4KUEA

Crystal structure of 3-hydroxybutylryl-coa dehydrogenase from clostridium butyricum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
280
structure length
280
Chain Sequence
MKKVFVLGAGTMGAGIVQAFAAKGCEVIVRDIKEEFVDRGIATITKSLSKLVAKEKITEADKEEILSRISGTTDMKLAADCDLVVEAAIENMKIKKEIFAELDGICKPETILASNTSSLSITEVASATKRADKVIGMHFFNPAPVMKLVEVIRGAATSQETFDAVKEMSESIGKTPVEVAEAPGFVVNRILIPMINEATFILQEGVAKEEDIDAAMKLGANHPMGPLALGDLIGLDVCLAIMDVLYNETGDTKYRASSLLRKYVRAGWLGRKTGKGFYDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxybutyryl-CoA dehydrogenase
publication title Crystal structure of (S)-3-hydroxybutylryl-CoA dehydrogenase form the n-butanol sysnthesizing bacterium, Clostridium butyricum
rcsb
source organism Clostridium butyricum
molecule tags Oxidoreductase
total genus 117
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.157: 3-hydroxybutyryl-CoA dehydrogenase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4kueA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kueA01
1A71A 3H9GA 4MP6A 3QVWA 4L74A 4TWRA 4P4LA 4CM4B 2WYWA 1XU7A 3COSA 4PLWA 2Y1OA 4OSPA 3DEYX 3PWSA 5ITVA 2FR1A 3VPXA 1R15A 1KEWA 2FWMX 1H94A 3K5PA 3WIEA 3IJPA 3JD1A 1YL5A 3CTVA 4BKQA 1PJBA 2VT3A 3QWIA 3S2GA 4W7HA 3X2EA 1QLJA 4HFNA 2OHXA 2P5YA 4MVJH 3JTMA 1DIRA 3WLFA 1X0VA 1KEPA 4FOOA 4BIIA 9LDTA 4DQXA 1LSSA 2HK9A 1GAEO 4KTVE 4D41A 2G5CA 5B4UA 1SEVA 5MDHA 4CJXA 2R2GA 4DUPA 4CQMB 1LLCA 2GF2A 3V2GA 3BTUA 1Q0HA 3PHGA 1ONPA 2J3HA 5THQA 5ILGA 2ZATA 2Q2VA 3JYNA 4LCJA 1HYGA 1PGQA 4RLHA 1CETA 1E7MA 5T6BA 3Q2IA 2BFPA 3NT5A 1N7GA 1PWXA 3FR8A 1SB8A 1TA4A 4BMNA 3C7AA 2GUGA 3GGGA 3JD4A 4NIMA 1EVZA 1M6HA 1MC4A 3OEWA 1MG5A 3UN1A 2O3SA 2WD8A 1R37A 5LC1A 5CDGA 5L95A 1ULUA 3O8QA 1DJQA 3Q2KA 4XIJA 3T7CA 1DRVA 3ZWAA 4OXNA 5CDSA 3AUSA 3IAHA 2HSDA 1VJTA 3OA2A 3O03A 3E5RA 3DQPA 5B4TA 3DWFA 2PD3A 2B0JA 3MOGA 3QWAA 2BRUA 2C07A 1NFFA 1X7HA 4NDNE 4BO1A 2CDAA 2H1SA 4GKVA 2I67A 4I8XA 3OJOA 3TPCA 3U4IA 2Y0CA 3NEPX 3OQ1A 3RC1A 4EEZA 5JAZA 4J90A 5KJFA 1EQ2A 2O3UA 1F17A 3D5TA 5HS6A 2D4AA 4RL6A 1G0NA 4BO0A 2OFPA 3HQ4O 3BHJA 1MGOA 1UDCA 3WSWA 3W1VA 4WCFB 1GL3A 2B4RO 1NVTA 5FFFA 2C59A 4Q3BA 1O5IA 5ICSA 3CE6A 3VDRA 5A3JA 2XXBA 1NP3A 2Q4BA 4JBGA 2OL4A 5A9RA 5DF1A 1GU7A 8ADHA 3E9NA 5K6AC 1D3AA 4GMGA 1LQTA 4KMSA 4CLEA 3LT4A 4QX6A 3DONA 4F46A 4M1QA 3NAQA 5JBIA 4BB5A 3BZUA 4M8SA 4CODB 4K9DA 1ENPA 1ID1A 3HJAA 3TZKA 4K6FA 3S1LA 4J91A 3DZHA 4DWVA 2VHXA 2VCYA 4O0LA 5G0VA 1Y9AA 2X7HA 3JD0A 1O95A 1E6WA 2FSVA 3ZV3A 3WWZA 1YXMA 1T2CA 5MGBA 3EW7A 4LCEA 1PWZA 2FR8A 2O23A 3M1AA 4BHTA 3OSUA 3JQBA 4MIEA 4I08A 5DP2A 1EK6A 2J5KA 3KYDA 1GYRA 5KOIA 4HXYA 3NT4A 4U6QA 3AFMA 1LDGA 3WYEA 4WKGA 3R1IA 3U0BA 3KV3O 1ZXBA 3OEYA 2CNBA 5ILOA 4NBWA 3HZZA 4NBRA 5G2OA 1DHTA 3WICA 2PTGA 4E0BA 1F14A 3GN1A 5U9CA 1P1JA 4JP3A 3JQ6A 2JCYA 4HBGA 2O4UX 3E1KA 1YL7A 3ZV5A 3Q11A 4NH4A 2OMEA 2ZYDA 1HL3A 1AE1A 1PTJA 3QWHA 3TZQA 3U49A 3BMOA 1JN0A 3RU9A 1HTBA 3EVNA 1VSVA 1WLYA 3FD8A 4YJHB 4MVJF 5DCUA 5DZSA 3RUFA 3P7MA 1PJLA 3P19A 3D4PA 3DO5A 4FS3A 4DIBA 3KM0A 1YONA 2QQ5A 3UH1A 2JFFA 1NVGA 4CMEA 3OJEA 5DCWA 5KJ6A 2FHSA 3GNSA 4NU6A 3G49A 2JFHA 4CLDA 4Z3KA 1P74A 3ZNPA 4ID9A 4E21A 4M54A 3TOXA 4CV0A 1SEPA 3ONEA 4AJ4A 2FPPA 2NV6A 1YVEI 2UVDA 1I3MA 1LLDA 4XYGA 1VKOA 2O50A 2NU7A 4Y8VA 4B7UA 3NUGA 3ITKA 1ZNQO 4XGKA 4WJZA 3B1FA 4PLVA 1MXFA 3F47A 3NJ8A 4RZIA 4Z0HO 2RHRA 3SJUA 4MP8A 2BI7A 1CYDA 1JWBB 1Y5MA 2HDHA 5KIAA 3WGOA 2VHWA 3AUAA 4I5EA 2NSDA 2QZ9A 2NVBA 1E1LA 2IEDA 3JSAA 1BDMA 4XYLA 1I33A 4GH5A 3WB9A 4AJHA 1HE2A 2ZYGA 1ZJYA 3CIFA 2GN8A 1J5PA 4BNNA 2X5OA 5TT0A 2D1YA 2PV7A 4IXTA 1YWGO 4RJTA 2C29D 1UDAA 1UZLA 4KQXA 1A7AA 2DKNA 4AJNA 2IYPA 4DC1A 4Q9NA 2YHIA 3X2FA 3QY9A 2YZ7A 4PZEA 4KWHA 3PLRA 4TROA 2VUUA 4NFSA 1YRLA 3PJFA 1KC3A 3MEQA 1JAYA 1DRUA 3F1LA 4OL9A 4XWYA 3D7LA 3ICCA 3ZWMA 1XDWA 3DHYA 3HB4X 1Z7BA 4DIFA 1YKFA 3PRJA 5JW6A 2GDZA 3VPHA 3WSVA 3C8MA 2D59A 4IGEA 3MJSA 2P9CA 3EDMA 4WCFC 4N7RA 4W99A 4J9UE 4B3IA 4OO3A 1ZK2A 4PFJA 4R1TA 4I5GA 4CM8A 3H5AA 1YOVB 4N18A 1A7KA 3GOHA 1ZK4A 3DBVO 5BSGA 4CM3A 3WGIA 3CKYA 4MP3A 5JAQA 3L9WA 3ANLA 4I9HA 4DVJA 1DC5A 5TGDA 4LK3A 1DHRA 3K2BA 3IQDB 4NI5A 1KERA 1WZIA 1H9BA 4NK4A 4AJOA 1R0LA 2GO1A 1ISIA 1MXHA 3HG7A 2FOIA 5I9NA 3L6OO 1C14A 4LRSB 5U1PA 4ZU3A 3H2ZA 1J49A 3NX4A 5TQVA 1HLPA 3QQPA 4AJEA 4BMSA 1O0SA 1J6UA 2WTBA 3KTDA 3MZ0A 2EF1A 3FBTA 4NBUA 2VYNA 3GLQA 3QWBA 3SC4A 1SCUA 3KSZO 1ZK3A 4YCAA 2HMSA 2V7PA 5B37A 3PHIA 1W6UA 2V6FA 5ICMA 1UUFA 2DAPA 2DTXA 3QE3A 3ST7A 4Z3DA 1BG6A 4CMAA 3IMFA 2C20A 3OIDA 1PJ4A 5H82A 4PGFA 4XQEA 1YB4A 1LTHR 4MVJA 1NFQA 3ZU3A 2B5WA 4E12A 3H8VA 3K8ZA 4O63O 4PG4A 1BXGA 2Q1UA 4BGEA 2B4TO 1Y7TA 2WSBA 2FZWA 2GGSA 4GAEA 4K6CA 2Y66A 1L7DA 2EG9A 3DBRA 1NM5A 2IRWA 3GUYA 4FQ8A 4IDEA 3VZPA 1B8VA 3FSRA 3PYXA 2FSSA 1A5ZA 4Z9XA 5A03A 3VH2A 1U8FO 1LU9A 3TL2A 3FBGA 4Q3DA 3DFZA 2HAEA 2Y67A 4JX8A 3WJAA 5T67A 1EUCA 2X5JO 2CDCA 3BMQB 2VZ9A 3ZNOA 2GNAA 4NZ9A 4WPGA 3ZWBA 3ROPA 1T4DA 3TNLA 1HXHA 2EKPA 1NR1A 5AOVA 3ZI0A 1DC3A 4E2WA 4E5MA 2X9GA 2G82A 4MO2A 1K6IA 1AHIA 3U5TA 3EY4A 4OOEA 1Z75A 3KB6A 1B3BA 3GRKA 3MWDB 3L4BA 2QG4A 4YR9A 5L45A 1UXKA 1A9YA 2DPHA 4DMMA 5JY1A 3DHNA 1YDWA 4BO4A 4GMFA 4MVJM 2GZ2A 4D42A 3ZW9A 4D79A 3U3XA 3F6YA 4FFNA 4CLRA 4S3MA 3UICA 1HWYA 4E4YA 2ZYAA 3A14A 4LVUA 3JQ8A 5EINA 3BA1A 3HWRA 2IZ0A 3AK4A 4OQYA 1MP0A 4W6ZA 5GZ3A 1P1KA 1P3DA 2HLPA 3WQSB 3EK2A 2WYVA 1V3UA 1N5DA 2NTVA 3WGYA 2HRBA 4XB1A 1SOWA 3K96A 1ARZA 1VKNA 4FIZA 4B8ZA 1B0AA 3QA9A 3GRPA 3IJRA 3C85A 3PXXA 2P2SA 3NTOA 5GZ6A 1LSOA 2F1KA 1E7WA 1JA9A 4XYMA 4YAJA 1QV7A 2X4GA 1YL6A 1ZBQA 3WMXA 5IDXA 2UYYA 4ZICA 5BNTA 1PEDA 2ZQYA 3DBLA 3CEAA 4FDAA 4UEJA 2VNSA 4TZKA 4YVFA 3RUHA 3LK7A 5L4NA 2Q2QA 1CJCA 2PD4A 1DLJA 3PVZA 2JJYA 1GV1A 3E18A 2B35A 2Q1SA 3ANMA 3KEOA 4EYEA 3ITDA 2O3JA 3NT2A 3ZHYA 3BXXA 2UUPA 3R3JA 4FFLA 4DIOA 3HHPA 4U8GA 4GWGA 3ZDFA 1GQ2A 4AJLA 1P0CA 1ZIDA 2WD7A 3LU1A 5HWSA 5TIIA 4GX0A 4UREA 3ENNA 3BTOA 3V2UA 3GZNB 4EITA 4OGWA 1OI7A 4LRTB 2A9FA 2NUAA 3TFOA 4FFRA 3VVBA 2W4QA 3KEQA 4FBGA 3PEFA 5TSDA 2C5EA 4GKBA 1O9BA 4I5DA 1QORA 3NV9A 1ADFA 1EMDA 1P1FA 5C7LO 3DMTC 1VE9A 3E8XA 5IZCC 4CR8A 2C2XA 2O48X 3GGOA 4O1MA 5G4KA 1Y8RB 1MFZA 4YT4A 3PZRA 2IZ1A 4IGFA 4II2A 5TJ9A 3RKUA 3EVTA 3FPLA 1XLTA 1I24A 3GEMA 3PIIA 3BHMA 1DFHA 4QFCA 4ALMA 1G1AA 4RF4A 2HCTA 2EJVA 4FC7A 3RBZA 2HMUA 1DIHA 3ENKA 4H3VA 4ND3A 3VKUA 1BHSA 1PJCA 5KTKA 2DQ4A 3CH6A 1HE4A 2YQ5A 2I9PA 1EE2A 3I52A 1RKXA 3IS3A 4DQVA 4J4HA 4ND2A 5JS6A 3WQRA 2G0TA 1R0KA 3Q6IA 5L4SA 4FR5A 4IZIA 3VZQA 4TRJA 1Q2XA 4CLHA 5H83A 4B4UA 1C1XB 3D3WB 3FF4A 5DULA 5T5QA 1DXYA 1SPXA 3H4VA 2HMVA 1DAPA 4IMPA 3WYCA 5GY7A 3UFXA 4OXKA 1HDOA 2CF5A 3BMCA 3CTMA 1NFRA 1DO8A 4E13A 3OF2A 3PFFA 3BYZA 1NWHA 3HFGA 4D3DA 4CM8B 2HUNA 4CM7A 1I2ZA 3GY0A 1N8KA 3FNFA 3RROA 4CMIB 3HE3A 3PGJA 3BAZA 3VDQA 4EEXA 4IJUA 4HP8A 5L51A 4F3YA 1KETA 3WG9A 3ZGYA 4D44A 4DC0A 4U5QA 1O89A 3FCOA 3UCFA 2EW2A 3CXRA 3RUAA 4QO7A 3HUDA 5L7WA 3QHAA 4WECA 1PR9A 2JL1A 3JQFA 3LZ6A 3M6IA 2D3TA 3NGXA 4U0KA 4MVJP 3RAJA 2OUIA 1VLLA 1C1DB 4P4GA 1BDBA 2I3AA 4P4NA 3F46A 4XJTA 2AHRA 1HF3A 3G17A 4BNIA 1FDWA 4RGBA 2NVUB 2YFQA 4OKNA 4DQUA 3JQBC 3PGXA 1KC1A 1K89A 1I10A 1FMCA 3GDOA 3TQHA 4CQLA 2I76A 2X8LA 4L73A 5COQA 1D8AA 5G0TA 1QMGA 3GVIA 1E77A 4CMKA 4G65A 1JKJA 1Q0QA 3VHRA 4NPCA 4Q3NA 2CMDA 1ZKMA 3ORFA 1Z45A 1IZ9A 1JDJA 4R01A 3AM4A 1PJ2A 3E9QA 4YAEA 5CP8A 2VYVA 1E1NA 4ALLA 1N1GA 4LVCA 4OJNA 4ZRMA 4KUHA 3H5RA 1I8TA 4JIGA 4CM9A 4CLOB 3F9IA 4BO5A 1QYWA 3EHEA 1V3VA 4MJLA 4E2XA 3NDJA 3GG2A 1ZH8A 4J7XA 1BW9A 3PHHA 5COAA 2Y93A 4YRDA 1FXSA 3FRJA 1R66A 2YY7A 1AN9A 4YWJA 5KKCA 3ZH2A 3VPFA 2R00A 5DP1A 1PGOA 3EZYA 2ZJ0A 3PQFA 3KZVA 1OMOA 1XQ1A 1ZZEA 3WFIA 4FN4A 4IS2A 5F5LA 5AXBA 1T1SA 3STHA 1HDRA 4PLZA 1GYQA 2VHVA 4WLNA 4PRLA 2R6JA 3GK3A 4IUYA 1CIVA 4KP7A 1QYVA 3C1AA 4YJFB 5EIOA 3L6EA 2Y05A 3DZKA 4ROSA 1V8BA 1YB5A 4K26A 3A06A 1U7HA 5EN4A 2BGKA 2ET6A 2A92A 1E3SA 3TZCA 1Y9EA 1U5AA 2QW8A 1DDOA 1BGVA 1IB6A 3ZHBA 1PL7A 1ZSVA 4R3WA 3ZN2A 5CAEA 1SNYA 4N5LA 1SBYA 2VTEA 1XEAA 3F5SA 2W2LA 4PVDA 1HETA 4TKMA 3DAGA 4LN1A 5F1PA 3KETA 4FC6A 4DL9A 3RC7A 3ZWWA 1I2BA 1NPYA 4GGOA 5G4LA 2EV9A 4WK6A 4EI2A 1RYDA 2AE2A 1WPQA 4RVSA 3EAGA 4I1IA 4MDHA 3C1TA 3H2SA 1E7RA 1NYTA 5CG1A 1DAOA 5JLAA 3UKOA 4CM1A 1LC3A 1P31A 1PL6A 2VWPA 2VZ0A 2DTEA 1V9LA 3EMKA 4GPD1 1LDYA 3QLJA 4BKPA 4XZ3A 2DVMA 3PTZA 1K5HA 4PLFA 1X7DA 4ZQGA 1N9GA 3FNHA 2FPIA 2QYTA 1YBMA 5JCXA 5KJCA 4XR4A 1S7CA 4FFPA 4FJ2A 4FGSA 3JYQA 4GSLA 2XAAA 2Q3EA 4R69A 4B7XA 4PLCA 2CVOA 4C4OA 3GT0A 1X1TA 4JK3A 4U7WA 2JAHA 2Z5LA 5ENDA 4NHEA 3SJ7A 3NYWA 3GA0A 1Y1PA 5BSFA 3OETA 4FCCA 3ROQA 3DZJA 3NTRA 5AXCA 3GF4A 1LDMA 4BO7A 2W2KB 3FTNA 3NGLA 5G0SA 1W0CA 1D1SA 3E03A 1CDOA 5G0UA 1Y8QA 3PQDA 2AXQA 1PS0A 1CWUA 5I7VA 1AXGA 1TEHA 4BNZA 3ZWOA 4D43A 2G17A 1H6DA 1U1IA 1JKIA 3F5QA 3GN2A 1HDXA 3JQ7A 3TN7A 2HJSA 3VH1A 3JV7A 3B20A 4UAGA 3NJ4A 5CEEA 1E3JA 5ENVA 4R5HA 4HV4A 1F8FA 3H9UA 1HYEA 3PWZA 2Q2WA 3AI3A 4J1QA 1WVGA 1H93A 2JD1A 1Z82A 3DZBA 2UV8A 3PHLA 3WGZA 1N2SA 3OMLA 1CERA 3UHAA 3TRIA 1ONOA 4R5MA 5EQFA 2C7GA 1YQGA 3UGKA 1L1FA 5I9LA 1B14A 5TLSA 3RFTA 3EC7A 4OYRA 3UVEA 1JW9B 4A27A 4GWKA 4BO3A 4YJGA 3LF2A 4ZHSA 3FWNA 1FDVA 2IXBA 5IDWA 2GZ1A 4G2NA 3E6AA 3L0DA 3GQVA 1GV0A 3ZWXA 2DBRA 2IDZA 4BO2A 4J7UA 3L6DA 5KVCA 2EGGA 4ZQHA 3T4XA 1XELA 3MCVA 1UP4A 1VM6A 4EGFA 1ONNA 3WTBA 4L76A 4TRNA 3N74A 3WJ7A 1KEUA 1I32A 2VUTA 3GFGA 5TRTA 3I3OA 4Y98A 5JFOA 3IIEA 4RQTA 1EE9A 3IP3A 2I6TA 2NQ8A 4DA9A 1DIGA 1NVMB 3D4OA 3GAFA 4XGNA 5L53A 4AL4A 4OM8A 4E31A 4JBIA 1ZVMA 4Z6KA 1T25A 1YDEA 2NU8A 3ZWYA 4G5HA 3DBHA 3I23A 1ZMOA 1DLIA 5HBRA 1PS9A 1U9JA 3KOUA 1TT5A 2GASA 4GLOA 4J16A 1H6AA 2OGUA 1OBFO 4PLGA 3RJ9A 5BT9A 4PZCA 1GPDG 3R3SA 2C54A 4JNKA 4OH1A 4F6LA 3GAZA 3L4BC 4RPKA 4M89A 2CDBA 1R4MA 3SLKA 3PPIA 1MC5A 2IZZA 1OFGA 2SCUA 1U28A 2PZKA 2D0IA 3TJRA 5IN4A 3SVTA 3ICPA 2NLOA 5BR7A 5LDGA 5A5FA 1XQ6A 4GVLA 3Q3CA 3ZHXA 2PKQP 3HNPA 1T2AA 2GCGA 1SOVA 3NRCA 1R16A 2JKVA 4E32A 1ZEMA 4J43A 4W9NA 4RV9A 2JHFA 1QV6A 2NNLD 2PNFA 3ONDA 2VQ3A 4ITUA 2CZCA 3S55A 5A9TA 1PJSA 2HQ1A 2WEKA 3JQEA 1E3LA 4WLUA 3WX0A 4QECA 4EUEA 3ZWCA 1F8GA 4JQCA 4Y6SA 1QKIA 5COBA 2YDXA 4GLLA 4BNHA 1H2BA 3GEGA 3MJTA 2VOJA 1B7GO 3EGOA 1P44A 1JVBA 1I36A 3I1JA 3DZGA 5CHEA 4IXWA 4YRBA 1I3LA 1OC4A 3NDRA 2Y1GA 3WWYA 4NJMB 3JYOA 4DTIA 1ZSNA 1XIVA 2NVWA 3K6JA 4A7PA 3VAZA 1E3IA 1HSZA 5JE8A 4F45A 3DAPA 2Q4EA 1TXGA 5HA5A 2V6MA 4II3A 3DXFA 1DB3A 5A04A 2PGLA 3N58A 4MKRA 3T4EA 4J9VA 3JD2A 3KRTA 2J3IA 2DLDA 1LNQA 1XR3A 4XKJA 4E6PA 2JAPA 2V65A 4ESOA 5CFZA 1KEVA 3GR6A 3FHLA 5BQFA 1NTOA 2RBEA 3NDIA 3MTJA 1V35A 2FPGA 4YQYA 2ZTVA 2QRKA 1LSUA 1B2LA 1EVIA 3T7EA 4GX2A 4KDFA 1WNTA 4B4WA 3QVTA 5EQDA 1EUZA 4MVJG 1UDBA 5T8KA 1MUUA 5JCJA 3PZBA 3O38A 3H9QA 1A27A 1E5LA 2P91A 1E3WA 1DFIA 1FDTA 4OIMA 2B69A 4UVGA 4HNGA 3U4HA 5BSEA 4R9RA 4EUFA 5JXWA 1P77A 2WYUA 4FSHA 3JD3A 4R16A 3I9OA 1B3RA 1MB4A 6LDHA 3LLSA 3ZV6A 1WDLA 1ORRA 2D5AA 3GDGA 3H3JA 3H6KA 4UUPA 5HS4A 5L40A 4GL4A 1PQUA 1E7YA 3LVFO 3RFVA 1I3NA 4R4JA 4YPOA 2GN9A 4XYBA 2EW8A 3TWOA 1EFKA 4J0FA 1N9GB 3NTQA 4RF2A 1BXZA 3DFUA 4BKUA 3GFBA 3JQAA 3W4IA 5HM8A 3WR5A 4BNMA 1LUAA 3W4KA 4PLHA 1OAAA 1U8XX 4WLVA 1U3UA 3FNGA 3AI2A 1T2EA 4CMCA 1N1EA 4CMGA 2OZPA 5A9SA 3RQSA 1NHGA 2P5UA 3B6ZA 1KVQA 4IDFA 3RBVA 4BNKA 1HKUA 1CF2O 2I99A 2AQKA 1DOHA 4O5OA 4DYDA 4G81A 5A4DA 3KYCA 3RIHA 1JVSA 1ADBA 1HDZA 3H7AA 1LDNA 5AXDA 2YV3A 3JQFC 4FGWA 1GCOA 4M86A 3PHJA 4BNYA 3GVCA 2D2IA 4M49A 3I9JA 4B79A 3I4CA 3AM3A 4OHUA 2E49A 3QVXA 3QW2A 3NKLA 4MIOA 5A1TA 1PU2A 1GUZA 4ND4A 4R3NA 3CPSA 4L8VA 4PG6A 1BXKA 1GTMA 3PYMA 4Q3EA 1NPDA 5DBGA 1KIFA 2PLAA 2ZQZA 5GMOA 5FI3A 2FR0A 5KNLA 3O8QB 4WUVA 4OAQA 4BV9A 5L7TA 1BRMA 2PZMA 5JDIC 5C7OO 4BO8A 2PH3A 4B7CA 4A73A 1LA2A 4J0EA 3INGA 4NMHA 4RVUA 3OBBA 3ROKA 1YJ8A 3TFQA 5H81A 2B37A 1VL0A 1U7TA 4DBVO 1K3TA 4JXKA 1HSOA 4BNTA 3WBFA 4WE3A 5DDIP 5ER9A 2UDPA 3PYLA 2EP5A 1N7HA 5I9MA 4WLEA 1TB4A 1H0KA 2VHZA 2R00C 3ZHZA 3RFXA 3SLGA 2Y0EA 3U62A 2I65A 1HYHA 4E2ZA 2O7SA 4BNFA 6ADHA 5F1KA 4JBHA 3GG9A 5EL0A 1E6UA 2VYND 1YB1A 4L0QA 2XF8A 3KUXA 1HLDA 2QX7A 3U9LA 1LJ8A 3HN2A 4XR9A 1RM4A 5I8WA 4XD2A 4AJKA 4XRGA 3I4FA 4YACA 5THKA 1R4NA 5JYEA 4IIVA 3FNEA 4URFA 4WGGA 4GBJA 2HJRA 1NASA 1K2WA 4MVJD 5B12A 1VC2A 2NU9A 3A4VA 4EBFA 4GGPA 1R12A 4QXMA 5I7FA 2Z95A 4TQGA 3VH3A 2DFVA 4XX0A 3RUEA 4RPJA 3KYBA 3PIDA 5JMPA 3RKRA 3FTPA 3G1TA 5IDYA 3KYDB 5TS3A 3I83A 2Y1DA 5JYDA 1YBAA 4YBZA 4BO9A 3R0IA 1K6XA 3JQGA 3AOGA 3I6QA 2HMWA 3LC7O 1EEHA 1OZAA 4EJMA 3ULKA 3N7UA 4BNLA 5ES3A 1DPGA 4IDDA 1MX3A 2X58A 4IJKA 5LCXA 3VTZA 4XJSA 4RF5A 3WQQA 4J3FA 4YTEA 2PGDA 1SC6A 4GX1A 3GDFA 2CFCA 4HUJA 2J8ZA 3BMOB 3ADPA 1GZ6A 2NU6A 4M55A 2YV1A 4RZHA 4CM4A 2X0JA 3VPGA 4F6CA 1SMKA 2VRCA 1E7SA 5JPIA 3HSKA 3WNQA 1P9LA 3WYBA 5I8ZA 3LT1A 4RVGA 4H16A 4ALJA 4WLFA 4XDYA 3RI3A 4D45A 5T57A 3GNTA 3IC5A 4NG5A 3UUWA 1V0JA 3ZV4A 1XSEA 4GSKA 3TDKA 1ZO8A 1UXGA 4XDZA 2FY8A 4LMPA 1RPNA 4GI2A 3EYWA 1HE5A 1KS9A 2CVZA 3GMSA 4LSMA 4RLSA 3ZZNA 2Y1EA 2X1HA 5AQ1A 4R1NA 4D0RA 2WMDA 3G1UA 4DBZA 1FDSA 1DIBA 3MTGA 5IN5A 4CQMA 4CL3A 4WLOA 3F3SA 1Z74A 4BNVA 4CLXA 1LRKA 5U4QA 1VJ1A 1VI2A 3ZWPA 1XKQA 4O6VA 3VVCA 2O4CA 4Y6PA 1YO6A 2AW5A 2NADA 2RCYA 3ONFA 4RVFA 4ZA2A 1NHWA 5BNIA 4AVYA 5C5IA 1IOLA 4XIYA 1TVEA 2EEZA 5IZ4A 1IULA 4GX5A 5JSFA 1U5CA 5EJ2A 1KOLA 1PJ3A 2NTNA 4HFRA 4Z0TA 3RUIA 2X0IA 1BVRA 2E6UX 3MJVA 1TT7A 2A94A 2ZJ1A 2X86A 3OQBA 2OBYA 2VT2A 3W8FA 5KJ1A 1LDEA 3DL2A 4HADA 5KVQA 4XQCA 2J6IA 1QYXA 2HK7A 2BHLA 2JCVA 2YHIB 4R9SA 1IY8A 1KBZA 4FD3A 4I5FA 3V1YA 1UAGA 3AFNA 5DN9A 2BFAA 1YQDA 3C7DB 1VSUA 4W7IA 3S8MA 3TL3A 1RM5A 1SAYA 4WOJA 1NBOA 3CMCO 3AU8A 4DGSA 5L3ZA 4RCVA 4CM5A 1QRRA 3H9JA 4WCFA 1JU9A 2B4QA 1UAYA 3JQAB 3RC2A 3AY3A 1PJTA 3ETEA 4IJWA 3LC1O 1F12A 1RM3A 1NNUA 3V1UA 2EKLA 5K9ZA 3D1LA 1VJ0A 4NBVA 2F00A 4RO0A 3VZSA 4A5OA 4HNHA 1YGYA 4EJ0A 5F1OA 1NQOA 3IUSA 1IUKA 3MJ4A 2J5QA 2TMGA 4BNGA 2YDYA 2DPGA 1NR7A 4RF3A 4QQRA 3O26A 3KYCB 4UVHA 5IDQA 3QJ5A 4L75A 3DOJA 1EZ4A 5B4VA 4BQPA 3RWBA 3SX2A 2P68A 1GPJA 3A28A 2ILTA 3PFWO 1GQYA 2CF6A 1M67A 5A5EA 3QRWA 1XYGA 5KWEA 4DXHA 4IS3A 1HDYA 1LXCA 5DOVA 1V3TA 4IBOA 1FJHA 4W9NC 4MVJI 4B3HA 3I6IA 4QSMA 3ADOA 1A72A 2ZTUA 3CINA 2DU8A 3D0OA 4DLBA 4MIYA 4RQUA 1PJQA 4D46A 5L4LA 1BMDA 1BWSA 2GPTA 3D64A 1BXGB 3B1JA 3VPSA 3I5MA 3P2YA 2Y99A 1AUPA 7ADHA 1T1RA 1QXSA 4YJHA 1D1TA 3DBRB 4K1LA 1EUDA 4YJDA 4CMEC 1E1KA 3OECA 3IDSA 4PLYA 3VC7A 2X22A 2VNAA 1LRJA 4AJIA 3MJCA 1NPTO 3ZWVA 3IP1A 1ISGA 4BOYA 3M2PA 5TX7A 2EHDA 3BIOA 1ADCA 1ENOA 4J4BA 4OOFA 2C5AA 2GN4A 4ZN6A 5CDTA 5CG2A 3TZ6A 4RPHA 3GUCA 1LBEA 2B5VA 4H7PA 3MOIA 1DIAA 4WEQA 5DT9A 4J4TA 1HDGO 4UUMA 3LDHA 1E7QA 2C0CA 2GZ3A 3SEFA 4A0SA 4PIVA 1E0DA 4DPLA 3QSGA 2O3QA 3H5NA 1GQQA 2CUKA 1LLUA 4HX5A 4E5PA 1YH3A 4KTTE 2VYVD 3GPDG 5CDUA 2CY0A 3W6ZA 2GD1O 3RUDA 1LQUA 1NQAO 1K0UA 4BNJA 4CM9D 3KVOA 3D4NA 4CLRB 5T8KC 1NWCA 1Z7EA 3IKVA 4IQGA 4IDGA 3JQ8B 4FPXA 4NJOA 3AM5A 3W6UA 1IPEA 5JAIA 1UP7A 4BL5A 2OO5A 4D0SA 4RDHA 1KVTA 3UF0A 1WP4A 2AQHA 3DZIA 4XB2A 1UP6A 3QVSA 4BKRA 4XQ9A 2IYOA 1C0KA 3H3FA 3G79A 1I01A 3MWEB 2EKQA 1E5QA 2BH9A 3U4CA 4R1SA 2CVQA 1XG5A 4N54A 4CR7A 2E4AA 1P1HA 2HMTA 4YA6A 3AW9A 3GMDA 4JJGA 2POQX 4JN6B 3UW3A 1JQBA 4FFOA 3DBLB 2DM6A 3CSDA 4IDCA 1F06A 1T26A 4CV3A 3AU9A 2BGMA 4N5MA 1YOVA 5EERA 2PZJA 2W8ZA 2DBQA 2W2LD 3WFJA 1LRLA 3QIVA 4CMJA 4I9UA 4A26A 5JO0A 1Q7CA 3E5MA 1J4AA 2WD7B 4RVHA 1U3TA 4DPKA 1W73A 4BB6A 3GC6A 4AG3A 2DFDA 2ZB8A 1ULSA 2IEBA 5AYVA 2W98A 1PQPA 1EBUA 5L9AA 1HRDA 1ZSYA 3EUWA 4WNCA 3RU7A 3MJEA 4BUCA 3AOEA 4E5NA 3OJLA 5A05A 2V6BA 2FMUA 2X5KO 2AEJA 3GNQA 2NTJA 2DT5A 2VWHA 4J49A 4TKLA 4J7CA 1R0SA 2VHYA 5G4KB 3IOYA 4YRAA 1PZFA 4IMRA 3DMTA 5IZCA 1NQTA 3PJDA 4UUNA 3HN7A 4D7AA 5EPOA 3VKVA 4CL8A 4TSKA 2AMFA 2J3JA 4EJ6A 3CMMA 3OQ6A 4XGIA 4HFMA 2FP4A 1B15A 5ADHA 1M6WA 1PSDA 3KLMX 4CUZA 3D5QA 1GUYA 1Q0LA 1F0YA 2OOSA 2VWGA 1DSSG 3M2TA 3EZLA 3ZWNA 3HFSA 1R6DA 4LSWA 5JDCA 4CV2A 1W4ZA 2Y0DA 4K28A 1U2GA 4W4TA 3ASVA 4YQZA 1GZ3A 5IFLA 1U3VA 1ZW1A 2XPCA 2G76A 3ANNA 1AGNA 2DBZA 5IXSA 4OSOA 1T2DA 3WXBA 3QV1A 1P1IA 4FFMA 3L07A 1I0ZA 3V8BA 3WTCA 4CV1A 3TOZA 3BMCB 2P4QA 4MOWA 3BMQA 4ZQFA 2G1UA 4N5NA 4ND1A 3PJEA 1SO8A 1M66A 1V6AA 3QP9A 4PLPA 3F4LA 1LSJA 1EBFA 3F4BA 1B8UA 5DNAA 5A06A 1XU9A 3FR7A 1JTVA 3B70A 1PX0A 2NWQA 3GZ4A 4HFJA 2EJWA 2ZB7A 3OP4A 1ENYA 2LDBA 1WWKA 4MVJE 4JP2A 3LT2A 3U09A 1I30A 3RVDA 1T2FA 3FPCA 1C0PA 2UAGA 1GDHA 3A1NA 2PFGA 4ND5A 2ZB4A 1H9AA 1WW8A 1PZGA 4E30A 3S2IA 2Q45A 2PD6A 1VRWA 1P0FA 4KDEA 2A35A 3WGTA 4H15A 3KSUA 4CQLB 1HDCA 5HTOA 2NACA 4JCOA 3CZMA 4ZGWA 5A02A 4GVXA 2H6EA 3OIFA 1P33A 1O94A 1PZEA 4BO6A 4OQZA 1LEHA 5T64A 1D7OA 3WBBA 3L4SO 3OFSA 4KQWA 1GCUA 1VL8A 1Y81A 1EFLA 2HKIA 3JYPA 1MV8A 2HU2A 1HE3A 2PH5A 2YUTA 2A4KA 1BW9B 4U6SA 5BNFA 3HDJA 4CUJA 1LDBA 2XOXA 2O3RA 2XXJA 2Y1CA 5DCYA 3W4JA 5IF3A 3C1OA 3GGPA 4AJJA 5KCZA 4ALKA 3L9XA 4CM6A 4IQ8A 5FYDA 2P9GA 3OJ0A 4R54A 4PRKA 1CQIA 1I2CA 5JO9A 1XA0A 3DAFA 4QTZA 1H6CA 3BTSA 2Q49A 4E33A 1TI7A 1U3WA 3S2EA 2ZK7A 3GEDA 2W90A 1GEGA 3OM9A 5I7SA 8LDHA 5F5NA 3GZNA 1C0IA 4FW8A 3W8EA 4A10A 1NAIA 1XHLA 5KVVA 1CEQA 1ZCJA 1OC2A 1UZMA 1A4UA 1LLQA 4DREA 2CSUA 4CUKA 1EQUA 4IPTA 2BFMA 2GERA 5ITWA 3K9QO 3K73O 1DJNA 1E92A 1YS4A 5EESA 2QYSA 2I3GA 3I9KA 7MDHA 1WMBA 3Q9NA 4BV8A 3ROMA 2AE1A 2JD2A 3JQ9A 1Y8RA 1VL6A 3KHUA 3M1LA 3DOOA 4MINA 2YJZA 4PVCA 4WOKA 5CPBA 4JLWA 1AHHA 1XGKA 3OH8A 3ZNQA 1LC0A 2ZTMA 5J23A 1E1MA 1BVUA 3V1TC 1YQXA 4PG5A 4LMRA 1RJWA 2B83A 5FEUA 2E82A 3CUKA 5B1YA 2YW9A 1BSVA 1X7GA 2J5RA 4Y6RA 3AY7A 1PGJA 1HEUA 3ETDA 4YT8A 4R68A 2BLLA 3SC6A 3GPIA 3H65A 3PQEA 1EDZA 2O2YA 4ZRNA 1EVYA 1YJQA 1YE3A 1AXEA 4Y67A 3RC9A 1X0XA 4C7JA 1T24A 2Q50A 1C1XA 2PR2A 4YXFA 3D3WA 3Q1LA 4YAGA 3WGGA 3KO8A 3O9ZA 1DEHA 2BI8A 2LDXA 3DTYA 3LC2O 2H5LA 3PJGA 3R6DA 5AXAA 3GH3A 3VOSA 1I5RA 5FI5A 4AJ1A 4E2YA 1N92A 3JQCA 3UOGA 2X0RA 4IQ0A 1QSGA 4BKOA 3AUTA 2ZCUA 4CMIA 2VZ8A 4BGVA 1UZNA 1KYQA 2O7QA 3DR3A 5JCJD 1L7EA 3VZRA 2AG8A 1Y8QB 2QRLA 1JLLA 1MFPA 1U4OA 4MPDA 5TT1A 3E48A 2DTDA 3A9WA 4P8RA 1SB9A 4NBTA 3AUUA 4IY1A 1WDMA 2BMAA 2GYYA 1PGNA 3S2FA 3G0OA 3ETGA 4J6FA 1C3VA 4NFHA 3JQ7B 4EW6A 4FB5A 2Z1NA 3TF5A 3IL2A 3RBXA 3WNVA 1C1DA 3U4DA 4AICA 3SBOA 2X23A 1IHXA 2VTDA 2E48A 2AEFA 4WCDA 1X13A 3RJ5A 1ZFNA 1QG6A 3Q0EA 2OBNA 2NVUA 5CEJA 1NXQA 5IXYA 9LDBA 5EMHA 3FWZA 3PLNA 4WNIA 5JMWA 2B36A 5K0ZA 1IYZA 3GVPA 3C24A 1T4BA 1BTOA 1QLHA 5DBIA 4Q3AA 1JWAB 4JGBA 1KVUA 3JQAD 1UJMA 3PP8A 4PZDA 3DTTA 5DBFA 5TJHA 3WGHA 1M76A 1WAMA 2TMDA 4OKIA 1UXJA 1PR3A 1GEEA 1K6JA 4YB8A 4NFYA 2RH8A 4A03A 2PY6A 2EGHA 1MLDA 4YJGB 1UXHA 3HDYA 4C7KA 1CRWG 4YDRA 4YT2A 3C7CB 1QP8A 4CLOA 3H9EO 1KY4A 4INAA 4Z9YA 4J1TA 4ILKA 1HZZA 4J2HA 1FF9A 5L7YA 3W8DA 3I9NA 1Q7BA 1Q1NA 1H6BA 2NQTA 3RASA 4B3JA 5GZ1A 2UUOA 2IXAA 2YYYA 2E37A 1PGPA 4FOSA 1DBVO 3UCXA 1IE3A 3KXDA 4ALNA 3E82A 2PA3A 4ONEA 1PL8A 2RAFA 2Y1FA 1ZK0A 2YHUA 3B1KA 5JY6A 1ENZA 3LYLA 4XYEA 5CPFA 4BNWA 3WGQA 2X0NA 3Q9UA 3ZNNA 4DLAA 2WWRA 4YJFA 5K6AA 1E3EA 4FJ0A 3RUCA 3LSYA 4JROA 3INTA 3DBHB 3BMNA 4LISA 4W82A 3K92A 4DMLA 3ZW8A 1U2DA 1TT5B 3PK0A 3I9MA 3IUPA 2WE7A 4HWKA 2HO5A 3DOCA 1FK8A 4E5YA 4EUHA 2I5PO 1PS8A 1OOEA 1DFGA 1R4MB 2BFOA 3KBOA 3LF1A 4IIUA 1PQWA 4MKZA 4QFDA 4U0JA 2BGLA 3LQFA 4IZHA 1FDUA 3OICA 3P5SA 5TC4A 4KUEA 1DC6A 3GHHA 1MA0A 1NX6A 3INRA 4QO8A 3ZCXA 4GQAA 2D8AA 1ISJA 4X54A 1C0LA 2ZKLA 3UAGA 3QWFA 5F21A 3BHIA 4B8WA 1P45A 4EDFA 2EP7A 4BMVA 4E5KA 3ON5A 3HB5X 3G3EA 2WE8A 3WIDA 1DRWA 1HZJA 1PIWA 3I9LA 2VUSA 3K30A 4J1SA 1M2WA 1UXIA 2OXIA 1Z73A 1EDOA 1KVSA 3ABIA 4TMFA 1DC4A 3ZU5A 3KLPX 5C3MA 1WXDA 4QUKA 1Y6JA 2BKAA 2WDZA 2X9VA 1G0OA 3LLVA 2QRJA 4J1NA 2J3KA 2AA3A 2QIOA 4R41A 3GVHA 4DPMA 2X9NA 2C82A 2C2YA 1YBVA 1EVJA 4UULA 4CMBA 4YAKA 5IAAA 4ZQEA 1PZHA 3ASUA 1ZMTA 2YV2A 1E6EA 4QT0A 2O2SA 2W2KA 4JJIA 2AEMA 4XCVA 4M87A 3BTVA 2Q1TA 3PDJA 1ML3A 4L9RA 2I66A 3PI7A 2X6TA 4TVOA 5F3RA 5I7EA 1GZ4A 3PWKA 3C3XA 3ZU2A 3RD5A 3AJRA 1LI4A 2Q46A 4LGVA 5FF9A 2VOEA 1JAXA 2GSDA 1P1RA 3WS7A 3AOEC 4TRRA 1NAHA 1U4SA 3TSCA 1M75A 4AJPA 4RDIA 4NNJA 4B4OA 4L4SA 2GLXA 1A4IA 1GUFA 3OIGA 4WEOA 2PKRA 4TVBA 4L4XA 2VRCD 4A2CA 1H5QA 2OORA 4DRYA 5CDYA 1GYPA 4LW8A 1E3WB 1WDKA 2ZB3A 2PGJA 3AWDA 3OHSX 4I9NA 3SXPA 2RHCA 1ISMA 3VH4A 1Z6ZA 4PN3A 1ZUD1 1XWFA 2H9IA 2P4HX 1D4FA 1KY5A 4PLTA 4ZQBA 1ISHA 1GR0A 5JDCC 2JHGA 2C7VA 1H2HA 3TZHA 2Y68A 1G6KA 4R1UA 5IJZA 1WMAA 5IG2A 2O3TA 5A3VA 5KKAA 2HRZA 3WLEA 1B16A 4CQMD 4S1VA 4ALIA 4PG8A 2PK3A 4HKTA 2BELA 4UUOA 1GY8A 3OA0A 2Z1MA 3WOHA 2DUWA 1W8DA 2EXXA 1UR5A 4P22A 1VPDA 4DYVA 3V5NA 3AY6A 4E3ZA 1ZXLA 4PCVA 2Q1WA 3L77A 4JJFA 2PZLA 4UVIA 2GN6A 2JCXA 1JKFA 4PG7A 3AI1A 4XEHA 5A9SB 3QVOA 1Y5RA 1XCBA 1GFSA 5TF4A 3JYLA 2BF7A 2EIHA 4J2OA 1QYDA 3K31A 1J0XO 4NQZA 4UVEA 3UXYA 2ZIZA 4KZPA 2OP1A 1NQ5A 1X15A 2CD9A 4AJ2A 4EZBA 3FN4A 3WDSA 4BNXA 4OXYA 1IPFA 5ER6A 5G0WA 3DZFA 4NK5A 4Q3CA 1B26A 1QYCA 2HK8A 3HDQA 4OMUA 4UEKA 4RORA 3UCEA 1WZEA 2PKQO 4KOAA 5TNXA 5JC1A 1GD1O 4DLLA 1HT0A 2WM3A 4YAIA 4BVAA 1ZEJA 2H63A 5KJEA 2OP0A 2BD0A 3IKTA 3HDHA 1X14A 1IZ0A 3JQDA 1A9ZA 1RWBA 2VN8A 2AQIA 4AFNA 4NU5A 3DMYA 1UH5A 3DC2A 4UVDA 3GHYA 4O59O 3D3EA 4FJ1A 1S6YA 3P2OA 4RPGA 3E9MA 3VTFA 2YFHA 5JDIA 2VRBA 2QZZA 4IDBA 2GR9A 4CMHA 1B8PA 2AG5A 4TZTA 2WJPA 2DBVO 4XQGA 4Y9DA 1I3KA 4ZJUA 2NM0A 3DDNA 2D5CA 4XA8A 4HY3A 3V2HA 2ZCVA 4YT5A 2V6GA 1QR6A 1O8CA 2FN7A 4BS9A 3OJFA 5KVSA 2GRAA 1LX6A 2ZTLA 4NJMA 4UEOA 4KUGA 1ISFA 2P9EA 1RM0A 1O6ZA 4MKXA 2FRDA 1RYEA 4Z9FA 4NR0A 4QEDA 2YQ4A 5CEFA 4KWIA 4YYZA 2AQ8A 1SZJG 4RPLA 5DOZA 4B4VA 5HRUA 3KSDO 4CR6A 1R4NB 2IODA 4YEDA 1GADO 2QHXA 4BGUA 1IL0A 3BMNB 4L4RA 1ZJZA 5JC8A 3FI9A 4RVDA 5AVOA 2RIRA 2EWMA 4BNUA 5BSHA 3LT0A 4D3SA 2VWQA 3DHEA 4IDAA 4IINA 1CQJA 1X1EA 3JQ9C 2IE0A 1ADGA 1TLTA 2DC1A 1ZK1A 3K2EA 4WASA 4XRRA 5C7IO 2FZEA 2JD0A 3F1KA 3RCBA 4D3FA 3WMWA 3RSHA 4CPDA 4IM7A 4P38A 2JFGA 4IJVA 4ZD6A 4Z0PA 4BQRA 3CZRA 2EERA 1EK5A 3JQGB 1KVRA 1MG0A 3HADA 5LDHA 2RH4A 4ZVVA 3O4RA 5JAMA 1Q7GA 2PWZA 4R51A 3DB2A 5C37A 4TRMA 5FWNA 1IHYA 3GVXA 3ZU4A 3JCZA 5JNLA 4Q39A 3PDUA 4BGIA 2DUUA 2Q99A
chains in the Genus database with same CATH superfamily
5CRIA 2EQAA 1JPNA 1YZYA 3H9GA 1S2OA 1RHKA 1W49A 1YUBA 2F1IA 2NU6B 3QVWA 2GCIA 2EQBA 5ETJA 4B17A 4BFWA 5K6RA 5LOVA 7REQB 2FG5A 1XU7A 2OV3A 1ZVJA 2WYWA 1N6KA 1W93A 3COSA 2M2IA 4PLWA 5E9AA 5IJWA 4MIKA 4INPA 4OQDA 3URMA 3EXHA 1NI3A 2Y0PA 2FWMX 2ZDQA 1H94A 3FAZA 4JLOA 5DHPA 3CR7A 3WIEA 1L9KA 4CIBA 1XTUA 3DAHA 1YL5A 1Z4QA 3CTVA 3OQHA 4IX9A 4Q6WA 5DU2A 3VO2A 3L1VA 3NRBA 3S2GA 3MTAA 5DTQA 3X2EA 1ACJA 4MWTA 5EZYF 5FEUA 2XT0A 1AQJA 2AN1A 2N46A 4EMBA 3SJAA 1A4XA 2VTBA 5K20A 4HH3C 4UHDA 1H1TA 4YRSA 4LOHA 2XTAA 1H65A 2CYBA 4DQXA 3GYBA 2Z43A 1TAHA 4LIPD 4NDZA 5IEBA 3IXMA 1RS0A 1TLFA 4Y2HA 2QROA 2F8LA 1WCXA 3MLAA 1RYMA 4DS3A 4UEWA 2QE6A 4PGMA 3UT6A 3H9BA 1OYVA 1ONPA 1RCUA 5ILGA 2VPXA 2O05A 2Q2VA 4LCJA 3OZRA 1TPZA 2PX8A 1E7MA 3ABRB 1DTWA 2ONCA 2KMLA 1RFGE 2VSOA 3NT5A 3LHDA 1N7GA 1C9KA 4Q18A 1AVTA 5FOTA 1SB8A 2Z5GA 1L7XA 1JHUA 1EK1A 2PBRA 3CZQA 2IP2A 4HPWA 1O54A 4NIMA 4RXTA 5AW3A 3FMVA 2XITA 1JF8A 3HXLA 3T9AA 2YASA 3RK1A 1EKXA 1NATA 4N01A 3SHFA 3I1FA 3TS1A 1ATZA 5K09A 1JU3A 1YMUA 2V9ZA 2FDCA 1DJQA 2QMEA 4MHOA 1BJTA 4PSAA 3AC0A 3BS4A 3T7CA 3TUZC 2ZRAA 4DJJA 4MUAA 5JISA 2JAWA 1VE1A 1VJTA 2FQWA 3O03A 3E5RA 1UMDB 3IDQA 3DQPA 2ZDGA 3L0IB 4GLBA 3VR6A 3ROEA 4XUGB 3ZDXB 3SC2B 1X7HA 2CW5A 4X8OA 1WQ4A 1P6XA 2CDAA 4J0JA 5G41A 2I67A 3QW4B 4I8XA 1Y6RA 3OJOA 4I66A 3TPCA 3UHFA 1FW6A 4RKEA 1CE8A 1L5SA 1GGHA 2ZI6A 5CM9C 3K09C 1L4BA 4D9GA 4J1TC 2G4CA 1Q11A 3FKQA 1F17A 3D7RA 3SQOA 5IVKA 1CLUA 1HFKA 5HFJA 4BO0A 1PFYA 2G09A 2PRZA 1XPOA 5CFLA 3BHJA 2IQIA 4I1VA 2C3UA 2ATIA 3W1VA 3B6EA 4MR7B 2NUPA 4Q3BA 1L3IA 4DLYA 2GARA 3ZGNA 2YIMA 4QDZA 5ICSA 2GVZC 1YS9A 1P18A 1R8QA 1NP3A 3L6BA 3EG9B 2BP7A 2ZVPX 5A9RA 3C14C 4F91B 3U7RA 8ADHA 3VMFA 4NPHA 3E9NA 2NTYC 3CN7A 2ODNA 1LQTA 2I4LA 4DMGA 1YBFA 3NAMA 4WZAB 3UBMA 4RX1A 5A7GA 5ENZA 4U2KA 2O0LA 2OEPA 2ZI5A 4F46A 1YF3A 4C6RA 4IH1A 1GFIA 1CVIA 3BZUA 5JARA 4L22A 3V32A 2Y92A 3F3KA 3PEVA 4IVNA 4R1OA 1ENPA 1YZFA 1ANKA 4GR4A 3HJAA 3PDHA 3TZKA 2YZNA 2E4WA 4J91A 4G1VA 2Z56A 4K88A 3IJEB 4YRJA 2IH4A 2VCYA 3NEJA 3REOA 1BH2A 4YXWA 1O95A 2P9YA 3WWZA 4Q6BA 1TCUA 3IAS6 5E9JA 1T2CA 4PAMA 1UC8A 1PWZA 3QSYA 4FEGA 4KPGA 5FWDA 4MIEA 2FSPA 5DP2A 5KOIA 3T15A 4BV2A 4U6QA 5CTJA 1LDGA 4ZVOA 1Z56C 2VBIA 2W58A 3FSEA 1N75A 3C48A 1ZXBA 3AHEA 1M7GA 3C5HA 1Y1RA 1D6NA 1DIOB 1XVVA 2AR7A 4UFNA 4NBWA 4YNBA 3AIOA 4AQDA 5KC8A 3ZU6A 3OCZA 1DHTA 3WICA 2PTGA 3UMMA 4E0BA 1F14A 2VHTA 2W2OA 1DX4A 3OZEA 3ADDA 2JCYA 1RI3A 1OIXA 1WHTB 4HBGA 2O4UX 2PU5A 3ZV5A 5KNDA 4RTRA 2ZYDA 1D2RA 1AE1A 3UJ3X 2PXCA 3TZQA 3ZIAD 1LJUA 5L6LB 3R8FA 1JN0A 3RU9A 1HTBA 1AZSC 3EVNA 2GBIA 1ETUA 1Z2PX 2QN1A 3LX4A 3K8OE 4NEHB 3MMXA 1FE8A 1ULTA 3VJKA 2JLYA 3IODA 3WGLA 1PJLA 2WLSA 2CEKA 2UZ4A 1NNI1 1R8YA 1G5IA 1VSQA 3EGXB 3HP1A 1K2VN 4Y9RA 5AJUA 4RCYA 5CCDA 3RYIA 4C87A 2CMHA 3BGSA 4BZPA 5D7BA 2QQ5A 4D96A 1SC3A 5ICCA 1JQDA 4CMEA 5IRCD 2PXHA 5AK6A 2O52A 4Y2QA 4YN3A 3GNSA 4NU6A 1G8MA 2QXYA 4CLDA 4H7HA 4Z3KA 3ZNPA 4M54A 1XCMA 3TOXA 4CV0A 3OX2A 3MUEA 3RS2A 1I3MA 1IBCA 1LLDA 5JCOC 1RP1A 4OMCA 2HMYB 3LT5A 4C06A 1V39A 1TCBA 3X43A 1VKOA 2GVNA 1JU4A 2BVNA 4B7UA 1ZM9A 1ZNQO 3KKPA 4XGKA 3K5IA 3F47A 1T3GA 3PNBA 5E4TA 2WB2A 1O94D 2XKJE 2JGDB 3MC1A 2D2FA 4MP8A 3T5DA 3ILYA 2BI7A 2FJ0A 5E8RA 3SVZA 3MGGA 1MCZA 4MICA 1Y5MA 1E2DA 2G5PA 2X42A 3D4BA 4P32A 2WSLA 3EGIA 4RHYA 5ES4B 3REQA 4EJSA 5B2EA 4P4SA 3AUAA 4AC9A 1DO0A 2IEDA 3GFRA 1BDMA 1MAWA 4S24A 3G2OA 1I33A 5FBLB 3MD9A 2P77A 1HE2A 3NO4A 1ZJYA 5JXHA 4ZEXA 2GN8A 4GOLD 5A5GA 5CX1A 5TQ2A 3ABOB 5LLTA 2D1YA 4LDRA 5DNCA 2CNKA 2WIKA 1YWGO 2QKYA 1VZ2A 3O84A 1VPVA 4KQJA 4RWZA 5ALIA 2JAUA 4HXGA 5G3YA 2DKNA 3EGDA 3KT3A 4ERNA 4LE1A 3QVMA 4FDUA 5DCLA 3BWYA 3X2FA 4EG4A 3A27A 1GGMA 4FWIB 2P4UA 2O06A 4JBXA 4JODA 4IIGA 1P2GA 2XCOA 5TARA 2HO4A 2XCTB 1DRUA 3E05A 3IFSA 1QFXA 5FPQA 3D7LA 4F5WA 1GA6A 1TO2E 3DHYA 4DIFA 3RT1A 4ZALA 4A16A 2G80A 1CUUA 2VPIA 4K8OA 4O29A 5JW6A 2YWEA 2GDZA 2GETA 3LGSA 3ZLBA 2XA1A 2D59A 3KUCA 4G9EA 3KZCA 3PNVA 3EDMA 2AG1A 3W8RA 4W9MC 4JQYA 3TSOA 4J9UE 4NV1A 3A9RA 4K0RA 2GBPA 1V5EA 4JY7A 1DADA 1ZK2A 2HJVA 1QHIA 2V55B 2J3MA 1FYWA 3B9PA 4PFJA 5J2UF 4CM8A 1YA4A 2FGKA 3KR9A 1KJ9A 4N18A 3FNBA 2H07A 2H7VA 2R8YA 3NHSA 5BSGA 4CM3A 1V45E 4QARA 3DUFA 3TK1A 1JR3E 3C43A 1UKCA 1F9EA 2R7KA 3IE2A 5BN4B 3CLRC 3M33A 3L49A 3GRYA 4JSRA 3SDZA 3T1VA 5CYPA 3IBSA 2XDQB 5CVCA 3V3TA 1L5OA 2C3MA 4LK3A 4OLHA 5JECA 2R1VA 3IQDB 1SBCA 2HGZA 3FFTA 1HQKA 3IBCA 3OVMA 2WIJA 1MN6A 4ZANA 3NAGA 2W6QA 1R0LA 4AJOA 3AHGA 3K5WA 4V1CA 3SZOA 3TVTA 1A9XB 2CMFA 2RHHA 4LRSB 4DQLA 2XRFA 1Y3AA 3I34X 3PUXA 4U2FA 2OB2A 1POXA 4OJQA 1TL7C 1OXTA 2VHCA 3ND6A 4UD6A 3SSAA 5DK6A 2ZJ8A 4MUKA 4JLMA 3E2PA 2EF1A 4NBUA 5FLKA 2O2DA 1JXAA 3LTNC 1K75A 4Z9BA 4GEGA 1SCUA 1CXZA 2AZDA 3V55A 4DRXA 4O3FA 3QF4B 4MGYR 5B37A 3TLMA 1OWPA 3PHIA 5BUZA 1OAOA 5F5XA 1G20A 2CFRA 1I0LA 4MRSA 2DAPA 2XLBA 1MNQA 4Z3DA 1MNAA 3IMFA 3BE6A 2HB6A 3AETA 4PGFA 1YB4A 1LTHR 3H99A 3TQFA 1Z62A 1P3Y1 3N70A 4JA2A 4UQPA 9LDBA 3H8VA 3M3HA 2Q3BA 5KWVA 3ISTA 4AECA 4EF6A 3IALA 1Q92A 3PC7A 3PC4A 1XE3A 4NCJA 1EDEA 3IR5A 1A69A 4O4JB 5EZ6B 1S0UA 4OUKX 2RI0A 1E9CA 4GAEA 4K6CA 3JZMA 2Y66A 4L50A 5CB8A 2QYOA 3DBRA 3VZPA 2IY9A 4DUZB 2ODPA 3OJWA 1B8VA 3TKAA 4ZCIA 1F5NA 1X1RA 2FSSA 3U60B 5B1IA 3MQ4A 5K4AA 4HNTA 1QHXA 2QS9A 2ZUCA 1EX1A 1U80A 1KAOA 3I04A 1U8FO 3TL2A 4A2WA 4R0NA 3R41A 1KS2A 4OHVA 4LQLA 2HAEA 3MQFA 4JX8A 3H83A 5IABA 1EUCA 4Z4GA 2CDCA 1G4HA 3BMQB 2COEA 3IR7A 5FUQA 4G86A 5C5EA 2PS3A 2QZPA 2YMPA 4OBWA 1GJRA 4QBGB 1EFPB 4OJKA 5AK0A 3WMFA 5IULC 1JLMA 1NR1A 1RXYA 4MV5A 1WUYA 4XE5A 1ODLA 1Z0DA 5AOVA 2UUCB 3NDBB 2CYAA 2FWPA 4X1YA 2BFDA 3KVYA 4MO2A 5B3JC 1I7DA 1HM5A 2IPNA 4MW4A 4JP5A 2IV3A 3U5TA 1M7BA 1O96A 1KIAA 3TM5A 3TTUA 3UPTA 3FKSD 3KB6A 1VE3A 3MMZA 4RFSB 2QTZA 3GCXA 2ZR7A 4ZZ1A 2AN5A 1TIPA 3MWDB 4FLFA 4OLBA 2AR9A 3WLIA 2NZXA 3WP0A 4TS4A 3LY9A 1VL2A 2PL5A 2VJLA 1HTWA 2R8RA 4Y30A 3RFCA 1CUXA 3GJ6A 5JY1A 4HJXA 3FHJA 4RSRA 4RJLA 3M81A 3ZW9A 2WWTA 2HQRA 4QBHA 3U3XA 1TKBA 1UF9A 4RYLA 3FY4A 5B64A 4S3MA 3BD8A 1HWYA 2WFLB 2E4UA 1R0RE 4FEAA 1K68A 3A14A 4XSVA 4C0HA 4E4YA 4QULA 5EINA 3BA1A 4RESA 1E6LA 3QMPA 4K9PA 2B21A 2Y9PB 4OQYA 2HZ7A 1MP0A 4W6ZA 4HATA 3RB8A 4X20B 1SUAA 3K96A 5LXTF 1VKNA 3K6KA 2D1TA 4FIZA 5BOVA 4B8ZA 4DA8A 1B0AA 4JUAA 3NBXX 3JZFA 3PXXA 2P2SA 2B4AA 5BO5A 4KLAA 3BVPA 1HMPA 1U2QA 1P8AA 3AGPA 3E7PA 4TT3A 2ERCA 2R11A 2Q5OA 5WRFA 3LRPA 1A2QA 4MQBA 1ECFA 2X4GA 1Y4ZA 1YL6A 1XTZA 2ZYIA 4G37A 3AT1A 3WMXA 3QLEA 2QAGA 1HNXB 1O2DA 4ZICA 3D8TA 3VSDA 2ZQYA 4MW7A 4FDAA 2FSUA 4HO1X 1V8OA 2VNSA 1JE1A 1TUBB 2FOXA 3LK7A 3R3XA 4TTPA 2Q41A 3B82A 2CXXA 3PQ4A 1WL8A 4P0QB 1IK6A 1QPGA 2BJVA 1PR6A 1K7XB 1PV2A 2OWDA 3C6QA 3TGWA 2B35A 3KEOA 5E4JA 3AF1A 3ITDA 3E7DA 3TI9A 3UK6A 2CLSA 3JATA 4I0WB 1SA0B 1QVAA 3R3JA 2AXPA 1SVUA 4OFXA 1XWWA 3T5CA 5LU8A 1P0CA 1ZIDA 2WD7A 4P08A 3JYHA 5TIIA 1QAOA 3A6JA 3G7UA 4GX0A 4IFEA 1WZ2A 1JKMA 1WY7A 4OGWA 1BX1A 1DDGA 2B8WA 2HRQA 1D7AA 5JZSA 3DGFC 3VVBA 2W4QA 4FGLA 4CT4B 2V5AA 3PEFA 1X9HA 4XWWA 2CB0A 4D80A 3LBAA 2YIDA 3B7GA 3CX4A 4Y1EA 3GUVA 1ZN9A 3EDYA 4Y0VA 1P1FA 1CUBA 2QP3A 4CEIA 4RC9A 1Z4JA 3E8XA 3UT5B 3JVEA 1XVUA 2PT5A 2NXCA 3GGOA 3JVIA 4LJ8A 1Y8RB 3OI7A 5G4KA 5TJ9A 3A1VA 4X7PA 2WJJA 4ZVKA 4UBNA 4KXWA 4PE5B 3HKCA 1WO8A 4UM7A 3FGNA 4NYMR 2ZSKA 1RD4A 1L8XA 1AKVA 1XLWA 1ZC4A 2BKLA 4UZSA 5DHRA 3WGJA 2EJVA 3IPXA 3L3BA 2HMUA 1DIHA 1FP7A 3W6OA 3ENKA 2GFHA 4H3VA 3C98A 1QJ4A 2HTFA 4I55B 4AK9A 3A6LA 5KTKA 3G6KA 1QCDA 3ANXA 3K0HA 2KJQA 2YQ5A 1EE2A 1HI9A 3I52A 2I3DA 4LTNA 3U4AA 1G8GA 2FF5A 1PW5A 2XMPA 1YR2A 4J4HA 4ND2A 5JS6A 4WKNA 3WHIA 5BSKA 5LM3A 2YNMA 1EK0A 1HEIA 4G01B 4ZVSA 3VU8A 5LP6F 1DDIA 4DMFA 2YVAA 4FR5A 3EIQA 4IZIA 3VZQA 5L4SA 5KNCH 3ZZ0A 3ZDZB 4BLPA 5EE3A 4FYMA 1DQZA 3NMUF 3D3WB 3FF4A 2W6ZA 3I42A 5DULA 4KJXA 1QOQB 1ZKDA 1P4GA 2HMVA 3WYCA 1QGUB 4JLSA 3KVNA 2CF5A 5KO2A 5LL6P 2BFWA 1TJNA 3CTMA 2QN9A 1N2ZA 1N6PA 4O1IA 1J2YA 4V02A 2JHAA 4E13A 2RHJA 4BJHB 5FUYA 4D3DA 3A6GA 1NZJA 4TYWA 3WL3A 2BGTA 2XB6A 2I7TA 1EFVA 5KYYB 3PGJA 2EBUA 4YFYA 3DNPA 4EEXA 3L46A 4IJUA 5GOZA 4HWTA 1UWVA 3F8SA 1SUBA 4HP8A 4LJ7A 3H84A 5DM0A 1KETA 2OECA 3ZGYA 2R751 3BIJA 3F0TA 2VSXA 4DC0A 2WILA 2XD4A 2EW2A 2QUHA 1F38A 3BUSA 3L7IA 5A6VA 1VECA 4EX6A 3MVEA 5FPTA 3BREA 1B00A 5I7AA 1ECJA 3M6IA 1CJTC 2D3TA 3NGXA 2J6HA 3RODA 5IYZA 2OCXA 1C1DB 2QUZA 4YFVA 3ZY4A 4QLBA 4QYIA 4TV9A 2O8CA 2Z1DA 2GNOA 4H08A 1Z39A 3EMVA 1VLHA 3IT3A 4P3OA 5CJ2A 4LE2A 4TXJA 4HRAA 1RWPA 2PL1A 4HQ0A 5AKEA 1A7UA 4BQQA 2NVUB 1DBWA 4UTPA 3JQBC 1NXOA 4KQMA 3Q3JB 4DXDA 1K89A 2ZYSA 3DMRA 3O7WA 3SXJA 1GCAA 4Z54A 5ARBA 1Y8CA 3OE4A 4L73A 4KRGA 4TUYA 1C2TA 3C16C 2KSQA 2O0MA 1Q0QA 2A2ZA 2CEAA 2Z9BA 4HSGA 3S29A 2CMDA 3ORFA 2OT3B 3FYHA 1Z45A 2AFHE 5IARA 1IZ9A 2QT0A 3V8RA 4Y2SA 3L05A 2JRLA 1PJ2A 2OXEA 5D1NA 3ECSA 2X7JA 5CP8A 2I7DA 2LP4Y 4A8JA 1N1GA 4OJNA 4ALLA 4BKMA 4DA4A 3DZDA 3H5RA 3V8PA 1ODIA 4RZXA 1UODA 3CLRD 4GI3A 4C4AA 1ICEA 4I5IA 3OD5A 4CM9A 4M53A 4D56A 1NDHA 1NW4A 1FMJA 3KTOA 4RKRA 3Q87B 3EHEA 1V3VA 3NDJA 2QTFA 1ZH8A 4J7XA 3KQSA 5COAA 1SCKA 2Y93A 3U5ZB 5HFAA 2LE0A 2FWJA 4BLWA 4Q16A 3GUZA 4OI0A 3VPFA 1H23A 1YCDA 5B3KA 5E2IA 4DV0B 1SHTX 4FN4A 4HXEB 5F5LA 5HOQA 2ID8A 1H1DA 5EGNA 4KXMA 3STHA 5LFAA 1WBDA 4LF6B 3HKBA 2VHVA 4PLZA 5INTA 2NGRA 5K8IA 2D3WA 2I29A 1CIVA 1NSTA 4MA5A 4PHCA 4YMSA 5EIOA 4B0PA 1S2NA 3KUUA 4EPWA 2IHJA 2HBZA 2NAPA 3DZKA 1G17A 3FWHA 1V8BA 4K26A 3VO9A 3A2KA 1Z6GA 2D2EA 1U1FA 3A06A 4U9UA 1U7HA 3ZVMA 3T9BA 4QODA 5A4IS 1RQPA 4I1SA 2ET6A 2R8OA 1II8A 2ZS9A 3ELWA 3M6XA 3TZCA 5I8PA 1GRCA 5AI5A 2QW8A 1J2RA 3ZHBA 1PL7A 4B76A 1PHRA 1SNYA 4N5LA 1RYZA 4B83A 2VTEA 2BGRA 1XEAA 3NEYA 1XXLA 2W2LA 2G4VA 5C2JB 1PFWA 1A9QA 1B0UA 3GX1A 4LN1A 5HFNA 4FC6A 5FBKA 1KQGA 4G0PA 1Q95A 4W5JA 1VLMA 2B94A 3RC7A 1WZCA 1K0FA 2EV9A 3B51X 2CK3D 3D3KA 5F7OA 3CTPA 3K1ZA 4L5JA 4WK6A 4OATA 4F4HA 1JH9A 1RYDA 3NKFA 5ECYA 1WPQA 5H0IA 1VBNA 4QTUB 1BFUA 5E38A 5ERXA 2NV0A 1X1DA 1XWIA 3RDPA 5JS7A 3H8SA 1TJ5A 1BFKA 1X7YA 2CHGA 3H2SA 1E7RA 5AM0A 1Z0UA 4BJ1A 4XPIA 3C4VA 3UKOA 1ZAYA 2WTAA 2GXSA 3AEQB 1PL6A 3LL7A 3ZS8A 1V9LA 5G02A 1LDYA 3ILSA 4FI3F 2DVMA 3PTZA 4YCBA 1N0HA 4PLFA 1X7DA 4AAYA 4MPPA 4HHEA 1IUOA 1VZ3A 2FPIA 4UUQA 4EDHA 1A9SA 2ONKA 3KSRA 5KCMA 3T5BA 5SZKB 3DJFA 4YMVA 4PQRA 4FJ2A 4FGSA 1DCMA 3V80A 5AR1A 1E3QA 3AWIA 4EL0A 4EHAA 4WN9A 2C4HA 3U3DA 4F9EA 1EUYA 3TUJC 2B1JA 2O8BA 1CZKA 2P67A 2VVTA 1M6EX 2CZGA 3GWZA 3PNMA 2QLTA 4RD3A 3LLCA 1GZDA 2JIBA 2Y6UA 4LJ6A 4P82A 3QKRA 4G1EB 1X1TA 4NAUA 4JK3A 4TZ0A 4U7WA 2Z5LA 1YC5A 4M3NA 5FOUA 1DBQA 5E1BA 1XA4A 3UJ7A 1MRSA 1X74A 2IUEA 1Y1PA 5BSFA 1RZVA 3CG0A 3OETA 3U4GA 3ESAA 3DZJA 1E2JA 3NTRA 4H35A 2C2KA 1KXZA 1LDMA 5CFMA 3USES 2W2KB 5HW0A 3IT0A 1D1SA 3E03A 5F4ZA 1NBWB 3JRXA 4L0CA 2Q6TA 5HGXA 1Y8QA 1Z5OA 2I03A 1PS0A 2NUBA 3E3LA 4Q82A 1P7WA 1BX3A 5DM70 4FT4A 1HRKA 2M1XA 5HVNA 1E64A 2F3UA 4QLOA 1F2UB 2V4ZA 3DVLA 2IYRA 3KWJA 1T35A 4QDKA 5ALNA 2ACEA 3ZWOA 4D43A 1MOSA 1KJIA 1R5NA 2PWBA 3DCYA 1QHHA 1S9DA 1JSCA 4N8SA 5JVDA 1W581 2F9FA 1OD6A 2HJSA 1L4GA 3CRQA 1WMDA 1YRBA 2YVQA 4FEEA 3VH1A 2HN9A 2Q5IA 3DLIA 3JV7A 5B53A 1IXYA 4MGHA 1VG9B 3NJ4A 5D3MA 1E3JA 2H4ZA 1HYEA 1GXSA 3TLCA 2EJCA 1WVGA 4RHXA 2JD1A 2RJOA 3ND7A 2IX3A 3KOWA 1GG9A 2GAAA 3DZBA 3HUTA 5L3RA 1VA5A 1A9TA 2FG6C 3OMLA 1NLFA 2FJUA 2W4IA 3UHAA 1ONOA 5KQLA 1CZUA 2UXBB 2C7GA 1G38A 5CNMA 1YQGA 3VR5D 4AIIA 4AZWA 1L1FA 5I9LA 1B14A 2J48A 3L7AA 5IASA 1LFAA 1WVIA 1WW2A 1Z2AA 3EC7A 3WLJA 4UU0A 2X6QA 4A27A 5AK4A 1XJCA 4YJGA 3FWNA 1FDVA 2AI2A 2C9CA 2IXBA 3QV2A 3SXUB 3D2CA 1C9JA 1GV0A 3NTVA 3ZWXA 5A6SA 4BO2A 1MGPA 1A5BB 1M3SA 2NV2B 5GZ1A 5KVCA 5IT5A 2KBFA 2X19A 4UXHA 2HHJA 3K2IA 4KQ9A 2XCIA 4MUEA 3T4XA 3W2TA 4R0MA 1NM5C 2OG1A 4ZJYA 1AS3A 1G2PA 1QGOA 1X9IA 2O6LA 3EYAA 4YH1A 3WTBA 2XYVA 4L76A 2C8JA 3D59A 1U0JA 3EZ9A 3HUEA 3N74A 4LDQA 3WJ7A 5A7FA 2YYAA 1JR4A 7MHTA 1W1UA 3TMAA 2LKDA 1K4YA 2EZUA 3IIEA 1HK7A 3IP3A 3LK6A 2NQ8A 5HQJA 2E9SA 3IVRA 3N76A 3TMKA 4DA9A 2GBLA 4X71A 4I19A 4B33A 1VHWA 4R2HA 4LQ4A 1Q1GA 4OHXA 4E5DA 1ZOOA 4C03A 1VRCA 1ZVMA 2H1CA 4ZGBA 1YDEA 4J94A 3WAGA 3ZWYA 4OK3A 3OCVA 3I23A 3L0BA 5DLYA 2J7PA 2RKWA 3KOUA 1X38A 2G7ZA 4ZI7F 1LVGA 1IJBA 3KQWA 4GLOA 5AUNB 3LPAA 4IFTA 4DAOA 1B42A 1D2NA 1UOOA 4LDZA 2YOHA 3DP7A 1L3BA 3PDIB 4JQZA 2VDPB 3HKDB 3GRVA 5BT9A 1GPDG 2PSDA 3PEUA 1XEFA 4OH1A 5IKOA 5BYBA 3WKAA 5IWCA 1SUSA 4P3PA 2IYZA 5FL7D 1XDDA 1ORVA 4IRMA 5KBYA 3WLRA 5AJZA 4ZT5A 4KVFA 1TO6A 5T3YA 3AEKB 2G77B 3PQCA 4ZAWA 3GP8A 3JTEA 3T61A 1YQQA 2JH9A 3VR1A 3FNQA 4G5XA 2K7ZA 1TQ2A 2P4SA 2NLOA 2FEOA 1P8JA 1QK5A 5FX2A 4JLKA 3RVRA 3THOA 3R7FA 4CKWB 4UC0A 3P9XA 2ZI4A 5AICA 2A84A 5C9ZA 3DE2X 4U7HA 1Z6AA 2JKVA 1YB2A 2AZ4A 4H6PA 4J43A 4TV8F 4GM1A 2X4LA 3QVLA 3IVCA 4W9NA 5EIBC 5ESDA 3HO1A 1NUAA 2PNFA 1RAFA 1HBJA 2WK1A 1Z6YA 1PJSA 4GP9A 3JQEA 4Q00A 4B6FA 4X6YA 1M2EA 4QECA 2IWHA 4EUEA 3VRHA 4IOKA 3BILA 2PUVA 1MABA 2CV2A 2ZRQA 3DXZA 2I1LA 1BGXT 3MA0A 3G13A 1Y3HA 3GEGA 3WBKA 3OPYA 4G0QA 2VP5A 2OLEA 4HQFA 3KEGA 5EUMA 3LBYA 2PCJA 3GB9A 5DWQA 2WHRA 4GQBA 1HE8B 2F3PA 3HR8A 4WA7A 4JI5B 1R9MA 5CD1A 3MW8A 4YRBA 4AW9A 4BX3A 2Y1GA 3N2GA 5K3DA 3PCRB 4RMIA 4NJMB 5H80A 2WMNB 4DTIA 5JALA 4LNUA 1WXEA 1DBSA 3C0KA 1XIVA 2NVWA 2ZBQA 5K8VA 4G0UA 4MAMA 2JAQA 5ALXA 4A7PA 3VAZA 2PRJA 3V4OA 4DY6A 3BSWA 4FYKA 1HSZA 4O4HF 3RBAA 4N6GA 2QMHA 4DUGD 3V1MA 3O91A 1DQSA 1EFUA 3N58A 4C7XA 5KB3A 3RT7A 3PXUA 1FSGA 1JDZA 3EUEA 1CTQA 2YHBA 3FCYA 2ZLBA 1KK2A 4KBGA 4YUZA 4E6PA 1W2HA 2VC2B 3HP4A 3PEEA 4PC3A 1EFTA 1NTOA 3EY9A 4YLGA 1M2OA 2GKOA 5DVZA 1ZHHA 2NPFA 3WO0A 2HY7A 1LSUA 4F96A 1BDHA 1U0FA 4HAIA 4DM7A 5IT4A 3WIBA 4CIDA 4DILA 3QVTA 2PKYX 3P9NA 2V7EA 4MVJG 2OHOA 1T1GA 2FCAA 1P75A 1RBZA 1XKLA 3A1UA 2GPSA 2CUZA 1R0ZA 3NHUA 5ALKA 3WP1B 1QAMA 3HSSA 1K6MA 3IE1A 2Z8YM 4NFLA 3PGKA 4JUIA 1NU6A 2FYTA 5J4KA 3O21A 3IAXA 3IDOA 1E5LA 1XMSA 4C4RA 4DNXA 2P91A 4PYNA 3AYXB 5F23A 3QX8A 1CK4A 1DFIA 2JIRA 3HBJA 4OIMA 2B69A 5FLEX 4HNGA 2DCUA 3E9ZA 4G1FA 2QZ4A 1HOTA 3EFOB 1K88A 5AHRA 4KXYA 1ZMRA 1B3RA 3G0GA 3I9OA 3NRJA 1PQ4A 1L5NA 1SOMA 3H3JA 2HU5A 3ESYA 1RVDA 4D8UA 1E63A 2WHXA 2ZR9A 4UUPA 5FFMA 1W47A 2HD4A 3R6LA 1E7YA 4Q4JB 1YFKA 1V48A 3HGMA 3N5KA 4R4JA 1SCAA 2GN9A 4DDMA 4F92B 1KZ4A 3A58B 3GRUA 1IWOA 3OLXA 1EFKA 1JS1X 2WHEA 2MYUA 3NTQA 2Z5FA 4RF2A 4EB3A 2Q9UA 3DFUA 3EZGA 4K2HA 5HM8A 3C3YA 3L92A 1C7RA 4BNMA 5ALVA 3ZX4A 1FNBA 3MYRA 2ZE7A 4K9NA 5DNEA 2PEZA 2QMOA 1V7QA 1W8IA 2ZRGA 1IY2A 1J42A 4HMQA 2I87A 1X80B 3DL7A 2L82A 3U1TA 4Y6QA 5CB0A 1VBMA 2QTBA 2OZPA 1GUBA 3D3NA 5A9SA 1OXKB 3A9VA 1NHGA 2P5UA 1P4SA 1ECCA 1JEYA 2V59A 1N3IA 3DNMA 2AFIA 4B2IA 1RAEA 2QENA 4DYDA 2Y4OA 1SCJA 5A4DA 4TYQA 4Z1OA 3EWNA 1JVSA 3UXHA 1V7ZA 3GARA 4IGIA 1LDNA 4BRWA 4FGWA 2VF8A 3H2YA 3G2NA 4CI0B 2AH5A 2D2IA 3I9JA 3ERCA 2QU8A 3P9KA 2ODEA 5K99A 4OHUA 2E49A 1PF7E 3ED5A 3W2HA 5A1TA 3ER9A 1SWWA 1FUEA 3SYNA 3H17A 2Q5CA 5LYJB 3CPSA 4L8VA 1TQHA 4PG6A 2XWSA 3S7TA 3ER8A 1BXKA 4REQA 4W1PA 1KHTA 2XXAB 4RKWA 2XUAA 3FPAA 2ZQZA 4EB6A 2V7UA 5GMOA 3NHMA 1ES9A 2FR0A 4O2BA 1PFUA 1B6GA 2Z4TA 2HK6A 3O8QB 3PX2A 1G5HA 5L7TA 3G2LA 1PG2A 4Z53A 4QG7A 1IXRC 5F3WB 4HTFA 5TY0A 4BO8A 2PH3A 2M9MA 2PLFA 4B3TB 1CDZA 1LA2A 3RFFA 3S40A 2TECE 4EGQA 1NVXQ 3OQIB 2OXFA 2QI9F 3AEXA 3PNOA 3FOAA 4KAJA 1MB9A 2A59A 4DC9A 4UTVA 4DOMA 2B37A 3M5CA 1FSFA 1MJHA 4A92A 1IUNA 3CCBA 4DBVO 4P5EA 3H1FA 1FFDA 1ZMBA 4WE3A 5EP4A 2VRWA 3PYLA 4FBLA 1FU7A 3GEBA 2X0FA 4FFSA 1GGEA 3GFOA 1YFZA 3LFTA 5I9MA 4WLEA 3OU6A 1TB4A 4JI3B 1H0KA 2IP4A 3R2JA 5AJXA 3RFXA 3SLGA 1MZPA 4ZOAA 5IJ9B 1X7WA 1ZH4A 4G36A 1VG1A 1HYHA 4E2ZA 2J0EA 3WJ1A 4BNFA 1BQEA 4OV6B 1GPAA 2CHEA 2FKAA 3A6ZA 1UJBA 5KQRA 4GRDA 4JOQA 4TQAA 1CS0B 3FUXA 3LRTA 2VYND 1YB1A 3DTVB 4L0QA 3WK9A 2XF8A 1VLVA 3KUXA 1XMIA 1USVA 1X7ZB 3A1TA 4XR9A 1TZKA 2JASA 1SUWA 1U3GA 5I8WA 3OZWA 2OHFA 2C4NA 4MW9A 5THKA 1UADA 3BJIC 3EODA 2O8FB 5EE1A 1H8ED 4DB4A 4IIVA 1G6Q1 1RKVA 4I8DA 4XAQA 3ZJ4A 3JU3A 3WIUA 4XPZA 4KSCA 3OFND 2OGWA 1PK9A 4KPFC 4JI8B 3AKYA 2O0KA 4I46A 4MVJD 4X7MA 5B12A 1VC2A 3F2IA 3NFRA 2VNJA 1XPRA 1R12A 3N28A 1GL6A 3JAKA 1OTXA 2Z95A 5FOVA 3ZZTA 2V96A 5KHLB 2ZBPA 4HEHA 5EJIA 3RUEA 4RPJA 1L5WA 3BE8A 3TRDA 2IUTA 2G9ZA 3OU7A 3THYA 2ILVA 4MQEB 3I3SR 3KT8A 1V6CA 3KYDB 3Q8LA 2HLNA 4Z4FA 3O4JA 3L7DA 4LXQA 1UT6A 5DYIA 4BO9A 3FNRA 1QIGA 3L8ZA 3R0IA 4EGAA 4QIHA 2Q2OA 3AOGA 2HNBA 1EEHA 3A05A 3CR3C 2HV9A 5AUQA 4ZVMA 3IEMA 3ULKA 4OQXA 2P3SA 1YQTA 4FQ5A 5ES3A 2R6ZA 5LCXA 4B09A 5KU1A 4L5IA 2XY4A 1Z28A 2AK3A 3L0OA 1GLGA 3WQQA 1D0SA 3NASA 2PGDA 2JI4A 4IVRA 4D81A 1SC6A 1AH2A 3GDFA 1NI4A 3SYLA 5B7GA 1W2WB 5BSVA 5JD5A 1P61B 3ADPA 3HU3A 4G0VA 4TYYA 1SG9A 1LFDB 3VPGA 2JNWA 4COOA 2Y1KA 4F9FA 5EZYB 1E7SA 2NO4A 5DHUA 3HSKA 3GLFB 3AQIA 4IKEA 5I8ZA 3LT1A 5DGTA 3IO3A 4HVCA 3LDAA 4X0EA 3GNTA 1J7JA 1TZ2A 1EA5A 1VIYA 2CNLA 1Y5IA 2ZM5A 3IP9A 1YE8A 1YS1X 3NGMA 4Y3UA 3KQPA 1O0CA 4ZU6X 1ICIA 2R6GA 3TDKA 1KEEB 1RWMA 3IDFA 5K05A 2GJAA 4Q05A 1RPNA 4GI2A 3EDRA 1OWOA 3PKZA 1KS9A 2CVZA 5FR2A 1A96A 1YJCA 5BWCA 1WPGA 2OAGA 4QELA 1PE0A 2C31A 4EPTA 3WY9A 2WMDA 4ZODA 2H1OA 1T6XA 4WLOA 3IHWA 3EGVA 1WJGA 3QKUA 4NG4A 2JI7A 1D03A 4MH0R 5EIBD 5H3LA 2YC4C 1B1AA 1EGAA 4BNVA 4CLXA 4LRUA 4AMVA 3ZWPA 3V7YA 1TTHA 2AFVA 4XWGA 1YVUA 3RKSA 4Y6PA 3U7QB 3W04A 4A1FA 2RCYA 5BNIA 2YWRA 3BKWA 2CJWA 1L5FA 1NHWA 4WI1A 4PHTA 3PNQA 3EIOA 1IOLA 4G8DA 3IP5A 2LWIA 3JWPA 3R09A 1VBKA 3FSGD 4OGFA 5CUQA 1EAYA 4JI1B 3SAJA 1G2QA 3CIOA 1IULA 3N6RA 2H0RA 5JSFA 5LLDA 3CF0A 5EJ2A 2I3ZA 1P5HA 1KKMA 5SYMA 1OFCX 4Z0TA 3RUIA 2X0IA 2HREA 1TT7A 2WAYA 2PX5A 4OXIA 5AVVA 2FPOA 3V1NA 4G2TA 3PSHA 3W8FA 5A2QA 5KJ1A 2Q5HA 1LY1A 1Z9BA 1B23P 3DL2A 4DJEC 2J6IA 4LMBA 2L0XA 3MLBA 2HK7A 2BHLA 2ZXUA 2Q9AA 2VDRB 1H1LA 2JCVA 2YHIB 4AKTA 1KBZA 3E61A 3CEMA 1C1HA 5AK3A 4QUDA 5E6SB 3EHDA 3FXAA 4RADA 3CF4A 3KTAA 1V26A 4ZVQA 1M10A 1TUEA 2CWDA 2Z8ZA 3S8MA 4E7PA 1RM5A 1SRQA 4WOJA 4ITRC 1FP4B 1NF8A 2C7PA 2JBHA 4COKA 5EFZA 4A8TA 3KJHA 4B46A 1Y3FE 4BQOA 3WISA 2OXCA 1G4AE 4M7RA 4ENRA 1JX6A 3UJHA 1UIMA 4LJSA 1IDOA 3VO8A 1AG9A 2JIPA 2PKCA 1S2DA 3KB8A 2R79A 3K0FA 3CWQA 4MWDA 3UHOA 3V7WA 3WLNA 5BY2A 3OC0A 4FDMA 2QL6A 4N7BA 4MCIA 2H48A 1QFSA 1JU9A 2B4QA 3NHBA 2WJGA 3TW8A 4DM3A 1BX0A 3AY3A 3OIUA 1FSZA 3ETEA 4IJWA 1U0BB 4N82A 3SNHA 2F1HA 1CZHA 3JZIA 3UAZA 5BWLA 2NTEA 3G8AA 1RC1A 2OB1A 2W9XA 4B6PA 2EKLA 4CG2A 3R0QA 4J76A 5DJ5A 3LHIA 1VJ0A 3C8HA 4LFAB 2JFUA 1R0BA 4JASB 1YGYA 4TMKA 4FINA 3SPXA 5F1OA 3BJZA 3O82A 3GGCA 4D98A 4DSTA 2WM9B 3MJ4A 1R8JA 2J5QA 4BNGA 4V1CI 3BSYA 5B57C 1CV2A 1RLOA 2HDNB 1COWD 1S3SA 2DPGA 2VDMB 1LTQA 1OX5A 4QQRA 3O26A 3KYCB 3NV7A 5AIAA 3KQUA 5IDQA 3DCIA 2Z3WA 1PV1A 3P52A 5LQKA 1N4AA 3DC7A 1PJAA 1EZ4A 3R20A 1MVLA 4B8YA 5REQB 1S7GA 2OZEA 2QL9A 4XIIA 2I80A 4HGPA 1ZG3A 3R74A 3F78A 2CF6A 2FMHA 2O2JA 3A8TA 3GLKA 3IMKA 4K03A 1YVDA 4F5YA 5BSMA 5JG7A 4GVPA 1XYGA 4JYPA 4LYDA 1EESA 5ED0A 4F12A 1FXUA 3RTBA 5B5SA 4PAOA 1LV7A 1V3TA 2N47A 2PLRA 4QFBA 3RREA 1CIPA 3VNAA 4B3HA 1WXWA 2DU8A 3EOZA 5DM2A 2GZSA 3EF1A 4EELA 4QNRA 4ZEOA 4RQUA 2B7BA 3BFKA 4X93A 4P4UA 3KHTA 1H2RS 4GE3A 1BMDA 1BWSA 2GPTA 5L4LA 1PNRA 1BXGB 4Z3OA 3B1JA 3R40A 1MJGA 5CIQA 3ZJUA 1E20A 2VK1A 4MSUA 1W48A 1RMYA 4B6QA 3Q7QA 2Y99A 1QV9A 1YQUA 2ZT6A 1HT3A 2GESA 2HU7A 2FH5B 3HRHA 1YS6A 4TKUA 5HZKA 4PBTA 4PTZA 5BWBA 3THXB 3NQ41 2E7ZA 2VP0A 4QJIA 3UWMA 4CMEC 3IDSA 1CUJA 4PLYA 1N8TA 1SHZA 5TEVA 3GJSA 3CKLA 1S2LA 1MV5A 1YU6A 4LRQA 4WOBA 2GTHA 2G5TA 2FK8A 3E0XA 4ZI2A 4BOYA 3FUVA