4KUEA

Crystal structure of 3-hydroxybutylryl-coa dehydrogenase from clostridium butyricum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
280
structure length
280
Chain Sequence
MKKVFVLGAGTMGAGIVQAFAAKGCEVIVRDIKEEFVDRGIATITKSLSKLVAKEKITEADKEEILSRISGTTDMKLAADCDLVVEAAIENMKIKKEIFAELDGICKPETILASNTSSLSITEVASATKRADKVIGMHFFNPAPVMKLVEVIRGAATSQETFDAVKEMSESIGKTPVEVAEAPGFVVNRILIPMINEATFILQEGVAKEEDIDAAMKLGANHPMGPLALGDLIGLDVCLAIMDVLYNETGDTKYRASSLLRKYVRAGWLGRKTGKGFYDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (S)-3-hydroxybutylryl-CoA dehydrogenase form the n-butanol sysnthesizing bacterium, Clostridium butyricum
rcsb
source organism Clostridium butyricum
molecule tags Oxidoreductase
molecule keywords 3-hydroxybutyryl-CoA dehydrogenase
total genus 117
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.157: 3-hydroxybutyryl-CoA dehydrogenase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4kueA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kueA01
4Q3EA 3ZU3A 4BNKA 3BA1A 3O8QA 1EEHA 9LDTA 4IJWA 5JXWA 3WJ7A 1HEUA 4NIMA 2BFOA 3S55A 2O4UX 5JMPA 3LU1A 1SOVA 2DTXA 2IDZA 3D4OA 5KKCA 3PHIA 4R5MA 3RCBA 3DHYA 5K6AC 1AHIA 2GN9A 1PL8A 2NTVA 3GGPA 4PRLA 2D8AA 2Y0DA 2AE1A 2EGHA 1IZ9A 4WOKA 3F3SA 4GX2A 3WGOA 3PYXA 4J1NA 4CMEA 1JVBA 4OYRA 5L7YA 1XIVA 1BMDA 3WTCA 2Q1UA 1ZMTA 1W8DA 3BMNA 1U1IA 3RD5A 5CG2A 2HK7A 4EI2A 3JYPA 1ARZA 4Y8VA 4PVCA 3QW2A 3QHAA 1YO6A 1UDAA 4CLXA 4BV9A 5IDYA 5L9AA 2W98A 1FF9A 3IAHA 4FC6A 2ZIZA 5ICMA 1X7DA 3FR8A 2BFMA 3F1KA 1K2WA 5IDWA 3PGXA 3KXDA 4L73A 5HM8A 4GQAA 4PLHA 3SBOA 3PPIA 1KY5A 1ZSVA 2HJSA 4WOJA 4XKJA 5GZ1A 4U8GA 2VRBA 4Y6RA 3ZNQA 5JDIC 4BOYA 1Z82A 2UUPA 3MZ0A 2IZZA 4RZIA 4RO0A 5F21A 2QRLA 4BUCA 2FPIA 3ABIA 4TQGA 4WPGA 3ZV6A 1LRJA 3FWNA 5IDQA 1CIVA 2ZYDA 3E82A 1B8VA 4Z9XA 3KVOA 3KEQA 1T2FA 4FFMA 2A35A 5DDIP 3DAFA 4IXTA 3I83A 1XQ6A 5DCWA 4D42A 4DLAA 4CLOA 1HE2A 5G2OA 4YQYA 2IZ0A 3M2PA 3WBBA 2BD0A 5T57A 3EAGA 4JX8A 4U7WA 4K6CA 4A7PA 1PJCA 1NPYA 3MOIA 4WLEA 2XPCA 1J49A 1I2ZA 2X9VA 4JJIA 3K8ZA 1EVYA 3OEYA 1VSVA 2OP0A 2C59A 2W2LA 1U2GA 1ZKMA 2NWQA 2ZB7A 3GK3A 3NX4A 3V5NA 4CMEC 5JSFA 4N54A 4E3ZA 5JDCA 4Y6PA 5DBGA 2HMSA 1VLLA 4YR9A 1PWZA 3NYWA 2DBVO 3BYZA 3A4VA 1R6DA 2JAPA 4QO7A 5CAEA 1RM3A 3UF0A 3O03A 5KWEA 1EK6A 1GDHA 4NBVA 1YOVB 2X8LA 4RVFA 4YAKA 1NWCA 1E77A 4JK3A 5CP8A 4K26A 4B79A 3GDOA 4JNKA 4HNHA 1KY4A 1PZGA 1VC2A 4NJMA 4XB2A 3W8EA 4NBWA 4CM4B 1Q7BA 3I9KA 3GHHA 3NRCA 2OZPA 1T24A 3WBFA 3SVTA 2X5OA 1A5ZA 5L95A 3KYBA 4A26A 2O4CA 5H82A 4BNVA 2UAGA 4TRMA 3HADA 4PZEA 2HMTA 3CE6A 2VQ3A 4FOSA 1AXEA 1HL3A 3TZQA 1HSZA 5BSEA 2WJPA 3ZCXA 1HF3A 2BGKA 4Z3KA 5AVOA 3DONA 3C85A 1GCOA 1UXKA 1I0ZA 3ANLA 1TLTA 3UW3A 3VDRA 5CEFA 1F8GA 3W4JA 1V9LA 5HS4A 2OFPA 4RPHA 4KMSA 3X2EA 3F6YA 1UP6A 5JO0A 4QSMA 4O1MA 4WCFB 4AJOA 3JD4A 1KERA 1NVMB 3KV3O 4IXWA 1QYDA 1WVGA 3LSYA 1KS9A 3GNTA 1GZ3A 4HFNA 5EQFA 1TT5B 3AU9A 2BKAA 3TRIA 8ADHA 1G1AA 3AUUA 3FTPA 2C2YA 3SLGA 3UCEA 3GG2A 1UZMA 5AXBA 3RUDA 3H9QA 5A9RA 1GFSA 4ZGWA 4IDBA 3PZBA 2D5AA 5A9SB 1MFZA 3PHJA 4W6ZA 4LGVA 1QYWA 4F45A 2XOXA 3TZCA 2HMUA 1XU9A 2P5YA 1P1FA 1H2HA 1XEAA 1FMCA 2YYYA 5AYVA 4E4YA 4IDFA 3AY6A 1ML3A 2Q1WA 1YL5A 1N1GA 1FDSA 5IN4A 1YE3A 3ROQA 1XLTA 5HTOA 2EIHA 1WW8A 4K9DA 1DO8A 1I3MA 1GEGA 4FW8A 4MPDA 4JN6B 5L3ZA 1PTJA 2CVQA 1EUZA 2PK3A 1X0XA 2Z1NA 1F0YA 4FQ8A 4EJ6A 3EGOA 5G0WA 3HN7A 1IZ0A 2FN7A 2XAAA 4D7AA 3FCOA 4WK6A 4B3HA 4RF2A 1QV6A 4KDEA 2FR0A 4GGOA 3KM0A 3JQAB 1CETA 5DBIA 3GZ4A 3ZNNA 4CMCA 3L0DA 4B7UA 5JAQA 1PR9A 1CDOA 4XYMA 4EEXA 3JQBC 3ZWWA 4DYVA 3U9LA 4BNXA 1LDNA 1NHWA 3AWDA 5AOVA 4CQMA 4YT4A 5GY7A 5ITVA 2PGLA 4WKGA 3JYOA 4LCJA 3W6UA 3UOGA 3PYLA 2WYWA 3N58A 2YDXA 1V0JA 5JC1A 3WR5A 1H6AA 3C1AA 4BNTA 1QSGA 2DBZA 2VWQA 2LDXA 1Q1NA 2YV3A 3OA0A 1PGQA 4MO2A 1BRMA 4NQZA 4CV0A 4KOAA 1LDBA 3UCFA 4IS2A 2GDZA 2YHUA 1ZXLA 2PY6A 3ROMA 1IL0A 2JD2A 3JD0A 3FTNA 3OJEA 4FN4A 4JBGA 3BTOA 2D3TA 2VWPA 4QTZA 3RU7A 5L53A 5JS6A 3PEFA 1MG0A 3S2IA 4ONEA 5B37A 3V2UA 3PDJA 4TRJA 3GEDA 5L4SA 3KETA 3VPSA 4D3FA 4BB6A 5B4VA 2PGJA 3GDGA 1BSVA 4KWIA 3QRWA 3H6KA 4JROA 5EIOA 4BO4A 4U5QA 1TI7A 5C37A 3WICA 3MTJA 2HSDA 5L4LA 3HE3A 3PRJA 4BNFA 1I33A 2JD1A 4R41A 3KEOA 1GQ2A 4HX5A 3GVPA 2OXIA 2BH9A 4QEDA 2P2SA 3I9MA 4BQPA 3D4PA 4S3MA 4W9NC 3E5MA 1DC4A 2AQHA 2HUNA 3OM9A 4H16A 4PLTA 4E2WA 3DDNA 2I6TA 3PFWO 2B4TO 3PTZA 1DDOA 4J1SA 4E33A 1OAAA 3PHHA 4HUJA 1UDBA 2DUWA 3AUSA 3JYQA 4GH5A 4Y98A 1O5IA 2DFVA 1J0XO 5DP1A 5HWSA 2FHSA 4H15A 4DQUA 4CMJA 3EVNA 5EPOA 3V1YA 4YAJA 1E5QA 4G5HA 4C4OA 4MVJG 1NQOA 1PEDA 3U09A 5A05A 1PZFA 3QSGA 2EJWA 2PH3A 3C24A 1EE9A 4WASA 3RC2A 3B70A 4WLVA 4J9VA 2YQ4A 2WEKA 3CH6A 4WNCA 5T6BA 3AM5A 4UUMA 3CUKA 4PVDA 3G17A 1P45A 4FFLA 3E9QA 4CMKA 4WUVA 3VOSA 1Y6JA 4RVDA 5A9SA 1CJCA 1YJ8A 2G0TA 2YDYA 4XWYA 3TPCA 5MGBA 2YHIA 1ID1A 3PQFA 2E4AA 4XJSA 3HG7A 3UUWA 1H6BA 3VH4A 3ZWPA 1HDYA 1U5AA 4J9UE 5KCZA 5KTKA 2W4QA 3AM4A 3DHEA 4UVDA 1NR1A 4OXYA 2GUGA 4E6PA 4ZVVA 3PI7A 2WE8A 3K2EA 5COBA 4TMFA 4QECA 5CFZA 2JCYA 4CM9D 2PKRA 2QYTA 5EL0A 3MEQA 1AN9A 3N7UA 2VTDA 3R1IA 4NU6A 5JY1A 1ZK4A 5THQA 4IM7A 4I5EA 1ISIA 2OMEA 5A5FA 3RIHA 3IKVA 2JD0A 2Q4BA 3GT0A 4CMIA 3BTVA 5EMHA 3JTMA 2UV8A 3WQQA 3KSUA 2P9GA 4Q3CA 4AFNA 1P1HA 1E1MA 1W4ZA 5FFFA 4CV2A 3H2ZA 4M49A 1E1LA 3L6EA 3I4FA 1ZMOA 1IHYA 3GOHA 1BVUA 1GY8A 3P2OA 3H8VA 4XYGA 4D3SA 1QG6A 3B1JA 1U7TA 1XELA 1P31A 2O2SA 4RLHA 4FJ1A 4Z9FA 4GLOA 4KTVE 4EEZA 4EZBA 1EQ2A 2I5PO 2RBEA 1NFFA 3DOOA 2I66A 3OICA 3WMXA 5JW6A 2WYUA 1QYVA 1ZVMA 3INGA 3D5QA 4R9RA 4E2ZA 2GZ3A 3JYNA 4HFMA 1YBAA 2EHDA 2YHIB 4EDFA 3I9OA 2EV9A 1XU7A 4MIOA 4QFCA 1XHLA 2JCVA 1GTMA 3IMFA 3FI9A 4CM3A 4MVJI 4EGFA 4GSLA 2DC1A 3VVBA 2WTBA 4YYZA 4XR9A 4NG5A 1X0VA 5KJEA 2DU8A 5C7OO 3Q6IA 5CPFA 4NMHA 3R6DA 2NM0A 3L4BC 4I9NA 1NAHA 5FF9A 1HXHA 4YJGA 1MX3A 3WJAA 3W4IA 4CR6A 3HDHA 2Y68A 5KJ1A 4L4RA 2NQTA 4QT0A 3EYWA 5TRTA 3G49A 5A06A 4D45A 2J6IA 4E30A 4LMRA 4HFRA 4P4GA 3ZU2A 4XQGA 1DIHA 2V6FA 4XYLA 1D8AA 2IODA 3DR3A 4O63O 3IL2A 1A4UA 5AXDA 3H4VA 3H9UA 5JDIA 4E21A 4CLRB 2V6BA 3HJAA 3VH2A 1R4NA 4U6SA 4LRSB 5BNTA 2V65A 3Q9NA 3GFBA 4GLLA 1PSDA 3LZ6A 1BWSA 1NYTA 3GY0A 5ENVA 1ENYA 4DIBA 1SB9A 1W73A 5TT0A 1HT0A 1MC4A 4E2XA 3ZDFA 4L9RA 1HYGA 1UZLA 1XCBA 4RVHA 5ENDA 4MP3A 4ALMA 4F3YA 2X5KO 5KIAA 2BFAA 1H6CA 3DMYA 1RWBA 3OSUA 3HWRA 3U5TA 2PV7A 4J6FA 1H2BA 2XF8A 3C3XA 3BZUA 4GX0A 1C0IA 2WD8A 4CPDA 2Y93A 3Q11A 4J90A 4H7PA 2TMDA 1DIBA 2JL1A 3DAGA 3H3FA 4BS9A 5I7FA 5G0UA 2H5LA 3A06A 1P33A 5IXSA 5KNLA 3GRKA 1R16A 1DFGA 2JHFA 4CJXA 4ZJUA 4Z9YA 1DHRA 4AJKA 4DA9A 1DB3A 4AJPA 3GPIA 1P44A 1E3WA 1KVRA 2P4HX 3GHYA 3ZV5A 3CMCO 2ZQYA 5JNLA 3GRPA 2O2YA 4LCEA 5C5IA 4B7XA 4L4SA 2PA3A 1R37A 1V3VA 1WDKA 4WEOA 3QWFA 1I8TA 4R5HA 3ZV3A 3S2GA 2CZCA 2LDBA 4I5FA 4FC7A 3L9XA 3HZZA 3BMQA 4XYEA 2BF7A 1N9GA 4INAA 1T1RA 1N92A 2A92A 2RAFA 4CMIB 3GH3A 3WWYA 3LQFA 4DPMA 3PDUA 1LLCA 3TDKA 4YRBA 1A7KA 2DLDA 5U1PA 4JCOA 2VHZA 1I5RA 3DBLB 3ORFA 1U3WA 4ND4A 1C3VA 4ZQHA 3T4XA 4BMSA 1DLIA 4FJ0A 2JCXA 2O3TA 3U49A 4DGSA 2G1UA 2RHCA 3NTQA 1ZUD1 1XQ1A 4GWGA 2HLPA 1D4FA 1Z7BA 4II2A 5T67A 4R1UA 4N18A 2P68A 4S1VA 4EJ0A 3TQHA 1YDWA 3K30A 2VZ8A 5HS6A 4PZCA 2GPTA 3ONFA 2GYYA 1M75A 2J5KA 3L6DA 2YY7A 4IBOA 2PZMA 4PLGA 1BDMA 3U3XA 2O7QA 3OETA 5I7VA 3ST7A 4ZA2A 3IIEA 4ALNA 1E7QA 3ETGA 4EUHA 5DCUA 1ONOA 3ZWBA 5HA5A 1PX0A 2G82A 3H5AA 3KSDO 3UHAA 2XXJA 5A1TA 4IDEA 3VKUA 1GZ6A 1B8PA 5K9ZA 4FFNA 4R1TA 1HWYA 1GUZA 3ZU5A 1P3DA 3NT4A 5L45A 3I6IA 5U4QA 4UEKA 3S2FA 1HRDA 4FCCA 2AXQA 1D7OA 1E7WA 3IC5A 1SBYA 1IB6A 4HADA 3GUCA 2IEDA 2X0JA 3CIFA 1U8XX 3IUSA 4MVJF 5T5QA 1R0KA 1DHTA 4UUOA 2WM3A 3P7MA 2NVUB 1LSJA 4WLFA 1YGYA 1M6WA 3ZWVA 1E1NA 1E3JA 1YL6A 2VHVA 1B16A 4YA6A 5EN4A 2NU9A 3RUEA 5KVVA 1N7GA 3FPCA 2VT3A 4O6VA 1E7SA 1N2SA 2Y66A 3HNPA 3FBGA 3DZBA 5A04A 2ZJ1A 2DQ4A 2IE0A 1YXMA 3H9JA 3QVOA 3E6AA 2VWGA 1LSUA 4YTEA 1E3IA 1QYXA 2R00A 2DBRA 4FOOA 4YQZA 4J43A 3VPHA 3BMCB 1RM4A 4II3A 5EINA 4D3DA 2NU6A 1RYDA 4BO6A 3DWFA 3GAFA 4O59O 1HLPA 3OA2A 5G0TA 2JKVA 4GAEA 1TXGA 3PK0A 5DP2A 2YUTA 2VUSA 3WMWA 3T7CA 2DFDA 3PWZA 3RI3A 4N5MA 1UZNA 1PQPA 1QORA 1XR3A 3JSAA 5BSGA 2X6TA 1DIGA 2VUTA 3DL2A 1DJQA 4W82A 5DOZA 4XJTA 4J4HA 4XGNA 3UGKA 2FR1A 4J2HA 4GWKA 2EWMA 3VZRA 2H9IA 1UAGA 4J4BA 3IQDB 1Y8RB 3JQ7B 2GASA 3H2SA 4G65A 1LNQA 4Z0HO 4K1LA 4WCFA 4DBZA 2AEJA 1LUAA 3LDHA 2O23A 3KHUA 1TB4A 4AG3A 2NUAA 2HMVA 3ZI0A 2VYVD 4MVJE 2B37A 3RAJA 5IF3A 3RROA 3PQEA 4PLPA 1I3NA 3S2EA 3KSZO 3AI2A 1B3RA 4A2CA 4XGKA 5KKAA 3LLVA 4J16A 4NNJA 1M2WA 2BGMA 3JD1A 3EC7A 4MDHA 1MUUA 4LK3A 3BMOB 3TF5A 2YV1A 4QO8A 4HFJA 2D5CA 1Y8RA 4GMGA 1PZEA 4OKIA 2RIRA 3WXBA 4BNYA 1B2LA 5CDUA 2AQIA 1HZJA 1YJQA 3F46A 4CM8B 1HDXA 4PIVA 3AOEA 4TKMA 2GO1A 5B12A 1A4IA 4ZHSA 3I3OA 1QLHA 1KEWA 2B36A 3KLMX 1GUYA 3ON5A 1NFRA 3CKYA 2O3RA 1ZJZA 4K28A 5JC8A 1WPQA 1C0KA 2Z1MA 2PNFA 1NASA 4CR7A 3T7EA 1JWBB 3PP8A 2QIOA 3I5MA 1DC6A 4GBJA 2YV2A 3ZWXA 7MDHA 3I1JA 4RQUA 3TL2A 2FMUA 4NPCA 5EESA 4E13A 2G17A 3E9NA 1MXHA 1FDWA 3WWZA 4B4VA 4P38A 1EBFA 1Y9EA 5IXYA 2V6GA 4W4TA 4M87A 2R6JA 3DZFA 3ZU4A 3LT4A 3ENKA 3DZJA 3WGIA 1N1EA 1ZO8A 2Y0CA 2C2XA 1QR6A 1U7HA 1SMKA 1X7HA 4HKTA 3GGGA 4ALJA 1B8UA 4J4TA 1NAIA 2J8ZA 3AY3A 1UDCA 1LEHA 2C5AA 2Q2VA 3ULKA 1LTHR 3L07A 4R16A 1Q0LA 2PFGA 1E7YA 4CUJA 1LLQA 1K3TA 5ICSA 4I5GA 1B14A 2D59A 2Y67A 4YJGB 2F00A 3NDRA 2QHXA 1H0KA 3HUDA 3WFIA 3ZW8A 3E48A 4ZQEA 4RQTA 1WXDA 3GG9A 1LQUA 4NH4A 3BHMA 1SC6A 4AL4A 3P19A 2YQ5A 3DZIA 1X1TA 5THKA 2A9FA 3L4SO 3DFZA 3GNQA 2Y1DA 3EY4A 2AG5A 3F9IA 1ENZA 1CQJA 1HSOA 1ISGA 2Q45A 2UYYA 1PS8A 2NVBA 2ZYAA 3QVXA 4AJ4A 4NBTA 1GYRA 1W0CA 2J3HA 3QVWA 1EBUA 3B20A 2X23A 4J0EA 3BMCA 3VTZA 3ZW9A 1L1FA 1YVEI 1JWAB 1TT5A 2GN8A 4Z0TA 4ZQBA 4JGBA 4Z3DA 1ZEMA 3AJRA 4IMPA 1DBVO 3OIFA 3C8MA 2UUOA 2DTEA 3WB9A 2EXXA 4AJJA 1ISHA 1GV0A 1MLDA 4HNGA 1NVGA 1ONPA 4RL6A 3RFXA 1O94A 2VNAA 4KQWA 5DBFA 4CQLA 2QRKA 4PG4A 4B7CA 1O89A 3BTUA 3AM3A 3VKVA 1VJ0A 5F1PA 4E32A 2Q3EA 2VOEA 1U4OA 2E6UX 1VPDA 2I65A 2ZB8A 1AGNA 3PIDA 1C1XB 1DIRA 1BXGA 3NKLA 3ZWMA 4PG6A 2Y05A 4TRRA 5JO9A 3PXXA 5T8KC 1EVIA 1MG5A 1IPEA 5G4LA 4A0SA 1DFIA 3PWSA 3DZHA 1BXKA 3F1LA 4JQCA 1LC0A 1ULSA 3QWIA 3VAZA 1WZIA 2C07A 1AUPA 2PWZA 3ITDA 4NFHA 4RCVA 3CPSA 3DOJA 1QXSA 3PGJA 3BHJA 2ZYGA 5B4UA 5KJCA 5EERA 3WDSA 1NBOA 3GN1A 3V2GA 1GAEO 2VNSA 5ILOA 3E03A 4OJNA 1HZZA 2PR2A 4G2NA 4Q3DA 4Q39A 4XIYA 3E8XA 9LDBA 1OZAA 5FWNA 3DMTC 3EHEA 3A14A 1E5LA 1YB1A 4CM5A 3DOCA 2NVWA 4UULA 1GYPA 4NFSA 4DVJA 1NX6A 1AXGA 4YWJA 1GL3A 1R15A 3KB6A 1KVTA 1PJQA 3T4EA 3U4IA 4BGVA 1EUDA 2CF6A 1FJHA 5FI3A 4J1QA 2EKPA 2EKQA 4OM8A 4TWRA 3AOGA 1GPJA 2I67A 3JD2A 1JKFA 1K6XA 3PLNA 1G6KA 1ZFNA 4IDAA 4AJHA 2W90A 4KUEA 3I52A 2B0JA 3WQSB 3Q1LA 4NBRA 2GF2A 3Q3CA 5BT9A 5TT1A 2FPPA 3HSKA 2NQ8A 4YT2A 1ZK2A 2WD7B 2X0RA 3OJOA 5KOIA 3V2HA 4YJHB 1FDUA 3I9LA 2Y1OA 1K0UA 3W8DA 4D0SA 2DT5A 4DTIA 4IGEA 3L6OO 1HYHA 1LX6A 4AJNA 2WE7A 3RFTA 1XKQA 3PYMA 2E82A 1GYQA 4A27A 2O50A 3Q2KA 1NVTA 3EUWA 5JDCC 3ZHBA 3K96A 3LC7O 3O9ZA 5A5EA 1I2BA 1E6UA 2ZQZA 3LF1A 3AI3A 3AI1A 4CLHA 3CTMA 3U4HA 3V1UA 3BHIA 2GRAA 3INTA 5G0VA 4B8ZA 1DLJA 3NDIA 4L74A 4Q9NA 1QMGA 4TRNA 1FK8A 1UJMA 1PGOA 1UXGA 3DZKA 3F4LA 4J49A 8LDHA 5TIIA 3ZZNA 4MJLA 3MWEB 2BLLA 1CEQA 2FZEA 2E48A 3FRJA 5I8ZA 1O95A 3ROKA 4F46A 2YZ7A 3NGXA 2VTEA 4GGPA 2OHXA 4ITUA 6ADHA 1LSSA 1N8KA 4B4OA 1UXHA 4JBIA 1IY8A 2ZTLA 1R4MB 4ND3A 1KEVA 4BNZA 2HDHA 5K6AA 3SJ7A 1PJ3A 1RYEA 1MV8A 1J5PA 3TNLA 3JQ6A 1YL7A 4JLWA 3RC9A 1UP7A 2W2KA 1QRRA 3ZHXA 1PJTA 3HFSA 3AUTA 4NI5A 5DCYA 2C20A 4JP3A 4B3JA 2NTJA 1P1JA 3GA0A 4HBGA 2VWHA 1YONA 4Y9DA 4BMVA 5ILGA 2IXBA 2JFFA 2JFHA 2GERA 2Q4EA 2BI7A 4DIOA 1T1SA 2I3AA 3OQ6A 3VZQA 1Z7EA 3TFQA 1QP8A 1UXJA 4ZQFA 4MINA 4BVAA 4DQVA 3BIOA 1K5HA 2PZJA 1Z75A 3ZGYA 2Q49A 1YBVA 4WLNA 3GFGA 3ANNA 2VYVA 4OXKA 3D4NA 3NJ8A 4A73A 4B8WA 3DBVO 1HLDA 1FXSA 2Q2QA 1YKFA 1E0DA 2GGSA 3DZGA 4CMGA 1Z74A 1ZIDA 4XGIA 1HE3A 5DF1A 3WG9A 2BGLA 3KO8A 1EDOA 2CFCA 1LRLA 3RUFA 1F14A 3HDJA 4ZQGA 1MXFA 2ZCUA 4U6QA 4IGFA 2VN8A 3OIDA 4M1QA 7ADHA 4XDYA 1Z73A 3TSCA 4E5YA 3PFFA 3DC2A 3K92A 1GR0A 2PLAA 1GV1A 4LRTB 4XQCA 1JKIA 2POQX 2QZ9A 1YDEA 4UREA 5CDTA 2EF1A 2FY8A 2GZ1A 2QQ5A 4PCVA 4FS3A 1BGVA 4LW8A 2YFQA 2B5WA 5F1KA 5A9TA 1NXQA 4G81A 1JW9B 4OKNA 5DULA 4R1NA 2PKQO 3OP4A 1T2DA 1YBMA 4YVFA 1DOHA 2EJVA 4YDRA 3CZMA 1PJ4A 1Y81A 1I30A 1TVEA 3ADOA 3GF4A 2Q50A 3SJUA 2Y1EA 4YACA 1M6HA 1YQXA 1ZBQA 1DC5A 2AMFA 3VH3A 3GUYA 4CMBA 1GUFA 3BMOA 5JAZA 4I9HA 2C29D 4RPLA 3Q0EA 3JQGB 3MJEA 3GAZA 3RVDA 4M55A 3ZHYA 3GZNB 4ID9A 4D44A 3FWZA 1PQWA 3QQPA 3N74A 4NU5A 1NQAO 2NU7A 1WP4A 1PIWA 1E3WB 1VKOA 3GMSA 3INRA 1E3LA 4P4NA 1M66A 2C7VA 3ETEA 4NDNE 5TNXA 4DC1A 1ONNA 4RPKA 3DFUA 4GSKA 1UR5A 1LDGA 3FN4A 3LT0A 5CHEA 4GPD1 4ILKA 3I4CA 4M86A 1IPFA 3C7CB 1GZ4A 1PWXA 2H1SA 2ZJ0A 2B83A 4PG7A 3NAQA 1SZJG 4E5KA 4P8RA 2QRJA 3TJRA 1N9GB 3IDSA 4BQRA 4NJOA 4CM4A 2IZ1A 2HRBA 3TZHA 2O3JA 1I36A 2WYVA 4RZHA 1LJ8A 2I99A 1HDRA 3CMMA 4CMAA 2VZ9A 3D3WB 3MJTA 4BKPA 1L7DA 3G1UA 1R0LA 1SCUA 2J5QA 1XSEA 3O26A 3WX0A 2RCYA 1YH3A 1DAPA 3ZN2A 3WIEA 2WDZA 5LDHA 2EERA 1IOLA 3FNGA 3PJFA 5FEUA 4DLBA 1PZHA 1BW9B 2GN4A 3G1TA 2R00C 4D0RA 4YRDA 1KEUA 2B69A 4BB5A 2X0NA 1T2AA 3Q9UA 1O6ZA 4MKRA 3GNSA 1WLYA 3KOUA 4BMNA 1OC4A 3RBXA 4XCVA 1IHXA 5F1OA 1HTBA 4PN3A 6LDHA 4BKRA 1LDEA 1LDMA 2HRZA 3LT2A 1ENPA 2HMWA 1HDCA 3NUGA 1Y9AA 1XA0A 3WYCA 5IFLA 4CODB 2EW8A 3G3EA 3ZWYA 1YQGA 2C5EA 2DBQA 3RUHA 5AXAA 4GKBA 5TQVA 2X4GA 3O8QB 1ZJYA 3KBOA 4NK4A 5JYDA 4UUPA 3F5SA 4YJDA 3RU9A 4NBUA 5C3MA 5J23A 2DPHA 1EMDA 2O48X 1SEVA 4BGEA 5L51A 4MVJA 2H63A 3HFGA 5BR7A 4J91A 1ZK3A 3TOZA 4OQYA 4AJ2A 2Q99A 3OEWA 2WMDA 1FDVA 4CV3A 1ZZEA 3EZLA 3FNEA 1DPGA 1ADBA 3WTBA 1NHGA 3HB4X 1C0LA 1U4SA 4UVHA 2GCGA 3KLPX 4N5LA 1SB8A 4ALKA 5A3VA 2GSDA 1TT7A 3UKOA 3RUIA 3VTFA 2AA3A 5ADHA 4W7HA 3MJVA 3WGGA 1E6WA 2JHGA 3RASA 2AG8A 3RKUA 3RKRA 4CL3A 2QW8A 3MJCA 5TLSA 3UH1A 5ER9A 5COQA 1PL6A 5MDHA 3HB5X 4J7CA 4LSMA 2HCTA 3COSA 4R69A 3H5RA 2Y1FA 1GQYA 4PG5A 1IE3A 1AHHA 1PJ2A 1JN0A 2OL4A 4YT8A 3X2FA 3RFVA 2AQKA 3AFNA 4KDFA 2BI8A 2X58A 2W2KB 4FGSA 3EVTA 2TMGA 1YB4A 5JAIA 5DOVA 2P4QA 3WGTA 1HDOA 4J7UA 1D1TA 1E3EA 4N5NA 4ND1A 1BDBA 5LC1A 5L7TA 1PGJA 1J4AA 3TL3A 1X15A 2OOSA 2HO5A 3PHLA 3QV1A 3UN1A 1VKNA 3VDQA 4KUHA 1A27A 1JAXA 4FFRA 1NTOA 4PLWA 4Y67A 2X1HA 2E49A 2X22A 3QWAA 4BNIA 4DMMA 4WLOA 3ZH2A 4JIGA 2J3IA 4LVUA 1VI2A 3NTRA 2Z5LA 4BO8A 1OBFO 3WOHA 3M1AA 3DBHB 5EJ2A 3LC1O 4OGWA 4D43A 4UAGA 1VJ1A 3KYCA 4CQLB 3B1KA 3WFJA 3OQ1A 3WGZA 1LBEA 5JFOA 5I9MA 1H6DA 3KYDB 1Y5MA 3QE3A 4E12A 4UEJA 4ND5A 3WNQA 4XQEA 5BNFA 3W8FA 1LI4A 1H94A 4DUPA 3K73O 3MJ4A 3NTOA 4NJMB 3HDQA 4BO1A 3QVTA 3PLRA 4GVXA 3SLKA 2W2LD 3CZRA 2ET6A 3FD8A 4ZRMA 1ZXBA 3S1LA 4AJLA 4CM7A 4D79A 4DIFA 5AQ1A 2IYOA 3DBRB 1Y5RA 2OBYA 4YEDA 5ER6A 1P1RA 1K89A 3AK4A 1I24A 4A10A 1TA4A 3JQ8A 4XX0A 4MOWA 1JKJA 1YB5A 1JAYA 4IJKA 1GQQA 4XDZA 3DHNA 5CG1A 3A1NA 3JQEA 1VE9A 3STHA 1LQTA 3QA9A 5JCXA 5CDGA 3C1TA 3ANMA 5IDXA 3R3JA 2NACA 4W99A 1E7MA 4IY1A 4QFDA 4PLZA 3GZNA 4BNGA 3LLSA 5BNIA 5H83A 3RUCA 1SAYA 3LF2A 4CLOB 4I1IA 4E2YA 5FYDA 4FGWA 3ASVA 4OSOA 1LC3A 1EZ4A 4MP6A 3C7AA 3U0BA 3GN2A 1KBZA 5BSHA 1WZEA 2D1YA 3ZWAA 4DQXA 4YJFA 1R12A 3PZRA 3UFXA 3V8BA 1S6YA 1HDZA 1J6UA 3OFSA 4IQGA 1Z6ZA 4ZD6A 3JQ7A 1B3BA 3D3WA 5K0ZA 1HETA 2VRCA 2QX7A 3VZPA 5C7LO 1U3TA 1GPDG 1YOVA 2CD9A 3D5TA 1LDYA 5A4DA 5HRUA 3PHGA 3AW9A 4KWHA 4YJHA 5LDGA 3U4DA 1U8FO 5I7EA 5I9NA 2AE2A 1I2CA 2HK8A 5JPIA 1LU9A 3JQAD 1NP3A 1WAMA 1RJWA 4I08A 4WEQA 3KUXA 5CEJA 4FJ2A 4RLSA 1KVSA 2HAEA 1NWHA 2O3SA 3JQCA 4GMFA 5IG2A 1WNTA 4R54A 2PD3A 1RPNA 3GQVA 4OOFA 5CDYA 3JQBA 3D64A 1P74A 3ENNA 5GZ6A 4BKQA 2CDAA 4LMPA 4UEOA 1LRKA 1T25A 3UCXA 3GEGA 4OAQA 4EBFA 4MIEA 2YFHA 3RWBA 2CVZA 5JCJA 4DMLA 4YPOA 3A9WA 3EW7A 1X14A 4RDHA 1XWFA 4FSHA 2X9GA 1HE5A 4FFOA 3QLJA 4IS3A 5DN9A 2GR9A 1U9JA 3BXXA 4MVJD 4KUGA 2UVDA 1UP4A 1C1XA 2HKIA 4FBGA 4MKXA 5DZSA 4YRAA 1Z45A 3QWHA 1WDLA 2ZK7A 4UVIA 3SC6A 5IJZA 3WYBA 4CMHA 3FR7A 1JLLA 1KVUA 2VYND 3CINA 4DBVO 3HDYA 3JV7A 3BTSA 1RKXA 3IP3A 4KQXA 1F17A 4K6FA 3U4CA 1CQIA 3RBVA 4EUFA 1BXGB 3WGYA 3QWBA 5LCXA 5JY6A 1A71A 2JAHA 4ROSA 4MKZA 4P4LA 1JA9A 5JE8A 4GX1A 2RH8A 2Q46A 2PD4A 2E37A 1DRVA 3A28A 1U5CA 1EVJA 3V1TC 3D3EA 3SEFA 4OOEA 1DIAA 1CERA 3RQSA 4CLDA 1HDGO 3G79A 4AJ1A 4AVYA 2BELA 1N7HA 4BKOA 3LYLA 2CNBA 5KVCA 3RUAA 1ZH8A 3GVIA 4ND2A 1DXYA 1GU7A 1ADFA 2VHYA 1Q7CA 2VT2A 2AEMA 2HJRA 5B4TA 3RJ9A 1U3VA 2EKLA 1MP0A 1ADCA 4EJMA 4YAGA 5CEEA 4MP8A 3E18A 4BO9A 4MVJP 1RM5A 2QYSA 4PLCA 4D41A 1BG6A 5BSFA 4GL4A 1GEEA 1JQBA 3OHSX 1ADGA 1KETA 3JD3A 4GX5A 4PZDA 4PFJA 1H93A 5JLAA 4NK5A 1YWGO 5KVSA 3KRTA 3PWKA 4CM8A 5H81A 1ZK1A 1Y1PA 2OP1A 1KVQA 4CLEA 1FDTA 3O4RA 4Z0PA 4H3VA 1Q0HA 2PKQP 1PR3A 2FR8A 2WWRA 3OJLA 3H65A 4EW6A 2ZB3A 5DT9A 4DC0A 4ESOA 3OF2A 3ZWCA 2GLXA 3OH8A 4IIUA 1IUKA 4Q3BA 5BQFA 5CDSA 1EE2A 1VRWA 1MGOA 1EDZA 4RF5A 4CL8A 2OO5A 4WE3A 4YCAA 2AQ8A 3R3SA 4J7XA 1EFLA 1NR7A 4MVJM 4ZU3A 3DAPA 2GN6A 2J3JA 4HWKA 2NTNA 1BVRA 4HY3A 3PQDA 4YAIA 2NADA 5IAAA 5HBRA 1PJLA 3WLFA 2Y1CA 2ZTVA 1ZSYA 3H3JA 3M6IA 4MIYA 3DO5A 4U0KA 1SPXA 2DM6A 4XRRA 2G5CA 5TC4A 2BHLA 1DFHA 3ROPA 2CY0A 3MCVA 1MB4A 3B6ZA 1R4MA 5EQDA 1M67A 5G0SA 2DVMA 1VL8A 4XYBA 2X7HA 2O3UA 3IP1A 4FIZA 4O5OA 2B5VA 4FFPA 1VSUA 2A4KA 2B35A 5JCJD 2NU8A 3E9MA 4P22A 3IUPA 2FOIA 2RHRA 1E3SA 1ZK0A 1VM6A 3UICA 4R3NA 3ZNOA 1KYQA 3B1FA 4TKLA 3S8MA 4DL9A 4RPGA 2A94A 1R4NB 1UUFA 2P5UA 3OJ0A 3GPDG 1DC3A 2XXBA 3JQ8B 5FI5A 1WWKA 2WD7A 3GMDA 4BO7A 3OBBA 3W6ZA 3DBRA 3PJGA 3K5PA 1I32A 3U62A 1QLJA 4R51A 5CPBA 4BKUA 2NVUA 5TJHA 3EZYA 1V35A 1TEHA 1GADO 4BNLA 3OQBA 4DLLA 4HV4A 3BAZA 2V7PA 5IZCC 2IEBA 4O0LA 2V6MA 4BO5A 1U3UA 1PGNA 4AJEA 3L4BA 4TVBA 4LN1A 3UAGA 3ZWNA 3QY9A 1B15A 4DXHA 4BNHA 4KP7A 3D1LA 3GLQA 3PJDA 4M54A 1IULA 1NPDA 3QP9A 2C7GA 5L7WA 4Q3AA 4M8SA 1L7EA 4URFA 2OUIA 4E31A 1N5DA 4WCDA 1VL0A 2PH5A 3JQFC 3HN2A 3ONEA 4L0QA 5JMWA 2C0CA 4XRGA 4FD3A 1Y7TA 1Q7GA 1ULUA 4E5MA 3K6JA 4CQMD 3ITKA 2ZCVA 1DSSG 1SOWA 2FSVA 3MTGA 5A3JA 3SXPA 4N7RA 1A7AA 4DREA 4L8VA 1WMAA 3NT5A 1V6AA 1G0NA 4HXYA 3RC7A 1ZEJA 1XGKA 4XZ3A 3I9JA 2QZZA 3DEYX 4DRYA 3CTVA 1UXIA 4QUKA 4R4JA 4W9NA 1VJTA 2AEFA 4IJUA 2Y99A 1G0OA 1E1KA 4RVUA 5F3RA 4TSKA 1PJBA 4IPTA 4W7IA 4R1SA 3OECA 3NJ4A 4BO0A 4B3IA 3GVHA 2ILTA 4PG8A 1BXZA 3FHLA 4OO3A 3QVSA 4QXMA 4M89A 5IZ4A 3P5SA 3K2BA 1X7GA 3NDJA 2GD1O 1K6IA 2F1KA 3TN7A 3EDMA 2D4AA 2IYPA 4JXKA 4R3WA 2NNLD 3AFMA 3MOGA 2CUKA 1E92A 2ZB4A 4RDIA 2J5RA 3AU8A 1K6JA 4OQZA 4BNMA 1NNUA 4FDAA 2VRCD 5U9CA 4WGGA 3ICCA 1S7CA 4RJTA 4JP2A 4IIVA 4HP8A 3FBTA 2I3GA 4Q3NA 1DEHA 4IDDA 3D0OA 2EGGA 5L40A 4UUNA 3PVZA 1M76A 4BNUA 4CM1A 2I76A 4C7KA 1H5QA 3LVFO 4JJFA 1DJNA 4OMUA 2GNAA 2O7SA 2FRDA 2UDPA 1NFQA 1PQUA 5T64A 1YS4A 3DB2A 1I10A 3H9GA 3L9WA 1Q2XA 3C7DB 1BW9A 1OC2A 1PS0A 3IJRA 4J1TA 4YJFB 3CEAA 1EVZA 3IKTA 2FSSA 1NPTO 4XIJA 1MFPA 1EQUA 1UAYA 1ISJA 4L75A 2Y0EA 1XYGA 3KTDA 1O9BA 5F5NA 1CWUA 2OGUA 1MC5A 4TZKA 4R9SA 1O0SA 3W1VA 1KOLA 4CM9A 3D7LA 3PJEA 2ZKLA 3WSVA 2C54A 3E1KA 2P9EA 4I9UA 1EK5A 1V3UA 1V8BA 4ALIA 1OI7A 5KJFA 4OSPA 1MA0A 1T2EA 1WMBA 2CMDA 3GVCA 5C7IO 2O3QA 3C1OA 3WSWA 2HK9A 3VPGA 4R68A 4ALLA 1EUCA 4IJVA 1GD1O 2W8ZA 4DPKA 4CLRA 1IYZA 3BMQB 2FZWA 3H9EO 2BRUA 4BV8A 3K31A 4U0JA 1U28A 2VZ0A 1A9YA 2ZATA 2ZTUA 3MJSA 4IQ8A 3VPFA 1C14A 4L4XA 5I7SA 4MVJH 3I23A 1QV7A 4IDGA 2EP7A 4UVEA 5ES3A 2EEZA 4B4UA 1W6UA 1ZCJA 2CF5A 4B4WA 5JYEA 2P91A 1DRUA 4QQRA 1YRLA 3RSHA 1YQDA 1D3AA 3WLEA 1KC1A 3WGQA 3JQGA 3M1LA 4YB8A 4BO3A 3LC2O 4IZHA 1KEPA 3LK7A 3QJ5A 5TJ9A 5L4NA 4YBZA 2Q1SA 2YJZA 4PLYA 3KYDA 4LISA 1NM5A 2PZLA 3DMTA 3H5NA 1WDMA 3ICPA 3VPXA 1OMOA 2OORA 4NZ9A 4WECA 5A03A 4WJZA 4YAEA 1LLDA 4R01A 2CSUA 3OIGA 4EUEA 1SNYA 5JAMA 3GDFA 3KZVA 3ETDA 3JQ9A 2FP4A 3HHPA 3FSRA 4NFYA 1P9LA 4L76A 1EFKA 2D0IA 1SEPA 3RBZA 2YW9A 3SX2A 2Q2WA 4IINA 4OIMA 2X86A 3ZWOA 1V3TA 2IRWA 4C7JA 4I8XA 3BMNB 4F6CA 2J3KA 2WSBA 4RF3A 4TROA 5JBIA 1CRWG 3WS7A 4IUYA 1DAOA 2OBNA 1PU2A 2RH4A 4XA8A 1PS9A 2B4QA 1JTVA 1B7GO 3DXFA 2G76A 1D1SA 2HU2A 1PGPA 1F12A 4BIIA 2VHWA 3I9NA 5KVQA 3OJFA 4TZTA 5B1YA 3JQAA 4IZIA 1ORRA 2HQ1A 1P1KA 2VHXA 3NGLA 4I5DA 4RV9A 2CDCA 5IN5A 1XG5A 3PIIA 1CF2O 4YT5A 1B26A 1E6EA 1ZSNA 1CYDA 4BL5A 4JJGA 4J0FA 3GVXA 4AICA 4FR5A 4RF4A 4BNJA 4GKVA 5TSDA 1LLUA 3WYEA 3AOEC 3IJPA 1Y8QB 4KZPA 2ZTMA 3ASUA 1BHSA 4UVGA 4DPLA 2EW2A 3VH1A 4J2OA 4NHEA 5AXCA 3MWDB 4F6LA 2AHRA 3DBLA 4J3FA 3WQRA 2B4RO 3WGHA 2CVOA 1ZW1A 1SO8A 3O38A 1LSOA 3GC6A 1KC3A 4IQ0A 1U2DA 3DBHA 4XB1A 2DPGA 5A02A 1ISFA 1T26A 3JYLA 4PGFA 2VCYA 3DTYA 4GI2A 4BGUA 2PTGA 5TF4A 1Y8QA 3ZV4A 4RVSA 1I3KA 1E7RA 3RJ5A 1A9ZA 5KJ6A 4A03A 4RVGA 3G0OA 3VC7A 3E5RA 3GGOA 3HQ4O 1Q0QA 3DQPA 3M2TA 3QIVA 3TOXA 4WNIA 2VYNA 3VHRA 4ZICA 3IOYA 1H9AA 1P0CA 4X54A 1JU9A 4XR4A 2Z95A 3GR6A 1O8CA 4BNWA 4A5OA 3NEPX 3VZSA 1H9BA 5ITWA 2BMAA 3EK2A 4RGBA 4KTTE 2P9CA 1NQTA 3CSDA 5GMOA 4BO2A 4BGIA 2PGDA 1R0SA 3NT2A 5COAA 3DTTA 1UH5A 4CUZA 3CXRA 4WCFC 3OMLA 2JJYA 3H7AA 4JBHA 3P2YA 2H6EA 2SCUA 2X0IA 3LT1A 3AY7A 2NSDA 2DKNA 4FPXA 3NV9A 3W4KA 4QX6A 4ZN6A 4CM6A 3VVCA 3AUAA 4XD2A 1HKUA 1NQ5A 1JVSA 1JDJA 1LA2A 3FF4A 3K9QO 3UVEA 3FPLA 2EG9A 2DAPA 4XEHA 1X13A 2NV6A 4OH1A 3R0IA 1XDWA 1T4DA 1HE4A 3TWOA 1ENOA 3TZ6A 4GVLA 1GCUA 4BHTA 1ZNQO 1B0AA 1PJSA 5G4KB 1C1DA 4PRKA 4IMRA 3KYCB 4CQMB 4E5PA 3FNFA 4LVCA 4TVOA 4WLUA 4EITA 4OXNA 3ADPA 1F8FA 2AW5A 1X1EA 2DTDA 5F5LA 4FB5A 2C82A 1RM0A 3F4BA 3FNHA 1VL6A 3Q2IA 3JQ9C 4D46A 4DWVA 4OL9A 2VOJA 2X9NA 1OFGA 2R2GA 3TFOA 3L77A 2NLOA 2FWMX 1KIFA 3F47A 4BNNA 2X5JO 5G4KA 2PZKA 5I8WA 3ZNPA 2FPGA 4YXFA 2Y1GA 2BFPA 3I6QA 4PLVA 2Q1TA 1I01A 2QG4A 5TX7A 1P77A 1DRWA 3GEMA 3SC4A 4Z6KA 4EYEA 1ISMA 3TZKA 2CDBA 1P1IA 3F5QA 5GZ3A 3RC1A 4IDCA 3ONDA 4AJIA 2I9PA 2D2IA 3JCZA 1C0PA 1BTOA 4OHUA 5TGDA 1T2CA 1C1DB 1P0FA 1T4BA 1PL7A 1HYEA 5TS3A 1QKIA 1AE1A 4E5NA 3EMKA 3JQFA 4RORA 4CUKA 3JQDA 3WIDA 3WNVA 1LXCA 1A72A 5DNAA 4PLFA 4LSWA 1OOEA 2EP5A 2GZ2A 3IS3A 1I3LA 4CV1A 4DYDA 1QYCA 2DUUA 5T8KA 4Y6SA 2JFGA 1F06A 4CR8A 3UXYA 4RPJA 4E0BA 2VUUA 4ZRNA 5IZCA 1R66A 5I9LA 3ZHZA 2IXAA 2PD6A 4NR0A 4XQ9A
chains in the Genus database with same CATH superfamily
3I5AA 4UTPA 3DEKA 3L84A 4JMLA 1M1UA 3BA1A 1EEHA 4L7QA 4AC9A 1SPBS 9LDTA 3PFIA 4IJWA 5ESWA 4C0QC 1SQSA 2EQ5A 1P2UA 4QKQA 3LU1A 2Z4RA 3D4OA 2IDZA 4KZKA 5KOYA 2XT6A 3TPZA 1NATA 3EEFA 4R5MA 3RCBA 3NCTA 5EQJB 2JVJA 1PL8A 4HUQB 2QUIA 2H4ZA 3A1VA 1SK9A 2D8AA 1BHQ1 1ZI6A 3IQEA 4YMTA 2JRLA 4CDRA 1Y4DE 3AUYA 4HZUB 4M0LA 6AT1A 1B6GA 5TQ2B 4HQOA 4AO6A 1GUDA 2AFVA 3NHWA 1ZIPA 1JVBA 4OYRA 5JD3A 1KRXA 2WF5A 4N47A 1NBHA 1FRQA 2B1JA 2I4OA 3KJGA 3KU1A 4FYXA 4BX9A 2E4WA 1N2EA 4RTSA 5FQNA 3JYPA 4X65B 4FKBA 2NV0A 4M98A 1XO1A 5FWYB 2JLXA 4UNNA 2QTMA 3BXGA 3F7TA 2JLZA 1PWEA 1YO6A 3AR5A 4UEWA 2XBUA 4WIAA 4CLXA 4BV9A 5IDYA 3JPYA 3TEJA 1US8A 3IAHA 3TRKA 2ZIUB 5L9AA 2WJZB 1CY2A 4GI7A 3VR6A 4C88A 5ICMA 2CZQA 2W2NA 5DWVA 4COKA 1PQYA 1Z47A 3SHQA 4F6RB 3RYCA 1K2WA 2W93A 1GUAA 1FJ2A 4HAXA 3WRXA 1NF9A 1U98A 3QA3E 2O8NA 4C08A 4CL8A 4CIAA 3PPIA 1HNNA 1KY5A 1ZSVA 1LB1B 4XKJA 4FUQA 1WBBA 1R64A 4Y6RA 2JVIA 3LI2A 3M6AA 4YRNA 4QGAA 1A50B 1T0PA 4X63A 1JMVA 1KMNA 1WOMA 4RO0A 3RFUA 3UK6A 5DTIA 1DUVG 1W4BA 4I8IA 1JJAA 2XE4A 1W30A 3F5MA 4WPGA 4CL0A 1M34B 4DAOA 4LZZA 3FWNA 4IICA 5IDQA 5J1SB 3HKDB 2ZYDA 5CFPA 4X00A 4Z9XA 3KVOA 4MITA 4BQFA 1E3MA 3TAUA 1M1YE 5IT4A 1T2FA 2OVFA 1T1GA 1XYYA 5DDIP 3DAFA 4IXTA 3SYKA 1MTOA 1XQ6A 5DCWA 2H2WA 4ZVLA 4D42A 4ENUA 1Z13A 4MKIA 4LHVA 1HE2A 4G5OA 3M2PA 5CR9A 3WBBA 2BD0A 3IJ5A 3MPOA 3DJFA 4YRIA 3SWWA 3BK1A 1FFGA 4D2IA 2O1XA 2B0CA 3I2GA 3CF6R 2B8TA 3MOIA 2IELA 4WLEA 4XD7D 5GPBA 1UADA 2O1EA 1I2ZA 3VDMA 2X9VA 1Y37A 1KI4A 2MR5A 1EVYA 1B4DA 1VSVA 2OP0A 1JIUA 2W2LA 2YCBA 1X8XA 3GK3A 4QYSA 3VU3A 1SCNE 1V39A 1V41E 4C21A 2C5LA 2RFLA 1FNBA 3GAMA 3SS7X 1JILA 1D2HA 4U2EA 1U04A 4E3ZA 4DAEA 1L5NA 2HMSA 1XKLA 2R68A 1VLLA 3IV6A 1D0SA 2G8NA 4G01B 3CLUD 3BYZA 1NSTA 5LQNA 2JAPA 1CZLA 4NULA 4P9NA 5IK2A 3VGJA 1RM3A 2OCXA 3UF0A 4BYMA 2Q6TA 4D8TA 4QU8A 1M2FA 1OAKA 2H52A 4KKXB 4KXUA 1VPTA 3VOBA 1Q0ZA 2HQBA 2PVPA 3OLVA 2JARA 1RRPA 1XCMA 4EA8A 3OQVA 5J3JA 2QLNA 4FHZA 5BYJA 3UT5A 4B79A 3GDOA 3U7RA 4HNHA 2QIPA 2GM9A 3H0EA 1WBDA 1RAGA 3RABA 2XKJE 3REQB 3WRVA 1JYEA 3MGAA 4BQOA 3AHJA 2OZPA 1E0KA 1JHMA 2X5OA 1I4OA 1A5ZA 2W83A 5L95A 1JALA 1KKUA 1D7AA 5KI6A 4KHZA 5H82A 2XITA 1VRVA 3UA4A 2PT5A 3PBKA 2HMTA 4BLOA 4FOSA 4LDJA 1FUKA 3VSEA 2RD2A 1EDBA 4FT4A 4BQEA 3CISA 5KBYA 2XVXA 1NV9A 3FDZB 4DLZA 5BWBA 2WIFA 2C5SA 1UQUA 4D98A 1L6IA 1MT0A 4XDGA 5AI6A 3VU1A 2NZ8A 1U0SY 4L6AA 3C85A 1GFZA 1GCOA 3CCFA 3ANLA 2NYUA 1F8GA 1TA0A 4G4GA 4XUGB 5CIQA 2H1LA 1GPYA 1OI2A 3N7AA 3QKTA 4HDNA 3I92A 2V3CC 1RXSA 4KMSA 1UP6A 1U7OA 4IDNA 2J48A 4UATA 4X44A 1WUHS 4KBFA 3RSGA 5HIKA 3MB8A 3FYUB 3RC3A 3KV3O 3DOIA 5D51S 1NYRA 4ENRA 1BOOA 4Y18A 1JI0A 1GRNA 2JHPA 3M9WA 4ESHA 3IT3A 2EFEB 2QY6A 1F9EA 2VF2A 4HQKA 3ZE7A 5EQFA 1FRFS 3AU9A 5A0TA 2BKAA 5KYGA 4UMVA 1G1AA 1J8DA 4NLLA 2ONCA 1J2UA 4II7A 1JFTA 2MINB 4KV7A 2YJGA 2ZITA 3DL4A 1X42A 1RHMA 5FPYA 3R0VA 1PG5A 1RWQA 1TTQB 2H29A 1Q17A 2A0YA 4ZT5A 3PHJA 4LGVA 1OA0A 4A3SA 4F45A 3KQMA 4N8EA 2QB5A 3TTYA 2BP7B 2JLQA 2FRDC 1H2HA 1FMCA 4O4JF 2O6LA 5I6DA 2JLAA 2P1RA 2YYYA 2YR0A 4KQEA 2Q1WA 3AY0A 1N1GA 1AV6A 3KL4A 4IOKA 5CDFA 4JY7A 1YE3A 3ROQA 1XLTA 2KSQA 5JV5A 2WTEA 4WNYA 3VR4D 1TM1E 1K66A 2AR9A 2BY4A 1KTVA 4FW8A 4ES6A 1JEEA 2J4DA 2NAFA 1YR6A 4HEJA 3FETA 4MYUA 4ETIA 1ABEA 4TYNA 2X8JB 4RD2A 3S99A 2PXXA 5CT8A 1FFXB 1N2IA 3KFLA 4YJ2B 4QT4A 3SBXA 2IHNA 3H4IA 4EJ6A 3QTLA 1IXRC 1J24A 1G3IA 2B7BA 5G0WA 5AVWA 5AW6A 1KGSA 2AMLA 4RULA 1Y80A 1U3FA 1W47A 3EEBA 2XAAA 2P2GA 3FSGD 3T7IA 4UBLA 4EG1A 1Z5NA 1GITA 4MX8A 3TOCA 4Y9TA 3OQNA 1ZL0A 1QV6A 3VHXA 3GD7A 5C18A 2FR0A 3K5HA 1E79D 2K87A 1KZ4A 2XUAA 4GGOA 2YXEA 1HX7A 2FE1A 3DLPX 3N2IA 4DIKA 1CZHA 3Q7PA 1ZGGA 4DA4A 3ORHA 5E4FA 1I2AA 1PR9A 5AW7A 3RVQA 1R9GA 4EEXA 4WADA 2OZKA 4DYVA 3U9LA 5ITVA 1LDNA 2XEXA 8OHMA 4DIUA 3PKZA 3O1JC 2H65A 4KN8A 4PX9A 4WKGA 1W36D 4LCJA 3KP1A 3ZZMA 4HUQA 2DHCA 4UZEA 3UBMA 4EDHA 2WMYA 4JJ8A 5B36A 1X1QA 3AJAA 2YWFA 2ZJOA 3QH4A 2YDXA 3NIWA 3N7TA 2ZP1A 1H6AA 3L1VA 3ZE1B 2ZYUX 2YJTD 3NJRA 1QF9A 2DBZA 1RI4A 2VWQA 1OASA 4M4SA 4RA6A 3CVYA 2GZAA 1ESNA 1Q1NA 2YV3A 4LKRA 3NOQA 4X8HA 3UB3A 3W3ZB 2JFZA 3GOQA 1BRMA 3OMXA 4NQZA 2PS0A 4CV0A 3DPUA 1WEKA 1ODKA 1LDBA 3CT4A 2FWAA 3MUEA 1U0RA 3N2KA 4IS2A 3PNSA 3UM9A 2PY6A 5ILQA 1C7QA 1KI3A 4EHFA 1TX4B 1RKUA 3KAJA 4YCLA 3RC8A 1N6RA 2G1AA 3C8ZA 1KQGA 4W8HA 2ACWA 3RF7A 3RU7A 3FDFA 3CW2A 4BWGA 3S2IA 5B37A 5TEVA 4ZOAA 3OJXA 2V3VA 5L4SA 1WS6A 3S8YA 4G6ZA 2JIPA 1YJCA 5DEOA 4DV7B 3SVLA 2PGJA 3EFEA 1BSVA 4G63A 5EIOA 1M6VA 3ROGA 4XJVA 5JMTA 2NO4A 5B1DA 5DRYA 3QV2A 1QDEA 1F4LA 1CKEA 1F0NA 1JHVA 5CX4A 5AQEA 1IG0A 3BRWA 2RB4A 4BNFA 2JD1A 5CH5A 2YHBA 1MJNA 1IK4A 1OB5A 3CZPA 3GP8A 3TTXA 2BH9A 1QP7A 2P2SA 3MVEA 1T1EA 4RPIA 1ZH6A 1K4YA 3C4QA 2VH2A 3D4PA 5BWCA 1ZIXA 1W1UA 2XYQA 2O2CA 3E5MA 1LD3A 1GSHA 1EINA 3C41J 3HKDA 2X2FA 3PFWO 1L1EA 1DDOA 1EVLA 3F9RA 3OQPA 4BVGA 1YHNA 2XNCA 4LVOA 4MAAA 4OHBA 3MF4A 1VLZA 2DUWA 1Z6TA 2X76A 2C3OA 3JYQA 4M0KA 4P4TA 4B48A 3G5AA 1A95A 1PSWA 3L5OA 1C9KA 1NLUA 4JX9A 2VO1A 2XIQA 2FV8A 5KYKA 3C45A 4HNTA 4LX0A 5MN4A 2ZBQA 3U09A 3U7QA 2YXPX 5EWJA 4QQKA 3C24A 2YVAA 3PNBA 5DM4A 1XRNA 3CTPA 4BE9A 1RJDA 1NY6A 4WLVA 1EFCA 4J9VA 5T6BA 1T1JA 4NMLA 4UUMA 5ARBA 3URKA 4KQJA 4PVDA 5P8WA 4FFLA 2CSXA 5TDHA 1ECBA 3NHBA 1I4EB 3B9RA 1OW3B 2ZIVB 2P5TB 1DTEA 1YJ8A 2A5LA 1H5UA 4BQIA 4ER3A 4MV1A 3U3MA 1G21A 1XNHA 1ID1A 3CZAA 4XJSA 2C9CA 2QAGB 1R0BA 1ZCAA 3UUWA 4CE6A 3VH4A 5JARA 4PQFA 4QREA 1HDYA 1U5AA 5KCZA 2APJA 1PT7A 2C5FA 2G1JA 2ZI6A 3AM4A 3DHEA 3QVKA 4Q1EA 4UVDA 3V7YA 3WLQA 1VBKA 5KQGA 1Y6GA 2C4HA 4XSVA 4ZVVA 1U2EA 4UE6A 5HILA 4H3SA 2W6ID 3ZCVA 4B83A 4E6PA 1Y4AE 1J06A 4PTYA 1DCFA 1SQ0A 3ZDDA 4MWEA 3LL4A 4LQ4A 2AHOA 3ESDA 4MLZA 1ECLA 4INJA 4YV1A 5E3JA 5CFZA 3ZVMA 3QLUC 1P7YA 3U13A 1Z0ZA 2WC1A 3OD5A 2AT1A 4QRDA 3ENWA 3L8GA 3E2PA 3TO5A 3VXKA 5KNDA 1U2SA 2DQKA 2GS9A 2QL7A 5EL0A 2ZI7A 1ZJWA 4DA0A 1PUIA 3N7UA 5AVJA 2VTDA 3U56A 1ZBDA 5JY1A 4P33A 5THQA 5K0BA 3AT1A 3X1WA 2PEZA 4PQGA 2TS1A 2XDQA 2OMEA 3RIHA 3IKVA 2OFWA 2IS2A 4YRMA 4TYWA 3TAHA 2UV8A 4TV8A 5K0GA 1G5IA 2BFEA 3GEIA 3KSUA 4OQEA 1M7GA 4TSFD 3WDMA 3NB0A 1ID8A 1EWTA 2G1KA 3T1YB 1E1MA 3R9WA 4TMTA 3O8CA 1K4MA 1E1LA 3ROXA 1UJBA 4UOEA 5AM4A 3BKWA 3ICVA 1BVUA 1GY8A 4F38A 1SJ9A 1YVDA 4YRFA 1Z4PX 3KE9A 1QRUA 1UDWA 4GMXA 1KAEA 3DSRA 3DOUA 1IHOA 3LYUA 3ZXUB 4Z9FA 1P31A 1G7CA 2B4AA 2O2SA 4ZVPA 2OYRA 2XB4A 1Z2OX 3SHWA 1QTNA 4PX3A 1NW9B 2E4UA 2YINC 3ED1A 2H1CA 2Z0MA 3MS2A 4GMKA 3SR0A 3F67A 3WMXA 1SXJB 3DM9B 1SCIA 5HR5A 3AVQA 3K9WA 3INGA 5SYNA 4C0KA 4E2ZA 2CKMA 1L4UA 4E09A 2KPOA 3L7JA 4WERA 1QBGA 3MT7A 1XU7A 4QFCA 3SZGA 1MX5A 2LKCA 1OBHA 3CLTC 3SD7A 4QM6A 3IMFA 1JSRA 4MVJI 5K8TA 3GJTA 1P9RA 4EGFA 4GSLA 1DJMA 3LDFA 2WTBA 1T9CA 4YYZA 1YR1A 1N1DA 1T0IA 4NG5A 1CY1A 3LKVA 1LPAB 3D6NB 3ASZA 5CTAA 5KJEA 2AMYA 5C7OO 1AMOA 2YICA 3D2AA 3E35A 1SUAA 2VH5R 2WFLB 1VJCA 2NM0A 2V7EA 2CUTA 4LDZA 5K8UA 1KU0A 4MV0A 5FWDA 4I46A 4I9NA 4X8OA 1NAHA 3KCQA 4MV6A 4URUR 5FF9A 4G4JA 1CJMA 4IVRA 1MX3A 3W4IA 5HHTA 3ZJ4A 3IXQA 4JBWA 2HMAA 2XNSA 1PZMA 1G6Q1 3P94A 3JZAA 3G49A 3VM6A 1X7XA 5A06A 4TV8B 5CA1B 4ZT6A 2BJWA 3CN7A 3E9RA 1H1DA 5CX1B 3E4DA 4UNRA 3KKLA 1QR2A 3ZTTA 4OXXA 4D9HA 1QYIA 2CBXA 3G2QA 1AK2A 4XWKA 5K0NA 1DIHA 2F62A 4XFDA 4WVLA 3IUBA 3INNA 4YN3A 3U48A 3LFHA 1NRJB 4AUEA 4BVLA 2RGAA 2L69A 3H4VA 3H9UA 4K8OA 5JDIA 4EEZA 4BFXA 4E21A 5CA0F 4ZALA 4UDYX 2V6BA 2H0QA 4CLRB 4ON9A 5FDFA 2A0UA 4DV3B 1Z6YA 2J7KA 1JKJB 3B2EA 3G2OA 1Z4KA 2BKLA 3CQ9A 2GKSA 2V65A 5DGHA 4BYGA 2W70A 4RTJA 1M8KA 3R5FA 5T41A 3PDHA 3LZ6A 2PLNA 1P2DA 2YMMA 3KC2A 3BFXA 2PUDA 4WK0B 1GA1A 1XCJA 3PEVA 4NMMA 1YI1A 5TT0A 4DZTA 4BECA 2X4LA 4N03A 3ZDFA 3AEQA 3H5OA 3ZHVA 2J07A 4JL5A 5ENDA 5HFAA 1C8KA 4MP3A 4AM8A 4UOZA 2BFAA 1T15A 1RWBA 4CNBA 3HWRA 1VE1A 2N1MA 4E15A 4NXMB 2QVCA 4LRWA 2C31A 2AXPA 2GFIA 1XJCA 4QNRA 5BSTA 1UKZA 4GX0A 1C0IA 1S9HA 4IILA 2F64A 1SU8A 4H7PA 1DIBA 4LWQA 4N01A 2O5VA 3AFHA 4UUAA 2JGDA 1CE8B 2QWXA 2QT1A 3H5LA 1WUJS 2JF0A 2MSKA 3FYCA 3N07A 3P8ZA 3CKLA 2ZUCA 1B76A 1O6BA 2XA9A 1P4RA 4CI9A 4CJXA 1NC1A 2JHFA 2OORC 3PPYA 5EJGA 4F4HA 3NMUF 4NCXA 4Z9YA 1BJTA 4XOIA 2ECFA 4RK1A 4AJKA 3KOYA 5F35A 3W77A 3GJ3A 4DA9A 4AJPA 4F7WA 3QFFA 4C7OA 4P34A 3FTCA 3ZV5A 3GT4A 3S2SA 1Y7IA 4F60A 1J07A 1ZD5A 3VV3A 4L0MA 7MHTA 3JVUA 5D3QA 5C5IA 7REQA 1UBUS 3AJ8A 2PA3A 4Y2GA 1R37A 3LD9A 1WDKA 4C1NA 4ITRC 1I8TA 1O94C 2DWOA 2GPWA 1DO2A 4NVRA 1CB0A 4CDNA 3ND9A 3NTVA 2WT9A 2LDBA 3IHKA 4IF6A 3HKBB 4KN5A 4X6UA 4FC7A 1BCRB 4F4DA 1DEOA 3JRWA 5ALHA 5FLEX 5HRAA 1LBTA 2BF7A 2PPLA 1U94A 1N92A 4GRDA 4HNAA 1GNPA 2X3YA 4Y2HA 3NHAA 2WPNA 3GLFA 3UUFA 4OPMA 4AN1A 3ZJTA 4PX5A 1JKXA 3K94A 2R11A 3IQFA 3DUFB 3LCUA 3HB1A 5FQOA 4YDQA 3T1NA 4UXHA 3RNOA 2Y9MB 4ENPA 2OK7A 2UZ3A 2V03A 1RJGA 4LXGA 4AF7A 4DGSA 2PWYA 2SHKA 4FLMA 2FK7A 3COZA 1R5BA 5HQ3B 2VCEA 2HLPA 2IJGX 4H7KA 1CDEA 1VHLA 4II2A 3GLFE 4R1UA 3CR7A 3PXUA 4S1VA 3U3DA 4ZGGA 1R8YA 1R4AA 2WWVD 5HS6A 3SZRA 4JV5B 1E59A 1M75A 1ZUWA 2YY7A 2PZMA 4M9SA 4PSKA 3U3XA 4V2UA 4XB6B 5F1YA 2O7QA 1HMYA 1XXHA 3OETA 4ZYXA 1XTSA 2YCLA 3IIEA 4ALNA 1FFEA 2QLJA 3N59A 1J9ZA 5DCUA 3AVUA 4FMCB 1Q0RA 3ZWBA 2UZAA 3P2KA 1G8PA 4UBJA 3SK0A 3L93A 4D8VA 5EJ6A 5IU6A 5FX2A 2QK4A 1G8GA 1GOTA 1PX0A 3II6X 3KSDO 5A1TA 4C43A 3EEIA 3D3NA 1T3TA 2C04A 1JIQA 3KPWA 2OAGA 4NZPA 3I2HA 3FOCA 1M1NB 1E9DA 1K7FB 3U7GA 1B8PA 1P9WA 2DFLA 4R1TA 1HWYA 1GUZA 3V8MA 1ZWLA 1U80A 2FWNA 3DLIA 3A6FA 3I28A 4EY4A 4N3AA 3SSAA 3FZNA 3K0FA 4PAWA 2DSTA 3OMWA 2MDTA 1EFPB 3S2FA 5DSXA 2FZLA 4RJLA 5DASA 1TVKB 3QE4A 4F8EA 3REOA 4GO1A 1BMFA 1T13A 3UOAB 3PVSA 4K40A 4HRXA 1EZZA 1WW2A 3FPGA 1S2DA 2IEDA 2QMQA 3B3GA 2ZWOA 1B74A 3CIFA 3IUSA 4ANFA 5T5QA 5ELXA 1R0KA 4HDRB 3FYDA 4UUOA 4B82A 1X1BA 1P0PA 3K72B 2NVUB 4EUKA 1SCJA 5DLPA 3VPDA 4EKIA 1LLFA 3I1IA 5JSQA 1M6WA 3ZWVA 1I94B 5EN4A 1B16A 4YA6A 4UCWA 4Q1BA 1N7GA 2IDMA 3FPCA 3FLMA 1TM7E 3OX2A 1K8ZB 5AWFC 3FIJA 4V38A 2AYYA 3DZBA 4ZAGA 5A04A 4JXJA 1FP2A 2IE0A 4RE5A 4WKOA 5G40A 4DYHA 1MW8X 3QVOA 1U90A 3E6AA 1O6CA 1LSUA 1V1RB 2WILA 2AV6A 3OLXA 1E3IA 1T9HA 1XN4A 2DBRA 2VJCA 3NUZA 4DV2B 3UFBA 3F73A 1U0GA 2WU4A 2H4XA 4R2HA 4F11A 3RVMA 1I14A 3DEAA 3AVOA 3DWFA 1HLPA 3OA2A 5G0TA 5CB4A 4GAEA 3PK0A 5DP2A 3L8MA 2R3SA 3KOMA 3OCXA 1AD2A 2DFDA 4XI9A 1SCAA 5H80A 2PGIA 1GTZA 1UMBA 4GUAA 4IYRA 1QORA 5FUVA 2X6TA 2IKSA 5LQCA 4QPPA 2X7XA 4INZA 1T8RA 3NNDA 3U6KA 3KJIA 1XK7A 1AK1A 4QUAA 4J4HA 1KFBB 4NPHA 2MIIA 5IC5A 2BDUA 4IGAA 4CN9A 3A1SA 3VZRA 2H9IA 4LOJA 2H1IA 2GHTA 1Q91A 3SLRA 4AO7A 2FPLA 3EG9B 3B1XA 1Y8RB 4B34A 4MUXA 3D2CA 3U4QA 2HEIA 3H2SA 4G65A 4IZ6A 4JUCA 4AAYA 1LNQA 2CNDA 1DTWB 2Q41A 4WCFA 1FQWA 1QHNA 1XZ8A 4P4SB 5IMBA 3G2NA 4FDUA 2CLKB 2CK3D 2F59A 1IY0A 3EGEA 4MMXB 4DWOA 2WICA 3RROA 2OZEA 3UJBA 1JXAA 1B3RA 2DHQA 2FG7C 4E3WA 1T5LA 3LLVA 4JQYA 4NNJA 1M2WA 4AMUA 1RBMA 5J5VA 4RLFA 3T3DA 3HUEA 4FI3F 1SHJA 1UWKA 2PX8A 4FSDA 2FUNB 4OK5A 2GEKA 2OFFA 3V3TA 3WWPA 4QO8A 4BVKA 2WB2A 2DOKA 2GK6A 4HFJA 3HB9A 5I51A 1GZHB 1M34A 4GMGA 1PE0A 4NYJQ 5LPNA 4OKIA 3N2NA 3VR6H 1HFJA 2B99A 2RIRA 3WXBA 1B2LA 5IJAA 1D03A 1HZJA 1R0WA 2YHAA 1YJQA 1W5EA 3F46A 2OXFA 1HDXA 3K6RA 3AOEA 3LM8A 3QVGA 4Z9BA 1AQYA 2NUAB 3TLKA 2IT1A 2AKAB 4CFSA 1YDHA 1QLHA 1P5RA 1Z5ZA 2HY7A 3HCDA 4RAQA 5BN5B 1BQ3A 1KEWA 3SM9A 2ZRPA 2ZBUA 3EMBA 3HBMA 4WV3A 1R6BX 2MSDB 3NC0C 4RHFA 3ON5A 3ZW7A 1U9IC 2O3RA 1UC8A 3GJXC 4K28A 3T5MA 4JHXA 4MB0A 4G1VA 3WLSA 3ZEIA 1JWBB 5FI1B 5G02A 5JSHA 1R74A 2RG1A 5DFAA 2QM3A 3TW8B 5EHIA 5FNVF 4GBJA 1ORIA 3UY4A 1MEJA 2MU1A 4ZTBA 1J42A 1DELA 5CH3A 4K05A 4RQUA 2AX4A 3W5JA 3X43A 4NPCA 3VYSB 1SC1A 2IEYA 3E9NA 3EUFA 4HGPA 3I45A 4XPIA 2BGJA 1IOVA 2PZ8A 1FDWA 1RD4A 1WU8A 4HBZA 1E2DA 4QDJA 4D80A 1XDBA 1H0RA 4LDRA 4W4TA 2R6HA 1TMYA 1FTWA 4B2PA 2ID4A 3ETCA 4Q3LA 2WG1A 3OU6A 3K05A 5AW8A 1UPBA 3EVBA 1NI4B 4YGXB 1K5DA 1N1EA 1CQPA 5AVVA 3WGIA 4EFLA 5A0FA 1PW7A 1U7HA 4F71A 4MW4A 1N78A 5KYYA 3GGGA 3MGBA 5LZ5A 3T1VA 2ST1A 5G3ZA 2F8TA 4U2GA 3OQIB 1UQRA 4X20A 1NAIA 3KEMA 3RARA 4BB0A 1OU0A 2EFHB 1B2RA 1RMTA 1QNFA 2DWQA 2NSHA 1JQDA 3OAAD 4G09A 5BQPA 3TRFA 4C01A 4G56A 5I4IA 3L07A 3AETB 2PFGA 4FX5A 5CXSA 3JWIA 3W6NA 4QTYA 5AHRA 1GFWA 2R9VA 3DA8A 4YRZA 1ILEA 4GIBA 1T4MA 4L5BA 1RTKA 1YZKA 2W6MA 4L16A 4MUGA 4LFBB 2QTTA 1XQWA 2F00A 2P1DA 2QHXA 3Q7TA 2CCJA 3WFIA 4X5OA 3BWYA 1CRQA 2CNKA 1WXDA 4BN4A 4MYCA 1WXIA 3GG9A 2LP4Y 1N2OA 3VOAA 3CNHA 3UK1A 1SC6A 1V43A 4AL4A 5CA1A 2YQ5A 4RSGA 3HV0A 1X9HA 5THKA 3AVVA 3EX7C 3TK1A 2K4MA 4YY3B 3DFZA 3GNQA 1PG0A 2OG1A 4RKYA 2H4HA 2Y1DA 3C6KA 2GD2A 3QEJA 1NKSA 1XXLA 1PFWA 5JFGA 3NP7A 1ISGA 2NVBA 2UYYA 2GAOA 4HWTA 5FXMA 3QFHA 3TGWA 3LO5A 4M60A 5AIAA 4U2BA 2QNIA 1W0CA 4B17A 3PD1A 1JXOA 1JR3E 1L4FA 1YVRA 2VUIB 3A1CA 4MRAA 4BLVA 1WZUA 1UKAA 4HQNA 5JRDS 5HQ3A 1F8YA 1EXWA 2VJLA 1JWAB 2GN8A 2OBLA 2QVBA 1HBJA 4IO1A 4Z0TA 3X1KA 3QKWA 1RPAA 3AJRA 3CEJA 1NXWA 1UEXC 3T0GA 1YZUA 2VPZA 3AV0B 1UFQA 4BJ5A 4RV5A 2DTEA 3VZDA 4UBIA 5BV1A 3KVNA 2VHQA 5GAJA 2MHCA 2XZLA 5FFNA 1ISHA 2WUWE 3DLCA 1R8SA 2BN4A 4L1KA 1ONPA 3TM4A 1G63A 3V1KA 2XOEA 4KQWA 1L5MA 4B7CA 5ALYA 1KK2A 3FSEA 1JLLB 4A23A 5AVRA 1TZJA 2DXIA 1UZUA 2JAUA 2JCGA 3RJMA 1L4LA 2ZB8A 2EC5A 1AG9A 4N5DA 5EMKA 3SF0A 4DS3A 3CC8A 3PTAA 4QDOA 4ETWA 4CNQA 4L85A 2C94A 3GIWA 3KXLA 3LTNC 2QMEA 3HU3A 1FYWA 1RYYA 5T8KC 3DXZA 3ZE6A 5DHUA 5EE1A 5EWLB 4JC5A 2C9OA 1DFIA 3PWSA 4RFSA 3QEMB 1NIPA 3H4TA 1BXKA 3MCWA 4Y2YA 4LHEA 5CH8A 5E7IA 3RYIB 3QWIA 2XNHA 2BTQA 4NFHA 5CK4A 4CF3A 4EKDA 1JF8A 1TO2E 2AJLI 2O8DA 5PNTA 3DE6X 5AI9A 2ZYGA 3K7EA 5B4UA 1QIGA 5KJCA 4L4UA 4M1WA 3NWPA 3GN1A 2ZPTX 4C1BA 5ILOA 1J33A 3D6JA 2VAPA 4XIYA 3SX0A 1Q14A 2HBZA 4GOJA 1ZLXA 2QMYA 9LDBA 4MS4A 1CTQA 4E94A 4Q1CA 3A14A 1FP6A 1HEYA 1O4VA 2LTAA 2LR0A 3DOCA 4IMIB 4U3JA 2NVWA 5HBGA 3BF7A 3V32A 2O6HA 5F2EA 2RK3A 4NOKA 1Z8HA 3TLYA 4NFSA 2OB1A 3IILA 3ZLUA 4DV6B 5SY6A 1C5KA 3RO7A 5CLQA 3KB6A 1C41A 1GA6A 1KVTA 2WHPB 3N0VA 1E2NA 3EJ6A 3A3KA 4KXMA 4GM0A 4J1QA 4QDTA 4TLEA 3VC2A 2OCBA 2DQZA 1AURA 4LRYA 4MROA 4IF4A 3JD2A 3PLNA 1OPRA 5A7GA 1G6KA 5ADVA 2ZR8A 2AFIB 3HH8A 4UMEA 1RFLA 4OQFA 3NANA 1L5HB 1VKZA 4UBNA 3WQSB 3EXHA 4TM7A 4L9SA 3FMPB 1UEIA 2FPPA 5CJPA 4EGQA 5HJ5A 1QTQA 3PLAE 3ENQA 2CDRA 3L1KA 4IHKA 5NLLA 4YT2A 5A2QA 1YGPA 3EPKA 3LUJA 4OGGA 4LV6A 2P3QA 3NBMA 2H2DA 2Y1OA 3ZGOA 2PVSA 3L6CA 2PL3A 3FZYA 1JG7A 4IGEA 4KIWA 1Y1LA 3H2IA 1L8LA 4DDVA 2WE7A 4LRXA 3RT7A 1E79A 1JNXX 2IXEA 3PYMA 4BFLA 1AIPA 1GYQA 1SRRA 5KS2A 2O50A 1NYLA 1R8XA 4C4SA 3EUWA 4FONA 3K96A 5A5EA 3O9ZA 5CLFA 2ZQZA 4E88A 3AI1A 1ZGHA 4CLHA 1KDTA 3JZFA 1KZHA 4Z7JA 2GRAA 2RCNA 4QM7A 1OUMA 3NDIA 4L74A 4Q9NA 1QMGA 4NESA 2PX6A 4TRNA 4ODIA 1RPZA 1U6JA 3LLCA 1MJGM 5G1NA 1N6LA 3ILSA 4EA7A 4B3MB 1CEQA 3SYTA 2DUMA 2FZEA 1CV2A 5KTSA 1QH1B 2X19A 1TADA 1O95A 2EOAA 1P4SA 2Q62A 3AHGA 3NGXA 4GLJA 3CRRA 4QL3A 2D5LA 1GJRA 2OHXA 1YASA 4ITUA 4MGZR 3T9CA 4WUTA 2AZXA 3LOPA 4PGGA 4Q03A 1PZXA 3EPPA 4H1VA 3ZCSA 3ZWKA 2AN1A 3N75A 2HDHA 2B8WA 3CR8A 1QTIA 5IAKA 4NARA 3GJZA 4MW0A 2QGFA 1EAMA 4BU0A 3RREA 1YL7A 2P9JA 4LE2A 3SF8B 1CFJA 3VYVA 1QRRA 2ODAA 3ZHXA 1PJTA 1EGQA 1UBKS 2C58A 2YOFA 3HFSA 5TV2A 3UENA 1VB5A 2XCLA 3RS4A 5FJIA 3LBYA 2LNDA 1KJZA 5G3YA 1P6UA 3GA0A 5E8RA 2XH8A 3LUBA 1NRIA 1GLVA 5D8DA 2IXBA 3YASA 4M1KA 4OFWA 1K8QA 2JFHA 1UM9B 3FTFA 3EBPA 4WZ6A 5TY0A 3B13B 1SG9A 5K05A 2FN8A 4DDMA 1T1SA 1JDNA 3OQ6A 1Z7EA 4J3JA 3QE2A 1QP8A 4S12A 1ABBA 2JCSA 1B0UA 3UHFA 3RVNA 3UAWA 2PZJA 1TF5A 1G20E 1Z75A 1MAAA 2FFQA 3HKCA 3ZGYA 1R8JA 3I4LA 2FEXA 4JWTA 1BA2A 3DTVD 3PC8C 5DJ5A 3D8BA 4K6MA 1N34B 2H1OA 1IXSB 4IUDS 2VYVA 3F78A 1DXOA 3CUTA 5IT5A 1Y1QA 3D4NA 3NJ8A 2ERYA 1HLDA 3S1AA 2Q2QA 1E0DA 4H7IA 1D04A 4G26A 4YYEA 3DKKA 1EFDN 4X84A 3HEMA 4CMGA 5DF1A 5BVGB 5C1BA 2I8AA 3HUFA 3KO8A 2DPLA 2JC3A 4EKGA 2GAIA 3ADBA 4IKEA 2EX1A 3BDIA 5ALGA 5JU6A 2VN8A 5I3ZA 1D09A 2HX1A 3TSCA 3KUUA 4ZC8A 4KI0A 4E5YA 1IN8A 1L4YA 1NMZA 4BBAA 1XP8A 3JARA 1GV1A 4QBHA 3WGLA 1ULBA 2R6AA 3SHOA 2Z1DA 2BISA 4KBYA 3RAFC 1YDEA 1NVBA 2GCNA 4UREA 4JXXA 2XGJA 3U40A 2GF9A 4JU9A 4QSHA 4LYYA 4F4CA 2C9MA 1YZHA 4DDKA 4AIRA 1AQJA 2AYXA 5INTA 4D92A 1QANA 3G9XA 1PYOA 1TK3A 3G0DA 4RACA 4UOQA 2PMKA 3TTVA 4N65A 5BV2P 1IM2A 4R6XA 2AS0A 2VRWA 1KYVA 2CE7A 3FB1A 1JA1A 2YFQA 1NJ8A 1XBTA 2R8BA 2RI1A 3KJQA 3QFCA 4JGGA 1GNSA 2ZAMA 4O3FA 4NNOA 1FB5A 1G5QA 4BTVA 4R1NA 2XUOA 2ZRAA 1EVQA 3DMFA 3OP4A 1RBZA 4P53A 4WFQA 4DR3B 3ITEA 3HR4A 4Z4CA 5B1IA 3DAOA 1PJ4A 2JFPA 3G88A 4AP5A 1UBFA 2JJQA 3P2IA 1AX9A 1DBPA 1TVEA 1C8LA 3Q3VA 3UWSA 2AGVA 1L3CA 3DFIA 3LCRA 2Q50A 2VHJA 2Y1EA 1J09A 2ZOSA 1NP6A 5AM3A 2XUJA 4G5QA 5D6NA 1YQXA 2JLCA 4IHJA 4AZ3A 1N0HA 3GUYA 1KO8A 1M2KA 2ZIXB 1KYYA 2H51A 5H59A 3WGMA 3EC2A 1AGXA 4G5GA 5K0LA 4I9HA 3V4OA 6Q21A 1CQJB 4C14A 2C29D 2HA5A 3E2MA 2WIBA 4YRTA 2NU9B 1IEVA 2AN5A 2GF0A 2QL6A 2VPQA 2VBIA 3GAZA 4PWYA 4ZOEA 3WL6A 3FWZA 3NHRA 3S44A 4AG6A 1I7SB 1G98A 3N74A 4ISBA 5JRZA 5HP4A 3CG0A 3OQOA 3CLHA 5AO9A 4ZYZA 4CIVA 1VKOA 1IQUA 2BFFB 3FRIA 3INRA 3K4HA 4A0FA 5LLTA 1L0BA 2MSWA 4P4NA 1G21E 4ND8A 5KC9A 5AKJA 10MHA 1Y1SA 2FKNA 2VPPA 4JP8A 3VJLA 3IP6A 3DFUA 5DI3A 3TTTA 3WB0A 2XE8A 5LSAA 3CEPB 4K6GA 3HYRA 3DE4X 3I4CA 2P9YA 5ALTA 5T4FA 1JH8A 1BCSA 5D5PA 4PG7A 4RMNA 3W7AA 2OILA 3DHWC 3KUDA 1E2QA 2QRJA 4RETA 3LFUA 4IDPA 4KO1S 3IIJA 1N9GB 1U2DC 1L5WA 1U0FA 2HA3A 2II6A 2WR8A 1CUIA 1UMCA 2I3ZA 3DJYA 4TPKA 1BN7A 3KQKA 5LXTA 4RZHA 4AWAA 2BTEA 2R7NA 1EFRA 3PR1A 5IH7A 4CMAA 1PFYA 1OGIA 2VZ9A 4FEYA 5LOVF 1JTEA 1U0BB 5JMOA 1ZI8A 2CYBA 3HRKA 3LMKA 1OKKD 3JYHA 4DR6B 3CRQA 2FEAA 1ESCA 4EKNB 3L7BA 4GI1A 4LV5B 1XSEA 3O26A 3STTA 5JLJA 1J99A 1YH3A 4KLRA 1JZTA 2WWHA 3UT0A 4YUZA 4I3GA 4PYOA 2AG6A 2Q3BA 3C98A 2I6QA 2ZRCA 4OBWA 3FNGA 4AU1A 4F1WA 5HJ7A 3R5KA 3GBVA 3NETA 3OPQA 4QYTA 5ALNA 4C05A 4B3CA 1BW9B 2ZRFA 2QUAA 3G1TA 2JRCA 3GB9A 3SU8A 1O0BA 1QFXA 4GOND 2B69A 5FWAA 4B2YA 4CHTA 4DA6A 1W19A 1W59A 2MINA 3EFHA 1XJWA 2X0NA 4JCCA 1Q1GA 4TLCA 5EJFA 1BWPA 4WK4B 3UKJA 4FU0A 1F1BA 2ZYSA 2EGUA 1OC4A 2V8BA 3BJZA 3GCDA 3KOUA 4ZCQA 4BMNA 4GPTA 1IHXA 4XCVA 2EJBA 3QUBA 1RTTA 4B3XA 5DNYB 1LZLA 1LPOA 1MOZA 1MQ9A 1BDHA 2HRZA 1H8ED 2IXDA 1TQHA 3BFJA 2AOXA 1ENPA 1L6RA 2PGAA 3KB2A 1FSPA 3HHEA 4RH0A 4OQPA 3VOTA 3EF1A 4F5ZA 3G3EA 3N2LA 3ZWYA 1YQGA 4WSOA 3UK0A 2JCBA 2WLSA 3SR4A 3WKEA 1CLUA 5K3OA 3IP8A 4K3VA 3FCSB 1ZN2A 4ZFNA 3IFSA 5BMVA 5FV4A 1Y6QA 2OGTA 4NK4A 3IV9A 1QC5B 2A0FA 2AFHE 3Q3GE 2H5JA 4JASB 4UUPA 4QJIA 3BE4A 4LOAA 2K6GA 4NBUA 4YJDA 1PLLA 5C3MA 5J23A 3EA0A 2ZJFA 2VJNA 4RABA 1G20A 1WXWA 4OV6B 1P8AA 2HHHB 4ZKDA 1FBNA 4CDGA 5FO0A 1QHHA 3HFGA 3TKYA 4H35A 2QLMA 4OI2A 3BSSA 1TJYA 1ZK3A 3G02A 3IVGA 4AJ2A 4OQYA 1OV6A 2ZI5A 1VHQA 3UIEA 3VFDA 3DDCA 2WMDA 3FCXA 1DAFA 2WZQA 2JHCA 1QAQA 2BVNA 1DPGA 3E7PA 1ADBA 1NHGA 4DARA 1SHZA 3OIVA 1QHSA 3K8QA 4PYLA 3HB4X 3LA6A 4AJ9A 1SQGA 1U4SA 4UVHA 2FTKE 3EGCA 4ALKA 2IKQA 2GSDA 4MLCA 3HI4A 3RUIA 3SGLA 5DIZA 1FRZA 2AA3A 3V8PA 3LRXA 4W7HA 2YIDA 1EIWA 3BORA 3FFTA 3E15A 4DEVA 3RASA 2AG8A 3RKUA 2CXTA 2QW8A 5DGDA 4BBZA 4CGZA 1CS0B 4RLQA 2R0QC 4LMAA 3LKBA 1PL6A 5COQA 3HB5X 4J7CA 3H11B 5ERXA 1KI6A 4RANA 1RWOA 4ZCLA 2FMHA 2O2ZA 4OFBA 1XL0A 4PRYA 4R69A 1ZD2P 3T5AA 5DGTA 4OXQA 4AQ7A 4FK8A 1AHHA 3QI2A 2WHPA 4IIGA 3TW4A 5JI2E 4YT8A 2FEKA 3ZWDA 2DBYA 2AQKA 3JR3A 5EJIA 2O8EA 2W2PA 3R3HA 3AFNA 5GVRA 5C2JB 3AP2A 2W2KB 4IOLA 4ZREA 1KP2A 4FGSA 1N0UA 2WU0A 4BU1A 1HDOA 1Z0AA 4IEFB 5A7HA 2AMJA 3E3MA 1D1TA 1E3EA 2PMCA 2XUQA 3VI4B 2ZI9A 4KXYA 3O4JA 3QELB 4ND1A 4H60A 1G20B 1BDB