E1SA 2IYVA 1DO2A 4LHVA 2VEDA 3IO5A 2AL7A 4PHHA 5J47A 4V03A 1F3OA 1H8HD 3IIKA 4AYXA 1GUAA 4Q4HA 1ZNZA 1P9NA 2CHQA 4LCBA 2IXEA 3X1ZA 2FFHA 1RRCA 4A15A 3OFNA 4BLSA 2UVQA 2XJ4A 4L8GA 1T5IA 1JAHA 4HAZA 1FL9A 1RZ3A 1D5CA 1JI0A 3PR1A 2OCPA 2FH5B 4IFBA 5DYGA 3DL0A 3I73A 4YC7A 4PQFA 1SHZA 2FWRA 4NYJR 2QAJA 1YE8A 3LY5A 2NO0A 3GEIA 1OXUA 4Q1CA 2PX3A 5HKKA 4XH9B 1D9XA 4JLMA 2Q3MA 2H57A 2ZJYA 2PT7A 4FMCF 3BFXA 3PXGA 1US8B 1KHTA 4TYQA 4Q1FA 3BD9A 2DCUA 1YRAA 4M1TA 3F3YA 3WMFA 4N1AA 2H8KA 3V9PA 1OFIA 3AKEA 3U6BA 2BM0A 2D62A 1PZNA 1VCIA 4CF7A 4TQUS 4TLEA 2WWXA 1E9RA 3ASYA 4DLWA 1Z6YA 2LKCA 3MWYW 4LJ9A 2AN9A 5CK4A 5L3SA 2WPDA 1G8GA 1OJLA 1NNEA 4MYCA 2Z4SA 3OEHA 5AJZA 1Z83A 1E2IA 3RSOA 1TU4A 3K70B 2J1LA 3T1TA 4JVNA 2A7QA 1ZM9A 2HJGA 3KDSE 4XWOA 3KFXA 3WY9A 3OHMA 2PZGA 1TMKA 2GJAA 2RGEA 3K0FA 4MUAA 1OF1A 3LH5A 4FCVA 1YZKA 1NN1A 1O3YA 4PANA 2VF7A 2OAP1 3AUYA 4QXAA 4MRRA 1IXRC 2ASEA 3A1SA 5BYKA 5L3VA 1Z6GA 2AWNA 2EWWA 3DKPA 4XVRA 1FMLA 1UADA 1W2HA 2WOOA 2OFXA 2O8EA 4IOMA 3K0CA 5EP1A 2CCJA 4L15A 1XTSA 2OO7A 4OHWA 4N3NA 2Q9CA 3HPQA 4TLDA 2WJGA 1RC8A 3NDBB 5FTJA 3CH5A 3QKUA 4QRHA 2OXRA 5TB5A 4ARZB 1WXQA 2IYXA 4TLCA 5AK0A 1R4AA 3BJIC 2Y8EA 2JLXA 1NSTA 2IA5A 1LV7A 2G0TA 5CYOA 4BLQA 4TL9A 3GP8A 1BS1A 2QORA 1N5KA 1TUEA 5GJVC 1IN7A 3VR1A 4QOSA 5HR5A 4A1FA 1RRFA 5SZHB 3M1IA 1DAMA 3UMFA 4OI2A 2C8VA 2CLSA 1W46A 3B13B 4XSHA 4PPGA 3ZZUA 4EFLA 1WP9A 3PITA 5AJVB 1AKEA 4KBGA 4DCTA 2WWWA 1J99A 1XTJA 2BHRA 2FSHA 4QJ5A 5CDFA 2BV3A 5CIQA 2ZROA 1R10A 1OIXA 5E4FA 2IYUA 1IN8A 2GNOA 2OHFA 1F2UB 1AQUA 2B7BA 1IN5A 1OFTA 2HYIC 3BRWD 1XJQA 1JR3D 5DIFA 2QG6A 1E1QA 3AF4A 2IS2A 1BMFA 4MKFA 4GMDA 4Q9KA 1O87A 4S35A 3SQWA 1IONA 4F4JA 1ZM3A 5FBRB 3MRSA 3FE2A 4DDVA 1A1VA 3CX8A 3Q3JB 1J90A 1AS2A 1GWNA 2Q21A 4BRWA 3QNUA 3UG7A 1ZM4A 3DPUA 1WB9A 2H92A 2YNMA 2W00A 4PHGA 3GFTA 3VQTA 2JJ8A 4HB4A 4KFSA 2HF8A 3TE6A 2Z5FA 1NVVQ 5HCNA 1E4YA 5IDVA 5KOYA 4DWJA 3AUXA 2CK3D 2JEOA 3ZVMA 5FL3A 4IXNA 4NCJA 1W48A 2ZI9A 1OYWA 2JIZD 2J46A 4NKRA 4Q7MB 1M8PA 2J9RA 2A5YB 2BKEA 1E2KA 2J87A 2V7QA 4IVQA 1FPMA 3HP1A 3P4XA 4OQFA 3GJ3A 5JCPA 3JZMA 3LV8A 1NLZA 2ZRIA 2ZAMA 4V0MA 3K0AB 1YR9A 1CF4A 3T06B 1LFDB 1L7VC 5AUNB 2J7PD 2ZYTX 2Z6VA 3QPUA 3DOFA 3ZVNA 4QGGA 5K8TA 2EVWX 1XMVA 2DWPA 3EWSA 4NHOA 1U99A 2ODBA 2ZYVX 4KO8A 1KY3A 3PCRB 2ZRPA 4JVLA 1UDWA 1P75A 1E9AA 2RH5A 3SR0A 5TV2A 2IWRA 4WW0A 2MSDB 1TUIA 1UKEA 2HCJB 1NLYA 1XB2A 3DVLA 4Q4JB 1E0JA 4MRNA 2RHDA 3DDCA 4DT1B 1CKEA 1EWRA 1GL7A 1W49A 2YHSA 5DNYB 2Q3HA 2RGGA 1G3UA 4M9QA 2C2HA 2DY1A 3BWDD 3RS0A 3KB1A 1IY0A 5DI3B 1ZM2A 1ZM7A 2CBZA 2CJWA 4MRVA 2O0KA 2YC2C 4X8OA 5KYKA 2JLZA 4DXAA 3FMOB 2ZEJA 4ZCMA 4OQNA 2SHKA 4DLRA 1ONBA 1GG2A 2G88A 1WF3A 3F8TA 3LX8A 4ZIRB 4AKHA 3WMEA 1G21E 2CK3A 2NTYC 2UKDA 3B9QA 4V02A 4YDSA 1I2MA 1S8FA 2VP0A 3W34A 3K09A 1OV4A 2GEDA 3K9GA 4E03A 4PC1A 1GL9B 1JAIA 4K46A 3U3KA 2FG5A 3QOFA 4C30A 3WBJA 1IY1A 1T8UA 3KFVA 1IQPA 1LTQA 3K9LA 3AVYA 3DEFA 1XEWX 621PA 4NMMA 5ELXA 4QNMA 3CPEA 5EE1A 1F2UA 5SZKB 3NWJA 5JCZA 1XCPA 3IDQA 3PEWA 2BEJA 4TZ0A 2ZSDA 1OKKA 4A2QA 2C78A 2GBLA 2RGXA 4FMCB 1R0WA 4R2IA 4OHZA 2YKGA 5FTLA 2W6ID 2CCKA 4YONB 1TEVA 2IUTA 2J7KA 3Q7QA 1II9A 1KI6A 4Y0AA 2J3EA 1PJRA 2ZE6A 3MJHA 1NN0A 1NVVR 4MYTA 3GJ7A 4LPKA 3VX3A 1BKDR 2G6BA 2ZVPX 3BB4A 4BLTA 1MT0A 4DBLC 1CJUC 2IYLD 2J5XA 3LX5A 2FOLA 4LX0A 2P5SA 1UEIA 5CDFE 4TN1A 5E7JA 3EG5A 2R44A 3SU8A 2O8FB 4FW9A 1ZMXA 1YR7A 2QMUA 2Z43A 3UXMA 2C98A 4I1OA 1U81A 4A9AA 2PMDA 1XD2A 1PV4A 2QPTA 1WE2A 1T9HA 3CX6A 1TQ6A 4KYUA 4NCKA 4BZPA 1E3MA 2QNRA 4TT3D 4B47A 5DLQC 4BECA 1N6IA 2GHIA 1MO4A 1CJKC 3K0AA 2O5VA 1UDXA 5B30A 2J0VA 3H4MA 4LZZA 3B85A 4DSOA 1TADA 4I1SA 3TGPA 1RIFA 1FZQA 3W90A 4BFVA 3ADKA 3PG5A 2D7CA 4IOLA 4PAOA 1X6VA 1R7RA 3HU1A 3KKPA 1XXHA 2JLQA 4LYAA 4Q00A 1LF5A 5EXTA 3VR3A 1N6PA 1P2UA 2QMEA 4QKQA 2IBMA 2W6JA 1KJYA 3RAPR 1JQJC 2C77A 3T35A 1CR4A 1GFIA 1Q12A 2HF9A 3B9PA 3IO3A 2AKAB 1L2TA 3NBFA 2JDIA 1ODFA 1MR3F 3B8HA 2DFNA 1DS6A 1W2GA 3P32A 1QRAA 1U9IC 1J2JA 1XX6A 3NVAA 4US1R 4W5WA 4CT5A 4TYWA 3I5YA 2JJ2D 4JS0A 4OJKA 4DT1A 4V0ME 2F1IA 4ZKEA 4F7WA 1M7HA 4GOJA 1Z0AA 2NO9A 2V54A 1F2TB 1MOZA 2HLDD 3R7WB 5DI3A 2XEXA 1H8ED 2F1RA 2FV8A 3EX7C 5GVSA 4NYMQ 4URXR 3BB1A 1Z5ZA 3K0EA 4Z1MA 5HZKA 2F7SA 4DHEA 5J4LA 5AJWA 1RFLA 2EFDB 1K5DA 2RAPA 2YOHA 3T5DA 3SQXA 1RPZA 3LVRE 2VHUA 1Q22A 1ZIPA 2OT3B 4A8JA 1XEWY 2CVHA 3T1VA 2I4IA 2GCOB 2ZJZA 5JWRA 3GLIB 5KDDA 5CYPA 1Z8FA 1VMAA 3AKCA 2HCBA 3X2SA 3U7HB 1XZQA 3QQ5A 3V00A 3IKJA 2FX3A 1C1YA 4FMDF 4EPYA 3HU3A 4R98A 2PX0A 1HYQA 4MRPA 4OL0A 5ANRB 1DE0A 4Q7JB 1E2MA 3LBIA 3RS3A 1AA9A 3HDTA 3GEEA 4ZPXA 5C4MA 2QRNA 3OE7D 1VYTA 4BFWA 3ZD7A 4OJQA 3AVXA 2REOA 2VL7A 4Z8YA 1XMIA 4KLNA 1DARA 1CBUA 2W58A 3AVPA 3C7KA 3CWZA 4ACBA 1KDOA 4B3BA 4HAXA 2ZRMA 3EAQA 3U3JA 4BEBA 2OBMA 5EP3A 4M1MA 1HQCA 1OH7A 2AFHE 3EA5A 1U2RA 1R0XA 1GZSA 4GBMA 1GOTA 1XMSA 3IIJA 3IQWA 4BZQA 2D7DA 4JLOA 3MWKA 3RS4A 1H8EA 2RGDA 2WVJA 2GVDC 4WBSA 1KMHA 4W5JA 2WOJA 1G8FA 1TQDA 2JJ1D 3EXAA 4KBFA 5JWHA 1ESMA 2O8FA 1DAIA 3R8FA 3A37A 3PUZA 4FWIB 1G5PA 1I4TD 3UWKA 3QKSB 2CL7X 5DO9A 2FEOA 1GITA 3ETLA 1QHSA 4Z51A 4DCSA 1KI3A 2YVUA 3HU2A 4EIWA 3A6PC 4P32A 1J8YF 5FOVA 1CR1A 4LWZA 5AWFC 3TW4A 1NG9A 1I2DA 2H7VA 4H1VA 5DHAA 1RYHA 4DIEA 5H1YA 4IDQA 2VA8A 2EYUA 4V0KA 1M1YE 5F9HA 4WVFA 3I3SR 1NBME 2GK7A 2ZS9A 2ZRFA 2N42A 2UZIR 3CUEF 5EQTA 2AD5A 3GJ8A 4JJKA 2ZR0A 3AKYA 5EXXA 3IHWA 1E9CA 1IN6A 5KSPA 4TZ6A 4NYMR 3NBYC 1NY5A 1CXZA 1EFCA 2XSZD 4PHFA 3CZQA 2K5UA 1FNMA 1E4VA 2QY9A 1OHHD 1Z6TA 4ZDIA 3NBZC 2YWFA 3BH7A 3BFVA 3UKDA 1GKIA 1F2TA 3U44B 3U61B 3WXMA 1G4UR 1R8SA 2GRJA 5HE9A 3WYGA 4MGYR 1FNNA 2W2VA 2QE7A 4LJ5A 1G17A 4DRZA 3HJNA 4B6FA 1W1WA 1W0JA 1Z6AA 3A36A 3EIQA 3QY0A 2Q9BA 4HUTA 5D3MB 3LAWA 4I1UA 3N2EA 4JBWA 2OM2A 2NO7A 4N0DA 3I8XA 3GLIA 5H8WA 4WXPA 2Q3FA 4KFTA 1H65A 2NQ2C 3PUVA 2FMXA 2J41A 4AWXA 1R0YA 2PMKA 2GBLC 3EZFA 4LDJA 2JAQA 1VIYA 2ZRGA 4YMVA 4BWYA 1VG1A 3TH5A 3ZQJA 3MUFA 3GPLA 1FFHA 3AF3A 3SC3A 1YZUA 2VYFA 4BZXA 4OI1A 1HY3A 1NVUQ 4WOPA 1GP2A 3LW7A 1P73A 8OHMA 3WMGA 4JBXA 2D4HA 2QTHA 5C18A 4LV8B 2ZI4A 4LYFA 4L16A 4G3XA 1GKYA 5FI0B 2A5FA 2P5TB 2WJYA 2YZ2A 4CEIA 3GJ0A 1XJCA 2D2EA 3ZGXA 2QN6A 5CM8B 521PA 2Q9AA 1KOFA 1PUJA 2ZJBA 5FOUA 5C46F 4LV5B 2B8TA 2WAYA 2G3YA 2AD1A 4URYR 4IFEA 3HYRA 4A0GA 1OHHA 1ZVQA 1XF9A 2D74A 3DHWC 1XTQA 4PHTA 3PEVA 3KJGA 5FPTA 2GETA 2NPFA 1W7AA 5KO2A 4JJZA 3W8NA 1VPLA 2IUUA 4D81A 1KSFX 4U5XA 1QHYA 3W6NA 1DELA 4UNRA 1KJWA 2FGJA 4RD3A 3SE0A 3GCGA 1KO4A 4W7SA 5FTMA 2OAQ1 5H70A 1NL3A 4P0TA 3VKWA 5DN6A 2DWQA 2ZRDA 3FOZA 1KO7A 1P4SA 1E2GA 4WZBE 4IEIA 5GJWC 4TYNA 2G83A 4M4SA 1KDPA 1SXJE 2YOFA 4K8OA 4C4PA 1TF5A 2E87A 4EPVA 1BIFA 1WCV1 1R2QA 1ZAKA 3JVUA 3SJZA 3TK1A 4I81A 2H16A 4CGZA 4WXRA 3U6KA 2OCYC 1Z63A 3VNVA 2GEVA 4URUR 3CZPA 2EFGA 5FR2A 2IWHA 2E1RA 4H9GA 4HDCA 1M7BA 4DSTA 4QG7A 4LBYA 2C95A 1FX0B 2CL0X 2P6NA 3BGWA 3PQCA 2D06A 2GF9A 1II8A 3I72A 4FCTA 4II7A 5KDLA 1NMZA 2AXPA 4PQYA 4F38A 4URVR 4MKIA 2QT1A 3NEJA 4MYHA 3H86A 2RCNA 4A8JC 1NIJA 2QT0A 1P7CA 2HDNB 4C0KA 3Q72A 2VO1A 3B1WA 5M04A 3U44A 1QHGA 2TMKA 2GESA 4FMDB 1UKVY 1SHKA 2O8DA 4G01B 1M2OB 1W47A 1FQKA 2H1LA 2GCPA 1G3MA 1G1MA 2N46A 2V8OA 4FN5A 4JKYA 3WYAA 2CL6X 1AQYA 2REXB 2ANBA 2B21A 2WWHA 3GLFB 1AGRA 4TSFA 1NP6A 2B7CA 1R5BA 2AX4A 2EWVA 4LJYA 5D3MA 2IT1A 4TLBA 1OB5A 2JLVA 1XMJA 4ASUA 2IXFA 5JI2E 1BO6A 1IJFA 5L3RA 2BCJQ 2CNWA 2ZS7A 5JS7A 3O47A 3Q7PA 2B8WA 4TMVA 1G41A 1R8QA 1MV5A 1G20E 5GJBA 2LWIA 5BQ5A 1VDZA 3EIHA 1PUIA 4A82A 1SGWA 1LS1A 3VHXA 1N6OA 4DLZA 2ZU6A 3SJBA 3RC8A 3V4FA 2QTFA 5FBQB 3MJRA 3PIRA 4HZUB 5CIWA 4A8JB 4Q02A 1P62B 2I1QA 3D6TB 5FOXA 1D2EA 1DG3A 2FU5C 4C0BA 3LRPA 2E9SA 3L82B 1W5TA 3LBNA 3DM9B 4IOJA 4RD1A 5FBLB 2NZJA 4JZKA 4C3ZA 1RKBA 3BBPA 4XD7D 2R9VA 5FOWA 2AHOA 5L8VA 1Z07A 2FPLA 4TTQA 1NJGA 1ZU4A 4Q21A 4L4UA 4QM6A 1KI4A 4D2IA 1C4OA 4ZCIA 1XD9A 4FMBB 1AGPA 4XTRA 5EXSA 2XOKD 1PLJA 2QTVB 3LDAA 1AM4D 2WKRA 5JJIA 4L9WA 4BASA 1CULC 3NDPA 4B76A 2BEKA 1NRJB 1Z0DA 3AGQA 4JLDA 3ADBA 1D2NA 2N1BA 3PENA 5KSOA 1T5LA 4BFTA 1G18A 3DZ8A 3W3AA 1HH4A 4B34A 1Z0IA 3RRMA 1CS4C 4Q47A 3VR4A 2X19A 2HEIA 4TL8A 3KB2A 2KBEA 1ZJ6A 3N5CA 4RVCA 1R6BX 3GD7A 4P33A 1H8HA 1UKYA 3TKLA 1L4UA 4JYCA 4OK5A 2XZLA 1VHTA 4HLCA 4IKEA 4URZR 4R71A 3Q85A 5A0FA 3RWOA 4A0HA 3CR7A 2XNDD 2XJ9A 2YINC 4A0RA 1OIWA 3TR5A 1ZUNB 4UXJA 4IDHA 4Q1AA 2NMVA 2KJQA 3TAUA 3RSLA 3OESA 3T15A 3A58B 1S4QA 2GAOA 2PLFA 1E2QA 1DOAA 3CIOA 3SYNA 2B6HA 2ZSBA 4F4IA 4DJTA 4RZ2A 4TTPA 1PLKA 4F93B 1TF2A 2FSGA 3C14C 3K53A 1W4RA 5FR1A 5C1BA 4JLNA 1ELOA 2RGNC 2VBCA 3VX4A 2CJWB 5FUYA 1OXVA 2P0EA 1FX0A 3RRYA 2YC4C 2J0UB 1CR2A 1YQTA 2C5LA 2RGCA 3SYKA 1NMYA 5F2EA 3EC2A 2G1KA 4Q1DA 1N0VC 2BBOA 1U9IA 2QEQA 3AQ4A 5BW8A 3W6PA 5BN3A 4OHYA 1RJ9A 4LC0A 3BAFA 4LPSA 1EGAA 2VSFA 2VP2A 5F98A 1DEKA 5JSZB 2OFOA 2PCLA 5CLQA 5IRCD 3GLHE 4TMXA 5LB4A 4D80A 3JZAA 3BE4A 3BH6A 4LOAA 3GLFA 3L0SA 1S0UA 3BB3A 2ODWA 2FZ4A 1CEEA 5CJPA 1OYYA 2QAGC 1GTVA 3GJ4A 1CP2A 2P67A 4BEJA 4TL7A 1NKTA 4UJ3A 1D6JA 3AVQA 2XZOA 1E2JA 1NVWQ 1WDTA 2LKDA 2PZEA 2ZIAA 2C99A 1COWD 5FUWA 1ZRHA 3ADCA 1HUQA 3NHBA 4YMWA 1JB1A 1E2LA 1J7KA 1TF7A 2GJ8A 3TNFA 4QC2A 3EA0A 3FHOA 3CRVA 1E0AA 1KI6B 1YVDA 4LJ6A 1NF3A 1ZINA 3CRW1 1CJVC 3PUWA 4HEJA 2QUZA 2DFTA 4HZUA 1SKYB 2PCJA 5AJYA 4NZYA 1Q20A 3A4NA 1NN5A 1EFRD 1R5NA 3GEHA 1SVOA 1DAFA 3ONWA 4RKFA 1E9SA 3EPJA 1AIPA 4G5RA 1N25A 2ZUBA 3TLXA 2V6IA 4GOXA 2BJVA 5E7IA 4YLGA 4BFYA 2QQ0A 3TVTA 2ORVA 1OXTA 4CYMA 2C9CA 2X2FA 1W44A 1E99A 2MSCB 1UBGA 1XD2B 4IOKA 4EPTA 121PA 2L0XA 2RHMA 1JR6A 3HR7A 2AFIE 3B78A 2GXQA 2IF0A 5CK5A 1Y63A 4JLVA 4M1YA 1HE1C 3SNHA 4RSGA 1XPOA 1VHLA 4C0LA 4ESHA 3CPJB 4KSCA 5IT5A 1M7GA 1G3RA 3FTQA 4GZMA 2A5DA 4CT4B 4N0EA 421PA 1QVRA 2QP4A 3KKMA 3AKDA 3JVVA 3EPKA 2ONKA 3QXXA 3ICQB 4D6PA 1XXHB 5LD2B 4B43A 5UKDA 2JLYA 2BMEA 2H17A 4D25A 1IN4A 4B2IA 4PZZA 2P2LA 2CHVA 2ODNA 3L0PA 4DUGD 3OEED 4LY6A 1COWA 4LV6A 4D0LB 2ATXA 3CLVA 3KUDA 1JR3A 221PA 4HI0E 4C0QC 4DKXA 4ZKDA 1E0KA 4JLBA 2FE4A 3VHLB 4PTLA 3PEYA 3AM1A 4U7DA 1S96A 5BWMA 3VU9B 3HR8A 4I1VA 4A92A 2F3RA 2CLDX 1KI7A 5FOSA 4Q18A 4O3MA 4B3DA 4QBFA 4UNPA 2ZE5A 2BDTA 5P21A 4GDFA 3AF2A 3AF0A 1EX6A 3T12A 3EIEA 1KI9A 3W3ZB 2FFAA 2J0UA 4E5UA 1EFHA 1KSJA 4RZXA 3MCAA 4GFDA 3TBKA 4I4LA 2ORWA 4UQOA 1TX4B 1JXOA 3KQLA 1OH8A 4HYYA 5JSZA 1TTTA 2JIZA 2BOVA 3DMDA 4RD2A 1KJZA 2VSOA 3U7FB 1NLFA 5DH9A 4NP6A 1C9KA 1GDDA 4HAWA 1N6LA 3BFKA 5IK2D 3KUCA 4KYIB 1KAOA 3I8SA 2A2ZA 1ZCBA 1NBMD 4HDQB 2ZSFA 1GNPA 3E70C 5HPYB 3MAAC 2J7PA 3NEYA 4XIGS 3IHLA 1N0UA 4KI0A 1II0A 3RS5A 2PH1A 3MFYA 3TRFA 3D31A 4ZCLA 4RFSB 2P6RA 2ZR7A 5LBIA 1GIAA 3B5JA 3Q5DA 5F3WB 1KI8A 3QF7A 1YHNA 1E2NA 1X8JA 3H84A 2WAXA 1W36D 1Q44A 3OIVA 2IC5A 2KE5A 2BM1A 4NYIQ 3I4LA 1KK1A 1P2TA 2MSEB 2I1VB 1UKZA 4B3XA 1HTWA 2ZE7A 1QDEA 3V4RA 4MQBA 4GL2A 3GLFE 5EE5B 5CB8A 4B73A 5FUXA 2IS1A 3VFDA 3A8TA 2XB4A 1Z0FA 4XOIA 1JQLB 1KMHB 1SQ5A 3WP1B 3ZH9B 4C0JA 1ZCAA 5JHGB 2HT1A 1YZTA 1NVXQ 2ZE8A 1P60A 2AK2A 4DLVA 4ZI2A 3CM0A 4U02A 2ZANA 1NIPA 1ZP6A 1XCGB 2QRZA 3CX7A 1E32A 2A9KA 5K8LA 2WWYA 4RKEA 1QF9A 3IPYA 1P72A 4UXHA 2CLCX 5CM9C 1EX7A 2A5JA 2GDJA 2BJWA 2EFCB 4Q01A 4JT2A 1FW6A 4TMTA 3B7GA 2ANCA 4QBHA 4IXMA 1JBKA 3FKQA 4JVSB 4RCZA 2C9OA 4EFNA 5GJCA 3UMSA 5AUQA 3MSXA 4MGIR 4AG6A 4MDEA 1Q0UA 2ZYWX 5A4JA 3WNCA 1Z47A 2Q0HA 1T4GA 4PO8A 1Q57A 3RABA 5IF9A 5KNBA 1JEDA 2QBYB 3QEOA 2J0QA 2WMOB 3FKSD 3TJZA 2UZ3A 3MGCA 3QG1A 4AYTA 1SKQA 4JBYA 2YWGA 2W6IA 3C5HA 3OF5A 2GEUA 1DAEA 2ZRKA 5GVRA 3KQHA 1JEEA 2DFLA 4G5GA 4WA7A 5EE0A 5BN5A 3BK7A 1VYUA 5CB6A 1XPRA 3VU9A 1UM8A 2VHJA 4Q7LA 3G82C 1DADA 4LBWA 1W0KD 2ODEA 2XXAB 4HATA 4V0NA 2FSFA 1DG1G 1ZC3A 1OH5A 3B1VA 5EP2A 4PC2A 4O0MA 4LI0A 3R20A 4B3FX 2QENA 4NH0A 4EDHA 4DLSA 3WHLA 5EP4A 3U4QB 2IHBA 1U8ZA 3X1WA 1Q21A 1DVRA 2DB3A 1HEIA 2AKYA 2GAAA 4HAVA 2JCSA 1SXJD 1JR3E 1S3GA 2PL3A 3G0HA 2R6AA 3C16C 4TT3A 1UBFA 1Y3AA 2BMFA 4JIMA 5EE3A 3ZD6A 3QIAA 4JKIA 3VNUA 3IBGA 2AWOA 1MKYA 3I5XA 3IPXA 3KQUA 3SHFA 4Q5IA 3K9HA 2QAGB 4NYIR 3REGA 2IS4A 1P6XA 4WAUA 3TR0A 2BMJA 4PSVA 1N3BA 3I32A 3QXSA 4Q4LA 1DAHA 4QHSA 1F48A 3ICEA 2PJZA 4O2LA 4RFSA 1OH6A 2QU8A 4EUNA 3THXB 2F43B 2F1JA 1FTNA 3NC1C 4K81B 4LHYA 3T1QA 4QGFA 4BUJA 4TQ9A 5TVKA 3BIFA 4CEIB 3GJ6A 3FKSA 1Q1BA 4MKHA 3L43A 1IJEA 2WZQA 3VKHA 1QHIA 2WV9A 4XVQA 3T5GA 5FOTA 2YJTD 1QG2A 2NG1A 3QENA 1HT1E 5G3YA 2JJ2A 3MLEA 4Q4AB 1XU4A 1G7RA 3QF4A 4DSUA 1AS3A 1G19A 2ZJOA 4MDFA 4JYBA 3ZZTA 3R8CA 4LRWA 2HLDA 1S9DA 4B71A 4DDTA 4XVUA 3LQQA 4MKGA 1RYFA 6Q21A 3M0EA 2BC9A 4B75A 3SEAA 2F3TA 1GM5A 4TMWA 1VCNA 3QSYA 2NIPA 5KSZA 3QKRB 3P26A 1EESA 5J4VA 1JJVA 2I3BA 1IAQA 3PJRA 4A6PA 2FFBA 1KI2A 1NKSA 5G53C 3CNOA 4QHYA 4JL5A 3RWMB 1RRPA 3FFAA 5JBQA 5AUPB 3ZQ6A 3RRNA 3G5UA 2HV8A 3SYLA 3AF1A 5JRZA 5JS8A 1V5WA 1YU9A 3BOSA 1ZBDA 4IJMA 1B23P 1U8YA 2XITA 2GILA 2Z4RA 2ZRHA 1U0JA 1TAGA 3FDIA 5TMPA 1I4LD 2QBYA 2OUKA 3OE7A 3SDZA 5EUMA 1VCMA 3UMRA 3CRQA 3Q8XB 3FMFA 1BYUA 4Z8XA 2OV2A 1KY2A 1T3HA 4LGMA 1II8B 5C4GB 1D2MA 3TSOA 1KIMA 2DPXA 2QP9X 3D3QA 1KSGA 3RS7A 1MABB 1ZIOA 3CPHA 2R6FA 2RGAA 1XRJA 4Q66C 5DHFA 2FFQA 3WHKA 1KTVA 4BE7B 1X1RA 2XXAA 4RY2A 2O8DB 3GLGA 2FGKA 2RGNA 4CW7A 1G5TA 1N2CE 1TEXA 4AKEA 821PA 3IIMA 4LJ8A 4C7OA 1ZUHA 4IDPA 2CMKA 4NTZA 2BMDA 1XXHE 2IX3A 3IILA 2D3WA 4QNRA 4KVGA 2DFKB 2IYRA 3U4QA 1ZNWA 2JJ1A 3K9NA 4EFMA 2BVNA 2KB0A 3AP3A 5KPJA 3TUIC 2A30A 4NCNA 2GWHA 2IYZA 4CVNA 3SBEA 3WNBA 4OYHA 2F6RA 1VTKA 2CDNA 2CE7A 3WNDA 3VTKA 3DZDA 4ACAA 1PVOA 2GJ9A 2QAGA 3P1JA 1P2VA 1YR6A 2EW1A 4OBEA 3SOPA 2DWOA 4D82A 1E2FA 4E09A 2WJIA 3GJXC 3QJYA 4M0LA 2QA5A 4D4KA 3J81k 1TNDA 3VR6A 2OLJA 2VH5R 2WTUA 3THXA 2F43A 4JL6A 2A3RA 2FF7A 3H1TA 3LXXA 2IK8A 1G8YA 2ZETA 2OXCA 3FPAA 2C9YA 3QI2A 4YXWD 1VG8A 4X8LA 2H18A 3RANA 2XSZA 1OIVA 3LLUA 3MG9A 4Q1EA 2MMGA 3SN6A 3ASZA 4Q19A 4Q4AA 3THWB 1E6CA 2BKUA 1QBKC 2ZSAA 1JECA 1X3SA 1ZD8A 1YZGA 1DPFA 3E5HA 3KTAB 3AGPA 1KGDA 3VAAA 1QHHB 1WA5A 3T61A 2B92A 1L8QA 2NZ8A 4BFXA 2VHCA 2WJHA 4DLTA
chains in the Genus database with same CATH superfamily
5ALGA 3ASUA 1JAYA 1INLA 1RADA 2WIFA 2C1ZA 2FN4A 1EVYA 1ZY2A 2HJVA 3QKRA 4OLJA 4BMPB 4Z54A 5AJXA 1KY5A 4U6NA 3ADDA 5KYYA 2CDCA 2PGLA 4FOOA 5FPHA 4BE4A 1DIGA 3VOTA 1RT9A 1H4VB 3OZXA 5CFQA 4F2GA 1H3NA 4RVGA 2IE8A 1FTGA 1L4MA 2FPMA 2PRZA 1CUEA 5DP1A 3HJGA 3N28A 4F8EA 3PI7A 2ZS8A 1MORA 2QSYA 4YP1A 1VG0B 4GNRA 4MRMB 3LS2A 3QK7A 4R9NA 1EXWA 3PNQA 2M32A 3GY0A 4LNHA 3KU1A 3W0LB 4QM7A 1N6NA 3WGLA 3ZIAD 1TYAE 1TRKA 1KFBB 1BYIA 1W6RA 2R6CA 3R9XB 3GJQA 2VPPA 5MF6A 2YXBA 3GVHA 2WKQA 3FGNA 3MJDA 3C3PA 1U0RA 3D1LA 3KE8A 3PXXA 4GMXA 4IHQA 2XNJA 2H63A 2XF8A 1Y98A 4IZIA 1H2EA 1RJWA 2VJLA 5LJLA 2EEPA 4PZ0A 4TWIA 2JGFA 1PL0A 1LK0A 2I67A 1U0BB 4PIPA 3SCZA 3MXTA 3MMPA 3MQ2A 3PC4A 1Y9DA 2ZI5A 1H2ZA 1M8FA 1H23A 2ATVA 4RD0A 4MEAA 1DJPA 3QEKA 4OIFA 2XVYA 4OI4A 1PJBA 4U63A 3CLSD 5L53A 2J67A 3OVMA 4OLAA 4DIDA 4Y9SA 2IYSA 5BR4A 1VIDA 4NK5A 4JV5B 1ZSNA 3FFBA 3KYCA 4GXRA 3U81A 2FA9A 2DQYA 5L4LA 1G1AA 1ST3A 1SULA 5HKKD 2JASA 4V2UA 2PJRA 2PU5A 2AJBA 2YYAA 3CGGA 3Q5EA 4TTTS 3A6FA 1EVIA 4GSYA 4MW9A 4D6YA 3U39A 4Z3KA 2HRDA 3ELWA 5AR1A 3RF6A 2FCRA 2GK3A 1WUYA 4RV5A 1EK5A 2BBTA 4K6GA 4BMDA 3R3UA 4GD3Q 1GSIA 1C0EA 3GFPA 3PYMA 1C4XA 3RVMA 5HZHA 4DB2A 1Q74A 2OHOA 2X0KA 2E4AA 3PLRA 4WV3A 1OZHA 5LDHA 4RPHA 2FPOA 2YQZA 4TWZA 3UCEA 3UJ8A 1L4YA 5EERA 3F71A 5BQOA 3IEVA 2V9PA 1H1TA 2IXDA 3IBYA 1RPAA 2W42A 2ZVJA 1CLUA 4F06A 3EWAA 1L5YA 2WABA 2ZWMA 2Q5QA 2BR4A 2ZYHA 4QTUB 3VNBA 4R0NA 2FDXA 5CFRA 3CLTD 1LJLA 4Q9IA 1JU3A 1UINA 2K7FA 3VYVA 2RH4A 5JJKA 5KNDA 2WM9B 2H4JA 4GOKA 3UGJA 1XU9A 3DDWA 4MVJP 3ZJUA 2R96A 1QRUA 1YRYE 5DGXA 1NM5A 3ZWMA 3U7GA 1T0JB 2REBA 2PRJA 4AZVA 1BXRB 2C8JA 5B1IA 5LQJA 1PZMA 3CY6A 1OWMA 1WKCA 4BMZA 3IKTA 4O02B 3O1IC 1HMYA 4KV7A 5G3ZA 3R0XA 1U6JA 4BTLA 5BNZA 4C0HA 1BJTA 1RZRD 4IIHA 5LQRA 3CVYA 4LTMA 3OQBA 3O6VA 5JANA 4PZUA 1L1FA 4RETA 3UV6A 4GLLA 1DC8A 2R8XA 1WHTA 1SXJC 3HTXA 4NBSA 4HV4A 4S04A 1J70A 3KLOA 4JJ6A 2KM1A 2WJPA 3E9MA 3GRYA 2ZDGA 4L8WB 1HMPA 1MOSA 4KVFA 1OPXA 4B80A 2ASVA 3KX2A 4QM6A 3REQA 1QHHA 3DKIA 3W2IA 4NJEA 4HQKA 2F55A 5JTUA 5AI0A 3A4MA 3RTBA 1SD2A 4H1TA 3EEOA 1AKRA 1IWBB 1QKIA 4AUMA 1SRQA 3DDUA 4B46A 4B4OA 1YIAA 4QX6A 3FWYA 4CKEB 4A36A 1WUIS 4JY7A 3VSBA 2GZHA 1MTZA 5F7OA 3VDMA 3BC1A 4QJ3A 5FBWB 3NTVA 3OIUA 5JBIA 1PNQA 5D8DA 3PPXA 1FJHA 2CXRA 4LVOA 3DCNA 1YF3A 3N2GA 4M0PA 1EGMB 3QVVA 1KRWA 3T1OA 4YT4A 5K0GA 1Z74A 2YN2A 4NE7A 2IU6A 2UU9B 2I7DA 2E89A 3GRFA 2X6QA 3P9SA 2NXEA 3S5JA 1KSHA 4MYSA 5B4TA 1OLSA 1RWVA 2VZ9A 3G5AA 1XZKA 4LSGA 4COOA 1UUFA 3SHWA 1N1MA 1P3DA 2ZI6A 4KODA 1N7GA 4GYJA 1B14A 3Q7TA 4U2CA 4HS4A 3DE5X 1KMMA 3ZI7A 2AI2A 1E1QD 5BN4B 3DL4A 1BMFD 1IM2A 2M6SA 1ADBA 4X65B 1L0BA 3CH7A 1I2AA 4AMBA 1WLYA 4IUBS 4NMWA 3MC1A 4RYLA 3AUKA 1U7PA 2LRHA 3RS8A 1KY4A 4BXOB 1AK9A 2C7RA 1M9NA 3PR3A 1BVUA 2PDAA 3IL2A 5A4AA 1H5QA 1H2HA 2XOKA 3NTRA 1RM5A 5LWHA 4UEOA 2SBTA 2O7VA 1F5NA 1T1SA 1U1DA 1X7WA 2WVHA 2J85A 4ZJYA 2O3SA 3QLVC 5CA0A 5ERGB 1F1JA 3JTEA 3AVUA 3RQSA 3FDJA 4Q6BA 1NKVA 4RZUA 4IHJB 3SYTA 4RVHA 6YASA 2CNKA 1ECCA 1HT2E 1A5TA 3C97A 4POAA 4S1NA 4ZJZA 1NJ1A 3QXHA 3B12A 3I23A 4W5HA 1J2UA 1ZD9A 1FJGB 3H2SA 1R3UA 1UAAA 3ZKWA 2P90A 3TQFA 3I92A 1T1IA 3F5FA 3LA8A 1YZQA 5HFJA 4EQ6B 4E32A 4H4CA 2WICA 4C0AC 5B1HA 5FTWA 4MGZR 4R0VA 4AQDA 2OP1A 2XAAA 1VM6A 3EN0A 3OTOB 1U9YA 4DLUA 4MWGA 1CUWA 1DSSG 1E96A 2CJXA 2WWGA 4ADSG 4R1PA 2WF6A 3F3SA 4ZV4A 1BHQ1 3A1WA 3L7IA 1QYIA 3WMWA 4EB0A 3VKGA 1MT3A 2XBLA 1K8XB 2WSSD 1K0FA 3EH2A 1JALA 1E1LA 2TMGA 4JYAB 5FI5A 4DWOA 1VE9A 2W2XA 5AM5A 2ZI7A 3D64A 1ZC4A 2WF7A 5A3QA 1FDVA 2HXSA 5EJ7A 3S81A 3RKSA 2R6DA 4UM8B 4OLHA 2X1MA 2FMHA 3KJIA 2ZBRA 3JR3A 4G1UC 1E7WA 1Z62A 1LW6E 1GXSA 2XAUA 1ZSVA 3LT4A 1CUUA 1O58A 2RARA 3M6FA 4JJGA 1L8AA 4HWTA 4MVXA 1E79D 1A7AA 5AKGA 1I6KA 3VC2A 2VPXA 3TSCA 2P9FA 4ZTUB 3L8CA 5JEEA 3ZE1B 2D2FA 5CDUA 4GLJA 5D5HA 2X9VA 4KGVA 1WJGA 1P0FA 3OCXA 3AIMA 3B7PA 2XGMA 3E61A 3FPLA 3MA0A 4FEAA 2PA0A 3TX2A 2WT4A 4EA9A 3F67A 2VK4A 2ACWA 2WAOA 2KI5A 721PA 5MGBA 2FUNB 2QPAA 3ECAA 4EEXA 2R8RA 3H1BA 4ZDKA 1VMIA 1LW7A 3KPJA 3KV3O 3BMCA 1ZGZA 1RW4A 2VDPB 4X61A 2X5XA 3E8MA 3QE0A 4LMAA 4D0GA 3R6DA 3QJGA 2ZRLA 4QBGB 2ZAGA 3MJTA 3QPAA 1O94C 5KSYA 3N05A 1IXSB 1ZICA 2HRQA 4W8HA 2W70A 2VA9A 4DZRA 5BWOA 4TSRA 4PW0A 4IIJA 4KFRA 2QLNA 1UMBB 1YZYA 3AWIA 3K8YA 3MB8A 4L0DA 1HETA 3WKEA 1RHUA 4AB1A 1Z88A 1EKXA 3FWNA 2DUNA 1XTZA 2O8BB 2BI4A 2HGZA 3CW2A 3AMVA 4WJZA 1MEJA 2PE5A 3V7YA 1UDRA 4RKWA 4XJVA 1ZUWA 4R16A 3JAMA 3UFBA 2B69A 2Z2KA 4JB2A 3BSSA 4G5FA 1Y9EA 5T7BA 1VGVA 3HV0A 4Y9DA 2DBYA 3E3LA 1N5JA 1OLOA 3H7IA 2ALJA 4IWNA 4TKUA 1OFHA 4D4HA 1XVUA 2Z2IA 4EJSC 5EXPA 1HF3A 3HCBA 3ZDQA 4O4IA 4TQAA 2XUQA 3COSA 1NMXA 5AUOB 5GOZA 1RYBA 1DZIA 2YWBA 4FFDA 1H05A 4HJRA 1JIUA 3OX1A 4TVOA 2R65A 3DCIA 4C0SA 3V7FA 2XNSA 3EQZA 1W19A 3KTOA 1FRFS 3QLUC 3LYUA 1F6BA 1I32A 1U1IA 1Z82A 3FIJA 1LGYA 4DLXA 4GM1A 1JAZA 1EBFA 1G2PA 3B1XA 4TS3A 1E77A 1JHUA 3ZHZA 3VYTB 1LS6A 2P6PA 3UJ7A 3S99A 3L0ZA 4BHTA 2VJDA 3WRYC 1TAHA 4CCSA 2NOAA 3ETNA 3ZX4A 5CVTA 4X60A 3B2EA 2NGRA 3GZJA 1U11A 4QPPA 5JU6A 4PYMA 3WJ1A 3ZVKA 5BR8B 4ZD6A 5A2QA 2J3KA 1JNYA 1KVRA 1D2GA 4FFVA 3OEEA 1HE8B 2P2ZA 2Z09A 1CS0A 3SE7A 4HTAA 5AFSA 1JJAA 1JFFB 3UIEA 4HEA1 4I9HA 5CJ2A 3O7WA 2ONCA 4OHKA 1LC3A 1KEZA 1FU7A 2YX1A 2XUJA 2NTVA 2WIAA 3HGTA 4K5QA 2IYQA 1R5JA 3EMBA 3H5RA 2P6UA 2FHPA 4J0DA 4CLEA 3VR3D 4X94A 3IEPA 4FINA 1VQ1A 1OASA 4Y2XA 1R37A 3CLSC 1XZ8A 3K31A 4LSWA 2AZDA 3RQIA 5HKLA 6ADHA 4WCFA 2KLHA 3F6BX 4PINA 3H0KA 3M82A 1NSFA 1R0KA 3PFFA 1QYXA 2IKQA 3MAGA 1KHHA 3QOYA 4QJ4A 5FFMA 3EDQA 1M1ZA 1TPZA 4NR0A 3QG5A 5FPKA 3KL2A 1VZ3A 4KQCA 2EEZA 1Q83A 2DFDA 2JFNA 1VLLA 2YTZA 3IV6A 4MA0A 3TLMA 1W96A 1XBTA 1MB0A 3TTSA 2O23A 3ES9A 4HLNA 4RCYA 4W9MC 1JF8A 1WZIA 4YIHA 4PYRA 1U2DC 3M4YA 4YGXB 2FQYA 4S1TA 3WIEA 4MO9A 1HV8A 2PUAA 3EDMA 3PFHA 4HNSA 5G0WA 5HUJA 1MAVA 3NGMA 2FOXA 3Q88A 4HD8A 4PAQA 4JNCA 4XKJA 1EXMA 4BJ3A 2OV6A 4OF4A 3V4ZA 1U65A 4Z1MD 4UHBA 4MHOA 4EA8A 5BYJA 2QOEA 3TIVA 5JAPA 1TK2A 3AW9A 1JFTA 1Y5MA 4BE9A 5BMVA 5CA1F 1T6XA 3CLTC 3O9VA 2PIAA 1KO8A 3F6YA 2C0PA 2DTDA 4ILKA 4OHCA 4OQMA 2ERYA 4ZZIA 3K5HA 4MWBA 5ALTA 4CXMA 3MINB 4KB5A 2ZYUX 4ZCPA 1E2BA 4NY1A 1Z18A 4UFPA 1U8FO 4P22A 1SWVA 3ZI0A 1HZZC 4HVAA 4RVSA 3K16A 2RSLA 2N9UA 1CF9A 1HDEA 1VJ0A 2JH3A 1B0AA 4PWZA 4FYPA 3RSZA 3T34A 4F2HA 3A9UA 4EKGA 1SVLA 1P9WA 4X1KA 3KPWA 5TVGA 2IZ7A 1TUBB 3AJEA 4WE3A 1E3TA 1E5XA 3CISA 4JJFA 4ZI7B 5IU6A 2VHQA 4DEXA 5NLLA 1JVSA 3P9RA 4QDOA 2WU1A 4BKPA 4EY8A 3S2FA 1QOZA 1WABA 3HXTA 3DDSA 4FBLA 4FHFA 4RJIA 1OVMA 2X8AA 3AEUA 4WKNA 3HMQA 2TMYA 3KXLA 2IYNA 4XGQA 3L2OB 4WUVA 4Q4JA 4BNFA 2QQEA 1UPBA 2EFJA 5TE9A 1X8KA 4XIYA 3HO8A 3CJQA 4NEHB 1OI4A 4CNBA 2GM4A 1KZ7B 3SZOA 4PXAA 4BRUA 3KQNA 3X43A 1UDBA 3E6AA 3RF7A 4OGLA 5F5LA 1V8OA 1A9XB 1G8JA 1RJGA 3UVEA 2PX4A 3SICE 4AY3A 3HJBA 4RSMA 1SVSA 2AG0A 1QYVA 3AY0A 2AVNA 4RFVA 3G59A 1F6WA 4LX8A 4RPIA 1YDEA 4LF4B 4CIBA 1C7FA 4Y2QA 2IF2A 4N39A 5A04A 4L8VA 4FCWA 2XUOA 2CVZA 4KQ2A 1BN6A 2VLIA 3BXZA 3OPMA 1DXQA 2CNOA 2FW6A 1XD8A 3U09A 2OHXA 1N77A 3LUKA 3TPZA 3NBMA 4A2WA 5ADWA 4GMHA 1XCJA 1XAGA 2GAJA 4HAYA 4ZT7A 3L0IB 3DFZA 5F2KA 1FNSA 4BNHA 5FUVA 1G8MA 2YWEA 3P27A 4CTKA 3NVMB 3O4GA 1TZKA 3UZUA 1KIFA 1U4OA 3EVFA 2Z83A 5GINE 1V8BA 4AQ7A 4DY4A 3ROMA 3PKIA 4G1FA 4PPNA 5C7IO 2JFBA 1Z39A 3ZWPA 4JLKA 2OZLB 3OTHA 5IJWA 2ZITA 3ITEA 3LLMA 5ES3A 3UJ9A 4I5DA 4WXEA 1XTIA 5K4HA 4OX9B 3LE8A 2EXXA 4H3HB 3ND9A 5A4MS 2EFEB 5H3CA 1A0OA 4FUQA 1V48A 3GYBA 1NNSA 5LQKA 2RBEA 4H6XA 5E7QA 4AIIA 2HTEA 8GPBA 1NJFA 4XQGA 1PWZA 1R4NA 2QZPA 3PJDA 4ISBA 2C07A 4HDNB 5DNEA 3RUPA 4BV9A 1WDWB 5B3KA 4FVTA 2ZRBA 1E1CB 3RV4A 4HL6A 4L76A 3BWBA 2O59A 3D8SA 4GR4A 1PJ3A 1YS9A 4UHEA 1KPHA 5JZVA 4WK2B 2CXQA 4ZKDA 3D4NA 1QRRA 1YR3A 5D5QA 4R2XA 1PCXA 4WCVA 2DLNA 4QPJC 4DE5A 5FAXA 1SXJA 2H1RA 1KJIA 3GGOA 4ZI5A 3U3MA 4ZT3A 1RLOA 3BM5A 3G2PA 1G9XA 1SVNA 2QE7D 4C22A 4C7XA 2PAFA 4UQPA 1W0JD 4BVEA 1KYYA 3TIFA 3DVRX 1P2SA 1QWSA 3EVTA 2VNHA 2MCFA 2GK4A 3WL7A 1P61B 1Y5NA 1F4LA 1VHDA 2GHRA 2I4RA 2ZYSA 3CF6R 3T1NA 2DT8A 2ZB3A 3WLRA 2XCQA 1WQ1R 3P20A 2EARA 4CQMB 2FZGA 1EWYA 2PKYX 4RSHA 1S1CA 2R62A 2WJVA 3U7EB 3FTCA 4YJ3A 3X1DA 2ZUWA 1HG1A 1VPVA 2YZNA 3G2KA 1E98A 2FUCA 5H68A 4BGEA 3LJKA 1BJKA 1P1IA 4Z7NB 1K6MA 2GZDA 5KI6A 2O5RA 1E6MA 4DCNA 1F0NA 1Y7HA 2O7NA 2ZUCA 1HKHA 4HLDA 2C4KA 4XTCS 4BJ6A 3C1OA 4YRIA 1EXDA 1T25A 3R76A 2LDBA 4EVSA 2BSQA 2IUSA 2QD3A 2Z5GA 3DMPA 5JLJA 1SXGA 1KKMA 1OV6A 3ILHA 3PQ3A 5FF9A 1ZOSA 1JSCA 2Q2NA 4Q1BA 3A6DA 3ROGA 3HA5A 4ZDWA 2E4UA 1X7GA 4H6PA 1GYQA 2GEKA 4AUNA 3WO1A 4E2FA 2W4MA 3QMVA 3IC5A 4L5BA 4A2PA 4HX2A 5BPHA 1Z4NA 3ZY2A 1QP4A 1WDKA 5FORA 5CUQA 2G4VA 2QMOA 4GC5A 1K7EB 3C8MA 3EIUA 4DAOA 1WMFA 1UC4B 1RXYA 2JAPA 2ZJ6A 3A6GA 2ZT7A 3ZCVA 1NXVA 4F6RA 1X7XB 3VYUB 1CE8B 3D3KA 4OP2A 5EMHA 1UWKA 3CF0A 1U0NA 4B84A 4B7UA 1DT3A 4ICIA 4LZPA 3DKKA 3VO1A 5JH7B 1C1DA 1VBFA 2AMYA 3QLVA 2B3TA 3UT5B 4RNDB 1U8XX 4PLWA 3OM1A 1XEXA 2B30A 4FGLA 3R3YA 5DN9A 4KAFA 5K8VA 1Z0ZA 5L3QB 3DVQX 5JAQA 1TLTA 3M6LA 5HTOA 4OFXA 4V0LA 4DBVO 4GRIA 2G9NA 4C3UA 2NZVG 2JKVA 3KWFA 1D4OA 4M1KA 3GCWA 4L0CA 1CZOA 2VJYA 3IEUA 3WP0A 2Y77A 2ZDHA 2OILA 4JT4A 3BMNA 4Q4HB 3LYLA 4ZANA 4YWJA 1VB3A 1J49A 3NAGA 4JD5A 3W5UA 3LKBA 5K3AA 5IAEA 3L4BA 4IJ5A 5EHGA 1H6CA 3EUFA 3BIXA 2ZVQX 2XDAA 1PEKE 2BP7B 3OLZA 3C3EA 4INOA 5DNAA 4UBNA 4RL4A 5B7PA 3COVA 2XX3A 1IVYA 2O2IA 4XWYA 3KELA 3K92A 3LNTA 3GEMA 2WM3A 2FEWB 4MMYB 1U94A 2O52A 1RXIA 1YMUA 1AF7A 3HYTA 3R41A 5AKIA 1YQWA 2MYUA 2PQ2A 2QZ4A 3KVRA 4L74A 4C06A 4FLMA 3EBLA 4AMZA 1UBKS 3I0NA 4GXQA 4PAWA 4I50F 1T3LA 5DIZA 5CA1B 2IDKA 1MDFA 3U31A 2JVIA 3JXEA 4B45A 4U7WA 2JPDA 3JYNA 4KLZA 5ECDA 4AJPA 4CTJA 2PBLA 1V5EA 3KQSA 1J42A 3GEPA 2WF9A 2CVQA 2HA4A 3W06A 2YWRA 1Z2PX 4G37A 1U3UA 5K0BA 3G2LA 3H3FA 3ISJA 3PNVA 3LL7A 1B8NA 1U5BA 5KPDA 2XT9A 3V8RA 3UWSA 1G8AA 1KDTA 4ENPA 4YR7A 3NFRA 5EJ5A 2V4MA 5JY6A 1U2PA 1UF9A 1NDUA 1GG5A 3OF2A 4LBZA 1R5OA 3PEEA 1X7DA 4OU4A 3VU8A 5B3AA 5KTPA 3R6LA 1NYTA 1N6RA 3KR2A 4HGPA 1K4KA 1JLKA 4CDGA 5LMNB 4QEZA 5FPYA 3WLOA 1NX9A 4EELA 5DWQA 2Z0MA 1HI9A 2J4CA 3GOHA 3H97A 3ZK7A 4P4TA 3ZBQA 2I80A 1O94A 2YUTA 3G0CA 3QY9A 3ZDYB 2DT5A 1JEJA 2QGZA 3DO5A 3WTBA 3JASB 5B2FA 3QKSA 4DC9A 4PIVA 2EHJA 5DASA 2ZU0C 3S44A 2QM8A 3ACCA 3CVVA 1Q1ZA 1X92A 2XXJA 1M2FA 3BK1A 1X1TA 1ISIA 1IXKA 1J4AA 2D54A 5BT8A 3C7TA 4US0R 1DOHA 3RHSA 4YXWA 4BQQA 2PN1A 2FMIA 5D2CA 1TKCA 1XR3A 1Y8AA 2F4NA 5G41A 4DIOA 3QFTA 3TYXA 5J1SB 1FTSA 1ZHHA 3V2IA 3AERA 2XTAA 3MOSA 3T9BA 1GNQA 1KGSA 1QPGA 1W85A 4K9SA 5BQXA 3FJ1A 2V6JA 1HDZA 1LNQA 1RRGA 4OSEA 4YAEA 1CJBA 3NH6A 2XB8A 1V16B 1KPGA 3ED5A 1I14A 3G13A 1T9GR 1BTOA 3FGPA 2VFAA 3L8DA 2HI0A 4KWHA 4M21A 4EJSA 3VH4A 2QE6A 3QPCA 2HZBA 4FGZA 1CQJB 1U1CA 1ZHFA 4N54A 3TZ6A 3K1JA 1KEUA 4I5GA 1B0UA 4EECA 4XLZA 1MBZA 3R4CA 2IIBA 1FP2A 5C52B 3ZYCA 4B2LA 4CMKA 4D7AA 1JG7A 2ZB7A 5LMZA 5J5AA 3LUGA 2IEZA 3UMBA 3VMFA 4I2NA 4A8PA 4Q15A 4BPBA 1MRNA 1GPUA 3QLUA 5I7VA 4JC5A 1NT4A 3FX2A 2DXIA 2WTNA 3UGTA 2W6CX 5C37A 4HPXB 3IAM6 4DR4B 1AZTA 4WFIA 2A1UA 5J5VA 3KQKA 2TYSB 1XELA 1TU3A 4TUYA 1FBNA 1HDIA 2Q3EA 3OEHD 1PR0A 3W4KA 3OM8A 4BY9E 2GFQA 2VTEA 3TD6A 4MV3A 2E18A 1DO2A 3DLIA 2ZPAA 4LHVA 3IO5A 5AM0A 4C4XA 2HRZA 2BFMA 3OC0A 5J47A 2EBHX 1H8HD 1J2EA 1SUFA 3ZE2B 5AIBA 4GGMX 3G17A 3IR7A 5EHNA 1PBNA 2IZ6A 2I7XA 4RVFA 3NBQA 2PXHA 3I4FA 2OHVA 2MSKA 5SY4A 3TZEA 3T4PA 2CHQA 2AW3A 2IXEA 3X1ZA 2ZBQA 3IUBA 1BX3A 2FFHA 2XA9A 3HB0A 1Q11A 4QDUA 3U7RA 5EJ8A 3HLYA 1T5IA 5IBCA 2PUDA 4HAZA 3SP1A 1RZ3A 1VHJA 2WG2A 1D03A 3AETB 1JI0A 5EIAA 3PR1A 2OCPA 5BT9A 3SAJA 1P5JA 3QPDA 5DYGA 3V8NA 1XUOA 4D45A 1S6YA 4IG4A 3I73A 3OECA 2P3QA 2OWDA 3DTYA 2RKBA 1AKUA 4JQYA 4K0RA 1P1BA 2YMQA 1CRWG 1WS6A 3U48A 4G4JA 5E9JA 4F2PA 1KU0A 3GEIA 1OXUA 2NVUA 1QIGA 3K2EA 2ZSKA 4XH9B 5HKKA 4MMXB 2IRWA 4C5BA 5AI5A 1SVUA 2H57A 1L3CA 1LSSA 2ZIXB 3A28A 5L4SA 2PKQO 4KUEA 1UXKA 1GFWA 2PT7A 3L4EA 4FMCF 4FZVA 4KLRA 3PXGA 5AKHA 1KHTA 2EKQA 4TYQA 4BO0A 1U2DA 1ND5A 4EHLA 4MUKA 3R7BA 4FGUA 4M7RA 2C5BA 4CMJA 3ASVA 2GYYA 4MKRA 5HM6A 1J2YA 4D3XA 4AF8A 3EXIB 4IV0A 4EG4A 1GCAA 1AD2A 4QQNA 5J2TB 3AKEA 2WFMA 2PIDA 1S8OA 2OAEA 1XOIA 1VCIA 4FNGA 4M98A 5HJ2A 2C57A 4TQUS 4BO1A 4ZGWA 2WTMA 4LF6B 5L3SA 4LVUA 1G8GA 1OJLA 4AMGA 1NNEA 1JSZA 1UJNA 2VK2A 3QOWA 5AJZA 1TU4A 1GV1A 4K3UA 3T1TA 4EYKA 4FOTA 5TQ2A 1YQ9A 2H59A 2XUPA 3WY9A 2FWMX 2QUIA 2PZGA 3ZHCA 2BLNA 2VTVA 4CM4B 3TOCA 3GT7A 2BT4A 2CDRA 3DUFA 2Z2ZA 5CCDA 3SC2B 3LUBA 4PANA 2VF7A 1VXOA 1BGXT 4YO8A 4QXAA 4LF8B 3H3JA 5K01A 1FE8A 2ASEA 2ID4A 3A1SA 3JARB 4XPIB 1FDUA 2AWNA 3KOMA 4TTVA 1TC1A 1Y81A 2VZLA 2P4QA 1FMLA 3OQ6A 4FD3A 4HNGA 4JUBA 2OFXA 1LBIA 2WSLA 3NBKA 3IMCA 5EP1A 2CCJA 3LQ4A 1K9VF 4OHWA 1IPHA 2QN9A 4BATA 1Q1GA 2Q9CA 2WP0A 4GM0A 1O0BA 2GN1A 1IB0A 1I3OA 4FLFA 3TTXA 3P2YA 3B6JA 1XNRB 4RMGA 5BW5A 4WEQA 3CH5A 2OXRA 3TTYA 3NHLA 1M6VB 1NR5A 4ARZB 1WXQA 4XGIA 4OGGA 2FQWA 4MP8A 3VU0A 2Y8EA 3UK1A 3BT7A 1QHFA 2IA5A 2G0TA 5SYMA 5CYOA 4BLQA 1A9SA 1XA0A 4J2HA 4X91A 4ZGBA 2QORA 4MW0A 1I1HA 3WLKX 4ZAFA 3FNHA 4HFNA 4QXOA 3IPAA 4QOSA 4GXNA 4WHMA 3USZA 3WSWA 1LK5A 4B8YA 1H69A 3K9FC 5SZHB 4LDRA 3WSVA 3ZE0B 3P2KA 5LZ8A 4N3CA 1Y6GA 1Q0LA 1TIKA 4YP6A 3ZZUA 4I4IA 4EFLA 1QH1A 1WP9A 5AJVB 3HZRA 4OBXA 4PXSA 5AXCA 3S68A 4CF6A 4EG7A 1Z0UA 4I50B 1XTJA 2AJ8A 2FN8A 2H4YA 2FSHA 4QJ5A 5DYNA 1FXWF 2BV3A 5CIQA 4F4DA 1OIXA 3ZXXA 5KTSA 2OKCA 1FFBA 2RFLA 4M88A 4R83A 1F2UB 1BCRB 1D1PA 4Q9NA 3U4CA 1KC3A 1YIDA 1LSOA 2M6RA 3N2NA 4ENQA 2Z2YA 3IYLW 4LXHA 1I7NA 1E1QA 4CLRA 1BMFA 3SS7X 3GN1A 1RLIA 2W6OA 2P1ZA 3P9NA 4GX5A 4II3A 1FFXB 1JE1A 1FFAA 3W2TA 4D98A 1JFSA 1FK8A 4CL8A 4F4JA 1XTVA 4ZHQB 1O96B 5FBRB 5K51A 3ZY6A 1V45E 1G5HA 2C4WA 3MWEB 3OE5A 3NHMA 4DDVA 1XDZA 4NG4A 5HDBB 4A16A 1A1VA 1WUHS 3CX8A 1J90A 1X2BA 2PUEA 5ABPA 1H9BA 3QVXA 1XRNA 1PZEA 1ZZEA 5LZ9A 1TIBA 1O6ZA 4E31A 2IQ5A 1I01A 1QV6A 2H92A 2QMZA 4PHGA 1PWYE 3O8NA 2OORC 1XP5A 2C5EA 3AEQB 4LOJA 3UAYA 3VMMA 3J7AC 1J5XA 1KU6A 3ZHSA 1XQVA 3A9TA 3THRA 1ONOA 5IDVA 3DZFA 2VRNA 1O9BA 2E6UX 2VT7A 3TBHA 5FL3A 1V35A 4NCJA 1W48A 2GLTA 4ZYXA 4NKRA 3U56A 2PUJA 3MT9A 2J87A 1E2KA 4OQFA 1FPMA 3RT9A 3WK4A 3D3EA 3GJ3A 1SA0B 3RREA 1JS1X 4Z7QB 2WT9A 2PY6A 2EP7A 2XADA 1JA9A 4V0MA 3K0AB 1YR9A 4L4SA 4PEVA 3KEFA 1OI7A 1TGVA 2FPPA 5I7AA 1CF4A 1L7VC 4CIWA 2PQ0A 4Y1RA 2GKGA 3RC2A 2II6A 1RXCA 2R8EA 5EIXA 3ZU3A 2H6EA 1AXRA 3E3OA 3EXHA 5EJGA 4QGGA 5CURA 3FLMA 1XMVA 5K8TA 3BCSA 1B8UA 5IKOA 3N39C 4NATA 2DWPA 2UYOA 4YLYA 3BYZA 4N65A 2AZXA 1E8MA 1D8AA 1SHLA 4K9KA 4GOND 4JVLA 4QFBA 3NOXA 3IDAA 3DVAB 3HI6A 1V1RA 3SR0A 4EVQA 1DJNA 5TV2A 2FQ1A 2IWRA 4F12A 5F23A 1GGNA 4WW0A 4EX7A 1TUIA 4CMEA 2HCJB 3D3WA 2CXNA 4HGOA 4OLFA 3LT1A 1ZUNA 4KPYA 1KWGA 1ZNQO 3DVLA 3A9SA 3H99A 2Q1XA 1E7YA 4LDQA 3ZGLA 1LPSA 2C9MA 4C7VA 4XCVA 4UU1A 2Q3HA 1CUIA 3SMVA 4M9QA 1L3IA 2OP0A 4MLCA 3M6MD 1UPUA 4QREA 3RS0A 1KEKA 3KB1A 4FEGA 4BQOA 1ZM7A 2CJWA 1PUXA 2JLZA 2NZYA 3H75A 1QIMA 2NUTA 2ZTHA 4ZCMA 3PI6A 1FY2A 2J0EA 2PZLA 1J09A 2N47A 1GG2A 3QHAA 4FOSA 3ID6C 4BGIA 1XU7A 1KZYC 2BHTA 1MXHA 4AKHA 3WLEA 8LDHA 5HOEA 1I2MA 2G04A 2VP0A 4FQ8A 5EIFA 1S4MA 2GEDA 1FFWA 2G4LA 3DAGA 2XD4A 1BS2A 1B73A 2WYUA 4KI7A 1PBTA 1EHIA 1ZLYA 2FG5A 3QOFA 1DOZA 5JXGA 1IY1A 3MJCA 1C41A 1U7XA 1ULZA 2CXOA 3E9NA 3JWGA 3M9WA 1OXKB 3FCEA 3AB7A 1FTQA 1LTQA 3U49A 3AVYA 1SU8A 4QO7A 3ZCXA 1XEWX 4E1AA 3D6JA 4LGVA 3FAKA 2MWMA 5ENZA 3ZE7A 1CJCA 621PA 1RAFA 2VYNA 3UK7A 4DIBA 5EE1A 2VF5X 1HT3A 5AKJA 2ZWOA 5IKXA 3PFBA 3NWJA 4MW1A 1RCTE 2PO7A 1XCPA 1TM3E 2R97A 5LQCA 3PT5A 4NF2A 5B3JA 3BXHA 1YOVA 2PSFA 4BMXA 3WAKA 4EP1A 1M72A 2GBLA 3F5SA 4FMCB 1R0WA 1AKWA 1EVQA 2I9PA 4H17A 3FWPA 4P2GA 2FR8C 3NV7A 4OHZA 2CCKA 5K4GA 2X0IA 4FDAA 1TEVA 4YONB 3FZEA 1TE2A 3FVVA 3T7EA 3WIUA 1KI6A 4AMVA 1WQ3A 4WEOA 1OU4A 1P1CA 3TLKA 2J3EA 4E7OA 3VVCA 3T4XA 2F8TA 4GX2A 4LPKA 4YPOA 3QHQA 2QNIA 3WK8A 5A4FS 3BICA 3BB4A 3IOYA 1L4FA 2Q7XA 1CJUC 4DBLC 3CYFA 3OZTA 4QOGA 3K6SB 2J5XA 3JZIA 1UJ6A 4YO7A 1Z6ZA 1I7SB 1I24A 1QS0A 2FOLA 3AHIA 4OHRA 4AWBA 2V7UA 2H00A 5B4VA 1S2OA 4W9NC 3SY8A 4JBIA 3E22B 1DQZA 5E7JA 3AUJB 1KQPA 5AW1A 1HGXA 2GTIA 3EY9A 1YR7A 5JS1A 2C98A 1H0RA 1JRLA 1CG6A 4CDMA 4RXUA 2CYCA 2PMDA 1VL0A 1Z38A 4DXHA 1SUBA 4L0MA 4GM4A 5ICSA 1ECGA 2HL6A 2QYSA 3AEKB 4NCKA 3PA8A 4CL3A 3ENNA 5JC8A 4EH1A 5LL6P 1JX6A 1OAKA 2M1XA 2D7DA 5DLQC 2XQFA 3ZR4B 5ITWA 2EQ5A 3SGLA 7REQB 2VNKA 3FLAA 5ILGA 2I87A 5TQ0B 4XB2A 3NPAA 4OXRA 4ZXPA 2P30A 2HQBA 1RIFA 4O59O 3W90A 4CTMA 3Q9SA 2VDRB 1FSSA 4BQRA 2DH5A 2G8NA 4L6IA 3HU1A 4Q00A 3VR3A 1LV8A 7AT1A 1LF5A 1N6PA 2QMEA 3R8XA 3C4QA 4R9VA 3RAPR 2C77A 2CY0A 1CR4A 1GFIA 3IAAA 4OBBA 3QA3E 5HIIA 3ZUGA 2OLEA 4R5MA 5KOIA 3NBFA 4F3YA 2BMVA 3QVWA 4LQLA 5IT9A 5CT9A 2PT9A 3RFVA 3ZNOA 4QBKA 1B0PA 1YJXA 3QKWA 1W2GA 3RUFA 3BWCA 4CT5A 1XX6A 1Z6PA 2ECPA 2GN4A 4TYWA 4O8ZA 1VL1A 4PLVA 3I5YA 4N76A 4F7WA 2CB0A 2FWAA 1Z0AA 4GBJA 4HNUA 1SM4A 1D2CA 4C21A 4AY5A 1MOZA 2AN3A 5ALRA 5A4IS 3D5TA 3EX7C 2F1RA 5GVSA 2O1SA 4NYMQ 5HIKA 1EIZA 3G8DA 1JEOA 3L9XA 1IH8A 1Z5ZA 2BFNA 3K0EA 4Z1MA 2IU0A 5EXDA 5LKRA 4XAQA 2FTKE 2F7SA 4L85A 5COQA 1H2YA 3NJ8A 3MCVA 3WV5A 1YRLA 3CEPB 1EM8A 4DILA 4EI7A 3SQXA 1MJNA 2DH6A 2H7XA 3DEIA 3LVRE 5BSTA 2VHUA 1Q22A 2LZ0A 2OT3B 3ZOKA 1YVPA 4WQMA 2GCOB 2QTMA 1ULTA 2XUKA 4QEKA 5KDDA 5EESA 4BB6A 3B2QA 3AI1A 3RFCA 3HHEA 4JYMA 2E5FA 4DWVA 2HCBA 3X2SA 4R41A 1SJ9A 4DJ5X 2YV3A 3EFEA 4PBTA 5C53B 4XX0B 4G24A 4YX9A 2WWTA 1YB2A 4B87A 1X7YB 4MRAA 5HA5A 3I37X 3BJRA 3O0TA 1XRRA 3DZHA 4J91A 2V58A 5JISA 1HYQA 4MRPA 4MIEA 5B6JA 3LKVA 3INGA 3HV2A 2FZWA 3TG2A 9MHTA 4Q7JB 5GAJA 5CD9A 2GPNA 1U2ZA 5CFZA 4E0BA 5C4MA 2QRNA 2RK6A 1VYTA 2ZATA 3JQGA 3RHZA 3FG9A 2EFYA 5CBKA 3D4PA 3ZD7A 3EEQA 1DTWB 3E82A 4Z8YA 2VXBA 5JXHA 3H1GA 1DARA 4YA6A 1FTWA 1NLUA 1OA0A 2W58A 1XYVA 4N0QA 4PG4A 5KTKA 1R0RE 2ZBFA 4WSOA 1I6WA 4Z3DA 4HAXA 5JYDA 3FETA 3G5MA 1T8PA 1X77A 2AQIA 1GAQA 1TKRA 3EXG2 4KMOA 4M1MA 2E4YA 4DMUB 3JW8A 3EA5A 3PL5A 1GA6A 5I5GA 1JB9A 1R0XA 4XVHA 4TLMB 1P7ZA 4GBMA 4K28A 1XQWA 3IIJA 3RBXA 5HJEA 2P9QA 3I9MA 5JLAA 2PZKA 5HUHA 4JYZA 4YH