4KUKA

A superfast recovering full-length lov protein from the marine phototrophic bacterium dinoroseobacter shibae (dark state)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
120
structure length
119
Chain Sequence
DIADLRALLDEDEAEMSVVFSDPSQPDNPMIYVSDAFLVQTGYTLEEVLGRNCRFLQGPDTNPHAVEAIRQGLKAETFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a short LOV protein from the marine phototrophic bacterium Dinoroseobacter shibae.
pubmed doi rcsb
source organism Dinoroseobacter shibae
molecule tags Signaling protein
molecule keywords blue-light photoreceptor
total genus 33
structure length 119
sequence length 120
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4kukA00
2A24A 4F3LA 1F98A 4R70A 1S1YA 5J7EA 4KUOA 5F68A 5IS1A 3A0VA 1N9LA 2L0WA 1MZUA 4YWZA 2INWA 2KX6A 2Z6CA 3NOTC 4HJ6A 4EXOA 3B33A 3H7WB 2HV1A 2V1AA 1DP8A 5HWTA 3UE6A 4XT2B 4WF0A 1G28A 1ODVA 3UB9A 1XFQA 5DKLA 3F1NB 3C2WA 4E04A 1XJ4A 1TS0A 3LIEA 3LI9A 1D7EA 2ZOHA 4H6JB 2BASA 3FG8A 3ICYA 3IS2B 3LI8A 4WN5A 5EFWA 3ZQ5A 3E4QA 4R38A 3VOLA 4I3AA 3LYXA 1X0OA 5DKKA 3D72A 5HWWA 4EERA 2A24B 2JHEA 4KUKA 1EW0A 3LIFA 1VB6A 4I5SA 3A0RA 4I3IA 4PKYG 3VE3A 1UGUA 1DP9A 2V0WA 4HHDA 1XJ3A 3G6OA 3MQOA 2JN7A 3MJQA 3F1OA 5TBMA 1S4SA 1OTIA 3LIDA 4HNBA 4GS9A 3UMEA 2PR6A 2ZBBA 3H82A 1TS6A 3MFXA 2OWJA 5J4EA 1DP6A 4M4XA 4XT2A 3F1NA 1GSVA 3EWKA 2PYRA 1GSXA 2WKQA 3FC7A 3MXQA 3NHQA 1T1BA 4HI4A 1V9ZA 2QHKA 3F1PB 1BYWA 2VV7A 4GS9B 2EA9A 1T18A 2P7JA 3K3DA 4GHIA 4WUJA 3RTYA 2PYPA 1S4RA 1T1AA 4L9GA 1JNUA 3BY8A 1S66L 4JGPA 4B9OA 5F69A 1OT9A 4LRYC 3UMDA 4EETB 2VV6A 1N9OA 2J80A 1OTDA 2VV8A 2Z6DA 1OTEA 1OTAA 2D01A 4HOIA 5HDCA 3PYPA 2PD8A 4NXEA 4DJ3A 3A0SA 4NXBA 5KIZA 3NOPC 4I3JA 1Y28A 1F9IA 4GHIB 3RH8B 1NWZA 4R3AA 4LRZE 1OT6A 1S67L 3EEHA 2WKRA 3LICA 4HY8A 5DJUA 2GJ3A 3CLOA 1LT0A 4KQDA 3HJKA 4LPZA 3T50A 4EESA 2K7SA 3GECA 2B02A 2ZOIA 3H7WA 2QJ5A 2QJ7A 4JGOA 4WLAA 4EEPA 1P0ZA 4EQ1A 2PHYA 3H82B 4LRXC 4WL9A 3ULFA 1LL8A 1S1ZA 2D02A 2OOLA 2YKFA 3LIAA 1GSWA 5HDSA 5J3WA 5G4YA 2YKHA 5IU1A 2L1MA 3P7NA 4JGQA 3VE4A 2V9AA 3E4PA 4JGRA 5A8BA 4BBVA 1UWNX 2V0UA 3UB7A 5HD5A 4F3LB 3NOUC 1DRMA 5HZHA 4EEUA 4HH3A 3BWLA 4MN6A 2KDKA 2R78A 4RQ9A 1WA9A 3KX0X 5AVFA 3SW1A 1LSVA 3IBRA 4K08A 4HIAA 3UB8A 5F5YA 2QKPA 1KOUA 3OLOA 1T1CA 2VEAA 2WKPA 4LLOB 4HJ3A 3K3CA 2PDRA 5HWVA 1N9NA 1D06A 2OWHA 2PD7A 2W27A 3NJAA 4HQAA 5G4ZA 3C8CA 3CWFA 4DJ2A 1LSWA 1V9YA 4I39A 4EW7A 5HSQA 1LSXA 1T19A 3HJIA 5F6AA 2W0NA 5HD3A 3F1PA 4R6LA 5HDDA 2M1CA 2VLGA 3BY9A 3F1OB 3H9WA 1OTBA 4GW9A 4HP9A 4HP4A 4L9EA 5AVEA 5TBMB 1XFNA 4BBTA 1XJ6A 2I9VA 2L4RA 3PHYA 1UWPX 4PKYA 4HJ4A 3GDIA 4HH2A 3CAXA 3LIBA 4L9FA 4MN5A 1TS7A 1OJ5A 2H28A 4BBUA 4NXFA 2PR5A 4I38A 3MQQA 4NXGA 3LUQA 3UB6A 1P97A 1XJ2A 4GCZA 3IS2A 5I5LA 2V1BA 1TS8A 4H6JA 3MR0A 2QWSA 1OJGA 2CMNA 5DJTA 3E4OA
chains in the Genus database with same CATH superfamily
4F3LA 4KUOA 4HJ6A 4EXOA 5FQKA 2V1AA 4LENA 3ZVWA 3UB9A 1KGEA 3F1NB 5EOOA 1DJCA 4H6JB 3FG8A 4WN5A 5EECA 3D72A 2FFFB 2XF3A 4YFMA 2VGLM 3SH9A 3Q7VA 1CEGA 3F1OA 2PT7A 4LCMA 3CITA 4DXCA 4EUVA 4M4XA 4GS9B 2VZWA 1PRQA 3HUNA 2Y79A 1WYCA 3UMDA 2Z2MB 1M6KA 4ID4A 2EXAA 2EFUA 2HJEA 1U60A 5FQIA 3B47A 4JXSA 4KQQA 4X55A 2Y4AA 2JKGA 3HJKA 4IHQA 4F94A 5HL1A 1K4EA 2ZOIA 4EEPA 1HZOA 3GMWA 1LL8A 3C30A 3IF6C 1YLYA 5G4YA 3IX3A 3P7NA 3ZNTA 4JGQA 3VE4A 2V9AA 4FD8A 2JKTI 1DRMA 2VJWA 5DVAA 4BJPA 2M7VA 2WYXA 3KYQA 4K08A 2ZL1A 1YQSA 5F5YA 3UB8A 1T1CA 4S2JA 4S2OA 1GA9A 2WGWA 4HQAA 5HPFA 2ZMVA 5HDDA 2Y2NA 3NI9A 4UA6A 4IVIA 3TJZC 3IS2A 4GD8A 4MMNA 4QU3A 3PBOA 1K54C 3W4OA 5M19A 5DTKA 4Y15A 2XQZA 3PBTA 3T4LA 3NDGA 1MWSA 4CLCC 3T1QB 2A24B 3JYIA 5GHZA 2V0WA 1K56D 1A0KA 4JKTA 1ONGA 2ZBBA 1TS6A 1RCJA 4CLCD 3FC7A 4R23A 4OOMA 3ZG7B 5K5BA 3WS1A 4DDYA 1JNUA 3BY8A 2JCHA 3UN7A 1LL5A 1BUEA 2V1ZA 3VOYA 1Y28A 2W1TA 3RH8B 3IWQA 4EESA 2DMWA 3H7WA 3CMZA 1XKZA 2Y59A 2L1MA 1UWNX 3BLMA 3M6HA 1AWIA 4RX2A 2RL3A 1E3UD 2Y2JA 4IEDA 3UO9A 3SW1A 5CGSA 1H3QA 4QY6A 1JWPA 4KZ3A 3IQAA 4DJ2A 4UQIS 2XR0A 1ALQA 1PZOA 3F1PA 3H9WA 2WGVA 3PHYA 1PI4A 4L9FA 2E8IA 2JC7A 1L0GA 4KQOA 1TS8A 4NXBA 5FA7A 1EI5A 1MWTA 5EM0A 5EVID 4PHTA 5M1AA 1K0KA 4RA7A 3OPLA 3L9KA 3ZG0A 5JYPA 3QP4A 3BJNA 3AGFA 3EEAA 3T4SA 2W3GA 2GX5A 3ITBA 1ACFA 4EERA 4MCWA 3IX8A 3A3IA 3UDXA 2J3TD 4EBNA 2PR6A 5J4EA 3OPRA 3CZDA 1KGGA 5F82A 2QHKA 1G6AA 4WUJA 4KG6A 2ZQ8A 3NC8A 1XP4A 1OTDA 1ES4A 4BENA 4WMCD 3SH8A 3NOPC 1DJAA 5A91A 3HREA 4O7DA 4KZ6A 4OQGA 4LGWA 1Q2PA 3NBLA 3C4OA 5F1GA 1XXMA 3GECA 2B02A 2Y2GA 1QMEA 3BQAA 1KVLA 3HBRA 1L0DA 3E4PA 3O88A 3B42A 1L3LA 2ZC5B 3DWKA 1PWDA 4PM6A 4DF6A 5AVFA 1LSVA 4X56A 2Z2LB 5HX9A 2HDRA 3LEZA 5G18A 4DE2A 5F6AA 5I94A 4ZAMA 3M2KA 4GW9A 1OTBA 1CQAA 3Q07A 1WYBA 1YM1A 3LIBA 4OOYA 4FOFA 2Q9NA 4Y0UA 4LCLA 4Y3IA 2W3FA 2ZQ9A 3M2JA 2XEPA 3VP4A 3NOTC 2JKRM 3BFCA 4ZRRA 2ZD8A 1XFQA 3PBNA 4DXBA 1D7EA 2ZOHA 4RX3A 3B3XA 5EFWA 3E4QA 2B18A 1N4OA 3VP1A 3L7HA 4MNRA 3EOIA 3LIFA 4I3IA 1ES2A 5E2HA 2ZC7A 3MQOA 1PNEA 1OTIA 5GHXA 4OPQA 4O01A 5CEDA 3R4KA 3TOIA 5BOHA 4N1XA 1K54A 1HTZA 3SZTA 3OCNA 1S6RA 3GTCA 4BL2A 2Y8HA 5DTSA 3IH8A 2ZC6B 3UE1A 4JGOA 2BLSA 3ZDJA 4S2IA 3ULFA 2D02A 5EVEA 5L10A 4BBVA 4E6WA 3NOUC 3NCKA 3PBQA 4E3KA 5GLDA 3N8LA 1ZKJA 2WKPA 3QNCA 4GD6A 4H8RA 1BSGA 5CEBA 2EFXA 4B4ZA 3CWFA 3DTIA 1TEMA 3OPHA 4HP4A 4YINA 3CI6A 1XFNA 4X69A 3MMHA 3CAXA 4BBUA 2PU4A 3NECA 1KE3A 4GKUA 3I7JA 1VEUB 2WAFA 5F68A 3LR5A 1NY0A 3W4PA 1PWCA 3S22A 4AFIA 1G28A 1ODVA 5GLAA 1CEFA 1H8MA 5E2FA 4MBFA 4KUKA 1P9WA 1NYYA 4CPKA 4EBLA 3OCLA 3G30A 1XJ3A 3UMEA 3ZFZA 3N4IA 3MXQA 2PYRA 1GSXA 3G2ZA 4P0MA 1BYWA 1VHMA 3IX4A 1XGIA 5L8MA 1S4RA 2WGWB 4KZ9A 4BQMA 1OT9A 3E0YA 4E3IA 1W8QA 2ZL1B 5HW3A 1I2WA 2O9AA 4GHIB 3LICA 2FH5A 1PYYA 3A3FA 3WWXA 4DDSA 4GN2A 2H5SA 4MLLA 4WLAA 2HPBA 2J8YA 3E2KA 4EUZA 1FCOA 3IBJA 3R7WB 4LRXC 1EWZA 2V0UA 1H8ZA 3MXSA 1PZPA 3MF0A 3O3VA 4BMWA 4WYYA 3TRCA 2DRWA 4UQIM 4HIAA 3OLOA 4B88A 3ZNYA 2LB9A 3MSHA 5FASA 3JPUA 2H0YA 1OPXA 4NETA 2VLGA 4R4SA 3SS3A 4Q0IA 2H28A 2Y2HA 3GV9A 3VSLA 3MR0A 1YMSA 1F98A 2OAQ1 4S2MA 1SKOA 4PM5A 4JF6A 2FZ0A 4WEKA 4WM9A 3VMAA 4E04A 1I5QA 2BASA 2XH9A 2LB5A 4I3AA 2Y91A 4ETZA 5EVIB 4I5SA 3ZG9B 3BEBA 4HHDA 1H5XA 2JN7A 3IXBA 5JYOA 3WRZA 4B4XA 3G35A 4Q0JA 3KYEA 4P6ZM 3T12B 1L2SA 2C5WB 2VV7A 4MN7A 2EA9A 4OLDA 5FI7A 1IYOA 2J80A 2VV8A 1PI5A 2ACGA 2D01A 4S2PA 5AQAA 2V8CA 3WRTA 4HY8A 1BLHA 2EXBA 3T4KA 5FQMA 3OBFA 5EPHA 2YKFA 4OQHA 1IYSA 2Y2MA 2PU2A 1Z09A 3IF6A 3OOVA 1ZG4A 5GLBA 5CTMA 5C5KA 2Y2KA 1ERMA 4P85A 1KOUA 3A3DA 3CUEA 1LLBA 5AQ7A 3MZFA 4X6TA 3FKVA 3C8CA 1V9YA 2ZJ9A 1T19A 2X02A 4NK3A 5FQ9A 4BBTA 2ZM2A 5AQBA 3UE0A 4BLMA 2GDNA 3VFFA 1IKGA 5I5LA 4C3QA 2WAEA 4OQ0A 4NEED 3UDIA 5DFXA 5J7EA 2L0WA 2INWA 4GDBA 3H7WB 2HV1A 4U0XA 4NG2A 4BD0A 4UHUA 4M3KA 3ICYA 3ZQ5A 3DTMA 3U2AA 1UGUA 3ZG5A 1K6RA 4LV3A 4R0QA 2XDMA 5KZHA 3ZCZA 1DP6A 3SOIA 5AJGA 1GHMA 2NUTC 1JWZA 2P7JA 4RVAA 3A3JA 1N9OA 3T4TA 2J9PA 3LY3A 4E3JA 3E2LA 4GNUA 3P09A 5DJUA 1JVJA 2EWWA 2JE5A 1Y54A 1LT0A 1TF1A 4FH4A 1N9BA 5GHYA 5A8BA 1YLJA 2WKEA 4DMZA 1BTLA 4QD4A 2PD7A 5LBRA 3IXGA 3OC2A 5HAPA 2V20A 2W3HA 4R6LA 1XJ6A 1JWVA 1GHIA 2IWCA 3MQQA 3MZEA 5DFYA 4ME4A 1W63M 1MZUA 2OLUA 3QP6A 4RYEA 2O9BA 5CTNA 4R3BA 1K57C 4QHCA 2RCXA 4BWIA 3CHWP 3FPWA 4WMCA 3IS2B 1YPRA 4R4RA 3WS2A 4C75A 4G3VA 1Z6FA 1VETB 4PKYG 2XA7S 4WZ5C 3SS5A 5TBMA 4Y2FA 1S4SA 2VGKA 1K38A 5E2GA 3MFXA 2WKQA 2PBDP 3RFBA 2G2WA 3G2YA 1ES5A 5A93A 3S1YA 2W1TB 3RTYA 1EROA 4L9GA 4P6ZS 1S66L 3IXHA 4HOIA 1OTEA 2R9XA 4FUWA 5L07A 3A0SA 5FSRA 4E6XA 3N6IA 4KZAA 3EEHA 1YMXA 3WS4A 2QJ5A 4KQRA 2EX8A 3LY4A 5HDSA 3QP2A 5IU1A 2MJ6A 5D3OA 2V2FF 1PW1A 2WK0A 1ZG6A 2FFYA 1FSWA 4IUHA 2VGLS 1VM1A 1D06A 3NJAA 3C7UA 3EGDC 1W79A 3O5YA 4N9KA 2DNSA 5IS1A 2WADA 3BYDA 5IT5A 3K2NA 3VOZA 3CG5A 4NXFA 4N9LA 4NXGA 4H6JA 4R70A 3UPNA 4KZ7A 3TG9A 3A0VA 2EX6A 3IF5A 4OLGA 4YWZA 3D9YA 3PAGA 5DF7A 1SCWA 2GNXA 4IBXA 1O07A 3BFGA 3T1SA 1RGYA 5KSHA 4DN0A 5HWWA 3T4OA 1HLUP 2XSSA 2P04A 3QHYA 3M6BA 1W63Q 4PAUA 4C6YA 3LIDA 4ZJ3A 4HNBA 4EV4A 4QY5A 4CLCA 2XROA 3HLEA 3TE8A 4XT2A 1KE0A 3OPPA 3DW0A 1GCEA 3KO6A 2PYPA 4KG2A 3FYZA 4OQIA 4KG5A 1K6SA 5EUAA 1VQQA 5HPIA 5E43A 3HLDA 1IFQA 3CPTB 4LRZE 5KMWA 3HLFA 3BFEA 2CC1A 1KDWA 5L2FA 3ZHHA 2H0TA 1K25A 2PAVP 3HUOA 2KDKA 3IBRA 2VEAA 4O0PA 1N9NA 2XFTA 3HLWA 4Y0TA 1LSWA 3HJIA 4DRTA 4ARZA 3NULA 1G68A 5CX7A 5TBMB 1ZC2A 3VP3A 5HAQA 1C3BA 3FZCA 5F83A 3MKEA 3MQ0A 3IWIA 5EM1A 3HCYA 4HESA 5FI6A 4ZJ1A 2JBFA 4GDNA 2R9WA 4LV0A 2HJ9C 3MZDA 3V67A 5E2EA 4L0LA 4UEYA 4P6BA 3LR0A 3VP0A 2X71A 5DKLA 4E3NA 3LR4A 2P08A 1BLPA 3G4PA 3VOLA 3QP8A 1X0OA 2JHEA 1EW0A 1FILA 4OPZA 3N8RA 4BD1A 3PBSA 3H82A 1XA1A 2OWJA 1ES3A 2HF6A 1FOFA 2UWXA 3BECA 2HDSA 2Y55A 4Y17A 3IHAA 1MXOA 3Q7ZA 2HDUA 4ZBEA 2P9VB 2WGIA 3UB5P 1S67L 3LGOA 2WKRA 4PMAA 4PPRA 2GJ3A 4HEFA 3CLOA 4IJGA 1H8YA 1MKIA 2PHYA 1SHVA 4ZJ2A 1VETA 1K4FA 5M18A 1LI0A 3DTEA 2HGVA 1YSPA 4KZ5A 4EEUA 3BWLA 3OZHA 3S7QA 4LLOB 4E3OA 3K3CA 1MPLA 5AQ9A 1LL9A 2Y2LA 3JVVA 4JXVA 2V8FA 1BLSA 1MY8A 3ZG8B 4OP8A 1SKOB 4HH2A 4MN5A 1TS7A 2PR5A 4I38A 1HVBA 3IT9A 5CHUA 3EGXC 4NKPA 2ZM0A 5GLCA 3GRJA 2B5RA 5DJTA 4BL3A 1N9LA 3LEQA 1XGJA 4Q0HA 5CECA 4X1MA 1PIOA 3P01A 3C2WA 1J3WA 5KSCA 4Q8IA 4K0XA 3PR6A 4WZ5A 3BFFA 3IWOA 1GA0A 3G6OA 4JXWA 4Z9QA 3R7WA 1MBLA 2EWVA 1T1BA 3VP2A 2O99A 1Q2QA 4P87A 3G32A 1T1AA 4GLQA 4CLCE 3IF6B 3SH7A 2PD8A 2G2UA 4WELA 3TSGA 3QNBA 1OT6A 2UV0E 4OVDA 2E8JA 3KSFA 1PW8A 2XGNA 2ZMFA 3VSKA 1G6OA 4FTXA 5J3WA 4Y13A 2YKHA 3W4QA 2JKFA 1ZTUA 3O86A 1ESIA 4HBUA 3NIAA 3VFHA 3LCEA 4PM7A 2R78A 1FQGA 4QPRA 3HVFA 1NZOA 3W2ZA 3WS5A 3SS4A 3RJUA 5EVIC 4EU0A 2XLNA 1LSXA 2QYBA 2VGJA 2I9VA 3UNWA 4FCFA 4G3KA 4KZ4A 4MBKA 4UAAA 2Q0OA 3LUQA 2V1BA 1KVMA 3S7OA 4D2OA 2VA0A 3KSIA 2KX6A 1KDSA 1P9RA 3DBAA 3GQZA 3GSGA 3IHBA 2EX2A 5FATA 1KGFA 1XJ4A 1TS0A 3UY6A 1KE4A 5CXWA 4OPRA 1CJFA 4R3JA 2ZC4B 3PBRA 3C38A 3Q82A 4R1GA 5HFOA 5DF9A 4Y7PA 1F2KA 1RGZA 5L09A 3GR2A 4QJGA 1GSVA 3EWKA 5HL6A 2HP9A 1V9ZA 3F1PB 2XD5A 4GOGA 4S2NA 3MKFA 4U3TA 4LRYC 2VV6A 3Q81A 2Z6DA 5FAPA 2OV5A 3AGDA 5A90A 5J8XA 3C5AA 3IXDA 3N7WA 1YLZA 2A3UA 4GJ4A 4EQ1A 1S1ZA 4ARZB 3S7NA 3U4LP 4KZ8A 1XPBA 1M40A 4N1HA 4HH3A 2P9VA 4MN6A 4RQ9A 3ZYTA 5CHJA 1HD8A 3AGEA 4KZBA 2ZC3B 1NRJA 3BY9A 3ISGA 4U0TA 3GDIA 3HUMA 1E3UA 2ZM8A 3S4XA 5TGFA 3UB6A 1XJ2A 5EV0A 4GCZA 2WZXA 4FSFA 3T4QA 2CMNA 3E4OA 2A24A 1S1YA 2VKSA 1K55C 2AVXA 2Z6CA 3PAEA 5FQQA 2IWDA 4Y0OA 3KSHA 4PM8A 5HWTA 4WEJA 2W1RA 5FDSA 3D4FA 1VEUA 5TJJA 3LIEA 3LI9A 4LV2A 4OPYA 4FH2A 3T1RA 1OMEA 4CQHA 3LYXA 5DKKA 3O87A 5EVLA 3MS6A 4JXGA 3VE3A 2A2LA 1LHYA 3A0RA 1TVFA 3MJQA 4GB7A 3Q1FA 1G5UA 2XD1A 5HAIA 3F1NA 3NHQA 4HI4A 3ITAA 1TDLA 1YLWA 4GHIA 3RXWA 4K0WA 1YAXA 5GL9A 3DTKA 3UE3A 1ZHHB 2HDQA 2P74A 4HBTA 1YSQA 4EWFA 2ZQDA 1FR1A 4R3AA 1MKMA 1L0FA 1STZA 1CK3A 3A3EA 2QJ7A 1ERQA 5FEGA 3HLCA 4XUZA 3N8SA 1GSWA 1E25A 2DCFA 4ESPA 3V3RA 3KX0X 1SDEA 3BQ8A 4MBHA 1IYPA 5FDHA 1PFLA 4OONA 2C6WB 2BTFP 4HJ3A 4DE1A 1W7FA 2NUPC 1CI8A 3MBZA 2X01A 3MXRA 3ZVTA 1FSYA 1OJ5A 3VV4A 4DE3A 5FAQA 3EQVA 4HP9A 1MWUA 1SZVA 1BULA 4CJNA 1BT5A 3FKWA 4IBRA 3DAVA 4II7A 3IH9A 1FIKA 3PTEA 3G34A 3FV7A 1S0WA 2J7VA 3NY4A 5U47A 1I2SA 3CJMA 2J9OA 3RXXA 1VB6A 1DP9A 2H10A 4QB8A 1WE4A 5EOEA 1NLYA 4OH0A 3LR3A 1TDGA 1GHPA 1T18A 3K3DA 1FR6A 1DJBA 2J3WA 3DWZA 1ONHA 1FCNA 3EQUA 4B9OA 3BW6A 2HP5A 1MWRA 5HDCA 5IHVA 1NXYA 1K55A 4DJ3A 2J3TC 1F9IA 5A92A 2G7UA 1J9MA 4YOFA 2Q9MA 1L0EA 3H82B 1NRFA 2Y2OA 3P98A 3UB7A 4F3LB 4QWOA 5MC7A 2B95A 2IA2A 5HARA 3V39A 2KOIA 4UA7A 5G4ZA 4I39A 2IWBA 4X25A 1DY6A 1K56A 5HD3A 2M1CA 3PXPA 1SDNA 4X68A 4DE0A 1BLCA 2A49A 2Y2PA 3BFDA 3BLSA 4IVKA 2JKTM 3QP1A 2VX8A 4XXRA 2HZ5A 2QWSA 1OJGA 2KLIA 5FQJA 2VK3A 1CI9A 5DTTA 4D60A 2XRNA 5FL3A 3CUEC 1CF0A 5CERA 1DP8A 4DKIA 4XT2B 4WF0A 3V3SA 1JTDA 5FEFA 3D3OA 1NZUA 5CGWA 3W8KA 4R38A 3T1XA 4Z1WA 4ETXA 1H0MA 4YNRA 3WS0A 2GZAA 1YLTA 2ZQCA 3S7PA 2ZLYA 4XUXA 2WUQA 2ZMAA 4O8GA 5CRFA 2XFSA 5CHMA 1JTGA 1IEMA 1ESUA 3FPVA 2OSUA 1Y4OA 3JVUA 2OAP1 4JGPA 4WZ4A 5KIZA 2EX9A 1TD5A 1LI9A 4JPMA 4MEZA 1XX2A 1BZAA 3V50A 4JLFA 4KQDA 2K7SA 3TW8A 1P0ZA 3T4JA 4CLCB 2OOLA 3LIAA 4S2NC 2OLVA 2Y2QA 1AXBA 3KSGA 4JGRA 3Q7VB 1W8YA 5HD5A 3E98A 4E3LA 5HZHA 5TFQA 1WA9A 4GZBA 2W3EA 5FI2A 2QKPA 4S2LA 4KENB 5HWVA 2OWHA 3LFVA 4ZTKA 2ZQAA 2JKRI 4B93A 4EW7A 4UA9A 3UPPA 2W0NA 4L9EA 5AVEA 5F1FA 2L4RA 1XA7A 4HJ4A 1YKDA 2M7UA 2WKIA 4Y5FA 4WBGA 4OKPA 4EBPA 2HP6A 2O9CA 5F69A 5FAOA 4LFUA 1PWGA 1YT4A 3MFDA 3B33A 4OP5A 3UE6A 3QP5A 4X53A 4MDZA 3LI8A 1NJ4A 1SKFA 1O7EA 5DF8A 5EVIA 3NDEA 4PM9A 2WZZA 4EQIA 4GS9A 2K2NA 2XA7M 1QMFA 3UDFA 1D1JA 1RP5A 3G31A 2PRFA 4JF4A 3FWLA 1IKIA 3GVBA 2W3DA 4IUKA 4E3MA 4EETB 2O0YA 1OTAA 4LV1A 3PYPA 4NXEA 3BM6A 2XK1A 3ZGAB 4I3JA 4X1LA 1NWZA 3LO7A 2K31A 1IELA 1IYQA 4LPZA 3V5MA 5EE8A 3T50A 1NLZA 3BRMA 1NYMA 4WL9A 3HLGA 3CPTA 1FCMA 3HL9A 4ZDXA 2WKHA 1F5MA 4S2KA 5TR7A 4A5RA 3UPOA 4K91A 3C7VA 1W5DA 2QMIA 4JF5A 3C4PA 2Y2IA 4JBFA 1MC0A 2PBYA 2PDRA 5CGXA 4N92A 2QZ6A 2W27A 2BG1A 1YLPA 5HSQA 1E4DA 4G3WA 2ZQ7A 3F1OB 4PKYA 1UWPX 1K57A 1IOUA 4OOLA 2I72A 2QPNA 1P97A 3HLBA 3KYZA
chains in the Genus database with same CATH topology
2A24A 4F3LA 4R70A 1S1YA 2VKSA 4KUOA 5F68A 3A0VA 3LR5A 4YWZA 2Z6CA 4HJ6A 4EXOA 3KSHA 2V1AA 5HWTA 2GNXA 4WEJA 2W1RA 4AFIA 1G28A 1ODVA 3UB9A 3F1NB 5TJJA 3LIEA 3LI9A 4H6JB 3FG8A 1H8MA 4WN5A 5KSHA 4DN0A 4CQHA 3LYXA 5DKKA 5HWWA 3D72A 4KUKA 3T4OA 2XSSA 1P9WA 2P04A 2VGLM 3VE3A 2A2LA 3A0RA 3OCLA 1W63Q 1XJ3A 4PAUA 3MJQA 3F1OA 3LIDA 2PT7A 4HNBA 3UMEA 4CLCA 3CITA 2XROA 4EUVA 4M4XA 3TE8A 4XT2A 3F1NA 3NHQA 3MXQA 2PYRA 1GSXA 4HI4A 1BYWA 1VHMA 4GS9B 3KO6A 4GHIA 5L8MA 2PYPA 1YAXA 1S4RA 2VZWA 3UE3A 1OT9A 2Y79A 3UMDA 3E0YA 1ZHHB 1YSQA 2HJEA 5HPIA 2O9AA 4GHIB 1IFQA 4R3AA 3B47A 4LRZE 3LICA 2FH5A 1MKMA 1STZA 3HJKA 4IHQA 2ZOIA 2QJ7A 4WLAA 4EEPA 4LRXC 3IBJA 3R7WB 1LL8A 3C30A 1GSWA 5G4YA 3P7NA 4JGQA 3VE4A 2V9AA 2V0UA 2JKTI 1DRMA 2VJWA 3MF0A 4BMWA 4BJPA 2M7VA 3TRCA 2KDKA 3KX0X 4UQIM 3BQ8A 3KYQA 3IBRA 4K08A 4HIAA 3UB8A 5F5YA 3OLOA 1T1CA 2VEAA 4O0PA 4HJ3A 1N9NA 2LB9A 4HQAA 2NUPC 1LSWA 5HPFA 1OPXA 2ZMVA 3HJIA 4ARZA 5HDDA 2VLGA 5CX7A 5TBMB 4Q0IA 1OJ5A 2H28A 3VV4A 3TJZC 3MQ0A 3HCYA 3EQVA 3IS2A 3MR0A 4HP9A 1F98A 2HJ9C 2OAQ1 4MMNA 3PBOA 3V67A 4L0LA 2FZ0A 4UEYA 4WEKA 4II7A 3LR0A 3PBTA 3T4LA 5DKLA 4E04A 3LR4A 2P08A 2BASA 2LB5A 3VOLA 4I3AA 1X0OA 4CLCC 2A24B 2JHEA 1EW0A 4ETZA 4I5SA 1VB6A 1DP9A 2V0WA 4HHDA 2JN7A 1NLYA 3PBSA 2ZBBA 3H82A 1TS6A 2OWJA 4CLCD 3LR3A 2HF6A 4Q0JA 4P6ZM 3FC7A 4OOMA 4MN7A 2VV7A 2EA9A 1T18A 3K3DA 2J3WA 5K5BA 1JNUA 3BY8A 3EQUA 4B9OA 3BW6A 2J80A 2VV8A 2D01A 5HDCA 4DJ3A 2J3TC 1F9IA 1Y28A 2W1TA 3RH8B 1S67L 2WKRA 4HY8A 2GJ3A 3CLOA 2G7UA 4EESA 4YOFA 2DMWA 3H7WA 4IJGA 3T4KA 2PHYA 3H82B 3OBFA 2YKFA 2L1MA 2HGVA 1YSPA 1UWNX 3UB7A 4F3LB 3OOVA 4EEUA 5MC7A 2IA2A 3BWLA 5C5KA 3SW1A 2KOIA 3S7QA 1KOUA 1H3QA 3CUEA 4LLOB 3K3CA 5G4ZA 3C8CA 3JVVA 4DJ2A 1V9YA 4I39A 4UQIS 1T19A 5HD3A 3F1PA 2M1CA 3H9WA 3PXPA 4BBTA 3PHYA 4HH2A 4MN5A 4L9FA 1TS7A 2PR5A 4I38A 2JKTM 4KQOA 2VX8A 3EGXC 4NKPA 5I5LA 1TS8A 4NXBA 2QWSA 4NEED 1OJGA 2KLIA 5DJTA 4PHTA 5DFXA 5J7EA 1N9LA 2L0WA 2INWA 4Q0HA 2XRNA 5FL3A 3H7WB 2HV1A 3CUEC 1DP8A 4XT2B 4WF0A 3BJNA 3P01A 3C2WA 3EEAA 3T4SA 2W3GA 2GX5A 3D3OA 3ICYA 3ZQ5A 4R38A 4Z1WA 4EERA 4ETXA 3PR6A 4MCWA 4YNRA 3U2AA 2GZAA 3S7PA 1UGUA 3G6OA 2J3TD 2PR6A 3R7WA 4O8GA 5J4EA 1DP6A 2EWVA 5AJGA 1T1BA 2NUTC 2QHKA 2O99A 3FPVA 2P7JA 4WUJA 3JVUA 2OAP1 1T1AA 4JGPA 1N9OA 4GLQA 1OTDA 3T4TA 4CLCE 2PD8A 4WELA 5KIZA 3NOPC 1TD5A 1OT6A 3KSFA 5DJUA 2EWWA 1LT0A 4KQDA 1TF1A 2K7SA 3GECA 2B02A 2ZMFA 3TW8A 1G6OA 1P0ZA 3T4JA 4CLCB 2OOLA 3LIAA 3BQAA 5J3WA 2YKHA 5A8BA 3E4PA 4JGRA 3KSGA 1ZTUA 3B42A 5HD5A 3E98A 5HZHA 2R78A 4QPRA 1WA9A 5AVFA 1LSVA 4DMZA 2W3EA 2QKPA 3W2ZA 5HWVA 2OWHA 2PD7A 5LBRA 3LFVA 3OC2A 4EU0A 2JKRI 4B93A 4EW7A 1LSXA 5F6AA 2W3HA 2W0NA 2QYBA 4R6LA 4GW9A 1OTBA 4L9EA 5AVEA 1XJ6A 2I9VA 2L4RA 4G3KA 4HJ4A 3LIBA 1YKDA 4FOFA 2M7UA 3MQQA 4Y3IA 4Y5FA 3LUQA 2W3FA 2V1BA 2O9CA 5DFYA 5F69A 4ME4A 3S7OA 1W63M 1MZUA 2VA0A 3KSIA 2KX6A 1P9RA 3DBAA 3NOTC 2JKRM 3B33A 2O9BA 3UE6A 4ZRRA 1XFQA 1XJ4A 1TS0A 4MDZA 4BWIA 3FPWA 3PBNA 1D7EA 2ZOHA 3LI8A 3IS2B 5EFWA 3E4QA 2B18A 3PBRA 3C38A 3EOIA 3LIFA 4G3VA 4I3IA 4PKYG 2XA7S 3MQOA 5TBMA 4Y2FA 1S4SA 1OTIA 5DF9A 4GS9A 2K2NA 3MFXA 2XA7M 1GSVA 3EWKA 2WKQA 5HL6A 4O01A 1V9ZA 3F1PB 3RFBA 2W1TB 3RTYA 3R4KA 2W3DA 4IUKA 4L9GA 4P6ZS 1S66L 4EETB 4LRYC 2VV6A 2O0YA 4HOIA 2Z6DA 1OTEA 1OTAA 3OCNA 3PYPA 4NXEA 3A0SA 4I3JA 1NWZA 3EEHA 2Y8HA 2K31A 4LPZA 3T50A 1NLZA 2QJ5A 4GJ4A 4JGOA 4EQ1A 4WL9A 3ULFA 1S1ZA 2D02A 4ARZB 5HDSA 3S7NA 5IU1A 2MJ6A 4BBVA 3NOUC 1F5MA 4HH3A 3PBQA 4MN6A 4RQ9A 3ZYTA 4IUHA 1MC0A 2WKPA 2VGLS 2PDRA 1D06A 2W27A 3NJAA 3CWFA 3EGDC 5HSQA 1NRJA 4G3WA 3O5YA 5IS1A 3BY9A 3F1OB 5IT5A 4HP4A 3CI6A 3K2NA 1XFNA 4PKYA 1UWPX 3MMHA 3GDIA 3CAXA 4BBUA 1IOUA 4NXFA 4OOLA 4NXGA 3UB6A 1P97A 1XJ2A 4GCZA 4H6JA 4FSFA 3KYZA 3T4QA 2CMNA 3E4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A24 A;  4F3L A;  1F98 A;  4R70 A;  1S1Y A;  5J7E A;  4KUO A;  5F68 A;  5IS1 A;  3A0V A;  1N9L A;  2L0W A;  1MZU A;  4YWZ A;  2INW A;  2KX6 A;  2Z6C A;  3NOT C;  4HJ6 A;  4EXO A;  3B33 A;  3H7W B;  2HV1 A;  2V1A A;  1DP8 A;  5HWT A;  3UE6 A;  4XT2 B;  4WF0 A;  1G28 A;  1ODV A;  3UB9 A;  1XFQ A;  5DKL A;  3F1N B;  3C2W A;  4E04 A;  1XJ4 A;  1TS0 A;  3LIE A;  3LI9 A;  1D7E A;  2ZOH A;  4H6J B;  2BAS A;  3FG8 A;  3ICY A;  3IS2 B;  3LI8 A;  4WN5 A;  5EFW A;  3ZQ5 A;  3E4Q A;  4R38 A;  3VOL A;  4I3A A;  3LYX A;  1X0O A;  5DKK A;  3D72 A;  5HWW A;  4EER A;  2A24 B;  2JHE A;  4KUK A;  1EW0 A;  3LIF A;  1VB6 A;  4I5S A;  3A0R A;  4I3I A;  4PKY G;  3VE3 A;  1UGU A;  1DP9 A;  2V0W A;  4HHD A;  1XJ3 A;  3G6O A;  3MQO A;  2JN7 A;  3MJQ A;  3F1O A;  5TBM A;  1S4S A;  1OTI A;  3LID A;  4HNB A;  4GS9 A;  3UME A;  2PR6 A;  2ZBB A;  3H82 A;  1TS6 A;  3MFX A;  2OWJ A;  5J4E A;  1DP6 A;  4M4X A;  4XT2 A;  3F1N A;  1GSV A;  3EWK A;  2PYR A;  1GSX A;  2WKQ A;  3FC7 A;  3MXQ A;  3NHQ A;  1T1B A;  4HI4 A;  1V9Z A;  2QHK A;  3F1P B;  1BYW A;  2VV7 A;  4GS9 B;  2EA9 A;  1T18 A;  2P7J A;  3K3D A;  4GHI A;  4WUJ A;  3RTY A;  2PYP A;  1S4R A;  1T1A A;  4L9G A;  1JNU A;  3BY8 A;  1S66 L;  4JGP A;  4B9O A;  5F69 A;  1OT9 A;  4LRY C;  3UMD A;  4EET B;  2VV6 A;  1N9O A;  2J80 A;  1OTD A;  2VV8 A;  2Z6D A;  1OTE A;  1OTA A;  2D01 A;  4HOI A;  5HDC A;  3PYP A;  2PD8 A;  4NXE A;  4DJ3 A;  3A0S A;  4NXB A;  5KIZ A;  3NOP C;  4I3J A;  1Y28 A;  1F9I A;  4GHI B;  3RH8 B;  1NWZ A;  4R3A A;  4LRZ E;  1OT6 A;  1S67 L;  3EEH A;  2WKR A;  3LIC A;  4HY8 A;  5DJU A;  2GJ3 A;  3CLO A;  1LT0 A;  4KQD A;  3HJK A;  4LPZ A;  3T50 A;  4EES A;  2K7S A;  3GEC A;  2B02 A;  2ZOI A;  3H7W A;  2QJ5 A;  2QJ7 A;  4JGO A;  4WLA A;  4EEP A;  1P0Z A;  4EQ1 A;  2PHY A;  3H82 B;  4LRX C;  4WL9 A;  3ULF A;  1LL8 A;  1S1Z A;  2D02 A;  2OOL A;  2YKF A;  3LIA A;  1GSW A;  5HDS A;  5J3W A;  5G4Y A;  2YKH A;  5IU1 A;  2L1M A;  3P7N A;  4JGQ A;  3VE4 A;  2V9A A;  3E4P A;  4JGR A;  5A8B A;  4BBV A;  1UWN X;  2V0U A;  3UB7 A;  5HD5 A;  4F3L B;  3NOU C;  1DRM A;  5HZH A;  4EEU A;  4HH3 A;  3BWL A;  4MN6 A;  2KDK A;  2R78 A;  4RQ9 A;  1WA9 A;  3KX0 X;  5AVF A;  3SW1 A;  1LSV A;  3IBR A;  4K08 A;  4HIA A;  3UB8 A;  5F5Y A;  2QKP A;  1KOU A;  3OLO A;  1T1C A;  2VEA A;  2WKP A;  4LLO B;  4HJ3 A;  3K3C A;  2PDR A;  5HWV A;  1N9N A;  1D06 A;  2OWH A;  2PD7 A;  2W27 A;  3NJA A;  4HQA A;  5G4Z A;  3C8C A;  3CWF A;  4DJ2 A;  1LSW A;  1V9Y A;  4I39 A;  4EW7 A;  5HSQ A;  1LSX A;  1T19 A;  3HJI A;  5F6A A;  2W0N A;  5HD3 A;  3F1P A;  4R6L A;  5HDD A;  2M1C A;  2VLG A;  3BY9 A;  3F1O B;  3H9W A;  1OTB A;  4GW9 A;  4HP9 A;  4HP4 A;  4L9E A;  5AVE A;  5TBM B;  1XFN A;  4BBT A;  1XJ6 A;  2I9V A;  2L4R A;  3PHY A;  1UWP X;  4PKY A;  4HJ4 A;  3GDI A;  4HH2 A;  3CAX A;  3LIB A;  4L9F A;  4MN5 A;  1TS7 A;  1OJ5 A;  2H28 A;  4BBU A;  4NXF A;  2PR5 A;  4I38 A;  3MQQ A;  4NXG A;  3LUQ A;  3UB6 A;  1P97 A;  1XJ2 A;  4GCZ A;  3IS2 A;  5I5L A;  2V1B A;  1TS8 A;  4H6J A;  3MR0 A;  2QWS A;  1OJG A;  2CMN A;  5DJT A;  3E4O A; 
#chains in the Genus database with same CATH topology
 4F3L A;  4KUO A;  4HJ6 A;  4EXO A;  5FQK A;  2V1A A;  4LEN A;  3ZVW A;  3UB9 A;  1KGE A;  3F1N B;  5EOO A;  1DJC A;  4H6J B;  3FG8 A;  4WN5 A;  5EEC A;  3D72 A;  2FFF B;  2XF3 A;  4YFM A;  2VGL M;  3SH9 A;  3Q7V A;  1CEG A;  3F1O A;  2PT7 A;  4LCM A;  3CIT A;  4DXC A;  4EUV A;  4M4X A;  4GS9 B;  2VZW A;  1PRQ A;  3HUN A;  2Y79 A;  1WYC A;  3UMD A;  2Z2M B;  1M6K A;  4ID4 A;  2EXA A;  2EFU A;  2HJE A;  1U60 A;  5FQI A;  3B47 A;  4JXS A;  4KQQ A;  4X55 A;  2Y4A A;  2JKG A;  3HJK A;  4IHQ A;  4F94 A;  5HL1 A;  1K4E A;  2ZOI A;  4EEP A;  1HZO A;  3GMW A;  1LL8 A;  3C30 A;  3IF6 C;  1YLY A;  5G4Y A;  3IX3 A;  3P7N A;  3ZNT A;  4JGQ A;  3VE4 A;  2V9A A;  4FD8 A;  2JKT I;  1DRM A;  2VJW A;  5DVA A;  4BJP A;  2M7V A;  2WYX A;  3KYQ A;  4K08 A;  2ZL1 A;  1YQS A;  5F5Y A;  3UB8 A;  1T1C A;  4S2J A;  4S2O A;  1GA9 A;  2WGW A;  4HQA A;  5HPF A;  2ZMV A;  5HDD A;  2Y2N A;  3NI9 A;  4UA6 A;  4IVI A;  3TJZ C;  3IS2 A;  4GD8 A;  4MMN A;  4QU3 A;  3PBO A;  1K54 C;  3W4O A;  5M19 A;  5DTK A;  4Y15 A;  2XQZ A;  3PBT A;  3T4L A;  3NDG A;  1MWS A;  4CLC C;  3T1Q B;  2A24 B;  3JYI A;  5GHZ A;  2V0W A;  1K56 D;  1A0K A;  4JKT A;  1ONG A;  2ZBB A;  1TS6 A;  1RCJ A;  4CLC D;  3FC7 A;  4R23 A;  4OOM A;  3ZG7 B;  5K5B A;  3WS1 A;  4DDY A;  1JNU A;  3BY8 A;  2JCH A;  3UN7 A;  1LL5 A;  1BUE A;  2V1Z A;  3VOY A;  1Y28 A;  2W1T A;  3RH8 B;  3IWQ A;  4EES A;  2DMW A;  3H7W A;  3CMZ A;  1XKZ A;  2Y59 A;  2L1M A;  1UWN X;  3BLM A;  3M6H A;  1AWI A;  4RX2 A;  2RL3 A;  1E3U D;  2Y2J A;  4IED A;  3UO9 A;  3SW1 A;  5CGS A;  1H3Q A;  4QY6 A;  1JWP A;  4KZ3 A;  3IQA A;  4DJ2 A;  4UQI S;  2XR0 A;  1ALQ A;  1PZO A;  3F1P A;  3H9W A;  2WGV A;  3PHY A;  1PI4 A;  4L9F A;  2E8I A;  2JC7 A;  1L0G A;  4KQO A;  1TS8 A;  4NXB A;  5FA7 A;  1EI5 A;  1MWT A;  5EM0 A;  5EVI D;  4PHT A;  5M1A A;  1K0K A;  4RA7 A;  3OPL A;  3L9K A;  3ZG0 A;  5JYP A;  3QP4 A;  3BJN A;  3AGF A;  3EEA A;  3T4S A;  2W3G A;  2GX5 A;  3ITB A;  1ACF A;  4EER A;  4MCW A;  3IX8 A;  3A3I A;  3UDX A;  2J3T D;  4EBN A;  2PR6 A;  5J4E A;  3OPR A;  3CZD A;  1KGG A;  5F82 A;  2QHK A;  1G6A A;  4WUJ A;  4KG6 A;  2ZQ8 A;  3NC8 A;  1XP4 A;  1OTD A;  1ES4 A;  4BEN A;  4WMC D;  3SH8 A;  3NOP C;  1DJA A;  5A91 A;  3HRE A;  4O7D A;  4KZ6 A;  4OQG A;  4LGW A;  1Q2P A;  3NBL A;  3C4O A;  5F1G A;  1XXM A;  3GEC A;  2B02 A;  2Y2G A;  1QME A;  3BQA A;  1KVL A;  3HBR A;  1L0D A;  3E4P A;  3O88 A;  3B42 A;  1L3L A;  2ZC5 B;  3DWK A;  1PWD A;  4PM6 A;  4DF6 A;  5AVF A;  1LSV A;  4X56 A;  2Z2L B;  5HX9 A;  2HDR A;  3LEZ A;  5G18 A;  4DE2 A;  5F6A A;  5I94 A;  4ZAM A;  3M2K A;  4GW9 A;  1OTB A;  1CQA A;  3Q07 A;  1WYB A;  1YM1 A;  3LIB A;  4OOY A;  4FOF A;  2Q9N A;  4Y0U A;  4LCL A;  4Y3I A;  2W3F A;  2ZQ9 A;  3M2J A;  2XEP A;  3VP4 A;  3NOT C;  2JKR M;  3BFC A;  4ZRR A;  2ZD8 A;  1XFQ A;  3PBN A;  4DXB A;  1D7E A;  2ZOH A;  4RX3 A;  3B3X A;  5EFW A;  3E4Q A;  2B18 A;  1N4O A;  3VP1 A;  3L7H A;  4MNR A;  3EOI A;  3LIF A;  4I3I A;  1ES2 A;  5E2H A;  2ZC7 A;  3MQO A;  1PNE A;  1OTI A;  5GHX A;  4OPQ A;  4O01 A;  5CED A;  3R4K A;  3TOI A;  5BOH A;  4N1X A;  1K54 A;  1HTZ A;  3SZT A;  3OCN A;  1S6R A;  3GTC A;  4BL2 A;  2Y8H A;  5DTS A;  3IH8 A;  2ZC6 B;  3UE1 A;  4JGO A;  2BLS A;  3ZDJ A;  4S2I A;  3ULF A;  2D02 A;  5EVE A;  5L10 A;  4BBV A;  4E6W A;  3NOU C;  3NCK A;  3PBQ A;  4E3K A;  5GLD A;  3N8L A;  1ZKJ A;  2WKP A;  3QNC A;  4GD6 A;  4H8R A;  1BSG A;  5CEB A;  2EFX A;  4B4Z A;  3CWF A;  3DTI A;  1TEM A;  3OPH A;  4HP4 A;  4YIN A;  3CI6 A;  1XFN A;  4X69 A;  3MMH A;  3CAX A;  4BBU A;  2PU4 A;  3NEC A;  1KE3 A;  4GKU A;  3I7J A;  1VEU B;  2WAF A;  5F68 A;  3LR5 A;  1NY0 A;  3W4P A;  1PWC A;  3S22 A;  4AFI A;  1G28 A;  1ODV A;  5GLA A;  1CEF A;  1H8M A;  5E2F A;  4MBF A;  4KUK A;  1P9W A;  1NYY A;  4CPK A;  4EBL A;  3OCL A;  3G30 A;  1XJ3 A;  3UME A;  3ZFZ A;  3N4I A;  3MXQ A;  2PYR A;  1GSX A;  3G2Z A;  4P0M A;  1BYW A;  1VHM A;  3IX4 A;  1XGI A;  5L8M A;  1S4R A;  2WGW B;  4KZ9 A;  4BQM A;  1OT9 A;  3E0Y A;  4E3I A;  1W8Q A;  2ZL1 B;  5HW3 A;  1I2W A;  2O9A A;  4GHI B;  3LIC A;  2FH5 A;  1PYY A;  3A3F A;  3WWX A;  4DDS A;  4GN2 A;  2H5S A;  4MLL A;  4WLA A;  2HPB A;  2J8Y A;  3E2K A;  4EUZ A;  1FCO A;  3IBJ A;  3R7W B;  4LRX C;  1EWZ A;  2V0U A;  1H8Z A;  3MXS A;  1PZP A;  3MF0 A;  3O3V A;  4BMW A;  4WYY A;  3TRC A;  2DRW A;  4UQI M;  4HIA A;  3OLO A;  4B88 A;  3ZNY A;  2LB9 A;  3MSH A;  5FAS A;  3JPU A;  2H0Y A;  1OPX A;  4NET A;  2VLG A;  4R4S A;  3SS3 A;  4Q0I A;  2H28 A;  2Y2H A;  3GV9 A;  3VSL A;  3MR0 A;  1YMS A;  1F98 A;  2OAQ 1;  4S2M A;  1SKO A;  4PM5 A;  4JF6 A;  2FZ0 A;  4WEK A;  4WM9 A;  3VMA A;  4E04 A;  1I5Q A;  2BAS A;  2XH9 A;  2LB5 A;  4I3A A;  2Y91 A;  4ETZ A;  5EVI B;  4I5S A;  3ZG9 B;  3BEB A;  4HHD A;  1H5X A;  2JN7 A;  3IXB A;  5JYO A;  3WRZ A;  4B4X A;  3G35 A;  4Q0J A;  3KYE A;  4P6Z M;  3T12 B;  1L2S A;  2C5W B;  2VV7 A;  4MN7 A;  2EA9 A;  4OLD A;  5FI7 A;  1IYO A;  2J80 A;  2VV8 A;  1PI5 A;  2ACG A;  2D01 A;  4S2P A;  5AQA A;  2V8C A;  3WRT A;  4HY8 A;  1BLH A;  2EXB A;  3T4K A;  5FQM A;  3OBF A;  5EPH A;  2YKF A;  4OQH A;  1IYS A;  2Y2M A;  2PU2 A;  1Z09 A;  3IF6 A;  3OOV A;  1ZG4 A;  5GLB A;  5CTM A;  5C5K A;  2Y2K A;  1ERM A;  4P85 A;  1KOU A;  3A3D A;  3CUE A;  1LLB A;  5AQ7 A;  3MZF A;  4X6T A;  3FKV A;  3C8C A;  1V9Y A;  2ZJ9 A;  1T19 A;  2X02 A;  4NK3 A;  5FQ9 A;  4BBT A;  2ZM2 A;  5AQB A;  3UE0 A;  4BLM A;  2GDN A;  3VFF A;  1IKG A;  5I5L A;  4C3Q A;  2WAE A;  4OQ0 A;  4NEE D;  3UDI A;  5DFX A;  5J7E A;  2L0W A;  2INW A;  4GDB A;  3H7W B;  2HV1 A;  4U0X A;  4NG2 A;  4BD0 A;  4UHU A;  4M3K A;  3ICY A;  3ZQ5 A;  3DTM A;  3U2A A;  1UGU A;  3ZG5 A;  1K6R A;  4LV3 A;  4R0Q A;  2XDM A;  5KZH A;  3ZCZ A;  1DP6 A;  3SOI A;  5AJG A;  1GHM A;  2NUT C;  1JWZ A;  2P7J A;  4RVA A;  3A3J A;  1N9O A;  3T4T A;  2J9P A;  3LY3 A;  4E3J A;  3E2L A;  4GNU A;  3P09 A;  5DJU A;  1JVJ A;  2EWW A;  2JE5 A;  1Y54 A;  1LT0 A;  1TF1 A;  4FH4 A;  1N9B A;  5GHY A;  5A8B A;  1YLJ A;  2WKE A;  4DMZ A;  1BTL A;  4QD4 A;  2PD7 A;  5LBR A;  3IXG A;  3OC2 A;  5HAP A;  2V20 A;  2W3H A;  4R6L A;  1XJ6 A;  1JWV A;  1GHI A;  2IWC A;  3MQQ A;  3MZE A;  5DFY A;  4ME4 A;  1W63 M;  1MZU A;  2OLU A;  3QP6 A;  4RYE A;  2O9B A;  5CTN A;  4R3B A;  1K57 C;  4QHC A;  2RCX A;  4BWI A;  3CHW P;  3FPW A;  4WMC A;  3IS2 B;  1YPR A;  4R4R A;  3WS2 A;  4C75 A;  4G3V A;  1Z6F A;  1VET B;  4PKY G;  2XA7 S;  4WZ5 C;  3SS5 A;  5TBM A;  4Y2F A;  1S4S A;  2VGK A;  1K38 A;  5E2G A;  3MFX A;  2WKQ A;  2PBD P;  3RFB A;  2G2W A;  3G2Y A;  1ES5 A;  5A93 A;  3S1Y A;  2W1T B;  3RTY A;  1ERO A;  4L9G A;  4P6Z S;  1S66 L;  3IXH A;  4HOI A;  1OTE A;  2R9X A;  4FUW A;  5L07 A;  3A0S A;  5FSR A;  4E6X A;  3N6I A;  4KZA A;  3EEH A;  1YMX A;  3WS4 A;  2QJ5 A;  4KQR A;  2EX8 A;  3LY4 A;  5HDS A;  3QP2 A;  5IU1 A;  2MJ6 A;  5D3O A;  2V2F F;  1PW1 A;  2WK0 A;  1ZG6 A;  2FFY A;  1FSW A;  4IUH A;  2VGL S;  1VM1 A;  1D06 A;  3NJA A;  3C7U A;  3EGD C;  1W79 A;  3O5Y A;  4N9K A;  2DNS A;  5IS1 A;  2WAD A;  3BYD A;  5IT5 A;  3K2N A;  3VOZ A;  3CG5 A;  4NXF A;  4N9L A;  4NXG A;  4H6J A;  4R70 A;  3UPN A;  4KZ7 A;  3TG9 A;  3A0V A;  2EX6 A;  3IF5 A;  4OLG A;  4YWZ A;  3D9Y A;  3PAG A;  5DF7 A;  1SCW A;  2GNX A;  4IBX A;  1O07 A;  3BFG A;  3T1S A;  1RGY A;  5KSH A;  4DN0 A;  5HWW A;  3T4O A;  1HLU P;  2XSS A;  2P04 A;  3QHY A;  3M6B A;  1W63 Q;  4PAU A;  4C6Y A;  3LID A;  4ZJ3 A;  4HNB A;  4EV4 A;  4QY5 A;  4CLC A;  2XRO A;  3HLE A;  3TE8 A;  4XT2 A;  1KE0 A;  3OPP A;  3DW0 A;  1GCE A;  3KO6 A;  2PYP A;  4KG2 A;  3FYZ A;  4OQI A;  4KG5 A;  1K6S A;  5EUA A;  1VQQ A;  5HPI A;  5E43 A;  3HLD A;  1IFQ A;  3CPT B;  4LRZ E;  5KMW A;  3HLF A;  3BFE A;  2CC1 A;  1KDW A;  5L2F A;  3ZHH A;  2H0T A;  1K25 A;  2PAV P;  3HUO A;  2KDK A;  3IBR A;  2VEA A;  4O0P A;  1N9N A;  2XFT A;  3HLW A;  4Y0T A;  1LSW A;  3HJI A;  4DRT A;  4ARZ A;  3NUL A;  1G68 A;  5CX7 A;  5TBM B;  1ZC2 A;  3VP3 A;  5HAQ A;  1C3B A;  3FZC A;  5F83 A;  3MKE A;  3MQ0 A;  3IWI A;  5EM1 A;  3HCY A;  4HES A;  5FI6 A;  4ZJ1 A;  2JBF A;  4GDN A;  2R9W A;  4LV0 A;  2HJ9 C;  3MZD A;  3V67 A;  5E2E A;  4L0L A;  4UEY A;  4P6B A;  3LR0 A;  3VP0 A;  2X71 A;  5DKL A;  4E3N A;  3LR4 A;  2P08 A;  1BLP A;  3G4P A;  3VOL A;  3QP8 A;  1X0O A;  2JHE A;  1EW0 A;  1FIL A;  4OPZ A;  3N8R A;  4BD1 A;  3PBS A;  3H82 A;  1XA1 A;  2OWJ A;  1ES3 A;  2HF6 A;  1FOF A;  2UWX A;  3BEC A;  2HDS A;  2Y55 A;  4Y17 A;  3IHA A;  1MXO A;  3Q7Z A;  2HDU A;  4ZBE A;  2P9V B;  2WGI A;  3UB5 P;  1S67 L;  3LGO A;  2WKR A;  4PMA A;  4PPR A;  2GJ3 A;  4HEF A;  3CLO A;  4IJG A;  1H8Y A;  1MKI A;  2PHY A;  1SHV A;  4ZJ2 A;  1VET A;  1K4F A;  5M18 A;  1LI0 A;  3DTE A;  2HGV A;  1YSP A;  4KZ5 A;  4EEU A;  3BWL A;  3OZH A;  3S7Q A;  4LLO B;  4E3O A;  3K3C A;  1MPL A;  5AQ9 A;  1LL9 A;  2Y2L A;  3JVV A;  4JXV A;  2V8F A;  1BLS A;  1MY8 A;  3ZG8 B;  4OP8 A;  1SKO B;  4HH2 A;  4MN5 A;  1TS7 A;  2PR5 A;  4I38 A;  1HVB A;  3IT9 A;  5CHU A;  3EGX C;  4NKP A;  2ZM0 A;  5GLC A;  3GRJ A;  2B5R A;  5DJT A;  4BL3 A;  1N9L A;  3LEQ A;  1XGJ A;  4Q0H A;  5CEC A;  4X1M A;  1PIO A;  3P01 A;  3C2W A;  1J3W A;  5KSC A;  4Q8I A;  4K0X A;  3PR6 A;  4WZ5 A;  3BFF A;  3IWO A;  1GA0 A;  3G6O A;  4JXW A;  4Z9Q A;  3R7W A;  1MBL A;  2EWV A;  1T1B A;  3VP2 A;  2O99 A;  1Q2Q A;  4P87 A;  3G32 A;  1T1A A;  4GLQ A;  4CLC E;  3IF6 B;  3SH7 A;  2PD8 A;  2G2U A;  4WEL A;  3TSG A;  3QNB A;  1OT6 A;  2UV0 E;  4OVD A;  2E8J A;  3KSF A;  1PW8 A;  2XGN A;  2ZMF A;  3VSK A;  1G6O A;  4FTX A;  5J3W A;  4Y13 A;  2YKH A;  3W4Q A;  2JKF A;  1ZTU A;  3O86 A;  1ESI A;  4HBU A;  3NIA A;  3VFH A;  3LCE A;  4PM7 A;  2R78 A;  1FQG A;  4QPR A;  3HVF A;  1NZO A;  3W2Z A;  3WS5 A;  3SS4 A;  3RJU A;  5EVI C;  4EU0 A;  2XLN A;  1LSX A;  2QYB A;  2VGJ A;  2I9V A;  3UNW A;  4FCF A;  4G3K A;  4KZ4 A;  4MBK A;  4UAA A;  2Q0O A;  3LUQ A;  2V1B A;  1KVM A;  3S7O A;  4D2O A;  2VA0 A;  3KSI A;  2KX6 A;  1KDS A;  1P9R A;  3DBA A;  3GQZ A;  3GSG A;  3IHB A;  2EX2 A;  5FAT A;  1KGF A;  1XJ4 A;  1TS0 A;  3UY6 A;  1KE4 A;  5CXW A;  4OPR A;  1CJF A;  4R3J A;  2ZC4 B;  3PBR A;  3C38 A;  3Q82 A;  4R1G A;  5HFO A;  5DF9 A;  4Y7P A;  1F2K A;  1RGZ A;  5L09 A;  3GR2 A;  4QJG A;  1GSV A;  3EWK A;  5HL6 A;  2HP9 A;  1V9Z A;  3F1P B;  2XD5 A;  4GOG A;  4S2N A;  3MKF A;  4U3T A;  4LRY C;  2VV6 A;  3Q81 A;  2Z6D A;  5FAP A;  2OV5 A;  3AGD A;  5A90 A;  5J8X A;  3C5A A;  3IXD A;  3N7W A;  1YLZ A;  2A3U A;  4GJ4 A;  4EQ1 A;  1S1Z A;  4ARZ B;  3S7N A;  3U4L P;  4KZ8 A;  1XPB A;  1M40 A;  4N1H A;  4HH3 A;  2P9V A;  4MN6 A;  4RQ9 A;  3ZYT A;  5CHJ A;  1HD8 A;  3AGE A;  4KZB A;  2ZC3 B;  1NRJ A;  3BY9 A;  3ISG A;  4U0T A;  3GDI A;  3HUM A;  1E3U A;  2ZM8 A;  3S4X A;  5TGF A;  3UB6 A;  1XJ2 A;  5EV0 A;  4GCZ A;  2WZX A;  4FSF A;  3T4Q A;  2CMN A;  3E4O A;  2A24 A;  1S1Y A;  2VKS A;  1K55 C;  2AVX A;  2Z6C A;  3PAE A;  5FQQ A;  2IWD A;  4Y0O A;  3KSH A;  4PM8 A;  5HWT A;  4WEJ A;  2W1R A;  5FDS A;  3D4F A;  1VEU A;  5TJJ A;  3LIE A;  3LI9 A;  4LV2 A;  4OPY A;  4FH2 A;  3T1R A;  1OME A;  4CQH A;  3LYX A;  5DKK A;  3O87 A;  5EVL A;  3MS6 A;  4JXG A;  3VE3 A;  2A2L A;  1LHY A;  3A0R A;  1TVF A;  3MJQ A;  4GB7 A;  3Q1F A;  1G5U A;  2XD1 A;  5HAI A;  3F1N A;  3NHQ A;  4HI4 A;  3ITA A;  1TDL A;  1YLW A;  4GHI A;  3RXW A;  4K0W A;  1YAX A;  5GL9 A;  3DTK A;  3UE3 A;  1ZHH B;  2HDQ A;  2P74 A;  4HBT A;  1YSQ A;  4EWF A;  2ZQD A;  1FR1 A;  4R3A A;  1MKM A;  1L0F A;  1STZ A;  1CK3 A;  3A3E A;  2QJ7 A;  1ERQ A;  5FEG A;  3HLC A;  4XUZ A;  3N8S A;  1GSW A;  1E25 A;  2DCF A;  4ESP A;  3V3R A;  3KX0 X;  1SDE A;  3BQ8 A;  4MBH A;  1IYP A;  5FDH A;  1PFL A;  4OON A;  2C6W B;  2BTF P;  4HJ3 A;  4DE1 A;  1W7F A;  2NUP C;  1CI8 A;  3MBZ A;  2X01 A;  3MXR A;  3ZVT A;  1FSY A;  1OJ5 A;  3VV4 A;  4DE3 A;  5FAQ A;  3EQV A;  4HP9 A;  1MWU A;  1SZV A;  1BUL A;  4CJN A;  1BT5 A;  3FKW A;  4IBR A;  3DAV A;  4II7 A;  3IH9 A;  1FIK A;  3PTE A;  3G34 A;  3FV7 A;  1S0W A;  2J7V A;  3NY4 A;  5U47 A;  1I2S A;  3CJM A;  2J9O A;  3RXX A;  1VB6 A;  1DP9 A;  2H10 A;  4QB8 A;  1WE4 A;  5EOE A;  1NLY A;  4OH0 A;  3LR3 A;  1TDG A;  1GHP A;  1T18 A;  3K3D A;  1FR6 A;  1DJB A;  2J3W A;  3DWZ A;  1ONH A;  1FCN A;  3EQU A;  4B9O A;  3BW6 A;  2HP5 A;  1MWR A;  5HDC A;  5IHV A;  1NXY A;  1K55 A;  4DJ3 A;  2J3T C;  1F9I A;  5A92 A;  2G7U A;  1J9M A;  4YOF A;  2Q9M A;  1L0E A;  3H82 B;  1NRF A;  2Y2O A;  3P98 A;  3UB7 A;  4F3L B;  4QWO A;  5MC7 A;  2B95 A;  2IA2 A;  5HAR A;  3V39 A;  2KOI A;  4UA7 A;  5G4Z A;  4I39 A;  2IWB A;  4X25 A;  1DY6 A;  1K56 A;  5HD3 A;  2M1C A;  3PXP A;  1SDN A;  4X68 A;  4DE0 A;  1BLC A;  2A49 A;  2Y2P A;  3BFD A;  3BLS A;  4IVK A;  2JKT M;  3QP1 A;  2VX8 A;  4XXR A;  2HZ5 A;  2QWS A;  1OJG A;  2KLI A;  5FQJ A;  2VK3 A;  1CI9 A;  5DTT A;  4D60 A;  2XRN A;  5FL3 A;  3CUE C;  1CF0 A;  5CER A;  1DP8 A;  4DKI A;  4XT2 B;  4WF0 A;  3V3S A;  1JTD A;  5FEF A;  3D3O A;  1NZU A;  5CGW A;  3W8K A;  4R38 A;  3T1X A;  4Z1W A;  4ETX A;  1H0M A;  4YNR A;  3WS0 A;  2GZA A;  1YLT A;  2ZQC A;  3S7P A;  2ZLY A;  4XUX A;  2WUQ A;  2ZMA A;  4O8G A;  5CRF A;  2XFS A;  5CHM A;  1JTG A;  1IEM A;  1ESU A;  3FPV A;  2OSU A;  1Y4O A;  3JVU A;  2OAP 1;  4JGP A;  4WZ4 A;  5KIZ A;  2EX9 A;  1TD5 A;  1LI9 A;  4JPM A;  4MEZ A;  1XX2 A;  1BZA A;  3V50 A;  4JLF A;  4KQD A;  2K7S A;  3TW8 A;  1P0Z A;  3T4J A;  4CLC B;  2OOL A;  3LIA A;  4S2N C;  2OLV A;  2Y2Q A;  1AXB A;  3KSG A;  4JGR A;  3Q7V B;  1W8Y A;  5HD5 A;  3E98 A;  4E3L A;  5HZH A;  5TFQ A;  1WA9 A;  4GZB A;  2W3E A;  5FI2 A;  2QKP A;  4S2L A;  4KEN B;  5HWV A;  2OWH A;  3LFV A;  4ZTK A;  2ZQA A;  2JKR I;  4B93 A;  4EW7 A;  4UA9 A;  3UPP A;  2W0N A;  4L9E A;  5AVE A;  5F1F A;  2L4R A;  1XA7 A;  4HJ4 A;  1YKD A;  2M7U A;  2WKI A;  4Y5F A;  4WBG A;  4OKP A;  4EBP A;  2HP6 A;  2O9C A;  5F69 A;  5FAO A;  4LFU A;  1PWG A;  1YT4 A;  3MFD A;  3B33 A;  4OP5 A;  3UE6 A;  3QP5 A;  4X53 A;  4MDZ A;  3LI8 A;  1NJ4 A;  1SKF A;  1O7E A;  5DF8 A;  5EVI A;  3NDE A;  4PM9 A;  2WZZ A;  4EQI A;  4GS9 A;  2K2N A;  2XA7 M;  1QMF A;  3UDF A;  1D1J A;  1RP5 A;  3G31 A;  2PRF A;  4JF4 A;  3FWL A;  1IKI A;  3GVB A;  2W3D A;  4IUK A;  4E3M A;  4EET B;  2O0Y A;  1OTA A;  4LV1 A;  3PYP A;  4NXE A;  3BM6 A;  2XK1 A;  3ZGA B;  4I3J A;  4X1L A;  1NWZ A;  3LO7 A;  2K31 A;  1IEL A;  1IYQ A;  4LPZ A;  3V5M A;  5EE8 A;  3T50 A;  1NLZ A;  3BRM A;  1NYM A;  4WL9 A;  3HLG A;  3CPT A;  1FCM A;  3HL9 A;  4ZDX A;  2WKH A;  1F5M A;  4S2K A;  5TR7 A;  4A5R A;  3UPO A;  4K91 A;  3C7V A;  1W5D A;  2QMI A;  4JF5 A;  3C4P A;  2Y2I A;  4JBF A;  1MC0 A;  2PBY A;  2PDR A;  5CGX A;  4N92 A;  2QZ6 A;  2W27 A;  2BG1 A;  1YLP A;  5HSQ A;  1E4D A;  4G3W A;  2ZQ7 A;  3F1O B;  4PKY A;  1UWP X;  1K57 A;  1IOU A;  4OOL A;  2I72 A;  2QPN A;  1P97 A;  3HLB A;  3KYZ A; 
#chains in the Genus database with same CATH homology
 2A24 A;  4F3L A;  4R70 A;  1S1Y A;  2VKS A;  4KUO A;  5F68 A;  3A0V A;  3LR5 A;  4YWZ A;  2Z6C A;  4HJ6 A;  4EXO A;  3KSH A;  2V1A A;  5HWT A;  2GNX A;  4WEJ A;  2W1R A;  4AFI A;  1G28 A;  1ODV A;  3UB9 A;  3F1N B;  5TJJ A;  3LIE A;  3LI9 A;  4H6J B;  3FG8 A;  1H8M A;  4WN5 A;  5KSH A;  4DN0 A;  4CQH A;  3LYX A;  5DKK A;  5HWW A;  3D72 A;  4KUK A;  3T4O A;  2XSS A;  1P9W A;  2P04 A;  2VGL M;  3VE3 A;  2A2L A;  3A0R A;  3OCL A;  1W63 Q;  1XJ3 A;  4PAU A;  3MJQ A;  3F1O A;  3LID A;  2PT7 A;  4HNB A;  3UME A;  4CLC A;  3CIT A;  2XRO A;  4EUV A;  4M4X A;  3TE8 A;  4XT2 A;  3F1N A;  3NHQ A;  3MXQ A;  2PYR A;  1GSX A;  4HI4 A;  1BYW A;  1VHM A;  4GS9 B;  3KO6 A;  4GHI A;  5L8M A;  2PYP A;  1YAX A;  1S4R A;  2VZW A;  3UE3 A;  1OT9 A;  2Y79 A;  3UMD A;  3E0Y A;  1ZHH B;  1YSQ A;  2HJE A;  5HPI A;  2O9A A;  4GHI B;  1IFQ A;  4R3A A;  3B47 A;  4LRZ E;  3LIC A;  2FH5 A;  1MKM A;  1STZ A;  3HJK A;  4IHQ A;  2ZOI A;  2QJ7 A;  4WLA A;  4EEP A;  4LRX C;  3IBJ A;  3R7W B;  1LL8 A;  3C30 A;  1GSW A;  5G4Y A;  3P7N A;  4JGQ A;  3VE4 A;  2V9A A;  2V0U A;  2JKT I;  1DRM A;  2VJW A;  3MF0 A;  4BMW A;  4BJP A;  2M7V A;  3TRC A;  2KDK A;  3KX0 X;  4UQI M;  3BQ8 A;  3KYQ A;  3IBR A;  4K08 A;  4HIA A;  3UB8 A;  5F5Y A;  3OLO A;  1T1C A;  2VEA A;  4O0P A;  4HJ3 A;  1N9N A;  2LB9 A;  4HQA A;  2NUP C;  1LSW A;  5HPF A;  1OPX A;  2ZMV A;  3HJI A;  4ARZ A;  5HDD A;  2VLG A;  5CX7 A;  5TBM B;  4Q0I A;  1OJ5 A;  2H28 A;  3VV4 A;  3TJZ C;  3MQ0 A;  3HCY A;  3EQV A;  3IS2 A;  3MR0 A;  4HP9 A;  1F98 A;  2HJ9 C;  2OAQ 1;  4MMN A;  3PBO A;  3V67 A;  4L0L A;  2FZ0 A;  4UEY A;  4WEK A;  4II7 A;  3LR0 A;  3PBT A;  3T4L A;  5DKL A;  4E04 A;  3LR4 A;  2P08 A;  2BAS A;  2LB5 A;  3VOL A;  4I3A A;  1X0O A;  4CLC C;  2A24 B;  2JHE A;  1EW0 A;  4ETZ A;  4I5S A;  1VB6 A;  1DP9 A;  2V0W A;  4HHD A;  2JN7 A;  1NLY A;  3PBS A;  2ZBB A;  3H82 A;  1TS6 A;  2OWJ A;  4CLC D;  3LR3 A;  2HF6 A;  4Q0J A;  4P6Z M;  3FC7 A;  4OOM A;  4MN7 A;  2VV7 A;  2EA9 A;  1T18 A;  3K3D A;  2J3W A;  5K5B A;  1JNU A;  3BY8 A;  3EQU A;  4B9O A;  3BW6 A;  2J80 A;  2VV8 A;  2D01 A;  5HDC A;  4DJ3 A;  2J3T C;  1F9I A;  1Y28 A;  2W1T A;  3RH8 B;  1S67 L;  2WKR A;  4HY8 A;  2GJ3 A;  3CLO A;  2G7U A;  4EES A;  4YOF A;  2DMW A;  3H7W A;  4IJG A;  3T4K A;  2PHY A;  3H82 B;  3OBF A;  2YKF A;  2L1M A;  2HGV A;  1YSP A;  1UWN X;  3UB7 A;  4F3L B;  3OOV A;  4EEU A;  5MC7 A;  2IA2 A;  3BWL A;  5C5K A;  3SW1 A;  2KOI A;  3S7Q A;  1KOU A;  1H3Q A;  3CUE A;  4LLO B;  3K3C A;  5G4Z A;  3C8C A;  3JVV A;  4DJ2 A;  1V9Y A;  4I39 A;  4UQI S;  1T19 A;  5HD3 A;  3F1P A;  2M1C A;  3H9W A;  3PXP A;  4BBT A;  3PHY A;  4HH2 A;  4MN5 A;  4L9F A;  1TS7 A;  2PR5 A;  4I38 A;  2JKT M;  4KQO A;  2VX8 A;  3EGX C;  4NKP A;  5I5L A;  1TS8 A;  4NXB A;  2QWS A;  4NEE D;  1OJG A;  2KLI A;  5DJT A;  4PHT A;  5DFX A;  5J7E A;  1N9L A;  2L0W A;  2INW A;  4Q0H A;  2XRN A;  5FL3 A;  3H7W B;  2HV1 A;  3CUE C;  1DP8 A;  4XT2 B;  4WF0 A;  3BJN A;  3P01 A;  3C2W A;  3EEA A;  3T4S A;  2W3G A;  2GX5 A;  3D3O A;  3ICY A;  3ZQ5 A;  4R38 A;  4Z1W A;  4EER A;  4ETX A;  3PR6 A;  4MCW A;  4YNR A;  3U2A A;  2GZA A;  3S7P A;  1UGU A;  3G6O A;  2J3T D;  2PR6 A;  3R7W A;  4O8G A;  5J4E A;  1DP6 A;  2EWV A;  5AJG A;  1T1B A;  2NUT C;  2QHK A;  2O99 A;  3FPV A;  2P7J A;  4WUJ A;  3JVU A;  2OAP 1;  1T1A A;  4JGP A;  1N9O A;  4GLQ A;  1OTD A;  3T4T A;  4CLC E;  2PD8 A;  4WEL A;  5KIZ A;  3NOP C;  1TD5 A;  1OT6 A;  3KSF A;  5DJU A;  2EWW A;  1LT0 A;  4KQD A;  1TF1 A;  2K7S A;  3GEC A;  2B02 A;  2ZMF A;  3TW8 A;  1G6O A;  1P0Z A;  3T4J A;  4CLC B;  2OOL A;  3LIA A;  3BQA A;  5J3W A;  2YKH A;  5A8B A;  3E4P A;  4JGR A;  3KSG A;  1ZTU A;  3B42 A;  5HD5 A;  3E98 A;  5HZH A;  2R78 A;  4QPR A;  1WA9 A;  5AVF A;  1LSV A;  4DMZ A;  2W3E A;  2QKP A;  3W2Z A;  5HWV A;  2OWH A;  2PD7 A;  5LBR A;  3LFV A;  3OC2 A;  4EU0 A;  2JKR I;  4B93 A;  4EW7 A;  1LSX A;  5F6A A;  2W3H A;  2W0N A;  2QYB A;  4R6L A;  4GW9 A;  1OTB A;  4L9E A;  5AVE A;  1XJ6 A;  2I9V A;  2L4R A;  4G3K A;  4HJ4 A;  3LIB A;  1YKD A;  4FOF A;  2M7U A;  3MQQ A;  4Y3I A;  4Y5F A;  3LUQ A;  2W3F A;  2V1B A;  2O9C A;  5DFY A;  5F69 A;  4ME4 A;  3S7O A;  1W63 M;  1MZU A;  2VA0 A;  3KSI A;  2KX6 A;  1P9R A;  3DBA A;  3NOT C;  2JKR M;  3B33 A;  2O9B A;  3UE6 A;  4ZRR A;  1XFQ A;  1XJ4 A;  1TS0 A;  4MDZ A;  4BWI A;  3FPW A;  3PBN A;  1D7E A;  2ZOH A;  3LI8 A;  3IS2 B;  5EFW A;  3E4Q A;  2B18 A;  3PBR A;  3C38 A;  3EOI A;  3LIF A;  4G3V A;  4I3I A;  4PKY G;  2XA7 S;  3MQO A;  5TBM A;  4Y2F A;  1S4S A;  1OTI A;  5DF9 A;  4GS9 A;  2K2N A;  3MFX A;  2XA7 M;  1GSV A;  3EWK A;  2WKQ A;  5HL6 A;  4O01 A;  1V9Z A;  3F1P B;  3RFB A;  2W1T B;  3RTY A;  3R4K A;  2W3D A;  4IUK A;  4L9G A;  4P6Z S;  1S66 L;  4EET B;  4LRY C;  2VV6 A;  2O0Y A;  4HOI A;  2Z6D A;  1OTE A;  1OTA A;  3OCN A;  3PYP A;  4NXE A;  3A0S A;  4I3J A;  1NWZ A;  3EEH A;  2Y8H A;  2K31 A;  4LPZ A;  3T50 A;  1NLZ A;  2QJ5 A;  4GJ4 A;  4JGO A;  4EQ1 A;  4WL9 A;  3ULF A;  1S1Z A;  2D02 A;  4ARZ B;  5HDS A;  3S7N A;  5IU1 A;  2MJ6 A;  4BBV A;  3NOU C;  1F5M A;  4HH3 A;  3PBQ A;  4MN6 A;  4RQ9 A;  3ZYT A;  4IUH A;  1MC0 A;  2WKP A;  2VGL S;  2PDR A;  1D06 A;  2W27 A;  3NJA A;  3CWF A;  3EGD C;  5HSQ A;  1NRJ A;  4G3W A;  3O5Y A;  5IS1 A;  3BY9 A;  3F1O B;  5IT5 A;  4HP4 A;  3CI6 A;  3K2N A;  1XFN A;  4PKY A;  1UWP X;  3MMH A;  3GDI A;  3CAX A;  4BBU A;  1IOU A;  4NXF A;  4OOL A;  4NXG A;  3UB6 A;  1P97 A;  1XJ2 A;  4GCZ A;  4H6J A;  4FSF A;  3KYZ A;  3T4Q A;  2CMN A;  3E4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...