4KUKA

A superfast recovering full-length lov protein from the marine phototrophic bacterium dinoroseobacter shibae (dark state)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
119
Chain Sequence
DIADLRALLDEDEAEMSVVFSDPSQPDNPMIYVSDAFLVQTGYTLEEVLGRNCRFLQGPDTNPHAVEAIRQGLKAETFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords blue-light photoreceptor
publication title Structure and function of a short LOV protein from the marine phototrophic bacterium Dinoroseobacter shibae.
pubmed doi rcsb
source organism Dinoroseobacter shibae
molecule tags Signaling protein
total genus 33
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4kukA00
4HQAA 4LLOB 4L9GA 3GDIA 5F5YA 3ICYA 3IS2A 3VE4A 4R70A 1V9YA 1JNUA 3UB8A 3SW1A 2A24B 3FC7A 2L1MA 3VE3A 3HJKA 1UWNX 4WF0A 1OTIA 2YKFA 4JGOA 2ZOIA 5F68A 3BY8A 4EESA 1DP6A 4RQ9A 1VB6A 1F9IA 2V1AA 1XJ2A 2PD8A 2QJ5A 2PDRA 4JGRA 1XJ6A 3UMEA 1GSXA 3LI8A 5DJUA 5TBMA 2CMNA 2WKRA 3A0VA 5HZHA 3MQOA 2R78A 4GW9A 4KUOA 3OLOA 1GSWA 3EWKA 3UB7A 3F1NA 2WKPA 5J7EA 3LIAA 5HWVA 3ULFA 3H7WB 1S1ZA 4XT2A 3NOPC 4WLAA 4BBVA 4LRYC 2D01A 3NOTC 3UMDA 2EA9A 2P7JA 1OTEA 1T1CA 3F1OA 4EETB 4L9FA 3F1PB 3LICA 4GHIA 2OWHA 3H9WA 4I5SA 2V9AA 4EQ1A 4R3AA 2Z6DA 3CWFA 5HWWA 2Z6CA 1OT9A 5AVEA 3P7NA 4HNBA 3MJQA 4GS9A 3HJIA 1MZUA 1S67L 5DJTA 4LPZA 4HP4A 4HOIA 3MQQA 3FG8A 5DKKA 3K3CA 1Y28A 2PR6A 4BBUA 4BBTA 2V0UA 2VV6A 1S66L 1T1AA 2PYRA 5HD5A 4WUJA 3UB9A 4F3LB 1V9ZA 2PR5A 3B33A 4PKYA 3K3DA 4HH3A 4NXGA 3IS2B 5G4ZA 4H6JB 4WL9A 4JGQA 1TS7A 1OTBA 3CAXA 4I3JA 3MXQA 4E04A 3A0RA 4LRZE 2L4RA 4HJ3A 5HDCA 5A8BA 2INWA 3LIDA 2A24A 3UE6A 1N9LA 2M1CA 3LIFA 1BYWA 2OWJA 1S4RA 3LYXA 4HH2A 4I38A 3LI9A 4EW7A 5IS1A 1OJGA 2PHYA 3E4OA 3UB6A 2PYPA 3C8CA 1TS0A 3MFXA 1KOUA 3F1NB 1ODVA 5G4YA 4JGPA 1OT6A 2PD7A 1N9NA 2YKHA 4K08A 2HV1A 4B9OA 2QKPA 1D06A 2GJ3A 3EEHA 3F1OB 3PYPA 2VV7A 1LT0A 3VOLA 3BY9A 3GECA 1TS8A 3H7WA 2QWSA 5J3WA 1S4SA 4HP9A 2ZBBA 4DJ2A 1P0ZA 4EEUA 1DP9A 3F1PA 2QHKA 3PHYA 3RTYA 3T50A 5HSQA 3D72A 3MR0A 1XFQA 2OOLA 1UWPX 3NOUC 5KIZA 1T19A 3H82B 3LIEA 2ZOHA 3E4PA 5HD3A 3A0SA 1X0OA 4M4XA 1DRMA 4HIAA 4L9EA 2KX6A 1XJ3A 4KQDA 5F69A 4F3LA 5AVFA 3IBRA 1NWZA 5HWTA 4HY8A 5IU1A 2QJ7A 1LL8A 1D7EA 4HJ6A 4H6JA 2W27A 1XJ4A 4R6LA 3BWLA 5TBMB 1LSWA 2V1BA 3RH8B 1XFNA 3NJAA 4EXOA 4NXEA 1LSXA 2J80A 5I5LA 1G28A 1T18A 5F6AA 4I3IA 1OJ5A 4MN6A 2JN7A 2WKQA 3C2WA 3CLOA 4XT2B 2L0WA 4EERA 1S1YA 4HI4A 2VLGA 4NXFA 5HDSA 3E4QA 1UGUA 2B02A 4HHDA 3NHQA 2VV8A 2I9VA 2KDKA 4GHIB 5EFWA 1GSVA 4MN5A 3G6OA 4HJ4A 4EEPA 4GS9B 4I3AA 4WN5A 4I39A 1EW0A 2VEAA 1N9OA 1DP8A 2D02A 4PKYG 4NXBA 1LSVA 3KX0X 4LRXC 2JHEA 4YWZA 1T1BA 5HDDA 1F98A 2BASA 2K7SA 4KUKA 2W0NA 5J4EA 4GCZA 1OTDA 2H28A 2V0WA 3ZQ5A 1OTAA 3LUQA 3LIBA 3H82A 1WA9A 4R38A 5DKLA 1TS6A 4DJ3A 1P97A
chains in the Genus database with same CATH superfamily
1SZVA 1BLSA 4S2KA 3ZG7B 4LLOB 3VP2A 5G18A 5F5YA 1ERMA 1HD8A 4R70A 4WZ5C 1L0EA 2Y59A 1PZOA 1CJFA 5A93A 3DBAA 4JGOA 4X25A 2HPBA 2ZOIA 3A3DA 3SS3A 3IXHA 4JKTA 2X71A 4OQHA 3MZEA 3GSGA 5HAQA 1XGIA 4MBHA 3FV7A 5L09A 4Q0HA 4N9KA 1YKDA 5DJUA 2LB9A 2BLSA 4JXGA 3W4PA 1JTGA 2VA0A 3K2NA 3UPNA 2PU4A 3NC8A 4FH4A 5FAQA 1W63Q 2WKPA 4IBRA 1RCJA 3OPLA 5HWVA 3ULFA 3H7WB 4ZAMA 2WGWB 2H5SA 1VETA 5GHZA 3NOTC 3GV9A 3UMDA 4O01A 1OTEA 2VK3A 4PM8A 3C7VA 2UWXA 1D1JA 3ITAA 5DFXA 4OOYA 3KSFA 2IWBA 3M6HA 5L2FA 2Z2MB 3IXBA 4YINA 1FSYA 2V9AA 3OOVA 3E98A 1TDLA 1LHYA 2LB5A 1MBLA 1ONHA 2A3UA 4B4ZA 5DTKA 1ZKJA 3DTMA 4KZ5A 1IKIA 1L0GA 1ZG4A 3VFHA 4UA6A 1YLWA 1CEGA 1Y28A 2ZQ7A 5MC7A 3N6IA 5EVID 3NULA 3QP5A 1T1AA 4F3LB 4QJGA 4BD0A 4Y5FA 4EV4A 4GD8A 2HJEA 3LEZA 2B95A 4E6WA 1IELA 2HP6A 2JKTM 5F83A 2ZD8A 3SS4A 5GHXA 4CPKA 3CAXA 1BZAA 5EVIA 1K54C 3W4OA 3MXQA 1IYSA 3A0RA 1EI5A 3FYZA 1SHVA 5A8BA 2INWA 4RYEA 3NCKA 4PM6A 4U0TA 1TDGA 2OWJA 4KZBA 1RGYA 4OOLA 2DMWA 3LI9A 3VSLA 1JWPA 1YQSA 3LGOA 1PIOA 2Y2KA 2J7VA 1MKMA 3CPTA 4UQIM 2WZZA 1XPBA 1ODVA 4JXVA 4Q8IA 1MXOA 1VETB 1HVBA 2I72A 3ZDJA 4IJGA 3HLWA 3WS0A 3EEHA 2PAVP 4JF5A 1PNEA 3PYPA 2VV7A 1LT0A 3VOLA 3AGEA 1TS8A 1S4SA 2B5RA 4QD4A 3MXRA 5DTTA 4HEFA 2O9BA 4GDBA 5GL9A 3OBFA 5FA7A 4WMCA 2XFSA 2QHKA 2ZC5B 3DAVA 3PHYA 5GLBA 3T50A 4GNUA 3HLFA 2Y2MA 2XF3A 3NDEA 5L07A 2KLIA 3MR0A 3I7JA 3UDXA 2OOLA 3NOUC 5KIZA 1T19A 1YSPA 3O88A 3S7NA 1ALQA 2GZAA 4S2MA 3ZG9B 4KQRA 3Q7VA 2HGVA 4LGWA 3TOIA 3PBSA 1DRMA 3T1SA 4JBFA 4HIAA 3HVFA 4WM9A 5AVFA 1SKFA 2QMIA 3T4KA 3UE0A 2Q0OA 3ZNTA 4F94A 2Y2JA 2GX5A 4FSFA 4RX2A 3CITA 2XLNA 1E4DA 1TF1A 1XX2A 2VGLM 1DJAA 5EPHA 4R3BA 2EX8A 1XA7A 1K55A 4OOMA 4RX3A 3BYDA 4GB7A 2EX2A 3BWLA 1VEUA 2Y2LA 3IXDA 4FCFA 5K5BA 4EBLA 5TBMB 4S2OA 3GR2A 1F5MA 1CI8A 1XFNA 2Z2LB 5A92A 4X69A 1LSXA 3SH8A 4IHQA 5HX9A 4BQMA 3T1RA 1KDWA 3TRCA 4I3IA 1BLPA 4K0WA 2JN7A 3WS5A 1IEMA 3IBJA 1Q2QA 3C2WA 3CLOA 3PAGA 2O9AA 4OH0A 1ONGA 1YLTA 4HI4A 1NRFA 1BLHA 4KZ6A 1QMEA 3HREA 3U4LP 4Y7PA 2WZXA 4E3KA 3IX8A 5KSCA 4GHIB 1NYYA 1BT5A 4BJPA 1XXMA 3G2YA 3Q07A 5HPFA 5HL6A 3TW8A 2ZC7A 2CC1A 3PTEA 3JVUA 3O87A 3GMWA 1E25A 2WADA 5DFYA 2OLUA 5CHJA 4WN5A 4AFIA 3CUEC 1DP8A 4UQIS 3V3RA 1J3WA 4DN0A 3QP8A 4O8GA 3ZFZA 1Y54A 2W3EA 4Y0TA 4Y13A 2JCHA 1FILA 3T12B 2K7SA 3IF6A 3Q7VB 5E2FA 1MWSA 2UV0E 4CJNA 5J4EA 4K91A 4JXSA 3UDFA 5DF9A 2H28A 3MBZA 2ZM8A 1E3UD 2B18A 5FQ9A 2W1TA 1CEFA 1S6RA 1S0WA 1WA9A 5J8XA 1TS6A 3WRTA 1P97A 4HQAA 4XXRA 1WYCA 5DF7A 2XR0A 3VP0A 1LL5A 4Y0UA 5FEGA 3DTEA 3N8SA 4QU3A 4E3NA 1E3UA 1RGZA 1CF0A 2C5WB 3BY8A 1DP6A 4RQ9A 4E3OA 1MWRA 3T4LA 1VB6A 3V67A 2V1AA 1XJ2A 2PD8A 3CI6A 3ISGA 5JYOA 5FQQA 4FH2A 2ZL1A 2C6WB 3LI8A 1PW8A 3A0VA 4WBGA 5E2HA 5HZHA 1G68A 4B93A 2R78A 2WYXA 2K2NA 4XUZA 2DCFA 2G2UA 2VGLS 3EWKA 3SZTA 4S2PA 4XT2A 3NOPC 1U60A 4ETZA 2PBDP 4LRYC 3TE8A 4JXWA 1YSQA 4BD1A 4N1HA 1BUEA 2NUTC 2WKHA 1YLZA 1ZC2A 4EETB 4G3VA 4L9FA 3F1PB 4KZ8A 2V2FF 3H9WA 3VP3A 3PR6A 3C38A 2JBFA 1L0FA 1LL9A 3R7WA 1IFQA 3N7WA 3CWFA 1JWVA 1OT9A 4HNBA 4ESPA 3HJIA 3MJQA 4GS9A 3C30A 4LCLA 4WELA 3VMAA 1S67L 1PWGA 2ZQAA 4EWFA 2P9VA 4KQOA 3C5AA 2PR6A 4Z1WA 3P09A 4EUZA 2V0UA 2WKIA 3GQZA 2VV6A 2EFXA 2W1TB 2PYRA 3UB9A 2XFTA 4DE2A 3LY3A 4YOFA 1FR1A 5KSHA 4P6ZM 3LEQA 3VP1A 3ZYTA 3B33A 4PKYA 1ES3A 3VP4A 5EM1A 3KYZA 2XQZA 5HAPA 4H6JB 4WL9A 4WEKA 3PBOA 4DXBA 2VKSA 2ZQ9A 1L2SA 3LFVA 3TSGA 1FQGA 3IHAA 4M3KA 1GHPA 4MEZA 2J9PA 4UEYA 3RXXA 3NBLA 1LI9A 3OPHA 3NY4A 3HUMA 4Y17A 3MS6A 3SH9A 2A24A 2ZL1B 3LIFA 2WUQA 4QWOA 3VFFA 1VQQA 2J3TC 4ZTKA 1YM1A 4I38A 1NRJA 1GA9A 3ZGAB 5EE8A 3DWZA 3HLEA 2PHYA 4DE1A 1ESUA 3UB6A 1K56D 3MFXA 1TS0A 5AQ9A 5FI6A 4OLGA 1KOUA 1ES4A 1FSWA 1ES2A 5KMWA 3BM6A 1N9NA 2ZQ8A 2IA2A 2OAQ1 3EEAA 1D06A 2GJ3A 1XKZA 3RJUA 3CJMA 4X1LA 4U0XA 1K56A 3Q7ZA 3BY9A 2QWSA 4GD6A 4LENA 1AWIA 1OMEA 2HDSA 4OVDA 4N92A 2OAP1 4H8RA 2ZBBA 3E2KA 3W8KA 3HL9A 1BSGA 1KGEA 4NETA 1P0ZA 3BLSA 3C4OA 4EEUA 2P9VB 2Y8HA 3RTYA 4EBPA 1J9MA 3UDIA 3VOZA 3EQUA 2QPNA 4E3JA 2FZ0A 4L0LA 2ZOHA 5IT5A 3O3VA 4JF6A 3S4XA 5CX7A 4II7A 4GZBA 4OP8A 2W3GA 4P6BA 1X0OA 5FSRA 4PM7A 5GLAA 2K31A 2VJWA 2KX6A 1XJ3A 5F69A 3ZVWA 1NWZA 1GHMA 5IU1A 4BWIA 1W63M 2H0TA 3QNBA 3UPOA 1H8YA 4HJ6A 5HPIA 1W5DA 2W27A 1P9WA 1XJ4A 1W8YA 5M19A 4R4SA 4JF4A 3IQAA 2V1BA 3RH8B 1SDNA 4P6ZS 5IHVA 5EVLA 2J80A 2Y4AA 5I5LA 3B42A 4KG5A 1OJ5A 4MN6A 4LV1A 4EERA 1PI5A 4QY6A 4ZRRA 1S1YA 5CEDA 3NDGA 5HDSA 1DJCA 2HJ9C 1UGUA 2Y2HA 1WYBA 2ZM2A 1G6AA 3G32A 2B02A 3LY4A 1BLCA 4HHDA 4KZ7A 3BFCA 3NHQA 4MN7A 1ERQA 2I9VA 3MKFA 2KDKA 4OONA 2O99A 3M2KA 4S2LA 4KG6A 5A91A 4N1XA 1IKGA 4MN5A 2J3WA 2VX8A 2H0YA 4X6TA 4O0PA 2KOIA 4HJ4A 3QNCA 1WE4A 4EEPA 2WK0A 4D60A 2XEPA 5CTNA 3V3SA 4CQHA 4PM9A 5FQKA 3E0YA 2DRWA 2JHEA 4YWZA 3KSIA 5HDDA 2JKGA 4CLCD 1FR6A 4PMAA 2BASA 1KGFA 3EGXC 1O07A 5DVAA 4CLCE 1H8MA 1YAXA 3GTCA 3BQ8A 2P74A 3MF0A 3MQ0A 3D3OA 5L10A 4MMNA 3LR0A 1Y4OA 3LUQA 4S2JA 3H82A 3IHBA 4S2NA 4RA7A 2JC7A 4CLCA 4RVAA 5EVIB 4PM5A 5FQJA 3O5YA 4L9GA 3GDIA 3ICYA 3AGFA 3IS2A 3S7PA 3VE4A 3BLMA 3C4PA 1JNUA 3UB8A 5FQIA 5CHUA 3FC7A 3VE3A 3HJKA 1UWNX 2EFUA 3U2AA 2YKFA 2J8YA 4PPRA 4NKPA 5F68A 4OQIA 4EESA 5I94A 1NXYA 1YT4A 2O0YA 3CPTB 1F9IA 2HDQA 5EOEA 2QJ5A 2PDRA 4OPYA 2GNXA 3OC2A 5FATA 4DXCA 1GSXA 3UPPA 3N4IA 4C3QA 2HP5A 5D3OA 4OKPA 1SDEA 1K0KA 3JVVA 4GW9A 4KUOA 1YMSA 2JKFA 3OLOA 5U47A 2PU2A 3F1NA 3IH8A 5EVIC 4WEJA 3RFBA 3LO7A 3LIAA 2WGIA 1S1ZA 4BBVA 4R3JA 2P7JA 2Y79A 4YNRA 3BFDA 4X68A 1JTDA 4GDNA 4GN2A 2A2LA 3W2ZA 3IWQA 4IBXA 3T4TA 4ID4A 2QYBA 2E8JA 1Q2PA 1QMFA 3N8LA 1K6RA 4IVIA 3V50A 4P85A 3SS5A 4R4RA 4EQ1A 4R3AA 2Z6DA 3D4FA 3BFGA 3QP6A 5AVEA 5E2GA 2Y2QA 1EROA 4OLDA 3DWKA 1MZUA 5DJTA 4LPZA 2V8FA 1VHMA 3G34A 2Y91A 4HOIA 5DKKA 1XP4A 5GHYA 3K3CA 1TD5A 4B4XA 1PZPA 3FWLA 3A3FA 3V5MA 3BECA 5HD5A 4WUJA 3T4SA 4ETXA 3HUOA 3IX3A 4Q0IA 2PR5A 4CLCB 3GRJA 4QPRA 4ZBEA 2V8CA 1H8ZA 4Q0JA 4NXGA 3BJNA 4ARZA 3IS2B 2H10A 5G4ZA 3CG5A 3QP2A 4G3KA 2Q9NA 1MY8A 5E43A 4MNRA 1VEUB 5F1FA 5FAPA 1MPLA 4BL2A 3UN7A 4KG2A 4LRZE 2EX6A 2L4RA 4NK3A 5TFQA 4UHUA 1YLJA 3BEBA 1OPXA 1ZTUA 2M1CA 4YFMA 3LYXA 1S4RA 5AJGA 2ZJ9A 4EW7A 3EGDC 4R23A 5IS1A 5GLCA 1OJGA 4OPRA 2XD5A 3E4OA 4C6YA 2PYPA 3G4PA 4A5RA 1KE0A 1ACFA 1NLZA 1CK3A 3F1NB 5G4YA 4JGPA 3SH7A 2PD7A 2YKHA 4K08A 5CERA 1K55C 3QP4A 4Y15A 1KVLA 4DF6A 2ZC3B 3S1YA 2MJ6A 3AGDA 5J3WA 3H7WA 3BFEA 1NYMA 4HP9A 4R1GA 3ZVTA 4G3WA 1IYOA 1PW1A 2DNSA 4DJ2A 3KSHA 4E3MA 2ZQDA 3MZDA 3IF6B 4WYYA 4ME4A 1DP9A 4XUXA 1SKOA 4LCMA 3UE1A 4OP5A 2BTFP 1K54A 1UWPX 3W4QA 3LIEA 3E2LA 5DF8A 5AQBA 3ZCZA 4ZDXA 5HL1A 1N4OA 4M4XA 3JPUA 1NLYA 1CQAA 3LCEA 1JWZA 2PT7A 4KQDA 1MWUA 4F3LA 1LLBA 3T1XA 5TR7A 3IBRA 3SOIA 4HY8A 4KZ9A 4K0XA 1LL8A 3V39A 4Y3IA 1D7EA 3IT9A 3MFDA 4KENB 1XA1A 4IVKA 3OCLA 3IF6C 3LR4A 4U3TA 2M7UA 3VOYA 3P98A 5GLDA 1LSWA 3UNWA 3HLBA 3NJAA 5AQAA 2PBYA 1GHIA 4NXEA 4EUVA 5FAOA 1G28A 1FIKA 1T18A 4N9LA 3PBQA 1I5QA 1O7EA 3IWIA 2WKQA 4XT2B 4EU0A 2L0WA 1KVMA 2Y2PA 3KO6A 3M6BA 1M40A 3ZHHA 5KZHA 3IWOA 4Z9QA 2VZWA 1YPRA 4FUWA 3DTKA 4OQ0A 2VV8A 3FKWA 4O7DA 3O86A 1YLYA 1GSVA 4ZJ1A 5TGFA 1BTLA 1DJBA 1KDSA 4KZ4A 5EV0A 2W3FA 4QHCA 5AQ7A 4KZ3A 4E6XA 3R7WB 4NG2A 4BENA 2EWWA 2A49A 1KE4A 5CGWA 3L7HA 4GS9B 1EWZA 4I39A 2WKEA 2VEAA 1N9OA 1Z09A 3ZG0A 1SKOB 1PWDA 3PBRA 4P87A 1W8QA 4P0MA 1BULA 2JKRI 4HBTA 4JPMA 1T1BA 4E3IA 4DDSA 2ACGA 1F98A 3TG9A 2IWDA 2W0NA 1I2WA 3NIAA 4DE3A 4FTXA 4GCZA 1TVFA 2V0WA 5FDSA 5CGXA 4D2OA 2XD1A 2X02A 5F1GA 3PAEA 5E2EA 2VGJA 1OTAA 3D9YA 2VGKA 2PRFA 2WAEA 5DKLA 3M2JA 4R38A 1H3QA 5CRFA 1W79A 3OPRA 5HFOA 2HF6A 1C3BA 3UO9A 2FFFB 2Y2IA 1ZG6A 3OCNA 3CZDA 4Y0OA 1V9YA 4C75A 4UA9A 3SW1A 2A24B 2L1MA 2G2WA 2EXBA 1FOFA 4WF0A 1OTIA 5JYPA 3S22A 3VSKA 4S2IA 1IYPA 1K4EA 2R9XA 5FASA 4DDYA 4LFUA 1GCEA 3NI9A 3LR3A 4JGRA 2XK1A 3T4JA 1XJ6A 4GJ4A 3UMEA 2J9OA 1STZA 2E8IA 5EUAA 3CUEA 4KZAA 5TBMA 5EM0A 1N9BA 2CMNA 2WKRA 4E3LA 3WS1A 5FI2A 3MQOA 1IOUA 1HTZA 1GSWA 1FCNA 1A0KA 1PI4A 3UB7A 1FCMA 5J7EA 2WAFA 3GVBA 1K25A 4WLAA 4WMCD 2D01A 2EA9A 2R9WA 3DTIA 1K57A 1XGJA 1CI9A 1T1CA 3C7UA 3HLCA 3WS4A 3F1OA 3ITBA 3A3IA 4OQGA 3CMZA 3LICA 3G31A 4GHIA 3ZG8B 4IEDA 2OWHA 3BQAA 4EBNA 4I5SA 1MKIA 2EXAA 2Y55A 2ZM0A 1H0MA 5HWWA 2Z6CA 1NZOA 3RXWA 3P7NA 1PRQA 5CEBA 2ZQCA 3BRMA 4DKIA 2IWCA 1L3LA 5CECA 1PYYA 4HP4A 4LV0A 2OV5A 2G7UA 3KYQA 3MQQA 3FG8A 2HDRA 3HUNA 4BBUA 3B3XA 4BBTA 1S66L 2ZMVA 3MXSA 3HLDA 4OPQA 1VM1A 3T4OA 5CGSA 1V9ZA 2JKRM 3K3DA 2XA7M 5CHMA 4QY5A 5FI7A 4HH3A 4FD8A 2Y2GA 3FKVA 3HCYA 4ZJ3A 3FPWA 2V20A 3Q81A 4JGQA 2FH5A 4UA7A 4X1MA 2JE5A 3WRZA 4WZ4A 3MZFA 1TS7A 1OTBA 4I3JA 4X56A 4E04A 2EX9A 1ZHHB 4MLLA 1IYQA 2V1ZA 4HJ3A 5HDCA 1HZOA 3LIDA 4MBFA 1ESIA 3UE6A 1N9LA 1BYWA 4HH2A 5FQMA 5EECA 4DMZA 4Y2FA 2HZ5A 2ZC4B 3Q1FA 1FCOA 3KSGA 3C8CA 4GOGA 1AXBA 2ZLYA 3UB5P 3FPVA 5HARA 1P9RA 1K38A 3T1QB 3VV4A 1OT6A 4X53A 2P04A 2HV1A 5FL3A 4B9OA 2O9CA 2QKPA 4IUHA 4B88A 3BW6A 5HW3A 3F1OB 2XRNA 1NJ4A 2NUPC 3PXPA 3GECA 1L0DA 2OLVA 5CTMA 5F82A 5L8MA 4NEED 3JYIA 3HBRA 2J3TD 3Q82A 4UAAA 4WZ5A 3G30A 1H5XA 2ZMFA 2HDUA 3F1PA 3IX4A 1K6SA 5BOHA 1M6KA 4HESA 5HSQA 5HAIA 2RL3A 3D72A 5DTSA 1F2KA 2FFYA 1XFQA 2Y2NA 3A3JA 1YMXA 3ZG5A 1LI0A 3H82B 2ZC6B 4JLFA 2AVXA 3E4PA 3MKEA 3BFFA 3S7QA 5HD3A 2HP9A 3UY6A 5FEFA 3HLGA 4IUKA 1K57C 3A0SA 3N8RA 3CHWP 5FDHA 4BMWA 4L9EA 2Q9MA 3B47A 3WS2A 3OPPA 3EQVA 3OZHA 4BLMA 5HWTA 1JVJA 1YLPA 3S7OA 3A3EA 4LV3A 2QJ7A 3LR5A 2GDNA 1KE3A 5C5KA 2M7VA 2XROA 4LV2A 2EWVA 4H6JA 1RP5A 1ES5A 2RCXA 3IH9A 4R6LA 3G35A 4FOFA 4DE0A 1PFLA 4EXOA 4GKUA 3MMHA 2XA7S 4OPZA 2XDMA 1I2SA 2WGVA 3PBTA 3IXGA 5F6AA 4S2NC 2XGNA 1GA0A 4CLCC 1NZUA 4MDZA 4PAUA 5M1AA 2VLGA 4NXFA 3UE3A 3E4QA 3P01A 4QB8A 3KYEA 4BL3A 4DRTA 1SCWA 1KGGA 1W7FA 3MSHA 3PBNA 5EFWA 2WGWA 5EOOA 5TJJA 5A90A 3L9KA 4GLQA 3ZNYA 1DY6A 1MWTA 4EQIA 2OSUA 3G6OA 3WWXA 3IF5A 1NY0A 5LBRA 4MBKA 2ZMAA 4PHTA 4I3AA 5M18A 1EW0A 4R0QA 2QZ6A 2D02A 3EOIA 1G6OA 4PKYG 2Y2OA 4NXBA 1LSVA 3KX0X 4LRXC 3FZCA 2XSSA 1HLUP 4KQQA 1Z6FA 2X01A 3DW0A 5EVEA 2W1RA 2BG1A 1K4FA 1PWCA 2JKTI 4MCWA 1TEMA 4KUKA 4ZJ2A 1OTDA 4ARZB 3ZQ5A 5CXWA 4HBUA 4X55A 3T4QA 2XH9A 3NECA 1G5UA 3LIBA 2W3HA 3TJZC 3R4KA 2P08A 3QHYA 3QP1A 2W3DA 3G2ZA 1MC0A 4DJ3A
chains in the Genus database with same CATH topology
3O5YA 4HQAA 4LLOB 4L9GA 3GDIA 5F5YA 3OCNA 3ICYA 3IS2A 3S7PA 3VE4A 4R70A 1V9YA 1JNUA 3UB8A 3SW1A 2A24B 3FC7A 2L1MA 3VE3A 3DBAA 3HJKA 1UWNX 4WF0A 1OTIA 3U2AA 2YKFA 4JGOA 2ZOIA 4NKPA 5F68A 3BY8A 4EESA 1DP6A 4RQ9A 3T4LA 1VB6A 2O0YA 1F9IA 3V67A 2V1AA 1XJ2A 2PD8A 2QJ5A 3CI6A 3LR3A 2PDRA 4JGRA 2GNXA 3OC2A 3T4JA 1XJ6A 4GJ4A 4Q0HA 3UMEA 1GSXA 1STZA 1YKDA 3LI8A 5DJUA 3CUEA 5TBMA 2CMNA 2WKRA 2LB9A 3A0VA 3JVVA 5HZHA 2VA0A 3K2NA 3MQOA 4B93A 2R78A 1IOUA 4GW9A 4KUOA 2K2NA 3OLOA 1GSWA 2VGLS 3EWKA 3UB7A 3F1NA 4WEJA 1W63Q 2WKPA 3RFBA 5J7EA 3LIAA 5HWVA 3ULFA 3H7WB 1S1ZA 4XT2A 3NOPC 4WLAA 4BBVA 4ETZA 3TE8A 4LRYC 2D01A 3NOTC 3UMDA 1YSQA 2EA9A 2P7JA 2Y79A 4O01A 4YNRA 1OTEA 1T1CA 2NUTC 3F1OA 2A2LA 5DFXA 4EETB 3W2ZA 4G3VA 4L9FA 3KSFA 3F1PB 3T4TA 3LICA 4GHIA 2QYBA 2OWHA 3H9WA 3BQAA 3PR6A 3C38A 4I5SA 3R7WA 2V9AA 3OOVA 4EQ1A 1IFQA 4R3AA 2Z6DA 3CWFA 3E98A 5HWWA 2Z6CA 1OT9A 2LB5A 5AVEA 3P7NA 4HNBA 3HJIA 3MJQA 4GS9A 3C30A 4WELA 1MZUA 1S67L 5DJTA 4LPZA 4HP4A 4KQOA 2G7UA 1VHMA 3KYQA 4HOIA 3MQQA 3FG8A 5DKKA 3K3CA 1Y28A 2PR6A 4Z1WA 4BBUA 1TD5A 5MC7A 4BBTA 2V0UA 2VV6A 1S66L 2ZMVA 2W1TB 1T1AA 2PYRA 5HD5A 4WUJA 3T4SA 3UB9A 4ETXA 4F3LB 3T4OA 4Y5FA 4YOFA 1V9ZA 4Q0IA 5KSHA 2PR5A 4P6ZM 4CLCB 2JKRM 2HJEA 3ZYTA 3B33A 4PKYA 4QPRA 3K3DA 2XA7M 4Q0JA 4HH3A 4NXGA 3BJNA 4ARZA 3IS2B 5G4ZA 3KYZA 3HCYA 3FPWA 4H6JB 4WL9A 2JKTM 4G3KA 4WEKA 3PBOA 4JGQA 2FH5A 2VKSA 1TS7A 1OTBA 3CAXA 4I3JA 3LFVA 3MXQA 4E04A 1ZHHB 3A0RA 4UEYA 4LRZE 2L4RA 4HJ3A 5HDCA 5A8BA 2INWA 3LIDA 2A24A 3UE6A 1OPXA 1N9LA 1ZTUA 2M1CA 3LIFA 1BYWA 2OWJA 1S4RA 3LYXA 4HH2A 4OOLA 4DMZA 5AJGA 2J3TC 4Y2FA 2DMWA 4I38A 3LI9A 4EW7A 3EGDC 5IS1A 1NRJA 1OJGA 2PHYA 3E4OA 3UB6A 2PYPA 1MKMA 3KSGA 3C8CA 1TS0A 3MFXA 1KOUA 4UQIM 3FPVA 1P9RA 1NLZA 3F1NB 3VV4A 1ODVA 5G4YA 4JGPA 1OT6A 2PD7A 2P04A 1N9NA 2IA2A 2YKHA 4K08A 2HV1A 2OAQ1 5FL3A 4B9OA 2O9CA 3EEAA 2QKPA 1D06A 4IJGA 4IUHA 2GJ3A 3BW6A 3EEHA 3F1OB 2XRNA 3PYPA 2VV7A 2NUPC 1LT0A 2MJ6A 3VOLA 3BY9A 3PXPA 3GECA 1TS8A 3H7WA 2QWSA 5J3WA 1S4SA 4HP9A 5L8MA 2O9BA 2OAP1 2ZBBA 4NEED 4G3WA 3OBFA 4DJ2A 1P0ZA 2J3TD 3KSHA 4EEUA 2ZMFA 4ME4A 1DP9A 3F1PA 2QHKA 2Y8HA 3PHYA 3RTYA 3T50A 5HSQA 3D72A 2KLIA 3MR0A 1XFQA 3EQUA 2OOLA 1UWPX 3NOUC 5KIZA 1T19A 1YSPA 3H82B 3S7NA 3LIEA 2FZ0A 4L0LA 2ZOHA 2GZAA 5IT5A 3E4PA 5CX7A 4II7A 5HD3A 3S7QA 2HGVA 4IUKA 2W3GA 3PBSA 3A0SA 1X0OA 4M4XA 1DRMA 1NLYA 1P97A 4BMWA 2K31A 4HIAA 2VJWA 2KX6A 4L9EA 1XJ3A 2PT7A 4KQDA 3B47A 5F69A 4F3LA 5AVFA 3EQVA 3IBRA 3T4KA 1NWZA 5HWTA 4HY8A 3S7OA 5IU1A 2GX5A 1W63M 4FSFA 4BWIA 3CITA 1TF1A 2QJ7A 1LL8A 3LR5A 4Y3IA 2VGLM 5C5KA 1D7EA 2M7VA 2XROA 4HJ6A 2EWVA 3OCLA 4H6JA 5HPIA 2W27A 3LR4A 1P9WA 4OOMA 1XJ4A 4R6LA 3BWLA 2M7UA 5K5BA 5TBMB 1LSWA 2V1BA 1F5MA 3RH8B 1XFNA 4FOFA 4P6ZS 3NJAA 4EXOA 1LSXA 2XA7S 3MMHA 4NXEA 2J80A 5I5LA 4EUVA 3B42A 4IHQA 1G28A 1T18A 3PBTA 3PBQA 5F6AA 3TRCA 4I3IA 1OJ5A 4MN6A 4CLCC 2JN7A 4MDZA 4PAUA 3IBJA 2WKQA 3C2WA 3CLOA 4XT2B 4EU0A 2L0WA 4EERA 2O9AA 4ZRRA 1S1YA 4HI4A 3KO6A 2VLGA 4NXFA 3UE3A 5HDSA 3E4QA 2HJ9C 1UGUA 3P01A 2VZWA 2B02A 4HHDA 3NHQA 2VV8A 3PBNA 4MN7A 2I9VA 2KDKA 4GHIB 5EFWA 1GSVA 4BJPA 2O99A 5TJJA 5HPFA 2W3FA 4GLQA 5HL6A 3TW8A 4MN5A 2J3WA 2VX8A 3R7WB 3G6OA 4O0PA 2KOIA 3JVUA 2EWWA 4HJ4A 5LBRA 4EEPA 5DFYA 4PHTA 4GS9B 4I3AA 4WN5A 4I39A 1EW0A 4CQHA 2VEAA 3CUEC 4AFIA 1N9OA 1DP8A 4UQIS 2D02A 3EOIA 1G6OA 3PBRA 3E0YA 4PKYG 4NXBA 4DN0A 1LSVA 2JKRI 3KX0X 4LRXC 2XSSA 2JHEA 4O8GA 4YWZA 1T1BA 3KSIA 5HDDA 4CLCD 2W3EA 1F98A 2BASA 2W1RA 3EGXC 2K7SA 2JKTI 4MCWA 4KUKA 4CLCE 1H8MA 1YAXA 2W0NA 3BQ8A 3MF0A 3MQ0A 5J4EA 4GCZA 5DF9A 1OTDA 2H28A 2V0WA 4ARZB 3ZQ5A 3D3OA 2B18A 4MMNA 3LR0A 1OTAA 3T4QA 2W1TA 3LUQA 3LIBA 3H82A 2W3HA 3TJZC 1WA9A 3R4KA 4R38A 5DKLA 1H3QA 2P08A 4CLCA 1TS6A 2W3DA 1MC0A 4DJ3A 2HF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQA A;  4LLO B;  4L9G A;  3GDI A;  5F5Y A;  3ICY A;  3IS2 A;  3VE4 A;  4R70 A;  1V9Y A;  1JNU A;  3UB8 A;  3SW1 A;  2A24 B;  3FC7 A;  2L1M A;  3VE3 A;  3HJK A;  1UWN X;  4WF0 A;  1OTI A;  2YKF A;  4JGO A;  2ZOI A;  5F68 A;  3BY8 A;  4EES A;  1DP6 A;  4RQ9 A;  1VB6 A;  1F9I A;  2V1A A;  1XJ2 A;  2PD8 A;  2QJ5 A;  2PDR A;  4JGR A;  1XJ6 A;  3UME A;  1GSX A;  3LI8 A;  5DJU A;  5TBM A;  2CMN A;  2WKR A;  3A0V A;  5HZH A;  3MQO A;  2R78 A;  4GW9 A;  4KUO A;  3OLO A;  1GSW A;  3EWK A;  3UB7 A;  3F1N A;  2WKP A;  5J7E A;  3LIA A;  5HWV A;  3ULF A;  3H7W B;  1S1Z A;  4XT2 A;  3NOP C;  4WLA A;  4BBV A;  4LRY C;  2D01 A;  3NOT C;  3UMD A;  2EA9 A;  2P7J A;  1OTE A;  1T1C A;  3F1O A;  4EET B;  4L9F A;  3F1P B;  3LIC A;  4GHI A;  2OWH A;  3H9W A;  4I5S A;  2V9A A;  4EQ1 A;  4R3A A;  2Z6D A;  3CWF A;  5HWW A;  2Z6C A;  1OT9 A;  5AVE A;  3P7N A;  4HNB A;  3MJQ A;  4GS9 A;  3HJI A;  1MZU A;  1S67 L;  5DJT A;  4LPZ A;  4HP4 A;  4HOI A;  3MQQ A;  3FG8 A;  5DKK A;  3K3C A;  1Y28 A;  2PR6 A;  4BBU A;  4BBT A;  2V0U A;  2VV6 A;  1S66 L;  1T1A A;  2PYR A;  5HD5 A;  4WUJ A;  3UB9 A;  4F3L B;  1V9Z A;  2PR5 A;  3B33 A;  4PKY A;  3K3D A;  4HH3 A;  4NXG A;  3IS2 B;  5G4Z A;  4H6J B;  4WL9 A;  4JGQ A;  1TS7 A;  1OTB A;  3CAX A;  4I3J A;  3MXQ A;  4E04 A;  3A0R A;  4LRZ E;  2L4R A;  4HJ3 A;  5HDC A;  5A8B A;  2INW A;  3LID A;  2A24 A;  3UE6 A;  1N9L A;  2M1C A;  3LIF A;  1BYW A;  2OWJ A;  1S4R A;  3LYX A;  4HH2 A;  4I38 A;  3LI9 A;  4EW7 A;  5IS1 A;  1OJG A;  2PHY A;  3E4O A;  3UB6 A;  2PYP A;  3C8C A;  1TS0 A;  3MFX A;  1KOU A;  3F1N B;  1ODV A;  5G4Y A;  4JGP A;  1OT6 A;  2PD7 A;  1N9N A;  2YKH A;  4K08 A;  2HV1 A;  4B9O A;  2QKP A;  1D06 A;  2GJ3 A;  3EEH A;  3F1O B;  3PYP A;  2VV7 A;  1LT0 A;  3VOL A;  3BY9 A;  3GEC A;  1TS8 A;  3H7W A;  2QWS A;  5J3W A;  1S4S A;  4HP9 A;  2ZBB A;  4DJ2 A;  1P0Z A;  4EEU A;  1DP9 A;  3F1P A;  2QHK A;  3PHY A;  3RTY A;  3T50 A;  5HSQ A;  3D72 A;  3MR0 A;  1XFQ A;  2OOL A;  1UWP X;  3NOU C;  5KIZ A;  1T19 A;  3H82 B;  3LIE A;  2ZOH A;  3E4P A;  5HD3 A;  3A0S A;  1X0O A;  4M4X A;  1DRM A;  4HIA A;  4L9E A;  2KX6 A;  1XJ3 A;  4KQD A;  5F69 A;  4F3L A;  5AVF A;  3IBR A;  1NWZ A;  5HWT A;  4HY8 A;  5IU1 A;  2QJ7 A;  1LL8 A;  1D7E A;  4HJ6 A;  4H6J A;  2W27 A;  1XJ4 A;  4R6L A;  3BWL A;  5TBM B;  1LSW A;  2V1B A;  3RH8 B;  1XFN A;  3NJA A;  4EXO A;  4NXE A;  1LSX A;  2J80 A;  5I5L A;  1G28 A;  1T18 A;  5F6A A;  4I3I A;  1OJ5 A;  4MN6 A;  2JN7 A;  2WKQ A;  3C2W A;  3CLO A;  4XT2 B;  2L0W A;  4EER A;  1S1Y A;  4HI4 A;  2VLG A;  4NXF A;  5HDS A;  3E4Q A;  1UGU A;  2B02 A;  4HHD A;  3NHQ A;  2VV8 A;  2I9V A;  2KDK A;  4GHI B;  5EFW A;  1GSV A;  4MN5 A;  3G6O A;  4HJ4 A;  4EEP A;  4GS9 B;  4I3A A;  4WN5 A;  4I39 A;  1EW0 A;  2VEA A;  1N9O A;  1DP8 A;  2D02 A;  4PKY G;  4NXB A;  1LSV A;  3KX0 X;  4LRX C;  2JHE A;  4YWZ A;  1T1B A;  5HDD A;  1F98 A;  2BAS A;  2K7S A;  4KUK A;  2W0N A;  5J4E A;  4GCZ A;  1OTD A;  2H28 A;  2V0W A;  3ZQ5 A;  1OTA A;  3LUQ A;  3LIB A;  3H82 A;  1WA9 A;  4R38 A;  5DKL A;  1TS6 A;  4DJ3 A;  1P97 A; 
#chains in the Genus database with same CATH topology
 1SZV A;  1BLS A;  4S2K A;  3ZG7 B;  4LLO B;  3VP2 A;  5G18 A;  5F5Y A;  1ERM A;  1HD8 A;  4R70 A;  4WZ5 C;  1L0E A;  2Y59 A;  1PZO A;  1CJF A;  5A93 A;  3DBA A;  4JGO A;  4X25 A;  2HPB A;  2ZOI A;  3A3D A;  3SS3 A;  3IXH A;  4JKT A;  2X71 A;  4OQH A;  3MZE A;  3GSG A;  5HAQ A;  1XGI A;  4MBH A;  3FV7 A;  5L09 A;  4Q0H A;  4N9K A;  1YKD A;  5DJU A;  2LB9 A;  2BLS A;  4JXG A;  3W4P A;  1JTG A;  2VA0 A;  3K2N A;  3UPN A;  2PU4 A;  3NC8 A;  4FH4 A;  5FAQ A;  1W63 Q;  2WKP A;  4IBR A;  1RCJ A;  3OPL A;  5HWV A;  3ULF A;  3H7W B;  4ZAM A;  2WGW B;  2H5S A;  1VET A;  5GHZ A;  3NOT C;  3GV9 A;  3UMD A;  4O01 A;  1OTE A;  2VK3 A;  4PM8 A;  3C7V A;  2UWX A;  1D1J A;  3ITA A;  5DFX A;  4OOY A;  3KSF A;  2IWB A;  3M6H A;  5L2F A;  2Z2M B;  3IXB A;  4YIN A;  1FSY A;  2V9A A;  3OOV A;  3E98 A;  1TDL A;  1LHY A;  2LB5 A;  1MBL A;  1ONH A;  2A3U A;  4B4Z A;  5DTK A;  1ZKJ A;  3DTM A;  4KZ5 A;  1IKI A;  1L0G A;  1ZG4 A;  3VFH A;  4UA6 A;  1YLW A;  1CEG A;  1Y28 A;  2ZQ7 A;  5MC7 A;  3N6I A;  5EVI D;  3NUL A;  3QP5 A;  1T1A A;  4F3L B;  4QJG A;  4BD0 A;  4Y5F A;  4EV4 A;  4GD8 A;  2HJE A;  3LEZ A;  2B95 A;  4E6W A;  1IEL A;  2HP6 A;  2JKT M;  5F83 A;  2ZD8 A;  3SS4 A;  5GHX A;  4CPK A;  3CAX A;  1BZA A;  5EVI A;  1K54 C;  3W4O A;  3MXQ A;  1IYS A;  3A0R A;  1EI5 A;  3FYZ A;  1SHV A;  5A8B A;  2INW A;  4RYE A;  3NCK A;  4PM6 A;  4U0T A;  1TDG A;  2OWJ A;  4KZB A;  1RGY A;  4OOL A;  2DMW A;  3LI9 A;  3VSL A;  1JWP A;  1YQS A;  3LGO A;  1PIO A;  2Y2K A;  2J7V A;  1MKM A;  3CPT A;  4UQI M;  2WZZ A;  1XPB A;  1ODV A;  4JXV A;  4Q8I A;  1MXO A;  1VET B;  1HVB A;  2I72 A;  3ZDJ A;  4IJG A;  3HLW A;  3WS0 A;  3EEH A;  2PAV P;  4JF5 A;  1PNE A;  3PYP A;  2VV7 A;  1LT0 A;  3VOL A;  3AGE A;  1TS8 A;  1S4S A;  2B5R A;  4QD4 A;  3MXR A;  5DTT A;  4HEF A;  2O9B A;  4GDB A;  5GL9 A;  3OBF A;  5FA7 A;  4WMC A;  2XFS A;  2QHK A;  2ZC5 B;  3DAV A;  3PHY A;  5GLB A;  3T50 A;  4GNU A;  3HLF A;  2Y2M A;  2XF3 A;  3NDE A;  5L07 A;  2KLI A;  3MR0 A;  3I7J A;  3UDX A;  2OOL A;  3NOU C;  5KIZ A;  1T19 A;  1YSP A;  3O88 A;  3S7N A;  1ALQ A;  2GZA A;  4S2M A;  3ZG9 B;  4KQR A;  3Q7V A;  2HGV A;  4LGW A;  3TOI A;  3PBS A;  1DRM A;  3T1S A;  4JBF A;  4HIA A;  3HVF A;  4WM9 A;  5AVF A;  1SKF A;  2QMI A;  3T4K A;  3UE0 A;  2Q0O A;  3ZNT A;  4F94 A;  2Y2J A;  2GX5 A;  4FSF A;  4RX2 A;  3CIT A;  2XLN A;  1E4D A;  1TF1 A;  1XX2 A;  2VGL M;  1DJA A;  5EPH A;  4R3B A;  2EX8 A;  1XA7 A;  1K55 A;  4OOM A;  4RX3 A;  3BYD A;  4GB7 A;  2EX2 A;  3BWL A;  1VEU A;  2Y2L A;  3IXD A;  4FCF A;  5K5B A;  4EBL A;  5TBM B;  4S2O A;  3GR2 A;  1F5M A;  1CI8 A;  1XFN A;  2Z2L B;  5A92 A;  4X69 A;  1LSX A;  3SH8 A;  4IHQ A;  5HX9 A;  4BQM A;  3T1R A;  1KDW A;  3TRC A;  4I3I A;  1BLP A;  4K0W A;  2JN7 A;  3WS5 A;  1IEM A;  3IBJ A;  1Q2Q A;  3C2W A;  3CLO A;  3PAG A;  2O9A A;  4OH0 A;  1ONG A;  1YLT A;  4HI4 A;  1NRF A;  1BLH A;  4KZ6 A;  1QME A;  3HRE A;  3U4L P;  4Y7P A;  2WZX A;  4E3K A;  3IX8 A;  5KSC A;  4GHI B;  1NYY A;  1BT5 A;  4BJP A;  1XXM A;  3G2Y A;  3Q07 A;  5HPF A;  5HL6 A;  3TW8 A;  2ZC7 A;  2CC1 A;  3PTE A;  3JVU A;  3O87 A;  3GMW A;  1E25 A;  2WAD A;  5DFY A;  2OLU A;  5CHJ A;  4WN5 A;  4AFI A;  3CUE C;  1DP8 A;  4UQI S;  3V3R A;  1J3W A;  4DN0 A;  3QP8 A;  4O8G A;  3ZFZ A;  1Y54 A;  2W3E A;  4Y0T A;  4Y13 A;  2JCH A;  1FIL A;  3T12 B;  2K7S A;  3IF6 A;  3Q7V B;  5E2F A;  1MWS A;  2UV0 E;  4CJN A;  5J4E A;  4K91 A;  4JXS A;  3UDF A;  5DF9 A;  2H28 A;  3MBZ A;  2ZM8 A;  1E3U D;  2B18 A;  5FQ9 A;  2W1T A;  1CEF A;  1S6R A;  1S0W A;  1WA9 A;  5J8X A;  1TS6 A;  3WRT A;  1P97 A;  4HQA A;  4XXR A;  1WYC A;  5DF7 A;  2XR0 A;  3VP0 A;  1LL5 A;  4Y0U A;  5FEG A;  3DTE A;  3N8S A;  4QU3 A;  4E3N A;  1E3U A;  1RGZ A;  1CF0 A;  2C5W B;  3BY8 A;  1DP6 A;  4RQ9 A;  4E3O A;  1MWR A;  3T4L A;  1VB6 A;  3V67 A;  2V1A A;  1XJ2 A;  2PD8 A;  3CI6 A;  3ISG A;  5JYO A;  5FQQ A;  4FH2 A;  2ZL1 A;  2C6W B;  3LI8 A;  1PW8 A;  3A0V A;  4WBG A;  5E2H A;  5HZH A;  1G68 A;  4B93 A;  2R78 A;  2WYX A;  2K2N A;  4XUZ A;  2DCF A;  2G2U A;  2VGL S;  3EWK A;  3SZT A;  4S2P A;  4XT2 A;  3NOP C;  1U60 A;  4ETZ A;  2PBD P;  4LRY C;  3TE8 A;  4JXW A;  1YSQ A;  4BD1 A;  4N1H A;  1BUE A;  2NUT C;  2WKH A;  1YLZ A;  1ZC2 A;  4EET B;  4G3V A;  4L9F A;  3F1P B;  4KZ8 A;  2V2F F;  3H9W A;  3VP3 A;  3PR6 A;  3C38 A;  2JBF A;  1L0F A;  1LL9 A;  3R7W A;  1IFQ A;  3N7W A;  3CWF A;  1JWV A;  1OT9 A;  4HNB A;  4ESP A;  3HJI A;  3MJQ A;  4GS9 A;  3C30 A;  4LCL A;  4WEL A;  3VMA A;  1S67 L;  1PWG A;  2ZQA A;  4EWF A;  2P9V A;  4KQO A;  3C5A A;  2PR6 A;  4Z1W A;  3P09 A;  4EUZ A;  2V0U A;  2WKI A;  3GQZ A;  2VV6 A;  2EFX A;  2W1T B;  2PYR A;  3UB9 A;  2XFT A;  4DE2 A;  3LY3 A;  4YOF A;  1FR1 A;  5KSH A;  4P6Z M;  3LEQ A;  3VP1 A;  3ZYT A;  3B33 A;  4PKY A;  1ES3 A;  3VP4 A;  5EM1 A;  3KYZ A;  2XQZ A;  5HAP A;  4H6J B;  4WL9 A;  4WEK A;  3PBO A;  4DXB A;  2VKS A;  2ZQ9 A;  1L2S A;  3LFV A;  3TSG A;  1FQG A;  3IHA A;  4M3K A;  1GHP A;  4MEZ A;  2J9P A;  4UEY A;  3RXX A;  3NBL A;  1LI9 A;  3OPH A;  3NY4 A;  3HUM A;  4Y17 A;  3MS6 A;  3SH9 A;  2A24 A;  2ZL1 B;  3LIF A;  2WUQ A;  4QWO A;  3VFF A;  1VQQ A;  2J3T C;  4ZTK A;  1YM1 A;  4I38 A;  1NRJ A;  1GA9 A;  3ZGA B;  5EE8 A;  3DWZ A;  3HLE A;  2PHY A;  4DE1 A;  1ESU A;  3UB6 A;  1K56 D;  3MFX A;  1TS0 A;  5AQ9 A;  5FI6 A;  4OLG A;  1KOU A;  1ES4 A;  1FSW A;  1ES2 A;  5KMW A;  3BM6 A;  1N9N A;  2ZQ8 A;  2IA2 A;  2OAQ 1;  3EEA A;  1D06 A;  2GJ3 A;  1XKZ A;  3RJU A;  3CJM A;  4X1L A;  4U0X A;  1K56 A;  3Q7Z A;  3BY9 A;  2QWS A;  4GD6 A;  4LEN A;  1AWI A;  1OME A;  2HDS A;  4OVD A;  4N92 A;  2OAP 1;  4H8R A;  2ZBB A;  3E2K A;  3W8K A;  3HL9 A;  1BSG A;  1KGE A;  4NET A;  1P0Z A;  3BLS A;  3C4O A;  4EEU A;  2P9V B;  2Y8H A;  3RTY A;  4EBP A;  1J9M A;  3UDI A;  3VOZ A;  3EQU A;  2QPN A;  4E3J A;  2FZ0 A;  4L0L A;  2ZOH A;  5IT5 A;  3O3V A;  4JF6 A;  3S4X A;  5CX7 A;  4II7 A;  4GZB A;  4OP8 A;  2W3G A;  4P6B A;  1X0O A;  5FSR A;  4PM7 A;  5GLA A;  2K31 A;  2VJW A;  2KX6 A;  1XJ3 A;  5F69 A;  3ZVW A;  1NWZ A;  1GHM A;  5IU1 A;  4BWI A;  1W63 M;  2H0T A;  3QNB A;  3UPO A;  1H8Y A;  4HJ6 A;  5HPI A;  1W5D A;  2W27 A;  1P9W A;  1XJ4 A;  1W8Y A;  5M19 A;  4R4S A;  4JF4 A;  3IQA A;  2V1B A;  3RH8 B;  1SDN A;  4P6Z S;  5IHV A;  5EVL A;  2J80 A;  2Y4A A;  5I5L A;  3B42 A;  4KG5 A;  1OJ5 A;  4MN6 A;  4LV1 A;  4EER A;  1PI5 A;  4QY6 A;  4ZRR A;  1S1Y A;  5CED A;  3NDG A;  5HDS A;  1DJC A;  2HJ9 C;  1UGU A;  2Y2H A;  1WYB A;  2ZM2 A;  1G6A A;  3G32 A;  2B02 A;  3LY4 A;  1BLC A;  4HHD A;  4KZ7 A;  3BFC A;  3NHQ A;  4MN7 A;  1ERQ A;  2I9V A;  3MKF A;  2KDK A;  4OON A;  2O99 A;  3M2K A;  4S2L A;  4KG6 A;  5A91 A;  4N1X A;  1IKG A;  4MN5 A;  2J3W A;  2VX8 A;  2H0Y A;  4X6T A;  4O0P A;  2KOI A;  4HJ4 A;  3QNC A;  1WE4 A;  4EEP A;  2WK0 A;  4D60 A;  2XEP A;  5CTN A;  3V3S A;  4CQH A;  4PM9 A;  5FQK A;  3E0Y A;  2DRW A;  2JHE A;  4YWZ A;  3KSI A;  5HDD A;  2JKG A;  4CLC D;  1FR6 A;  4PMA A;  2BAS A;  1KGF A;  3EGX C;  1O07 A;  5DVA A;  4CLC E;  1H8M A;  1YAX A;  3GTC A;  3BQ8 A;  2P74 A;  3MF0 A;  3MQ0 A;  3D3O A;  5L10 A;  4MMN A;  3LR0 A;  1Y4O A;  3LUQ A;  4S2J A;  3H82 A;  3IHB A;  4S2N A;  4RA7 A;  2JC7 A;  4CLC A;  4RVA A;  5EVI B;  4PM5 A;  5FQJ A;  3O5Y A;  4L9G A;  3GDI A;  3ICY A;  3AGF A;  3IS2 A;  3S7P A;  3VE4 A;  3BLM A;  3C4P A;  1JNU A;  3UB8 A;  5FQI A;  5CHU A;  3FC7 A;  3VE3 A;  3HJK A;  1UWN X;  2EFU A;  3U2A A;  2YKF A;  2J8Y A;  4PPR A;  4NKP A;  5F68 A;  4OQI A;  4EES A;  5I94 A;  1NXY A;  1YT4 A;  2O0Y A;  3CPT B;  1F9I A;  2HDQ A;  5EOE A;  2QJ5 A;  2PDR A;  4OPY A;  2GNX A;  3OC2 A;  5FAT A;  4DXC A;  1GSX A;  3UPP A;  3N4I A;  4C3Q A;  2HP5 A;  5D3O A;  4OKP A;  1SDE A;  1K0K A;  3JVV A;  4GW9 A;  4KUO A;  1YMS A;  2JKF A;  3OLO A;  5U47 A;  2PU2 A;  3F1N A;  3IH8 A;  5EVI C;  4WEJ A;  3RFB A;  3LO7 A;  3LIA A;  2WGI A;  1S1Z A;  4BBV A;  4R3J A;  2P7J A;  2Y79 A;  4YNR A;  3BFD A;  4X68 A;  1JTD A;  4GDN A;  4GN2 A;  2A2L A;  3W2Z A;  3IWQ A;  4IBX A;  3T4T A;  4ID4 A;  2QYB A;  2E8J A;  1Q2P A;  1QMF A;  3N8L A;  1K6R A;  4IVI A;  3V50 A;  4P85 A;  3SS5 A;  4R4R A;  4EQ1 A;  4R3A A;  2Z6D A;  3D4F A;  3BFG A;  3QP6 A;  5AVE A;  5E2G A;  2Y2Q A;  1ERO A;  4OLD A;  3DWK A;  1MZU A;  5DJT A;  4LPZ A;  2V8F A;  1VHM A;  3G34 A;  2Y91 A;  4HOI A;  5DKK A;  1XP4 A;  5GHY A;  3K3C A;  1TD5 A;  4B4X A;  1PZP A;  3FWL A;  3A3F A;  3V5M A;  3BEC A;  5HD5 A;  4WUJ A;  3T4S A;  4ETX A;  3HUO A;  3IX3 A;  4Q0I A;  2PR5 A;  4CLC B;  3GRJ A;  4QPR A;  4ZBE A;  2V8C A;  1H8Z A;  4Q0J A;  4NXG A;  3BJN A;  4ARZ A;  3IS2 B;  2H10 A;  5G4Z A;  3CG5 A;  3QP2 A;  4G3K A;  2Q9N A;  1MY8 A;  5E43 A;  4MNR A;  1VEU B;  5F1F A;  5FAP A;  1MPL A;  4BL2 A;  3UN7 A;  4KG2 A;  4LRZ E;  2EX6 A;  2L4R A;  4NK3 A;  5TFQ A;  4UHU A;  1YLJ A;  3BEB A;  1OPX A;  1ZTU A;  2M1C A;  4YFM A;  3LYX A;  1S4R A;  5AJG A;  2ZJ9 A;  4EW7 A;  3EGD C;  4R23 A;  5IS1 A;  5GLC A;  1OJG A;  4OPR A;  2XD5 A;  3E4O A;  4C6Y A;  2PYP A;  3G4P A;  4A5R A;  1KE0 A;  1ACF A;  1NLZ A;  1CK3 A;  3F1N B;  5G4Y A;  4JGP A;  3SH7 A;  2PD7 A;  2YKH A;  4K08 A;  5CER A;  1K55 C;  3QP4 A;  4Y15 A;  1KVL A;  4DF6 A;  2ZC3 B;  3S1Y A;  2MJ6 A;  3AGD A;  5J3W A;  3H7W A;  3BFE A;  1NYM A;  4HP9 A;  4R1G A;  3ZVT A;  4G3W A;  1IYO A;  1PW1 A;  2DNS A;  4DJ2 A;  3KSH A;  4E3M A;  2ZQD A;  3MZD A;  3IF6 B;  4WYY A;  4ME4 A;  1DP9 A;  4XUX A;  1SKO A;  4LCM A;  3UE1 A;  4OP5 A;  2BTF P;  1K54 A;  1UWP X;  3W4Q A;  3LIE A;  3E2L A;  5DF8 A;  5AQB A;  3ZCZ A;  4ZDX A;  5HL1 A;  1N4O A;  4M4X A;  3JPU A;  1NLY A;  1CQA A;  3LCE A;  1JWZ A;  2PT7 A;  4KQD A;  1MWU A;  4F3L A;  1LLB A;  3T1X A;  5TR7 A;  3IBR A;  3SOI A;  4HY8 A;  4KZ9 A;  4K0X A;  1LL8 A;  3V39 A;  4Y3I A;  1D7E A;  3IT9 A;  3MFD A;  4KEN B;  1XA1 A;  4IVK A;  3OCL A;  3IF6 C;  3LR4 A;  4U3T A;  2M7U A;  3VOY A;  3P98 A;  5GLD A;  1LSW A;  3UNW A;  3HLB A;  3NJA A;  5AQA A;  2PBY A;  1GHI A;  4NXE A;  4EUV A;  5FAO A;  1G28 A;  1FIK A;  1T18 A;  4N9L A;  3PBQ A;  1I5Q A;  1O7E A;  3IWI A;  2WKQ A;  4XT2 B;  4EU0 A;  2L0W A;  1KVM A;  2Y2P A;  3KO6 A;  3M6B A;  1M40 A;  3ZHH A;  5KZH A;  3IWO A;  4Z9Q A;  2VZW A;  1YPR A;  4FUW A;  3DTK A;  4OQ0 A;  2VV8 A;  3FKW A;  4O7D A;  3O86 A;  1YLY A;  1GSV A;  4ZJ1 A;  5TGF A;  1BTL A;  1DJB A;  1KDS A;  4KZ4 A;  5EV0 A;  2W3F A;  4QHC A;  5AQ7 A;  4KZ3 A;  4E6X A;  3R7W B;  4NG2 A;  4BEN A;  2EWW A;  2A49 A;  1KE4 A;  5CGW A;  3L7H A;  4GS9 B;  1EWZ A;  4I39 A;  2WKE A;  2VEA A;  1N9O A;  1Z09 A;  3ZG0 A;  1SKO B;  1PWD A;  3PBR A;  4P87 A;  1W8Q A;  4P0M A;  1BUL A;  2JKR I;  4HBT A;  4JPM A;  1T1B A;  4E3I A;  4DDS A;  2ACG A;  1F98 A;  3TG9 A;  2IWD A;  2W0N A;  1I2W A;  3NIA A;  4DE3 A;  4FTX A;  4GCZ A;  1TVF A;  2V0W A;  5FDS A;  5CGX A;  4D2O A;  2XD1 A;  2X02 A;  5F1G A;  3PAE A;  5E2E A;  2VGJ A;  1OTA A;  3D9Y A;  2VGK A;  2PRF A;  2WAE A;  5DKL A;  3M2J A;  4R38 A;  1H3Q A;  5CRF A;  1W79 A;  3OPR A;  5HFO A;  2HF6 A;  1C3B A;  3UO9 A;  2FFF B;  2Y2I A;  1ZG6 A;  3OCN A;  3CZD A;  4Y0O A;  1V9Y A;  4C75 A;  4UA9 A;  3SW1 A;  2A24 B;  2L1M A;  2G2W A;  2EXB A;  1FOF A;  4WF0 A;  1OTI A;  5JYP A;  3S22 A;  3VSK A;  4S2I A;  1IYP A;  1K4E A;  2R9X A;  5FAS A;  4DDY A;  4LFU A;  1GCE A;  3NI9 A;  3LR3 A;  4JGR A;  2XK1 A;  3T4J A;  1XJ6 A;  4GJ4 A;  3UME A;  2J9O A;  1STZ A;  2E8I A;  5EUA A;  3CUE A;  4KZA A;  5TBM A;  5EM0 A;  1N9B A;  2CMN A;  2WKR A;  4E3L A;  3WS1 A;  5FI2 A;  3MQO A;  1IOU A;  1HTZ A;  1GSW A;  1FCN A;  1A0K A;  1PI4 A;  3UB7 A;  1FCM A;  5J7E A;  2WAF A;  3GVB A;  1K25 A;  4WLA A;  4WMC D;  2D01 A;  2EA9 A;  2R9W A;  3DTI A;  1K57 A;  1XGJ A;  1CI9 A;  1T1C A;  3C7U A;  3HLC A;  3WS4 A;  3F1O A;  3ITB A;  3A3I A;  4OQG A;  3CMZ A;  3LIC A;  3G31 A;  4GHI A;  3ZG8 B;  4IED A;  2OWH A;  3BQA A;  4EBN A;  4I5S A;  1MKI A;  2EXA A;  2Y55 A;  2ZM0 A;  1H0M A;  5HWW A;  2Z6C A;  1NZO A;  3RXW A;  3P7N A;  1PRQ A;  5CEB A;  2ZQC A;  3BRM A;  4DKI A;  2IWC A;  1L3L A;  5CEC A;  1PYY A;  4HP4 A;  4LV0 A;  2OV5 A;  2G7U A;  3KYQ A;  3MQQ A;  3FG8 A;  2HDR A;  3HUN A;  4BBU A;  3B3X A;  4BBT A;  1S66 L;  2ZMV A;  3MXS A;  3HLD A;  4OPQ A;  1VM1 A;  3T4O A;  5CGS A;  1V9Z A;  2JKR M;  3K3D A;  2XA7 M;  5CHM A;  4QY5 A;  5FI7 A;  4HH3 A;  4FD8 A;  2Y2G A;  3FKV A;  3HCY A;  4ZJ3 A;  3FPW A;  2V20 A;  3Q81 A;  4JGQ A;  2FH5 A;  4UA7 A;  4X1M A;  2JE5 A;  3WRZ A;  4WZ4 A;  3MZF A;  1TS7 A;  1OTB A;  4I3J A;  4X56 A;  4E04 A;  2EX9 A;  1ZHH B;  4MLL A;  1IYQ A;  2V1Z A;  4HJ3 A;  5HDC A;  1HZO A;  3LID A;  4MBF A;  1ESI A;  3UE6 A;  1N9L A;  1BYW A;  4HH2 A;  5FQM A;  5EEC A;  4DMZ A;  4Y2F A;  2HZ5 A;  2ZC4 B;  3Q1F A;  1FCO A;  3KSG A;  3C8C A;  4GOG A;  1AXB A;  2ZLY A;  3UB5 P;  3FPV A;  5HAR A;  1P9R A;  1K38 A;  3T1Q B;  3VV4 A;  1OT6 A;  4X53 A;  2P04 A;  2HV1 A;  5FL3 A;  4B9O A;  2O9C A;  2QKP A;  4IUH A;  4B88 A;  3BW6 A;  5HW3 A;  3F1O B;  2XRN A;  1NJ4 A;  2NUP C;  3PXP A;  3GEC A;  1L0D A;  2OLV A;  5CTM A;  5F82 A;  5L8M A;  4NEE D;  3JYI A;  3HBR A;  2J3T D;  3Q82 A;  4UAA A;  4WZ5 A;  3G30 A;  1H5X A;  2ZMF A;  2HDU A;  3F1P A;  3IX4 A;  1K6S A;  5BOH A;  1M6K A;  4HES A;  5HSQ A;  5HAI A;  2RL3 A;  3D72 A;  5DTS A;  1F2K A;  2FFY A;  1XFQ A;  2Y2N A;  3A3J A;  1YMX A;  3ZG5 A;  1LI0 A;  3H82 B;  2ZC6 B;  4JLF A;  2AVX A;  3E4P A;  3MKE A;  3BFF A;  3S7Q A;  5HD3 A;  2HP9 A;  3UY6 A;  5FEF A;  3HLG A;  4IUK A;  1K57 C;  3A0S A;  3N8R A;  3CHW P;  5FDH A;  4BMW A;  4L9E A;  2Q9M A;  3B47 A;  3WS2 A;  3OPP A;  3EQV A;  3OZH A;  4BLM A;  5HWT A;  1JVJ A;  1YLP A;  3S7O A;  3A3E A;  4LV3 A;  2QJ7 A;  3LR5 A;  2GDN A;  1KE3 A;  5C5K A;  2M7V A;  2XRO A;  4LV2 A;  2EWV A;  4H6J A;  1RP5 A;  1ES5 A;  2RCX A;  3IH9 A;  4R6L A;  3G35 A;  4FOF A;  4DE0 A;  1PFL A;  4EXO A;  4GKU A;  3MMH A;  2XA7 S;  4OPZ A;  2XDM A;  1I2S A;  2WGV A;  3PBT A;  3IXG A;  5F6A A;  4S2N C;  2XGN A;  1GA0 A;  4CLC C;  1NZU A;  4MDZ A;  4PAU A;  5M1A A;  2VLG A;  4NXF A;  3UE3 A;  3E4Q A;  3P01 A;  4QB8 A;  3KYE A;  4BL3 A;  4DRT A;  1SCW A;  1KGG A;  1W7F A;  3MSH A;  3PBN A;  5EFW A;  2WGW A;  5EOO A;  5TJJ A;  5A90 A;  3L9K A;  4GLQ A;  3ZNY A;  1DY6 A;  1MWT A;  4EQI A;  2OSU A;  3G6O A;  3WWX A;  3IF5 A;  1NY0 A;  5LBR A;  4MBK A;  2ZMA A;  4PHT A;  4I3A A;  5M18 A;  1EW0 A;  4R0Q A;  2QZ6 A;  2D02 A;  3EOI A;  1G6O A;  4PKY G;  2Y2O A;  4NXB A;  1LSV A;  3KX0 X;  4LRX C;  3FZC A;  2XSS A;  1HLU P;  4KQQ A;  1Z6F A;  2X01 A;  3DW0 A;  5EVE A;  2W1R A;  2BG1 A;  1K4F A;  1PWC A;  2JKT I;  4MCW A;  1TEM A;  4KUK A;  4ZJ2 A;  1OTD A;  4ARZ B;  3ZQ5 A;  5CXW A;  4HBU A;  4X55 A;  3T4Q A;  2XH9 A;  3NEC A;  1G5U A;  3LIB A;  2W3H A;  3TJZ C;  3R4K A;  2P08 A;  3QHY A;  3QP1 A;  2W3D A;  3G2Z A;  1MC0 A;  4DJ3 A; 
#chains in the Genus database with same CATH homology
 3O5Y A;  4HQA A;  4LLO B;  4L9G A;  3GDI A;  5F5Y A;  3OCN A;  3ICY A;  3IS2 A;  3S7P A;  3VE4 A;  4R70 A;  1V9Y A;  1JNU A;  3UB8 A;  3SW1 A;  2A24 B;  3FC7 A;  2L1M A;  3VE3 A;  3DBA A;  3HJK A;  1UWN X;  4WF0 A;  1OTI A;  3U2A A;  2YKF A;  4JGO A;  2ZOI A;  4NKP A;  5F68 A;  3BY8 A;  4EES A;  1DP6 A;  4RQ9 A;  3T4L A;  1VB6 A;  2O0Y A;  1F9I A;  3V67 A;  2V1A A;  1XJ2 A;  2PD8 A;  2QJ5 A;  3CI6 A;  3LR3 A;  2PDR A;  4JGR A;  2GNX A;  3OC2 A;  3T4J A;  1XJ6 A;  4GJ4 A;  4Q0H A;  3UME A;  1GSX A;  1STZ A;  1YKD A;  3LI8 A;  5DJU A;  3CUE A;  5TBM A;  2CMN A;  2WKR A;  2LB9 A;  3A0V A;  3JVV A;  5HZH A;  2VA0 A;  3K2N A;  3MQO A;  4B93 A;  2R78 A;  1IOU A;  4GW9 A;  4KUO A;  2K2N A;  3OLO A;  1GSW A;  2VGL S;  3EWK A;  3UB7 A;  3F1N A;  4WEJ A;  1W63 Q;  2WKP A;  3RFB A;  5J7E A;  3LIA A;  5HWV A;  3ULF A;  3H7W B;  1S1Z A;  4XT2 A;  3NOP C;  4WLA A;  4BBV A;  4ETZ A;  3TE8 A;  4LRY C;  2D01 A;  3NOT C;  3UMD A;  1YSQ A;  2EA9 A;  2P7J A;  2Y79 A;  4O01 A;  4YNR A;  1OTE A;  1T1C A;  2NUT C;  3F1O A;  2A2L A;  5DFX A;  4EET B;  3W2Z A;  4G3V A;  4L9F A;  3KSF A;  3F1P B;  3T4T A;  3LIC A;  4GHI A;  2QYB A;  2OWH A;  3H9W A;  3BQA A;  3PR6 A;  3C38 A;  4I5S A;  3R7W A;  2V9A A;  3OOV A;  4EQ1 A;  1IFQ A;  4R3A A;  2Z6D A;  3CWF A;  3E98 A;  5HWW A;  2Z6C A;  1OT9 A;  2LB5 A;  5AVE A;  3P7N A;  4HNB A;  3HJI A;  3MJQ A;  4GS9 A;  3C30 A;  4WEL A;  1MZU A;  1S67 L;  5DJT A;  4LPZ A;  4HP4 A;  4KQO A;  2G7U A;  1VHM A;  3KYQ A;  4HOI A;  3MQQ A;  3FG8 A;  5DKK A;  3K3C A;  1Y28 A;  2PR6 A;  4Z1W A;  4BBU A;  1TD5 A;  5MC7 A;  4BBT A;  2V0U A;  2VV6 A;  1S66 L;  2ZMV A;  2W1T B;  1T1A A;  2PYR A;  5HD5 A;  4WUJ A;  3T4S A;  3UB9 A;  4ETX A;  4F3L B;  3T4O A;  4Y5F A;  4YOF A;  1V9Z A;  4Q0I A;  5KSH A;  2PR5 A;  4P6Z M;  4CLC B;  2JKR M;  2HJE A;  3ZYT A;  3B33 A;  4PKY A;  4QPR A;  3K3D A;  2XA7 M;  4Q0J A;  4HH3 A;  4NXG A;  3BJN A;  4ARZ A;  3IS2 B;  5G4Z A;  3KYZ A;  3HCY A;  3FPW A;  4H6J B;  4WL9 A;  2JKT M;  4G3K A;  4WEK A;  3PBO A;  4JGQ A;  2FH5 A;  2VKS A;  1TS7 A;  1OTB A;  3CAX A;  4I3J A;  3LFV A;  3MXQ A;  4E04 A;  1ZHH B;  3A0R A;  4UEY A;  4LRZ E;  2L4R A;  4HJ3 A;  5HDC A;  5A8B A;  2INW A;  3LID A;  2A24 A;  3UE6 A;  1OPX A;  1N9L A;  1ZTU A;  2M1C A;  3LIF A;  1BYW A;  2OWJ A;  1S4R A;  3LYX A;  4HH2 A;  4OOL A;  4DMZ A;  5AJG A;  2J3T C;  4Y2F A;  2DMW A;  4I38 A;  3LI9 A;  4EW7 A;  3EGD C;  5IS1 A;  1NRJ A;  1OJG A;  2PHY A;  3E4O A;  3UB6 A;  2PYP A;  1MKM A;  3KSG A;  3C8C A;  1TS0 A;  3MFX A;  1KOU A;  4UQI M;  3FPV A;  1P9R A;  1NLZ A;  3F1N B;  3VV4 A;  1ODV A;  5G4Y A;  4JGP A;  1OT6 A;  2PD7 A;  2P04 A;  1N9N A;  2IA2 A;  2YKH A;  4K08 A;  2HV1 A;  2OAQ 1;  5FL3 A;  4B9O A;  2O9C A;  3EEA A;  2QKP A;  1D06 A;  4IJG A;  4IUH A;  2GJ3 A;  3BW6 A;  3EEH A;  3F1O B;  2XRN A;  3PYP A;  2VV7 A;  2NUP C;  1LT0 A;  2MJ6 A;  3VOL A;  3BY9 A;  3PXP A;  3GEC A;  1TS8 A;  3H7W A;  2QWS A;  5J3W A;  1S4S A;  4HP9 A;  5L8M A;  2O9B A;  2OAP 1;  2ZBB A;  4NEE D;  4G3W A;  3OBF A;  4DJ2 A;  1P0Z A;  2J3T D;  3KSH A;  4EEU A;  2ZMF A;  4ME4 A;  1DP9 A;  3F1P A;  2QHK A;  2Y8H A;  3PHY A;  3RTY A;  3T50 A;  5HSQ A;  3D72 A;  2KLI A;  3MR0 A;  1XFQ A;  3EQU A;  2OOL A;  1UWP X;  3NOU C;  5KIZ A;  1T19 A;  1YSP A;  3H82 B;  3S7N A;  3LIE A;  2FZ0 A;  4L0L A;  2ZOH A;  2GZA A;  5IT5 A;  3E4P A;  5CX7 A;  4II7 A;  5HD3 A;  3S7Q A;  2HGV A;  4IUK A;  2W3G A;  3PBS A;  3A0S A;  1X0O A;  4M4X A;  1DRM A;  1NLY A;  1P97 A;  4BMW A;  2K31 A;  4HIA A;  2VJW A;  2KX6 A;  4L9E A;  1XJ3 A;  2PT7 A;  4KQD A;  3B47 A;  5F69 A;  4F3L A;  5AVF A;  3EQV A;  3IBR A;  3T4K A;  1NWZ A;  5HWT A;  4HY8 A;  3S7O A;  5IU1 A;  2GX5 A;  1W63 M;  4FSF A;  4BWI A;  3CIT A;  1TF1 A;  2QJ7 A;  1LL8 A;  3LR5 A;  4Y3I A;  2VGL M;  5C5K A;  1D7E A;  2M7V A;  2XRO A;  4HJ6 A;  2EWV A;  3OCL A;  4H6J A;  5HPI A;  2W27 A;  3LR4 A;  1P9W A;  4OOM A;  1XJ4 A;  4R6L A;  3BWL A;  2M7U A;  5K5B A;  5TBM B;  1LSW A;  2V1B A;  1F5M A;  3RH8 B;  1XFN A;  4FOF A;  4P6Z S;  3NJA A;  4EXO A;  1LSX A;  2XA7 S;  3MMH A;  4NXE A;  2J80 A;  5I5L A;  4EUV A;  3B42 A;  4IHQ A;  1G28 A;  1T18 A;  3PBT A;  3PBQ A;  5F6A A;  3TRC A;  4I3I A;  1OJ5 A;  4MN6 A;  4CLC C;  2JN7 A;  4MDZ A;  4PAU A;  3IBJ A;  2WKQ A;  3C2W A;  3CLO A;  4XT2 B;  4EU0 A;  2L0W A;  4EER A;  2O9A A;  4ZRR A;  1S1Y A;  4HI4 A;  3KO6 A;  2VLG A;  4NXF A;  3UE3 A;  5HDS A;  3E4Q A;  2HJ9 C;  1UGU A;  3P01 A;  2VZW A;  2B02 A;  4HHD A;  3NHQ A;  2VV8 A;  3PBN A;  4MN7 A;  2I9V A;  2KDK A;  4GHI B;  5EFW A;  1GSV A;  4BJP A;  2O99 A;  5TJJ A;  5HPF A;  2W3F A;  4GLQ A;  5HL6 A;  3TW8 A;  4MN5 A;  2J3W A;  2VX8 A;  3R7W B;  3G6O A;  4O0P A;  2KOI A;  3JVU A;  2EWW A;  4HJ4 A;  5LBR A;  4EEP A;  5DFY A;  4PHT A;  4GS9 B;  4I3A A;  4WN5 A;  4I39 A;  1EW0 A;  4CQH A;  2VEA A;  3CUE C;  4AFI A;  1N9O A;  1DP8 A;  4UQI S;  2D02 A;  3EOI A;  1G6O A;  3PBR A;  3E0Y A;  4PKY G;  4NXB A;  4DN0 A;  1LSV A;  2JKR I;  3KX0 X;  4LRX C;  2XSS A;  2JHE A;  4O8G A;  4YWZ A;  1T1B A;  3KSI A;  5HDD A;  4CLC D;  2W3E A;  1F98 A;  2BAS A;  2W1R A;  3EGX C;  2K7S A;  2JKT I;  4MCW A;  4KUK A;  4CLC E;  1H8M A;  1YAX A;  2W0N A;  3BQ8 A;  3MF0 A;  3MQ0 A;  5J4E A;  4GCZ A;  5DF9 A;  1OTD A;  2H28 A;  2V0W A;  4ARZ B;  3ZQ5 A;  3D3O A;  2B18 A;  4MMN A;  3LR0 A;  1OTA A;  3T4Q A;  2W1T A;  3LUQ A;  3LIB A;  3H82 A;  2W3H A;  3TJZ C;  1WA9 A;  3R4K A;  4R38 A;  5DKL A;  1H3Q A;  2P08 A;  4CLC A;  1TS6 A;  2W3D A;  1MC0 A;  4DJ3 A;  2HF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...