4KUEA

Crystal structure of 3-hydroxybutylryl-coa dehydrogenase from clostridium butyricum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
280
structure length
280
Chain Sequence
MKKVFVLGAGTMGAGIVQAFAAKGCEVIVRDIKEEFVDRGIATITKSLSKLVAKEKITEADKEEILSRISGTTDMKLAADCDLVVEAAIENMKIKKEIFAELDGICKPETILASNTSSLSITEVASATKRADKVIGMHFFNPAPVMKLVEVIRGAATSQETFDAVKEMSESIGKTPVEVAEAPGFVVNRILIPMINEATFILQEGVAKEEDIDAAMKLGANHPMGPLALGDLIGLDVCLAIMDVLYNETGDTKYRASSLLRKYVRAGWLGRKTGKGFYDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (S)-3-hydroxybutylryl-CoA dehydrogenase form the n-butanol sysnthesizing bacterium, Clostridium butyricum
rcsb
source organism Clostridium butyricum
molecule tags Oxidoreductase
molecule keywords 3-hydroxybutyryl-CoA dehydrogenase
total genus 117
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.157: 3-hydroxybutyryl-CoA dehydrogenase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4kueA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kueA01
4XX0A 5KWEA 4DMMA 2DBRA 2ZYAA 4LSWA 3T7EA 5G0WA 3L4SO 4A2CA 4R5HA 1JWAB 1D8AA 4OXNA 1SO8A 4LN1A 1HDZA 2FWMX 3MJEA 3KZVA 3Q6IA 4GWGA 4NJMB 3AUAA 1E1KA 5B37A 4B4WA 4BNKA 1IZ0A 2OBNA 5TJHA 1HKUA 2NTJA 1GUFA 5B4UA 3MJSA 1HSOA 1NPYA 1LQTA 5BNTA 3UHAA 2DUUA 3GEDA 3GHHA 3JQDA 1YDWA 1ZSNA 3QVXA 1NVMB 4DMLA 4D7AA 3ENNA 3K8ZA 1HDXA 3DBRA 5TLSA 1G1AA 4IS3A 4GMFA 3D3WA 3C1AA 1HTBA 3SEFA 1ARZA 4AJPA 2EJWA 1E3WA 4F45A 4E13A 2WD7B 1NNUA 1U3WA 4IIUA 1B3BA 2VYND 4CMAA 2J5QA 2I3GA 3B6ZA 1FDWA 1NP3A 2B4RO 2O48X 4HNGA 5JXWA 1NTOA 5JMWA 2C5EA 2HK8A 2IZ0A 1A72A 2YV1A 3M1AA 3GRPA 4R1TA 1ZK1A 4QO8A 4IPTA 3DBHA 3IUPA 1XSEA 4NBTA 3DMYA 2WDZA 3LT0A 4EGFA 3OQ1A 4KP7A 4ND3A 4ZICA 3AU9A 4WJZA 1SC6A 2G82A 1T1RA 4DPKA 3ORFA 4IDEA 1Y1PA 3W8FA 3UH1A 1PJCA 5JDCC 1UP4A 4O63O 1PZEA 3GT0A 4E12A 1PU2A 2GN8A 4PLTA 3QE3A 1Y81A 3D3WB 3ADOA 2OBYA 3FNGA 3BYZA 4D0RA 3SJ7A 3RU7A 3PQDA 3GNSA 2YZ7A 3VH4A 5T6BA 4YJGB 4MVJM 2RH8A 1QLHA 3DOOA 3ZW9A 2I99A 1DJNA 3IJRA 5EL0A 3AM3A 4NJMA 4DWVA 1K6XA 2PD4A 1ID1A 1CWUA 3DZFA 2D4AA 3HN2A 4GBJA 3K92A 4LK3A 2J6IA 4WNIA 4Y6PA 3TZ6A 1UXGA 4E5KA 4PCVA 4BO0A 4EEXA 5L3ZA 4ZHSA 3VH2A 3AFNA 5CP8A 3VZQA 2XXBA 3KSZO 4BB6A 1PGOA 2BH9A 2NVUA 4L9RA 2V6BA 2W90A 3VHRA 3RBZA 3HDHA 4UEOA 1TXGA 4L73A 1PQWA 1OBFO 3VPXA 1HE5A 2YV3A 1ZXBA 5IG2A 1KETA 1EBFA 3LYLA 1PS9A 2B69A 2X5KO 1DIRA 2LDBA 2JAPA 3OFSA 3KLMX 2C82A 5CDYA 4CLHA 4XYEA 5C7OO 3BTOA 5GMOA 4RLSA 1E92A 5KNLA 3NGXA 1XWFA 1ZO8A 1ZW1A 2YQ5A 4YJGA 1NASA 1V35A 4RF5A 4BO5A 3C7CB 2P68A 4M8SA 4NZ9A 2IYPA 3QVWA 4EJ6A 4MJLA 4OAQA 4DYDA 1M6HA 3C7DB 1WW8A 1ADCA 1I3MA 4OOFA 1ZIDA 3G49A 4WKGA 1I36A 3UAGA 2BGLA 3O9ZA 3VC7A 2O23A 1P45A 2CVZA 1PJTA 2YQ4A 4KOAA 4B3HA 3I52A 3IKVA 3LVFO 3UVEA 2EP7A 3I6QA 5AOVA 1EUZA 1Y8RB 3OEWA 5JS6A 1E6UA 1C1DA 3C1TA 4WE3A 4N5NA 3TN7A 3H2ZA 2J3JA 4IGEA 1ZNQO 3H65A 3HG7A 4J4HA 3Q0EA 2P91A 4BNMA 4MP8A 1LDGA 2VHXA 3OF2A 4ALLA 1F8GA 3P2YA 1VM6A 2B5VA 4D79A 1LSOA 2FSSA 2PV7A 3KOUA 8ADHA 4TWRA 4TKMA 4QXMA 1HE3A 2VYNA 3U4HA 2X7HA 4WLNA 5BSGA 1DRUA 1Y8QB 4BB5A 1R15A 3H5RA 1W0CA 3D64A 3ZHXA 2DVMA 3O03A 1KEUA 2WYUA 4Q3BA 3QIVA 1BRMA 3QWIA 1NWHA 4M54A 1YBVA 3HZZA 2NQ8A 1VPDA 4IDGA 3I9LA 4YJHB 2HMTA 4KDEA 1GEGA 2DBQA 3ASVA 4A26A 4PN3A 3KM0A 2FPIA 2VRCD 3GVPA 3HADA 1RYDA 3ZHZA 4R01A 3KETA 4YAIA 4YPOA 4MVJE 4FR5A 3PJDA 4M49A 4BMVA 3KV3O 5G2OA 3FHLA 5JDCA 3DQPA 1LRJA 2B35A 5A5FA 3RC1A 3QRWA 2QHXA 4FFRA 3WMWA 4AJEA 1U4SA 3Q9NA 3DZGA 4Q9NA 4JROA 2Q49A 5AXAA 4A03A 4E5NA 4IXTA 4OYRA 5GY7A 1JKIA 4CM1A 4MINA 4I9NA 3EZLA 2I76A 2JFFA 2P5UA 3TZQA 1UR5A 4IQ0A 1M76A 3VVBA 2UUPA 5FI5A 2AEMA 2JCXA 1T25A 1MG0A 5L7WA 1BDBA 4BO4A 4RPLA 3TZCA 3E5MA 3MJCA 2PKRA 1OC2A 2YW9A 3H9JA 1BTOA 4KWIA 3S2IA 1EFLA 3DBLA 4AJLA 4WLVA 1XU9A 4A73A 5IAAA 3UOGA 1GAEO 4LRSB 1DRWA 3I3OA 3ZU4A 3ZWAA 4N5MA 4DPLA 3MJTA 2JL1A 3KSUA 4ZQEA 3F1KA 1XHLA 3HNPA 1UZNA 1EVJA 4RVHA 2CVOA 3KVOA 1DLJA 2ZQZA 4NBUA 4NHEA 3PHLA 2ZTMA 4LISA 4RF3A 4TVOA 3WBFA 2BFMA 1JU9A 3WOHA 4BNXA 1GPJA 5BQFA 4CLRB 2BD0A 3EVTA 4BKUA 1B8UA 1EQUA 1FF9A 1TB4A 5K0ZA 4O1MA 3GGOA 3WGZA 4YB8A 3KYCB 1ULUA 4BKRA 4NR0A 4EI2A 4R69A 4F3YA 1PGJA 1MC5A 2HSDA 4Q3AA 4LVCA 1W8DA 2OGUA 1HYEA 3RQSA 5CPFA 4ND4A 4IGFA 4ZRMA 2GYYA 4NQZA 3WLEA 1U7TA 5EN4A 3T4EA 1P1HA 3LC7O 5I7FA 2VCYA 1B8PA 1R0KA 1ZEJA 3LC2O 4CM3A 4WOJA 1T2DA 3DBLB 4OGWA 2WSBA 3VDRA 4BNTA 2X5JO 2PZKA 2NUAA 4MKZA 2GERA 3CIFA 1GZ3A 4K1LA 4LMRA 3SX2A 1ISJA 2ZTUA 1VSVA 1FXSA 3GC6A 4K9DA 2JKVA 1I3NA 2GGSA 2Q50A 3SC4A 3D7LA 4L4SA 3GUYA 3WLFA 4UUOA 3M2TA 3JQ9C 3JQAD 4FFLA 3EUWA 2GDZA 3G3EA 1V9LA 1ISHA 3TOZA 3TPCA 3W4JA 5JAMA 1GFSA 2PKQO 5F21A 2OL4A 3PGXA 3WX0A 1X1TA 2HU2A 1XLTA 4KUHA 3BMOA 4BO1A 4O6VA 5B4TA 5IDWA 4ZQGA 3W6UA 2D8AA 4N18A 5BR7A 3BHMA 2IEBA 3ZWCA 3I9OA 1GADO 1M75A 1CEQA 1GY8A 2Q4EA 2GZ2A 2Z95A 3KBOA 4J9UE 4WOKA 3TWOA 3TSCA 4JBHA 3V1YA 4NMHA 3CSDA 5I9LA 1EEHA 3RUIA 5FYDA 2H9IA 5L4NA 3OJOA 4Y8VA 1HDRA 1GCUA 2BF7A 2C2XA 4P38A 3QWFA 5F3RA 1CRWG 1PR9A 3UFXA 4BIIA 5LC1A 3KYCA 3I23A 2VQ3A 1JWBB 3ZWBA 1MV8A 3AWDA 3QLJA 5A1TA 5I8ZA 4XA8A 3WYBA 4J90A 4YT2A 3FI9A 4YT5A 1MFPA 1P44A 4DVJA 4QECA 1EVYA 1I0ZA 2W2KB 1XG5A 2H6EA 1BXZA 4CQLB 3JV7A 4NBWA 2Y93A 3DZJA 4CUZA 4MDHA 5EPOA 3NJ8A 4HKTA 1R4NA 1H94A 3SJUA 3DHEA 1K0UA 4BV8A 3CMCO 5BNIA 1K2WA 1P9LA 2QIOA 2ZQYA 2C54A 3WIDA 3TFQA 1ENOA 4EYEA 2PLAA 3FNHA 4Y67A 7ADHA 4FS3A 3HN7A 5ADHA 1H0KA 2R00C 4CMKA 1GV0A 3N58A 1UXHA 4KMSA 4RQTA 2VWHA 1NR7A 4FJ2A 1N92A 4RO0A 5BT9A 5B4VA 2XOXA 1I33A 1L7DA 1B15A 2HK7A 4YEDA 1ENPA 3JQ6A 3TZHA 5U1PA 5DNAA 4PG7A 3FPCA 3C3XA 5C7IO 4PLFA 3K96A 4P4GA 1Z6ZA 2IEDA 4EEZA 4EJMA 5JAIA 4PG8A 4QT0A 1T2EA 1X0XA 1T24A 4IDCA 4LCJA 3PP8A 1E3SA 3S2GA 1X7GA 4RPGA 3BTSA 4GKVA 4ALNA 1BHSA 5KTKA 2A35A 5LCXA 4BS9A 1F0YA 1T1SA 2VHWA 2X1HA 4B7UA 3OM9A 4KZPA 2EW2A 4U5QA 3KHUA 4HWKA 1YL5A 3OEYA 5ITVA 5HTOA 4ALKA 3DDNA 4DL9A 3OETA 4BV9A 5K6AA 3UW3A 1A9ZA 4NU5A 2V65A 2UV8A 3EVNA 5AXDA 1DBVO 3WWZA 4HFNA 4EUHA 1EK6A 5EQFA 2O7SA 1Z7BA 5IZCC 2CVQA 3U62A 3GOHA 4Z9FA 2Y1CA 2PZLA 4IM7A 4NK4A 3VH1A 4U8GA 4WLOA 2JHFA 3ETEA 1ZKMA 2FN7A 4YQYA 5HRUA 3EGOA 3GMSA 2O3SA 1R4NB 4UUPA 4E2YA 3PFWO 4J3FA 1NM5A 1MC4A 4IXWA 4OQZA 1R4MB 4FJ0A 3AUUA 3WQSB 4K26A 4O59O 4JQCA 2WTBA 2ZTVA 4BGIA 3L6EA 2TMDA 2R6JA 1U28A 3K6JA 3VZPA 5CAEA 4YBZA 2D5CA 5IDQA 1M67A 1BSVA 2VNSA 3E9NA 5TT0A 1IUKA 2VYVD 4DBZA 3WB9A 2NVBA 4KDFA 1RM5A 3RUEA 3UKOA 4I5FA 5ENVA 3TL3A 1LJ8A 2FP4A 2DAPA 3ZV4A 1HT0A 2AE2A 4UVIA 4CMIB 4B3IA 1DFHA 2NLOA 2RIRA 2W98A 4IJWA 3TOXA 4XIYA 2VRCA 4BNZA 3I6IA 1TT7A 4D42A 4XWYA 3DFZA 2WJPA 3OIFA 4ITUA 2FR0A 1UXKA 4FCCA 1MXHA 4WUVA 4HV4A 2AMFA 1XQ1A 1JAYA 3F47A 3F1LA 3WQQA 3WTBA 3U49A 3VDQA 1LSUA 5CDSA 2HUNA 4MIYA 4EITA 2QZZA 1LBEA 4NFSA 4UVHA 3WTCA 3F9IA 3PTZA 3W4IA 2Q2WA 3DWFA 1PZGA 3ON5A 3DOJA 1R12A 4L4XA 2FSVA 2QRJA 5CEEA 4NK5A 1IY8A 5COQA 4RVSA 4B8WA 2PR2A 3VPSA 2PY6A 1U3VA 1H9BA 4PGFA 2NQTA 5CFZA 4CLOB 3HJAA 5ER9A 1B7GO 5JAQA 4E2WA 1GDHA 3BMNB 5DULA 2HRZA 5KJEA 3GNTA 4YRBA 4RPKA 5DOVA 1NQ5A 2DFVA 1EVIA 4E5MA 1YONA 1YB1A 3LSYA 3BMCA 4PZEA 1CETA 3BMQA 3S55A 2GF2A 4XR4A 3D4OA 1WDKA 3I9KA 4Q3NA 1N1GA 5G4LA 3ZWYA 2ZATA 1YBAA 3V1TC 5AXBA 2VHZA 2Y1DA 3DFUA 3GZNB 4FFOA 4RQUA 1R0SA 4HNHA 4XQGA 2G76A 5DF1A 4OL9A 4JLWA 1GPDG 1YB5A 4RDHA 3JQFA 5EESA 2I66A 1OMOA 4D46A 3I1JA 3WGHA 2BI7A 3K9QO 2NWQA 1PZFA 2C7VA 4CMIA 2B0JA 5ICSA 1HDGO 2YV2A 4BHTA 1LRKA 1N2SA 3GPIA 1U3UA 1ZFNA 2O4UX 5ILGA 2E82A 3K5PA 4E31A 1WMBA 4GX5A 1KC3A 5FI3A 1JA9A 3NT2A 4OSOA 4WGGA 3MTJA 5BNFA 5U4QA 4BO7A 5C3MA 5FF9A 3ICPA 2Z1MA 1FDSA 5F1OA 3F4BA 3WGTA 1YO6A 5I7SA 1PQUA 3E18A 2HCTA 4JBGA 4YAGA 3W8DA 5ITWA 3ONEA 4HFRA 2WE8A 5HM8A 3K31A 3ZV5A 3WGIA 4II3A 1U9JA 1XCBA 3JQCA 3E9QA 4XEHA 1B16A 3H5NA 3DMTA 4I1IA 3FNEA 3EC7A 1VJ1A 4DC0A 4J2HA 1GD1O 4UVGA 1I3LA 3JYNA 3Q2KA 1AUPA 1MXFA 4J9VA 4NU6A 5DZSA 4J1TA 4TZKA 1LDNA 4F46A 3ZH2A 4XYGA 3H3JA 1YKFA 4U6SA 5A3VA 4RF4A 2AEFA 4H16A 1D4FA 2R00A 3OJEA 4PZCA 2FHSA 4P22A 2D59A 1ZMOA 3DHNA 1OOEA 5KVQA 2HMUA 3JD3A 1ZK4A 4NI5A 5IZ4A 2ZKLA 3OA0A 2EGHA 4R16A 5H83A 4J4BA 4WCDA 1KEPA 3E9MA 3OSUA 1DC4A 1JKFA 3WJ7A 2EW8A 1G0NA 1G0OA 4AJJA 3GZNA 3ETDA 1LNQA 3ICCA 3DEYX 3WR5A 1I8TA 3DR3A 2E6UX 4KUEA 4XZ3A 3SVTA 4ZQHA 1A4UA 2O3JA 1ADBA 4TSKA 1DFIA 4XKJA 2X4GA 3Q3CA 4LMPA 2CNBA 4Q3DA 2W4QA 3BTVA 4E33A 1QYXA 3RI3A 4ND2A 4KUGA 1EQ2A 1G6KA 3FBTA 4YXFA 5CEJA 2PTGA 3GZ4A 1NBOA 3PDJA 2J5KA 4J43A 4BUCA 1X0VA 2BKAA 2JHGA 2P4QA 3QWAA 4CMHA 1C0IA 1Q0HA 1U1IA 3WBBA 2X0JA 3AUSA 3NEPX 3ZWNA 2VWPA 4YDRA 2QRKA 1N9GA 1B2LA 3KEQA 4EJ0A 1BWSA 3QJ5A 5HWSA 2QYTA 3U09A 5KVSA 1W73A 1H6DA 1SEVA 1DLIA 1UDCA 2ZYGA 3OECA 2IDZA 5GZ6A 4M89A 4RPJA 1DIGA 4NNJA 2EKQA 2FZWA 2JD1A 3AY6A 1YWGO 5CG1A 3FBGA 3EHEA 4CV3A 3JQFC 1E7RA 1PGNA 2DBZA 1MG5A 1P33A 1MGOA 2FR8A 4MPDA 4JXKA 3GH3A 3QWHA 3DAGA 4E5PA 3JYQA 3GPDG 5GZ3A 3QHAA 5DP1A 3CE6A 1YL7A 3F46A 3PZBA 3OIGA 4ND1A 5F1PA 1UZMA 4BMNA 5CG2A 1A27A 4PLVA 3S8MA 1ZUD1 3WGGA 1WNTA 2Q1SA 1TT5A 2P5YA 4MOWA 4IJUA 2EERA 1S6YA 1F14A 2ZJ1A 1HSZA 4BNNA 1KC1A 3PDUA 1BXKA 2B37A 3F4LA 3C8MA 5DBFA 5IDYA 5DBGA 1A7AA 1H5QA 5EJ2A 3LDHA 4Y6RA 2IZZA 1IB6A 1GQYA 1VKNA 3FD8A 1BMDA 1N7HA 1U5CA 2DT5A 4JJGA 3VTFA 2AXQA 1T4BA 1GYQA 3HFGA 3GGPA 4BKPA 4C4OA 5L45A 2X5OA 3RC7A 5JBIA 3U4IA 3CZRA 3NJ4A 1NQTA 1A4IA 1NFQA 3H9QA 1HF3A 2OZPA 4M86A 2W2LD 2QZ9A 4AJ2A 4Z6KA 1J49A 1ADFA 2CUKA 1VL8A 4Z3DA 4R9RA 1MLDA 4DA9A 1DPGA 1YB4A 1T4DA 3OBBA 4GLLA 2VHYA 2NADA 3FN4A 2PGJA 2HDHA 1V3TA 1P1JA 1D3AA 2I65A 3ZWMA 3IIEA 1W6UA 2IXBA 4URFA 2NVUB 2VTDA 3BHJA 1UDAA 4IINA 5JNLA 3CTMA 3KEOA 2CSUA 4TRMA 1QYVA 3ONDA 1YOVA 4Y6SA 2UDPA 4ZQFA 2ZK7A 5ILOA 2BMAA 3FWNA 3F5SA 2CDAA 2EEZA 3DAPA 5BSHA 3E03A 4BNWA 2NTNA 4D3SA 4MP6A 2WMDA 4J1NA 1SOVA 4D44A 5TT1A 4CV0A 4OXKA 4F6LA 3ZU5A 1FDVA 1MUUA 1R16A 3H6KA 4B4UA 1NVTA 4II2A 4CM8A 2POQX 1YBMA 4G5HA 5JY6A 1GEEA 2HMSA 4JX8A 4WASA 4XIJA 5L95A 1PTJA 4CR7A 3TFOA 5IFLA 1DRVA 5K6AC 1S7CA 3NGLA 1VE9A 1Y8RA 1X14A 3I4FA 4XB1A 3K2EA 1T26A 3UCFA 2Y67A 4CODB 4RLHA 1H6AA 1L7EA 4RV9A 2O3TA 1H2HA 1HLDA 4J0FA 5L51A 2GD1O 1J6UA 3IDSA 3Q11A 1QV7A 2JCYA 1P0FA 2PH3A 3LC1O 3JYOA 4CM9D 3U4CA 4UVEA 4N54A 2JJYA 1TA4A 4Y9DA 1Z74A 5ER6A 1ISIA 1I30A 3COSA 3W4KA 1QV6A 2Y05A 4D43A 2I9PA 3AY7A 1JQBA 3RASA 3U3XA 1NFRA 4CM8B 1GUZA 1NQOA 2PK3A 2E37A 4CMJA 1DB3A 4AJHA 3I4CA 4EDFA 5A3JA 3R3JA 3RKRA 3WFIA 2E49A 3ZDFA 2G1UA 3P5SA 3JD4A 3O4RA 4MIEA 3DMTC 1QR6A 1UZLA 3BTUA 3CPSA 4Q3CA 1YJQA 3BZUA 1Y9AA 1XA0A 5JMPA 2C5AA 4MVJH 5EINA 5KKCA 3GVIA 3M6IA 3N74A 1A9YA 4E3ZA 4W6ZA 2J5RA 3DBHB 5LDGA 3H3FA 3RIHA 1Y5MA 2IXAA 3IMFA 4OXYA 1GZ6A 3BA1A 3DBRB 3DC2A 4RF2A 4YAJA 1F17A 1WVGA 3JQ8B 3PWKA 1N8KA 2GN4A 1E3IA 2NU6A 3CZMA 1HLPA 5A9SB 4FGSA 2WD7A 1Y7TA 1PS8A 5LDHA 3GA0A 4BNJA 4PZDA 3RUDA 3WG9A 2C07A 3AFMA 3GVXA 3FNFA 4U7WA 4XQEA 2CZCA 3HWRA 2VUUA 3NAQA 1PJBA 4DIBA 5JLAA 7MDHA 2BFPA 1XELA 3F5QA 4HY3A 3NDJA 3L9XA 4MKXA 1C3VA 4IDAA 5H82A 2ZB7A 4RGBA 5JCJD 5I9NA 3VOSA 2OP1A 4CLRA 1ENYA 3PWSA 5L7YA 4GQAA 4IMRA 4M1QA 1HZJA 1ZXLA 4JIGA 3CMMA 2GZ1A 5JW6A 1NFFA 2Y68A 3JD2A 1ISMA 4G81A 1LQUA 2HQ1A 3GK3A 3L9WA 2HKIA 3WGQA 1IULA 3W8EA 1ZJYA 1HYGA 3UGKA 3EMKA 3DZIA 4JNKA 4ZJUA 1LU9A 1E1NA 3WGOA 1QSGA 1Z75A 4NFHA 4XYMA 3W1VA 1Z45A 3PK0A 2EWMA 2C0CA 3PPIA 4IDBA 1QORA 3P2OA 1K6JA 1P74A 1LLCA 1DIAA 1GYPA 1VI2A 2V6FA 2Z5LA 1E3EA 4C7JA 3AM4A 4S3MA 1VL6A 4PLHA 1KVRA 3ZU3A 1Q0QA 5JDIA 2AQIA 3HFSA 3PLRA 3CEAA 2BHLA 1RPNA 4CUKA 1Q7GA 4EW6A 1JVBA 4J7XA 5BSEA 4NJOA 5DDIP 1XQ6A 1LRLA 1OFGA 1CQJA 3INTA 4KQWA 4AL4A 2VT3A 1M6WA 1DHTA 5F1KA 1SAYA 1LSJA 2YUTA 4JK3A 2IZ1A 1FMCA 4B7CA 3RD5A 3CTVA 3ZNNA 3DTYA 4J2OA 2OORA 2Q1WA 2CMDA 2Y0DA 2CFCA 1OZAA 1PGPA 4HUJA 2C59A 4R1UA 4RORA 1C1XB 3ZV6A 3L0DA 3GVCA 4MVJD 1EK5A 4IQGA 1DEHA 5DCUA 4PLYA 1LLUA 1XIVA 2VZ8A 2V6MA 2DQ4A 4O5OA 4FW8A 3IKTA 1LUAA 5TS3A 3A14A 3EK2A 3TZKA 2VOJA 4DUPA 4H7PA 3OJLA 2Q45A 4B4VA 1WXDA 4M55A 3ZWPA 1SOWA 3QY9A 4NDNE 1I01A 4WCFC 1BW9A 3L07A 3M1LA 3WXBA 4ROSA 4KWHA 3B70A 1XYGA 1CQIA 2WE7A 4XR9A 4AFNA 4BGUA 2GLXA 4FFPA 4A0SA 2A9FA 3LZ6A 3FF4A 4J7UA 5CEFA 1QYCA 1UP7A 3BHIA 2DTEA 3SBOA 4CLEA 2RCYA 4A10A 4D3DA 2Q3EA 4A7PA 5JCJA 4BNHA 4ILKA 1O89A 3IOYA 3O26A 3PGJA 1KVUA 2PGLA 3FCOA 1SNYA 3X2EA 4H15A 5DBIA 1HDCA 3GAFA 3GN2A 4UULA 1HRDA 4MO2A 5JYEA 2Q4BA 2WD8A 1KYQA 4R5MA 3H7AA 3DZBA 5JPIA 2JD0A 3W6ZA 2X0RA 2DUWA 1PS0A 1U2DA 1Y9EA 3RBXA 4GGPA 3IJPA 1VC2A 3T4XA 3STHA 1B8VA 2EKPA 3L4BC 1E77A 2I67A 3TQHA 1DIBA 4N5LA 4P8RA 6ADHA 5EERA 1KY5A 3PXXA 3R0IA 4H3VA 4OQYA 1EDZA 1C1XA 1QYWA 3UUWA 3TRIA 3DL2A 4JGBA 4XRGA 1M2WA 4BO8A 3ABIA 1YQDA 3D3EA 4HX5A 1LTHR 1R6DA 2AW5A 3OP4A 4CQMD 5FEUA 2VOEA 4RDIA 2WYVA 4Z0TA 3H9EO 1IHXA 4E6PA 4J91A 2EP5A 4E32A 1WZEA 5ES3A 4B4OA 1PSDA 1Z73A 1KVSA 2ZIZA 5DT9A 3SC6A 1DSSG 1YH3A 3GUCA 5JO9A 2AHRA 4OMUA 1H6CA 2DU8A 3EDMA 5A9RA 2A92A 3OIDA 5T64A 1V3VA 2DLDA 3MJ4A 3ZCXA 2B5WA 4RCVA 2I5PO 1ONPA 1SB9A 4QUKA 3TJRA 4PLZA 4GX1A 3PEFA 1LC0A 2CY0A 2VZ9A 4YA6A 4CM9A 5JC8A 3CINA 1WP4A 1DDOA 1LDBA 5A4DA 2J8ZA 4L74A 5CDUA 2VNAA 3ZWWA 3PJEA 4MVJA 4CMGA 4YAEA 4WNCA 5BSFA 4FJ1A 4I08A 3ASUA 1E7YA 2EF1A 1HDOA 2CF6A 4OO3A 2ZB3A 3DB2A 1E3LA 3GFGA 2OFPA 5DP2A 1RM0A 2SCUA 4XB2A 4PG5A 4RZIA 1D1SA 1U8XX 4DLLA 1IPFA 2VRBA 2UUOA 3IQDB 5L7TA 3PQEA 3ITKA 5KJFA 4HFMA 1HETA 1SMKA 2HMWA 5T8KC 3VPFA 4AJIA 2PZMA 2DTXA 2D1YA 2WWRA 3FTPA 4DC1A 1ZH8A 3QW2A 4AVYA 4D41A 2EKLA 2F00A 3K2BA 3ROKA 2BGMA 5T5QA 1OI7A 1XGKA 1UXIA 3PFFA 3AW9A 2B4QA 1E7SA 3AUTA 1E3JA 3BXXA 2VZ0A 4FPXA 4S1VA 4TKLA 1UH5A 4YCAA 4IJKA 2W2KA 3GG9A 4YQZA 2H1SA 4BMSA 3FTNA 3ROMA 4TZTA 4X54A 3AI3A 3GN1A 2FPGA 1A5ZA 2NTVA 4FIZA 3ZHYA 4BO9A 1O94A 2X0NA 2O50A 2BGKA 4MVJI 4UVDA 1QXSA 2AQHA 4CM7A 1XU7A 3BMCB 3Q2IA 1O5IA 3JQ7B 3RSHA 4UUMA 1N7GA 4DIFA 1AGNA 3BMQB 4XGIA 1Z82A 3VPHA 2HRBA 1VL0A 4TRNA 1PJQA 1E3WB 3NUGA 1KVTA 1P0CA 4WLFA 3E82A 1K5HA 4BKOA 5A06A 4JN6B 1FDUA 2W8ZA 5F5LA 1LLQA 1JN0A 3E48A 3WGYA 4TMFA 3RC9A 5MGBA 3NYWA 5MDHA 4CM5A 4CQLA 1HEUA 3GF4A 1E7MA 4ID9A 4QO7A 5KJCA 1X7HA 1D7OA 3ZNOA 2AE1A 1EMDA 4CJXA 1WWKA 2HAEA 4R1NA 4EBFA 1GCOA 3IC5A 1H2BA 3JYPA 1BG6A 4R9SA 3VZSA 2ZJ0A 3I9NA 3ADPA 3KYBA 2Y99A 4XD2A 2YHUA 4NG5A 4WEQA 4ALMA 1BVRA 2P2SA 8LDHA 3HE3A 5HS6A 4BNLA 1DXYA 3HDYA 5TSDA 2BRUA 3DO5A 1YS4A 3DAFA 3HQ4O 4YACA 4AICA 4Z0PA 3PQFA 5G0UA 4RVGA 3PYMA 4LCEA 5L9AA 4I9UA 5I9MA 3GRKA 4MVJP 4W9NA 3T7CA 3C7AA 2HMVA 2GASA 3CH6A 3WFJA 2V6GA 4XJSA 2RH4A 3ITDA 1WDMA 1BW9B 4R51A 2PKQP 2G5CA 4L76A 4AJNA 3WJAA 3SLKA 4G2NA 4XQCA 4MVJG 3L6DA 3MWEB 3QP9A 5I7EA 4CM6A 1K3TA 1E5QA 2VUSA 4I5GA 1H93A 2HO5A 1O6ZA 3L77A 3PVZA 1WMAA 4NPCA 4E4YA 4YT8A 3JQ7A 1E0DA 4JP3A 2D3TA 4NBRA 1ORRA 2EV9A 4RPHA 3DONA 4WK6A 1V8BA 1ZK2A 3QVSA 3VTZA 1FJHA 1ADGA 5TX7A 2EJVA 2FRDA 5JCXA 4W82A 5HA5A 3R1IA 1YXMA 3RKUA 5AXCA 3GDGA 3AI2A 2JCVA 4EZBA 1RWBA 4HBGA 4CLDA 4CMEA 1LI4A 3ANMA 4GLOA 4NBVA 2OXIA 2RHCA 1YRLA 2X6TA 4ND5A 5F5NA 4GI2A 1BVUA 1QMGA 4FSHA 2VHVA 2AG5A 3WYCA 3ZW8A 3GDOA 3E8XA 4AJOA 1ONOA 4R1SA 2D0IA 4CPDA 1WPQA 3GEGA 5TRTA 2FOIA 1P3DA 1RJWA 4A5OA 2I6TA 1T2FA 3NTRA 3ENKA 3EY4A 3C1OA 4GPD1 1Y6JA 4FC6A 1A7KA 1ZBQA 2YFQA 2GNAA 3ZWXA 2R2GA 4BNVA 4XYLA 5JSFA 3C85A 3ST7A 5L40A 5J23A 4FFNA 3D5QA 2P9EA 3AOEC 4PLCA 1E7QA 5FWNA 1KVQA 1NPTO 3S1LA 4YJHA 4BGEA 3EYWA 4YR9A 4TQGA 5KVVA 3AY3A 3QVOA 2PH5A 1YOVB 2UAGA 1H9AA 4UUNA 3RROA 1UDBA 2D2IA 2PA3A 1I2CA 2CDBA 1MX3A 2WYWA 1PL6A 3R6DA 4BOYA 4CL3A 3OQ6A 1F12A 3JSAA 4XGKA 5DOZA 2VTEA 1SZJG 1ZCJA 4L4RA 5KCZA 4PG6A 4CM4A 4K6CA 3I83A 1PL7A 3WICA 4Z3KA 1I3KA 1SEPA 3SXPA 4IY1A 2ZTLA 1BXGA 1VJ0A 1EVZA 1WZIA 3D4PA 4GL4A 4G65A 3UICA 2QYSA 3NKLA 3FPLA 4BNGA 2O3QA 4PVCA 1LDEA 3WDSA 4CLOA 1F8FA 3KB6A 4GKBA 1DC6A 1ZJZA 1X7DA 1NYTA 2CDCA 3D4NA 3ETGA 4YJDA 3MOGA 5C5IA 3G17A 3K73O 2YHIB 1DIHA 2OHXA 1NAHA 2OO5A 3RUAA 4CL8A 4QFDA 3VH3A 1O8CA 3HUDA 2P4HX 2DM6A 4DYVA 3GR6A 5THKA 4BL5A 4KTTE 3R3SA 3UXYA 4AJKA 1C0PA 4ZGWA 1ML3A 2AQKA 1I24A 3A4VA 3U0BA 3AU8A 4BNUA 4WCFB 4FFMA 3AOEA 1SBYA 3JD1A 4AG3A 4YRAA 5KVCA 2EGGA 5COAA 1LX6A 1AXEA 2J3IA 5ENDA 1O0SA 1GU7A 3KYDB 1OAAA 4IMPA 5ICMA 1J0XO 4XRRA 2JFGA 1PJ4A 1NQAO 1BXGB 4L8VA 4I8XA 1HWYA 4BKQA 3RJ5A 2A4KA 5L53A 1GTMA 3GG2A 4YJFA 3LF1A 3ZN2A 3L6OO 2C20A 4U6QA 1QLJA 4U0JA 3WSVA 2QW8A 4E2ZA 3JQGA 2DC1A 3QSGA 1Q7BA 4Q39A 1TEHA 4EUFA 4CMEC 2WEKA 4LSMA 2ZCUA 3LT4A 5FFFA 2YHIA 5A02A 5CPBA 3JQAA 1PJSA 3ZNPA 1E1MA 2X9GA 2HJSA 1AE1A 1PQPA 1WLYA 4K28A 1DFGA 2ZYDA 5T57A 2DTDA 4DLBA 4E30A 4CV2A 1I32A 3TF5A 1U7HA 4CM4B 2GR9A 3NTQA 1LA2A 1EDOA 1KY4A 3FR7A 3ZI0A 3JQ8A 4DRYA 4J16A 4WCFA 1KS9A 2Q1TA 4CMCA 2Q2QA 2Y1EA 3KUXA 3WMXA 3I9MA 1CYDA 5A9SA 3IS3A 1K6IA 3KYDA 1TLTA 1X15A 3DHYA 1I5RA 1Q7CA 1SCUA 2A94A 1GYRA 2BI8A 4LW8A 3GGGA 5JY1A 2UYYA 4FQ8A 1X1EA 3OJ0A 3LU1A 4XDYA 3RJ9A 1CIVA 1KEVA 4FGWA 1UXJA 5IN4A 4FB5A 3INRA 4W9NC 2Y1FA 4YTEA 1UJMA 5K9ZA 4DTIA 1KBZA 2DPHA 4R54A 4R41A 3X2FA 3GQVA 1HE4A 3OICA 4OM8A 1R37A 2PWZA 3SLGA 4YT4A 5CDTA 2E48A 4FC7A 1E5LA 3LQFA 3RFXA 1ONNA 2Q99A 3LF2A 2GPTA 3DOCA 3TNLA 3GMDA 5A03A 2C7GA 3DZKA 9LDBA 3ZZNA 3JCZA 1KOLA 4DPMA 2GZ3A 5A05A 3AK4A 3G79A 3PYLA 3RCBA 4XQ9A 3VPGA 1LDMA 3JQGB 1DAPA 3MTGA 1AHHA 4KTVE 2G0TA 5IZCA 3GAZA 5IXYA 3IP3A 1Q0LA 3DXFA 3U5TA 1NR1A 3FR8A 4XGNA 1ZK3A 4B8ZA 3HHPA 1OC4A 1P31A 1YQGA 3A9WA 1DO8A 4UEJA 2LDXA 1RKXA 1B0AA 1CJCA 4RL6A 2NVWA 3MWDB 2GCGA 4OKIA 3VAZA 1YDEA 2X86A 1IPEA 4J6FA 5AQ1A 5JE8A 2O2YA 3NRCA 5JDIC 2NU9A 1C0KA 1PEDA 4W99A 1EUDA 4CV1A 3KLPX 3OMLA 4FDAA 5HS4A 2AA3A 1HYHA 3K30A 5COBA 3KSDO 4FOSA 5G0VA 3WIEA 1TVEA 4UAGA 1ISGA 4OHUA 4DGSA 2GUGA 4DQXA 4GAEA 2AG8A 2P9CA 2PFGA 4XDZA 4E5YA 2IE0A 2ZB8A 1DC3A 3HB5X 1E6WA 4MKRA 3UF0A 3GY0A 1U2GA 4ZVVA 2Q46A 4B79A 4FBGA 1HXHA 4R4JA 4WEOA 1RM3A 1XEAA 1CDOA 4WLUA 2PGDA 3PI7A 1TT5B 5TJ9A 4IJVA 4P4LA 3DBVO 4R3WA 1YVEI 3PHGA 1EZ4A 1DOHA 2E4AA 4PLPA 2HJRA 4TRRA 5A9TA 4FN4A 1T2AA 5A04A 1SB8A 1N1EA 3V2GA 1CERA 4EUEA 3I9JA 2IRWA 1V6AA 2VWQA 1JW9B 3QWBA 5B12A 1PIWA 3M2PA 3A1NA 2IYOA 3GFBA 1P1RA 1LXCA 3B20A 5KJ6A 3S2FA 3WNVA 2P9GA 1A71A 5I8WA 4L75A 2RBEA 1PWXA 2FZEA 4I5EA 2Y1OA 3HDQA 3B1KA 4J49A 1C14A 4E21A 2VYVA 1FDTA 2ZCVA 3KXDA 3PRJA 2X58A 4R3NA 2XAAA 4ZRNA 3AOGA 3G1TA 2VN8A 5EMHA 1VSUA 5THQA 1P1IA 1XR3A 4IS2A 1Q2XA 1KEWA 2W2LA 1P1KA 3U9LA 4JJFA 3EW7A 5T67A 4E2XA 1UAGA 1EE9A 3NDIA 3MOIA 3JYLA 2OMEA 3G0OA 2PNFA 1R66A 3JQEA 3JD0A 1C1DB 4YWJA 3ANLA 1JLLA 3KO8A 2BFOA 4J7CA 3RC2A 3CUKA 4OSPA 3F6YA 3WWYA 2YJZA 3JQBA 1HDYA 4B3JA 1FK8A 1F06A 2NU7A 1GUYA 1PR3A 3ZU2A 4J4TA 3KTDA 3HDJA 5H81A 4LVUA 1KERA 5CDGA 4CR6A 2D5AA 4JP2A 4P4NA 1J4AA 1JTVA 3E5RA 3MCVA 4HADA 1YJ8A 5DCYA 4IDFA 2EIHA 4UEKA 2VUTA 3H8VA 4AJ1A 1M66A 3LT2A 3E6AA 3EZYA 4PLGA 4CLXA 4CMBA 4B7XA 5KJ1A 5JAZA 4IUYA 1BGVA 4YJFB 3VZRA 1U4OA 4R68A 4ZD6A 2O3UA 3NX4A 4BNYA 1NX6A 5JYDA 3NDRA 1BDMA 1P77A 4DREA 1U8FO 5C37A 1J5PA 3MJVA 4D0SA 9LDTA 3IP1A 3RAJA 2NACA 4PRLA 3ANNA 1GR0A 2O3RA 4K6FA 1WAMA 2O7QA 4MIOA 2ILTA 5KIAA 2B4TO 3RU9A 4E0BA 4IZHA 4Z0HO 5JFOA 2X8LA 3UCXA 4BVAA 5TGDA 1GZ4A 2X22A 4RVDA 5HBRA 2ET6A 4CUJA 3BAZA 6LDHA 3H4VA 4YRDA 3INGA 1AN9A 5KKAA 4ZN6A 5TC4A 5TQVA 4ESOA 1LEHA 3BMNA 2VWGA 4YVFA 4DXHA 5L4LA 2FR1A 4W7HA 1EUCA 1JDJA 1PWZA 1ZK0A 3JQBC 4HP8A 5DN9A 3DZHA 5EQDA 4WLEA 1UP6A 2YDXA 2IODA 4Q3EA 2C2YA 1LSSA 1GQ2A 3WSWA 1PZHA 1PJ2A 2J3HA 1PJ3A 3TDKA 4LGVA 3WYEA 3VVCA 2Q1UA 4RVUA 4QQRA 4CR8A 4GGOA 2CD9A 4O0LA 3AM5A 4IQ8A 5I7VA 5JO0A 1NVGA 3QQPA 2J3KA 3AJRA 3LLSA 2JAHA 4PVDA 2JD2A 1PGQA 3Q1LA 3JTMA 2NV6A 5KOIA 4HFJA 1LC3A 4GVXA 2YDYA 1MFZA 3D1LA 1JKJA 3RUHA 3AI1A 4C7KA 1CF2O 3V2UA 2V7PA 1NHWA 1H6BA 2QX7A 4ZU3A 4NIMA 4GH5A 4W7IA 3P19A 1IZ9A 1MA0A 3C24A 4CQMB 2XXJA 4UREA 2Y0EA 4MVJF 2EXXA 3U4DA 5IN5A 5C7LO 2OOSA 3RBVA 3GHYA 1NXQA 4KQXA 3S2EA 1QKIA 5GZ1A 4I9HA 1Z7EA 3H2SA 3ZWVA 1I2ZA 1HZZA 1SPXA 1JAXA 2CF5A 1GQQA 3DTTA 3PZRA 2RAFA 1Y5RA 4BNIA 3PWZA 1IL0A 4NH4A 2X23A 4OIMA 4M87A 3OJFA 4JJIA 3QA9A 4W4TA 1LLDA 1LDYA 4GWKA 3A28A 4JCOA 4L0QA 1T2CA 1X13A 2UVDA 1PX0A 2QQ5A 2JFHA 3O8QB 3RVDA 3LLVA 3PLNA 3BMOB 2AEJA 3EAGA 1WDLA 2X9NA 3IAHA 1NAIA 4QX6A 4GSKA 1O9BA 1XKQA 3VKVA 1HE2A 2ZB4A 1UAYA 2YY7A 3ZNQA 1TI7A 2HLPA 5L4SA 4QFCA 4WECA 5TIIA 1DJQA 1XDWA 1ZSVA 3G1UA 3ZV3A 4IIVA 3L4BA 2X0IA 2Y66A 3V2HA 4GMGA 3FWZA 1VJTA 3BIOA 3MZ0A 1E7WA 1KIFA 1UUFA 2X9VA 1YE3A 3LK7A 4OH1A 1U3TA 3HB4X 2EHDA 3CKYA 4DQVA 3ZHBA 2EG9A 3WNQA 2PZJA 3OH8A 2DFDA 2FY8A 2YFHA 3GNQA 1Q1NA 4N7RA 4AJ4A 4CQMA 4GSLA 2NSDA 4JBIA 5DCWA 2FPPA 2XPCA 4J1SA 4BGVA 5JC1A 1IOLA 1YL6A 4RVFA 1HL3A 4XYBA 2B36A 3KRTA 2QRLA 3V1UA 1RM4A 2QG4A 1N9GB 1NHGA 4GX2A 5G0TA 1ZZEA 3RUCA 4INAA 1I10A 4WPGA 4DQUA 5CHEA 1VRWA 4J1QA 1B26A 1E6EA 5AYVA 4XCVA 1MP0A 2PD3A 4LRTB 1DC5A 4J0EA 2HK9A 1AHIA 1NWCA 1O95A 1IYZA 2B83A 2BFAA 3P7MA 4TRJA 1QYDA 1VLLA 4DLAA 3NT4A 4OOEA 4QEDA 5G4KA 4YAKA 3O8QA 1W4ZA 5IF3A 2G17A 4I5DA 1L1FA 3B1JA 2PD6A 3O38A 4BQPA 1K89A 2WM3A 4OKNA 3IL2A 4GX0A 2TMGA 3ULKA 3N7UA 3V5NA 1AXGA 4BO3A 4DBVO 4Y98A 1IHYA 3GVHA 4A27A 1B3RA 3TL2A 5IDXA 3PIIA 4DIOA 4ALJA 1V3UA 5B1YA 1D1TA 3OA2A 2VT2A 3GDFA 4IZIA 3RFTA 4PRKA 3PHHA 1C0LA 1DAOA 2GRAA 3B1FA 2H5LA 3PHJA 3RWBA 3V8BA 5AVOA 4YYZA 3PHIA 1JVSA 2XF8A 3VKUA 3PIDA 1PJLA 4RZHA 4BO2A 1EFKA 5TF4A 3IUSA 3ONFA 1B14A 1GV1A 3F3SA 1ZEMA 3D5TA 3GEMA 1E1LA 4PIVA 3QV1A 4FD3A 5EIOA 1YQXA 2FMUA 3PYXA 4MP3A 2H63A 4PFJA 2DKNA 1QP8A 2F1KA 3LT1A 3NTOA 3NV9A 3H9GA 5IXSA 2YYYA 1NPDA 3ROPA 3H9UA 1Y8QA 2C29D 3JQ9A 2AQ8A 2BLLA 4ZQBA 2RHRA 3Q9UA 4OJNA 1R4MA 4TVBA 5T8KA 3ZWOA 1QG6A 1ZVMA 2O2SA 4HXYA 1MB4A 4F6CA 3UCEA 3ZGYA 2BELA 2GO1A 3GLQA 3WQRA 1DHRA 3E1KA 3FRJA 4RJTA 3I5MA 5IJZA 4D45A 1P1FA 2I3AA 3PJFA 1GL3A 3NT5A 4QSMA 2Y1GA 4NFYA 3HSKA 1YGYA 2DPGA 1ZMTA 4BQRA 5G4KB 2DBVO 1I2BA 3RFVA 3D0OA 1QRRA 3OHSX 4IBOA 1U5AA 4Z9YA 1V0JA 2Q2VA 2GN9A 2GSDA 5G0SA 3UN1A 2NU8A 5U9CA 3WS7A 1ISFA 2Z1NA 3H5AA 1EBUA 1R0LA 4IDDA 3JQAB 4QTZA 4BNFA 5A5EA 4ONEA 1IE3A 3OQBA 1ENZA 3CXRA 1N5DA 1PL8A 4PLWA 1RYEA 2GN6A 3QVTA 4BO6A 1EE2A 4TROA 2NNLD 1ULSA 1VKOA 4XJTA 4ZA2A 3FSRA 4FOOA 3ROQA 3RUFA 2NM0A 2OP0A 2Y0CA 4D3FA 3MEQA 5TNXA 4U0KA 4PG4A 4Z9XA 4ALIA 3A06A 1ZSYA 2O4CA 2OUIA 4GVLA 3PJGA
chains in the Genus database with same CATH superfamily
2W2PA 3Q10A 4P84A 1XJ0A 4BASA 2DBRA 1XRPA 3VSBA 4DMMA 5KWEA 3SX0A 4EWLA 5G0WA 3NDBB 4J0DA 4UBLA 1ND6A 1KYZA 4A2CA 4PU0A 1VYHA 2CFTA 4MA0A 1XC7A 1QK5A 2NAFA 4FVTA 4K9RA 5EKDA 1SO8A 2FWMX 1L5HB 4BN0A 2MR6A 4DOMA 3Q5GA 4GWGA 5JZVA 3K2QA 1D2MA 3BIWA 1SHUX 2JJ8A 2OZLB 3EGIA 1A9XA 3OOJA 2ORWA 5TJHA 1DQSA 1EM6A 2VUHB 1IPHA 5D5PA 4CCYA 3MJSA 5LMZA 3KUDA 3C97A 2WJJA 4MB6A 2DUUA 2MSCB 3GEDA 1EX7A 3JQDA 3OOSA 2NIPA 3K70B 1ZSNA 2FOLA 3OQJA 4DMLA 4UDOA 3QU2A 2YNMA 2E1RA 2F8LA 1AO3A 2MIIA 3DEAA 1ZY2A 2IHUA 3F5FA 3P5BA 4FZJA 4R6XA 5DTRA 4GMFA 5KQLA 3ANTA 3D3WA 5H68A 4BX0A 1FJGB 1E69A 1AT1A 1RE0A 1P62B 2EJWA 1L5ZA 3B3FA 3GLHE 4K6HA 4KK4A 4R7GA 1ODKA 4F45A 2H9AA 3M6WA 3VO9A 4L5BA 3BGVA 4RHTA 1NNUA 4OYLA 2OYCA 5KTNA 1B3BA 2I55A 3GLSA 3HSSA 4MQUA 4O4LB 1CY1A 2QTFA 2QX4A 4TN1A 1D0SA 2BEJA 5HPYB 5KQRA 1Y6GA 2HIGA 3BEOA 5PGMA 4TM8A 4NCNA 1C9DB 2ZYHA 4QTXA 8ABPA 2AOXA 2JPDA 3B6ZA 4Y2PA 2VDJA 1LI5A 2HHJA 2O48X 1QV9A 1S1CA 2AC4A 4HJRA 5TQ0B 1NTOA 1RAEA 1FX0B 2XGMA 1J99A 3D1JA 1L5KA 2C5EA 4DR3B 3WYGA 4EABA 3B9QA 2YV1A 1M2VA 1SC4A 2HU8A 2QTGA 3HMQA 4MHTA 3PE3A 1IXRC 1XSEA 2FPOA 4NBTA 1UQTA 1A4RA 1MOQA 1SHJA 3WO0A 1QFXA 3PS9A 3MRVA 4KP7A 1YQTA 3M4ZA 2KI5A 1YFJA 1DQZA 4R0NA 2G82A 1I94B 1T1RA 1Y1PA 1RPAA 1PJCA 5JDCC 2GXQA 4GP9A 3WMGA 1KP9A 2ZPAA 4HAIA 3GT0A 1PU2A 1ESZA 2ZE6A 3GP5A 1RVDA 2ZBFA 3D3WB 4X8LA 2OV6A 4JUDX 4PZZA 2HNKA 4YRTA 3A6DA 1BS2A 2YJ3A 3PQDA 1VDMA 4GMXA 3RVBA 4MQEB 3VH4A 1PUJA 2ID7A 4YJGB 1JG4A 1RWWA 1T9KA 2MYTA 1QLHA 2P6PA 1UKAA 3DOOA 3OTQA 3ZXYA 1OLUB 1G1MA 1GPMA 1RMTA 3O4JA 5E2BA 3U81A 4KHPB 4MMZB 1AQJA 3AM3A 2PD4A 4H35A 1EI9A 3SBEA 2DX7A 4UU7A 2OECA 4E5KA 1XQXA 1IOZA 5IBCA 4XWWA 2X3YA 4Z51A 3Q3IA 5K6TA 5AK4A 2GN0A 4DDHA 2AUMA 1KJYA 1RWKA 1Z0IA 5JD5A 3L8ZA 1XPJA 2Q07A 3VHRA 1II8A 3KTFA 3FUXA 4TWZA 3RBZA 3N0TA 3T3EA 4UEOA 5LOVA 2CLIB 4TYWA 1TXGA 3HXPA 5K09A 1GPBA 1YJBA 2J32A 1HE5A 2IQIA 1GR1A 1UBGA 1KETA 1EBFA 2DHDA 2YC2C 3RM3A 4G0WA 4B6PA 1IN7A 3QBTA 1PS9A 4GKJB 1ZMRA 2VDVE 1DIRA 2X5KO 1FA9A 4JFAA 3EQ6A 3BWYA 2C82A 1JA0A 1NJ1A 2OXEA 2ZDHA 3I73A 1W1IA 4FNGA 1VGRA 4KQMA 4MV0A 4CLHA 4RLSA 1VJRA 1SCUB 3P9IA 3OLQA 4HGOA 1Z7WA 2L69A 3MTEA 4M21A 1UPTA 5B1IA 5CFPA 1XWFA 3TRJA 3NP7A 4F4DA 3A6EA 3VSAA 2H2AA 3DDSA 1V35A 2REQB 3QYFA 2P68A 3P27A 4AUEA 4DCGA 4DIDA 4DLXA 3U7QB 3LIPA 2I7VA 4EJ6A 1HNXB 4L50A 5JT1A 1FVHA 3EPHA 4GOKA 5F12A 3OWOA 4BWGA 5BT8A 4PCLA 5A6SB 1T5SA 2J0EA 4LQDA 1WSBA 1WB9A 3FZQA 2E7ZA 2HXSA 1NN5A 2ZUEA 1FP2A 3VC7A 1LVHA 2VAPA 3H6HA 5IM5A 4B47A 2QJFA 1LW6E 1NOKA 1YHYA 1GFZA 3HLKA 2I87A 2QLMA 3ND8A 3IKVA 4KOAA 4RK1A 3UVEA 4F60A 1GFIA 1P9RA 4YO7A 4EY6A 3I39X 1E6UA 3QHQA 3C1TA 3QXCA 3NAGA 3FZGA 2E4VA 3P52A 3EQ8A 1AKMA 4TV8F 4C4RA 5FPKA 5JTUA 3HG7A 2FLWA 3Q0EA 2QTWB 4G63A 1M5TA 2VHXA 3B52X 3P2YA 3SZ3A 4G5QA 1LSOA 5IN4A 8ADHA 1II0A 4V2IA 1QTRA 3SEZA 3NEAA 3O8NA 4F4IA 4M9RA 3KJQA 1NVKA 2VYNA 3AF2A 2DR3A 4IX1A 1VB5A 5IVIA 4BB5A 2L0XA 3AILA 4LFBB 2NO7A 3JVVA 1W0CA 3D64A 3NC0C 1CVIA 2R9VA 4MGIR 5EWMB 3JQQA 4GPZA 1A9TA 3ROTA 1KEUA 2E9SA 4C7MA 4M0DA 4CQNA 1F20A 1W36B 1CJSA 3USES 4TUYF 1VJGA 1GJRA 2OQVA 4M54A 1E32A 1R2QA 1YBVA 3C45A 4ASUD 1WABA 2INGX 4Z54A 3T3PB 2FSGA 5IAEA 1OA1A 1ZA2A 3LHKA 1B23P 2DBQA 3WC4A 4EW2A 3M6LA 2FPIA 2VRCD 3HJTA 2RKWA 4Y6LA 1E9VA 2OESA 2JIRA 4BB9A 5E3HA 3ZOKA 4MVJE 4ZI3A 1KI6B 3QFCA 5AUNB 3PJDA 2Q6TA 4Z8YA 3I8OA 4BMVA 5JDCA 2R0QC 3FHLA 2EQ5A 1Q0PA 1SVOA 2NZUG 3HL0A 1KFCB 4Y9UA 3WWOA 1D0IA 2CKDA 3M6MD 2VTVA 1ZUIA 4CG0A 1Y7LA 4G24A 3FWKA 2PZGA 3NHKA 4XPZA 5JI2E 1U4SA 4BV2A 2OCLA 1E1RA 2Z3VA 1N0UA 1TADA 3D5EA 4OFXA 4A03A 4IXTA 1EB9A 4DLUA 5IKOA 4M1EA 1RC1A 4CM1A 2CLCX 2Q8QA 3ZR4B 2YUIA 1ZGBA 1T8WA 3OEHA 2P5UA 4MPRA 5FTLA 3TZQA 4POAA 1E58A 2CZGA 2HNAA 3O2NA 3H2JA 4GF5A 2FSHA 2UUPA 4LVNA 1A95A 2W8BA 3DE0X 3V8EA 1O6GA 2JGFA 4IRXA 1JVNA 1KL7A 4RPLA 3E5MA 1EZZA 3H9JA 2YW9A 1BTOA 1V16B 1VJDA 3S2IA 4X20B 1XMQB 1T35A 1N2IA 1M6EX 3D7KA 1K92A 4B2IA 3MLEA 4YQFA 3VX4A 4LF6B 4WINA 2C4WA 4A0GA 4CIYA 3FTFA 3I3OA 4N5MA 5SZJA 4YMGA 1L4NA 3KSUA 4LYGA 1XHLA 2B98A 1LF0A 2ZRBA 3HNPA 3IXMA 3WWPA 3EPKA 3OPYI 4OQFA 4NHEA 3T5TA 3CRZA 1LBQA 1C4OA 2O2IA 4TVOA 4U7HA 3KJZA 2H65A 1JU9A 4MYTA 1XCPA 3QUAA 2JDIA 4BNXA 3ELUA 3SJAA 1VL5A 1V9CA 1ZAKA 4UTXA 3I6BA 1NQUA 4Q1EA 4AS1A 1FF9A 1FLDA 1L7XA 4MJXA 5KYXB 3GGOA 2H17A 1T3SA 4YB8A 1OW3B 3THXB 4EYQA 3GLFA 1ULUA 4BKRA 2YOHA 1VLJA 4NR0A 2BMFA 5SYAA 4HUTA 4IMIB 4R69A 5KVAA 1EVKA 4HGNA 4MVYA 1PGJA 4Q3AA 1JHPA 4C0XA 2OGUA 4XLLA 4L08A 4RK6A 3RQSA 2JH9A 4D82A 1NYQA 4MEAA 1ZOLA 4KBFA 2HF2A 2WMNB 4IGFA 2WU0A 3WLEA 1U7TA 3HVHA 4KR6A 5P8WA 4TZ6A 4RKYA 4AJEA 2Z6QA 5I7FA 4KSBA 4US2R 1F2UA 3C2QA 3P20A 4LC0A 4WBNF 5ABPA 4O3FA 3DBLB 1RZ3A 2HMAA 4D3XA 3VDRA 4DEXA 2X5JO 2PZKA 2RHTA 2IIBA 3CC8A 3IAEA 1RI3A 2GHTA 1O9HA 1Q74A 3SX2A 2AHOA 2RARA 2AMLA 3W3AD 3L82B 3Q7TA 2QF7A 4LHXA 2R86A 1U63A 2C8LA 1FXSA 3AFIA 3OX4A 3Q1KA 4EY3A 2JKVA 3CLRD 1I3NA 2I2FA 3M3DA 2J3LA 3SC4A 1FSSA 2QLJA 4EM6A 4YCJA 3BB1A 3EZGA 3WLFA 1ZISA 3JQAD 3WP1B 3LGAA 2OXRA 1GGJA 3H97A 1ISHA 4CF5A 5BUSA 1SC3A 2NSYA 2XYRA 3I09A 5BSTA 1IEVA 2R62A 5JAMA 1WEKA 3WX0A 4NCIA 3TLKA 4BDTA 1KY2A 4P4UA 1N9ZA 2R87A 2F17A 5EIEA 4ZODA 5CK4A 1N4AA 4G2TA 1XFDA 4WXHA 3GJ3A 3MUFA 5IDWA 3FLEA 3AEKA 4G5GA 1JR3D 3OAAD 3O2JA 5F33A 5AI8A 2ECQA 4KIFA 1JRLA 2IUUA 2ILVA 1IUPA 4B8YA 1K63A 3A1TA 1SQSA 3TXXA 4J0GA 2NQ2C 3HI6A 1J9EA 1VPTA 3TWOA 2GTHA 1YFKA 4NMHA 2YYSA 2W7TA 3RUIA 2H9IA 3OJOA 1G5PA 3O4GA 1M2GA 4J0QA 4M0CA 3HJGA 5JV5A 4DBLC 2HLDD 3E9EA 2TMYA 3QWFA 5LZ7A 3A32A 4UTRA 3I23A 4RJIA 5EJFA 3ZWBA 1JWBB 2OG2A 3DMPA 1NUSA 3H5TA 5GVRA 3AWDA 3TFWA 3CFYA 3P9RA 4YT2A 4ZCQA 3S4YA 3U3ZA 1G38A 2AMJA 3ESYA 1HQCA 4DVJA 5JROA 4RHFA 3VAYA 4P82A 1Z2PX 4IHQA 4UUAA 1GDTA 3JV7A 3UJ9A 2Y93A 4A2PA 4ZYTA 3SF0A 5JD4A 5CIWA 2AK2A 1OY1A 1R4NA 1H94A 1JI0A 3AR6A 3DHEA 4RFVA 4WIAA 1BU5A 2G6BA 1K0UA 4XVQA 3SJUA 2MOKA 1K2WA 4DV4B 2XODA 5EZYA 2H2DA 3DAHA 2N46A 2QIOA 3GPLA 4ER5A 3SIPA 2ZQYA 1ZQ1A 4AN4A 4OVKA 3GUUA 1S8AA 4DJFC 2QLFA 2F59A 3PSAA 4L15A 3M82A 3T7DA 3FNHA 4Y67A 4DARA 3MTAA 3ASZA 7ADHA 1FNCA 2NUTA 3HN7A 3RW9A 3DCJA 3N5CA 1M2NA 1U2DC 5JD6A 2O2DA 2R00C 3G2QA 3W5HA 4EATA 1K75A 1NR7A 1P5JA 2I4MA 3H2KA 3SKYA 1JYSA 1Y1LA 4FJ2A 4KXVA 5IJ9B 3TG8A 4RESA 3ER9A 3VNRA 2Q9UA 2I1VB 1EJBA 4ZYWA 1ICIA 4R7ZA 3N86A 4NEHB 4TPKA 2QG9A 1I33A 4B4DA 1ENPA 5DTQA 2XQFA 3ZCPA 2AFHB 1GAJA 1TM4E 2ZJ2A 4FS8A 3IESA 4EJSC 1XEFA 5L3QB 1RLOA 2AEEA 2RAVA 3K96A 2VZLA 2IEDA 1ETUA 1JFVA 4WFJA 4LWQA 3SR0A 4D4IA 1T2EA 3UWOA 4QUIA 1T24A 2PQ0A 3CXUA 5PNTA 2C9CA 1O6FA 4MS3B 1APBA 1V7ZA 3W77A 4BS9A 5J40A 2X1HA 3PQ6A 3QYJA 5ITVA 2EW2A 2ZWOA 3VA7A 3KX2A 1S02A 2F3QA 3CIOA 4A2WA 3CW9A 3MGGA 4CTNA 1Q0TA 3N2YA 1GRVA 1JDNA 3WIUA 1I4OA 4E09A 2F43A 1Y9DA 4NU5A 1ZCAA 4YECA 3BE5A 1A2BA 1KKLA 5AXDA 3IQWA 3WWZA 1N6LA 2Q8PA 2I1LA 2R7KA 4LBYA 3WSTA 1ZC4A 3ZPXA 1NQVA 3FY4A 3S2SA 3L8YA 1DC7A 4OQMA 1Z7BA 1Y3CE 3U62A 2RGNC 2SKCA 3HH8A 4JT8A 4OHXA 5TY0A 5BYAA 2X3UA 4UARA 4CEHB 4NK4A 1ID8A 4DT1B 4TXLA 6PFKA 3GT4A 3MWKA 3Q9SA 1UC5B 1DT3A 1DX6A 5B36A 3GMSA 3H83A 1A5SB 3QXSA 4UUPA 4HMOA 4E2YA 1E2HA 1XZMA 3NFYA 4FJ0A 5IJXA 3WQSB 2GD2A 2ZYVX 4K26A 4O59O 2WTBA 1U0HC 4P7JA 1I0LA 3B8HA 4PBTA 3OT1A 4PBRA 1TYBE 1X7YA 4DDUA 3JWJA 3QTBA 2BV3A 1XZPA 4D9FA 4RL4A 3QG1A 4YFYA 3D8HA 3R9IA 1KBOA 5CAEA 5JASA 2PRJA 2VNSA 2HBQA 1BX3A 4R9NA 4DBZA 1VJ5A 1LPOA 4PX9A 3RUEA 1RM5A 4J1TC 4H7JA 3WB9A 1YD7A 2VQFB 2BMDA 2VJBA 3ZV4A 4G1BA 2PJRA 1U2EA 1FFXB 4R2JA 2RIRA 3H9CA 1VGQA 4DNPA 1W34A 2XOKA 4D42A 4XWYA 1GPNA 3DEFA 2V1UA 4YAUA 4BXOA 3OIFA 5ALHA 3TBFA 3IGFA 4WUVA 4HV4A 3P26A 2AMFA 3KQNA 2HDWA 3U7RA 1JAYA 3QPAA 3EIUA 5I51A 3A1EA 3EXFA 1DJOA 1SUBA 5IYZF 1POWA 2KW5A 3CWQA 3VDQA 4CGYA 3ZHUA 5BNWA 5AO9A 4MIYA 4H0FA 2Z6AA 4RTMA 1LBEA 1QHNA 3ER6A 4RSRA 1DQYA 4TMKA 3WTCA 4K6MA 1XTBA 5LN1A 4L8WB 3B48A 2JLYA 1X3LA 3UJAA 4PR0A 3DOJA 4L4XA 2FSVA 3OT1B 4CGZA 5FB3A 4NK5A 3AF6A 3VKHA 4JJ8A 2D2EA 3FGNA 1DG9A 4KK3A 3TR5A 5GOTA 2PY6A 5LYYA 3VPSA 2G8LA 3IR5A 4PGFA 4NAVA 4ABTA 2J08A 1IWBB 5CFZA 3HJAA 5ER9A 4L0DA 1CKEA 5JAQA 5ELMA 1W52X 1Q91A 1E9DA 4TMVA 4WDRA 1KI8A 2HRZA 2AVNA 4DTCA 3I32A 4CT4B 3U4GA 5AVKA 4RPKA 1GA4A 4CEIB 3JRWA 1YZGA 2AL7A 2H1RA 1YONA 2CDNA 4DKXA 2LBPA 5F2NA 3U80A 3CT6A 1K66A 1U7DA 1B2RA 2UZ1A 3P0JA 5FXMA 3JS5A 1FRFS 3BMQA 3FNIA 1X7WB 4XR4A 3I9KA 1WDKA 1NBHA 2JGRA 1N1GA 2WIFA 3IMCA 4R8SA 4JEIA 3ZWYA 1EM8A 3S81A 2Y1DA 3T9FA 2V3CC 1B1AA 2FRXA 4G0ZA 3RYHA 1LK7A 1K3UB 1ZVJA 1FUIA 3HDVA 3LV8A 4MRMA 4PGAA 4HNHA 4EG4A 4OL9A 3ONVA 1J5EB 3AXSA 2O07A 4KAAA 4RX1A 2ZANA 2I66A 2VJDA 2RHGB 2AC7A 4ZYLA 1BJTA 2G4VA 4D46A 2BI7A 2VCEA 1N9KA 2BR3A 2YYAA 4CMIA 3TIIA 5ICSA 1HDGO 2II6A 5EWLA 1LH0A 1KZ6A 4E6EA 4URVR 2NT4A 1QU2A 1LRKA 4HJXA 5DTEA 3I0ZA 2DCUA 2H92A 3DTVB 5ILGA 4E31A 3ZJTA 2RHLA 1M34A 4RK4A 3EDOA 3ESDA 1UK7A 4LOKA 1UJCA 2I03A 2RB4A 3NT2A 5FI3A 5BNFA 5U4QA 4CKZA 1UT5A 2O0KA 3LBIA 1UMKA 2YVLA 3KC2A 1CF4A 1NNLA 1VL1A 3F4BA 4H6VA 1M1ZA 3WGTA 4M1OA 3GLKA 4TT8A 4WDQA 5I7SA 2YWXA 3E18A 4ZXFA 5ITWA 3AF1A 3ONEA 4PRZA 3WGMA 3SGLA 4A6PA 1T10A 1NRIA 4PRYA 3I3SR 3L7JA 3IE0A 3GEBA 3K31A 3L93A 3ZV5A 3PHBE 4AWAA 4BE4A 3WGIA 2E89A 3TNYA 4O1HA 3DBIA 5DGXA 2PS3A 4P4SA 5DNVA 1IC6A 4DC0A 3I4LA 1GD1O 1M2KA 1TJ3A 4KJXA 3FTDA 4WN3A 3MB5A 3ZCVA 4C0HA 4K6KA 4Y9SA 1VXRA 1GRRA 1G9XA 1EVLA 2Y0PA 3ISTA 4J1TA 2R7LA 3OWXA 4LPSA 1TEXA 1G2QA 3OQOA 2DMRA 3NIGB 2BKXA 5IBPA 3UJDA 2QTVB 1YKFA 3A2NA 3CR8A 3L0IB 4U6SA 1FP7A 4BATA 3E9YA 1RLTA 2XQVA 5CBKA 3OJEA 4D6XA 1POXA 4X66B 2FDCA 3KWLA 3VV2A 4ZCRA 5EJ5A 1QNLA 4AIIA 4EHBA 2D59A 1ZMOA 3DHNA 1E2BA 3NCTA 4NI5A 1ZK4A 5IZ4A 3OA0A 4TV9A 4R16A 5H83A 1T9ZA 1V43A 4WCDA 4ZMSA 3U40A 5KSPA 1G0OA 1D1QA 1OSNA 3GZNA 1ESEA 3NKVA 3ETDA 1QUFA 4XVHA 1ECCA 3DEYX 4L02A 1RHKA 4W8HA 4WOBA 3DR3A 3UOWA 3FLMA 1HRKA 1G3QA 2HLDA 2ZJ8A 4XQ0A 3SVTA 4KZKA 4PANA 1A4UA 4TSKA 1YK1A 4XKJA 2IWRA 1CRZA 3CY6A 5K0JA 5KYNA 2G04A 1P39A 3D6FA 2W4QA 1RJFA 1GZ7A 2IE8A 1T3TA 3BTVA 1KAHA 3M83A 4E33A 3RI3A 5HKBA 4KUGA 4HRVA 4JXJA 4BPBA 5ADUS 1FRZA 2ZSDA 5CEJA 5JIBA 1XMSA 3QLTA 3DDCA 4Q02A 3I1FA 5KNCD 1B8OA 2AFIB 1NN3A 2YXDA 3ET5A 3LMKA 3GYGA 4K9PA 4QQ8A 1C0IA 4RA9B 3CNNA 1SUPA 4CMHA 2CFOA 2WIDA 1E2UA 3WBBA 4GUAA 5DIFA 3GP8A 5L3SB 2YZ2A 2HIAA 1KMIY 3AF3A 3O4VA 5I47A 4RA6B 2X9QA 3GBVA 2C9DA 3QJ5A 3VC1A 1N2XA 2FG7C 3H6GA 2VXOA 2CDRA 1SEVA 1TD1A 2PN1A 4FBMA 4FCWA 2ERYA 3EBLA 4K9LA 4P7KA 1GNPA 1M8GA 3U37A 1C8LA 4BNDB 4RPJA 1DIGA 5DMXA 3KSBC 3O83A 2JARA 4NNJA 3KJIA 1Y1QA 1I51A 1QF9A 1D0VA 4TVKA 2JD1A 4ZCLA 1BKDR 3M89A 1E9FA 3L7CA 4V38A 3OD5A 2YX1A 2VHTA 2D13A 1E7RA 3GFVA 3CZ4A 3JQFC 1PGNA 2TECE 3LECA 4H3HB 3S7TA 2VJAA 2BGNA 1MG5A 3NH6A 3LXMA 1KYWA 1PJ8A 1XDDA 3W05A 3MLAA 1SXJA 4DV6B 4GDFA 3QWHA 1FSPA 4OBBA 4OHCA 2G83A 1OX4B 1WVMA 2D2FA 1U0SY 3CF4G 1Z15A 4AZ0A 4QBFA 1B76A 1OTHA 3ZTYA 1TM7E 3PZBA 3EDCA 3P2IA 3CB4A 1E6LA 4ND1A 1HGXA 4GBGA 4QXOA 4ZCTA 5KYWB 1M2FA 3VV3A 1KKUA 3H2IA 4BVEA 1R9NA 4PLVA 1Q0UA 4LHYA 1J8MF 3FYTA 4O4JF 2QM7A 2C1EA 1TT5A 4MOWA 4LE0A 2GESA 2PT9A 3K0EA 2OY0A 3N7TA 4KPUA 2XQIA 3OHPA 4EHDA 1M7BA 2VNHA 4LECA 1YB2A 4LC9A 4YJ3B 1YS6A 2WP8J 1KC1A 5GGXA 4B6FA 4BNNA 1S2OA 5EJ2A 1MA3A 1YOBA 5CLJA 2NW6A 3I9V1 2ODEA 3ZE0B 3CVJA 4XFKA 1T0UA 1Q0SA 2HR1A 4I3FA 3VTFA 1T4BA 3ANYB 1SG9A 3RC7A 3U4IA 2HCBA 3NJ4A 4G8DA 4OXQA 3V7WA 1NQTA 1H2FA 1P0IA 1FTGA 1QX4A 2GLUA 1OWMA 1JPNA 2GZRA 2IKQA 2OT3B 1HF3A 1QB7A 3A1CA 3E9RA 3O2SB 3P96A 4PZLA 2W2LD 1ZNZA 2B6NA 4IJ6A 4JZYA 4NZOA 1J49A 1MRZA 4OTZA 4M7RA 2CUKA 4WUTA 2GBCA 4EI7A 2V0NA 4FI3C 3GPCA 1XTVA 5IJWA 1YE8A 1Y5LA 2EVWX 2H1OA 2CBGA 2ZJAA 3JATB 4LF7B 2W4MA 2W37A 4RULA 5IH3A 3FHOA 1UPAA 4NS1A 6ABPA 1S96A 4FHEA 3RRZA 1N2EA 2HF7A 1V16A 2HDHA 1SUCA 3EISA 3UGQA 1D3AA 2CWWA 4DRXA 2PHZA 2NVUB 3WGVA 3GLHA 5B58T 1CUVA 4G0YA 2VDUE 3BHJA 4NRDA 2BEKA 2IOFA 3KKMA 4NESA 4WERA 3KEOA 1Q12A 3E27A 1K9SA 1FU8A 4DEYA 1U7UA 3SU8A 1DKLA 4KBYA 1YOVA 3LXRA 2CXQA 5EE0A 4PAOA 2Y2VA 2O5RA 4R0MA 2DQKA 3KPUA 2O1SA 2WUFA 4YUWA 1ABBA 1W0KD 3DAPA 1U1EA 2ZJZA 4V02A 4ZO9A 1S7GA 3E03A 1JEQB 2HZ7A 4D3SA 3VC3A 2EZ9A 4JL6A 3UHFA 1SRRA 2W6CX 4EPVA 2J45A 1OXBB 1SOVA 2KYRA 3F7MA 3IJEB 2C04A 3GFPA 5K3FA 2FUCA 5TT1A 2RGEA 3MMPA 4JXZA 4HB3A 4F6LA 1FDVA 1KSHA 5CT8A 3BGSA 4B44A 1REQA 4FGZA 2WZBA 4ZVNA 1NR5A 1RYNA 2DP4E 2EIXA 4N82A 4XWAA 1Z5NA 3ZYCA 3NTXA 1JQ5A 3BF7A 3OCVA 3FPSA 4L07A 1AXRA 4OLFA 2WJYA 1YDFA 5DEOA 4FNMA 5IBRA 5L95A 1Y7IA 4A3SA 3QLUC 4GZMA 2PXXA 2EL9A 4HNRA 1U0GA 5K6AC 3NGLA 4HQOA 1SKMA 2WSSD 3T54A 3VNAA 4MYHA 3VOTA 2NV0A 1M34B 3TE7A 3K2EA 3X1MA 4C9BA 2DB3A 1ZD8A 3PUJA 4RLHA 1H6AA 1L7EA 2O3TA 2JLBA 1T8UA 4X95A 4ZO8A 2GD1O 1J6UA 1Y6FA 2DY1A 2ECFA 4ZI7A 1VE6A 4MW1A 3Q11A 4U9HS 4ZJYA 1IY2A 2C0PA 1U11A 2FZGA 3UMFA 4D56A 4CM9D 4EVRA 2MCFA 4UVEA 2HFJA 1Q1QA 1SBCA 3NJRA 4GC5A 1ISIA 3COSA 1HK7A 2I8LA 4JLOA 3G9TA 1OFCX 2Y05A 2Z4RA 1SG6A 2CD7A 3O82A 3TSWA 1H4TA 1JQBA 1YS7A 4J76A 4QQKA 4E1AA 5FYQA 5K0TA 1ZD2P 1GUZA 1NQOA 4CM8B 4FHZA 3T1QA 5J4LA 5A71A 4CTMA 3MERA 1KJIA 5FTMA 5J4VA 3R3JA 5J59A 3GH1A 1ZN8A 1RXCA 4FSDA 2I7DA 4KRYA 3NM6B 2E49A 2C3OA 2VHEA 4MRSA 1M1YE 4F11A 1QQAA 1BEEA 5C1DA 4X7BA 3P5SA 4NS4A 3UYLA 3JD4A 2P5SA 3OCYA 4MIEA 2OQIA 3DMTC 4JEMA 1QR6A 4RY8A 2P6OA 2PS0A 3O7WA 3HR4A 3ORRA 4NBSA 3G2IA 3RKSA 1H05A 3IXLA 4Q3CA 1YJQA 5JRZA 4BFUA 2XCUA 4JUFA 4CIAA 1XA0A 2O52A 3E4DA 3HU2A 3OZIA 5HP4A 4WTOA 4BVFA 5KKCA 1C3OB 2UXBB 1A9YA 5IUNC 4IIJF 3G5UA 2J5RA 3DBHB 1D04A 3H3FA 2PFKA 3FYDA 4XDGA 5JNRA 1T5OA 1Y5MA 1FVOA 3NONA 4QXAA 3N7AA 3AR7A 3TLBA 1T8PA 2MMCA 2V45A 3NHAA 4YAJA 3I04A 2F3SA 5MF6A 1WVGA 2O19A 1Y3BE 4JASB 4YCDA 4BEJA 2NU6A 2NYRA 1T1JA 4QRHA 4CIBA 5LP6B 3F67A 1O08A 1C3LA 5A9SB 4FGSA 1CVRA 4DW8A 1Y7TA 1H8HA 3C3YA 1J0DA 2CK3A 4TS9A 2RGWA 4OU4A 4BNJA 3M33A 5EMNA 1L9KA 1K7CA 2VF8A 3ELDA 4EPRA 2AMYA 4M8NE 5T3YA 5FUQA 1XNGA 5LNK1 1BE8A 1IHOA 4JJZA 4F3NA 1TQHA 1L5GB 4GOOD 5FL7D 3TW8B 3HUFA 5JXJA 3CF4A 1JSZA 5DRTA 3TNDA 1W1WA 2BFPA 2NGRA 5KOJA 3AVOA 3O91A 4HVLA 3AGPA 1SY7A 2VDLB 4IDAA 2OBBA 2ZB7A 5JCJD 2Q3JA 5LA6B 5K0BA 4U2CA 2AJBA 3CX7A 2OP1A 4ZZIA 3E7DA 1ZCZA 2JCBA 2AN5A 2CCJA 2MDTA 2H7CA 2JW5A 2O8FA 3T5BA 1Y63A 4KOEC 3OJWA 3PNKA 2GBLC 1JPVA 5K5EA 3AEZA 2H8KA 4LXIA 1FZQA 1GZDA 3RHFA 4U7DA 5JW6A 1NOIA 4D9CA 4NAHA 1XALA 3BKWA 3QKRB 3RTCA 5BW5A 1XTPA 2PCLA 3JALA 2ZYIA 4OV6B 3TK1A 2GTIA 2COUA 5FHRA 4KU4A 1ZOIA 3I05A 1IULA 3EIHA 1ZJYA 4RETA 3ZE7A 3WRXC 3GWZA 3LHIA 2WB4A 4FDUA 3DZIA 4ZJUA 4NZZA 3WGOA 1QSGA 1UJBA 4BNYA 4IO0A 4G86A 2EWMA 1KNQA 5E1BA 3ESBA 2A0YA 2EARA 4U4AA 3TIFA 1BHO1 3KPWA 3COVA 3HBFA 2VHUA 4AXBA 1Q1EA 3ZZ0A 3UMMA 1LLCA 4NJEA 4KR2A 2ABWA 3DFKA 3S8EA 1IBSA 5DX1A 1VKZA 4KLRA 4MUGA 5A6SA 1AC5A 1CNFA 4C7JA 1THMA 2YZKA 4JLMA 1VL6A 4K88A 3OX3A 4PLHA 1BCSB 1Q0QA 5JDIA 2D2XA 1ESCA 1FS4A 3HFSA 3ZXSA 3PLRA 1WHTB 2BHLA 1RPNA 4ZV7A 2R65A 3CRW1 3Q7IA 4Y2JA 4HR7A 2OHOA 4AN0A 1NUHA 2QLNA 5CDFA 4EW6A 4JITA 3QKRA 4MGYR 1WD7A 5DDIP 4C0JA 4IYJA 1SWWA 2VXYA 1LRLA 3VKWA 1V8OA 1CQJA 1AKUA 2FWNA 5CUQA 1J1UA 3CJQA 4Q16A 2O5CA 3D7MA 4AL4A 3E70C 2VT3A 1M6WA 3F71A 3UBMA 1ORVA 4A0FA 3KLBA 2YUTA 1I5EA 4WRRA 3RSOA 4IYRA 4JK3A 4LBZA 5KVQA 1BH6A 1WB5A 3R76A 1DT5A 5EEGA 1OZFA 3CTVA 1LX7A 2R6GA 3CKLA 3ZNNA 5LWHA 1F5NA 2CMDA 4OJTA 2CFCA 1OZAA 5EWMA 1PGPA 1I7SB 4R1UA 4R98A 3UMYA 3W06A 4PC1A 4HQLA 4DGQA 5LQKA 4BCBA 4PHHA 3THSA 4G5FA 2G9VA 1BRTA 3IKTA 4DRXB 5TS3A 3TZKA 2VOJA 2JLQA 1P4JA 2AOUB 3GLHB 5CNKA 5HR5A 1KOGA 1NVXQ 4R8KA 2IPMA 2PT7A 2W42A 4I4NA 3FCEA 2WJVA 1I01A 1Z25A 1BW9A 3L07A 3RNOA 3TZLA 1FPMA 3ILSA 4PAWA 1XYGA 1CQIA 2C8JA 1D2NA 1DX4A 3JWGA 3PENA 4KLAA 4AFNA 3QPWA 1C9JA 2D74A 4KDCA 3WHPA 2A67A 2GLXA 2ZBGA 1QONA 4FFPA 4LHEA 1T8RA 4A91A 2IOYA 2QX9A 3HJCA 1E98A 2GVDC 4Y2XA 4YXWD 1B4DA 2WNSA 1QYCA 3IDFA 1UP7A 3VBCA 5HQJA 1WV0A 4HDCA 3MCAA 5FWDA 1EWVA 1QX3A 3ZE6A 4ILKA 5J2UB 4X93A 1D07A 3O26A 3OC0A 1KVUA 1K6MA 1ODFA 1ZCBA 1MIHA 3MAGA 3RWMB 3FCOA 3CVUA 1O58A 2XYGA 5KWJA 5AK5A 4M37A 1NUTA 1J2JA 3L6BA 4H15A 4H7EA 4X5OA 2ZRQA 2AJDA 4COKA 5AVSA 2F9FA 4RD3A 3P8ZA 3GAFA 4UULA 3H2GA 4D8TA 5B3KA 5JS8A 1G3RA 5ECYA 2Q4BA 2WD8A 3M6UA 3JZFA 4L5IA 3H7AA 2FGKA 4MUAA 4QWMA 5K8LA 3R40A 3Q5DA 1G8FA 2RGYA 4QU5A 5C4GB 1PHRA 3RBXA 5AKGA 3LD9A 4GGPA 2NP6A 1VC2A 2NPFA 4WK2B 3MCTA 2FQXA 5FTNA 1B8VA 5J2TB 3QOFA 1U2PA 4HWGA 2NZ2A 1TIBA 3BFVA 3WJ2A 2P7HA 4GLFA 1LWOA 4RH0A 2KBFA 4BMDA 1BJRE 5EERA 1HX7A 2HA2A 4NVRA 3X44A 4H3VA 3OKAA 3H0EA 2ZAYA 3TRIA 3DL2A 3HR7A 4V3BA 5F9HA 4XRGA 1QQ5A 2G1AA 1YQDA 3FHCB 1NJ2A 2AW5A 3OP4A 4MHSA 1B41A 3BXOA 4Q4AB 5A6VA 1X94A 1Z5ZA 5AJWA 4I8DA 4WFKA 4Z0TA 1N0VC 4HQ0A 2ANBA 3ENQA 4MWOA 4J91A 4E32A 2P2NA 1WZEA 4GOJA 1UKVY 3M4JA 4LY0A 4UTOA 3HJHA 1PSDA 1CF9A 3B2EA 1EIZA 1A76A 4KAXA 3SC6A 5I9IA 1YKGA 4HEA1 2WT9A 5KDLA 4N40A 4JUBA 3AETA 3F9CA 4IKEA 4LVOA 1DXOA 3ZCXA 1V3VA 1EGHA 4JBWA 1YQEA 2JFQA 5IU6A 2B5WA 4BQEA 2P90A 4S12A 1QTNA 1Q57A 2GPNA 1H1TA 5KQMA 4AKHA 4RPCA 3TJRA 5CFLA 1MZVA 3PXDA 4OMCA 1Y1TA 4N8DA 2VZ9A 4GO1A 4CM9A 2H1WA 3K4HA 3NP9A 1L4YA 3OU2A 4RNDB 5H3LA 3SC2A 4JLSA 4ACBA 4F2PA 3DMNA 4X85A 3HC7A 1EBBA 3H4TA 4GP6A 3V4ZA 2VNAA 5AP9A 3A3KA 3HACA 1ZLXA 2BFFB 2ZBEA 4Y2QA 4CMGA 1C9YA 5BSFA 4I08A 1TO6A 2RKOA 4P92A 2PT5A 1OTYA 4TUYB 3RRBA 2J9RA 2A33A 2GH1A 1B0ZA 2VK2A 4DLLA 1DBQA 4OQPA 1CJVC 4ZDKA 2F2TA 2VRBA 3W5AA 1R0BA 2UUOA 2ZSHA 5L7TA 3PQEA 2IS1A 1WLSA 5LD2C 4MS1B 1N6HA 3AVVA 5I7AA 2AVDA 2XCOA 5CYPA 3MT7A 5T8KC 5CB6A 1M74A 1BD3A 1HL7A 4RTQA 2XGGA 3PX7A 4TLMB 4HLCA 1BN7A 4DC1A 1ZH8A 4AVYA 5FQOA 1YNOA 5A7FA 1A8UA 3X1KA 3K2BA 1W47A 5M04A 1WJGA 2ORYA 3OO0A 3HCPA 3MJDA 5HFNA 3VO2A 3IUYA 2GETA 5D7NA 5LB4A 1SVMA 1VRVA 1UXIA 2KE5A 4U9UA 2HFKA 2Z9CA 3EB9A 1FOEB 2A30A 1JG6A 3LCUA 1E3JA 1NIJA 2FKNA 5K0NA 3BWCA 1KH1A 4UTZA 3HPRA 1Z0UA 1J2RA 2OHFA 2PH1A 2FMKA 4KFUA 4IJKA 1DUVG 5ALDA 3B7PA 5JMOA 3BWMA 4KMOA 1G8JA 5LQCA 1O95D 4KXFB 2JK1A 1IN1A 3IP8A 1A5ZA 2NTVA 3GFRA 3B6KA 2W4IA 4ZVUA 4XM1A 2O50A 2JIMA 4MVJI 3R5JA 2RDMA 2VPIA 2AQHA 3UG7A 3UK6A 4LOIA 4CM7A 1XU7A 2IZ5A 3CLUD 2Z3ZA 4ZJZA 3Q2IA 5JOQA 1O5IA 2O57A 1FZTA 2P9ZA 3JQ7B 3E3NA 3QLVA 4QBHA 4MI1A 2OO7A 5JJKA 1YAHA 2AB0A 4PY2A 4XGQA 5K20A 1I1OA 2I2XB 3AFGA 4P3KA 4CHGA 2ZUTA 2HRBA 4I4IA 4LKRA 1N34B 1RQNA 3F7OA 1KVTA 1BXRB 1P0CA 2G36A 1SG0A 4WN9B 1C9KA 5B3JC 4D26A 1L3BA 2HA0A 2W8ZA 4NHOA 5DM4A 5F5LA 1ILEA 4Q9AA 3KWJA 5AKEA 4ARZA 5B30A 2DLCX 2QKYA 4OK3A 2C97A 4TMFA 4WA7A 5BOSA 3A6PC 2XT6A 1SA0B 5F4BA 4US0R 2A1IA 2X40A 3OM1A 3TECE 3DE7X 2OLJA 1E9AA 1JNXX 1P75A 1S8FA 1S4QA 3AL3A 2BFCA 5CTAA 5A7GA 1ZUNA 3W2EA 1GVHA 4C4AA 4QYIB 1L1QA 4YV0A 5KYTA 1G3MA 1I3CA 3VUEA 4MSUA 1CX9B 1RWNA 2DG2A 1BG6A 4B3GA 3I9NA 3AVYA 1AQYA 1TA9A 1G4UR 2QP4A 1YR7A 4BC1A 4G9BA 2EC5A 4WEQA 1BVRA 2LZ0A 8LDHA 5A7HA 2JB9A 2V7TA 1SQ5A 1P7PA 3FVVA 4C89A 2GEBA 1GM5A 1A1VA 3HL4A 3JX9A 4BEBA 5J5AA 4EHLA 3PQFA 2UYOA 3PYMA 4LCEA 1P4HA 1Y4DE 2ODNA 3CONA 3WXMA 4W9NA 3BGDA 3G8BA 4B7AA 1CUCA 5JCPA 2G9NA 4K8OA 2IKSA 2IW3A 1IBLB 5A06A 2ZWAA 2HMVA 5KTSA 4ZTUB 2RK4A 4HSGA 1BDHA 4IGIA 3ITDA 1WDMA 5ALOA 1BW9B 2G5CA 1NXTA 2YOGA 1HE8B 2HIMA 4D9BA 3SLKA 4AX8A 4CEHA 3RVKA 3B6JA 5BW8A 1FP1D 2BC9A 3KE8A 1AIPA 3ZQ6A 1GGNA 1X8XA 4MVJG 1NDUA 5I7EA 2JIQA 1K3TA 4I5GA 4F2WA 1GXSB 3IR6A 1O6ZA 3PFIA 3GZJA 4FTWA 1WS6A 1YTLA 2C3UA 4P35A 4D74A 2QNRA 4NBRA 1MQ9A 1ULBA 2EV9A 1H1LA 4RPHA 3DC7A 3DONA 1V8BA 4WGFA 3YASA 1ADGA 1ZESA 5JCXA 2CEAA 3CUWA 3FJOA 3IQXA 5DHTA 4W82A 2V96A 3LLCA 5FWYA 1XCMA 1I7NA 4K0R