4KU4A

Crystal structure of a ras-like protein from cryphonectria parasitica in complex with gdp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
189
structure length
171
Chain Sequence
AGKITDKIAMLGEGGVGKTSLTVNLTKHVFSETYDPTLEDSYRRQCVIDGIPSHLEILDTAGALREQWIRQNELFVIVFDVTRRSSFEAAERLFEEVIQTKRKLDEPFAPSLVVLVGNKCDLDTRREVGTLEGSSLAKKLGCGFVETSAKLGTNVEEAFFSVVRADRRRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-3 from Cryphonectria parasitica
publication title Crystal Structure of a Ras-like Protein from Cryphonectria parasitica in Complex with GDP
rcsb
source organism Cryphonectria parasitica
molecule tags Signaling protein
total genus 61
structure length 171
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ku4A00
3L2OB 2JCSA 4TLAA 4TQUS 4MYTA 5DE3A 4JJZA 1MOZA 4HAUA 3EZ7A 4DEXA 2QG6A 4UXHA 5BYJA 4W5HA 4MUAA 3GLFA 3BH0A 2ZANA 4PC6A 5HE8A 2V9PA 5JRJA 3GJ8A 4TMXA 3H4MA 4C30A 1US8B 3Q85A 4FMCB 1S8FA 1XTSA 3SR0A 1IXRC 5FBVB 2ZJ5A 1P61B 3A1TA 2GWHA 4O0MA 4NBSA 4HATA 5AJZA 3KXIA 2OT3B 4LY6A 4AKEA 2GNOA 1XDBA 2CK3D 1SXJB 4KFTA 4I1UA 4Q47A 4I4LA 2QMOA 2PEYA 3C15C 3B82A 1VYTA 1HH4A 3A4MA 4UXJA 1NN0A 4ZCLA 5CDFA 4Q7KA 2EW1A 2XX3A 3UMSA 2A5JA 2WMOB 1QVAA 1EG7A 1ZM4A 3A1WA 3E2IA 4LHZA 1UBGA 2QZ4A 1TEVA 2EFGA 4MGZR 3S1AB 3PJRA 2OBNA 1NIJA 3K53A 2CMKA 3B60A 1X1RA 4DVGA 1J90A 4DJTA 1CF4A 1S96A 2FF7A 1TQ6A 4L16A 4O2LA 4Q1AA 1IN5A 1U8AA 2HF8A 2Q6TA 1S4QA 3DKPA 3BFKA 4ZV4A 1B23P 3LY5A 2NO6A 4XVRA 4JT4A 4F38A 1GIAA 2W2XA 1KO1A 5J5CA 1DO2A 2HCJB 2IYXA 3D6TB 3EPLA 4QXAA 1ETUA 4IEEA 1KNQA 3IEUA 4OQNA 4HB4A 1XJCA 3IO3A 2QT0A 2QE7D 2O5VA 1JJVA 4B3DA 2QAGB 2WM9B 5F9FA 2NTYC 5EXPA 2DFLA 3ETLA 5CYPA 2W2TA 3R9WA 1P5ZB 1C9KA 4FXPA 4KITB 1Z0DA 4HI0E 3IGFA 1RJ9B 1GUAA 1Z0IA 2C99A 2RGXA 3QOFA 1OFTA 2IYZA 4BFYA 3QBTA 4C7OB 2DWQA 4NDZA 2CK3A 2ZR0A 1KIMA 1NN3A 2GKSA 1OB5A 2O8FB 3C5HA 5EXTA 4QOSA 4B33A 1OIVA 5LB2A 3ZH9B 4GZMA 1UBFA 2JLUA 2WVJA 4KJZA 2B7BA 4KAXA 1U98A 4B6FA 4RSGA 2PMKA 2R44A 5L3SB 1GWNA 3U6BA 2QSZA 2DWPA 1FQKA 3K0CA 3LA6A 1R4AA 3Q72A 4JLKA 4H1VA 4ILEA 1IY1A 1TUIA 2ZRLA 2GJ9A 3QJYA 2RGEA 3QF4B 1E32A 1OKKD 2ZI3A 4OHXA 3L0PA 3WP0A 5SZKB 2P6NA 1BS1A 1Z83A 1QDEA 5CK4A 4D82A 1NY6A 2IYUA 3MMPA 4TLDA 1ZUHA 2L0XA 1RW4A 5FTLA 5JZVA 3FPAA 1S3SA 4B76A 4G01B 1EFTA 1Q22A 3RC3A 4PANA 2IUUA 1FNMA 4P4SA 1IXZA 2ZJ8A 3SFZA 3VKHA 3MJRA 4GBMA 3K8YA 4WXRA 4L15A 2GBLA 4LBZA 5B2ZA 1HE8B 2P0EA 1NMYA 3VR1A 2VP5A 1II8B 1I2DA 2XTZA 2PMDA 2OBMA 1IXSB 4HAVA 1SKYB 1OH5A 4XD7D 1RC8A 2FFQA 3KB2A 1Z2CA 2FG5A 3AF3A 4PZZA 4QBGB 4BFTA 1E1RD 2V6JA 4A15A 4DLVA 3RLFA 4L4UA 3RS3A 1X1SA 4LYHA 3IKJA 4N0DA 1E6CA 3FDIA 2JLZA 2XAUA 4A4DA 3I92A 2ZS9A 1OFHA 3HP1A 3Q5EA 1D6JA 3LWNA 1SHKA 4TLCA 5FTKA 1MRNA 4A2PA 3K0SA 2KJQA 3C5CA 3DDCA 1NMXA 1M6NA 1Q21A 1CR1A 3CF0A 1YZGA 2ZI7A 3G0HA 3QKSA 5KOYA 3MWLA 3QPVA 4M1WA 4UNNA 1OKKA 4UQOA 3K70C 3NKVA 3BC1A 1VG9B 3DPUA 4Q1BA 2QMHA 1RVDA 1NSTA 2SHKA 3OIYA 4ZDKA 1TPZA 2WSSD 2ZRGA 4BFXA 1XPRA 1GNPA 2ZUDA 2HXSA 2N42A 1JALA 3FWYA 3CB4A 3J81k 2MSCB 4ARZB 1DO0A 4G1UC 4GOKA 5P21A 3JZAA 1CRQA 1AK2A 5DI3A 1DAHA 4LZZA 4B2LA 2WIAA 2AKAB 4RD3A 2OBLA 3SYLA 2LCFA 2AFHE 2R2AA 5D3MA 4NYMR 4FMBB 4MYCA 4XD7A 1UF9A 2VP6A 1XBTA 5CK5A 2IXGA 3BH6A 4QNMA 2QU8A 3NVAA 3EW9A 1E1RA 2VSXA 1LFDB 3A36A 2JJ2A 1XEWY 1YZUA 2IS2A 5AUOB 1EFHA 1KK1A 2I1QA 3ZZUA 2FWRA 1KJWA 4OI2A 3LH5A 3I5YA 5KSPA 1QBKC 3KJGA 1DS6A 3PEYA 1G8PA 2XNSA 1Y63A 4JLVA 2XB2A 1XD2A 2G77B 1D2NA 3TQFA 5JSZB 4TYQA 2XJ9A 1KDPA 5EUQB 4QBIA 4BLQA 1KMHB 1TAGA 2X1VA 3GJ4A 4PC3A 1E2QA 2I4IA 1PLLA 2DB3A 2WSSA 2ZR7A 3RNLA 3NH9A 3OZXA 4PPFA 2OAQ1 5IHPA 2NOAA 2MSEB 1A1VA 2IUTA 2H18A 1ZBDA 3KTAA 4LC0A 3X1YA 3BBPA 3IPXA 1LW7A 4CEJB 3P4XA 4ZDIA 4JZKA 2Q9CA 1YQTA 3DM9B 2GJKA 4BFUA 3NBFA 1O87A 4PHGA 3EX7C 3WP1B 1A82A 1I4LD 1ZAKA 4IFEA 1Q0UA 4ZIRA 2VQSA 1G8YA 4L5BA 1N0UA 2WWIA 3ZVMA 4XSGA 1Q12A 1AKYA 4DCTA 3AVXA 2R6AA 1XMJA 4V03A 3HDTA 3RS5A 5HTKA 1GFIA 3LD9A 1RRGA 5DYIA 3ZZ0A 3B2EA 2ZYVX 4PC7A 1N0WA 2LWIA 4JLAA 1FNNA 2IUSA 3MG9A 2ZI6A 3B6EA 1HE1C 5GVRA 2JASA 4EPXA 3CF2A 4MKFA 4YXWD 4D81A 1N5IA 3CM0A 3GJ5A 1XPUA 5H68A 4EFMA 2WKRA 5DO9A 5HKKD 1AM4D 1Z3IX 3AVYA 3CNOA 1UDXA 4LJAA 4Q4LA 3U60B 3THWB 2EYQA 3SFVA 1KI4A 4LWZA 2IW3A 3U7FB 3UWKA 1NF3A 3SJBA 2DWOA 2P6UA 1TQ2A 2Q3FA 4HYYA 4JVSB 2IWHA 3M0EA 2ZAMA 4AC9A 1DADA 2BOVA 2OXCA 4RD0A 1R0XA 5A4JA 1X8LA 2JA1A 5D3QA 4O25A 3GJ3A 4LJ6A 4OI0A 3C14C 5FL3A 1P62B 4IVRA 2Q9BA 4DLZA 3FHCB 2GZAA 5JHGB 2WICA 2QMUA 1CXZA 1N6HA 3A4NA 5E4FA 1TF7A 1YZLA 1G7SA 3BIFA 1MV5A 4OJKA 3TAHA 3B9PA 2KSQA 5KU1A 4Q9LA 4DRZA 2IK8A 1UFQA 4FWIB 4ESHA 1DTSA 1E69A 1OW3B 1DELA 1W49A 3QKTA 1YJ5A 1VCOA 2FSIA 3OIWA 2Z43A 1N3BA 3QE0A 1G20E 1Z47A 1II0A 4WIAA 2CVFA 3Q9LA 1G9XA 5K8LA 4LHYA 2IYSA 2ZXUA 1AZSC 4YXWA 1X6VA 4B32A 1VCNA 5HKKA 4Q1EA 4R2HA 1D9XA 3R7WB 5KNDA 3FKSD 4EJSA 2FN4A 3EZ2A 3MD0A 4KYIB 1Z07A 5LBIA 4EPVA 3TR5A 1MABA 3C7KA 3M6AA 1ZUIA 4HB0A 2X2FA 1OHHD 4Q18A 4F92B 5FH9A 1HY3A 5LD2B 4Q4HA 4MRPA 3LBHA 4JKIA 4KXFB 3WBJA 4JKYA 2RKOA 4KV9A 3CKLA 1BKDR 4XH9B 2CHQA 5EP3A 4PC2A 4LPSA 1CP2A 4D4KA 2KBFA 2WAYA 3NEYA 1RZ3A 1JJ7A 3A1VA 2IS6A 2RGDA 2XTMA 4B3GA 1LTQA 4TTPA 4MGYR 2IYRA 1CLUA 1SVOA 2XJ4A 3NTUA 1Z29A 3CX6A 1FX0A 5FOVA 1AZTA 1SULA 2GESA 2PLRA 4II7A 1ZMXA 2ZRMA 3ZGXA 2O0JA 3BE4A 4AIIA 5FTJA 3BH7A 3U3KA 4IOJA 4E03A 1KKLA 1NN5A 2V6IA 2Z83A 4A0GA 1M1YE 4GI7A 2F3TA 3E5HA 3B8HA 1U94A 3G5UA 3VU9B 1Q44A 2FEMA 4H9GA 1S0UA 4A92A 2G83A 1EWQA 1OIXA 3T1QA 2IEZA 4RVCA 4BASA 3VMFA 4RD2A 1GM5A 1TQDA 1VIYA 1E1QD 3FKSA 1R8QA 4P31A 3PUVA 1XZPA 2PEZA 4P32A 4URUR 1OH6A 4A8JB 2RGBA 4PTLA 3SC3A 1FW6A 1DVRA 1OHHA 2HLDD 3U4QA 2CLDX 4DCVA 4H1UA 1AJEA 1ZNXA 4TZ0A 4P4SB 4D4MA 2RAPA 4Q9HA 4QL3A 5TY0A 4GNKA 1OH7A 2KBEA 3GLGA 2WOOA 3F5FA 2GTPA 1GL9B 4A6PA 3CRVA 1NNEA 1LS1A 4XTCS 1YR8A 3TUIC 2VBCA 1H8ED 3IQWA 2IBMA 2Z5FA 1N6KA 4JYCA 4P0TA 4Q19A 1R0WA 4N3NA 4DXAA 3LFUA 2IYVA 3OEED 1XTIA 2VIIA 5FTNA 1P6XA 2OHFA 3BRWD 3FFBA 2AR7A 3IBYA 3TW4A 2QA5A 5FBLB 2P5TB 3GEIA 1E4VA 1FFHA 4HDCA 4B74A 3EPHA 2GHIA 1DOAA 3EZ9A 5IRCD 3JZMA 4YMVA 3QPUA 2V1XA 4B44A 4OHYA 2ZSFA 3LO5A 3RDPA 4B75A 1KGDA 4XTRA 4OQFA 1C1YA 3CPHA 2JJ1D 1W36B 5KHOC 3TLXA 2KB0A 1II9A 1QHNA 1U81A 2ZIAA 2ZRAA 2CJWA 4YMUA 1M7BA 2OE2A 2N46A 3UG6A 5K8UA 4F7WA 1E1QA 3GJ6A 4IKEA 2BWJA 2FSGA 2O0KA 2R6DA 3D7MA 3DZDA 4QRHA 3TVDA 4BRWA 3GLGE 2RGNC 1D8TA 1VIAA 1XJ0A 2HLDA 4DUGD 1AS3A 5DI3B 1NKTA 2QY9A 2EVWX 2CDNA 1NRJB 4AI6A 1UBEA 1AGRA 4CW7A 2F6RA 4HAYA 5D3MB 5CJPA 5FOWA 4IVQA 5FI1B 3C16C 5TV2A 2PJRA 3ZVNA 5LPNA 4DC9A 3OEEA 4MITA 4Q7JB 4BWYA 5EJEA 3AH8A 1Z5ZA 5B64A 3TE6A 2FGJA 3I61A 5JECA 3CLVA 2GJSA 1VCMA 3EPKA 2XOKA 1HTWA 2FPLA 2GVDC 1YZQA 1CEEA 3GLIA 1W5SA 3CH4B 1EFUA 1Z28A 4L9WA 3W3ZB 2CCKA 4MRVA 3WNBA 2X77A 1DAMA 2NO1A 2OAP1 2XSZA 4GPTA 2EFDB 2NIPA 2BKUA 2D74A 1ZJ6A 2JJ1A 2QT1A 2ZU0C 1XD2B 1XPOA 4LJ5A 3KUDA 2ZI4A 1R5BA 2ZRDA 3PG5A 2D4HA 3KFVA 4MRSA 4OHWA 2ZRKA 4GDFA 3VHLB 2YC2C 2H92A 4G5QA 2ZJOA 4IDPA 2OILA 2JLWA 5E7JA 2VSOA 4AK9A 2WAXA 5F98A 1P9RA 1Y3AA 1SXJC 1W48A 2GRJA 1IM2A 4PO8A 2REOA 4HSEA 4B6EA 3EWSA 1TUEA 1AN0A 3UG7A 3TAUA 4JVLA 4DUGA 3RC8A 1Z6YA 2IL1A 2DCUA 1JQLB 2Q0HA 2C9YA 1QHXA 4U5XA 4ZIRB 4ZKEA 3QEJA 2Q21A 4WZ6A 5JJLA 2FGKA 4EFNA 1W4RA 2H1LA 3I8SA 8OHMA 2E9SA 3TMKA 3HU1A 1GP2A 5J4VA 3NHAA 1YR6A 1E0SA 2OFWA 4Q03A 3GLIE 2AK3A 4M9XA 1QRAA 2ZRIA 4LBWA 1YHNA 2HCBA 3AM1A 5AJXA 1LB1B 3P20A 2BC9A 2H8KA 4TLBA 5L8VA 4GP7A 3L8YA 2MMCA 5EE1A 3QXCA 3AP2A 5BWMA 2GA8A 2WJJA 4RD6A 3NG1A 1PUJA 2BCJQ 1KK2A 2X19A 2DFKB 3W9YA 3CWQA 3KXLA 1CJVC 2YWHA 3BOSA 2Q3MA 3SJCA 2B21A 3RAPR 3PUWA 3UMFA 4Q9KA 4V0LA 3TKLA 4DIDA 4DDVA 4HLUA 4G5RA 2YC4C 4A1FA 5J4LA 2BEJA 2FMXA 3Q5DA 3CR8A 1W4CA 2LKDA 2ZRHA 4URZR 4QKQA 3SHWA 1FZQA 3NIBA 3PQCA 3FGNA 3O47A 5BN4A 1E2DA 5GJCA 4V0MA 3GJ0A 5KDLA 4JLDA 1IBRA 1EFRA 1KSJA 2GCOB 4AURA 5ANRB 2QAJA 1XB2A 1KJYA 4M2LA 1FPMA 1T6NA 3H1TA 3U7EB 3SZRA 4E07A 1E9CA 1P7CA 3N2EA 2IYWA 3QUSA 2NQ2C 2G6BA 3IPYA 3EA0A 5DI9A 4B43A 5KSZA 4FWTA 1DAEA 1MO3A 1E79D 1CJUC 4UJ5A 4GP6A 2C95A 2R6CA 1VYVA 4HAXA 5CLQA 2R9VA 3HU2A 1GRNA 4Q48A 2BIFA 5JCPA 1E99A 3GLHE 1L4UA 3B1ZA 2ZTSA 2UVQA 5CB6A 2NPFA 4XJXA 1T9HA 2BBWA 3G82C 4OYHA 1G41A 2W6JD 1E9BA 3AEZA 4EJSB 2GXAA 2XXAA 1IQPA 3B5JA 1NL3A 2C04A 3EC1A 1MABB 3QG5A 3KKPA 2XZPA 1KNXA 3I73A 3GFPA 1QHHA 4Q4HB 5G40A 3I5XA 4F91B 4XWAA 1ZC4A 3K0FA 1YKSA 4V0ME 4EPTA 3VKWA 3N5CA 2IX3A 1VG1A 3Q7PA 2ATXA 3ONWA 3RVBA 1G8HA 2ZE6A 1W2GA 1I4DD 5GJVC 2A7QA 3SN6A 2RB4A 2WWXA 2QGZA 4M1SA 1QZXA 4LV6A 1VMAA 4US0R 1BYIA 1NP6A 4A0RA 5J4KA 2QRNA 1S9HA 2F3RA 2GK7A 3AVOA 1Z6TA 1FX0B 3GJ7A 2B92A 2GEUA 2VP9A 3ASYA 5AWFC 4R7ZA 3GLFE 3L82B 4CIDA 2KI5A 4M4SA 2F9MA 1G3MA 1E2GA 3P4YA 4KO8A 1E0JA 1VYUA 1XP8A 3GEHA 3IDQA 3DKVA 1JBKA 1BO6A 1E79A 2IXFA 2NGRA 5DGXA 4K46A 1J8MF 3AF4A 3DOFA 2AX4A 4LJ9A 4C0HA 3AKCA 3CBQA 1UKYA 2R6GA 1L4YA 4P4TA 1SVIA 1R6BX 1G7CA 1YZKA 2VLIA 4MDFA 4IDHA 1MRSA 5EE0A 2DY1A 2QTVB 1YZNA 2KE5A 4ON9A 3U2QA 3RS7A 4W5WA 4DLUA 3LXRA 4DLRA 3P1JA 4IEIA 5CDFE 1P9NA 3QI2A 1K8RA 4NCKA 3KQLA 4XWKA 4G3XA 3ZLJA 4OK5A 3IHLA 3U4QB 1XEWX 3KJHA 2WOJA 3IIKA 4WOPA 4B73A 4DLTA 1TF2A 5JS7A 5DYGA 1KI6B 3GLGB 4JVNA 4Q4JA 2IYYA 2DFNA 4ZKDA 4S2EA 5KDDA 1IOZA 2ODBA 1F48A 4LOAA 1L2TA 3PENA 2RGCA 1AS2A 2GXUA 2HXYA 4EPYA 2VHTA 1OFUX 2WWFA 2VEDA 3I72A 2DYKA 1EWRA 3FVQA 4FINA 5CM8B 3NDPA 3WRXC 4V0KA 1JAHA 2ZJZA 1JI0A 2VF8A 4MRNA 2OCAA 3WNCA 3DOEA 5E7IA 1U99A 4CEHA 2DBYA 1G7RA 1N6LA 5FBQB 5HPYB 1KI8A 4Z8XA 2P67A 2XEXA 2PZGA 3K09A 4IJMA 2CNWD 2QE7A 4PAMA 2EYUA 4C0JA 1PUIA 4BEBA 2ODNA 4QBHA 5TMPA 5E3HA 2Y8EA 1LVGA 3I4LA 2QSYA 1KY3A 3TGPA 3EPJA 1RYFA 2QORA 1VG0B 4Q1CA 1LS6A 1OXXK 3MRSA 3ICEA 5B58C 3CRQA 2CJWB 2VHUA 2WV9A 4F4CA 2ZYWX 4ZCIA 2HUPA 3B7GA 5ELXA 3CO5A 1AQUA 1R0ZA 2A5YB 4ZO4A 4MGIR 3GJXC 4IVPA 4QHYA 1BYUA 5AUQA 1XXHA 2ZETA 1N0VC 1XCPA 4V0NA 1EGAA 1CR2A 5AUPB 3GP8A 3B78A 5BW8A 2J7PD 3B1VA 5FL7D 1WP9A 1ZC3A 2J41A 2JGNA 2VL7A 3A4LA 3ZD6A 1NMZA 3W6PA 4DT1A 5L3QA 2PZEA 4D4LA 4UKDA 4BPBA 2YWEA 4OKSA 5JCZA 4BECA 2QBYA 1YE8A 4C0KA 3WNDA 4N0EA 5GJBA 4LK2A 1ZD9A 2ZROA 2OFXA 1TEXA 2AD1A 4NMMA 1U8YA 2QGNA 2J3EA 5EP2A 3ICQB 4EKDA 1N25A 2GXSA 3LDAA 3LNCA 3QNUA 2R65A 4DLWA 4I1OA 2FOLA 3CNNA 3GLIB 4XWOA 3PEUA 4FCWA 1T91A 1FQJA 3GD7A 4HEJA 2AFIE 4KODA 2D7DA 1LF0A 2CNWA 3BFXA 4KSBA 1W44A 2C98A 2XB4A 5HZHA 3NDBB 1GOTA 3M4YA 1R7RA 3LX8A 4DWJA 1VDZA 1KYIA 3NEJA 2C9CA 2P6RA 2FZLA 1ZD8A 2V55B 4DBLC 3NWJA 4RZUA 1XXHE 2ZS8A 3LRPA 4IDQA 4GT1A 1HUQA 4AG6A 3CZQA 1XEFA 2AN9A 1JB1A 4Q66C 1E4YA 3CF6R 5KSYA 4PZLA 1MO6A 1WMSA 2PLFA 2X8AA 5FI0B 2ZRBA 1KDRA 4M21A 1TMKA 2QPTA 2QROA 2IS4A 2BMDA 1HURA 3JVVA 2J7PA 1IN6A 1U2RA 4KU4A 2MSDB 3UMRA 5FL7A 1JQJC 2QEQA 3TRFA 2V1UA 2QTFA 4LPKA 1G17A 3RWOA 3B85A 1GRRA 2NO9A 3VR5A 2BM1A 2ZE7A 5FFMA 4LYFA 1IN8A 4L8GA 2GJ8A 2XZOA 5JS8A 3F0TA 2YINC 4TN1A 1GAJA 3K9HA 2HV8A 3TK1A 5AJWA 3EIHA 4NCIA 1KSFX 1WE2A 3K9LA 4HLQB 3U3RA 1WXQA 5HZKA 2IA5A 1IONA 3OIUA 5IT5A 1W0JD 2J0UB 3CX8A 2A30A 1WB9A 2WBLC 4OQMA 3GLHB 4B3FX 1F6BA 3WY9A 1W5TA 5DHAA 3R8FA 4B3XA 2F55A 1I4TD 1NN1A 4AYWA 2AKYA 3L0OA 4C4PA 2RH5A 1XTRA 2FNAA 4WZBE 1SKQA 1CJKC 4LJ4A 4NE2A 2GZHA 5DH9A 2RHMA 2VSFA 1EFCA 1H8HD 1XU4A 1J7KA 2EWWA 4I99A 4KBGA 3QF7A 2Z4SA 3IIMA 5LDDC 1CU1A 4AKIA 1AKEA 2CCGA 2NO7A 5KUTA 4HB3A 3CPJB 4ACBA 2C96A 2JLSA 4G5OA 1PLKA 4DB4A 3PXGA 3RHFA 4D0LB 4CT4B 2NPIA 2ONKA 1T3LA 1XEXA 2WJVA 3KKNA 3V9PA 4LJYA 4PHHA 2O8BA 2EFEB 3R9IA 3VNVA 3EASA 1GRQA 4TT3D 1XX6A 4TZ6A 1ZCBA 3F8TA 1OF1A 4Z8YA 2YOFA 1G18A 1X3SA 5C4GB 5J4YA 5G3ZA 5J47A 3GLFB 4A0HA 1G21E 3EZ6A 1RYHA 2GCNA 5H70A 3RANA 2CBZA 1IY0A 1OT3A 1C4OA 3TJZA 3ZS9A 2HYDA 4A8JC 1ZD1A 3W8NA 2GEVA 5CIWA 1G8GA 2A5DA 2Z6VA 4R9UC 1ZU5A 4MKHA 4Q9JA 1SXJD 3TBKA 4F4JA 1TADA 1W0JA 2V7QD 1W47A 3SYKA 2RGNA 2XXAB 5FBWB 3TIFA 4DSOA 4BZXA 2YWFA 3T15A 4C0BA 1QHHB 2ZSAA 3AVUA 2O8CA 2UKDA 1OXVA 2VP4A 1KI7A 2OLJA 4ZCMA 2W0SA 3K0FB 5JFGA 3VR6A 1H8HA 2QN6A 3O8DA 4MQBA 3AVQA 2AHOA 3WMGA 1CULC 2FE4A 2P5SA 1AGPA 2WTUA 1S1MA 1W2HA 2OLKA 2IYQA 3QXSA 1UM8A 4M8NE 1A7JA 1BOFA 5CLLA 4CYMA 4D80A 3QY0A 3W5IA 4E22A 4CEIA 4P4UA 3OE7D 1QG4A 1ESNA 1J8YF 1IAQA 1YU9A 3FFAA 3UXMA 4JJKA 2CLCX 2YYZA 4KFRA 3CRRA 2GF9A 4TT3A 3PVSA 1E3MA 1W36C 2BCGY 3BB4A 4PSKA 2XNDD 3WMFA 3B1XA 4X8HA 1NJGA 4Q4AA 4J0QA 3ADCA 3T1VA 3U5ZB 1K6MA 2OO7A 3UPUA 4ACAA 2W2VA 3JVUA 3GMTA 1Q1BA 4TMTA 1G3IA 1DBSA 2CL0X 2P3SA 4PSAA 3TUJC 4NCJA 1NBMD 2ZSDA 4EIWA 3SYNA 1OXUA 2J1LA 3O8CA 1OIWA 1SXJA 1ESMA 4YQFA 1ODFA 5HE9A 1F2UA 2V7QA 4CVNA 4ZI2A 2JLQA 2ZE8A 2X2EA 4FMDF 1J99A 3KKQA 5FUYA 1D2EA 1EX7A 4HAZA 4TSFD 5JLJA 3T1TA 3F3YA 3HWSA 5CJ2A 4DIEA 3GCGA 4B71A 1H65A 3RRMA 4LCBA 4M1MA 1YVDA 1LF5A 2QQ0A 1A2BA 2ODWA 2H7VA 4HLCA 2JDID 3SU8A 3OAAD 2IYTA 4Q4JB 1W46A 5DN6D 4JSTA 3ZZTA 4D2IA 1VHLA 2GXQA 1P2VA 1P75A 4L9SA 4NTZA 5IF9A 4Y0VA 4PQRA 4CZ2A 3T5DA 2O8EA 3BB3A 1VCIA 1UKVY 5FPHA 3U44A 4CGZA 3FE2A 721PA 1NVVQ 1KO4A 1KAOA 2IT1A 2QMEA 4CEHB 2FFAA 2RHDA 2VRWA 1G64A 4Q00A 3DO6A 3UANA 3PEVA 3ZS8A 2XNDA 3GPLA 2HF9A 3EARA 4E09A 3FKQA 1MO5A 3AV0B 3SBEA 4A2QA 5JHHB 1E9DA 4FI3C 1IJFA 2FZ4A 3QXJA 3IUYA 3WYFA 4X8OA 1NBMA 2WWWA 1ZP6A 1DPFA 4NYIQ 3CR7A 521PA 4TL7A 4DCUA 3BD9A 4LYAA 4QGFA 4MYHA 2AXPA 2JEOA 1PLJA 4IXNA 2QNRA 4TSFA 4DCSA 3EWAA 5EZ5A 1XXHB 3H86A 4OK3A 4GZLA 3I32A 1IN4A 4JSYA 2VH5R 4LYJA 2O8DA 2BM0A 4BZQA 1RRPA 2QTHA 1G6OA 5AUNB 2JDIA 2QM8A 2QP9X 4C2TA 2PX3A 2IWRA 3OAAA 3I1FA 3N2IA 4X8MA 5DN6A 3T5GA 4EPRA 4DT1B 1N6PA 3AKDA 3SOPA 3X1ZA 4IOLA 5J4HA 5L3QB 4MH0R 1SGWA 3P32A 1Q3TA 4Q7LA 3T35A 1XD8A 5BQ5A 2QBYB 3QKSB 2IF0A 5EZ6B 3E1SA 4LI0A 4QG7A 4A2WA 1GNQA 3EZFA 2CHGA 4JBYA 4YLGA 4DHEA 3WXMA 2DR3A 5K8TA 1PVOA 3L43A 3AVWA 4HUTA 2QRZA 2YVUA 5GVSA 4DDWA 4NHOA 2H17A 1Q20A 1ZIPA 4KLZA 4OHVA 3IEVA 1JPJA 1T5LA 3AP3A 3TW8B 2BBSA 3CUEF 3PITA 2OCYC 3ZDQA 3L0SA 5KNCA 1E98A 5J40A 4MKGA 1II8A 1NVXQ 1YRAA 3R20A 1UBCA 2AXNA 421PA 1CS4C 4QNRA 2ZS7A 1W0KD 5FUVA 3K0EA 2OV2A 4HUQA 4DLSA 1ZCAA 1SVLA 4B47A 1H8EA 5G53C 1E2FA 4FN5A 2AL7A 2FX3A 1E9FA 4KSCA 4UNSA 4LHWA 1U90A 3SJZA 4WVFA 2ZYTX 1UKEA 1WRBA 3K9NA 2YJTD 2J46A 4FCVA 4RD1A 1KY2A 4TLEA 4BFVA 3UIEA 2WHXA 2ZSBA 1R5NA 3T06B 3SHFA 2ZYUX 5DISB 1DG3A 2PH1A 1HYQA 1OSNA 4IOKA 821PA 1QVRA 1R0YA 5HCNA 1DE0A 4RCYA 1QHIA 4QGGA 4URVR 3UWOA 4NPHA 1P3JA 2J0VA 3X1DA 1Q3HA 1SVWA 1N5LA 1KK3A 1U9IC 2FJUA 4Q1FA 3UKDA 1ZM9A 2WWHA 4LC1A 5TARA 1VG8A 1E94E 4ITRC 4W5JA 3T34A 1HT2E 2WMNB 4PXAA 4UNQA 4EJSC 1X86B 1UPTA 1XFAA 1JECA 4ASUD 1N6IA 2G1KA 3KTAB 3D31A 4URXR 1ZW6A 2MMGA 3D3QA 2UZ3A 4EFLA 3VHXA 4JLOA 4LX0A 2AWOA 4E5UA 1NLYA 3AKYA 3AGQA 4NCHA 3K1JA 2ORIA 3PV0A 4FD2A 3CZPA 4PZYA 2W00A 1XJQA 4TMWA 1L8QA 1V43A 1W0KA 1WF3A 1GKUB 1UJ2A 2REBA 4W7SA 3AB3A 5FPKA 4GOJA 1UDWA 4YMWA 5A0FA 2OM2A 3UK6A 4UXIA 4B34A 1G19A 2J7KA 3HU3A 1OH8A 2VA8A 3KKMA 3K70D 1KDTA 2OCPA 2JLRA 3QBVA 4TWZA 5IDVA 1GDDA 1KTVA 1NY5A 4V02A 5FPYA 2AD5A 4KI0A 3WHKA 1HV8A 3ND8A 1TU4A 1S9DA 2PT5A 2R62A 2ZSEA 1G7TA 2F1IA 2GK6A 1T8UA 5F3WB 4NZYA 3PEWA 1XEXB 2ZM5A 2C2HA 4R71A 1E2LA 3A37A 4FW9A 1MO4A 2NG1A 2O8BB 2PT7A 4ESVA 2QAGC 4JBWA 3B1WA 3QENA 3LAWA 2GAOA 4M9SA 3W6OA 3MJHA 4UNPA 4AYTA 3HPRA 2JLYA 1RRCA 2ZJBA 4HZIA 4Z51A 4PQYA 2IHYA 3AUYA 3BGWA 4PPGA 3SI7A 3GFTA 2WJHA 3KXKA 3MWYW 1D2MA 4JBXA 4Y0AA 4JLNA 4XSHA 4YMSA 1ELOA 1FOEB 1NLZA 5SZHB 1U0JA 3CONA 4WBSA 4C0QC 4IDNA 2J0QA 3DHWC 4QGAA 1DEKA 3KJIA 4TQAA 3QIAA 1OLOA 2HT6A 3KDSE 4US1R 5EUMA 1IN7A 4B35A 1VTKA 3MCAA 2ZRPA 3PCRB 1NI3A 3NC1C 4DB2A 1PV4A 4PAOA 1ZNZA 4G0NA 3CNLA 5C1BA 2GCPA 4JL5A 2OG2A 2O8CB 2WJGA 4OI1A 4AKHA 3GFOA 2VO1A 5IK2D 1EK0A 2ZVQX 1A4RA 2IHBA 3HR7A 2V4ZA 4B48A 4UJ3A 1G3QA 2AK2A 3BK7A 2G1JA 3L0IB 5SZIA 1GTVA 1KO5A 4LBVA 3TSZA 2YHSA 4HLDA 1WQ1R 1NKSA 5DLQC 2WIBA 1O3YA 2WKPA 3RS4A 3ADKA 5UKDA 3THWA 1FMLA 5EXXA 4CEIB 1FUKA 3KQHA 1DAKA 3MWJA 2BVNA 2OSBA 4OJQA 4KBFA 1AQYA 1Z22A 1AIPA 4FMCF 3IILA 1KI9A 1S1CA 2WJYA 4Q4AB 5B57C 1ZRHA 1QHSA 3U6KA 1Q1EA 2ZRCA 5TVKA 4LHVA 6Q21A 1YR7A 4PHFA 3RSLA 4BE7B 5EP1A 1QF9A 4HDOB 1M7HA 2JLVA 2W0MA 2WSMA 3QQ5A 1Q1QA 3BS4A 1UKZA 3RS2A 4AD8A 3Q8XB 4IRUB 1F2UB 1KK0A 2ZUCA 3EAQA 3RWMB 5BXQC 1LNZA 1R8SA 1JEDA 5JI2E 4CT5A 3FHTA 1SVMA 2XITA 3WHLA 1FL9A 5GADl 5IK2A 5C4MA 2P2LA 3DVLA 1E2NA 1U0LA 1XTQA 2IEYA 2A2ZA 5EE5B 2REXB 2OXRA 4BFWA 1E9EA 4P33A 1NJFA 5KDOA 4JLPA 3VKGA 5GJWC 3CPEA 5FUXA 2QQEA 2QL6A 5JWRA 2CL6X 2BHRA 5F2EA 1T5IA 4EQ6A 3R7WA 2O8EB 4WZAE 1RE0A 3U44B 3Q3JB 2D7CA 2GZDA 4C3ZA 1KKMA 3A1SA 2W6JA 4PPNA 5L3RA 2GJAA 2IXEA 3AUXA 2NZ8A 4TYPA 1G1MA 2ERYA 2HJVA 2DPXA 4XIGS 3NBXX 2YKGA 4LGMA 4A82A 2EQBA 1V5WA 1XZQA 4TL8A 3LVRE 5FOSA 3X1XA 1OXTA 4M9QA 3TR0A 3NBZC 4NP6A 4TYYA 5E95A 5JWHA 3W90A 3OFND 2PX0A 2ASEA 3SQXA 3U3MA 1G4AE 5FOXA 1GKYA 4M53A 1ZVQA 4DSNA 3LX5A 4S35A 4BLRA 1F2TA 2BMFA 3B9QA 1OYYA 1E9AA 4KVGA 1YZTA 3IIJA 2GVZC 3ADDA 3BWDD 4M22A 3TVTA 2FU5C 3FYHA 1NG1A 2P65A 4JVMA 4M1YA 1G16A 1TX4B 2ZRJA 3QXXA 3RRZA 4LV5B 3E70C 2ZJ2A 1W1WA 2VHQA 5JRZA 4YC7A 5EE9A 2PJZA 1E2JA 2CCJA 1XNJA 2O8DB 5TXGA 1HEIA 1F3OA 3MFYA 5HR5A 4CF7A 1ZU4A 2B8WA 1XMIA 3OHMA 2QI9C 4QJ5A 4BFSA 1XTJA 3CRMA 3EIEA 3VU9A 5DNYB 1R5OA 1W36D 4D26A 1E96A 3TQCA 3EA5A 3LVQE 4G5GA 2BBTA 3QSYA 3R9XA 3AF2A 4JS0A 2EFHB 4WXPA 1KHTA 1T8TA 3PIRA 3I3SR 4DSUA 1Q57A 3PFIA 4JLJA 3HR8A 1GVNB 2F9LA 4RD4A 1LV7A 2W6ID 5G3YA 3QXHA 1VHTA 4A8JA 3VX4A 2OZEA 2NMVA 3FB4A 2DFTA 3U61B 3LLMA 3ZYCA 1RPZA 2Z0MA 3KB1A 3CH5A 4PR0A 1SVSA 3RABA 3V4FA 1NSFA 1ZM2A 4AY2A 2YOGA 3OFNA 3DL0A 4HLUC 2ZI9A 3LW8A 1WDTA 2B8TA 2J87A 3ECCA 4FCTA 4EUNA 3KQUA 3U7HB 2QPAA 4DLXA 3NXSA 2ODEA 2IS1A 1JR3D 4HUQB 1A2KC 3THOA 3ZQJA 4PX9A 5TB5A 1XMSA 3QG1A 2W58A 1CR0A 4MYUA 2V54A 4TYWA 1GZSA 2C03A 1Z0KA 1KJZA 1ZNYA 2JJ2D 2PBRA 1OYWA 1FP6A 2R6FA 2ORVA 2ZR9A 1M74A 3BB1A 1YR9A 4US2R 1BH2A 4DKXA 3HJNA 2QENA 3H2YA 5KTYA 2ZI5A 1N5KA 2F7SA 4TYNA 1COWD 3H0KA 1XF9A 4BLSA 4EDHA 2RGGA 1FP7A 4Q5IA 3I62A 3QKRA 4KLNA 2OCBA 1MR3F 4NH0A 1VECA 4BRUA 3LBNA 1OJLA 1ZNWA 5EXSA 3ZQ6A 2ZRFA 2VHJA 3KX2A 4QM7A 2XTNA 1GITA 2W6IA 1D9ZA 3IO5A 4HZUA 4A9AA 3NH6A 1JXMA 3ZVRA 4NYMQ 4C0AC 2ZITA 1Z0AA 2XZLA 2VPPA 2ZUBA 3SBDA 1ZYUA 3QVUA 5E7MA 1P2UA 3EIQA 1T0HB 4U7DA 1M8PA 3K9GA 4XVUA 4D4JA 1KI2A 3A8TA 2PCJA 3CX7A 1PJRA 3NC0C 4NONA 2E1RA 3VAAA 5FPTA 1OE0A 2VHCA 4PO1A 1JPNA 5K8IA 4MGKR 4GL2A 4GFDA 1NLFA 4D6PA 1JR3A 2OFOA 1E2IA 3RRYA 1S2MA 1ONBA 4LBYA 3MLEA 4URYR 5KPJA 4RFVA 5LB4A 3WMEA 5FUWA 2A78A 2JAQA 5EP4A 3U7GA 3W5JA 3THXA 3C4JA 3SEAA 4LJ8A 2FSFA 3P27A 1MT0A 4CRWB 3DZ8A 2W83A 1G8FA 1UEJA 2OUKA 3W34A 2C78A 2J45A 3RRNA 2FEOA 2FSHA 4A36A 4AWXA 1ZUNB 2CEAA 2FDCA 3THYA 1FMJA 2VYFA 4NU0A 1COWA 5LD2C 4TQ9A 3TUZC 2V3CC 3IHWA 3SE0A 4PAQA 1JNYA 2ZJYA 1P73A 3KQKA 1KSGA 3VQTA 3QKUA 3AKEA 2QM7A 1X8JA 2HDNB 4PFSA 3AP1A 5EQTA 2ATVA 4BLPA 3M1IA 4A6XA 1NG9A 3DMDA 1G5TA 3K0AA 3LLUA 1JXOA 1X8KA 5JBQA 1KZGB 1Z6GA 1G291 1E0KA 3RYTC 4QM6A 3ZVLA 2H5EA 1IHUA 4D0NA 2B6HA 3PR1A 3WYAA 1EXMA 4K81B 3U3JA 1CRPA 4NL4H 3FMFA 1JR3E 3AF0A 4TMVA 2KWIA 1E2PA 4YMTA 4BLOA 1MH1A 4B3CA 1P2TA 3BJIC 4RJLA 1OXSC 3KFXA 4PQFA 4Q02A 2J0SA 3A6PC 3QPWA 5AJVB 3MWKA 1NVWQ 4RY2A 3K0CC 4ZPXA 4DDTA 3SJAA 2D3WA 4QHSA 1Q1ZA 2G9NA 1GKIA 3T1OA 3LW7A 4Q01A 1SQ5A 2ZRNA 4KFSA 3K70B 4PSVA 4ZI3A 2YOHA 3L8ZA 2ZREA 4Q21A 1PZNA 4IHQA 1BIFA 1HQYE 3OESA 1ZM7A 3P26A 3DM5A 1DG1G 1M2OB 3NHBA 3T61A 4JLMA 3K09C 1R2QA 3Q7QA 4TTRA 4I81A 1Z63A 2GBLC 5JEEA 1RFLA 2GAAA 5SZJA 1SHZA 3C41J 5AK0A 4QHTA 2F43A 3GEEA 4JL6A 4C0SA 3A1UA 5C18A 4RKEA 2ZVPX 4POAA 1Z8FA 4D25A 2E87A 5TDHA 1ZINA 3IQXA 4AG5A 4BEJA 2J9RA 3HPQA 1IY2A 2JIZD 2BEKA 3KKOA 4RFSA 4TL6A 3LXXA 3X2SA 1ANKA 2WWGA 1CKEA 1DAGA 2O52A 4DLYA 4FIDA 2GCOA 4O2RA 2EU8A 5F9HA 2QP4A 2HJGA 3AQ4A 3TSOA 5HCIA 3NBYC 5AR1A 5BN3A 1QHGA 2RMKA 3ASZA 3VX3A 2JATA 2O0HA 3QVVA 1FTNA 5G41A 5A5GA 5JWOA 3SDZA 2B7CA 3VNUA 1G3UA 2D62A 4EAQA 4EPWA 4OL0A 4QC2A 1DARA 4Z1MD 1KDOA 2CE2X 4NYJQ 4BZPA 3OIVA 4Q1DA 1W4AA 2GDJA 2VF7A 3U3OA 4JT2A 1US8A 1OPXA 4IXMA 4MDEA 3O8RA 2VP2A 4X8LA 3BFVA 4ZDWA 1E2EA 4KFUA 1Z0FA 1U9IA 2LKCA 1K5GA 2BMJA 4TMZA 4NYJR 2D2EA 4OQLA 121PA 4OQXA 3RSOA 4EQ6B 2JLXA 1YRBA 2YZ2A 1WBDA 1F60A 1G3RA 2BJVA 5KPDA 4QJ4A 4Q9IA 3CRW1 2Q3HA 2V8OA 4MA4A 2ONJA 4Z54A 1XRJA 5B30A 3KL4A 1N6RA 4JLBA 1CTQA 3CWZA 3CIOA 1FTSA 2K5UA 3FHOA 4GRAA 1E9SA 4FMDB 1KO8A 1NVUQ 1JEEA 1GL7A 3D8BA 2WPDD 4PC1A 4HAWA 2YV5A 4URWR 3S1AA 2JIZA 1P4SA 3LQRA 1E2KA 1EX6A 4KYUA 3VR4A 4AYXA 5JMTA 2TMKA 1ZIOA 221PA 1F2TB 1XCGB 2ZU6A 3PUXA 2ZJAA 2GETA 1AS0A 4ERNA 4ZDJA 2FPKA 2OEPA 4JMPA 4QJ3A 4LRWA 5C2JB 2QUZA 1SZPA 5C46F 4RZ2A 1WBBA 1CR4A 2ZPTX 4KCGA 3KQNA 1KOFA 4M1TA 2GILA 5CYOA 3OE7A 2BMEA 5DSZA 1U8ZA 1JAIA 4I1SA 4MKIA 2N1BA 4Z1MA 1QG2A 2YNMA 5JI3E 3ND9A 3EG5A 1K5DA 1D5CA 2ANCA 2C77A 2QAGA 3FMIA 4C9BA 1W7AA 1NVVR 4OBEA 1P9WA 5FTMA 2FV8A 4V0OA 1SXJE 621PA 2CLSA 1RJ9A 1UEIA 1DAIA 1WA5A 4IOMA 4YONB 5DIFA 1P72A 4AKGA 5H1YA 2IC5A 3BXZA 1UADA 4IFBA 4C7OA 3AVVA 2H57A 2VTKA 2O8FA 2EFCB 3SS8A 3C8UA 4TTQA 5JEDA 2H16A 3MGCA 4WW0A 3HYRA 5CITA 3R8CA 2C8VA 3SNHA 3X1WA 5FOTA 3FOZA 4OI4A 1XD9A 3QEOA 2C9OA 1ZM3A 1KI6A 3FMOB 3UATA 4NYIR 1Z6AA 1E0AA 2BBOA 4M1KA 1P60A 3H84A 5L3SA 4C2UA 4DZZA 2WPDA 1VKJA 1AA9A 4QFMA 5DHFA 1UAAA 1E2HA 4RZXA 5AJYA 1VPLA 5KO2A 4M9ZA 2VP0A 3EXAA 1WCV1 3QF4A 4LHXA 4LUCA 4YDHB 3CW2A 1N6NA 1Z0JA 3REFA 4RKFA 3OEHD 2G0NA 1XWIA 2PL3A 3LBIA 3B1YA 4BLTA 4KHZA 3DEFA 1EESA 4XVQA 1M34E 3AF1A 4GSYA 4U00A 1GG2A 2FFBA 3N70A 5KNBA 5JJKA 2ERXA 4A0FA 2XOKD 3PUYA 4TMKA 2Z4RA 2CHVA 4LJ7A 1J70A 4ABYA 1Z6XA 3LV8A 3O8BA 2FFHA 4MRRA 2QP3A 2XSZD 1T4GA 5KYKA 1L7VC 1NBME 2ZEJA 1G6HA 1OFIA 3MAAC 2G3YA 3SQWA 3QKRB 1HT1E 2Q9AA 1N5JA 4LDJA 4U02A 2R8RA 2ZQ5A 2BJWA 1TU3A 5CB8A 3I8XA 3WBKA 1CBUA 3ZJYA 1LY1A 1A5TA 4I1VA 1KI1A 1W4BA 1Z06A 2DHRA 4HZUB 1CJMA 2C5LA 1TNDA 4GOXA 4IDOA 1XMVA 2RCNA 4DSTA 5FBRB 3LQQA 2J5XA 1KSHA 4HDQB 4W9MC 1KI3A 1GL6A 5FR2A 3VR3A 3REGA 3TNFA 1T3HA 2FA9A 2JJ8A 3BERA 2J59A 3ZIAD 4BFZA 4G5SA 3W8RA 4YDSA 3W3AA 1I2MA 4OK6A 3A58B 2D2FA 4RCZA 1BMFD 3OEHA 1OB2A 2ZAOA 3THXB 1Z08A 1DAFA 2G0TA 5FOUA 1T0JB 2OESA 2YWGA 4M1OA 1TF5A 1RIFA 4WA7A 5KSOA 2WJIA 4ARZA 1XTKA 2IF2A 1SKYE 4DEYA 3THYB 4XOIA 1J2JA 3BORA 2ECKA 5L3VA 5CIQA 2UZIR 4DDUA 5FR1A 1P2SA 2GEDA 2F1RA 3KZ1E 4QBFA 3PUZA 2BDTA 2XGJA 4NCNA 2BKEA 4JYBA 4PHTA 4Q7MB 3BAFA 4BUJA 4OHZA 1HQCA 4CDGA 1IJEA 5EE3A 5CM9C 1JR6A 3OF5A 1M7GA 3VFDA 3KJEA 3K0AB 1N2CE 4LSGA 3WYGA 1F5NA 4UNRA 1E2MA 4C0LA 1TL7C 1N6OA 2WKQA 3MUFA 5H8WA 3MSXA 2PCLA 1U0HC 3AVTA 1KO7A 2A5GA 1EFRD 1KMQA 2A9KA 4GMDA 1GILA 3B13B 4DCNA 2GF0A 2QPOA 3DMNA 3IBGA 5BYKA 2ZE5A 1SVKA 2PZFA 1Z2AA 1XCMA 4B2PA 3TSWA 4BGDA 2NZJA 3ZIAA 1CJTC 4F93B 1HA3A 3V00A 4JIMA 2I1VB 1MKYA 2CL7X 3AGPA 2BV3A 5JSZA 2WWYA 4IW3B 1FUUA 4N1AA 3FTQA 4BQSA 1BMFA 1R10A 1KMHA 4F4IA 3W6NA 4LV8B 1E9RA 4RZ3A 2A3RA 3VTKA 3ADBA 2RGAA 4B2IA 1T3SA 1G5RA 2F1HA 4TL9A 5M04A 3WRYC 3GQBA 4HB2A 4R2IA 1CIPA 4GMXA 4CEJA 1KAGA 4M0LA 4ASUA 4D0GA 2F1JA 4JL8A 3TH5A 3KUCA 2EWVA 2HEIA 4R98A 5FPSA 1OV4A 2J0UA 2CXXA 2IYLD 2HYIC 3GLHA 2G88A 1KZ7B 2FPMA 3HYTA 2A5FA 3AVPA 4K8OA 4MUBA 4P3YA 1TTTA 4O3MA 1GSIA 2CE7A 1G4UR 1RRFA 1RKBA 2F43B 2AWNA 4KVAA 3VR2A 5BN5A 1NIPA 4NKRA 1GNRA 4PO9A 1QHYA 3V4RA 4RFSB 1G5PA 3ZD7A 2ANBA 3RS0A 2HT1A 2NO0A 2WZQA 4QGHA 4PPQA 2CVHA 3T12A 3EC2A 1B0UA 1S3GA 3FMPB 5JJIA 2ORWA 4WAUA 2D06A 1TQ4A 2FH5B 4B3BA 2I3BA
chains in the Genus database with same CATH superfamily
3BQMB 4GL4A 3VYWA 3MJCA 1SURA 5HMLA 2IZ5A 4YFVA 1PTJA 1TVKA 3HY3A 3LBAA 4HAUA 4HGYA 4C04A 1VPWA 4DEXA 3E35A 3UBMA 3GLFA 1CE8B 2ZANA 3BH0A 4Y6OA 4RO0A 5DCUA 5HE8A 1VXRA 1PJ3A 2V9PA 4DLAA 3T5BA 3BGIA 3H4MA 5B1YA 3M6IA 5C5DA 2Q2VA 3FF1A 2OOSA 1XTSA 3NYQA 1M1YB 4IIXA 2MCFA 3IR6A 2A94A 1IWBB 4NBSA 4PN3A 4DUYB 4I08A 3KXIA 3LIIA 4DNOA 4OSPA 3THRA 5HUJA 4AKEA 1V0JA 3ZV6A 5FV7A 5JQGB 3WGJA 4D42A 1XDBA 1CUCA 3LZCA 1SPBS 2HA4A 2Y1XA 2RD2A 4K86A 1AVTA 3ZCVA 5KOIA 1N34B 3NPAA 1ZJJA 2FJ0A 4COKA 3U19A 2RI0A 4UXJA 2R97A 4L4XA 4KNVA 1BEUB 1GV1A 2VPTA 4F06A 4KQJA 2XX3A 5CCDA 1NYRA 1CQXA 4E2XA 4PSUA 1EG7A 1ULUA 4LHZA 5K45A 4H1TA 2C0QA 3T94A 1LPOA 2EFGA 3HJCA 3VSDA 5CD9A 3HKCB 5THXA 2FFJA 1F2DA 3B60A 2CFCA 4DAEA 1KMCA 4KLAA 4YA6A 2VBFA 2GTIA 2VPWA 4CUKA 4ABTA 1S96A 1X1EA 1TMYA 1TQ6A 3G0CA 4O2LA 3DDUA 4JB8A 5JADA 1VJGA 2XUOA 1YT5A 2YCBA 3DKPA 1QIEA 2Q6TA 1S4QA 4FTWA 4KUEA 1SUFA 1ZZGA 4XB1A 3WGZA 1AO3A 1LNSA 3B36A 4XVRA 1BE0A 4F38A 4HQRA 5D87A 1DO2A 2LZ0A 4QXAA 4OQNA 2C54A 4MV6A 5HBGA 4XIYA 2PR2A 3N1UA 1SRQA 4M55A 2CDRA 4DMKA 2QT0A 3DE4X 2QE7D 3VJKA 4OLJA 5ISMA 5EXPA 5DK6A 3ETLA 1Z6ZA 5GOZA 4FDVA 2W2TA 1UKAA 3F4KA 3R9WA 1EQ2A 1P5ZB 4L8VA 4FXPA 4YCJA 3OOSA 1L6RA 2I5PO 5CEEA 1OFTA 2J4CA 3JZFA 2Q5EA 3FSJX 4YDQA 2WP8J 4BFYA 1I33A 4A2CA 1EJ0A 1TU0A 4MGHA 4C6HA 1Z5NA 3LPLA 4C7OB 3AKZA 4NDZA 1H3FA 2CK3A 1KIMA 1H5NA 1TCAA 3DCNA 3C5HA 1A77A 2RG1A 5EXTA 5LYJF 2ZKIA 4B33A 4LQCA 1A9YA 1OIVA 4YO8A 4E21A 1SK9A 3VSBA 4GDFA 3WNVA 3SVLA 3PDWA 4ROTA 5HIKA 1JHUA 4KAXA 1BH6A 2PMKA 3DJYA 2R44A 1ULHA 5L3SB 2XUGA 3E7DA 2QSZA 2WIGA 3E9DA 2JFNA 4JLKA 4LA4A 4YN3A 4TRRA 5H82A 6CHYA 3PD0A 1GU0A 4OP1A 1K7SN 1TUIA 4KLRA 4ZOQI 4E1BA 3QJYA 3F73A 2WTEA 1RJDA 4RADA 1KZHA 2ZI3A 3ZWPA 3N76A 4DFDA 1Z7BA 4TLDA 2HQ1A 2V58A 5KI6A 4BNGA 3T3MB 1L5OA 2QL5A 4WNCA 1EFTA 3K9QO 4QPCA 4UDYX 1Z0ZA 2VKQA 2YTZA 3K8ZA 5CXXA 5FKJA 2IUUA 4GXNA 4IS3A 5LLDA 4MO9A 4S24A 3USZA 3VKHA 4GBMA 2VRCD 1MB3A 4LBZA 2J5KA 1AV6A 2XD9A 3EGDA 2FJPA 1EQUA 2WD7A 2P0EA 2V5VA 3NPMA 1PS8A 1M8KA 2XUHA 2VP5A 1D0VA 3NWEA 2PMDA 3P5BA 3SR4A 2CLOB 2AFIA 4HAVA 1MX3A 3OPMA 3OJOA 4FGSA 1RC8A 3NTQA 1WW3A 4M76B 1XK6A 1RZRA 4M88A 3RAGA 4ZXPA 5CRIA 3R5JA 3RVDA 1Z2CA 4HN9A 1DGQA 1E1RD 4JB0A 4X91A 4CLEA 4DQKA 4H35A 1ISPA 2AFHA 2EG9A 1FDWA 3RBAA 4N0DA 3OCXA 4B6GA 3E0XA 1CNEA 2R4UA 4UD2A 2A59A 2XVXA 3LCUA 3NCTA 4FHGA 1M6YA 4RQTA 2ZS9A 2XECA 2AG8A 2PR7A 2QRJA 2C5SA 2DWCA 1Q6ZA 4A2PA 4FX2A 2KJQA 1MPXA 3B9RA 4XYMA 4AQDA 2C2BA 1VGQA 1A5ZA 1YZGA 1JPVA 4ZYYA 4UQOA 3K73O 3MB5A 2SHKA 3N0XA 3KVOA 4ZDKA 1U6IA 2L42A 4CM6A 4FK8A 1L4MA 2FW0A 3AEUB 5CK4A 3T3GA 3VM6A 1V1RB 4BFXA 1GNPA 2H4ZA 2ZUDA 2H0QA 3KD3A 4MW1A 2OBYA 3A2NA 1JALA 3FWYA 3PHGA 1QFJA 3RFFA 1N2IA 3C4VA 1XTVA 4OMFG 3OEYA 2QNIA 1DO0A 4G1UC 4GOKA 2AI1A 3AUSA 3JZAA 1CRQA 4KRXA 1QSGA 3T9CA 1DAHA 1E7QA 2E2WA 3FKJA 4MUYA 3SYLA 3A10A 3H75A 4QSMA 4I55B 2AFHE 2BKXA 4OUDB 3ZU5A 1CYDA 2HIAA 2GMWA 2JFHA 1DWPA 4FMBB 4MYCA 3WNZA 1E6UA 1OI3A 1UF9A 2MR6A 3L1KA 1K7XB 4BX3A 5A5DA 1HL3A 2PNFA 4QNMA 4MRAA 2PPLA 4RLQA 2V9ZA 2OFPA 3ZHBA 2QTZA 2FSUA 2NU8A 1T5DX 2JFQA 3NM6B 4FNAA 1B8PA 1XEWY 1M3SA 1EA5A 1JXAA 1PR0A 1S8OA 4OGGA 4RNDB 3G3EA 4B83A 3DULA 3ZZUA 4ALLA 4YRNA 4OBXA 3PVCA 4XA8A 3E5MA 3D59A 4REQB 1YI0A 1T3TA 1UC9A 2E4AA 3G2LA 4OI2A 5JARA 3SBOA 4AJ9A 4YLEA 4FOTA 1DS6A 1TAQA 4BO9A 3PGMA 1LH0A 1BHQ1 4P3PA 2OV6A 3K2BA 4EI9A 3OG9A 3TLGB 4X3OA 3TB6A 1Y63A 4WD3A 1XD2A 1D2NA 4ED9A 3KCNA 3IP3A 3KWLA 4BNIA 2J0EA 2A9OA 2XJ9A 1KDPA 3DEJA 3K5HA 4QBIA 5EUQB 5AT1A 3C8HA 5AXAA 3V3KA 4ND7A 4XXHA 5K20A 4PC3A 4B8ZA 2ZUTA 2YHUA 1KHHA 1X7YB 2WSSA 3OZXA 3RNLA 4BMXA 2OAQ1 3NHSA 3HV0A 2NOAA 4J3JA 4RQAA 3TAHA 4F5WA 2H18A 2VAPA 3G9TA 3X1YA 1UXKA 3D3WA 1LW7A 4CEJB 2Y3IA 4ZDIA 3AHFA 3INTA 1PK8A 2AHRA 2CNOA 1YQTA 2MINA 2P4QA 1B73A 2P2YA 3DM9B 1MC5A 4ZOBA 5KX5B 1M33A 1USVA 1XA0A 3CS3A 3NBFA 4PLPA 1MZVA 4U7FA 4I4TF 4ZV7A 3WP1B 3UWMA 2YWCA 1XMOB 1ZAKA 4IFEA 1P33A 1RPJA 5GIOE 2FUKA 2VQSA 5LWHA 3HE3A 3GFRA 4C0WA 4RU1A 3ZVMA 4P7FA 2QL7A 2G76A 4XSGA 1AKYA 1RWKA 4OO3A 3PL5A 4B7UA 3WADA 2R6AA 4V03A 4ZOLF 2YY6A 3HDTA 1W35A 2OD9A 4FONA 4HTFB 3IURA 2VN8A 3PRYA 4LY9A 1RRGA 2AJLI 3GWGA 3PF8A 5REQB 4PC7A 4NEQA 3V7YA 1N0WA 1CHNA 3UY4A 1KC3A 1YQQA 4FFWA 4DAOA 2WUGA 1FNNA 4DVJA 2YS7A 3JD1A 3MG9A 2ZI6A 5CVJA 1HE1C 1EUCB 3O6VA 4PYJA 3CF2A 3ZV7A 3CM0A 3GJ5A 4MWZA 4IBOA 4CN8A 3G2KA 1OT5A 1AM4D 3DZBA 5A1TA 4KN8A 1CDOA 3CNOA 1UDXA 3ROZA 1U8XX 2PK3A 3E8XA 1M1NB 3S7ZA 5KNLA 3THWB 3OOHA 5IDQA 5K3BA 1Q11A 2IW3A 1NXWA 2B30A 1E7MA 2G40A 3MPUA 3MOIA 4MOWA 3BQNB 2XNKA 4UHFA 5C9ZA 2QRMA 3GJYA 4GKVA 5DXJA 4BQQA 1BDMA 2Q3FA 4HYYA 4JVSB 4DC1A 1E3LA 1F0YA 3D81A 2D1FA 2OCIA 2UZ0A 3GCXA 4QPZA 5CNMA 5EN4A 4OLFA 1RYYA 2YH2A 3HDVA 3SHVA 2PYDA 1KFCB 4JDPA 2OO3A 1DADA 4FE4A 3MC1A 1A7AA 1X1TA 2P0AA 4P38A 4RD0A 4ROSA 4XX1A 1NXTA 3T5PA 1IBLB 2JCXA 3EGXA 3C3BA 3JVEA 4G65A 1X8LA 5D3QA 1PJ8A 2DQ4A 3GJ3A 4O25A 4LJ6A 3PHJA 4JJ6A 3C14C 1GZ3A 2OV4A 3WB0A 1NW7A 3LKZA 1N92A 4EW6A 2JIPA 4IVRA 1N9GA 3GGCA 2AV6A 2GZAA 4JH0A 2WICA 4J1TA 4DLZA 2HQBA 2QMUA 3IULA 4HDSA 3A4NA 1DB3A 3G0BA 5IVDA 1XNRB 1BHJA 1I7PA 1PGOA 1G7SA 2W98A 2GR9A 3CV3A 3BIFA 2AQIA 3D02A 1MV5A 1FTYA 1KYYA 4OJKA 4B2YA 1N5DA 4FW8A 2ZT7A 3B9PA 1REQB 3OX4A 1DWQA 4LS3A 4Q9LA 3S6JA 4MCAA 3ROTA 4DRZA 1PP4A 4RTOA 2M32A 2K87A 1K8QA 1DTSA 3L6UA 1T6ZA 3IMCA 1K27A 2VAWA 1VCOA 1MORA 1Y81A 3IXQA 3N0TA 2BGGA 3IVMA 4Q0MA 4ZZ3A 3WNBA 1WSAA 1II0A 1MFPA 2IPNA 4B84A 5BT8A 1MDBA 3CQ9A 4BZZA 2D5CA 2NTVA 3N8DA 5K8LA 2ZXUA 1AZSC 1R6XA 3OLVA 4FYYA 3JASB 1YIOA 1YOVB 2QIOA 3PFGA 5DJ5A 4CQLA 4D99A 4K0RA 5LBIA 4IIEA 3ZGVA 4RXTA 2WB2A 2HJ9A 3KHKA 3M6AA 4HH0A 2RH4A 1ZUIA 3UICA 4H7HA 2X2FA 1OHHD 4Q18A 1QHEA 4GSLA 4PGAA 4PRZA 1JKJA 1HY3A 5LD2B 3ZU2A 4MRPA 1PX2A 2XUIA 1E63A 1F1JA 3ESCA 5C52B 2AG1A 1Y0BA 4Y2SA 2Z6AA 3Q40A 3CKLA 4NMXB 3MD9A 4LNUB 4UMFA 4XH9B 1MJGM 5EP3A 2RHLA 1UT5A 1VSVA 1NBWB 4Q37A 1YWGO 3ZOZA 2LR0A 1C29B 2CD9A 1ZJ5A 3AJRA 1NONA 2DUMA 5FBKA 4D4KA 1YIAA 1SCUA 2VKTA 3RADC 5HW0A 4ZI7F 1WNTA 2CJYA 3HHEA 4S1PA 2RGDA 1T6BY 4B3GA 1LTQA 4MW5A 4TTPA 2ZAIA 3GCDA 1U7TA 1IOLA 2HU8A 3ZKWA 1U9JA 1AZTA 5FA8A 2GESA 3EVAA 2OWEA 3ZGXA 3M2PA 2O0JA 2ST1A 3BE4A 3CSDA 4G23A 4NECA 4NS4A 4R8RA 4BO1A 1SKMA 5FTJA 3BH7A 3D5QA 4JUAA 1HZZC 1E1DA 4WACA 5DBOA 4IOJA 2P68A 2WM2A 1M1YE 3ACDA 4YP1A 1PWHA 4GX1A 5BSEA 1N4DA 4YUYA 1Q17A 3W2TA 4QOIA 3S2IA 3HWRA 2FEXA 2JF0A 4PLCA 1S0UA 1IVSA 4GPAA 2W2OA 4MB2A 1RI2A 3I4CA 1KR5A 1X3LA 4BO2A 4BASA 4S1VA 1PGNA 3V8VA 1TQDA 1VIYA 3GJSA 3HCCA 1R8QA 4P31A 1CRZA 1XQXA 1A9PA 3Q11A 4F9FA 4P32A 2PEZA 3LGXA 4URUR 3U56A 1J8DA 4BXOA 3JATB 3UJHA 1KEUA 1GNSA 1FW6A 1Y7TA 2EJCA 2Q1WA 4D97A 4HDNA 4J1QA 4NZMA 3U4QA 2N47A 4LY3A 3OKPA 4D4MA 1LZLA 3ZIUA 2RAPA 3I6MA 4Q9HA 1YO6A 4CN9A 1BWSA 2ACKA 3CURA 3DBOB 3EEFA 1CRLA 2P91A 1OH7A 4ZN6A 1YB4A 6LDHA 5I6DA 2GTPA 1VPTA 1SKAA 3MBIA 1BS9A 2IFTA 1Y9JA 3KZOA 3OQJA 4PIVA 4R1PA 3UXEA 1L7DA 5KQRA 2Q3CA 1PTKA 1MX5A 5CFQA 3I2YX 2Z5FA 4JYCA 1JPUA 2HGZA 2QT9A 3V9AA 3E4DA 2JD1A 4BIIA 3EF0A 1XTIA 2I78A 2LPMA 4NV0A 1P6XA 5FTNA 3BRWD 3H2IA 4LXHA 3FR7A 4B8YA 3IBYA 3TW4A 2HL6A 3FFXA 4G25A 3TQSA 1JFSA 1TM5E 2DT5A 3GEIA 3DNMA 5AH0A 3ZCSA 4WK0B 1OOEA 2WF8A 1NM5C 3C3AA 4PWZA 2PUBA 4QT4A 1E62A 4OHYA 2ZSFA 3RDPA 3F6YA 4YJGB 2QTTA 1WDMA 4UHCA 4XTRA 4AJ4A 5AESA 1C1YA 2JJ1D 4NLLA 2A1UA 3QHPA 1SQSA 2RI6A 3BGSA 2C3YA 1LVHA 1H5UA 1T15A 1T3ZA 2G07A 2BZGA 3C6MA 3PHIA 1QHNA 4OVKA 2ZIAA 4C07A 3V8MA 1M7BA 2B4AA 3OFVA 5DN6D 1LXCA 3KQPA 4QATA 4IKEA 3KV3O 2PVCA 1V1MA 2O0KA 3AL2A 3D7MA 3JWPA 5BSRA 2P8SA 3RUCA 1SUEA 2PH3A 3KELA 1KEZA 1D8TA 1VIAA 2HLDA 1POXA 3L0DA 1ZGBA 3BDIA 2I9KA 3WIEA 4YGYA 1VL1A 1CPYA 4BQRA 1P91A 5CUQA 3G8BA 5DI3B 3TLYA 5DVZA 1XN1A 2P3LA 2QY9A 4L9AA 3VR6H 2GKGA 4O4HA 3ZG6A 4FEEA 4BC0A 5KWSA 1AGRA 2HWWA 2Q7XA 2XI4A 2Y93A 5D3MB 1PV2A 4HNAA 4F6LA 1P0MA 1ILWA 3BF8A 3PEEA 5CJPA 1KU6A 2IYNA 3E9CA 2IYAA 3EZGA 1ZGJA 3NT5A 5FI1B 2Y0DA 4FZRA 4BBAA 3ZVNA 5AXCA 4WLEA 1M2JA 4NNPA 4YBRA 3AH8A 5EJEA 5JJ5A 1NRIA 5B64A 3HBFA 2DJIA 1TEHA 4N54A 5JECA 3R4CA 1JEYA 1ISIA 4E4TA 3LPMA 5ENZA 5JCOA 2XOKA 4H3KB 3EPKA 3REOA 2GVDC 3ZWVA 1RLJA 2VNHA 4OHUA 1W5SA 1AKQA 2HO4A 1HYEA 2VYQA 4I1RA 4PXYA 3RVNA 3V8NA 3KOWA 4D02A 2YUIA 3QV2A 4TWJA 3NM4A 2J30A 2X9LA 3VPDA 2BKUA 3FDZB 2VAMA 2ZCVA 1OWLA 3KK0A 1KH3A 2CMGA 3FCEA 3AEYA 5CNKA 2Q4EA 3L02A 2IZ7A 3WIDA 2ZI4A 1R5BA 2H1CA 2EFJA 3FUUA 3KFVA 4OHWA 1CIJA 2CUTA 4JBLA 2QR2A 3ES9A 1JFFA 2DUJA 2LV8A 2Z8ZA 2ZJOA 3KJNA 4OLHA 3CUUA 2W6CX 4L72A 4WWHA 4CMHA 1QRDA 2OL4A 3FPBA 1PJ2A 3BXPA 2DP4E 3M7IA 4HH1A 5AKZA 4ESOA 4L22A 2C97A 3LYAA 4QXMA 3RROA 1Y7IA 3DMYA 2HSDA 1LJUA 2P6PA 1RABA 5JS2A 1DQRA 3G0OA 1LRJA 2XXJA 5GZ1A 3EWSA 3AR4A 3RB8A 4X3CA 3RVJA 3TAUA 1Z6YA 4BGEA 1DT5A 2PZLA 1JKMA 2RK4A 3C7TA 1KAEA 3FWNA 3IJ5A 4FFOA 5ECGC 3EUEA 3IP8A 2CKDA 3M9XA 5J58A 3PJDA 4BNVA 5AOAA 3NTRA 4EKNB 1DV2A 1S4MA 2OBBA 3I6ZA 3QEJA 4ZKEA 4WZ6A 2GB4A 1GARA 4HEA1 3S99A 1AB6A 4TV8F 1KQNA 3TQQA 4KQCA 8OHMA 3KEOA 3HM2A 4HEHA 2ZR8A 4NENA 4FSHA 3HU1A 1GP2A 2P62A 1O8BA 4LRQA 1E0SA 1LJ8A 4JYMA 3R6GA 4XR4A 4FEAA 3FTFA 1E2BA 3ZYZA 2HCBA 2HBYA 3UOGA 2OPHA 4DNFA 2Q6LA 2B4RO 2E37A 2AB0A 1G1AA 4GP7A 4P83A 4KR7A 3CZCA 2O3TA 5TGDA 1U0OC 2CLMB 4C5AA 4E5DA 5EYPB 1Z5UA 5BWMA 2GA8A 2WJJA 2WTMA 3NG1A 4PV7A 2CLHB 3WLFA 1KK2A 1L1EA 4DEVA 3HDYA 3QGMA 2O19A 2X19A 3A0RB 2FPIB 3W9YA 1SBCA 2Q4DA 3COPA 3CWQA 1GNTA 4F6RA 2WNIA 3WQQA 2HD4A 4F96A 2VJAA 4JODA 4OFWA 3RT7A 4OG2A 4DIDA 2FPSA 1PBTA 3LYUA 4BMCA 2JRLA 4XX0A 2HMVA 4HJRA 3JY6A 4A7PA 2JI9A 3HCDA 5BVGB 3Q5DA 2KPOA 3GRKA 4HDKB 1ADYA 1SBQA 1W4CA 2LKDA 4PYNA 5AOVA 4DMUB 1O77A 2IUFA 3MGKA 4O4JA 2FR8C 3O47A 5GZ6A 8MHTA 1VHJA 4UQLA 1YCDA 1GGJA 5HSGA 5GJCA 4GPD1 1L1QA 4JLDA 1GKKA 2HMWA 3OE5A 4QYTA 3TECE 3Q2OA 5B2FA 5F5XA 3WS7A 2NP7A 5IU6A 1XB2A 5EWJB 1O8CA 2GEBA 4LE2A 2JCGA 2R6R1 1C9NA 3AETB 1X7XB 1BEEA 2DJ5A 3N2EA 3KOZA 3ZWCA 3OTHA 1PGQA 3OA0A 1OCEA 4IIGA 3FLAA 5TJ9A 4BHTA 4Q1VA 3O74A 5LZ2A 2MYTA 1E79D 1VYVA 2GRUA 3KTOA 4ESEA 1Y5IA 1E89A 5AVSA 5ICMA 2G9UA 1H2BA 1YH3A 5KNBH 1KDVA 1QVVA 3JD4A 4V3BA 5IJ0B 4S04A 3ORFA 5I47A 1L4UA 4WQMA 1IATA 1Z34A 5K1ZA 1CFJA 2NPFA 5CB6A 4LHSA 3G82C 1PNVA 4OYHA 4CG0A 1M2OA 3UT5B 3K2QA 1E9BA 2DG2A 5LLSA 1J1ZA 3AYXB 5BT9A 1F6DA 2GXAA 1BVYF 3NIFB 1WSWA 3K9CA 4PGGA 1MABB 4R1SA 3FUVA 3BZBA 1WUHS 4I7EA 4AKTA 4F5EA 2PLAA 2E4UA 3GN1A 1QHHA 1Y80A 4QOGA 3OM8A 4EG8A 5KQMA 4Q4HB 2PRSA 2XYPA 2PPVA 2SECE 2AJDA 3I58A 4TS1A 4F91B 1JZTA 3K0FA 1O58A 1YKSA 1I94B 4E70A 3VKWA 2IQIA 4CKWB 3I9V6 3HN6A 2BDUA 4GE0A 2ZE6A 1OXMA 1I4DD 2CGEA 2A7QA 3E8SA 3DT9A 4C21A 2WWXA 2QGZA 4M1SA 5ALXA 5IT9A 4LV6A 4OSEA 5DP1A 1EGVB 1P7YA 2G7MC 4KO3S 4DA4A 1BYIA 4W5NA 4A0RA 1VE5A 1F17A 2FX5A 3GVCA 4G9EA 4HDRA 3OICA 2GK7A 1FVOA 3NONA 4G56A 1UXHA 4PY2A 1U7HA 4JR1A 4M8IA 2EIHA 4CIDA 4EG6A 2KI5A 3PGA1 2G5PA 2HX1A 3L1HA 2BFCB 1QOZA 2PANA 4K5QA 3ETNA 3O91A 4Z6KA 4B87A 1YXMA 2B83A 1VYUA 3IDQA 1HX7A 3ZZNA 2GPTA 1BO6A 4HQOA 5DGXA 2OC9A 3BXFA 3RTEA 1F4LA 2HRDA 1OTXA 1I01A 2FP3A 4P4TA 4WTOA 4WN9A 3ZE1B 3TF5A 4IDHA 3C97A 1EHIA 2FX2A 4V1CI 1MXFA 1Y1PA 3CKKA 1DQYA 5EE0A 1JIQA 4E51A 4DDMA 4GWLA 1W88A 2XDYA 2QRKA 5CFMA 2KE5A 1X13A 1YMUA 1B16A 4ON9A 4KIWA 1YC2A 3CXUA 4DLUA 1O89A 4DLRA 3MS4A 3P1JA 2QUHA 3W0LB 4BP1A 2OP1A 1DZIA 3EK2A 3KQLA 3PNKA 3EY9A 4G3XA 1Y7LA 1ZBQA 2Y2UA 1LPAB 1W5BA 3IHLA 2ZB3A 1ACLA 1N5MA 4H4DA 5LMCA 5IN5A 3AFGA 3E6AA 4WOPA 1TK3A 2JLAA 1TF2A 1VL2A 2XUFA 5DYGA 3KTFA 3HUUA 1Z5WA 1BHSA 1KI6B 3M6MD 4OJTA 3Q9UA 1IE3A 3DE6X 2D59A 4Q4JA 1U1IA 4E32A 2HK7A 4EZBA 2DFNA 1RLOA 2H2WA 2ZLBA 1BKSB 1F48A 3O7MA 4LOAA 4RL4A 1FDSA 1Z9BA 2H31A 1AS2A 2WF7A 1L5KA 3RIXA 3ZXYA 4BN4A 4YR7A 1OFUX 1Y3CE 3I72A 2JFBA 3IAM1 5T67A 5CCBA 1ZIXA 2DYKA 4HS4A 4JC4A 5AW4A 1Q74A 3AHCA 3H5IA 4A6EA 2HU2A 3I2KA 5ARCA 4MYSA 2X0NA 3T95A 1UBRS 2QQ5A 5E7IA 4FX5A 5F3RA 1SHLA 1E8MA 1BXGB 4IJ5A 3ASUA 4Z8XA 1EE2A 1XGKA 2P67A 4Z9FA 2C9MA 3SHQA 3JYPA 2QE7A 4CF5A 2JHFA 2PGJA 4IYJA 3MT9A 5JC8A 1PUIA 1ZK1A 2J07A 2Q6KA 3C1OA 3I76A 4FFVA 4PFKA 5JAIA 1H94A 1U8UA 4MRMB 5JVDA 3PLAE 1QR6A 1LVGA 3ZY3A 1KY3A 4RUKA 1VG0B 3UV6A 2ADOA 2CWDA 4F4CA 2ZYWX 2P9TA 5BWBA 2VHWA 3IRUA 3ILVA 2Q50A 8ABPA 3GJXC 3KRTA 1O95C 3RHSA 1TUBA 2H11A 4RYLA 2N9UA 5AUQA 4EMTA 1M5UA 2ZETA 1GLVA 1N0VC 1UBNA 1NTOA 1HYGA 1XCPA 1JLLA 2VEOA 4L2IB 3WIUA 5BW8A 4G0PA 4Z5XA 1DV1A 5FL7D 3U4AA 1ZC3A 3ZD6A 1NMZA 2C4WA 3W6PA 4HX9A 4DT1A 2G4LA 3FWKA 4YCBA 3CISA 2P90A 3NHPA 4D4LA 5C8YB 4OKSA 3R3JA 4J7CA 4Z7JA 2JS7A 1QH8A 1IJKA 1QVZA 2EKQA 3KT8A 3SS9X 3WNDA 1YONA 2Y0PA 4RBNA 5DGCA 3M3DA 5GJBA 4LK2A 4O0LA 1NASA 3H42B 1L3IA 1SC1A 4FFLA 2XQJA 4HNVA 3GO4A 4IIJA 5A0VA 3C43A 4J2OA 3OJXA 4C76A 3ICQB 3LNCA 2XMDA 4DIBA 5F7ZA 1E8NA 1NI4A 4FCWA 1E3SA 1GEGA 2YUTA 1PFVA 1LF0A 1LLDA 1T8RA 4DLLA 4MZDA 3SG0A 1DLIA 3GT3A 4BB6A 2C98A 2XB4A 4BQOA 2HSJA 5HZHA 2VF4X 1P1KA 1K8XB 5AM5A 3M4YA 1M6WA 1R7RA 3LX8A 3RC2A 5C1DA 4N18A 4K1XA 4Q24A 5JS6A 3PHHA 3NEJA 1NZFA 1VB5A 4PZ9A 3LXMA 2P6RA 1ZD8A 1U0FA 4GM1A 3NWJA 5JSUA 1WZNA 2EATA 2I6UA 3OIFA 4I5EA 3WWOA 1G8MA 1M1ZA 5DTJA 3Q3VA 4G63A 3PPYA 4G89A 1A9TA 2C58A 4Q66C 4BWVA 1U3FA 4WZBA 4O2AF 4FSDA 1BCSB 1PNTA 1ZQ1A 3D4LA 4H16A 2BEVA 3TX2A 2X8AA 3O4HA 5FI0B 3DHYA 2BI7A 4LMAA 3GD5A 2E85A 1N7GA 1U1FA 3OP1A 3MTQA 4M86A 2QPTA 3WGOA 3INRA 2QROA 1UZAA 2BMDA 1BFKA 3M6FA 3CG4A 1HURA 3JVVA 2J7PA 5J2TF 2C7PA 1U2RA 3JQDA 1SZCA 4B85A 2QTFA 1NR1A 1KQGA 4LPKA 3LP5A 4AJOA 2NO9A 3PNBA 3AG6A 4C6SA 3ZDDA 1MD9A 4OHFA 5JOQA 2BM1A 2CYAA 4FGWA 3M3PA 4B31A 1Z7GA 5ITVA 4KHPB 1XTTA 2GJ8A 2XZOA 3L1VA 2R6HA 3CT6A 1GAJA 4IS2A 1ULAA 3ROQA 2HV8A 4KVFA 2FZGA 4WHMA 4LFAB 1NQXA 1Y34E 2R1VB 1X92A 2PMWB 5KOHB 3RRJA 3TE7A 1KSFX 3LLSA 4IJVA 4UTPA 3TZBA 2WD9A 1T9AA 1EVKA 3U3RA 5KTOA 3Q0IA 1IONA 4F12A 3IMGA 3O8OB 5JAPA 1M2NA 1SZDA 2A30A 4ZQEA 2CB9A 3S55A 1XLUA 5GM2A 5A7FA 2F3QA 6NULA 5DHAA 1KL7A 2R47A 1IPHA 1ZHOA 1V2GA 2AKYA 2PKWA 3L0OA 5EKXA 4X7BA 1U0RA 2FNAA 4WZBE 1SKQA 4IQ0A 1FFCA 4ETIA 3SIXA 4A9AA 3AJ9A 4WY8A 4CM4B 3Q1LA 1BXZA 2E4ZA 2XUZA 1R66A 5CH5A 1WXXA 3K1AA 1Q2XA 2I34A 4H4CA 1J7KA 1UOQA 5BN4B 4H15A 4PLVA 2Z4SA 2NYVA 4ZOCA 4CBVA 2C8LA 2H4HA 3JAWB 1XVLA 2NO7A 5JZOA 1H2ZA 1RLTA 2JEZA 3DQPA 2C96A 4O4LF 1GGEA 5TGZA 3ORYA 1GRVA 3BK2A 4LQDA 3PYMA 3OPNA 2NPIA 3VISA 4CLXA 4D0LB 1YDGA 2MSLA 2WJVA 4NU6A 4TMFA 3QX9A 1SCNE 2FE1A 4ISBA 2EFEB 1BOOA 3R9IA 1D3AA 2FZWA 3R9KA 1J5EB 4BB5A 4FE7A 3R3ZA 5LA6F 2FCAA 2HWKA 4TT3D 1W1UA 1CETA 2YCLA 3FDXA 4Z8YA 1XAIA 3GLFB 1ZVVA 3G2PA 5GGYA 3EGIA 1RYHA 3GMDA 3PQ5A 5I9BA 3K9BA 2GCNA 3QELA 4PBTA 5G0UA 2OYRA 1OT3A 3B3QA 3DEHA 1PEKE 1NW4A 1PSDA 2F3PA 5AVWA 4WEOA 1ZD1A 2G04A 2WABA 1L5LA 3JTMA 1WETA 1PT5A 1G8GA 1X7WB 1YFJA 1SXJD 1NLUA 1CUSA 4F4JA 5IJ9A 2OO5C 2FW6A 2I2XB 2PFSA 5FLYA 1STOA 3GHHA 3QZUA 4DSOA 2PAAA 3F7OA 5DGTA 3I05A 5BSMA 4BZXA 1OA0A 4NMHA 4ZEVA 4BMVA 1OXVA 1Q95A 4J6FA 1GG9A 2ZIXA 3KYDB 4MUNA 5E8JA 2W2KA 3RRBA 1XEAA 4DQVA 5CDTA 4KQHA 4OGWA 1JJFA 4M7OA 3WRVA 4HMPA 1H8HA 1WDKA 3O8DA 2FRDA 4YI5A 4AKSA 4D3XA 4W1SA 2AHOA 1PDOA 1NSYA 5LP6F 2XAAA 1CULC 2FE4A 2PQ0A 3DHVA 3IXMA 4UMVA 5CD1A 3TEJA 1TPYA 2QYTA 3FOCA 1PT7A 2OLKA 2IYQA 5LKRA 4M8NE 3DMRA 5K4AA 3FGPA 5GONA 4NXMB 4BS9A 4D80A 1P77A 1W5EA 3L8DA 3MOGA 1YU9A 3R3XA 4JJKA 1CF4A 1O94C 3LQFA 4AROA 4FYMA 4MWCA 3UMGA 1BXKA 3W9SA 1RTTA 3QEMB 3R0QA 1AQLA 2ZPUA 1DDIA 2P9FA 4TVKA 1OI4A 4YB8A 4N65A 5G0WA 5KTNA 1I2AA 3B1XA 4L8YA 1VPVA 4X8HA 5HHTA 4IKOA 4J0QA 3T1VA 3U9TA 1T0PA 1WO8A 3NKFA 5EHXA 1NXXA 3U5ZB 3UPUA 1D1PA 2HJRA 3JVUA 1BFDA 1CF9A 1PZGA 4FYKA 2AF3C 5ALFA 3PD1A 1G3IA 2IKSA 1FMFA 3LL7A 1DBSA 1MRZA 3RG2A 4V2IA 3TUJC 1NBMD 1S6YA 1ITZA 3EQZA 4L07A 1RACA 1XVAA 2ZSDA 3QVOA 4R7GA 4EIWA 2WD8A 1V25A 1OXUA 4MUHA 2JGIA 3MIIA 5CX4A 2B4YA 3ZK8A 3MRXA 4BO7A 1ODFA 4CVNA 1EINA 1ULTA 1U9CA 3IXLA 1EGMB 4LYYA 3EPRA 1MA0A 3MS2A 1D2EA 3T1TA 4HHEA 4ZVMA 3HWSA 2E55A 2XRMA 4XM2A 1MX9A 3Q88A 4LCBA 5HNKA 2I4OA 2WSBA 2QQ0A 3QM1A 3Q3CA 3GARA 4MP8A 5CXUA 2BR3A 1EEHA 2H7VA 3TTSA 1JDTA 5KKCA 5HQJA 1Y5NA 4WK2B 1NW9B 4UZEA 4ND4A 3O8QA 3C7CB 1LBHA 1KTIA 1V11A 3DTTA 3PIDA 5I7HA 3U5TA 4KBYA 4D2IA 3PFHA 1VHLA 1RWMA 2AW5A 1M2VA 5IFKA 2GXQA 2H2FA 3GC6A 1P75A 1E1CA 3PZRA 1C3VA 3PCXA 2GF2A 2BFNA 5E4YA 4NTZA 5I5EA 4Q12A 4IDEA 2IZ0A 2R7LA 3C5WP 3U44A 5FPHA 1QFMA 2V5AA 3A11A 3FE2A 3E3LA 4PXSA 3CKYA 3HVJA 3I1IA 4LSMA 4IIUA 2AXEA 1E5QA 1VI6A 1DG9A 4RY0A 2IT1A 1Z35A 3L18A 4ZYUA 1PG5A 1UMBB 4FBGA 4Q00A 5JV5A 5AJTA 4N48A 3DO6A 2VVTA 3MRVA 2X9VA 4IILA 4NZPA 3AFHA 3ZS8A 5A2QA 2XNDA 2B8EA 1WXFA 1X7HA 4QG3A 3VZCA 3EARA 3IV7A 5DXAA 4E09A 3FZNA 1BGWA 1W9HA 2B37A 3QVGB 3DVAB 4KP7A 1ORTA 5CVUA 3SBEA 5JASA 1EP2B 4A2QA 4OYRA 1XAGA 4TV9F 5F23A 3QXJA 3IUYA 3C48A 2AFIB 4HS9A 4LE0A 4KR0A 4X8OA 3WYFA 5IH7A 4KAJA 2I7VA 3AG5A 4G0ZA 5IJZA 2M6LA 1OGIA 2WWWA 2Y71A 2QY6A 2G70A 3ORRA 3GA0A 3MTJA 1GCAA 1HBJA 4BGUA 1DFGA 3JW8A 3P9XA 4YWJA 4JWTA 1YNOA 5FIUA 2OORA 4IXTA 2JEOA 1D09A 4KEAA 5ALYA 2IV2X 4DCSA 2C3MA 5EESA 1OV6A 1Z45A 1J0AA 1R0RE 3L3BA 4C3UA 4DZRA 3I2FA 3IIIA 1IN4A 1VL5A 4FHDA 3SLGA 2O8DA 1A98A 3AEKB 4ZQHA 1RYEA 1RRPA 4EVRA 4X84A 2D0PB 5CDYA 2E18A 4C2TA 2PX3A 2IWRA 3G2HA 3N2IA 4MV9A 3T5GA 5A4FS 3AR5A 3X1ZA 5IH3A 1ID1A 2IVZA 3O9MA 4IOLA 5EFZA 2GSWA 1AUQA 3ZC3A 1U5AA 3RR2A 3FTEA 2V7UA 2QQFA 5BQ5A 1T25A 3A6FA 3C8DA 3O90A 2Z1NA 4KQKA 3E1SA 2G4CA 5LDGA 5SYAA 4KO1S 3A0UA 5ES3A 2FY8A 1VBNA 4PTZA 3RVLA 4YLGA 3W1VA 3WXMA 1G0NA 3FN4A 4I9UA 1PVOA 5EOVA 2YL2A 5EI5A 2QRZA 1JHOA 3FUWA 3JU3A 4ZT5A 2H17A 4AIRA 5GVSA 1QTNA 2QB5A 1XVUA 3IEVA 1RT9A 3I9MA 1Z17A 4RHCA 3TW8B 2WUWE 2UZ1B 3H6GA 3FAZA 3EW7A 3PITA 4OF4A 2Q2NA 1JIJA 3FNBA 1E98A 3KG2A 1MGPA 1II8A 1ENPA 1YV9A 2AXNA 421PA 3E9RA 4QNRA 4BNZA 3D6FA 1W0KD 4O5OA 5E1DA 3SX2A 3IEKA 1GLNA 1UPXA 4B47A 2BCEA 2QR5A 4IGKA 4J4BA 2BFBA 1E2FA 3G02A 3HJFA 4TKUB 2JGKA 5CNIA 1PR6A 4EVQA 2IGBA 4K3VA 2C7RA 4HVAA 5JD3A 2C3PA 1W76A 2DY0A 5K3SA 1UKEA 3H04A 3FCUB 5DRTA 4ZEXA 1FYWA 2C94A 3FNHA 3DFUA 1GSOA 1KY2A 1MTOA 1TLTA 4RD1A 3NFRA 3TIGA 4AWBA 5F7XA 4ALJA 2V6BA 4RV