4KU4A

Crystal structure of a ras-like protein from cryphonectria parasitica in complex with gdp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
189
structure length
171
Chain Sequence
b'AGKITDKIAMLGEGGVGKTSLTVNLTKHVFSETYDPTLEDSYRRQCVIDGIPSHLEILDTAGALREQWIRQNELFVIVFDVTRRSSFEAAERLFEEVIQTKRKLDEPFAPSLVVLVGNKCDLDTRREVGTLEGSSLAKKLGCGFVETSAKLGTNVEEAFFSVVRADRRRKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-3 from Cryphonectria parasitica
publication title Crystal Structure of a Ras-like Protein from Cryphonectria parasitica in Complex with GDP
rcsb
source organism Cryphonectria parasitica
molecule tags Signaling protein
total genus 61
structure length 171
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ku4A00
5FR1A 4K8OA 3HYRA 3R7WB 4U00A 2RGAA 2IYVA 4JLJA 4TQ9A 1RVDA 2Q9AA 2X8AA 3NDPA 4O25A 4A1FA 3C5HA 4BUJA 2WWFA 1AM4D 3KKQA 5CIQA 4HZIA 3K8YA 1UEIA 3K9LA 2OAP1 4QGFA 4GMDA 4CEIA 4B75A 1YKSA 2CMKA 4GFDA 2ZI6A 1GRQA 1HE8B 3NH9A 4TLBA 1HT2E 3SJBA 4MDFA 5GJBA 1NY6A 4LHXA 3TUIC 2QSZA 4R2IA 3AQ4A 4K81B 1Q1BA 4KYIB 1SULA 1YQTA 1M7GA 5H68A 2AKYA 3PG5A 2WBLC 2QRZA 3TVTA 5JWHA 2CL6X 5KU1A 3CWZA 3H2YA 4JLOA 3V9PA 2FSIA 1GSIA 3RSLA 3B7GA 4FWIB 1UBEA 2VHTA 3GFPA 3IGFA 4FCWA 5LB2A 3QIAA 4S35A 4LJ9A 4I99A 2RHDA 4LPSA 1GIAA 2VHCA 3GLIA 2J0SA 3F5FA 3K0FB 2AHOA 1Z63A 1RW4A 2F43B 1E94E 2IUTA 2WSMA 1FZQA 4EPWA 4MYTA 5J4VA 4C2TA 3X1ZA 3QUSA 4IDHA 4NHOA 4NL4H 4B47A 4DT1A 5FL7A 1KSGA 5CM9C 3B8HA 1YR9A 1AA9A 3R9IA 2VLIA 2YHSA 4FCVA 3TK1A 3VR3A 3VNUA 1KTVA 3MJRA 1E9EA 3D8BA 1DELA 5TVKA 3ZZUA 4G5SA 1R8SA 4MGYR 1NMZA 5FTJA 4XH9B 3DOFA 1E3MA 1DAIA 3KUDA 2IYZA 1M34E 2OFWA 4LWZA 4MKHA 3KJIA 3R9WA 4DB4A 2GF0A 1CJVC 1NVUQ 1RE0A 1FP6A 4MKIA 3ETLA 4H1UA 1YZLA 2HT6A 2VSOA 1IN5A 1P2TA 3VFDA 2JLYA 4CT4B 2RMKA 4EPYA 4JT4A 4F38A 1XMVA 3CRQA 2D3WA 2B21A 2HYIC 2RHMA 3T35A 3DL0A 2F1HA 1XX6A 4Q47A 1MRNA 1CJUC 4B44A 1ZNXA 1KI8A 1GNPA 2PBRA 3AF1A 5FUWA 5AWFC 3ND9A 3PQCA 2C95A 3L2OB 3U3JA 3T06B 1US8A 3PXGA 3VKHA 2KBFA 3SQWA 2WKQA 3SDZA 1XPUA 3NHAA 3PEVA 2FWRA 5KNBA 1AZTA 4LBVA 1OXSC 1D2MA 4X8HA 3THOA 4LV5B 2CK3A 3H0KA 5CDFA 4I1SA 5DISB 4RD3A 1OIVA 2LCFA 3NKVA 3D31A 3TE6A 2BKUA 3X1YA 3WNBA 4Q4HA 1AS2A 3KX2A 3SOPA 1R6BX 2MSEB 1E2IA 1GG2A 4A8JA 1AZSC 2O8EB 3K09C 1AKEA 3AKCA 3C16C 2AWOA 4PSVA 2RGGA 3AVPA 2R8RA 4KBGA 3QXCA 2DFLA 4DRZA 2WAXA 1TTTA 4QFMA 2ZYVX 2AK3A 3ZZTA 3R20A 5TXGA 2ZRHA 4BE7B 5KNCA 1ZIPA 4B3GA 2HLDA 5HCNA 3KKNA 5FTNA 1W5SA 2GHIA 4DSTA 3T1TA 2NTYC 3OZXA 1OHHA 4GBMA 3CRVA 2GJSA 3EPJA 1OKKD 3BB3A 3C4JA 3QKSB 5J40A 1NN0A 1SVOA 4M53A 1C1YA 4DBLC 2QA5A 2DY1A 1G3UA 4N1AA 2QQ0A 3P4YA 2Z5FA 5JSZB 3WNCA 2EWVA 2JJ2A 4EQ6B 1OB5A 1EFRD 1YU9A 1NBMD 1LS6A 4HAUA 2SHKA 2R6DA 5E7JA 1CRPA 3ICQB 3NBYC 4P0TA 2OESA 2RGCA 4V0NA 3R7WA 3EA0A 1XD9A 2E1RA 2WJJA 2FSHA 1SQ5A 2ZU6A 3KQHA 2IF0A 1SXJC 4DLUA 1S3SA 2FE4A 4YDSA 1GTVA 2JLVA 3THWB 3H84A 4MRPA 1W0JA 2JIZD 1BMFD 2C03A 5JS7A 5EP2A 2IXFA 5C4GB 2QTFA 4BLSA 3BIFA 1X3SA 1W4BA 3BB1A 3PUVA 1ONBA 1JAHA 1OFIA 4IEIA 1SKYB 3LLUA 3FHTA 2FNAA 1DS6A 2X2EA 3IPXA 3NIBA 4KHZA 1G6HA 1XMSA 2G0TA 2JJ1D 1MRSA 2PZEA 3KTAB 3LY5A 5J4HA 4PPQA 4JLDA 5DGXA 1DO2A 1JECA 3T34A 3HU2A 1VHTA 3KKOA 1JI0A 4LHYA 4B3DA 3U6BA 3T1OA 1DAHA 1FPMA 3QI2A 3SNHA 3T5DA 4BZXA 4ZDWA 4W5HA 3SYKA 1OYYA 1WDTA 1J99A 1VG1A 1XXHB 4LGMA 2V7QD 2XNDD 1KDOA 2VO1A 3SHWA 3ZJYA 4IRUB 2D7CA 5C4MA 5KNDA 2HJGA 4AWXA 2ECKA 3B82A 3W3AA 3F8TA 2ZJ2A 1FW6A 1ZVQA 3NVAA 5F3WB 3VX4A 3GLHB 4OQLA 4ACAA 3U7EB 2J87A 4C0HA 4G5QA 1XMJA 3CBQA 4YMSA 3X1WA 5IHPA 2D2FA 2ZRKA 2WPDD 4B2LA 1P62B 1TEVA 2Z43A 1KY3A 3FB4A 1OB2A 2KBEA 1LF0A 3QPVA 4TSFD 1N6HA 3NDBB 4N0DA 1P2VA 2R9VA 3QSYA 1AJEA 1N6LA 3ZVNA 2JLWA 2YZ2A 1G7CA 1VKJA 1Z3IX 4MH0R 3PV0A 3RABA 4PPFA 1VHLA 2GZDA 3WP1B 4OL0A 5JEEA 2PLRA 5L3SB 1E9RA 1G9XA 1WQ1R 3ZYCA 1D5CA 2VQSA 2JDIA 2ZROA 4D0LB 2JJ8A 3I5YA 221PA 2CDNA 2X19A 5FTKA 4F91B 4OQXA 2RH5A 3ADBA 3JZMA 1Q3HA 3A4NA 2I4IA 3UG7A 1JR6A 1M6NA 2F55A 3WXMA 3B9QA 3W90A 4JKIA 1LVGA 4C0JA 1P61B 2OCPA 2UKDA 4LYHA 5CYOA 1IXZA 4OQNA 3E2IA 3LFUA 4BLOA 4JKYA 2D4HA 3QXJA 4P4UA 1YJ5A 1XB2A 3K9HA 4E07A 2PT7A 2DPXA 1EFUA 4FIDA 1WMSA 2ZSAA 3EC2A 3QE0A 4NU0A 3M1IA 4BLPA 3AVWA 2AD1A 4E09A 4YMWA 2E9SA 3UIEA 2P3SA 1T0HB 3WYAA 4DLVA 4LZZA 4DB2A 2O8EA 1A5TA 2B7BA 3RHFA 1CEEA 2UZIR 4ZCLA 1X8LA 4Q7JB 2CEAA 3ZVRA 2PJZA 4D82A 2BJWA 3KKPA 1U98A 4DCTA 2IS1A 1R0ZA 1ZM3A 1QHYA 4RD2A 2ORWA 2FGJA 2HF8A 1ZCBA 1AGRA 5E95A 2QTVB 3KXKA 2NMVA 1I4DD 4QNRA 2JIZA 1JR3A 1XTSA 1W48A 2YVUA 2A7QA 2PEYA 4RZ2A 1E4VA 4GOXA 5GJWC 5HR5A 2F6RA 2JLRA 4KYUA 5CM8B 1SXJB 1RJ9B 4DZZA 1TUIA 3O8BA 3QKSA 4B32A 5KSZA 4DSOA 2J41A 4P32A 4E5UA 1PV4A 1QHHB 5JLJA 3T61A 2ONKA 1Z08A 2XITA 2JATA 1BKDR 3AF3A 5JSZA 3DHWC 4WVFA 2ATVA 1IM2A 4EQ6A 5B30A 3TQFA 3LV8A 3QKUA 2QMUA 4ESHA 1UM8A 1G6OA 2AFIE 1QRAA 2HXSA 3K1JA 2XNDA 1XD2B 2AK2A 2CXXA 2ZETA 3BFXA 5AJZA 5FOVA 3A1TA 4Y0AA 1GVNB 3UG6A 1KI1A 1MV5A 4QHYA 3WBKA 4UNNA 2ERXA 4BFXA 1VPLA 2FPLA 1UKYA 4BFUA 3LBNA 4DIDA 3THWA 4DLZA 1P60A 3EC1A 3B5JA 5JZVA 1CBUA 2KJQA 3MWYW 1DARA 2VF7A 4C30A 4DXAA 5KSOA 2GRJA 1SXJD 1GP2A 1UFQA 2WPDA 4B34A 4A0HA 3VR2A 1NMYA 3VNVA 4JBWA 4ERNA 4Q02A 2R44A 5E7MA 1U8YA 1ZD1A 1EG7A 4JLMA 3OE7D 4MUAA 1VG8A 1L4UA 4HDQB 5AJVB 3L0SA 4OYHA 4KFUA 4JSYA 2J0QA 2KB0A 2ZYUX 3IKJA 5JJLA 5EP3A 1HT1E 2C77A 2NO0A 5LB4A 2A5JA 4DKXA 1XJQA 3FKSD 3ZS9A 1XXHA 1CP2A 3U3KA 4WZBE 4B3XA 2GILA 3EIEA 1S1MA 4QL3A 1IXSB 1KO1A 2W2VA 4DDVA 3KZ1E 1KJZA 1JAIA 4PC3A 3ASYA 1EX7A 2YKGA 3AF2A 3GLHA 1JPJA 3ADKA 4KV9A 4BFVA 2FF7A 2XZLA 1DG3A 3IHWA 4IVQA 3ZIAD 5HKKD 5JEDA 5KTYA 4GT1A 2ZQ5A 2QAJA 4L9SA 3IO5A 3LX8A 4UXHA 1DOAA 2GBLC 5EJEA 4QM7A 3CNNA 3P27A 2IUSA 3NC0C 5KSPA 4IHQA 3EWAA 1FQJA 3V00A 2JA1A 4KXFB 1TPZA 4QBFA 1R4AA 4Q4JB 1F5NA 4GOKA 5L3SA 4D4MA 4XVRA 3AP2A 2IF2A 3QJYA 1E79A 1BH2A 2ZJBA 5DO9A 5JCZA 2ZTSA 4ZO4A 3K09A 3ADDA 5AUNB 4ASUA 4QHTA 1TQ4A 1VG9B 1OSNA 4WZAE 1AKYA 1N6PA 2O0KA 5IK2D 3JVVA 1ZINA 3S1AB 1YR6A 3PCRB 3TMKA 2P6UA 2TMKA 3OF5A 4A8JC 4UNRA 1DEKA 5TDHA 1Q1QA 4ZKDA 621PA 2WJIA 1Z0DA 4ZDKA 2EYUA 3SI7A 5ANRB 4JVMA 1XTKA 3RNLA 1UKZA 4JLKA 3D7MA 1CIPA 3L82B 3H4MA 4LBYA 3W34A 3BFVA 3U7HB 1DAGA 1MOZA 1OT3A 2IYUA 3HDTA 4GL2A 2ZAMA 4QBGB 3VAAA 4YMTA 3WMEA 121PA 4LDJA 3GLFE 2K5UA 2NOAA 5FI0B 4OK6A 4QKQA 4B3BA 2NZ8A 1Z6TA 2WWXA 4M8NE 1Q57A 1Z22A 4KFRA 1EESA 1ZD9A 1ZBDA 2HEIA 2BBWA 3PIRA 3IUYA 2CJWB 4G1UC 2DFNA 1N5JA 1NF3A 1S8FA 3WYFA 4IDNA 4CEHB 3BBPA 1F2UB 3SR0A 1U0LA 3AEZA 1NKTA 2CL7X 3FMPB 5J47A 5FBLB 1U90A 1G4UR 1NVVQ 3MUFA 1KMHB 4UJ3A 4OHYA 1YR7A 5CDFE 5FBRB 4XD7A 3K9NA 1KJWA 3K70C 1S9DA 2P67A 4NCIA 4PZLA 3I8XA 1OIWA 4UXIA 3KUCA 4KBFA 2WHXA 5DN6A 2VA8A 3ZD7A 5DI9A 2QL6A 4LPKA 1QHHA 2BBSA 1E2MA 1WA5A 4TLAA 3OE7A 4KVGA 1WRBA 4HDCA 5G41A 1W2GA 4NE2A 4BFWA 3I32A 4QXAA 3MFYA 5EE3A 3FVQA 1CRQA 3IILA 4PQRA 1N5LA 3L43A 4EFNA 3A1SA 3GLIB 3DMDA 1TU4A 2ZITA 2HXYA 2V55B 4QC2A 4GZLA 4DHEA 1GM5A 3DEFA 5FBVB 4F92B 5DHFA 1HTWA 2A5YB 3VTKA 1HEIA 3LA6A 1KK0A 2IX3A 1BYIA 1SVSA 3P26A 2FEMA 3VR6A 4IDPA 2QM7A 3W5JA 1N5KA 1T8TA 3GQBA 1NI3A 1JXOA 2VHQA 3WMFA 4JSTA 4B6EA 2FV8A 3CUEF 4LV8B 4PHGA 2R6FA 2OG2A 3ZIAA 5HKKA 1KOFA 1W4AA 2PMKA 3HR7A 5DIFA 4MUBA 2V1UA 1LTQA 3EZ2A 4N0EA 2BHRA 1Q1ZA 5FH9A 5KUTA 1G7SA 2BDTA 1UF9A 3PUXA 4EPTA 1ZU5A 1G3RA 4C9BA 1FP7A 3IPYA 3HP1A 2P65A 3QKRB 2WIAA 1Q44A 4JVLA 3AGPA 1TEXA 3K0CC 2E87A 1M1YE 1TL7C 3K0SA 4FN5A 4C0AC 3NG1A 5J5CA 3T1VA 5HTKA 4KSCA 3R9XA 1KNQA 2VP6A 1N0WA 3U44B 2FFBA 1QG2A 1W44A 1YHNA 4MRRA 1US8B 1K5GA 1A1VA 4DSUA 5FBWB 3M6AA 3CX8A 2WSSA 2L0XA 2OSBA 1YZUA 2W2XA 3AUXA 4NPHA 3B85A 3TW4A 2B92A 1U0HC 3GJ6A 4LJ8A 1W46A 3RYTC 1LW7A 1WCV1 1IY2A 3EPHA 2OEPA 3F3YA 4O2RA 1ELOA 4PSKA 4DLWA 1SVIA 421PA 4V0ME 3KQNA 3KB2A 3W3ZB 2EFHB 1SZPA 2ZUBA 2ZYTX 4Q4AB 4A8JB 1HA3A 3UXMA 1COWD 1O3YA 1VYTA 1F48A 2I1QA 3W6NA 4JVNA 2UZ3A 4JYCA 5JHGB 2IS6A 3RDPA 3IIJA 4Q4JA 1N6RA 3L8ZA 3OHMA 4Q1AA 1Z0IA 1C4OA 4BEJA 3PEUA 4DEXA 4KVAA 2QNRA 1TQ2A 4M22A 4D4LA 1DAEA 4JS0A 4LY6A 1KI9A 2GK6A 3WMGA 2PH1A 1NRJB 4POAA 2MSDB 2AN9A 2W00A 4IKEA 2WWYA 1N0UA 5CITA 4B2IA 3S1AA 2AR7A 1KK3A 3UATA 2VRWA 4H1VA 5IRCD 3AKYA 3CNOA 2NO9A 4HB2A 2OFXA 1MABB 4MYUA 2CK3D 2FPMA 3TSZA 1QHNA 2JLUA 1NY5A 2GVDC 1KSJA 1EFTA 1ZUNB 2OBLA 2VP2A 3ZQJA 2XXAB 2OBNA 2QTHA 1MO3A 3FYHA 3K70B 1FTSA 1HH4A 4MITA 4PZYA 2C04A 3NTUA 4V0LA 2IYRA 4I1VA 1ZAKA 1KHTA 2QBYB 2IYXA 3FMFA 5JWOA 4FWTA 5IF9A 1E6CA 3AVVA 1AQUA 1P9WA 2WJGA 2WWWA 2ZI4A 4XJXA 2QN6A 3CRRA 4YONB 5FUVA 3TUZC 2CJWA 2JCSA 4D4KA 1Z47A 4LX0A 4BLRA 3BH6A 3M0EA 4CEHA 2HLDD 4URWR 1F2UA 1WBDA 3RWMB 1QF9A 1OHHD 3BFKA 1KMHA 4FMDB 3AF4A 1TQDA 4PANA 1U99A 1AK2A 1II8B 2D06A 3B1VA 3Q5EA 2R65A 3FE2A 1TF2A 1NBME 3K0EA 1OFTA 1TQ6A 1GFIA 2EQBA 3UWOA 1S9HA 1CR4A 4KJZA 2P0EA 2JJ2D 4IVRA 1TX4B 4QGGA 3LRPA 3NBXX 3GJ8A 4L5BA 4JJZA 1E0AA 2CHVA 1P9RA 2REXB 4X8LA 2DCUA 2WTUA 3TRFA 1G291 1T3LA 2OLKA 3TW8B 1ZC4A 1XF9A 3MRSA 5J4KA 5LDDC 3I72A 2AWNA 4S2EA 2BCGY 3GEEA 3RS3A 4TQAA 2YOGA 2JLSA 1G4AE 3BJIC 4Z8YA 2LWIA 4A2WA 1W0JD 4EAQA 3GJ3A 2BOVA 4B48A 4D25A 4JJKA 4CW7A 2QGZA 3BGWA 4DWJA 2FFAA 4NONA 1PLJA 3SC3A 4FINA 4O3MA 5AJYA 1KO7A 3PUWA 1KKLA 3LVRE 3KQLA 1LNZA 1E0KA 1VYUA 1A7JA 1GKIA 1T4GA 1W49A 2G1KA 2UVQA 3U3OA 2IEYA 2R6AA 1RC8A 2XB4A 4NCJA 2FPKA 4P33A 1COWA 1ODFA 2BMDA 3UPUA 3T12A 3QKRA 4JLNA 2R6GA 2BBTA 1UDWA 2GBLA 3SN6A 3SE0A 3H86A 1FMJA 4US1R 2HJVA 4A0FA 2X2FA 1AQYA 4BEBA 4PO8A 3KFXA 5C2JB 2V8OA 2V4ZA 1VG0B 3U44A 4V0KA 5DH9A 1CLUA 1SKYE 4RY2A 2EFCB 1LS1A 2GCOB 4Z8XA 4OHXA 5FOTA 3CKLA 2ZRIA 4M9XA 2ZI5A 4A2QA 1GZSA 4BPBA 5G3YA 1N25A 1T5IA 1Z6GA 4TTPA 3TR5A 4LSGA 3EZFA 3A6PC 3ICEA 4YMUA 1A2BA 4IOKA 4RZXA 4UNPA 2IBMA 4LUCA 4ZCMA 1KO4A 4HATA 1W36C 2GTPA 2XB2A 4BWYA 5SZJA 4Q4AA 1M74A 1OXXK 4QJ4A 5AUQA 5SZIA 1GAJA 3B1YA 3VHXA 1NVWQ 5DYIA 2ZU0C 2XSZD 4M1YA 3B60A 4LJ4A 4BFTA 2AFHE 4A2PA 4PAOA 4QNMA 1H65A 1TU3A 4RJLA 2J7PA 4D0GA 4P3YA 1KSHA 3N2IA 2JDID 1XCPA 1EX6A 4FMCB 1HQYE 3GLHE 4Q01A 3ADCA 4O2LA 3GJ7A 2HUPA 2ZVPX 2VTKA 4W7SA 1JBKA 5KPDA 4WAUA 4TL6A 2WJVA 3LAWA 2ZM5A 4Q4LA 3LBIA 1RIFA 1Q21A 4AYXA 4I4LA 1DAMA 2QRNA 1MABA 1E2HA 2CE7A 2F7SA 1HE1C 5EUMA 2GWHA 2F1RA 1E9SA 2ANBA 4ZPXA 5TARA 3SJCA 4BLTA 4AYWA 1Z2CA 3NWJA 2XXAA 4GOJA 2FMXA 4IOMA 2YWGA 4XVQA 3R8CA 2HDNB 1ZM4A 2OZEA 3WP0A 4TYWA 1P75A 2BMJA 3FFBA 2QBYA 4EJSA 1P5ZB 1ZM9A 2YOHA 5JECA 2O8CB 3CO5A 1BS1A 2YWEA 3I8SA 2ZRAA 4TN1A 5B2ZA 4TLDA 4NYJR 5JS8A 1Q20A 1T8UA 1G3MA 1Z6YA 2EU8A 3OIVA 1JR3D 1ESNA 4G01B 4BGDA 1Z0KA 3RS0A 1S4QA 4ZIRB 1Z06A 3VR1A 2GXUA 2VL7A 3T15A 1EWQA 3ECCA 1DBSA 3QXHA 4NKRA 1IOZA 1DG1G 4B3CA 1NG9A 5DE3A 1II8A 1XEWY 3CPJB 1OV4A 4BRUA 4GI7A 1CU1A 1Y63A 2IA5A 3ZQ6A 4EFMA 2X1VA 5JI2E 3GLGA 1ZRHA 2N42A 5EE9A 4TZ0A 4CRWB 1E2GA 2QT0A 3BS4A 4LBWA 1E9AA 2NGRA 2J9RA 2KE5A 3Q9LA 3PEWA 1Q1EA 5FI1B 3HR8A 2GEDA 5EXTA 2BEKA 1RRGA 1HY3A 5IT5A 2V9PA 3QG1A 3MLEA 2BV3A 4URZR 2WJHA 4OHWA 4CIDA 4AD8A 1MH1A 1DE0A 2IYLD 4KODA 1E2FA 1JQJC 4HI0E 2GXSA 3KFVA 3FHCB 4GDFA 1E0SA 3CH4B 1CR1A 4NYIQ 4Z54A 1OH6A 3GJ0A 2DBYA 2NO7A 2FX3A 4DEYA 3K0CA 2IYWA 1SXJE 1ZM2A 2YINC 2ORVA 3QF7A 4HLDA 5K8IA 2QPOA 1F3OA 1VCIA 1W1WA 3SJAA 2H18A 2WVJA 5KOYA 4NYMR 2W58A 1M7BA 4BZPA 1E2QA 2LKCA 2F9LA 4D80A 3ZS8A 2FU5C 3CX6A 3L0IB 4PC6A 4TMXA 4XTCS 1XZPA 3U6KA 1MO4A 5A5GA 4LHVA 3CX7A 3TKLA 2Q0HA 2XSZA 4FXPA 4R7ZA 3AVOA 1MT0A 3I3SR 3CIOA 4AK9A 3EX7C 3CF2A 1W36B 2PX0A 4TL8A 5L3QB 1G8HA 4JZKA 4AY2A 3E5HA 4JT2A 4DLXA 3RS5A 4NCHA 1U81A 1E69A 2C96A 1XTIA 2VH5R 1RYFA 2PZGA 3EZ6A 3SS8A 2CL0X 3GCGA 1PUIA 4TTQA 4GP7A 5KPJA 2ZRMA 5H70A 2GCOA 1G41A 1EK0A 2C9OA 4QHSA 4ZI2A 5FOWA 2P6RA 4R2HA 2V3CC 2YYZA 5EXXA 2ZAOA 4X8MA 4B43A 1JB1A 4TL9A 2V6JA 2H92A 2XTNA 3CF0A 4PO9A 4QRHA 4A82A 3CM0A 4XOIA 3O8RA 4HUTA 3QOFA 3Q7QA 2QPTA 2QP4A 2IHYA 2W6JA 2WWGA 4LJYA 5EUQB 3NC1C 4QJ3A 4HLUA 3RSOA 1DAFA 2C9CA 2H16A 3I1FA 2WIBA 2VBCA 3GJ5A 5DLQC 2GXAA 1HURA 2C78A 3HJNA 1Q0UA 4LHZA 4WIAA 2H8KA 1II0A 2XOKA 2ZI7A 4ON9A 1W36D 1E79D 1CJKC 2YC2C 2YJTD 4Y0VA 4DCSA 2VHJA 3I5XA 5C1BA 2VPPA 5BN4A 1FUUA 4ASUD 2W83A 1E96A 2Y8EA 3DDCA 3LO5A 4OI1A 2BMEA 1KJYA 2GEVA 3QNUA 3TQCA 1XFAA 3TJZA 1M8PA 1GRNA 3CPHA 3VHLB 3PITA 3CPEA 4U5XA 2B6HA 4Q1EA 5B64A 3HYTA 1AIPA 1T91A 1X8JA 3SQXA 3CLVA 1OXUA 2OUKA 3GEHA 4F7WA 1FQKA 4I1UA 4TZ6A 2Q6TA 2NG1A 4PPNA 1NVXQ 1VECA 4F4CA 2F1IA 3SJZA 3IIKA 3GJ4A 3MSXA 1Z0JA 5LD2C 3B6EA 3RS2A 1G5RA 1KO5A 2I3BA 4KITB 1NN5A 1CKEA 2BMFA 2IYTA 2O0JA 3LD9A 3AVXA 3SHFA 1YVDA 2Q3MA 2GJ9A 3OESA 2EFEB 1Z0FA 2O8CA 5H1YA 1HV8A 4TQUS 2J5XA 4TMWA 4KFSA 4YXWD 4NZYA 2PEZA 2OCBA 5EXSA 4B74A 3U4QB 5G3ZA 1IY0A 2ZRNA 2B7CA 1G21E 4K46A 4ZIRA 2IL1A 2FJUA 3BAFA 2ZS8A 2QSYA 4XD7D 2ZS7A 4ESVA 4A9AA 1IN6A 4EUNA 5DN6D 3KXIA 3U3MA 5SZHB 2JEOA 1AS3A 2DWOA 1VDZA 1YZQA 3IIMA 3RAPR 4C2UA 1DO0A 3C5CA 4RZ3A 1KZ7B 5LPNA 2HCBA 3EWSA 3RRZA 3I73A 2YC4C 1KYIA 3FDIA 5JCPA 1E9FA 4RFSB 2CHGA 2ODWA 2XZPA 3KJGA 5KDDA 1EXMA 4B33A 4DLTA 2DFKB 2ZE8A 3N70A 5SZKB 5AUOB 2RB4A 3NBFA 2B8WA 2OBMA 4OK5A 4UKDA 2DHRA 1IJEA 1FL9A 2C99A 4O0MA 1ZC3A 2GZHA 4PX9A 3DKVA 1G20E 3WNDA 1S2MA 1XEFA 3JZAA 4GNKA 5GVRA 1DVRA 3K0AA 1XEWX 2OAQ1 2J59A 2WICA 3CNLA 5G53C 1H8HA 5F9HA 3N5CA 1ZUHA 3QY0A 2YWFA 2ZR9A 1XPRA 3AVUA 5C18A 4DCVA 2PCLA 2J0UB 1GKUB 2O8DB 3THYB 2CVFA 3GLIE 2NO1A 1NMXA 2ZSFA 1KI3A 2ZJYA 4HUQA 5CYPA 1NP6A 2ZRCA 5JI3E 3RC8A 2DWPA 1X1SA 3BOSA 3NEJA 4URYR 3U2QA 4DLRA 5L3QA 2OXRA 4BQSA 2XEXA 1CTQA 4YC7A 8OHMA 2O8FA 4JVSB 4RD1A 3CONA 3LH5A 2QAGC 1M2OB 1IQPA 3BB4A 5J4YA 1IAQA 4PHHA 2JAQA 3RC3A 4WW0A 2WSSD 3TH5A 1L4YA 4OKSA 4PZZA 3ZVMA 5IDVA 4A15A 3CF6R 3HPRA 4GMXA 4YMVA 5KO2A 2IYQA 2BWJA 4TT3A 4Q1BA 4B73A 1VIYA 4NCKA 2ASEA 2Q9BA 1TNDA 4LYFA 4M9ZA 1II9A 1PVOA 3TLXA 1J8MF 2W2TA 3IHLA 5CIWA 3IO3A 5B58C 3OFNA 4L16A 4F4IA 1IBRA 1XTJA 5KHOC 4TYQA 4J0QA 5TV2A 2VHUA 1SVWA 4AURA 5FPSA 4R71A 4Q19A 4MQBA 1MR3F 1JALA 3BC1A 4XTRA 4JMPA 5EE1A 1KDPA 4TWZA 4JL5A 1J8YF 5LD2B 4YXWA 4JYBA 3QQ5A 1WBBA 2ZRLA 2PJRA 3AKEA 1F60A 3N2EA 4IFEA 2XTMA 2IT1A 2WAYA 3CWQA 3MG9A 1R0XA 4BRWA 2Q21A 2D2EA 2WOOA 1X8KA 4M1KA 3DMNA 2XAUA 3SFZA 1P3JA 4Q7MB 2AXNA 1KSFX 4KU4A 4DCNA 1Q22A 2RCNA 4JLPA 4HSEA 5BWMA 3VX3A 1MO5A 4D4JA 1TADA 4D0NA 1G16A 1XP8A 4EJSC 1TAGA 2HYDA 3U60B 4AKIA 3H1TA 3X1XA 4TL7A 3QF4B 4OI4A 3P20A 3FGNA 1XTQA 4HAZA 5EE0A 3UMSA 1V5WA 1DPFA 4PQFA 3REFA 1SVLA 1LFDB 1XJ0A 2ANCA 2ZRFA 5GJVC 4CZ2A 1GITA 2XNSA 1BIFA 1S3GA 4G5RA 4Q66C 1W4RA 4C4PA 2H1LA 5E7IA 2JLXA 4CVNA 3AV0B 4ZCIA 3W5IA 1GRRA 5E4FA 5HCIA 1U8ZA 4FI3C 2FDCA 3L0PA 3WYGA 4OJQA 1U9IA 3B1WA 3U4QA 4PXAA 4XSGA 1EFCA 4CF7A 1CS4C 1FNNA 3U7FB 3RRNA 4WBSA 2GETA 4KAXA 1OIXA 1KDRA 4G0NA 1XRJA 4DDUA 4C0QC 1E4YA 4LC1A 1E2KA 4RVCA 1QHXA 3FFAA 3KDSE 1W4CA 4DCUA 5HZKA 5J4LA 1XNJA 1YRAA 1P7CA 2GJKA 2NIPA 2VP9A 4N3NA 2RAPA 4B76A 3AVYA 1W7AA 2OILA 1FOEB 5FPYA 1ZIOA 2QENA 3OEHD 3BH0A 1UBGA 4LBZA 2QE7A 1N0VC 3FWYA 1VCNA 4D2IA 2XJ4A 3V4FA 4RFSA 1XCMA 1UAAA 4DDWA 2XX3A 3QPUA 1E32A 4IFBA 2O5VA 2H7VA 1N6KA 4JL8A 1OW3B 3DKPA 2IS4A 2BEJA 1P4SA 5CB8A 4H9GA 5BXQC 2C8VA 4HB3A 3DM5A 1K5DA 3SYLA 2J3EA 2D62A 4NP6A 2QAGB 3GLFB 2IXGA 4U02A 2H17A 1FTNA 2C98A 3A8TA 5FTLA 3OAAA 2FZ4A 2MMGA 2YNMA 1F2TB 4A6XA 2GXQA 4IOLA 1ZP6A 1NSTA 4C0BA 1E1QA 2O52A 1ZNWA 1BYUA 2J0UA 2W0SA 4NTZA 2O8DA 3VKGA 4HB0A 3THYA 2O0HA 2WMOB 1D2NA 1ZUIA 4GZMA 3AM1A 4BLQA 1C9KA 1R5OA 1P6XA 2NZJA 1A2KC 3D3QA 4LYJA 4IDQA 4PHFA 4WXRA 1RFLA 4L4UA 3QBTA 3KL4A 4Q9HA 2F3TA 4IJMA 1YR8A 3OEED 3A58B 1GKYA 1XD8A 2A3RA 3B1ZA 4CEJB 2FSFA 4RD4A 2ZEJA 1G8GA 1WE2A 2OCYC 2JASA 4G3XA 5A4JA 2XTZA 2OV2A 5P21A 2AX4A 4PC1A 5EP4A 1JQLB 3ASZA 3U61B 4I1OA 1FMLA 4HLUC 1W2HA 2Z83A 3GMTA 3RANA 3RLFA 2FA9A 3ZDQA 5DYGA 2ZSBA 4DDTA 1CR2A 4YQFA 2XGJA 3C15C 821PA 4A6PA 2ZSEA 3QVUA 1N6OA 2P5SA 4A36A 5CB6A 2GF9A 2AKAB 5F98A 4EJSB 2ODNA 3SBEA 1Z6XA 1NLFA 4B3FX 5BYKA 2KWIA 2ZRGA 1VCOA 1KZGB 2WZQA 4HEJA 4LJ5A 1R8QA 1KI6A 4B2PA 4P4SB 2J7PD 2GA8A 5CJPA 4ZDIA 2IK8A 5FTMA 1CJTC 2W6IA 4DUGA 4GP6A 4LCBA 2GZAA 3RWOA 1OLOA 4IDOA 2QI9C 3V4RA 1QG4A 4PHTA 4P31A 5FFMA 1X86B 1ESMA 2A5GA 2ZSDA 4PAMA 1J2JA 4LI0A 4RD6A 3GLGB 1Q3TA 1N6IA 2QPAA 2QORA 4Q5IA 3UMRA 3SBDA 3G82C 2GCPA 3QBVA 4GSYA 1G7RA 1D9ZA 3QF4A 4Q18A 4IEEA 2FFQA 3VU9A 1E2PA 3OEHA 2N46A 3K70D 4FD2A 1E9BA 2FOLA 5EZ5A 2BC9A 4BASA 4EPXA 1YRBA 1G7TA 1E2JA 4LK2A 2PT5A 2W0MA 3VMFA 1O87A 4P4TA 4TMKA 3LQRA 5FL3A 4DIEA 3Q5DA 3ND8A 1JR3E 5FUXA 3CR8A 3THXA 4Q9LA 3DZDA 1E9CA 4Q9JA 1S0UA 4Q48A 2O8BB 5E3HA 2J46A 5JRZA 1W0KA 1Z28A 4JBYA 4X8OA 1KY2A 2FGKA 2QEQA 5F2EA 1NL3A 1QBKC 2WV9A 3Q72A 4OQMA 3W8RA 1JJVA 6Q21A 1EFHA 4M2LA 3BERA 3NXSA 2IYYA 1E1RA 3P1JA 4RKFA 1UBCA 3AUYA 1GUAA 1XZQA 2QY9A 3MAAC 2ATXA 1ZD8A 1Z0AA 3ZGXA 1P2UA 5BQ5A 5CK4A 1G18A 3U3RA 2FSGA 5DSZA 2RGXA 3CRMA 3EW9A 2NQ2C 3VQTA 4HB4A 3EARA 1MO6A 1XU4A 4NH0A 1UJ2A 1XMIA 3BK7A 4LYAA 1ZCAA 4TYYA 4W5WA 2WWIA 3GFOA 1ANKA 3TUJC 2FEOA 3PFIA 1B23P 2CCJA 2V1XA 2ZJZA 2ZRDA 3TAHA 4PR0A 1RRCA 3OEEA 3IBYA 1VTKA 3BWDD 5D3MB 2BM1A 1G3QA 4QBHA 4EPRA 2GJAA 3ONWA 1XEXB 3Q7PA 3I92A 2ZR0A 4MGZR 2OO7A 2PZFA 2AD5A 1L8QA 2WMNB 1N5IA 3A1UA 1IXRC 3NH6A 4OI2A 4L8GA 3GP8A 2IC5A 4RSGA 4NDZA 3TSOA 3GLFA 1E2LA 2QAGA 3UWKA 4RCZA 1QVAA 3U5ZB 4HAWA 4IXMA 2ZS9A 1U94A 4OBEA 1Q12A 1HQCA 1I4LD 2CNWA 4NMMA 1UADA 3AKDA 2EWWA 1F2TA 4FMDF 2CVHA 4DVGA 3DZ8A 4LV6A 4UNQA 2ZXUA 1UKEA 3WHKA 1XXHE 2ZI9A 5AJXA 4WXPA 1G19A 2H5EA 2HV8A 3Q8XB 2BCJQ 2XZOA 2C2HA 1TF7A 2YWHA 2Z4RA 4F93B 4Q00A 3KXLA 3BH7A 2ZJAA 1E2DA 2IHBA 4XSHA 1YZNA 1TUEA 4C0SA 1XWIA 1GOTA 1YZGA 4CEJA 4Q21A 2Z4SA 3B78A 4Z1MA 4TLEA 5EQTA 1ZNZA 2VEDA 1NJFA 1JEDA 1LY1A 4M21A 1T0JB 2OFOA 3AB3A 3GJXC 2ODBA 2V54A 1Z2AA 3HU3A 1WF3A 1KK2A 4G5OA 1SVKA 2GCNA 4UXJA 1G17A 1PJRA 1JPNA 2VF8A 4M4SA 3B1XA 1R0YA 5JJIA 4QG7A 3BRWD 5HZHA 2BVNA 4TYPA 2W6JD 4KSBA 2BIFA 3A37A 3W9YA 1G3IA 1T3SA 3REGA 2VSFA 1KIMA 5F9FA 1XCGB 3QKTA 3OIYA 4CYMA 2ZJ5A 3UMFA 4ZKEA 2CLDX 1E98A 2QT1A 1U0JA 4KFTA 5C46F 1NSFA 4HAVA 3OIUA 4QOSA 2XOKD 3IDQA 4D81A 2A2ZA 2OHFA 5JFGA 4P4SA 4FCTA 1G5TA 3EPLA 4AI6A 521PA 4IOJA 1D2EA 3X2SA 1R0WA 1KI2A 1NIPA 4M1WA 1HYQA 1KGDA 1IN7A 3HPQA 2F1JA 5JMTA 1L2TA 2QMOA 2ZRBA 4MKFA 2R6CA 1FX0B 2OM2A 5AUPB 3B2EA 4GRAA 3KJHA 2EYQA 2DB3A 2ZANA 5FOUA 4RKEA 1OFHA 2NO6A 2A30A 1BO6A 4DLYA 3LVQE 3O8DA 5HE9A 2GAAA 4HAXA 2ZIAA 4WOPA 4B35A 3UK6A 4JLBA 2ZE7A 1ZU4A 3A1VA 3EZ9A 4AKEA 2EFDB 1P9NA 4AIIA 3W6OA 1G1MA 3FTQA 1XJCA 1SHKA 1A82A 1U9IC 4M1OA 2ZVQX 3ZD6A 3MWLA 2CCGA 4HZUB 4PPGA 1NVVR 1QHIA 1T3HA 2ZE5A 1ZMXA 3C14C 2WWHA 1EWRA 1M7HA 2O8BA 4AC9A 4KI0A 4PO1A 4V0MA 2GDJA 2G1JA 1G5PA 2J45A 5DI3B 2ZE6A 3K0AB 2DWQA 2G6BA 4ZV4A 4FMCF 3AGQA 2QMEA 5FBQB 1NLZA 1PLKA 1G8PA 4BFSA 1LF5A 2EFGA 3K0FA 2QMHA 2REBA 2XJ9A 1DADA 2F43A 2G0NA 1KAOA 3IEUA 4Z51A 3GEIA 3UKDA 2HT1A 1B0UA 1U8AA 4LJ7A 1S1CA 2FH5B 2DR3A 3W6PA 1WP9A 5K8UA 2VP4A 1KMQA 2ZRPA 4HUQB 1P73A 2RGNA 2EVWX 2PL3A 4Q7KA 2VIIA 3LXRA 5BN5A 3LXXA 2QZ4A 3IQWA 2RKOA 2WKRA 2O8FB 4W9MC 5D3MA 2GEUA 2QP9X 4UJ5A 2P5TB 2FG5A 4IW3B 2GKSA 4Q03A 4M0LA 1XEXA 4BECA 2P2LA 4BFYA 1KI4A 1J7KA 4C0KA 4WZ6A 4Q1CA 3QEJA 1K8RA 1OH8A 1NLYA 3B9PA 4IVPA 4U7DA 1H8HD 5CK5A 1KO8A 4HYYA 5EZ6B 2A78A 4ZI3A 1NIJA 4YLGA 1PUJA 3HU1A 2A5DA 3NBZC 2VP5A 4DSNA 4PQYA 2J0VA 4L15A 4L9WA 2GJ8A 2ZR7A 3AH8A 2WM9B 1OKKA 2IWRA 4TYNA 2A9KA 1G64A 5AJWA 4URVR 1OE0A 4AKHA 4PTLA 3CB4A 3PR1A 2DYKA 3TVDA 5FPTA 3EASA 4PFSA 4C7OB 3PEYA 4M9QA 4QJ5A 1WB9A 1Z07A 3G0HA 3IQXA 5KDOA 1ZJ6A 3MMPA 4C0LA 1FUKA 3CZPA 1SHZA 2VP0A 5BW8A 3AVQA 4KLZA 2D7DA 1F6BA 3TAUA 4E03A 1EFRA 3D6TB 1NBMA 4KO8A 4DJTA 2OLJA 3HWSA 3WRXC 5KYKA 3Q3JB 3PUYA 2N1BA 2ONJA 4BZQA 3E1SA 4OI0A 3NHBA 1OXVA 1V43A 3BORA 5GJCA 5JWRA 3EPKA 3LDAA 2ZUDA 5TB5A 4TT3D 4LOAA 4AG6A 4AKGA 5AK0A 4QGAA 1UPTA 1CULC 1GILA 1YE8A 2A5FA 2Q3FA 1XBTA 5A0FA 4EKDA 2BKEA 3RS4A 3OFND 1BMFA 2P6NA 3EAQA 1HUQA 1L7VC 1GNRA 2G83A 2WJYA 1SGWA 4JLAA 1A4RA 1AGPA 3X1DA 2G3YA 3FMOB 4URXR 4TLCA 2PCJA 3KKMA 2JJ1A 4OJKA 4CDGA 3TIFA 3DOEA 2IYSA 1TF5A 3C7KA 2YOFA 1UDXA 5EE5B 2RGDA 4A0RA 1GWNA 1XPOA 4E22A 4Q9IA 3LWNA 5BYJA 1DTSA 1DAKA 4NCNA 4TMZA 1OF1A 1FX0A 2EW1A 3DPUA 4R9UC 1K6MA 1AS0A 2V7QA 1Z83A 4MRVA 2QG6A 1KNXA 1T6NA 4M1SA 5FR2A 1VYVA 2KSQA 4CGZA 1G8FA 4Q1DA 1E0JA 2MMCA 5DHAA 2F3RA 2NPFA 1X6VA 1Z29A 2QM8A 2X77A 4MRNA 5G40A 3DO6A 1Z5ZA 3A36A 2IW3A 3FHOA 1QHGA 2CHQA 4ACBA 1E99A 1D6JA 2WOJA 1NKSA 1N6NA 2WKPA 4ITRC 3RRMA 1N2CE 3LW8A 4C3ZA 1GNQA 4OHVA 3I62A 4HZUA 3FPAA 5KDLA 3VKWA 4RCYA 1UKVY 2PLFA 3KTAA 4MKGA 4Q9KA 4TSFA 1CXZA 2BBOA 2OXCA 1W5TA 2RGEA 2QGNA 4B71A 2G77B 1T5LA 3F0TA 2F9MA 3KQUA 4PSAA 1CF4A 2VYFA 5DI3A 3GFTA 5EP1A 1P2SA 1QDEA 3QEOA 4OQFA 1AN0A 1J70A 5CJ2A 2CLSA 1UEJA 4PAQA 3IEVA 3SYNA 3ZZ0A 5CLLA 3WRYC 4W5JA 3LX5A 5HE8A 4US2R 3L8YA 1FFHA 3WHLA 3JVUA 3B13B 3RVBA 2CLCX 2QU8A 1NN1A 1E2NA 1QZXA 1Z6AA 3MGCA 1SKQA 3G5UA 3PENA 4MDEA 4ARZB 3EIQA 4JLVA 4ILEA 4M1TA 2ZUCA 3QPWA 1RZ3A 2QE7D 4TMTA 3J81k 4MYCA 2IXEA 4US0R 3RRYA 2JGNA 5JRJA 3C41J 1LB1B 1ZYUA 3T1QA 4PC7A 5TMPA 3MJHA 2GVZC 2VSXA 2KI5A 3DM9B 3MCAA 1ZNYA 3PUZA 3T5GA 1JNYA 2BM0A 3LQQA 4V03A 1KKMA 1IJFA 2IEZA 5BN3A 2ZPTX 1R10A 1EGAA 4D26A 2FZLA 2IUUA 3BXZA 1Y3AA 4II7A 1IY1A 4WA7A 2DFTA 3OAAD 1JEEA 4XIGS 4LHWA 1GL6A 3EZ7A 3C8UA 1E1QD 4B6FA 3AP3A 3MD0A 1JJ7A 3K53A 1D8TA 2NPIA 4A0GA 3R8FA 1RRFA 1R5NA 1N3BA 4JBXA 3ZLJA 1QVRA 3LLMA 3PJRA 2IWHA 1P72A 4NYJQ 1KI6B 1OFUX 3LW7A 1MKYA 1NJGA 3MWKA 3P4XA 3SFVA 4A92A 4BFZA 2J7KA 2RGBA 3FKQA 4C7OA 1NNEA 2AXPA 4ZDJA 3SZRA 1R7RA 3A4MA 1H8ED 2Q9CA 1ETUA 4D6PA 1OH5A 5CLQA 1GL7A 5JJKA 4XWOA 4TMVA 3LNCA 4LC0A 4FMBB 1KK1A 1OH7A 2I1VB 2Q3HA 1IN4A 1YZTA 4R98A 3CW2A 2H57A 4NBSA 4UNSA 2REOA 4HAYA 3VR5A 1CR0A 3O8CA 3CR7A 1X1RA 4JL6A 4CEIB 2R62A 3ZH9B 3TBKA 5JHHB 3VU9B 4EFLA 2FN4A 2ZI3A 3GD7A 3TR0A 1XTRA 1WXQA 2QP3A 3A4LA 2R2AA 3BE4A 4LJ6A 4G5GA 1Z8FA 1J90A 1I2MA 4CT5A 4A4DA 1T9HA 1SXJA 3QG5A 5EXPA 1RJ9A 2HCJB 5D3QA 3THXB 2ODEA 3K9GA 4JIMA 1OYWA 4KLNA 4EPVA 3KQKA 3KJEA 2W6ID 4DUGD 3A1WA 1CJMA 4YDHB 3MWJA 2HF9A 4HLCA 4MGKR 4NYMQ 4AYTA 5FL7D 5GVSA 5KSYA 4V02A 4MGIR 3FKSA 4QBIA 2ZRJA 3CH5A 1XD2A 1GL9B 4DT1B 2FFHA 4DLSA 3M4YA 4RD0A 3SU8A 2PMDA 1RPZA 1RYHA 3DVLA 1LV7A 3EXAA 4LRWA 4Q1FA 5HPYB 1KAGA 1PZNA 2QROA 3P32A 2GNOA 4M9SA 4V0OA 2J1LA 3QXSA 1XDBA 5ELXA 1D9XA 4MA4A 3EG5A 3E70C 3EIHA 5FPHA 4FW9A 2OT3B 4XWAA 1JXMA 2AL7A 2OE2A 1UBFA 2YV5A 4PC2A 1W0KD 2C5LA 4I81A 5UKDA 3EA5A 3KB1A 1QHSA 4GPTA 2LKDA 2Z0MA 4RZUA 3AF0A 3FMIA 2QQEA 5L3RA 1E1RD 3CZQA 3GLGE 2RGNC 1I4TD 3NEYA 3WBJA 4F4JA 1RKBA 1ZM7A 1ZW6A 3AVTA 5L8VA 4XWKA 4RFVA 2GAOA 2QUZA 3QXXA 3U7GA 1OJLA 5FUYA 1G8YA 4XVUA 5IK2A 4OHZA 4ARZA 5M04A 4QM6A 4NYIR 2JLQA 2B8TA 4AG5A 5JBQA 2OCAA 4EDHA 3GPLA 2IS2A 2ORIA 1RRPA 2ZJ8A 1SVMA 5FPKA 1OPXA 4TTRA 3TNFA 1NN3A 2G9NA 3TSWA 5FOSA 1VIAA 1H8EA 3I4LA 5L3VA 3O47A 5H8WA 4Q4HB 1VCMA 2JLZA 5K8LA 3LBHA 4MYHA 4OK3A 3L0OA 1KI7A 3TGPA 2V6IA 2ZYWX 3QVVA 4HLQB 1R5BA 4MRSA 3WY9A 1S96A 2G88A 2GK7A 1GDDA 1VMAA 1W47A 3PVSA 2GESA 5LBIA 5TY0A 3QENA 5FOXA 2C9YA 4UQOA 1IONA 1I2DA 5B57C 1IN8A 2CNWD 4Q7LA 3BD9A 2CE2X 5AR1A 1TMKA 721PA 2ZREA 5DNYB 3SEAA 3W8NA 1E9DA 1KDTA 1BOFA 1R2QA 3VR4A 2Z6VA 1IHUA 3RS7A 2D74A 4IXNA 4ABYA 4EIWA 3ZVLA 4DC9A 4HDOB 4LJAA 3UANA 2CCKA 4M1MA 3AP1A 1PLLA 1NG1A 2MSCB 5GADl 1U2RA 1E2EA 2BJVA 4QGHA 2PX3A 3OIWA 4KCGA 4URUR 3CRW1 1YZKA 2ERYA 3Q85A 2ZJOA 2CBZA 4Z1MD 3FOZA 3IBGA 3I61A 1FNMA 1OXTA 5K8TA
chains in the Genus database with same CATH superfamily
3K94A 4XWGA 5I4CA 2WU1A 4INAA 5JJCA 2Q9AA 4GLJA 3VGPA 3C5HA 4PFJA 4UVIA 2WWFA 3MJCA 4W8OA 3WWPA 1YASA 5FV7A 2FR8C 4UUBA 4ALJA 3SQNA 4IZOA 3K8YA 2PYDA 2OAP1 1NDUA 4N7BA 4GMDA 2C5FA 3MQ4A 3V4OA 5JBIA 1OPRA 4J8PA 1SXIA 3CVXA 3HI4A 5FLKA 2ZI6A 1B8PA 1HE8B 1VMKA 4MIOA 4MR9A 4QQRA 1H0SA 4Y7CA 1M5RA 1HFWA 3K32A 3H65A 2Z6AA 3Q4GA 4BY9E 5CT4A 1M6EX 5D86A 4UREA 1N2IA 4R2IA 3DLHA 3AQ4A 1C8LA 1G9TA 4LYYA 1SULA 2J3HA 3P2YA 1YQTA 1M7GA 4ZK6A 5H68A 2P8SA 4GD3Q 3PG5A 3NBAA 3FPHA 3PFWO 3H3XA 4ZMRA 4YUWA 3VU8A 1DJPA 1NZDA 1PL7A 1LZKA 2AJBA 1RAAA 2RGYA 4K9SA 4L72A 4MQ6A 4NU8X 3SICE 3RSLA 3B7GA 2CLMB 3F3KA 3I9LA 3GP5A 3H13A 3VSEA 4BKOA 1WG8A 4FCWA 5AK4A 4DQLA 5C1OA 5JS1A 2J6IA 4JLWA 3C5VA 3PZRA 2YY7A 4LJ9A 4OM7A 4I99A 2RHDA 1KH1A 1EZ4A 1VRCA 4S35A 4BNNA 3UV6A 1R0SA 1VL6A 3LPCA 4Y6PA 2ZYIA 4WINA 3V1TC 3K0FB 1W5AA 1MJFA 1Z3CA 2JKZA 1I7LA 4MR7B 2F43B 1F0KA 3RS9A 1KQFA 1Z63A 4C2TA 3I0MA 4TYMA 3BM5A 2GEFA 4NL4H 3TQHA 3V8NA 4B47A 5H9WA 1V26A 1Y5LA 2JI8A 2WFLA 4LYGA 3D4IA 1AA9A 3IQHX 2VLIA 2YHSA 4FCVA 4TV8A 3ZE6A 7ABPA 2BGJA 4MYRA 3VNUA 2I5PO 1I2BA 1KTVA 4AMBA 5C1DA 1XQWA 2ZUFA 1F8YA 3MJRA 2CSXA 2H5JA 1VKNA 3KOYA 1CRWG 1EJ2A 1LZLA 3CT6A 2WU3A 2Q5HA 5D3ZA 1PU2A 5SYNA 2JGKA 1R66A 2PZLA 1E3MA 3DTVD 1L4KA 1YK1A 3NWOA 4GQIA 4WV3A 4MKHA 3KJIA 1BX1A 1U3GA 2WF6A 3SZOA 3VBEA 4RM2A 5KWSA 3R9WA 2OTCA 7ADHA 4FEEA 1BVHA 3W2TA 1UBSB 2ID4A 2RH4A 3JATB 5BNIA 3SXUA 3EGXB 3GD5A 1WB4A 2HT6A 4FYIA 2K6GA 2YW9A 1LDGA 4DWOA 3CF4G 3OWXA 1H66A 3T4PA 2AJCA 4KKXB 4JT4A 3ZX4A 3DOIA 1G5IA 5H16A 1P1RA 3SLRA 3F71A 3FTFA 1ZLYA 2DAPA 4N8SA 2JC3A 3AUSA 2FWNA 5EVJA 3DAFA 4HWTA 1ZNXA 3N2KA 4UZEA 3PQCA 1S6YA 2LUOA 2C95A 1CUXA 5FWXB 1US8A 1DKLA 2JZNA 3FMVA 2C2WA 4YREA 4P3KA 3OPXA 1T9GR 3PXGA 5BSKA 2OHXA 1HMYA 5BO5A 1XPUA 3NHAA 3BWBA 5C8ZA 3IUSA 1AZTA 5KNBA 1K98A 3LUHA 4N8DA 5C32A 5TC4A 2DPYA 3KAQA 1FTQA 3THOA 1PEAA 1YIOA 4LV5B 3CV3A 1SBHA 2CK3A 1ZA2A 4BIMA 4M37A 5LQRA 1OIVA 4C6TB 3NKVA 3QITA 3A31A 2BKUA 2AGVA 4MW0A 4ZO8A 2DR0A 3TLYA 1WDMA 2R96A 4WK4B 3KSUA 2JJQA 2F00A 3HDVA 2BEVA 1LLDA 3WGQA 4O0LA 1ZY2A 5COQA 4ZXFA 2V0CA 2NUBA 4NCXA 1MGPA 4B4VA 3IVXA 3L1VA 3T1NA 1JZTA 3C16C 4PSVA 2FYTA 3PYLA 3FJ1A 4KBGA 1LFAA 5LA6B 3QXCA 4NU6A 1V6CA 1UOOA 3U0VA 3WZLA 1NF2A 1RQRA 2ZYVX 2ODTX 1CY2A 4OHOA 3VUFA 1TTTA 1PQYA 2HSJA 3R20A 1A8SA 5TXGA 4BRSA 2VDNB 4F96A 3DV9A 1EK1A 1XJWA 4BE7B 2CBXA 4Y2RA 1ZIPA 2HLDA 5E6RA 3KKNA 5FTNA 4M89A 3T1TA 3PCTA 1YB2A 3OZXA 1OHHA 1T3ZA 2Y1LA 2FW8A 3CRVA 5EQFA 4C5AA 1JU4A 2IBTA 2JIDA 3BB3A 3JWPA 3OD5A 3QKSB 1KFBB 2DU8A 4DPLA 2ZDGA 1C1YA 4DBLC 2DY1A 4TV9A 1VLQA 2QQ0A 1NW3A 3VPXA 3P4YA 4GDMA 4IIJA 4KAJA 1GAEO 1EGVB 2XYQA 3SEQA 1OB5A 2HSDA 1PS9A 3A2LA 3OM1A 4RKWA 3HGTA 1E77A 1LS6A 1E8NA 1NP7A 4U3JA 5E7JA 3C6ZA 1MJ5A 4JI5B 4P0TA 2RGCA 4V0NA 3R7WA 3E35A 4KQJA 3T7DA 4G9EA 4AJPA 5FDFA 3UWMA 2FSHA 1SQ5A 2VJOA 1BJTA 2A0YA 2X4DA 1KF0A 2ZU6A 2IF0A 1E1KA 1FXWA 2NUTA 4DLUA 3HQ4O 1S3SA 2HGSA 3P0HA 5CGZA 2FE4A 4D9EA 5DXAA 2IZZA 2WJ3A 3NTLA 3VZPA 2CWDA 2C03A 2PY6A 2SBTA 5EP2A 4BLSA 5F12A 2DKNA 4GMGA 2G5GX 4IH1A 3PUVA 4BS9A 4YAGA 1JHPA 1TM5E 5DTQA 1OFIA 2PWYA 3CURA 2J9YB 4BO4A 5EEGA 1DS6A 4KVFA 3IQZA 3NIBA 2UZAA 1G6HA 3HBJA 3QVWA 3KTAB 1R15A 5A1JA 1D8AA 3PJDA 2FW0A 1P4RA 4R2MA 5HF6A 4DA6A 3H2BA 1RI5A 3M9LA 1DO2A 3EEOA 1JECA 1N36B 3L07A 4FX5A 1JI0A 3OT4A 3BK1A 4LHYA 2YZNA 4R2XA 1BWRA 1XHFA 2QK4A 4OU4A 3U49A 1FPMA 2H48A 5M2QA 3QE4A 1A88A 4W5HA 4FHDA 1JAZA 1CEQA 1KVRA 2C4HA 3T95A 3HCCA 1XXHB 2XUOA 3SHWA 2VO1A 5DYNA 5AM5A 4IRUB 1XWFA 2D7CA 1LLCA 5C4MA 3AHDA 3CKMA 4JBLA 5K3DA 1HE5A 2L69A 2I71A 5AHRA 2ZJ2A 3AJRA 6GPBA 4ZJYA 4YRRA 3WK7A 4FPXA 1ZVQA 4MWCA 4OSEA 4Y6LA 5FEUA 1IHYA 3NVAA 1O7JA 4IINA 1WOMA 1JYEA 2NUAA 2GFIA 3E9QA 4I4TA 4K9MA 3PEEA 3I61A 5F3WB 2J87A 2Q3LA 3G13A 2Q1SA 2QI9F 2AG1A 4W8GA 5D00A 1ZXBA 5BOSB 5ADWA 2DBVO 1XMJA 1RHMA 4FD3A 4BJ3A 2CB9A 1HZZC 2D2FA 2PS1A 4B2LA 2R48A 3LHDA 1A9PA 2Z43A 3DULA 2TECE 3NATA 3P2EA 1LF0A 4HNRA 1ORWA 4I14A 4AXBA 4TSFD 3CLTC 5DHPA 4P0PB 1P2VA 4XLLA 3QSYA 4BOYA 4REOA 5JNSA 2DGDA 2JLWA 2YZ2A 3EBLA 1VYHA 1FFXA 3IALA 1Z3IX 4MH0R 1VHLA 4YV7A 4P2BA 4GLOA 4XIYA 3O94A 3TINA 1C1DA 4OJYA 4JX8A 3JWGA 1ZHFA 2X3UA 4QYIB 1D5CA 3K7EA 1YZFA 4GXTA 3BA6A 1NE2A 3BHMA 3DTNA 3BJZA 5L51A 1N2EA 1XAJA 2NV0A 1I0ZA 1XRPA 2CDNA 3M33A 4YJGB 3I5YA 2X19A 4RTQA 4ARIA 3IEKA 3JZMA 1Q3HA 1SU8A 1F8GA 3KR9A 2I4IA 5BSTA 5JTTA 5HM6A 4D9HA 4WQMA 2NTJA 1U11A 2LW7A 3AI7A 3DP7A 5K0BA 1TTHA 3ZWCA 3B9QA 3W90A 4NENB 1YRLA 1AXRA 3S44A 4RF4A 2HMWA 1RMTA 4OQNA 4Q16A 3E2IA 3BE5A 4P4UA 4KNWA 2B37A 2HLPA 1C29B 4R3WA 3G2JA 2PKYX 2VJKA 4ZOLF 1LDMA 4FIDA 3U4HA 1LRLA 2W2QA 4MWEA 4KXWA 4DCGA 1C2TA 4E09A 4ZI7A 5T6BA 4BP8A 4DB2A 2VH2A 2NU9B 5EIAA 4DW8A 1MOQA 5GMOA 3GW8A 2XKBA 2FUKA 3DAPA 1X8LA 4Q7JB 1QG0A 2CEAA 1BMTA 1OXKB 5TGTA 3ZVRA 2WSIA 1B8VA 1CUSA 2OECA 3EGOA 4N18A 4RD2A 3VNQA 2QZSA 3D8TA 3ET4A 2Y0PA 3I01A 4OO3A 1ZCBA 3DMTC 3LZ6A 1H3FA 2SECE 1K08A 4PCVA 5E95A 3RTEA 2H1SA 4C78A 4QNRA 1JR3A 2JIZA 2I99A 1G63A 3E27A 1HG1A 1NPDA 1KZ4A 1W48A 5DNAA 4C7JA 3PDIB 4KAFA 2A7QA 2PHZA 4R1MA 4D3ZA 4RZ2A 1E4VA 2FW1A 5GJWC 5HR5A 4DF3A 4KYUA 1V8ZA 5A5DA 2PMCA 4FDMA 1GPAA 1LSUA 1K97A 3FTCA 1WIWA 4GX5A 1BX3A 3O8BA 3NGLA 3VH2A 5C1PA 1R64A 4DLKA 3NT4A 1PV4A 5A3QA 3O6VA 1O9BA 1KBZA 3DEIA 2DR2A 3AG5A 1NXPA 4XFJA 3T61A 5L4LA 1QH9A 1WABA 1OWMA 2JLAA 2QLTA 1WTAA 1BKDR 5JSZA 4H3HB 2XF2A 1ZEMA 3EG9B 4ZYVA 3K15A 3UCFA 1NSYA 2WD8A 3LV8A 3A4IA 2L18A 4CTMA 2QMUA 1X0VA 1UM8A 2OENG 4FNAA 2AFIE 3OF2A 3A6HA 2O3TA 3MMZA 3T54A 3K1JA 1JVNA 1P1HA 2HNBA 2FMIA 2AK2A 2CXXA 2XDAA 2ZETA 3FSGD 2J3KA 3GEMA 5AJZA 5AVUA 1PVVA 4M36A 3VR5D 4BCDA 3G7UA 1SURA 2JCBA 3FN4A 4UNNA 3WBKA 2I6TA 1T2AA 7REQB 1E3WA 2ZKLA 1GQ2A 3DZKA 4RHYA 3ZU6A 1NFRA 4R8LA 1YV9A 4YB8A 4X94A 4BN0A 1MZPA 1Z74A 3BWMA 2BF4A 2KJQA 4RCVA 4OATA 5JZVA 1ZX1A 3AHIA 3IPLA 3ZXXA 4ER0A 1PL6A 2WPDA 4MUMA 1KR5A 1D5WA 1ZKMA 1NMYA 4N7JA 1KBQA 3E0QA 5EGSA 2W2KB 3DVRX 3K31A 4JBWA 4DCMA 5AFSA 1U8YA 1ZDMA 1CEXA 1MFZA 2NNWB 4JLMA 4MUAA 4Z4CA 2E48A 4HDQB 1EFDN 2JAOA 3NT5A 3BHNA 5CFZA 5FOQA 3GK3A 1EX9A 2PKQP 3LRTA 2JD1A 5EP3A 1UZLA 3DFIA 1CUBA 1YL6A 5I5GA 3PHLA 4EZEA 3MJSA 3SKXA 1UWCA 2GZ2A 2C77A 2NO0A 2QLLA 5GONB 3TM4A 1EFPB 1O89A 1XJQA 2R5NA 4YRIA 1QLWA 1FDWA 4WZBE 1DEXA 4B3XA 4DM4A 4ZCPA 4MV1A 3H2SA 4F2DA 3IB6A 2ATEA 2HB6A 4QL3A 1IXSB 1KO1A 1NAHA 2AC2A 1TK2A 1WU8A 3CJQA 3H9UA 3NIWA 4YRSA 2I4LA 3Q0IA 4O2BB 4KVZA 5AKGA 5I4IA 3WKCA 1XMXA 3DNMA 2K2QB 3EXFA 3V1MA 1RU3A 4PVCA 1QZUA 3KKZA 4FZ3A 4EKEA 2PSSA 3WVNA 4C76A 4HQLA 1UJBA 2H9IA 3BWEA 3IHWA 3JALB 5HKKD 2C7OA 2ZQ5A 1CY4A 2PMFA 2FZWA 2GN4A 4L9SA 3LX8A 4UXHA 1DOAA 2GBLC 1UJCA 5EJEA 2DBRA 1HNXB 1FPQA 1T1GA 3HHEA 3CNNA 4QM7A 1CZHA 2BHTA 4YPVA 2IUSA 3NC0C 3WGLA 5ARCA 3KDAA 4I5IA 2ZUVA 3EWAA 1FQJA 3FWZA 2BGUA 1AB6A 3FWPA 3TCXB 4DR1B 2PUBA 2EATA 1L1FA 1R4NA 1PG2A 2BFDB 1BS2A 5MGNA 3MWGA 2BY4A 3IULA 2IF2A 4BMNA 3CLTD 5I9BA 5TPWB 4BBPA 1BH2A 2ZJBA 3C24A 3QLEA 4GS5A 5I7SA 2MYTA 3NHMA 4NDAA 4MCHA 2NWQA 3LL4A 4B5LA 1TIBA 1YZHA 3GEBA 3K09A 4JUDX 5AUNB 1XZCA 1C3XA 1F0YA 3UAOA 4WZAE 2EX0A 4E5SA 1SWVA 5IK2D 1LRKA 3BWYA 3EMDA 3QFFA 3F9IA 3PCRB 2XT6A 3TEMA 5D5QA 3ZK8A 1YS4A 4DXHA 3E7PA 1G21B 3W2GA 3UB4A 1U0BB 1YE3A 2WJIA 1BGVA 3P2OA 1E8MA 4ZT5A 2AI2A 2G6TA 3OQNA 3TZ6A 3AVWA 3KQPA 3BFPA 1XTKA 2V6BA 1UKZA 3QIVA 1O95A 1XTBA 1YRQA 2ZB2A 3D7MA 1B74A 3RJMA 3U7HB 3KU4A 2GLXA 2IYUA 1NXVA 2JCGA 4HQRA 1C0IA 3FUXA 5LNK1 3Q8LA 2H1CA 6ADHA 4N47A 3DLBA 3NTOA 1RRMA 1ZD9A 4OA8A 2EV9A 2X3YA 2D1QA 2CJWB 4MAFA 2BE7A 1LK5A 2JKYA 2P62A 1XQXA 2QTBA 2Y93A 3I42A 4OSOA 4M7OA 1HSZA 4IJ6A 4IDNA 3J80A 2FDRA 1TGVA 1Y9AA 2QTVA 1FS6A 1JDUA 1PDWA 1ORDA 1NKTA 1SAYA 4EMSA 2GDZA 5J47A 4B46A 3VZCA 4EGSA 1G4UR 1N2ZA 1WSDA 4IDGA 5IM5A 2D1FA 2LV8A 5FBZA 1N8TA 2I3ZA 5ALQA 1KJWA 4HQFA 3DFUA 4QJBA 1S9DA 2P67A 4PZLA 2RCYA 3K70C 1H2FA 1NKVA 4NRDA 5EC8A 3V8RA 5DN6A 4BLUA 3ZD7A 4PWZA 1XALA 4NG4A 3F7MA 3ELYA 4D8WA 1QHHA 4K3UA 1OR8A 1WA5A 3ACCA 4TLAA 2MR6A 2Q3EA 3JCZA 4NE2A 2QUBA 4BX9A 2WK1A 3MFYA 2O8NA 5EE3A 2OOSA 2YVQA 4PQRA 4N9WA 1PEKE 1N5LA 3L43A 1IPFA 4KIGA 3WKDA 4RWZA 4C4SA 3IBCA 5KCZA 4TKZA 1DTWA 1EMDA 1H2ZA 4QPCA 1HDEA 3IH5A 3GLIB 1SXPA 2C20A 2FQ1A 3DOOA 3PHHA 4GZLA 1YL7A 1B0AA 3OE1A 3BMXA 4DHEA 3G0IA 4E1BA 1UXOA 3DEFA 4EARA 3QMMA 2C8LA 4NQRA 4CF5A 1HEIA 1J0BA 3G2KA 3Q3EA 1UZNA 1VJCA 1L6IA 4DG9A 2YVKA 4WJKB 1BYIA 1PR6A 1RHUA 4LDRA 4X92A 5FEMA 1L4NA 4L9AA 4IDPA 2QM7A 4UBKA 2Q4RA 2YDYA 4G5FA 2ZJ4A 2TRSB 3B6MA 4H1TA 4QDKA 3DP9A 3CUEF 4PHGA 2M6SA 2R6FA 4DFDA 5KWIA 2PL5A 1YA8A 4TGLA 3ZIAA 3IPAA 1WX1A 3DDHA 1K1EA 4ENWA 2PMKA 3A3KA 1JR2A 2DY0A 4X1YB 4XQEA 5B1HA 4MUBA 1L3BA 1I1OA 3SXUB 5BMVB 3I3OA 4H31A 3R44A 1DC5A 1G7SA 1NT4A 2QW8A 4RIFA 3D4PA 5DGIA 4EPTA 1ZU5A 3SP1A 4KUHA 1WV0A 1XC7A 4R1UA 3IPYA 2WIAA 3BGOS 4R6XA 1U2GC 1UFVA 1SC1A 3AGPA 1E59A 1ODIA 1O5TA 2E87A 3GZNA 4IH4A 3K0SA 5I7VA 5I7RA 4HXGA 1D4ZA 3LIIA 4UMFA 2GRUA 5J5CA 1CUWA 4E4YA 3N2KB 3P9YA 5HTKA 3R9XA 4JYAB 1OCEA 3K35A 1W44A 1US8B 1A1VA 4EEXA 4BMSA 3C1AA 3JARA 5FBWB 2WSSA 2L0XA 1P7PA 1SEVA 3SR3A 3JYHA 1MC8A 1P5JA 1DI0A 3TW4A 1WZUA 1OD6A 2HNAA 3OY2A 2H4ZA 1DRUA 4AS1A 1T0PA 1W46A 3GG9A 1EXDA 1WCV1 3EPHA 1ZSNA 3CUWA 3GJRA 3EXG1 4M54A 1ECCA 2P2YA 2EJTA 2EFHB 2JK1A 2F67A 2XE7A 1G8AA 2A7XA 2BEVB 2ZYTX 1ZCFA 3CNQS 3ND7A 3OFVA 4BGIA 1HA3A 1MNAA 1LC3A 1NURA 3H4VA 4HKTA 2AB0A 3KXDA 1O3YA 2XRFA 4ZRDA 3FZEA 3ZU3A 5BSVA 4RVNA 3W6NA 3ZXIA 4PZ9A 1IZ7A 1BNCA 1OT5A 1WMBA 3FUUA 3IIJA 2P9GA 4Q4JA 3L8ZA 4Q1AA 1JKJA 1QMPA 1Z0IA 2CVOA 3PEUA 3QGMA 4H0FA 4BEJA 3SC6A 4DEXA 2PUWA 2MYNA 3C0KA 4LXIA 1CZLA 3TE7A 4MI1A 3I34X 2GK6A 4GAEA 3OT5A 4IJVA 5E9WA 3TQIA 4C0XA 3ICVA 3F6BX 1Z73A 1MENA 4HUJA 4QT0A 4AJ2A 4HVLA 1CJCA 2MSDB 4JXKA 4POAA 2WWYA 4ZTZB 1N0UA 3F96A 4NATA 4R1OA 1ZVVA 2AR7A 1KK3A 3UATA 3BXXA 5KNBD 5IRCD 1JJAA 1QV9A 4TV9B 1RAHA 3IL2A 5EJGA 2CK3D 1MAHA 3JAKB 2ZXEA 1NY5A 1U8UA 3DBIA 2NZUG 1EFTA 5B6JA 4OHPA 3ZQJA 2H3EA 1WO8A 2AOTB 2HSZA 4U3JB 2RK3A 3K70B 1I94B 1CDOA 2Y76A 1W1UA 5TIIA 3G0DA 3NTUA 1M2NA 1ZAKA 3WDMA 5JXIA 2IYXA 5JWOA 1NUPA 2XCLA 5IF9A 1P9WA 2ZI4A 1YJQA 5HIJA 2QX8A 3SZLA 1K5PA 1IOWA 1XQVA 2B61A 2IEAA 2C42A 1X13A 2YICA 1PYOA 3M6XA 2AG5A 3NEPX 4TKVB 1S02A 1XNGA 7AT1A 1Z47A 1O6GA 3NWEA 3KQOA 3BH6A 3DMRA 3M5WA 4UCWA 4A0GA 3DHNA 4NBTA 1DKPA 2HLDD 4E5YA 3BZWA 2F48A 4CV2A 1O0BA 1GFZA 3B89A 1JYSA 1OHHD 4HDSA 4PZUA 3B3JA 4PYQA 4W4TA 2DP4E 3K0HA 3ZZMA 1KMHA 2XXJA 1TQDA 1QYIA 1SN7A 1QK3A 3GC6A 3STUA 3Q5EA 2R65A 2HMVA 5FKJA 2FPXA 2QRKA 2HIHA 1USGA 4EG3A 9ABPA 1IAVA 1SOWA 3N1UA 1NBME 2CKMA 4OBBA 2FPPA 3K0EA 1VC2A 1YOVA 2RI6A 3GMSA 4C3UA 2C9ZA 3FETA 3QX8A 1DWQA 3VPDA 2GKGA 3ED1A 3RSGA 2OFFA 1S9HA 4NV0A 2P0EA 4IVRA 3CC8A 5IMSA 4QGGA 5AHWA 1XDWA 4JAVC 3DO8A 3FSEA 1CZRA 1T6ZA 5EMNA 5CDYA 4L5BA 3CBGA 1OJ7A 5DNWA 1HM5A 4PLWA 2WF8A 4I50A 2X2OA 4ER7A 3NDRA 2FZCA 4X8LA 5REQB 1Y4UA 1G291 3ANSA 3PX7A 2WLSA 4IHKA 5J4KA 2M98A 1U3CA 5LDDC 5EMHA 1NNLA 2FJ0A 1XL0A 2BCGY 4OKIA 1NFQA 4C2BA 4MV8A 4D57A 4B8YA 1H4QA 4M6WB 4I9HA 3BJIC 4V39A 2LWIA 1XI2A 3N3AC 4GC9A 2BEUB 3GJ3A 4MHTA 2D1YA 1HFJA 5C1IA 2QGZA 3VISA 3BGWA 4BC0A 4DMCA 4DWJA 1UPUA 3IBSA 4ALNA 3SC3A 5AVVA 1QGOA 4JI6B 1KO7A 3KVRA 1C0PA 1C9YA 3UENA 4BVFA 5C35A 1LNZA 1E0KA 2G1KA 4CMJA 3U3OA 4AFNA 1U04A 4OTZA 3QI7A 1BX0A 1HDOA 3IE0A 1L7AA 2WIDA 3LY7A 1XP5A 1U80A 1W73A 2Q0QA 1P0CA 1SZJG 3UT0A 4CMIB 5KOHB 2PT9A 3EZLA 1T5SA 1G2QA 1TGYA 2FRDC 3PRKE 2AR0A 4OM8A 3N53A 4P33A 3U1TA 1UT5A 4IS3A 4YH1A 1JPVA 2F17A 1FFEA 1MG5A 3V3TA 3COWA 4A73A 5A0VA 1RJGA 4IIJF 2R6GA 2Q4TA 4HTFA 3SN6A 3ZNQA 4WZZA 5IBRA 4NCAA 5CX4A 1T29A 4IX9A 3P5SA 2OKGA 2X2FA 5TRTA 2GPYA 2Q8QA 3DAGA 1FYXA 4P93A 4A0FA 4BEBA 4D42A 1NE7A 2A94A 4PO8A 5LXTA 5LDGA 2DKOA 5TMBA 1A8PA 1L5SA 1KJJA 3R0ZA 3U44A 3DE4X 3TD9A 3L0ZA 4NNPA 3CVVA 2QNBA 5IAKA 1TRKA 2OOKA 5JO9A 4RY2A 2EFCB 2AUTA 4IHJA 4BMCA 1AC5A 1VMIA 3GAFA 3O1HB 4U6SA 4N0MA 3ETEA 3FFWA 4PLHA 4EB6A 1HR0B 4BPBA 1A71A 1N25A 1T5IA 3GVCA 3LQKA 3WYBA 3ZBTA 5I47A 4TTPA 1QGUA 4GP9A 1Z0SA 4LSGA 5C7LO 2IHUA 4DUZB 1MB2A 1N2HA 1EDZA 3CNHA 3FTEA 3RFTA 3ENKA 4YMUA 3OQIA 1FDIA 1QUFA 4IOKA 2IBMA 4F97A 5IDXA 1KO4A 4Y1RA 3P9IA 2GTPA 4CM5A 4BWYA 1JU3A 5SZJA 3HJGA 5M5BA 5MN6A 1M74A 2BKAA 3NRCA 3P9SA 4DL9A 3INGA 3VHXA 3HDQA 5JAQA 3QX9A 4PNEA 3OIFA 1Z7WA 2ZU0C 3GY0A 4M1YA 5THXA 1WXHA 3QFCA 2VVTA 3SBOA 4Q9AA 5AI8A 4QNMA 1YFKA 1TU3A 5DNVA 2EKPA 2J7PA 5BRNA 2G82A 4L5JA 3TVYA 3ZNPA 3N2IA 4JITA 3ZLBA 4AG3A 5KYGA 1XCPA 3EVAA 1MVNA 4HFRA 3VU0A 4E51A 4MXDA 5AHKA 4J0JA 3K9CA 5JAPA 2GN6A 4Q01A 4NE9A 3ANMA 2HUPA 3G49A 4L3OA 4YP0A 3WLHA 1QZ3A 4W7SA 5BVHB 3T9EA 1JBKA 3DEJA 3WK4A 2VDKB 4TL6A 2B98A 3IMGA 4LWQA 2ID8A 4X24A 1V25A 1T6BY 4NQZA 5E8JA 3TAXA 3ZV5A 5J2UF 1H6DA 3G2IA 4XD2A 3WZ2A 3WWCA 5IBPA 4AZVA 1Y37A 1GEEA 5IAJA 2QRNA 4Z5XA 1E2HA 3Q1LA 5EUMA 4I4TF 5IKOA 5BV2P 2V03A 3IKMB 5KC9A 2Z8ZA 4ZPXA 1PX0A 1QFZA 1VI6A 4U4AA 5TARA 1ZUNA 4YFVA 1JQ5A 2XXAA 1R9GA 3E22A 1RDFA 2G76A 3O3OB 3L4EA 2I6FA 1U7ZA 4G8CA 4I5DA 2AMJA 4KQWA 3A0RB 4LY9A 5HIMA 3HO1A 4YDQA 3WP0A 1GJRA 1AA6A 4RGQA 5EZQA 2COUA 4AJJA 4RE6A 1F8XA 5JECA 1MLDA 2O8CB 3CO5A 3I8SA 2HBYA 1ATIA 2YN4A 3UC5A 4FHGA 2ZRAA 3HV0A 2AXEA 3P52A 5GGYA 4UTOA 3QYJA 1E3SA 1G3MA 1ND6A 3C3MA 3EVBA 1JR3D 1ESNA 4G01B 4BGDA 3Q40A 2OQIA 4OGLA 1OI4A 1S4QA 3LF1A 2GXUA 5F64A 1PUXA 2BEWB 3C8ZA 4JBGA 3RU7A 4D74A 4RTJA 4LOIA 2V9CA 3LUCA 5CBKA 5JZMA 2E55A 4WBNB 3GRUA 1SCKA 3LWZA 3JTEA 1II8A 4WXMA 1E6KA 1TUBA 4BJ1A 3TGWA 4LF5B 3CPJB 1E1DA 1OV4A 3IXLA 4FLEA 3RHSA 3TCNA 3TTXA 2BFMA 4EFMA 4AZ0A 1ZRHA 2N42A 5EE9A 4DZRA 3ENQA 1FXUA 5CT5A 4ZQEA 2R6HA 2OORA 1SZCA 3BL6A 1GZ6A 3N2YA 1VBFA 4LJ7A 3GLSA 3N2LA 2GEDA 4WLOA 1JHDA 4C1NA 1RRGA 2I91A 1W9MA 2ZUWA 4RWEA 2V9PA 4U39A 2WJHA 3UWDA 4C06A 5JPDA 2A58A 4P83A 1LBHA 2YZMA 5ELMA 3VDXA 2DZDA 2MSKA 2IYLD 1C1HA 3K5WA 3ZHUA 1QVWA 4WOCA 3FHCB 4CKWB 4JEHA 1E0SA 2O2DA 4F5YA 1CR1A 3PBKA 3TRIA 1GPUA 5A5EA 2XECA 3VH1A 3RVOA 4YXFA 3DE3X 3TW0A 1Z0ZA 5DLYA 3GZTB 4OBXA 4YCDA 1GYQA 3C3EA 1SXJE 3EXFB 2YINC 3PNMA 1KZHA 5HP4A 2WHEA 3BJRA 3U62A 1IHOA 4NJEB 3QF7A 5A0TA 4RV4A 1FRNA 3R3VA 1OLSB 4Q3BA 1A72A 4KGDA 2WHPB 3DE6X 3K0BA 2EERA 2I29A 4UBOA 5ALFA 1XNHA 3RW9A 4YEDA 4EFDA 5H4GA 1GCOA 1EVIA 1CZNA 4U7HA 3DCIA 2B2NA 4NNJA 1JDZA 1ITZA 4O29A 4RF5A 1XZAA 2VJPA 1E2QA 2LKCA 3BMNB 2P35A 4P6VF 5FADA 5B53A 5JH7A 2FU5C 1TC1A 1PNVA 2ZUTA 3QEAZ 1XZPA 2ACVA 4RLHA 5A5GA 1QH0A 3U6KA 1PK8A 1R4NB 4FXPA 4NBLA 2XD9A 4CUKA 1MT0A 4EH1A 3I3SR 3CIOA 3Q15C 4GRDA 4AK9A 4LDPA 5KHOC 4F4DA 3E1KA 2HNKA 2O7RA 4HZGA 5EWLA 5ED0A 4RKRA 3UK2A 5SY4A 1ODKA 5L3QB 4NJMA 1G8HA 4M3NA 1GZUA 4ZYTA 3IQIX 4OAQA 4CQMA 3UK1A 4X6XA 4NCHA 4QBTA 5E4JA 5HJ5A 4LF4B 1XTIA 3FPFA 3ZKWA 1ZN2A 2AG6A 3BVPA 4ZV9A 3LUGA 3EZ6A 3H9JA 2CL0X 3GCGA 2JBAA 4EHLA 5KPJA 4C7KA 1RQXA 3PTAA 1RXWA 1L7PA 1YDHA 1WVMA 4RJIA 4V0QA 4ARVA 5JCXA 5JV5A 1BDHA 2P6RA 1OC2A 2YYZA 1ZI8A 2Z1DA 1A9ZA 1PR9A 4C07A 2FPIB 5CVJA 3FCUB 4E13A 3AINA 2UXDB 1SQ0A 4G0ZA 2XTNA 4H1HA 4A82A 4PO9A 4DQ0A 4DJEC 1XPJA 3S2UA 4XOIA 1E2BA 1E3IA 2E4VA 2QJFA 1EZ1A 3QOFA 5CH8A 2PPLA 4R83A 4EHDA 1F4LA 4HUTA 1EYZA 2QPTA 3ZD8A 1N7JA 2DFDA 5EUQB 2RGRA 3AY7A 1TAQA 1K92A 3RSOA 2CV0A 2POCA 4HX5A 5TT0A 2NVWA 4LDNA 4C7BA 3GJ5A 2HZBA 2GYVA 3CU5A 1LBEA 1RQPA 4KIWA 5DLQC 2C78A 3SEFA 3HJNA 3OICA 1Q0UA 5A9TA 2H8KA 4G5YA 3USZA 2BSAA 4GLLA 4DXDA 3D9QX 4DCSA 1T3TA 4AX8A 4X44A 3LWBA 3I5XA 1X3LA 5CNMA 4EOGA 1ZXXA 2Q3CA 2EQ5A 3EFHA 1RRVA 2W2NA 5B7PA 5CEJA 4E46A 1E96A 3LO5A 2BDEA 3DDCA 3OQPA 4XUCA 4RTKA 3B48A 1LLUA 2WM3A 4PYOA 2O5CA 2PA0A 3TJZA 1YQ9A 2BGNA 3KWJA 4K9DA 5AVJA 1DBIA 3RR2A 4Q1EA 1LPPA 3HYTA 1EVYA 1MOSA 3SQXA 1Z7GA 3DUFA 2QLFA 1FFCA 4WESA 3VSAA 1SQGA 3FYUA 1KQPA 4LKOA 1UBTS 5BR8B 4ZGBA 5TMDA 4GR4A 1NVXQ 3NPMA 1HEUA 4B87A 1VM6A 2APJA 3LSYA 3OCWA 5K03A 3SQDA 1KOGA 3B6ZA 3OE5A 2O3UA 5KTPA 4XASA 3IIKA 2DECA 3DNFA 3RS2A 3IS3A 1FZTA 1E4EB 1E7YA 2A92A 3ZDBA 3BILA 1UJ5A 3U13A 1XVAA 1K7XB 1CKEA 5DWDA 4RK1A 5TQ2A 3KSBC 4NHEA 5GP1A 1M2EA 2IYTA 4MNTA 3SHFA 1YQQA 1P31A 5LNK6 5LUAA 2FEWB 3H17A 1Z0FA 3UUFA 2J5XA 2I62A 4KFSA 4J29A 4YXWD 2O2SA 2PZKA 1EPUA 1K75A 2BFBA 1YBFA 1TKBA 3AIOA 3HY3A 4KNVA 3D6AA 2OCBA 3SWWA 1URPA 2PRZA 3EJWA 2CF5A 2Q3BA 1THGA 5G3ZA 1P1FA 4E7OA 1W88A 2PYIA 1X7WA 3H1EA 1E5XA 5LZ4A 1AVTA 2BI4A 1GU0A 4CHGA 2QSYA 4EJ6A 2QN9A 3H2ZA 1CUAA 2YL2A 2ZS7A 3ZYZA 1GO2A 4ND5A 2OR3A 4R84A 1FYWA 2J5KA 4EG0A 5DN6D 1LDEA 1BA3A 1U6IA 5SZHB 4BB6A 5DM70 2JEOA 3ER9A 2DWOA 1ZGBA 1QTIA 3NHUA 5AKKA 1M9NA 3LPLA 1TK9A 3RAPR 1FX1A 2DTDA 2VAXA 1BFKA 1XU7A 2XVYA 3O1JC 1B1CA 5E9JA 5I3CA 1U1EA 2HCBA 5LPNA 2EIHA 4ZREA 1Q3KA 4J76A 2H2IA 3GZNB 1UMDB 4EHAA 3QVGB 2WILA 4MW2A 2OSVA 5A62A 4P1ZA 4IQGA 4XGNA 1INLA 1E9FA 5D7BA 5JCPA 4KPEC 4W5QA 4ZGGA 1P7YA 5WRFA 2ODWA 3KJGA 4CL0A 3I2YX 1EXMA 3GHHA 4UTPA 5CB4A 2BFOA 4WFJA 3N70A 3T7AA 2W90A 4KWIA 1DPGA 3ZV6A 1ILEA 1LU9A 3B52X 3RSZA 5AVWA 2EF0A 1WEHA 1FYEA 3IQGX 3VO1A 2JIOA 4YIHA 4IIUA 1CUFA 2DHRA 2VJNA 1FL9A 2CNDA 3NBQA 1Y4ZA 3FOCA 2WG0A 1VE1A 1ZC3A 4LECA 4YRJA 2PLWA 4PX9A 4NG5A 5B36A 3HVKA 2JGIA 5GY7A 1NZJA 4BMVA 2IYFA 5G53C 2VK1A 1JKMA 2Q4OA 3D8NA 3N2ZB 1P1JA 1J6UA 5AKLA 5AKZA 1YS7A 4C14A 1NOIA 1PHPA 2X5JO 3HB5X 1QQ7A 3QUCA 4IICA 1XF1A 4WD3A 3TXYA 4B6GA 1GGNA 1P81A 4YGYA 4DCVA 2V4MA 5CNJA 2BGIA 4O02B 3W2IA 1GKUB 5KQSA 3U80A 4BMZA 3THYB 1EUZA 2BHNA 2CVFA 2IVFA 3NM4A 4DADA 5C8VA 4P4LA 2ZJYA 4AKSA 5KWEA 2ZRCA 5JI3E 2JGAA 3FOEC 1Z2OX 4HEA6 3IEMA 1Z2EA 3NEJA 2EGHA 2PSEA 3DSRA 3I83A 4D8TA 5IYZA 3SS9X 3EULA 1CTQA 4PRYA 1T15A 8OHMA 1GU7A 2OV6A 3JQPA 4KUGA 1T9CA 3NIGB 1EB9A 4ABTA 5J4YA 4PHHA 3TL3A 3DFZA 3RC3A 5L4SA 2WSSD 4P3OA 5AKJA 5IC6A 1AU9A 3D4LA 1L4YA 4Z3KA 5INTA 3I2IA 5JSFA 3UWSA 4F84A 2GZSA 4Q24A 1OXBB 3HPRA 5KO2A 1CFJA 1REQA 2IYQA 4LNUA 4OYYA 5TQ0A 4TT3A 3R41A 1HPLA 5CA0A 4YAFA 3TLXA 3U1BA 1J8MF 2W2TA 3DOHA 4UD2A 1PBTA 4PGFA 4F4IA 1U2PA 3ONFA 1PKXA 3ADPA 3MRXA 1K9VF 4AWAA 4Y2YA 1JA1A 1A9QA 3H11A 3GROA 1UBHS 4TVOA 2GH1A 2GTHA 1MR3F 3EWNA 1L5HA 1LWOA 4HQ6A 4JMPA 3ROEA 2E49A 1VB5A