4KUKA

A superfast recovering full-length lov protein from the marine phototrophic bacterium dinoroseobacter shibae (dark state)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
119
Chain Sequence
DIADLRALLDEDEAEMSVVFSDPSQPDNPMIYVSDAFLVQTGYTLEEVLGRNCRFLQGPDTNPHAVEAIRQGLKAETFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords blue-light photoreceptor
publication title Structure and function of a short LOV protein from the marine phototrophic bacterium Dinoroseobacter shibae.
pubmed doi rcsb
source organism Dinoroseobacter shibae
molecule tags Signaling protein
total genus 33
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4kukA00
2PR6A 4I5SA 3FC7A 2L0WA 2QJ7A 5IU1A 3KX0X 3LIEA 2VV6A 1JNUA 1TS8A 2L4RA 5HZHA 4BBUA 3H9WA 4NXGA 3BY9A 5TBMB 4EEPA 1GSVA 3F1OA 4H6JB 3F1NA 3RH8B 1S67L 1TS7A 3MFXA 3BY8A 4R3AA 4GCZA 1LSVA 1N9NA 4I3AA 4HI4A 4HQAA 4RQ9A 3E4OA 3GECA 3PYPA 4JGOA 1LSXA 5I5LA 5HSQA 2YKFA 2ZOIA 3UB6A 3UB8A 2WKRA 1OTDA 1OT6A 1N9LA 4EEUA 5A8BA 3MJQA 3H7WB 1OTAA 1V9ZA 1XJ4A 4L9GA 4MN5A 4HHDA 1S4RA 4EERA 4F3LA 3ICYA 3ULFA 4GHIB 3RTYA 3LIBA 2QHKA 2QKPA 1NWZA 2JN7A 1V9YA 1Y28A 3E4PA 3LIFA 1T1CA 1WA9A 1GSXA 1XJ6A 3BWLA 2V0WA 2PYPA 5HD3A 3UMEA 4HOIA 4LRZE 3A0VA 3C8CA 3T50A 1ODVA 1DP9A 1BYWA 3F1OB 4I38A 4NXEA 3F1NB 1XFQA 1P0ZA 2Z6CA 1XFNA 3ZQ5A 4WF0A 5J7EA 4PKYA 2B02A 3IS2A 5DKLA 2OWHA 3C2WA 4I39A 5DJUA 3P7NA 2PDRA 3G6OA 4PKYG 4GS9B 5DKKA 4B9OA 1XJ3A 3F1PA 3LIAA 4M4XA 2V1AA 4JGPA 2J80A 1DRMA 2PYRA 3HJKA 4WL9A 4I3IA 1X0OA 1LT0A 1T1BA 4NXFA 3NOPC 4F3LB 3UE6A 3VE3A 2VV8A 4LRYC 4WN5A 2PD7A 2H28A 1TS6A 2OWJA 1OJGA 2V0UA 1T19A 5IS1A 2ZOHA 1DP6A 2V9AA 2K7SA 5DJTA 4GS9A 1OTEA 1XJ2A 2D01A 1S1ZA 3IBRA 3SW1A 1GSWA 1LL8A 2KDKA 3A0RA 5J3WA 4LRXC 2HV1A 4EESA 5G4YA 3D72A 4JGRA 3NOTC 2KX6A 1LSWA 1T18A 3IS2B 4EETB 3LYXA 3FG8A 2PD8A 4EQ1A 1OTBA 5KIZA 3CLOA 4HH3A 3LI8A 3A0SA 4E04A 3F1PB 5F6AA 5AVEA 3LICA 2PR5A 3HJIA 4HP9A 4R6LA 3CWFA 4K08A 4I3JA 1F98A 3H82A 5HWTA 4HP4A 1EW0A 2W0NA 1OJ5A 1TS0A 1S1YA 4HJ3A 2D02A 3MXQA 3NHQA 2QJ5A 1P97A 5J4EA 1N9OA 3VOLA 4NXBA 3LIDA 4HY8A 2PHYA 2I9VA 5F69A 4KQDA 2M1CA 1UWNX 4HNBA 5F5YA 4JGQA 4BBVA 3VE4A 3MQQA 1UGUA 2R78A 3UB7A 2GJ3A 1OTIA 3LUQA 2INWA 5HWWA 4XT2B 2BASA 2EA9A 2A24A 1KOUA 1D7EA 4HIAA 3MR0A 4L9FA 2VEAA 4WLAA 1S66L 4R70A 2P7JA 4LPZA 1D06A 3PHYA 4EW7A 5EFWA 3EEHA 2VV7A 1F9IA 2V1BA 5TBMA 3H82B 4H6JA 4KUKA 3UMDA 3LI9A 2W27A 3K3CA 4LLOB 5G4ZA 1S4SA 4XT2A 3K3DA 4EXOA 5HD5A 4HH2A 3MQOA 3GDIA 3B33A 4YWZA 4HJ4A 4DJ2A 2VLGA 2JHEA 3E4QA 1OT9A 2L1MA 2ZBBA 4KUOA 5HDSA 4DJ3A 3UB9A 1DP8A 4HJ6A 2QWSA 4L9EA 3NJAA 5AVFA 4BBTA 5HDDA 1VB6A 4GW9A 5HDCA 1G28A 2WKPA 2YKHA 1UWPX 4R38A 1MZUA 3H7WA 3NOUC 1T1AA 3EWKA 5F68A 2CMNA 2OOLA 4MN6A 2WKQA 2A24B 2Z6DA 3CAXA 5HWVA 3OLOA 4WUJA 4GHIA
chains in the Genus database with same CATH superfamily
3CHWP 1TDGA 1LI9A 1DJBA 3NULA 4UA9A 2O0YA 5EECA 5FQMA 1H3QA 3UE0A 3ZG0A 1CEFA 5BOHA 1JNUA 3S22A 1TS8A 2L4RA 3IF6A 3G4PA 2ZMFA 1GSVA 4CPKA 4N1XA 4GJ4A 1PIOA 3GVBA 4WBGA 3RH8B 4QU3A 5EPHA 5GHXA 2IA2A 4X53A 3BY8A 4R3AA 2XD1A 2VA0A 4I3AA 4D60A 3ZG5A 4HI4A 1ZTUA 4HQAA 4RQ9A 4P6BA 3IWIA 4YINA 3PYPA 1N4OA 2PRFA 2Q0OA 4GD6A 3OPHA 1NYMA 4KQQA 3UB8A 2WKRA 4LENA 1OTDA 4S2OA 4OP5A 3ZFZA 3KSGA 1KE0A 3LFVA 1OTAA 1V9ZA 1PNEA 3S4XA 5HAIA 5FQQA 2J9PA 4EERA 3VP3A 4PM7A 1PYYA 2Y2LA 5HPIA 4E3IA 1FR1A 1CI9A 5L8MA 3LIBA 2QHKA 5FQKA 3E2KA 1ONGA 1V9YA 2HJEA 3N8LA 1XGIA 1T1CA 3WS2A 2EWVA 3JYIA 3BWLA 4PAUA 4LRZE 1U60A 2PT7A 2WKIA 4I38A 1XFNA 3WWXA 1ESUA 2HP5A 4IJGA 2XF3A 4K0WA 3PAGA 2WKHA 3DAVA 3IX4A 3PAEA 5FAPA 3C7UA 4LV3A 4EBPA 2PDRA 5TFQA 3TJZC 4FCFA 2OLVA 4Y17A 4Y0UA 5EVID 4WZ4A 3MXRA 5CTMA 3V5MA 4D2OA 2HZ5A 1ALQA 4B9OA 1G5UA 3Q81A 3IXBA 4EUVA 3IX3A 2WUQA 3E0YA 3V39A 4M4XA 1W8QA 2V1AA 2J80A 3VSLA 3KYZA 2PYRA 4WL9A 3HVFA 1K54C 3O5YA 3EQVA 2H0TA 4WMCD 2EX9A 1W63M 2ZL1A 1XGJA 3QNCA 3NOPC 4F3LB 1F2KA 5FI2A 3UE6A 2HDQA 1JTGA 4GDNA 2VV8A 3BQAA 2PD7A 3LR5A 5FI6A 5CERA 5CECA 1XXMA 2OWJA 3GSGA 5L2FA 1Q2PA 2ZOHA 2V9AA 2K7SA 2D01A 3IBRA 3QP8A 1S6RA 1YPRA 5DTTA 4MMNA 5FATA 4ZDXA 1ZG6A 4G3VA 1KDSA 1WYCA 1YLPA 5CEBA 3IS2B 1NZOA 2MJ6A 1MWTA 4KZ8A 5DF7A 3PBSA 4JBFA 3FZCA 2KLIA 1OTBA 1JVJA 2VX8A 2V8FA 4NG2A 2W3FA 3LR0A 1KGEA 3OPLA 3U4LP 3P01A 3CLOA 1IKIA 2Y4AA 2W1RA 3RJUA 3ZG8B 1I2WA 3LI8A 1SCWA 4GOGA 3A0SA 5EOOA 4E04A 1K56A 4Q0JA 5F83A 3F1PB 5F6AA 5AVEA 3HJIA 4DKIA 2WGWB 1WE4A 2Y2NA 1TVFA 2B95A 3HLGA 5F82A 3CMZA 5EOEA 5HWTA 4RA7A 3M2KA 1VQQA 3N8RA 2WK0A 2GX5A 3UDFA 2W3GA 2D02A 1MWRA 3HUOA 2OAP1 1YT4A 5J4EA 3VOLA 4NXBA 1YKDA 3IF6C 2DCFA 2XFTA 5I94A 1C3BA 3MKFA 4R1GA 4U0TA 3VFFA 1NRJA 2WGWA 2P74A 5F5YA 3AGFA 3MQQA 3DTIA 1ES3A 3TE8A 3UB7A 4RX3A 5E2FA 3GRJA 2HPBA 4KZ7A 3MSHA 2P9VB 2A24A 1PWGA 4HIAA 3NCKA 3DTKA 3G30A 1ONHA 3O87A 3MZDA 3G34A 1S66L 3NDGA 3BFFA 1SHVA 2Y55A 2ZMAA 1TEMA 3EEHA 1HZOA 1F9IA 3H82B 3IH9A 2XFSA 1CQAA 2W27A 1S4SA 4CLCE 1VEUB 4R4SA 4HBTA 3MFDA 3T1RA 4GDBA 1CK3A 2J3TC 3MQOA 2XEPA 3GDIA 2A49A 4HJ4A 4XXRA 2ZC3B 4BD0A 1L0DA 1KDWA 2L1MA 2Z2MB 4IUHA 5E2EA 2H0YA 2V2FF 3BYDA 1DP8A 4UHUA 3S7QA 4L9EA 5AVFA 5C5KA 3QP6A 4C3QA 2HDSA 2WKEA 4H8RA 1PZOA 1G68A 2DNSA 4JXVA 5DFYA 3OCNA 1MZUA 3H7WA 3O88A 4GKUA 3ZNYA 2ZM0A 3AGEA 5CXWA 1VEUA 3CUEA 4KG6A 5F68A 2CMNA 4GB7A 4MN6A 4MNRA 2H5SA 4XUXA 5HWVA 3Q7ZA 5E2HA 5AJGA 3FC7A 4Y5FA 1BULA 2QJ7A 5IU1A 5HW3A 5M19A 4Y15A 1RCJA 3NY4A 3HREA 3KSFA 4BBUA 4LV1A 4CLCB 3BY9A 2HP6A 3F1OA 4ARZB 4H6JB 5HFOA 1GHIA 3T1XA 2EWWA 3OPRA 3SH7A 5TR7A 3WS1A 1L0GA 1BLSA 1Z09A 5HAPA 5CGXA 5L09A 3MZEA 3HL9A 4FUWA 2WAFA 4L0LA 2PU2A 5L10A 4DN0A 1N9NA 1E3UA 4MBKA 3DWZA 5FEGA 1G6AA 1IKGA 2W3HA 5CX7A 1STZA 3ZVWA 4O0PA 4JGOA 5I5LA 5HSQA 3UDXA 2YKFA 1IOUA 4N9LA 4PPRA 2ZQ8A 4UQIM 5DTKA 4OH0A 1OT6A 1N9LA 4EEUA 1PWCA 3MJQA 3DTMA 4NKPA 4QJGA 2B18A 4L9GA 4HHDA 4WEKA 3KYEA 4WEJA 1YSPA 5FQIA 1S4RA 5G18A 3ICYA 1VM1A 1NLYA 4GHIB 4K0XA 2QKPA 1NWZA 3BQ8A 2JKTM 3KYQA 1SDEA 4LCMA 5A93A 2EFXA 3LIFA 1XJ6A 3A3IA 3MQ0A 2V0WA 5GL9A 2EX8A 3EGXC 4KZAA 1ZHHB 2ZM8A 2V8CA 3C8CA 1BYWA 2ZMVA 1K6RA 4ID4A 1E25A 3M2JA 4UQIS 1HVBA 1P0ZA 1K38A 3M6HA 5F1GA 3MKEA 3LR3A 3V3SA 2J3TD 4WF0A 4KZ4A 2B02A 3SS5A 3Q7VA 4OQHA 4LV0A 2GNXA 5E43A 4IUKA 5DKLA 3A3EA 1K0KA 3UN7A 5DJUA 2IWCA 3B3XA 3UNWA 5HX9A 4FH2A 3P7NA 4DE2A 4S2IA 3G6OA 1ES4A 5CHMA 1SKFA 3CITA 4OPQA 4B4ZA 2QMIA 1GA9A 4OPZA 3HLWA 2VGLM 4BENA 5HARA 1XJ3A 1BLHA 1S0WA 1DJAA 5GLDA 5AQAA 3UE3A 3T4QA 3GMWA 1BTLA 3SS3A 4QWOA 2Y59A 5FDSA 1YMXA 4LRYC 4WN5A 2H28A 2ZQDA 4Y7PA 4EBLA 2WZZA 4PMAA 2V0UA 5IS1A 4BL2A 5DF8A 2X02A 3U2AA 1XJ2A 1JWPA 1S1ZA 4DXBA 4JXGA 4FTXA 4K91A 3PBQA 1KGFA 1JTDA 5J3WA 2OV5A 1KE3A 2QZ6A 4LRXC 3UO9A 5F1FA 1ACFA 3NIAA 2Y2JA 2VGLS 3HLCA 4JF4A 1CF0A 4II7A 4IVIA 3TG9A 2KX6A 3E98A 2B5RA 2WADA 1T18A 2O9AA 3LYXA 4R0QA 2HDRA 2Q9MA 4EQ1A 4EQIA 2FFFB 2OSUA 4S2PA 1G6OA 4HH3A 1W5DA 5MC7A 2X71A 3T4TA 3JVUA 1L2SA 4PM5A 2FH5A 2UV0E 2JKRM 2VJWA 5GHZA 2PR5A 4HP9A 1FOFA 1YLTA 2EXAA 3CUEC 3IHBA 4JXSA 3CWFA 4I3JA 4FH4A 2HJ9C 2XRNA 4S2KA 2ZL1B 1SDNA 1K56D 1TS0A 1S1YA 1EI5A 4S2MA 3MXQA 3NHQA 2EFUA 4ETZA 4X68A 3M6BA 4E3KA 4Y13A 2QJ5A 1MC0A 1MPLA 2XROA 1Z6FA 1NZUA 3ZNTA 3OC2A 2PHYA 3BECA 3MMHA 5F69A 4WM9A 4KQDA 1J9MA 3P98A 4B4XA 2O99A 4YFMA 2Y2KA 3C5AA 1PFLA 4JKTA 4E3LA 3K2NA 4BQMA 3LY3A 5EM0A 5FAQA 1BLPA 1GHMA 3KSHA 4WYYA 5EUAA 4MN7A 1YLJA 2R78A 2GJ3A 1ERQA 1Q2QA 5EV0A 1FSYA 2INWA 5HWWA 4XT2B 4DF6A 3A3FA 3FPVA 1D7EA 4DE0A 3IXHA 5EVLA 1ES2A 3JVVA 4CLCC 2VEAA 3GQZA 1CEGA 3O86A 5HL6A 2P7JA 1XPBA 2W1TB 2ZQCA 5A90A 1EROA 2Y8HA 2JKGA 4MEZA 2V1BA 4JLFA 5TBMA 3GR2A 1L0EA 3WS5A 4UAAA 4XT2A 2K2NA 1XX2A 2H10A 3NECA 4BMWA 4HH2A 2Y2GA 3G35A 3WRZA 3B33A 3BM6A 2VLGA 3E4QA 5HDSA 4DJ3A 2W1TA 4ZAMA 2XR0A 3GV9A 4OQIA 4HJ6A 2QWSA 3T1QB 4BBTA 4IBXA 4GW9A 1QMEA 4X6TA 2XLNA 4BJPA 2YKHA 1UWPX 2EXBA 1M6KA 3NOUC 5D3OA 5AQ9A 3TOIA 4R3BA 2WGIA 1T1AA 3EWKA 3QHYA 1OPXA 4Z9QA 1RP5A 1KE4A 3HLDA 4R3JA 2A24B 3SS4A 3CAXA 2QPNA 3OLOA 5A92A 5J7EA 1MWUA 4LFUA 1JWZA 1FCMA 5LBRA 1HD8A 2R9WA 4UA6A 2JKFA 1FR6A 3V3RA 2VGKA 3PBTA 2K31A 3VMAA 3LIEA 2VV6A 2AVXA 4WMCA 3WRTA 5HZHA 4OPYA 4KZBA 1VETA 4NXGA 3DWKA 2V20A 3C4OA 3S7OA 1FILA 3F1NA 4MCWA 3AGDA 4KQRA 1K57A 4EUZA 3HLBA 4QY6A 4OKPA 4AFIA 1GHPA 5HAQA 3DTEA 1S67L 4E3OA 3EOIA 3FV7A 3D4FA 1PWDA 3Q1FA 1Y54A 4Z1WA 3VV4A 1W7FA 4P6ZM 3LGOA 3IHAA 1LI0A 3E4OA 1AWIA 2ZM2A 3CJMA 2W3DA 3L9KA 3G32A 1NYYA 2DMWA 3UB6A 4MBHA 1ZKJA 1KVLA 2Y2HA 5HL1A 4KG2A 4DE3A 1E3UD 5CHUA 5A8BA 3FKWA 3OZHA 2VGJA 3H7WB 1EWZA 4Y0OA 1K55A 1XJ4A 1NRFA 4MN5A 3N6IA 4X1LA 2RL3A 2ZQ7A 2ZC5B 4X55A 4CLCD 3VOZA 3BFDA 4RX2A 4JF6A 4OLDA 3ULFA 4HESA 5J8XA 4PM6A 3OPPA 3NC8A 1BUEA 3D9YA 1WA9A 1GSXA 1MKMA 3UE1A 2Y2MA 2GZAA 2ZC7A 1GCEA 1LL5A 5HD3A 2PBDP 4P87A 4HOIA 3A0VA 3T50A 3F1OB 2Z6CA 3W4QA 3S7NA 4BD1A 1LLBA 2Y2IA 1MBLA 4S2JA 3ZQ5A 3W8KA 1K6SA 3IQAA 1YSQA 4ZBEA 4OP8A 3G31A 2WYXA 4ZJ1A 5K5BA 2RCXA 4I39A 3LY4A 3RXXA 3D3OA 4N9KA 3UB5P 4OPRA 4A5RA 4IBRA 2OLUA 2M7VA 1W79A 2P04A 2EX6A 4PM9A 4KZ6A 1FSWA 4JXWA 3IF5A 3MS6A 1H8MA 3LIAA 3RXWA 4JGPA 2PU4A 3BW6A 3FKVA 2LB5A 4EWFA 2X01A 3HCYA 4I3IA 3SH9A 4HEFA 1LT0A 4BLMA 3IXDA 1T1BA 5KMWA 5CRFA 3ZGAB 4NETA 3UPOA 1TD5A 1TS6A 5U47A 1K54A 1OMEA 1OJGA 5DJTA 3PR6A 2ZD8A 4P0MA 3SW1A 1GSWA 4EBNA 2KDKA 4N1HA 4G3KA 4DRTA 3Q82A 2ZQ9A 4NK3A 2HV1A 3TW8A 2J9OA 4Y0TA 4NEED 1KVMA 4IEDA 4GN2A 2V1ZA 3DBAA 4JGRA 3O3VA 3Q7VB 3SOIA 4FD8A 2A3UA 3BLSA 4QY5A 4EETB 4GNUA 4OONA 2G2WA 3FG8A 2G7UA 3VP2A 5JYOA 4MLLA 2BLSA 3ZHHA 1K25A 2A2LA 4QPRA 4CQHA 1WYBA 5FI7A 4S2NA 4JF5A 1NJ4A 3SH8A 3LICA 3ITBA 5FSRA 4CJNA 3PBOA 3MBZA 3PBNA 3R7WB 1H0MA 4R6LA 2JCHA 4C6YA 4X56A 1EW0A 2W0NA 1OJ5A 3VSKA 3BFGA 1ES5A 3VOYA 1ESIA 3OBFA 2O9BA 3MZFA 2C6WB 3CPTB 1FCNA 1SZVA 1XKZA 4E6XA 4B88A 1P97A 1IYSA 4OQGA 4E3NA 1SKOA 1QMFA 2NUTC 1XA7A 3ZDJA 3T12B 1YMSA 3A3DA 3ISGA 2JE5A 2VK3A 2M1CA 1UWNX 4HNBA 2CC1A 2HDUA 3R7WA 4DDYA 4E3MA 1E4DA 1K57C 4GZBA 5FL3A 4JGQA 4U3TA 4BBVA 4DXCA 1NLZA 2J8YA 2Y2PA 1UGUA 3LCEA 1OTIA 3LUQA 5TGFA 5FASA 2BASA 3UPPA 3CPTA 3RFBA 1KOUA 4OLGA 4KENB 2R9XA 4O7DA 4L9FA 5EVEA 1CJFA 1NY0A 3QP1A 5CEDA 1K55C 2C5WB 1D06A 4EW7A 5EFWA 4UA7A 2NUPC 3ZCZA 1IEMA 2Z2LB 3FYZA 4KUKA 3LI9A 1LL9A 3K3CA 4BWIA 1XP4A 3K3DA 4X69A 3IT9A 3IH8A 3V50A 4EXOA 4U0XA 5HD5A 1PI5A 1TF1A 2XK1A 4ZRRA 1H8ZA 4ZJ3A 5A91A 3I7JA 4WZ5A 4DJ2A 5FAOA 1PRQA 4DE1A 2OAQ1 2JHEA 3CG5A 2ZBBA 3HBRA 3WS0A 4KUOA 1YM1A 3UB9A 1TDLA 4Y3IA 1VB6A 2DRWA 4X1MA 2PAVP 3P09A 2WKPA 1ERMA 5AQ7A 5GLCA 3L7HA 3V67A 1RGYA 3SZTA 1I5QA 2OOLA 2PBYA 4KZ9A 2Z6DA 5CGSA 2XA7M 3ITAA 4EU0A 2PR6A 4I5SA 1FQGA 2L0WA 4P85A 5M18A 2ACGA 1IYOA 3KX0X 5GHYA 1NXYA 1F5MA 2VZWA 4UEYA 4KZ5A 3R4KA 4RYEA 3H9WA 4M3KA 5TBMB 4S2LA 4EEPA 3UDIA 5AQBA 1Y4OA 3W4OA 1H5XA 5FA7A 2O9CA 2LB9A 3MXSA 5FQ9A 1N9BA 1TS7A 3MFXA 3T4KA 3BFEA 2EX2A 3C30A 4GCZA 1LSVA 3EGDC 3OCLA 1L0FA 4QD4A 3PTEA 3GECA 1LSXA 3BRMA 3ZYTA 2XA7S 4O8GA 2ZOIA 1PW8A 4JPMA 4ZJ2A 3T1SA 5CGWA 2BTFP 1A0KA 3BFCA 1IYQA 3CZDA 3PXPA 3QP5A 4Y2FA 1ZC2A 1PW1A 3OOVA 3QP4A 1ZG4A 3ZG9B 1DJCA 4F3LA 5EVIB 1BZAA 1MXOA 3BEBA 3RTYA 2J3WA 4MBFA 2WGVA 4S2NC 3S7PA 2JN7A 1Y28A 3E4PA 3EQUA 5TJJA 2ZC4B 5CHJA 3JPUA 2G2UA 1CI8A 4GLQA 1YAXA 2ZLYA 3HUMA 4FSFA 1VHMA 4YOFA 4KQOA 2PYPA 3UMEA 1HTZA 1VETB 2ZJ9A 1W63Q 1ODVA 1DP9A 3C4PA 3HLEA 4NXEA 3F1NB 1XFQA 3VP0A 2XDMA 4PKYA 3NI9A 5EVIA 3MF0A 2JC7A 3IS2A 3FPWA 3UPNA 2OWHA 3C2WA 3T4SA 2KOIA 4LGWA 5KSCA 4PKYG 1P9WA 3HLFA 4DMZA 4X25A 4GS9B 4XUZA 4KZ3A 5DKKA 5DTSA 1HLUP 2GDNA 5IHVA 3KO6A 3F1PA 1H8YA 3LO7A 1DRMA 2ZC6B 3DW0A 3HJKA 1O07A 4ME4A 1X0OA 3VFHA 5JYPA 4LCLA 3W4PA 4NXFA 3ZVTA 2E8IA 3VE3A 3VP4A 3PBRA 2XGNA 3KSIA 5FQJA 2Y79A 1MKIA 1LHYA 2IWDA 2HGVA 1T19A 2FZ0A 3C7VA 1DP6A 4GS9A 1OTEA 4QHCA 5KZHA 3TSGA 1LL8A 2XQZA 4OVDA 4IHQA 3A0RA 4DDSA 3NBLA 3HUNA 5EE8A 4EESA 1IYPA 5G4YA 2HP9A 3QP2A 4OQ0A 2QYBA 3D72A 3B42A 4F94A 3NOTC 2Q9NA 1LSWA 2JKTI 4GD8A 4WZ5C 4ZTKA 2Y91A 2PD8A 5KIZA 2P9VA 1L3LA 3EEAA 3G2YA 4PM8A 4P6ZS 3G2ZA 4IVKA 4Q0HA 1IELA 3N7WA 1I2SA 3N8SA 1IFQA 4HBUA 4E6WA 1PZPA 4FOFA 5IT5A 1K4EA 5GLAA 4K08A 1F98A 3H82A 4HP4A 1W8YA 2J7VA 1M40A 1JWVA 2VKSA 3N4IA 2JBFA 1BT5A 4HJ3A 1YLWA 5FDHA 1MY8A 5CTNA 3W2ZA 1YQSA 2I72A 4WELA 1N9OA 3WS4A 2Y2OA 5DF9A 3LIDA 4HY8A 3B47A 2I9VA 1J3WA 3CI6A 3LR4A 3IXGA 4ESPA 3IWQA 4Q8IA 3A3JA 3IBJA 3QNBA 3VE4A 3T4JA 1O7EA 2E8JA 2IWBA 3IX8A 3Q07A 3S1YA 2W3EA 1FCOA 4Q0IA 5KSHA 5FEFA 2EA9A 4C75A 2UWXA 4KG5A 4MDZA 1BSGA 3BLMA 2ZQAA 1D1JA 1BLCA 5DFXA 2XH9A 1P9RA 3MR0A 3T4OA 4WLAA 4ETXA 1MWSA 4R4RA 4QB8A 1KGGA 4R70A 2P08A 2Y2QA 5M1AA 3ZG7B 1DY6A 4LPZA 4EV4A 4BL3A 3PHYA 4OOLA 1FIKA 2VV7A 3VP1A 2WAEA 1YLZA 3T4LA 4CLCA 3UY6A 3E2LA 4ARZA 4H6JA 3UMDA 2XSSA 5E2GA 4LV2A 4LLOB 5G4ZA 4O01A 4PHTA 1XA1A 4OOYA 2FFYA 4YNRA 1GA0A 3GTCA 1RGZA 2JKRI 1SKOB 5GLBA 3FWLA 4YWZA 4E3JA 3LEZA 1OT9A 4OOMA 3NDEA 2WZXA 5L07A 3NJAA 2BG1A 5HDDA 1K4FA 5EVIC 4G3WA 3IF6B 5HDCA 1G28A 2XD5A 4R38A 3TRCA 5HPFA 4RVAA 1PI4A 5DVAA 4R23A 2M7UA 4N92A 1YLYA 4B93A 3LEQA 5EM1A 3C38A 2HF6A 2WKQA 3IWOA 1AXBA 3BJNA 4WUJA 4GHIA
chains in the Genus database with same CATH topology
5AJGA 4EU0A 2PR6A 5LBRA 4I5SA 3FC7A 2L0WA 4Y5FA 2O0YA 2QJ7A 3PBTA 5IU1A 2K31A 3KX0X 3LIEA 1H3QA 2VV6A 1F5MA 2VZWA 1JNUA 1TS8A 2L4RA 3KSFA 4UEYA 5HZHA 3R4KA 4BBUA 3H9WA 4CLCB 4NXGA 2ZMFA 3BY9A 5TBMB 4EEPA 1GSVA 3F1OA 4ARZB 4H6JB 3S7OA 3F1NA 4GJ4A 4MCWA 2EWWA 2O9CA 2LB9A 3RH8B 4AFIA 1S67L 1TS7A 2IA2A 3MFXA 3T4KA 3EOIA 3BY8A 3C30A 4R3AA 4GCZA 4L0LA 1LSVA 4DN0A 1N9NA 2VA0A 4I3AA 3EGDC 4Z1WA 3VV4A 4P6ZM 4HI4A 1ZTUA 3OCLA 4HQAA 4RQ9A 3E4OA 2W3HA 5CX7A 1STZA 4O0PA 3GECA 2W3DA 3PYPA 4JGOA 1LSXA 5I5LA 3ZYTA 2XA7S 5HSQA 2YKFA 1IOUA 4O8GA 2ZOIA 2DMWA 4UQIM 3UB6A 3UB8A 2WKRA 1OTDA 1OT6A 1N9LA 3KSGA 4EEUA 5A8BA 3LFVA 3MJQA 3H7WB 4NKPA 1OTAA 1V9ZA 1XJ4A 2B18A 3PXPA 4L9GA 4MN5A 4HHDA 4WEKA 4Y2FA 4WEJA 1YSPA 1S4RA 4EERA 3OOVA 4F3LA 4CLCD 5HPIA 3ICYA 1NLYA 3ULFA 4GHIB 5L8MA 2J3WA 3RTYA 3LIBA 2QHKA 2QKPA 1NWZA 3S7PA 3BQ8A 2JKTM 3KYQA 2HJEA 1V9YA 1Y28A 2JN7A 3E4PA 3EQUA 5TJJA 3LIFA 1T1CA 1WA9A 2EWVA 1YAXA 1GSXA 1MKMA 1XJ6A 3BWLA 3MQ0A 2V0WA 4GLQA 2GZAA 4FSFA 1VHMA 3EGXC 4YOFA 4KQOA 2PYPA 5HD3A 4PAUA 3UMEA 1ZHHB 4HOIA 4LRZE 2PT7A 3A0VA 3C8CA 3T50A 1W63Q 1ODVA 1DP9A 1BYWA 2ZMVA 3F1OB 4I38A 4NXEA 4UQIS 3F1NB 1XFQA 1P0ZA 2Z6CA 3S7NA 1XFNA 3LR3A 3ZQ5A 2J3TD 4WF0A 4IJGA 1YSQA 4PKYA 5J7EA 2B02A 3MF0A 3IS2A 3FPWA 5K5BA 2GNXA 4IUKA 5DKLA 2OWHA 3C2WA 4I39A 5DJUA 3D3OA 3T4SA 2KOIA 3P7NA 2PDRA 2M7VA 3G6OA 4PKYG 1P9WA 3TJZC 2P04A 3CITA 4DMZA 4GS9B 5DKKA 2VGLM 4B9OA 3KO6A 4EUVA 1XJ3A 1H8MA 3F1PA 3E0YA 3LIAA 4M4XA 2V1AA 4JGPA 2J80A 3BW6A 2LB5A 1DRMA 3KYZA 2PYRA 3HJKA 3HCYA 4WL9A 3O5YA 4I3IA 3UE3A 4ME4A 3EQVA 1X0OA 3T4QA 1W63M 1LT0A 1T1BA 4NXFA 3NOPC 4F3LB 3UE6A 3VE3A 2VV8A 3BQAA 3PBRA 4LRYC 4WN5A 2PD7A 3LR5A 3KSIA 2H28A 2Y79A 1TD5A 1TS6A 2OWJA 1OJGA 2HGVA 2V0UA 1T19A 5IS1A 2ZOHA 2FZ0A 1DP6A 2V9AA 2K7SA 5DJTA 3PR6A 4GS9A 1OTEA 3U2AA 1XJ2A 2D01A 1S1ZA 3IBRA 3SW1A 1GSWA 1LL8A 2KDKA 4IHQA 3A0RA 4G3KA 3PBQA 5J3WA 4MMNA 4LRXC 2HV1A 4EESA 3TW8A 5G4YA 4NEED 2VGLS 2QYBA 4G3VA 3D72A 3B42A 3DBAA 4II7A 4JGRA 3NOTC 2KX6A 3E98A 1LSWA 2JKTI 1T18A 2O9AA 3IS2B 2MJ6A 4EETB 3LYXA 3PBSA 3FG8A 2KLIA 2PD8A 4EQ1A 1OTBA 2VX8A 5KIZA 2G7UA 2W3FA 3EEAA 3LR0A 3P01A 3CLOA 2W1RA 4P6ZS 1G6OA 4HH3A 3LI8A 2A2LA 4CQHA 4QPRA 4Q0HA 3A0SA 5MC7A 4E04A 3T4TA 3JVUA 1IFQA 4Q0JA 3F1PB 2FH5A 5F6AA 5AVEA 2JKRM 2VJWA 3LICA 2PR5A 3HJIA 4HP9A 3CUEC 3PBOA 4FOFA 3PBNA 3R7WB 5IT5A 4R6LA 3CWFA 4K08A 4I3JA 2HJ9C 2XRNA 1F98A 3H82A 5HWTA 4HP4A 1EW0A 2W0NA 2VKSA 1OJ5A 1TS0A 2GX5A 1S1YA 4HJ3A 2W3GA 2D02A 3MXQA 3NHQA 4ETZA 3OBFA 2O9BA 2OAP1 3W2ZA 2QJ5A 1P97A 1MC0A 4WELA 5J4EA 1N9OA 3VOLA 2XROA 4NXBA 1YKDA 5DF9A 3LIDA 3OC2A 4HY8A 3B47A 2PHYA 2I9VA 2NUTC 3LR4A 3CI6A 3MMHA 5F69A 4KQDA 2M1CA 1NRJA 1UWNX 4HNBA 2O99A 3R7WA 3IBJA 5F5YA 5FL3A 3K2NA 4JGQA 4BBVA 3VE4A 1NLZA 3KSHA 3T4JA 3MQQA 1UGUA 3TE8A 4MN7A 2R78A 3UB7A 2GJ3A 2W3EA 1OTIA 3LUQA 2INWA 5HWWA 4XT2B 2BASA 4Q0IA 5KSHA 3FPVA 2EA9A 4MDZA 3RFBA 2A24A 1KOUA 1D7EA 4HIAA 5DFXA 3JVVA 1P9RA 4CLCC 3MR0A 4L9FA 2VEAA 4WLAA 3T4OA 4ETXA 1S66L 4R70A 2P08A 5HL6A 2P7JA 4LPZA 2W1TB 1D06A 3PHYA 4OOLA 4EW7A 5EFWA 2Y8HA 3EEHA 2VV7A 3T4LA 1F9IA 4CLCA 2NUPC 2V1BA 5TBMA 3H82B 4ARZA 4H6JA 4KUKA 3UMDA 2XSSA 3LI9A 2W27A 3K3CA 4BWIA 4LLOB 5G4ZA 1S4SA 4XT2A 3K3DA 4CLCE 4O01A 4PHTA 2K2NA 4EXOA 5HD5A 4YNRA 4BMWA 4HH2A 2J3TC 1TF1A 4ZRRA 3MQOA 3GDIA 2JKRI 3B33A 4YWZA 4HJ4A 4DJ2A 2VLGA 2OAQ1 2JHEA 3E4QA 1OT9A 2L1MA 2ZBBA 4OOMA 4KUOA 5HDSA 4DJ3A 4IUHA 3UB9A 2W1TA 1DP8A 4HJ6A 2QWSA 3S7QA 4L9EA 3NJAA 5AVFA 5C5KA 4BBTA 4Y3IA 5HDDA 1VB6A 4GW9A 5DFYA 4G3WA 4BJPA 5HDCA 1G28A 2WKPA 2YKHA 1UWPX 4R38A 3OCNA 1MZUA 3H7WA 3NOUC 3V67A 3TRCA 5HPFA 2M7UA 3CUEA 1T1AA 4B93A 3EWKA 5F68A 2CMNA 1OPXA 2OOLA 4MN6A 3C38A 2HF6A 2WKQA 2A24B 3BJNA 2Z6DA 3CAXA 5HWVA 3OLOA 4WUJA 4GHIA 2XA7M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR6 A;  4I5S A;  3FC7 A;  2L0W A;  2QJ7 A;  5IU1 A;  3KX0 X;  3LIE A;  2VV6 A;  1JNU A;  1TS8 A;  2L4R A;  5HZH A;  4BBU A;  3H9W A;  4NXG A;  3BY9 A;  5TBM B;  4EEP A;  1GSV A;  3F1O A;  4H6J B;  3F1N A;  3RH8 B;  1S67 L;  1TS7 A;  3MFX A;  3BY8 A;  4R3A A;  4GCZ A;  1LSV A;  1N9N A;  4I3A A;  4HI4 A;  4HQA A;  4RQ9 A;  3E4O A;  3GEC A;  3PYP A;  4JGO A;  1LSX A;  5I5L A;  5HSQ A;  2YKF A;  2ZOI A;  3UB6 A;  3UB8 A;  2WKR A;  1OTD A;  1OT6 A;  1N9L A;  4EEU A;  5A8B A;  3MJQ A;  3H7W B;  1OTA A;  1V9Z A;  1XJ4 A;  4L9G A;  4MN5 A;  4HHD A;  1S4R A;  4EER A;  4F3L A;  3ICY A;  3ULF A;  4GHI B;  3RTY A;  3LIB A;  2QHK A;  2QKP A;  1NWZ A;  2JN7 A;  1V9Y A;  1Y28 A;  3E4P A;  3LIF A;  1T1C A;  1WA9 A;  1GSX A;  1XJ6 A;  3BWL A;  2V0W A;  2PYP A;  5HD3 A;  3UME A;  4HOI A;  4LRZ E;  3A0V A;  3C8C A;  3T50 A;  1ODV A;  1DP9 A;  1BYW A;  3F1O B;  4I38 A;  4NXE A;  3F1N B;  1XFQ A;  1P0Z A;  2Z6C A;  1XFN A;  3ZQ5 A;  4WF0 A;  5J7E A;  4PKY A;  2B02 A;  3IS2 A;  5DKL A;  2OWH A;  3C2W A;  4I39 A;  5DJU A;  3P7N A;  2PDR A;  3G6O A;  4PKY G;  4GS9 B;  5DKK A;  4B9O A;  1XJ3 A;  3F1P A;  3LIA A;  4M4X A;  2V1A A;  4JGP A;  2J80 A;  1DRM A;  2PYR A;  3HJK A;  4WL9 A;  4I3I A;  1X0O A;  1LT0 A;  1T1B A;  4NXF A;  3NOP C;  4F3L B;  3UE6 A;  3VE3 A;  2VV8 A;  4LRY C;  4WN5 A;  2PD7 A;  2H28 A;  1TS6 A;  2OWJ A;  1OJG A;  2V0U A;  1T19 A;  5IS1 A;  2ZOH A;  1DP6 A;  2V9A A;  2K7S A;  5DJT A;  4GS9 A;  1OTE A;  1XJ2 A;  2D01 A;  1S1Z A;  3IBR A;  3SW1 A;  1GSW A;  1LL8 A;  2KDK A;  3A0R A;  5J3W A;  4LRX C;  2HV1 A;  4EES A;  5G4Y A;  3D72 A;  4JGR A;  3NOT C;  2KX6 A;  1LSW A;  1T18 A;  3IS2 B;  4EET B;  3LYX A;  3FG8 A;  2PD8 A;  4EQ1 A;  1OTB A;  5KIZ A;  3CLO A;  4HH3 A;  3LI8 A;  3A0S A;  4E04 A;  3F1P B;  5F6A A;  5AVE A;  3LIC A;  2PR5 A;  3HJI A;  4HP9 A;  4R6L A;  3CWF A;  4K08 A;  4I3J A;  1F98 A;  3H82 A;  5HWT A;  4HP4 A;  1EW0 A;  2W0N A;  1OJ5 A;  1TS0 A;  1S1Y A;  4HJ3 A;  2D02 A;  3MXQ A;  3NHQ A;  2QJ5 A;  1P97 A;  5J4E A;  1N9O A;  3VOL A;  4NXB A;  3LID A;  4HY8 A;  2PHY A;  2I9V A;  5F69 A;  4KQD A;  2M1C A;  1UWN X;  4HNB A;  5F5Y A;  4JGQ A;  4BBV A;  3VE4 A;  3MQQ A;  1UGU A;  2R78 A;  3UB7 A;  2GJ3 A;  1OTI A;  3LUQ A;  2INW A;  5HWW A;  4XT2 B;  2BAS A;  2EA9 A;  2A24 A;  1KOU A;  1D7E A;  4HIA A;  3MR0 A;  4L9F A;  2VEA A;  4WLA A;  1S66 L;  4R70 A;  2P7J A;  4LPZ A;  1D06 A;  3PHY A;  4EW7 A;  5EFW A;  3EEH A;  2VV7 A;  1F9I A;  2V1B A;  5TBM A;  3H82 B;  4H6J A;  4KUK A;  3UMD A;  3LI9 A;  2W27 A;  3K3C A;  4LLO B;  5G4Z A;  1S4S A;  4XT2 A;  3K3D A;  4EXO A;  5HD5 A;  4HH2 A;  3MQO A;  3GDI A;  3B33 A;  4YWZ A;  4HJ4 A;  4DJ2 A;  2VLG A;  2JHE A;  3E4Q A;  1OT9 A;  2L1M A;  2ZBB A;  4KUO A;  5HDS A;  4DJ3 A;  3UB9 A;  1DP8 A;  4HJ6 A;  2QWS A;  4L9E A;  3NJA A;  5AVF A;  4BBT A;  5HDD A;  1VB6 A;  4GW9 A;  5HDC A;  1G28 A;  2WKP A;  2YKH A;  1UWP X;  4R38 A;  1MZU A;  3H7W A;  3NOU C;  1T1A A;  3EWK A;  5F68 A;  2CMN A;  2OOL A;  4MN6 A;  2WKQ A;  2A24 B;  2Z6D A;  3CAX A;  5HWV A;  3OLO A;  4WUJ A;  4GHI A; 
#chains in the Genus database with same CATH topology
 3CHW P;  1TDG A;  1LI9 A;  1DJB A;  3NUL A;  4UA9 A;  2O0Y A;  5EEC A;  5FQM A;  1H3Q A;  3UE0 A;  3ZG0 A;  1CEF A;  5BOH A;  1JNU A;  3S22 A;  1TS8 A;  2L4R A;  3IF6 A;  3G4P A;  2ZMF A;  1GSV A;  4CPK A;  4N1X A;  4GJ4 A;  1PIO A;  3GVB A;  4WBG A;  3RH8 B;  4QU3 A;  5EPH A;  5GHX A;  2IA2 A;  4X53 A;  3BY8 A;  4R3A A;  2XD1 A;  2VA0 A;  4I3A A;  4D60 A;  3ZG5 A;  4HI4 A;  1ZTU A;  4HQA A;  4RQ9 A;  4P6B A;  3IWI A;  4YIN A;  3PYP A;  1N4O A;  2PRF A;  2Q0O A;  4GD6 A;  3OPH A;  1NYM A;  4KQQ A;  3UB8 A;  2WKR A;  4LEN A;  1OTD A;  4S2O A;  4OP5 A;  3ZFZ A;  3KSG A;  1KE0 A;  3LFV A;  1OTA A;  1V9Z A;  1PNE A;  3S4X A;  5HAI A;  5FQQ A;  2J9P A;  4EER A;  3VP3 A;  4PM7 A;  1PYY A;  2Y2L A;  5HPI A;  4E3I A;  1FR1 A;  1CI9 A;  5L8M A;  3LIB A;  2QHK A;  5FQK A;  3E2K A;  1ONG A;  1V9Y A;  2HJE A;  3N8L A;  1XGI A;  1T1C A;  3WS2 A;  2EWV A;  3JYI A;  3BWL A;  4PAU A;  4LRZ E;  1U60 A;  2PT7 A;  2WKI A;  4I38 A;  1XFN A;  3WWX A;  1ESU A;  2HP5 A;  4IJG A;  2XF3 A;  4K0W A;  3PAG A;  2WKH A;  3DAV A;  3IX4 A;  3PAE A;  5FAP A;  3C7U A;  4LV3 A;  4EBP A;  2PDR A;  5TFQ A;  3TJZ C;  4FCF A;  2OLV A;  4Y17 A;  4Y0U A;  5EVI D;  4WZ4 A;  3MXR A;  5CTM A;  3V5M A;  4D2O A;  2HZ5 A;  1ALQ A;  4B9O A;  1G5U A;  3Q81 A;  3IXB A;  4EUV A;  3IX3 A;  2WUQ A;  3E0Y A;  3V39 A;  4M4X A;  1W8Q A;  2V1A A;  2J80 A;  3VSL A;  3KYZ A;  2PYR A;  4WL9 A;  3HVF A;  1K54 C;  3O5Y A;  3EQV A;  2H0T A;  4WMC D;  2EX9 A;  1W63 M;  2ZL1 A;  1XGJ A;  3QNC A;  3NOP C;  4F3L B;  1F2K A;  5FI2 A;  3UE6 A;  2HDQ A;  1JTG A;  4GDN A;  2VV8 A;  3BQA A;  2PD7 A;  3LR5 A;  5FI6 A;  5CER A;  5CEC A;  1XXM A;  2OWJ A;  3GSG A;  5L2F A;  1Q2P A;  2ZOH A;  2V9A A;  2K7S A;  2D01 A;  3IBR A;  3QP8 A;  1S6R A;  1YPR A;  5DTT A;  4MMN A;  5FAT A;  4ZDX A;  1ZG6 A;  4G3V A;  1KDS A;  1WYC A;  1YLP A;  5CEB A;  3IS2 B;  1NZO A;  2MJ6 A;  1MWT A;  4KZ8 A;  5DF7 A;  3PBS A;  4JBF A;  3FZC A;  2KLI A;  1OTB A;  1JVJ A;  2VX8 A;  2V8F A;  4NG2 A;  2W3F A;  3LR0 A;  1KGE A;  3OPL A;  3U4L P;  3P01 A;  3CLO A;  1IKI A;  2Y4A A;  2W1R A;  3RJU A;  3ZG8 B;  1I2W A;  3LI8 A;  1SCW A;  4GOG A;  3A0S A;  5EOO A;  4E04 A;  1K56 A;  4Q0J A;  5F83 A;  3F1P B;  5F6A A;  5AVE A;  3HJI A;  4DKI A;  2WGW B;  1WE4 A;  2Y2N A;  1TVF A;  2B95 A;  3HLG A;  5F82 A;  3CMZ A;  5EOE A;  5HWT A;  4RA7 A;  3M2K A;  1VQQ A;  3N8R A;  2WK0 A;  2GX5 A;  3UDF A;  2W3G A;  2D02 A;  1MWR A;  3HUO A;  2OAP 1;  1YT4 A;  5J4E A;  3VOL A;  4NXB A;  1YKD A;  3IF6 C;  2DCF A;  2XFT A;  5I94 A;  1C3B A;  3MKF A;  4R1G A;  4U0T A;  3VFF A;  1NRJ A;  2WGW A;  2P74 A;  5F5Y A;  3AGF A;  3MQQ A;  3DTI A;  1ES3 A;  3TE8 A;  3UB7 A;  4RX3 A;  5E2F A;  3GRJ A;  2HPB A;  4KZ7 A;  3MSH A;  2P9V B;  2A24 A;  1PWG A;  4HIA A;  3NCK A;  3DTK A;  3G30 A;  1ONH A;  3O87 A;  3MZD A;  3G34 A;  1S66 L;  3NDG A;  3BFF A;  1SHV A;  2Y55 A;  2ZMA A;  1TEM A;  3EEH A;  1HZO A;  1F9I A;  3H82 B;  3IH9 A;  2XFS A;  1CQA A;  2W27 A;  1S4S A;  4CLC E;  1VEU B;  4R4S A;  4HBT A;  3MFD A;  3T1R A;  4GDB A;  1CK3 A;  2J3T C;  3MQO A;  2XEP A;  3GDI A;  2A49 A;  4HJ4 A;  4XXR A;  2ZC3 B;  4BD0 A;  1L0D A;  1KDW A;  2L1M A;  2Z2M B;  4IUH A;  5E2E A;  2H0Y A;  2V2F F;  3BYD A;  1DP8 A;  4UHU A;  3S7Q A;  4L9E A;  5AVF A;  5C5K A;  3QP6 A;  4C3Q A;  2HDS A;  2WKE A;  4H8R A;  1PZO A;  1G68 A;  2DNS A;  4JXV A;  5DFY A;  3OCN A;  1MZU A;  3H7W A;  3O88 A;  4GKU A;  3ZNY A;  2ZM0 A;  3AGE A;  5CXW A;  1VEU A;  3CUE A;  4KG6 A;  5F68 A;  2CMN A;  4GB7 A;  4MN6 A;  4MNR A;  2H5S A;  4XUX A;  5HWV A;  3Q7Z A;  5E2H A;  5AJG A;  3FC7 A;  4Y5F A;  1BUL A;  2QJ7 A;  5IU1 A;  5HW3 A;  5M19 A;  4Y15 A;  1RCJ A;  3NY4 A;  3HRE A;  3KSF A;  4BBU A;  4LV1 A;  4CLC B;  3BY9 A;  2HP6 A;  3F1O A;  4ARZ B;  4H6J B;  5HFO A;  1GHI A;  3T1X A;  2EWW A;  3OPR A;  3SH7 A;  5TR7 A;  3WS1 A;  1L0G A;  1BLS A;  1Z09 A;  5HAP A;  5CGX A;  5L09 A;  3MZE A;  3HL9 A;  4FUW A;  2WAF A;  4L0L A;  2PU2 A;  5L10 A;  4DN0 A;  1N9N A;  1E3U A;  4MBK A;  3DWZ A;  5FEG A;  1G6A A;  1IKG A;  2W3H A;  5CX7 A;  1STZ A;  3ZVW A;  4O0P A;  4JGO A;  5I5L A;  5HSQ A;  3UDX A;  2YKF A;  1IOU A;  4N9L A;  4PPR A;  2ZQ8 A;  4UQI M;  5DTK A;  4OH0 A;  1OT6 A;  1N9L A;  4EEU A;  1PWC A;  3MJQ A;  3DTM A;  4NKP A;  4QJG A;  2B18 A;  4L9G A;  4HHD A;  4WEK A;  3KYE A;  4WEJ A;  1YSP A;  5FQI A;  1S4R A;  5G18 A;  3ICY A;  1VM1 A;  1NLY A;  4GHI B;  4K0X A;  2QKP A;  1NWZ A;  3BQ8 A;  2JKT M;  3KYQ A;  1SDE A;  4LCM A;  5A93 A;  2EFX A;  3LIF A;  1XJ6 A;  3A3I A;  3MQ0 A;  2V0W A;  5GL9 A;  2EX8 A;  3EGX C;  4KZA A;  1ZHH B;  2ZM8 A;  2V8C A;  3C8C A;  1BYW A;  2ZMV A;  1K6R A;  4ID4 A;  1E25 A;  3M2J A;  4UQI S;  1HVB A;  1P0Z A;  1K38 A;  3M6H A;  5F1G A;  3MKE A;  3LR3 A;  3V3S A;  2J3T D;  4WF0 A;  4KZ4 A;  2B02 A;  3SS5 A;  3Q7V A;  4OQH A;  4LV0 A;  2GNX A;  5E43 A;  4IUK A;  5DKL A;  3A3E A;  1K0K A;  3UN7 A;  5DJU A;  2IWC A;  3B3X A;  3UNW A;  5HX9 A;  4FH2 A;  3P7N A;  4DE2 A;  4S2I A;  3G6O A;  1ES4 A;  5CHM A;  1SKF A;  3CIT A;  4OPQ A;  4B4Z A;  2QMI A;  1GA9 A;  4OPZ A;  3HLW A;  2VGL M;  4BEN A;  5HAR A;  1XJ3 A;  1BLH A;  1S0W A;  1DJA A;  5GLD A;  5AQA A;  3UE3 A;  3T4Q A;  3GMW A;  1BTL A;  3SS3 A;  4QWO A;  2Y59 A;  5FDS A;  1YMX A;  4LRY C;  4WN5 A;  2H28 A;  2ZQD A;  4Y7P A;  4EBL A;  2WZZ A;  4PMA A;  2V0U A;  5IS1 A;  4BL2 A;  5DF8 A;  2X02 A;  3U2A A;  1XJ2 A;  1JWP A;  1S1Z A;  4DXB A;  4JXG A;  4FTX A;  4K91 A;  3PBQ A;  1KGF A;  1JTD A;  5J3W A;  2OV5 A;  1KE3 A;  2QZ6 A;  4LRX C;  3UO9 A;  5F1F A;  1ACF A;  3NIA A;  2Y2J A;  2VGL S;  3HLC A;  4JF4 A;  1CF0 A;  4II7 A;  4IVI A;  3TG9 A;  2KX6 A;  3E98 A;  2B5R A;  2WAD A;  1T18 A;  2O9A A;  3LYX A;  4R0Q A;  2HDR A;  2Q9M A;  4EQ1 A;  4EQI A;  2FFF B;  2OSU A;  4S2P A;  1G6O A;  4HH3 A;  1W5D A;  5MC7 A;  2X71 A;  3T4T A;  3JVU A;  1L2S A;  4PM5 A;  2FH5 A;  2UV0 E;  2JKR M;  2VJW A;  5GHZ A;  2PR5 A;  4HP9 A;  1FOF A;  1YLT A;  2EXA A;  3CUE C;  3IHB A;  4JXS A;  3CWF A;  4I3J A;  4FH4 A;  2HJ9 C;  2XRN A;  4S2K A;  2ZL1 B;  1SDN A;  1K56 D;  1TS0 A;  1S1Y A;  1EI5 A;  4S2M A;  3MXQ A;  3NHQ A;  2EFU A;  4ETZ A;  4X68 A;  3M6B A;  4E3K A;  4Y13 A;  2QJ5 A;  1MC0 A;  1MPL A;  2XRO A;  1Z6F A;  1NZU A;  3ZNT A;  3OC2 A;  2PHY A;  3BEC A;  3MMH A;  5F69 A;  4WM9 A;  4KQD A;  1J9M A;  3P98 A;  4B4X A;  2O99 A;  4YFM A;  2Y2K A;  3C5A A;  1PFL A;  4JKT A;  4E3L A;  3K2N A;  4BQM A;  3LY3 A;  5EM0 A;  5FAQ A;  1BLP A;  1GHM A;  3KSH A;  4WYY A;  5EUA A;  4MN7 A;  1YLJ A;  2R78 A;  2GJ3 A;  1ERQ A;  1Q2Q A;  5EV0 A;  1FSY A;  2INW A;  5HWW A;  4XT2 B;  4DF6 A;  3A3F A;  3FPV A;  1D7E A;  4DE0 A;  3IXH A;  5EVL A;  1ES2 A;  3JVV A;  4CLC C;  2VEA A;  3GQZ A;  1CEG A;  3O86 A;  5HL6 A;  2P7J A;  1XPB A;  2W1T B;  2ZQC A;  5A90 A;  1ERO A;  2Y8H A;  2JKG A;  4MEZ A;  2V1B A;  4JLF A;  5TBM A;  3GR2 A;  1L0E A;  3WS5 A;  4UAA A;  4XT2 A;  2K2N A;  1XX2 A;  2H10 A;  3NEC A;  4BMW A;  4HH2 A;  2Y2G A;  3G35 A;  3WRZ A;  3B33 A;  3BM6 A;  2VLG A;  3E4Q A;  5HDS A;  4DJ3 A;  2W1T A;  4ZAM A;  2XR0 A;  3GV9 A;  4OQI A;  4HJ6 A;  2QWS A;  3T1Q B;  4BBT A;  4IBX A;  4GW9 A;  1QME A;  4X6T A;  2XLN A;  4BJP A;  2YKH A;  1UWP X;  2EXB A;  1M6K A;  3NOU C;  5D3O A;  5AQ9 A;  3TOI A;  4R3B A;  2WGI A;  1T1A A;  3EWK A;  3QHY A;  1OPX A;  4Z9Q A;  1RP5 A;  1KE4 A;  3HLD A;  4R3J A;  2A24 B;  3SS4 A;  3CAX A;  2QPN A;  3OLO A;  5A92 A;  5J7E A;  1MWU A;  4LFU A;  1JWZ A;  1FCM A;  5LBR A;  1HD8 A;  2R9W A;  4UA6 A;  2JKF A;  1FR6 A;  3V3R A;  2VGK A;  3PBT A;  2K31 A;  3VMA A;  3LIE A;  2VV6 A;  2AVX A;  4WMC A;  3WRT A;  5HZH A;  4OPY A;  4KZB A;  1VET A;  4NXG A;  3DWK A;  2V20 A;  3C4O A;  3S7O A;  1FIL A;  3F1N A;  4MCW A;  3AGD A;  4KQR A;  1K57 A;  4EUZ A;  3HLB A;  4QY6 A;  4OKP A;  4AFI A;  1GHP A;  5HAQ A;  3DTE A;  1S67 L;  4E3O A;  3EOI A;  3FV7 A;  3D4F A;  1PWD A;  3Q1F A;  1Y54 A;  4Z1W A;  3VV4 A;  1W7F A;  4P6Z M;  3LGO A;  3IHA A;  1LI0 A;  3E4O A;  1AWI A;  2ZM2 A;  3CJM A;  2W3D A;  3L9K A;  3G32 A;  1NYY A;  2DMW A;  3UB6 A;  4MBH A;  1ZKJ A;  1KVL A;  2Y2H A;  5HL1 A;  4KG2 A;  4DE3 A;  1E3U D;  5CHU A;  5A8B A;  3FKW A;  3OZH A;  2VGJ A;  3H7W B;  1EWZ A;  4Y0O A;  1K55 A;  1XJ4 A;  1NRF A;  4MN5 A;  3N6I A;  4X1L A;  2RL3 A;  2ZQ7 A;  2ZC5 B;  4X55 A;  4CLC D;  3VOZ A;  3BFD A;  4RX2 A;  4JF6 A;  4OLD A;  3ULF A;  4HES A;  5J8X A;  4PM6 A;  3OPP A;  3NC8 A;  1BUE A;  3D9Y A;  1WA9 A;  1GSX A;  1MKM A;  3UE1 A;  2Y2M A;  2GZA A;  2ZC7 A;  1GCE A;  1LL5 A;  5HD3 A;  2PBD P;  4P87 A;  4HOI A;  3A0V A;  3T50 A;  3F1O B;  2Z6C A;  3W4Q A;  3S7N A;  4BD1 A;  1LLB A;  2Y2I A;  1MBL A;  4S2J A;  3ZQ5 A;  3W8K A;  1K6S A;  3IQA A;  1YSQ A;  4ZBE A;  4OP8 A;  3G31 A;  2WYX A;  4ZJ1 A;  5K5B A;  2RCX A;  4I39 A;  3LY4 A;  3RXX A;  3D3O A;  4N9K A;  3UB5 P;  4OPR A;  4A5R A;  4IBR A;  2OLU A;  2M7V A;  1W79 A;  2P04 A;  2EX6 A;  4PM9 A;  4KZ6 A;  1FSW A;  4JXW A;  3IF5 A;  3MS6 A;  1H8M A;  3LIA A;  3RXW A;  4JGP A;  2PU4 A;  3BW6 A;  3FKV A;  2LB5 A;  4EWF A;  2X01 A;  3HCY A;  4I3I A;  3SH9 A;  4HEF A;  1LT0 A;  4BLM A;  3IXD A;  1T1B A;  5KMW A;  5CRF A;  3ZGA B;  4NET A;  3UPO A;  1TD5 A;  1TS6 A;  5U47 A;  1K54 A;  1OME A;  1OJG A;  5DJT A;  3PR6 A;  2ZD8 A;  4P0M A;  3SW1 A;  1GSW A;  4EBN A;  2KDK A;  4N1H A;  4G3K A;  4DRT A;  3Q82 A;  2ZQ9 A;  4NK3 A;  2HV1 A;  3TW8 A;  2J9O A;  4Y0T A;  4NEE D;  1KVM A;  4IED A;  4GN2 A;  2V1Z A;  3DBA A;  4JGR A;  3O3V A;  3Q7V B;  3SOI A;  4FD8 A;  2A3U A;  3BLS A;  4QY5 A;  4EET B;  4GNU A;  4OON A;  2G2W A;  3FG8 A;  2G7U A;  3VP2 A;  5JYO A;  4MLL A;  2BLS A;  3ZHH A;  1K25 A;  2A2L A;  4QPR A;  4CQH A;  1WYB A;  5FI7 A;  4S2N A;  4JF5 A;  1NJ4 A;  3SH8 A;  3LIC A;  3ITB A;  5FSR A;  4CJN A;  3PBO A;  3MBZ A;  3PBN A;  3R7W B;  1H0M A;  4R6L A;  2JCH A;  4C6Y A;  4X56 A;  1EW0 A;  2W0N A;  1OJ5 A;  3VSK A;  3BFG A;  1ES5 A;  3VOY A;  1ESI A;  3OBF A;  2O9B A;  3MZF A;  2C6W B;  3CPT B;  1FCN A;  1SZV A;  1XKZ A;  4E6X A;  4B88 A;  1P97 A;  1IYS A;  4OQG A;  4E3N A;  1SKO A;  1QMF A;  2NUT C;  1XA7 A;  3ZDJ A;  3T12 B;  1YMS A;  3A3D A;  3ISG A;  2JE5 A;  2VK3 A;  2M1C A;  1UWN X;  4HNB A;  2CC1 A;  2HDU A;  3R7W A;  4DDY A;  4E3M A;  1E4D A;  1K57 C;  4GZB A;  5FL3 A;  4JGQ A;  4U3T A;  4BBV A;  4DXC A;  1NLZ A;  2J8Y A;  2Y2P A;  1UGU A;  3LCE A;  1OTI A;  3LUQ A;  5TGF A;  5FAS A;  2BAS A;  3UPP A;  3CPT A;  3RFB A;  1KOU A;  4OLG A;  4KEN B;  2R9X A;  4O7D A;  4L9F A;  5EVE A;  1CJF A;  1NY0 A;  3QP1 A;  5CED A;  1K55 C;  2C5W B;  1D06 A;  4EW7 A;  5EFW A;  4UA7 A;  2NUP C;  3ZCZ A;  1IEM A;  2Z2L B;  3FYZ A;  4KUK A;  3LI9 A;  1LL9 A;  3K3C A;  4BWI A;  1XP4 A;  3K3D A;  4X69 A;  3IT9 A;  3IH8 A;  3V50 A;  4EXO A;  4U0X A;  5HD5 A;  1PI5 A;  1TF1 A;  2XK1 A;  4ZRR A;  1H8Z A;  4ZJ3 A;  5A91 A;  3I7J A;  4WZ5 A;  4DJ2 A;  5FAO A;  1PRQ A;  4DE1 A;  2OAQ 1;  2JHE A;  3CG5 A;  2ZBB A;  3HBR A;  3WS0 A;  4KUO A;  1YM1 A;  3UB9 A;  1TDL A;  4Y3I A;  1VB6 A;  2DRW A;  4X1M A;  2PAV P;  3P09 A;  2WKP A;  1ERM A;  5AQ7 A;  5GLC A;  3L7H A;  3V67 A;  1RGY A;  3SZT A;  1I5Q A;  2OOL A;  2PBY A;  4KZ9 A;  2Z6D A;  5CGS A;  2XA7 M;  3ITA A;  4EU0 A;  2PR6 A;  4I5S A;  1FQG A;  2L0W A;  4P85 A;  5M18 A;  2ACG A;  1IYO A;  3KX0 X;  5GHY A;  1NXY A;  1F5M A;  2VZW A;  4UEY A;  4KZ5 A;  3R4K A;  4RYE A;  3H9W A;  4M3K A;  5TBM B;  4S2L A;  4EEP A;  3UDI A;  5AQB A;  1Y4O A;  3W4O A;  1H5X A;  5FA7 A;  2O9C A;  2LB9 A;  3MXS A;  5FQ9 A;  1N9B A;  1TS7 A;  3MFX A;  3T4K A;  3BFE A;  2EX2 A;  3C30 A;  4GCZ A;  1LSV A;  3EGD C;  3OCL A;  1L0F A;  4QD4 A;  3PTE A;  3GEC A;  1LSX A;  3BRM A;  3ZYT A;  2XA7 S;  4O8G A;  2ZOI A;  1PW8 A;  4JPM A;  4ZJ2 A;  3T1S A;  5CGW A;  2BTF P;  1A0K A;  3BFC A;  1IYQ A;  3CZD A;  3PXP A;  3QP5 A;  4Y2F A;  1ZC2 A;  1PW1 A;  3OOV A;  3QP4 A;  1ZG4 A;  3ZG9 B;  1DJC A;  4F3L A;  5EVI B;  1BZA A;  1MXO A;  3BEB A;  3RTY A;  2J3W A;  4MBF A;  2WGV A;  4S2N C;  3S7P A;  2JN7 A;  1Y28 A;  3E4P A;  3EQU A;  5TJJ A;  2ZC4 B;  5CHJ A;  3JPU A;  2G2U A;  1CI8 A;  4GLQ A;  1YAX A;  2ZLY A;  3HUM A;  4FSF A;  1VHM A;  4YOF A;  4KQO A;  2PYP A;  3UME A;  1HTZ A;  1VET B;  2ZJ9 A;  1W63 Q;  1ODV A;  1DP9 A;  3C4P A;  3HLE A;  4NXE A;  3F1N B;  1XFQ A;  3VP0 A;  2XDM A;  4PKY A;  3NI9 A;  5EVI A;  3MF0 A;  2JC7 A;  3IS2 A;  3FPW A;  3UPN A;  2OWH A;  3C2W A;  3T4S A;  2KOI A;  4LGW A;  5KSC A;  4PKY G;  1P9W A;  3HLF A;  4DMZ A;  4X25 A;  4GS9 B;  4XUZ A;  4KZ3 A;  5DKK A;  5DTS A;  1HLU P;  2GDN A;  5IHV A;  3KO6 A;  3F1P A;  1H8Y A;  3LO7 A;  1DRM A;  2ZC6 B;  3DW0 A;  3HJK A;  1O07 A;  4ME4 A;  1X0O A;  3VFH A;  5JYP A;  4LCL A;  3W4P A;  4NXF A;  3ZVT A;  2E8I A;  3VE3 A;  3VP4 A;  3PBR A;  2XGN A;  3KSI A;  5FQJ A;  2Y79 A;  1MKI A;  1LHY A;  2IWD A;  2HGV A;  1T19 A;  2FZ0 A;  3C7V A;  1DP6 A;  4GS9 A;  1OTE A;  4QHC A;  5KZH A;  3TSG A;  1LL8 A;  2XQZ A;  4OVD A;  4IHQ A;  3A0R A;  4DDS A;  3NBL A;  3HUN A;  5EE8 A;  4EES A;  1IYP A;  5G4Y A;  2HP9 A;  3QP2 A;  4OQ0 A;  2QYB A;  3D72 A;  3B42 A;  4F94 A;  3NOT C;  2Q9N A;  1LSW A;  2JKT I;  4GD8 A;  4WZ5 C;  4ZTK A;  2Y91 A;  2PD8 A;  5KIZ A;  2P9V A;  1L3L A;  3EEA A;  3G2Y A;  4PM8 A;  4P6Z S;  3G2Z A;  4IVK A;  4Q0H A;  1IEL A;  3N7W A;  1I2S A;  3N8S A;  1IFQ A;  4HBU A;  4E6W A;  1PZP A;  4FOF A;  5IT5 A;  1K4E A;  5GLA A;  4K08 A;  1F98 A;  3H82 A;  4HP4 A;  1W8Y A;  2J7V A;  1M40 A;  1JWV A;  2VKS A;  3N4I A;  2JBF A;  1BT5 A;  4HJ3 A;  1YLW A;  5FDH A;  1MY8 A;  5CTN A;  3W2Z A;  1YQS A;  2I72 A;  4WEL A;  1N9O A;  3WS4 A;  2Y2O A;  5DF9 A;  3LID A;  4HY8 A;  3B47 A;  2I9V A;  1J3W A;  3CI6 A;  3LR4 A;  3IXG A;  4ESP A;  3IWQ A;  4Q8I A;  3A3J A;  3IBJ A;  3QNB A;  3VE4 A;  3T4J A;  1O7E A;  2E8J A;  2IWB A;  3IX8 A;  3Q07 A;  3S1Y A;  2W3E A;  1FCO A;  4Q0I A;  5KSH A;  5FEF A;  2EA9 A;  4C75 A;  2UWX A;  4KG5 A;  4MDZ A;  1BSG A;  3BLM A;  2ZQA A;  1D1J A;  1BLC A;  5DFX A;  2XH9 A;  1P9R A;  3MR0 A;  3T4O A;  4WLA A;  4ETX A;  1MWS A;  4R4R A;  4QB8 A;  1KGG A;  4R70 A;  2P08 A;  2Y2Q A;  5M1A A;  3ZG7 B;  1DY6 A;  4LPZ A;  4EV4 A;  4BL3 A;  3PHY A;  4OOL A;  1FIK A;  2VV7 A;  3VP1 A;  2WAE A;  1YLZ A;  3T4L A;  4CLC A;  3UY6 A;  3E2L A;  4ARZ A;  4H6J A;  3UMD A;  2XSS A;  5E2G A;  4LV2 A;  4LLO B;  5G4Z A;  4O01 A;  4PHT A;  1XA1 A;  4OOY A;  2FFY A;  4YNR A;  1GA0 A;  3GTC A;  1RGZ A;  2JKR I;  1SKO B;  5GLB A;  3FWL A;  4YWZ A;  4E3J A;  3LEZ A;  1OT9 A;  4OOM A;  3NDE A;  2WZX A;  5L07 A;  3NJA A;  2BG1 A;  5HDD A;  1K4F A;  5EVI C;  4G3W A;  3IF6 B;  5HDC A;  1G28 A;  2XD5 A;  4R38 A;  3TRC A;  5HPF A;  4RVA A;  1PI4 A;  5DVA A;  4R23 A;  2M7U A;  4N92 A;  1YLY A;  4B93 A;  3LEQ A;  5EM1 A;  3C38 A;  2HF6 A;  2WKQ A;  3IWO A;  1AXB A;  3BJN A;  4WUJ A;  4GHI A; 
#chains in the Genus database with same CATH homology
 5AJG A;  4EU0 A;  2PR6 A;  5LBR A;  4I5S A;  3FC7 A;  2L0W A;  4Y5F A;  2O0Y A;  2QJ7 A;  3PBT A;  5IU1 A;  2K31 A;  3KX0 X;  3LIE A;  1H3Q A;  2VV6 A;  1F5M A;  2VZW A;  1JNU A;  1TS8 A;  2L4R A;  3KSF A;  4UEY A;  5HZH A;  3R4K A;  4BBU A;  3H9W A;  4CLC B;  4NXG A;  2ZMF A;  3BY9 A;  5TBM B;  4EEP A;  1GSV A;  3F1O A;  4ARZ B;  4H6J B;  3S7O A;  3F1N A;  4GJ4 A;  4MCW A;  2EWW A;  2O9C A;  2LB9 A;  3RH8 B;  4AFI A;  1S67 L;  1TS7 A;  2IA2 A;  3MFX A;  3T4K A;  3EOI A;  3BY8 A;  3C30 A;  4R3A A;  4GCZ A;  4L0L A;  1LSV A;  4DN0 A;  1N9N A;  2VA0 A;  4I3A A;  3EGD C;  4Z1W A;  3VV4 A;  4P6Z M;  4HI4 A;  1ZTU A;  3OCL A;  4HQA A;  4RQ9 A;  3E4O A;  2W3H A;  5CX7 A;  1STZ A;  4O0P A;  3GEC A;  2W3D A;  3PYP A;  4JGO A;  1LSX A;  5I5L A;  3ZYT A;  2XA7 S;  5HSQ A;  2YKF A;  1IOU A;  4O8G A;  2ZOI A;  2DMW A;  4UQI M;  3UB6 A;  3UB8 A;  2WKR A;  1OTD A;  1OT6 A;  1N9L A;  3KSG A;  4EEU A;  5A8B A;  3LFV A;  3MJQ A;  3H7W B;  4NKP A;  1OTA A;  1V9Z A;  1XJ4 A;  2B18 A;  3PXP A;  4L9G A;  4MN5 A;  4HHD A;  4WEK A;  4Y2F A;  4WEJ A;  1YSP A;  1S4R A;  4EER A;  3OOV A;  4F3L A;  4CLC D;  5HPI A;  3ICY A;  1NLY A;  3ULF A;  4GHI B;  5L8M A;  2J3W A;  3RTY A;  3LIB A;  2QHK A;  2QKP A;  1NWZ A;  3S7P A;  3BQ8 A;  2JKT M;  3KYQ A;  2HJE A;  1V9Y A;  1Y28 A;  2JN7 A;  3E4P A;  3EQU A;  5TJJ A;  3LIF A;  1T1C A;  1WA9 A;  2EWV A;  1YAX A;  1GSX A;  1MKM A;  1XJ6 A;  3BWL A;  3MQ0 A;  2V0W A;  4GLQ A;  2GZA A;  4FSF A;  1VHM A;  3EGX C;  4YOF A;  4KQO A;  2PYP A;  5HD3 A;  4PAU A;  3UME A;  1ZHH B;  4HOI A;  4LRZ E;  2PT7 A;  3A0V A;  3C8C A;  3T50 A;  1W63 Q;  1ODV A;  1DP9 A;  1BYW A;  2ZMV A;  3F1O B;  4I38 A;  4NXE A;  4UQI S;  3F1N B;  1XFQ A;  1P0Z A;  2Z6C A;  3S7N A;  1XFN A;  3LR3 A;  3ZQ5 A;  2J3T D;  4WF0 A;  4IJG A;  1YSQ A;  4PKY A;  5J7E A;  2B02 A;  3MF0 A;  3IS2 A;  3FPW A;  5K5B A;  2GNX A;  4IUK A;  5DKL A;  2OWH A;  3C2W A;  4I39 A;  5DJU A;  3D3O A;  3T4S A;  2KOI A;  3P7N A;  2PDR A;  2M7V A;  3G6O A;  4PKY G;  1P9W A;  3TJZ C;  2P04 A;  3CIT A;  4DMZ A;  4GS9 B;  5DKK A;  2VGL M;  4B9O A;  3KO6 A;  4EUV A;  1XJ3 A;  1H8M A;  3F1P A;  3E0Y A;  3LIA A;  4M4X A;  2V1A A;  4JGP A;  2J80 A;  3BW6 A;  2LB5 A;  1DRM A;  3KYZ A;  2PYR A;  3HJK A;  3HCY A;  4WL9 A;  3O5Y A;  4I3I A;  3UE3 A;  4ME4 A;  3EQV A;  1X0O A;  3T4Q A;  1W63 M;  1LT0 A;  1T1B A;  4NXF A;  3NOP C;  4F3L B;  3UE6 A;  3VE3 A;  2VV8 A;  3BQA A;  3PBR A;  4LRY C;  4WN5 A;  2PD7 A;  3LR5 A;  3KSI A;  2H28 A;  2Y79 A;  1TD5 A;  1TS6 A;  2OWJ A;  1OJG A;  2HGV A;  2V0U A;  1T19 A;  5IS1 A;  2ZOH A;  2FZ0 A;  1DP6 A;  2V9A A;  2K7S A;  5DJT A;  3PR6 A;  4GS9 A;  1OTE A;  3U2A A;  1XJ2 A;  2D01 A;  1S1Z A;  3IBR A;  3SW1 A;  1GSW A;  1LL8 A;  2KDK A;  4IHQ A;  3A0R A;  4G3K A;  3PBQ A;  5J3W A;  4MMN A;  4LRX C;  2HV1 A;  4EES A;  3TW8 A;  5G4Y A;  4NEE D;  2VGL S;  2QYB A;  4G3V A;  3D72 A;  3B42 A;  3DBA A;  4II7 A;  4JGR A;  3NOT C;  2KX6 A;  3E98 A;  1LSW A;  2JKT I;  1T18 A;  2O9A A;  3IS2 B;  2MJ6 A;  4EET B;  3LYX A;  3PBS A;  3FG8 A;  2KLI A;  2PD8 A;  4EQ1 A;  1OTB A;  2VX8 A;  5KIZ A;  2G7U A;  2W3F A;  3EEA A;  3LR0 A;  3P01 A;  3CLO A;  2W1R A;  4P6Z S;  1G6O A;  4HH3 A;  3LI8 A;  2A2L A;  4CQH A;  4QPR A;  4Q0H A;  3A0S A;  5MC7 A;  4E04 A;  3T4T A;  3JVU A;  1IFQ A;  4Q0J A;  3F1P B;  2FH5 A;  5F6A A;  5AVE A;  2JKR M;  2VJW A;  3LIC A;  2PR5 A;  3HJI A;  4HP9 A;  3CUE C;  3PBO A;  4FOF A;  3PBN A;  3R7W B;  5IT5 A;  4R6L A;  3CWF A;  4K08 A;  4I3J A;  2HJ9 C;  2XRN A;  1F98 A;  3H82 A;  5HWT A;  4HP4 A;  1EW0 A;  2W0N A;  2VKS A;  1OJ5 A;  1TS0 A;  2GX5 A;  1S1Y A;  4HJ3 A;  2W3G A;  2D02 A;  3MXQ A;  3NHQ A;  4ETZ A;  3OBF A;  2O9B A;  2OAP 1;  3W2Z A;  2QJ5 A;  1P97 A;  1MC0 A;  4WEL A;  5J4E A;  1N9O A;  3VOL A;  2XRO A;  4NXB A;  1YKD A;  5DF9 A;  3LID A;  3OC2 A;  4HY8 A;  3B47 A;  2PHY A;  2I9V A;  2NUT C;  3LR4 A;  3CI6 A;  3MMH A;  5F69 A;  4KQD A;  2M1C A;  1NRJ A;  1UWN X;  4HNB A;  2O99 A;  3R7W A;  3IBJ A;  5F5Y A;  5FL3 A;  3K2N A;  4JGQ A;  4BBV A;  3VE4 A;  1NLZ A;  3KSH A;  3T4J A;  3MQQ A;  1UGU A;  3TE8 A;  4MN7 A;  2R78 A;  3UB7 A;  2GJ3 A;  2W3E A;  1OTI A;  3LUQ A;  2INW A;  5HWW A;  4XT2 B;  2BAS A;  4Q0I A;  5KSH A;  3FPV A;  2EA9 A;  4MDZ A;  3RFB A;  2A24 A;  1KOU A;  1D7E A;  4HIA A;  5DFX A;  3JVV A;  1P9R A;  4CLC C;  3MR0 A;  4L9F A;  2VEA A;  4WLA A;  3T4O A;  4ETX A;  1S66 L;  4R70 A;  2P08 A;  5HL6 A;  2P7J A;  4LPZ A;  2W1T B;  1D06 A;  3PHY A;  4OOL A;  4EW7 A;  5EFW A;  2Y8H A;  3EEH A;  2VV7 A;  3T4L A;  1F9I A;  4CLC A;  2NUP C;  2V1B A;  5TBM A;  3H82 B;  4ARZ A;  4H6J A;  4KUK A;  3UMD A;  2XSS A;  3LI9 A;  2W27 A;  3K3C A;  4BWI A;  4LLO B;  5G4Z A;  1S4S A;  4XT2 A;  3K3D A;  4CLC E;  4O01 A;  4PHT A;  2K2N A;  4EXO A;  5HD5 A;  4YNR A;  4BMW A;  4HH2 A;  2J3T C;  1TF1 A;  4ZRR A;  3MQO A;  3GDI A;  2JKR I;  3B33 A;  4YWZ A;  4HJ4 A;  4DJ2 A;  2VLG A;  2OAQ 1;  2JHE A;  3E4Q A;  1OT9 A;  2L1M A;  2ZBB A;  4OOM A;  4KUO A;  5HDS A;  4DJ3 A;  4IUH A;  3UB9 A;  2W1T A;  1DP8 A;  4HJ6 A;  2QWS A;  3S7Q A;  4L9E A;  3NJA A;  5AVF A;  5C5K A;  4BBT A;  4Y3I A;  5HDD A;  1VB6 A;  4GW9 A;  5DFY A;  4G3W A;  4BJP A;  5HDC A;  1G28 A;  2WKP A;  2YKH A;  1UWP X;  4R38 A;  3OCN A;  1MZU A;  3H7W A;  3NOU C;  3V67 A;  3TRC A;  5HPF A;  2M7U A;  3CUE A;  1T1A A;  4B93 A;  3EWK A;  5F68 A;  2CMN A;  1OPX A;  2OOL A;  4MN6 A;  3C38 A;  2HF6 A;  2WKQ A;  2A24 B;  3BJN A;  2Z6D A;  3CAX A;  5HWV A;  3OLO A;  4WUJ A;  4GHI A;  2XA7 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...