4KULA

Crystal structure of n-terminal acetylated yeast sir3 bah domain v83p mutant
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
207
structure length
193
Chain Sequence
b'LDGWQVIITDDQGRVIDGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNNVPEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein SIR3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 49
structure length 193
sequence length 207
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4kulA00
4JJNK 1ZHIA 4KUDK 4DOVA 4FT4A 4LD9K 1ZBXA 4KUIA 4DOWA 3TU4K 4BB7A 4FT2A 2FVUA 1W4SA 1M4ZA 4FSXA 3PT9A 4KULA 3PTAA 4DA4A 2FL7A
chains in the Genus database with same CATH superfamily
2HQHA 3EG9A 2VC8A 3NHNA 4II1A 1YJWT 2DIGA 2JM9A 2QA4A 2GFUA 2OAUA 5M9OA 1VQNT 2IVWA 1FX7A 2AKKA 4UC4A 2W10A 1QWFA 3CPWP 2LX7A 3CCET 4M77G 1RAFB 3MP1A 2QAZA 2DA9A 1NZ9A 2DNUA 1RI0A 2VB6A 2MYSA 1VQ6A 3CMEQ 1YIJT 2VVKA 2O9VA 2EQJA 3A8LB 2JS2A 2NYSA 4Y92A 2XICA 2FZKB 4DOVA 2D0NA 4IUTA 2OTLT 3AHUA 1KFZA 2VUBA 5KE3A 2O88A 5GAN3 4JUVA 4GLMA 2HL5C 4CI0C 3EFOB 3RMSA 4C92G 4IUUA 2RQRA 2KR3A 1AHJB 3H0HA 5FU6C 1RI9A 1WI7A 2KY9A 2JOYA 2EQIA 2GQIA 3QWYA 1S72Q 4N0AC 1QLYA 2KNBB 3H41A 1JBMA 1YHQA 1XQHA 3M55A 3HRSA 5CQYA 4BDYA 1E7OA 5AT1B 2KVQG 4L6V5 2RQWA 3X28B 1RAGB 4BE0A 4PJOC 2DL5A 3CD6Q 2HBWA 1Q95G 4J9EA 2V8JA 1KD1C 3QYHB 4PJOF 1BI0A 1M3BA 5GAN7 3CC4A 3M53A 3I56T 3HP9A 2QA4T 2GGRA 3ME9A 2DERA 4OB2B 1VQLQ 1TUGB 2O4XA 3I35A 4RTXA 2NWMA 1EFNA 4M77C 4KUIA 2KROA 5KYYB 4J7FA 1IB8A 1ZSZB 2NUPA 2RI3A 2DEUA 1VQ6T 3INZA 1VYTA 4F7UG 4M77F 2CSIA 2OTJA 1MUZA 1Z9QA 2ZPEB 2LNHB 3OYMA 4ZTFA 2O2OA 1ABQA 5ECAA 1YJ9A 1WXUA 3BW1A 2HCKA 3P8DA 2RJCA 4RMOA 4X9DA 5IT9E 1AD5A 2RQUA 4JRPA 4ELYC 1Q86C 4LN2A 4JRQA 2RJEA 4OMFB 2LNVA 3OMCA 1WQWA 4JRIA 4C92C 1K9MU 5CKFA 5GANh 3CC7A 1V29B 3OB9A 1M8MA 2COZA 4J9CA 3RKWA 5CR2A 2MWPA 1HSQA 4IIMA 1ABOA 5GAN4 4C92F 4OB1B 4QT7A 5LJ5h 4ME7A 3MEUA 4WTOB 2KRSA 1YHQT 1PRLC 2OJ2A 3CC2Q 2JXBA 4M7DE 1PM3A 1Y0MA 2CREA 2A3LA 2L3RA 1ZLMA 2DTHA 2FL7A 2EGCA 2LQ8A 1H92A 2DFUA 2DRMA 4ATOA 5HK3A 4FIBA 4M75D 2KK4A 2BTTA 4PK4A 3CMEA 1T3LA 1TXQA 1VQPA 2JS0A 2K3BA 5GAN8 4FSXA 2DTIA 2VYTA 5GANf 3CC4T 3OYFA 2HMAA 3CPFA 2LRQA 3RKYA 2JNGA 4M75B 4A4HA 3X25B 1X6OA 4AG1C 3JB9D 3RERA 5LJ5f 3HL8A 4FCYA 2HZYA 3EGXB 3L2UA 4AT1B 3S6WA 3EGDA 4GLKA 1KD1U 2FPEA 1G2BA 2V8KA 1W2BS 2DKGA 2HSEB 1WGSA 5CCAA 3JCMf 1SKUB 4F7UF 2HQXA 1YJ9T 3LWHA 1S72A 4M7DA 1T0JA 1GCQC 4M78G 1JEGA 4QQDA 1U3OA 5I2MA 4F17A 3OW2A 2PVOB 1TU0B 1NYFA 1VQ7Q 2E3IA 1X75C 4B9XA 3OYGA 2P84A 1JO8A 3CC7T 1KC8R 1K1ZA 2YXYA 5IHNA 1S1NA 3QJ6A 5J3BA 1YJNQ 1PC0A 4CC2A 2NUPB 4A4KA 1WHLA 4B6MA 1UEBA 1BB9A 2LCSA 2E65A 1TOVA 2G3RA 2VASA 3PVLA 4E7JA 2KXDA 1VQLA 3I55Q 2FRWA 4RG8A 2DLPA 4P5NA 4OGEA 4ZN1A 1RAEB 1AWWA 4JPBW 4RCCA 1QVGA 5AYFA 2L3QA 3CMET 2XU8A 1M2OA 1X6BA 3ZEHA 4D6WA 4C5HA 2J05A 5FW9A 4EMHA 3PIPA 2BIVA 1LJOA 3THKA 5CQXA 3UDCA 2K2MA 2DYIA 1U8RA 1LNXA 1M2VB 4ZGEB 3OYLA 3CEYA 3OYEA 2GFAA 1UGQB 2VWFA 2C0TA 3QYGB 1G3WA 2KQWA 1ZX6A 2JW4A 5GANg 5GMKe 4EMKA 1WZOA 4AFZC 4C0FA 2FPFA 3P8HA 4XAXB 4ESRA 1ZUKA 4JS5A 4X34A 4HKEA 4KGVB 2Y4YA 3N5BB 1KQSS 1GL5A 5LJ5g 3REAB 1T3SA 4JRKA 2ROLA 2GCXA 1AWJA 2RD1A 2XIDA 1VQ5A 2E41A 1S72T 4M78C 1LVKA 2O9SA 3OYBA 4N4HA 1SHGA 1Q81R 1WHKA 2DF6A 2JMCA 3JCMg 3VS5A 4ANJA 4M78F 5DLQE 1J3TA 1ZA1B 1JXMA 3PFSA 1BI2A 3CD6T 1YN8A 1M1KU 4BACA 1WA7A 4TVRA 4OVAA 2JTEA 2LJ3A 1OI1A 1D1BA 2GTOA 2VKNA 3L2ZA 4M7DD 3VJPA 4HCZA 1Q82R 2QEXQ 2LQWA 1RL2A 3QJYA 4JZ4A 5HY6A 2LP5A 2MAMA 2JTMA 5GMKj 1VQLT 1Q81U 3OA6A 1A0NB 3J80E 3JCMc 1FYNA 1Y07A 2CUBA 3DKMA 2D0QB 4M7DB 4CC7A 3HFNA 3C12A 1EIFA 3M56A 3RUXA 4FYXB 1N6AA 4PKCC 1UGVA 4XTVA 4B9WA 1CKAA 2Y90A 2ED0A 1K73R 1RLPC 2M16A 1VA7A 2MK5A 4HT9A 5KYWA 3MPUB 3CCMA 1VOMA 1WLPB 2K79A 3M0RA 4HT8A 1YCSB 1M27C 1YWPA 2X4WA 2CZ6B 2J6FA 2RA2A 2QASA 1VQ7A 1QVFS 3KBGA 3PE0A 1NE8A 1M30A 1DJ7B 3UA7A 4AFUC 4O6JA 2NUTB 1YJNA 1QP3A 4J6XA 2RHUA 4DEYA 1N8RC 1IHWA 3MJXA 1K73U 3TREA 1JB0E 1D09B 1NLPC 2D9TA 4HVWA 3TSWA 5GJWB 3OYIA 3A5ZB 1RAIB 1PRMC 3I55A 2K5IA 1YHQQ 1AZGB 1GBQA 3JCMV 1R8OB 3PGGA 4OMMA 1MNDA 4F04B 1U1TA 5I22A 2D6FA 2V8IA 2AIRB 3FB9A 4M7AE 5GAN6 1BI1A 1HD3A 2EYYA 1SPKA 1K76A 2DZ9A 2MOXA 1CSKA 2VGNA 3UA6A 2HEQA 4OMOA 2HNIA 1X01A 4E47A 5FRNA 4XU2A 3EFSA 3ZL7C 5GANd 2WSFE 2DE0X 3NPFA 2F1LA 5GAOp 4Z02A 4F7UA 1Q7YR 3VU3C 4BE2A 3ZBDA 3CCJQ 1MGQA 3MCAB 5LJ5d 4V2SA 2K7AA 4PJLA 3VRYA 1WHHA 1ZUYA 4C8QB 1FWZA 1D0YA 2MF2A 1EX4A 3OBYA 1OX8A 3WVEB 2A36A 2PVDB 2PNIA 1M90C 2OTJQ 4C0ZA 4BB7A 5KYXB 1AVZC 3QZ5B 2M1HA 5EG2A 4Z88A 1MV0B 2E6NA 3C94A 4HCKA 1NPRA 3BY7A 3M4YA 1VQ7T 5DLOA 2V1QA 2XMFA 1B34A 3QDFA 1QCOA 4BI8B 2DILA 2WSEE 5GAN5 2DXUA 3VS4A 4M7AA 2DAQA 4ELZC 4QW2A 3SWNC 3QHSA 3OSVA 4J6WA 3JCMb 3J81E 1AWXA 2E4HA 4RTWA 1ZA2B 1YJNT 5KYUA 1AEYA 1D0XA 1JQQA 4IURA 4KH0B 1KG1A 4AFSC 4HXJA 1OOTA 2DL7A 2XHCA 3FJ5A 3TCJA 2QEXA 3G71A 3V7SA 4AMCA 4JJNK 3EG2A 1PG5B 1NG2A 3I55T 2IPOB 4OP0A 2FYKA 1PKSA 5KYWB 4RTZA 5GMKm 2YUOA 2YDLA 1MHNA 3CCQQ 2B86A 3EG1A 4D8DA 2A28A 3LYIA 4XTZA 2RH2A 1PCXA 2LJ0A 2M9UA 2QDLA 4J5YA 2DPPB 2LCCA 2CH4W 1VQPQ 2VV5A 3AT1B 2DXCA 3FRNA 5IXBA 2PQWA 1X2KA 4GBQA 3OS5A 2LT1A 2JT4A 2FVUA 5I2SA 4PJJA 2DL8A 1UECA 3MKDA 4OGCA 2JMAA 3OS2A 3G6EA 1TUCA 2LQKA 4PJNA 3CCVA 2RHXA 1H8KA 2IG0A 4M78A 4Y91A 5GMKi 3FJPA 5KE2A 3CXCS 2FZGB 1WFWA 4DBHA 1PD1A 1H641 3QO3A 2K4YA 4M4ZA 2YLBA 1LPLA 3PT9A 1FMVA 3RESA 3SD4A 3H8ZA 1SRMA 4YTLA 4C0DB 1IGQA 3VYGA 5KH6A 4KT0E 5IN1A 1N27A 1NJIR 2YRDA 3VS2A 1OV3A 2XDBA 1G83A 4KRTA 2KRNA 2LC4A 2ESWA 2CUDA 4BI4A 2DD5A 3C95A 4XQ3A 3H0FA 2QEXT 3G71T 5KCOA 1QVPA 3QIIA 2CZ1B 4NL2A 1VQ8A 2NUZA 1WNLA 3VS3A 4K11A 4C8QC 2B8AA 4FT4A 3CCJA 1WXTA 1QKXA 4M7AD 3L2WA 3QPHA 1FMWA 3TSZA 2OI3A 2YRCA 2XKOC 3OY9A 1PD0A 2CYZB 1K9MR 3NTKA 5A0LA 1NJIU 1XOVA 4FSSA 4C8QF 1UJYA 2G6FX 5GMKh 2BZ8A 5HCKA 1RLQC 5CKHA 1PWTA 4DBQA 4M7AB 2EWNA 3M0TA 1SEMA 3JB9I 2L5QA 3ZFJA 4XTXA 2HKNA 1UGSB 1D0ZA 5KYUB 2KXCA 1R77A 5L8RE 4LXCA 2DX1A 3QSUA 4OB3B 3LX7A 3KXTA 2RHZA 3GNFB 3EG9B 2D8HA 5LJ3h 3U23A 4NL3A 1PSFA 3E9FA 2YRVA 1VQOA 3OMGA 4HVVA 8ATCB 1BKBA 3TVTA 4N4GA 1OULA 5FROA 9ATCB 3M0SA 1VQ5Q 3C4SA 3G4SA 2F2XA 4LUEA 2PZ1A 2MMPA 3PMIA 1WHGA 5KYNA 2C0OA 2EJ9A 2DVJA 4J83A 3MEVA 3RBBB 3CBOA 2ZGWA 1HJDA 1KC8C 2CDTA 2H3JA 2EBPA 2ENMA 1UG1A 3CCQA 1KD1R 1ZSGA 2RN8A 1VQKA 1UUEA 2HKQB 3EH2A 2K3XA 2M0YA 2K57A 2QQSA 3M58A 4LDXA 4HVUA 1X69A 2CT4A 5EC7A 4LDYA 1VQ8T 3VYHB 1I1JA 3M0UA 1H3ZA 3CCJT 1W2BP 4JS4A 2DL4A 4Q5WA 3CBPA 1KHIA 2H8HA 2EPDA 2CP5A 1TUDA 2OTJT 3KFVA 4NOYA 1JJ2S 1ARKA 5IHIA 4C0DC 4DBFA 1SG5A 3CCMQ 2DTOA 4MMKA 1Q86R 3MP6A 4FT2A 4JDSA 1RAHB 2EIFA 2ED1A 1IREB 1OZ3A 3SWNA 3QXEB 1W6XA 3DLMA 4E7HA 1X2QA 2K3YA 3M54A 2O4XB 1ZUUA 1GXIE 5GAOq 1VQOT 2BZYA 2D8JA 3BDUA 3H0IA 3CCRQ 4M75G 2QYZA 4PNOA 2D1XA 1BIBA 2KEAA 3HRUA 4QQ6A 1Q86U 3JCMP 1ZSZC 2EAYA 4XTUA 3UATA 4PJOE 4FM4B 1MMAA 3CCUQ 3CCQT 3V7CA 2KT8A 3JB9G 4OB0B 4XU3A 5A2QE 1OU9A 2XDPA 2QTVA 3HRTA 2QTXA 4CC3A 2DYBA 1VQPT 2DVEA 1SSFA 4PFOA 1Q82C 2EYWA 4E7LA 4FU6A 5FU7B 4HCBA 3EGUA 2QDYB 2X51A 3R6OA 2YUNA 4M77E 3A8MB 2A7YA 1KQSP 3M5AA 1VQ4Q 2J7IA 4JLGA 3QDRB 2KGTA 3V7RA 3L2VA 2BE9B 3NFCA 1MV3A 1M1KR 4L59A 4C5EA 2NLUA 1RUWA 2CH4A 2DXTA 3VUBA 3T9NA 4N0AA 5GAMe 2DETA 3MO8A 1QWEA 1KIKA 1OEBA 1VIEA 3OW2S 2DBMA 1YCYA 1ZBJA 3FIFA 2RJDA 5D6XA 4PFPA 2CP2A 1N5ZA 4PJOA 1YITQ 2E3HA 3JAME 5LJ3e 3E2UA 4R0KA 1I81A 4C92E 4QVCA 3DLLA 3JV3A 3M57A 3UPUA 2R5MA 2E64A 2MWOA 2EYQA 4BDZA 1AWOA 1D3BA 4M75C 1ACMB 2C06A 1UE9A 3EGDB 1G3SA 4M77A 3G71Q 2R5AA 4OMLA 3QWXX 4M75F 4KGZB 1QVGS 3PTAA 4DBRA 1NYGA 3DB3A 4NS5A 4ZTJA 1WHJA 1UGPB 3E19A 5DY9A 4ORZA 5GAMj 4XU1A 4RCBA 2QQ9A 5GMKl 2QXFA 1ZBXA 1K8AC 2GNCA 2JUFA 4J8OA 3VKIA 1YNZA 4E7KA 3LGFA 3JB9F 2AT1B 3VS7A 2BUDA 1LCKA 1VYUA 3BDLA 1QVFP 2QQBA 3H6ZA 3JCMe 1TWBA 4OMNA 5LJ3j 4O5VA 4VUBA 2KBTA 1R0BG 1Q7YC 5CIUA 4C92A 3ULRB 3FC3A 3IQLA 2COWA 4LD6A 1M3CA 1Z9ZA 4EPCA 3LGLA 2E5QA 4F7UE 3G6EQ 2RQTA 3CCVQ 3HKSA 1W1FA 2L3SA 1QQJA 2BE7D 3CCRA 2MI6A 1VQ5T 1KK7A 2RHIA 3CBMA 3SDZA 1IO6A 5I11A 4M7DG 1XNIA 3OYHA 2AKLA 1KHCA 5J26A 4LDWA 3X24B 4C0GA 5CO7A 2X9HA 1IZ6A 1C6VX 3VS1A 3CCUA 4XK8E 1WQ7A 1M1GA 4AFQC 2FRYA 2EQMA 5A0DA 3RMQA 2PUOB 4XTYA 2A08A 1NEBA 3JCMW 1KQ1A 1D1CA 1SRLA 2M51A 1ZHIA 4EMKB 4WF2A 1OX9A 4KH1B 4BD3A 1F1BB 2X3XD 3EFOA 2WSCE 2CZ0B 1IHVA 3META 2HL3A 4PJOD 2FZCB 2L3PA 2ZAEA 4IKFA 4JZ3A 3CCEA 2YT6A 2QG9B 1M4ZA 1VQ8Q 1U5SA 1VQ4A 4PLLA 2KI7A 2GQVA 2RJFA 1K4US 3I5SA 2KDSA 2L0AA 4PJOB 4R55A 2I2LA 1K0SA 3CQTA 1SHFA 5CKEA 1GCQA 3DB4A 5CAIA 2DIQA 2QGFB 2KSSA 4M77D 2CP0A 3CCMT 4E7ZA 4C5IA 3X20B 1V76A 1D3BB 1WXBA 5C6SA 3GLXA 2IIMA 1YITA 3L42A 2R58A 2VXEA 1YI2Q 1Y7XA 2AHJB 2OAWA 4M77B 1X27A 2LMJA 2HAXA 4LD9K 3M59A 3JB9H 1YBYA 2E6ZA 3NGPA 1K0XA 3UF4A 1N8RR 1W4SA 2LTOA 1VQOQ 1O9SA 3CCRT 1AOJA 1IXDA 1ZSZA 4M78E 1Y57A 2HBPA 3G4SQ 4M7DC 4C92D 2QGGA 4QVDA 4X9CA 3OYDA 3KUFA 3QZ9B 5J39A 4RUGA 4C8QG 1VYVA 4M7DF 4J9HA 3CCUT 3JCMJ 3A1PA 3R6NA 4LDUA 2VGMA 4C92B 1CKBA 1VQMA 3CCSQ 3UT1A 1N8RU 1G8XA 1VQKQ 2PU9B 5IHKA 2LQNA 3I56A 3HHTB 1UGRB 3SFMA 1VQ9Q 1HYOA 2FPDA 3RR6A 1PKTA 1UTIA 3VUZA 4FW1A 2CZ7B 1OPLA 2P4TA 1VQ4T 1UJ0A 4QQGA 1K9MC 2EGEA 1WPYA 2DJQA 3CXCP 1GFDA 1WDXA 3CPWS 2K5FA 3EG0A 4EDUA 3M0PA 4JJDA 1M90R 3JCMQ 1PSEA 5CKDA 3VV0A 1BYMA 2ZPFB 2M0OA 1PNJA 2HD0A 4BUGA 1LOJA 5DM7R 5D7UA 4LE9A 3S3MA 2KYMA 1NEGA 3LH0A 4J6YA 1BIAA 4J9GA 2EJGA 4KULA 5L23A 1YITT 2RQVA 3TQ7P 3GF5A 4F14A 4A53A 3OYYA 1W70A 3OSSC 4EMKC 3L2RA 1VUBA 4M75A 1I5OB 3C0CA 3MEAA 4DOWA 4BE1A 2FO0A 2C0IA 4E6RA 1M90U 3TEEA 3F70A 2LVMA 4F7UB 4ZNXA 3V8LA 2FHDA 1GCPA 3EGXA 1SSHA 2BKDN 2O31A 2PTKA 2ZPIB 2JM8A 3EH1A 2L8DA 1JU5C 2KAFA 4KGXB 4E7IA 2LZ6B 2W0ZA 2L2PA 3GP8A 1X6GA 1X43A 5GJVB 2F2WA 3PIOA 5IAYA 1B07A 1NBEB 4EIKA 3SB2A 2EJFA 2CP3A 1VIFA 4JJBA 1G3TA 2YSQA 4F16A 1BI3A 1VQMT 3A8OB 4PFZA 2DK3A 4Z89A 2WACA 1PHTA 2DO3A 1B34B 1HK9A 2LX9A 2RMOA 2JZ2A 3M9QA 1QKWA 5GAMh 2ROTA 1XTDA 3O5ZA 4OMPA 1HXDA 2CS7A 1GBRA 3LW5E 1RAAB 1XJWB 1YI2A 1WYXA 2XK0A 3WVDB 2K9GA 3L2QA 3G6ET 2FB7A 2XI9A 3FDRA 2RB6A 3CCVT 4CRIA 2SEMA 3VRZA 2ZPBB 3G1JA 5D6YA 2MCNA 4J9IA 4C5GA 4WCIA 2ZCFB 1W2BA 1MMNA 2M02A 3A8HB 1JJ2A 3QUIA 1KJWA 3URGA 2EKOA 4N4IA 4HCCA 1JXOA 2LDMA 1QMCA 4RKUE 1TS9A 1N9SA 1M2VA 2ABLA 1T0HA 2PUKB 1QP2A 5GAMf 1WIEA 2RI2A 4Y28E 4GY5A 1KSWA 2MIOA 3OS1A 3Q1JA 3CCSA 3ER0A 4M78D 2RF0A 4M7AG 3PNWC 3P8BB 3GOXA 2EFIA 3MHXA 1M1FA 1VQ9A 2JJ9A 2R57A 3GPLA 5LL6S 5LJ3f 1GFCA 2ECZA 4FW2A 2AK5A 4MZMA 2EW3A 3BE3A 3CMAQ 1WHMA 4M78B 3A8GB 1NLOC 3JCMX 4MDXA 3JCMh 2OX7A 2DM1A 1FXXA 3QKJA 5HKCA 1QW1A 1RABB 1I4K1 5FWCA 1JJ2P 4BY6B 2DD4A 4DEXA 1OU8A 3S3OA 2BZXA 3LLRA 2YWWA 1UHFA 2CSQA 4LUDA 4DQ2A 2KE9A 2X4JA 4DA4A 1P92A 2RI5A 2A37A 1E6GA 1EZZB 2AZVA 2K6DA 1QCNA 5I21A 2CKKA 2EYZA 5C0MA 4MZTA 3QBYA 3GBQA 2HSPA 1YI2T 3FEOA 2X4XA 3OYJA 2XD0A 1SF9A 1M1KC 2YUQA 3O8VA 4ZN3A 3VS6A 4D8KA 3LWIA 5GAOl 2RNAA 1KQSA 3L1AA 1TH7A 1M8VA 2MPXC 2JN0A 3OQ5A 1IRXA 1GRIA 4OMQA 3G4ST 5HK0A 1MNEA 3RKXA 2P0QA 1Q81C 3QG1A 3HFOA 1OQKA 3GNGA 3CD6A 3CCLQ 1TSFA 2KRMA 3V8KA 1BBZA 2F69A 6AT1B 2DJZA 2YLCA 1Y96A 2RK2A 3PVQA 3CCST 4A4GA 4M7AC 1YWOA 3E1SA 3JRZA 1VQKT 4R56A 1M9SA 2DRKA 3UWNA 4J9BA 1VQ9T 5GAMg 4ZGDB 3WXMB 2DBKA 1YJWQ 2ZPHB 4M7AF 4AG2C 1C0MA 1VQNQ 1BCMA 2NUTA 2YHTA 4RG2A 3S3NA 4C8QE 3CCEQ 2VXFA 4KUDK 5LJ3g 1KC8U 4E2FB 4QKUA 2GTJA 2QQAA 1WX6A 1BK2A 1UDLA 2LCLA 1H3HA 3SHWA 1YIJQ 1RACB 2KYBA 3OW2P 5FRMA 4QVZA 5A0GA 8AT1B 2EQUA 2P0PA 1WJRA 2DEQA 3EG3A 1K73C 4XTWA 3HPWA 3OYKA 4J7IA 3VS0A 2OTLQ 2A0FB 2KMTA 4FYWB 2ATCB 1KQ2A 4MZPA 2EKHA 4HA8A 2DZCA 3BFMA 3NTHA 5FWBA 1QVFA 3D7SB 2E70A 2XDDA 1TG0A 3REBB 1E6HA 4IUQA 4JLIA 1IGUA 5GAOn 2Z0WA 2J6KA 1U1SA 1UHCA 4RTVA 5IXFA 2GF7A 3ASKA 1AT1B 4BI3A 3CC2A 2EYXA 2K5LA 4A63B 1OPKA 4RTTA 1QVGP 4C8QA 3HSBA 5D6WA 5GANe 2GBQA 3CMAA 5GAN2 3OS0A 4BY6C 2RPNA 5KYXA 4J9FA 1G5VA 3RIRA 3G7ZA 2X35A 5LJ5e 1FMKA 4IUVA 3I9QA 4OF1A 2P0KA 2RHYA 2X4YA 1VQMQ 3SWNB 1UFFA 4ZGJB 3TU4K 1OYXA 1R0CB 3I56Q 2EGAA 2E10A 2QA4Q 7AT1B 5CK9A 1I07A 3EHRA 2I0NA 3GIBA 2H3EB 1I5LA 2PVGB 2HQEA 2RM4A 2F5KA 2ZZDA 5GAOm 4LDVA 1VQ6Q 2J06A 1V1CA 2EVRA 2CGHA 5KCHA 3PMTA 4A4EA 1OZ2A 1NM7A 1NPPA 1YFNA 4IUPA 1Q82U 5GANj 1Y96B 3NTIA 2F2VA 3JB9J 1JRIA 2KT1A 4IIOA 2LJ1A 2SRCA 3EFRA 5LJ5j 1G3YA 3JSCA 4A4FA 2ZPGB 3CCLA 1UB4A 2CT3A 3RNJA 4Z8AA 2E1HA 2FEIA 3M4GA 4MDWA 2QI2A 4FYVB 3E9GA 2HDAA 5GAMd 1RADB 2FG0A 1C1AA 5FU7C 1N9RA 1B3QA 3H9NA 2O01E 2Y4XA 3V8JA 4X1VA 2E5KA 4XU0A 3CC2T 5FU6B 1YJWA 2RK1A 2E12A 1QCFA 1U06A 4E7SA 1VQNA 4MMLA 1AZEA 5LJ3d 3CMAT 3OBWA 1Y71A 4CC4B 3EHQA 3SEMA 1D1AA 2RO0A 1B7TA 1WJSA 3MEWA 1I8FA 4RTUA 1YIJA 2V1RA 1K8AR 2YUPA 4KBMB 4FYYB 5FLXE 3M0QA 4FL6A 5CVIA 2DXBA 5GAOr 3CC4Q 4C8QD 2DMOA 2K2VA 3I5RA 3OYNA 2DL3A 2LT4A 2OTLA 2EQKA 1ZQ1A 4J9DA 2J6OA 4L5GA 3MP8A 3FLGA 4PLIA 1WJQA 3J7AF 2CP6A 4JJCA 1M3AA 4RTYA 3RDVA 4LNPA 4A54A 3CPWA 2CP7A 4PJMA 1K8AU 2QK0A 2COYA 2JVVA 4PL6A 1BU1A 1M5Q1 1K9AA 3EAEA 3JCMd 2JTFA 2L89A 5KYYA 1YJ9Q 1O75A 3NMZC 3CXCA 2V26A 1I0CA 4EMGA 1Q7YU 2AZSA 1BCOA 1MMGA 2X3WD 3X26B 3A98A 3CCLT 5IH2A 1TTHB 2QQRA 4PJOG 3OYAA 3CC7Q 2XG8D 1YP5A 3OYCA 1NJIC 2F5TX 3HTRA 1MMDA 3LH5A 5CKBA 2P4RA 4M75E
chains in the Genus database with same CATH topology
4FM4B 2RA2A 2ZPBB 5D6YA 4C5GA 2VC8A 4II1A 1YJWT 1VQ7A 3CCQT 2ZCFB 2DIGA 2QA4A 3V7CA 1W2BA 1QVFS 2GFUA 2OAUA 3JB9G 5M9OA 1VQNT 2IVWA 4OB0B 3A8HB 3KBGA 4XU3A 5A2QE 1JJ2A 3QUIA 1FX7A 2XDPA 1NE8A 3HRTA 2QTXA 4UC4A 1VQPT 1DJ7B 3CCET 2DVEA 4M77G 1SSFA 3MP1A 4O6JA 3URGA 1Q82C 1NZ9A 2EKOA 4N4IA 1YJNA 4HCCA 1QP3A 1RI0A 4E7LA 4J6XA 4FU6A 2RHUA 1N8RC 1VQ6A 5FU7B 4HCBA 2LDMA 4RKUE 1YIJT 1K73U 3TREA 1N9SA 1JB0E 2QDYB 3R6OA 2D9TA 2EQJA 1QP2A 2PUKB 3A8LB 5GAMf 3OYIA 3A5ZB 2RI2A 4M77E 3A8MB 2A7YA 4Y28E 4GY5A 3M5AA 2XICA 3QDRB 3Q1JA 4JLGA 3OS1A 3V7RA 3I55A 3CCSA 2K5IA 3ER0A 4DOVA 4M78D 3L2VA 4M7AG 4IUTA 3PNWC 2OTLT 3NFCA 3P8BB 3AHUA 2VUBA 5KE3A 5GAN3 4JUVA 3JCMV 3GOXA 4L59A 1R8OB 3PGGA 4C5EA 2EFIA 3MHXA 1M1FA 1VQ9A 3GPLA 2R57A 2NLUA 5LL6S 5LJ3f 1U1TA 2DXTA 3VUBA 3T9NA 4N0AA 5GAMe 2D6FA 2V8IA 4MZMA 4CI0C 3MO8A 3FB9A 4M7AE 5GAN6 1BI1A 4M78B 3A8GB 3RMSA 1VIEA 4C92G 3JCMX 4IUUA 2DZ9A 3OW2S 2VGNA 4MDXA 1YCYA 1AHJB 3FIFA 2RJDA 5D6XA 3JCMh 5FU6C 1FXXA 2HNIA 3QKJA 1X01A 4E47A 5FRNA 4XU2A 5HKCA 2KY9A 4PJOA 1QW1A 3EFSA 1VQ8A 5GANd 1I4K1 3JAME 4BY6B 5LJ3e 2WSFE 2DD4A 2JOYA 3S3OA 1VQKT 3LLRA 5GAOp 1I81A 4C92E 4QVCA 4N0AC 4Z02A 4F7UA 3DLLA 1JBMA 3M57A 3UPUA 3VU3C 1YHQA 4BE2A 1XQHA 3M55A 3ZBDA 1MGQA 3HRSA 5CQYA 4DQ2A 2R5MA 2X4JA 3MCAB 5LJ5d 4BDYA 4V2SA 4DA4A 2E64A 1P92A 2RI5A 2KVQG 2MWOA 4L6V5 2EYQA 4BDZA 4C8QB 3X28B 1D3BA 4M75C 1FWZA 5I21A 2MF2A 4BE0A 4PJOC 2CKKA 3OBYA 5C0MA 4MZTA 3WVEB 2C06A 2PVDB 1M90C 4C0ZA 4BB7A 3QBYA 3QZ5B 1G3SA 2M1HA 4M77A 2R5AA 1YI2T 5EG2A 2V8JA 3FEOA 1KD1C 3QYHB 4M75F 2X4XA 3OYJA 2XD0A 2E6NA 4PJOF 1M1KC 1BI0A 3C94A 3O8VA 1NPRA 1QVGS 3BY7A 3M4YA 4ZN3A 5GAN7 3CC4A 3PTAA 3DB3A 4NS5A 4ZTJA 3M53A 3I56T 3HP9A 1VQ7T 3LWIA 5DLOA 2QA4T 5GAOl 1UGPB 3ME9A 1KQSA 3E19A 5DY9A 5GAMj 1B34A 3L1AA 1TH7A 4OB2B 4BI8B 1M8VA 4XU1A 2O4XA 4RCBA 2QQ9A 2WSEE 5GAN5 2DXUA 5GMKl 2JN0A 4M7AA 2QXFA 1ZBXA 4KUIA 4M77C 3OQ5A 2DAQA 4ELZC 2JUFA 1K8AC 4J8OA 3VKIA 4QW2A 4E7KA 3SWNC 3QHSA 3LGFA 3OSVA 5HK0A 3G4ST 3JB9F 4J6WA 3JCMb 3RKXA 3J81E 2BUDA 4J7FA 2P0QA 1YJNT 1Q81C 3BDLA 3QG1A 2QQBA 3H6ZA 3HFOA 2RI3A 4IURA 3JCMe 3INZA 1VQ6T 3GNGA 5LJ3j 4F7UG 4M77F 4O5VA 3CD6A 1KG1A 2OTJA 4VUBA 1Q7YC 2XHCA 3TCJA 3V8KA 2QEXA 3G71A 5CIUA 3V7SA 4C92A 4JJNK 3FC3A 4LD6A 2F69A 2ZPEB 2DJZA 3OYMA 2YLCA 1Y96A 4ZTFA 3I55T 2RK2A 3CCST 4M7AC 4A4GA 4OP0A 4EPCA 1YJ9A 3E1SA 2FYKA 3LGLA 2E5QA 3BW1A 3JRZA 3P8DA 2RJCA 4F7UE 1M9SA 5GMKm 4RMOA 4R56A 4X9DA 5IT9E 3HKSA 3UWNA 1VQ9T 5GAMg 4ZGDB 3WXMB 4JRPA 4ELYC 1Q86C 2ZPHB 1MHNA 4M7AF 4JRQA 2RJEA 3LYIA 4XTZA 2RH2A 4OMFB 2LNVA 3CCRA 2M9UA 3OMCA 1WQWA 2YHTA 2MI6A 4JRIA 4RG2A 4C92C 5CKFA 3S3NA 1K9MU 2RHIA 1VQ5T 4C8QE 3CBMA 5GANh 4J5YA 2DPPB 2LCCA 3SDZA 3CC7A 1V29B 3OB9A 2VV5A 3FRNA 2DXCA 3RKWA 2VXFA 5CR2A 4KUDK 2MWPA 5LJ3g 1XNIA 3OYHA 4M7DG 1KC8U 1KHCA 5J26A 4LDWA 4C92F 5GAN4 2PQWA 4OB1B 2QQAA 3X24B 3OS5A 5CO7A 4C0GA 5LJ5h 2LCLA 2LT1A 1IZ6A 2FVUA 4ME7A 3MEUA 5I2SA 5FRMA 4QVZA 5A0GA 3CCUA 4XK8E 1WQ7A 1M1GA 1YHQT 2EQUA 2P0PA 1WJRA 2DEQA 2EQMA 3RMQA 2PUOB 5A0DA 4M7DE 4XTYA 4OGCA 1K73C 3OS2A 3G6EA 4XTWA 3HPWA 2A3LA 3OYKA 2L3RA 4J7IA 2DTHA 2LQKA 3JCMW 2FL7A 1KQ1A 3CCVA 2LQ8A 2RHXA 1ZHIA 4EMKB 4WF2A 4BD3A 2IG0A 2KMTA 2WSCE 4M78A 2CZ0B 5HK3A 4Y91A 4ATOA 5GMKi 1KQ2A 4FIBA 4M75D 2KK4A 3FJPA 3META 4MZPA 5KE2A 3CXCS 4PJOD 4HA8A 3CMEA 2DZCA 3BFMA 3NTHA 1QVFA 2XDDA 2E70A 1VQPA 2K4YA 1H641 3QO3A 3CCEA 5GAN8 4IKFA 1M4ZA 4IUQA 2YLBA 4FSXA 3PT9A 4JLIA 2DTIA 1VQ4A 2VYTA 5GANf 3CC4T 3OYFA 3RESA 3CPFA 4PLLA 3SD4A 2LRQA 3H8ZA 3RKYA 5GAOn 2GQVA 4YTLA 4C0DB 2RJFA 2JNGA 3VYGA 5KH6A 4M75B 2KDSA 4KT0E 4A4HA 4PJOB 1U1SA 5IN1A 3X25B 1X6OA 4R55A 1N27A 2I2LA 3JB9D 2GF7A 3ASKA 4BI3A 3CC2A 3RERA 5LJ5f 2K5LA 5CKEA 3HL8A 4C8QA 2XDBA 3DB4A 5CAIA 3HSBA 2DIQA 2KSSA 5D6WA 5GANe 3L2UA 3CMAA 4M77D 5GAN2 3OS0A 4BY6C 2LC4A 3S6WA 4GLKA 1KD1U 3CCMT 1G5VA 2V8KA 4BI4A 2DD5A 3RIRA 4C5IA 3C95A 1W2BS 3X20B 4XQ3A 1D3BB 2DKGA 3G7ZA 5C6SA 3G71T 5KCOA 2QEXT 3GLXA 1WGSA 5CCAA 2X35A 1YITA 5LJ5e 1QVPA 3L42A 2R58A 3JCMf 3QIIA 2VXEA 2CZ1B 4NL2A 1Y7XA 2AHJB 2HQXA 4IUVA 1WNLA 4F7UF 3LWHA 1YJ9T 4M77B 2P0KA 4OF1A 4C8QC 1S72A 4M7DA 2B8AA 2RHYA 2X4YA 3SWNB 2HAXA 4FT4A 4LD9K 4M78G 3M59A 4QQDA 4ZGJB 3CCJA 3TU4K 3JB9H 1OYXA 5I2MA 4M7AD 1YBYA 2PVOB 2E6ZA 3QPHA 3L2WA 3OW2A 3OY9A 2XKOC 2E10A 1W4SA 2CYZB 3NTKA 5A0LA 2LTOA 1NJIU 1XOVA 5CK9A 4C8QF 1X75C 4B9XA 1O9SA 3CCRT 3OYGA 5GMKh 3GIBA 3CC7T 4M78E 5CKHA 2HBPA 4M7DC 1I5LA 4M7AB 4C92D 2EWNA 2PVGB 2HQEA 4QVDA 3JB9I 2L5QA 3ZFJA 3QJ6A 5J3BA 2RM4A 2F5KA 2ZZDA 4XTXA 5GAOm 4X9CA 4LDVA 3OYDA 1UGSB 3KUFA 2CGHA 3QZ9B 3PMTA 4A4KA 5KCHA 5L8RE 1UEBA 5J39A 4C8QG 3QSUA 4M7DF 2E65A 3CCUT 4A4EA 1OZ2A 2G3RA 1NPPA 4OB3B 3JCMJ 3LX7A 4IUPA 3KXTA 4E7JA 4LDUA 2RHZA 2VGMA 1Q82U 4C92B 3GNFB 1VQLA 1VQMA 4RG8A 5GANj 1Y96B 3UT1A 1N8RU 5LJ3h 4P5NA 4OGEA 2PU9B 4ZN1A 3NTIA 3I56A 3HHTB 3JB9J 4NL3A 1UGRB 1PSFA 3E9FA 3SFMA 4RCCA 2YRVA 1JRIA 1VQOA 3OMGA 1QVGA 1BKBA 3EFRA 5AYFA 5LJ5j 4N4GA 1G3YA 2XU8A 3JSCA 4A4FA 2ZPGB 3CMET 3ZEHA 1UB4A 3CCLA 4D6WA 4C5HA 5FROA 2E1HA 3C4SA 3VUZA 4EMHA 3G4SA 3PIPA 2BIVA 3M4GA 1LJOA 4MDWA 2MMPA 2CZ7B 2QI2A 5CQXA 2P4TA 1VQ4T 3PMIA 3UDCA 3E9GA 2EJ9A 5GAMd 1U8RA 1LNXA 4QQGA 1K9MC 4ZGEB 3OYLA 3CEYA 4J83A 3OYEA 1WPYA 2GFAA 1UGQB 5FU7C 3CPWS 2K5FA 1N9RA 3MEVA 4EDUA 3V8JA 2O01E 2Y4XA 3CBOA 3QYGB 1G3WA 4XU0A 3CC2T 2KQWA 3JCMQ 1PSEA 2ZGWA 5FU6B 5CKDA 1KC8C 2H3JA 1YJWA 2RK1A 2E12A 3VV0A 3CCQA 1BYMA 2ZPFB 5GANg 2M0OA 5GMKe 2HD0A 4BUGA 4EMKA 1LOJA 5DM7R 1VQNA 4MMLA 4C0FA 5LJ3d 3CMAT 1VQKA 3OBWA 3P8HA 1Y71A 4XAXB 3S3MA 4JS5A 4X34A 3LH0A 4HKEA 4J6YA 2Y4YA 3N5BB 1BIAA 2K3XA 1KQSS 2RO0A 5LJ5g 2EJGA 2K57A 2QQSA 3M58A 4KULA 4LDXA 4JRKA 1YITT 1WJSA 3GF5A 2GCXA 2XIDA 2RD1A 3MEWA 4LDYA 2E41A 1VQ5A 1I8FA 4A53A 3OYYA 1YIJA 3VYHB 1VQ8T 1S72T 3OSSC 4KBMB 4M78C 4EMKC 5FLXE 3L2RA 1H3ZA 1VUBA 4M75A 3CCJT 4JS4A 3OYBA 4FL6A 4N4HA 5CVIA 2DXBA 5GAOr 4Q5WA 3MEAA 4DOWA 4BE1A 4C8QD 2K2VA 3OYNA 1M90U 3TEEA 3F70A 2LVMA 4F7UB 3V8LA 2LT4A 2FHDA 3CBPA 3JCMg 2EQKA 2OTLA 1KHIA 1ZQ1A 4L5GA 3MP8A 4M78F 3FLGA 4PLIA 5DLQE 1WJQA 3PFSA 1BI2A 3J7AF 3CD6T 2BKDN 2OTJT 1M1KU 2ZPIB 4BACA 4NOYA 2L8DA 4TVRA 4OVAA 1JJ2S 2KAFA 4C0DC 4E7IA 1OI1A 3L2ZA 3GP8A 4A54A 4M7DD 3VJPA 3PIOA 2DTOA 3CPWA 4HCZA 4MMKA 5IAYA 3MP6A 4FT2A 4JDSA 1RL2A 2EIFA 3QJYA 5HY6A 3SB2A 2EJFA 1K8AU 2JVVA 1IREB 1OZ3A 4PL6A 1VIFA 3SWNA 2MAMA 3QXEB 1M5Q1 2JTMA 3EAEA 5GMKj 2JTFA 3JCMd 2L89A 1G3TA 1VQMT 1VQLT 1BI3A 3OA6A 1Q81U 3J80E 3DLMA 4E7HA 3A8OB 1O75A 3JCMc 3CXCA 2DK3A 2WACA 2K3YA 1Y07A 3DKMA 4M7DB 2D0QB 3M54A 4PJOE 2DO3A 1B34B 1HK9A 3HFNA 2LX9A 4EMGA 2O4XB 3C12A 1Q7YU 1GXIE 1EIFA 3M56A 3RUXA 2JZ2A 5GAOq 1VQOT 3M9QA 1N6AA 3X26B 3BDUA 3CCLT 5GAMh 1XTDA 4M75G 4PKCC 4B9WA 4XTVA 2QQRA 4PJOG 1HXDA 4PNOA 2Y90A 3OYAA 2CS7A 2XG8D 3OYCA 1NJIC 1BIBA 2F5TX 3LW5E 2M16A 4HT9A 1YI2A 3HRUA 4QQ6A 3CCMA 1Q86U 2XK0A 3JCMP 2EAYA 3WVDB 3L2QA 3G6ET 2FB7A 4HT8A 4XTUA 2XI9A 5CKBA 3FDRA 4M75E 2X4WA 2RB6A 3CCVT 4CRIA 2CZ6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJN K;  1ZHI A;  4KUD K;  4DOV A;  4FT4 A;  4LD9 K;  1ZBX A;  4KUI A;  4DOW A;  3TU4 K;  4BB7 A;  4FT2 A;  2FVU A;  1W4S A;  1M4Z A;  4FSX A;  3PT9 A;  4KUL A;  3PTA A;  4DA4 A;  2FL7 A; 
#chains in the Genus database with same CATH topology
 2HQH A;  3EG9 A;  2VC8 A;  3NHN A;  4II1 A;  1YJW T;  2DIG A;  2JM9 A;  2QA4 A;  2GFU A;  2OAU A;  5M9O A;  1VQN T;  2IVW A;  1FX7 A;  2AKK A;  4UC4 A;  2W10 A;  1QWF A;  3CPW P;  2LX7 A;  3CCE T;  4M77 G;  1RAF B;  3MP1 A;  2QAZ A;  2DA9 A;  1NZ9 A;  2DNU A;  1RI0 A;  2VB6 A;  2MYS A;  1VQ6 A;  3CME Q;  1YIJ T;  2VVK A;  2O9V A;  2EQJ A;  3A8L B;  2JS2 A;  2NYS A;  4Y92 A;  2XIC A;  2FZK B;  4DOV A;  2D0N A;  4IUT A;  2OTL T;  3AHU A;  1KFZ A;  2VUB A;  5KE3 A;  2O88 A;  5GAN 3;  4JUV A;  4GLM A;  2HL5 C;  4CI0 C;  3EFO B;  3RMS A;  4C92 G;  4IUU A;  2RQR A;  2KR3 A;  1AHJ B;  3H0H A;  5FU6 C;  1RI9 A;  1WI7 A;  2KY9 A;  2JOY A;  2EQI A;  2GQI A;  3QWY A;  1S72 Q;  4N0A C;  1QLY A;  2KNB B;  3H41 A;  1JBM A;  1YHQ A;  1XQH A;  3M55 A;  3HRS A;  5CQY A;  4BDY A;  1E7O A;  5AT1 B;  2KVQ G;  4L6V 5;  2RQW A;  3X28 B;  1RAG B;  4BE0 A;  4PJO C;  2DL5 A;  3CD6 Q;  2HBW A;  1Q95 G;  4J9E A;  2V8J A;  1KD1 C;  3QYH B;  4PJO F;  1BI0 A;  1M3B A;  5GAN 7;  3CC4 A;  3M53 A;  3I56 T;  3HP9 A;  2QA4 T;  2GGR A;  3ME9 A;  2DER A;  4OB2 B;  1VQL Q;  1TUG B;  2O4X A;  3I35 A;  4RTX A;  2NWM A;  1EFN A;  4M77 C;  4KUI A;  2KRO A;  5KYY B;  4J7F A;  1IB8 A;  1ZSZ B;  2NUP A;  2RI3 A;  2DEU A;  1VQ6 T;  3INZ A;  1VYT A;  4F7U G;  4M77 F;  2CSI A;  2OTJ A;  1MUZ A;  1Z9Q A;  2ZPE B;  2LNH B;  3OYM A;  4ZTF A;  2O2O A;  1ABQ A;  5ECA A;  1YJ9 A;  1WXU A;  3BW1 A;  2HCK A;  3P8D A;  2RJC A;  4RMO A;  4X9D A;  5IT9 E;  1AD5 A;  2RQU A;  4JRP A;  4ELY C;  1Q86 C;  4LN2 A;  4JRQ A;  2RJE A;  4OMF B;  2LNV A;  3OMC A;  1WQW A;  4JRI A;  4C92 C;  1K9M U;  5CKF A;  5GAN h;  3CC7 A;  1V29 B;  3OB9 A;  1M8M A;  2COZ A;  4J9C A;  3RKW A;  5CR2 A;  2MWP A;  1HSQ A;  4IIM A;  1ABO A;  5GAN 4;  4C92 F;  4OB1 B;  4QT7 A;  5LJ5 h;  4ME7 A;  3MEU A;  4WTO B;  2KRS A;  1YHQ T;  1PRL C;  2OJ2 A;  3CC2 Q;  2JXB A;  4M7D E;  1PM3 A;  1Y0M A;  2CRE A;  2A3L A;  2L3R A;  1ZLM A;  2DTH A;  2FL7 A;  2EGC A;  2LQ8 A;  1H92 A;  2DFU A;  2DRM A;  4ATO A;  5HK3 A;  4FIB A;  4M75 D;  2KK4 A;  2BTT A;  4PK4 A;  3CME A;  1T3L A;  1TXQ A;  1VQP A;  2JS0 A;  2K3B A;  5GAN 8;  4FSX A;  2DTI A;  2VYT A;  5GAN f;  3CC4 T;  3OYF A;  2HMA A;  3CPF A;  2LRQ A;  3RKY A;  2JNG A;  4M75 B;  4A4H A;  3X25 B;  1X6O A;  4AG1 C;  3JB9 D;  3RER A;  5LJ5 f;  3HL8 A;  4FCY A;  2HZY A;  3EGX B;  3L2U A;  4AT1 B;  3S6W A;  3EGD A;  4GLK A;  1KD1 U;  2FPE A;  1G2B A;  2V8K A;  1W2B S;  2DKG A;  2HSE B;  1WGS A;  5CCA A;  3JCM f;  1SKU B;  4F7U F;  2HQX A;  1YJ9 T;  3LWH A;  1S72 A;  4M7D A;  1T0J A;  1GCQ C;  4M78 G;  1JEG A;  4QQD A;  1U3O A;  5I2M A;  4F17 A;  3OW2 A;  2PVO B;  1TU0 B;  1NYF A;  1VQ7 Q;  2E3I A;  1X75 C;  4B9X A;  3OYG A;  2P84 A;  1JO8 A;  3CC7 T;  1KC8 R;  1K1Z A;  2YXY A;  5IHN A;  1S1N A;  3QJ6 A;  5J3B A;  1YJN Q;  1PC0 A;  4CC2 A;  2NUP B;  4A4K A;  1WHL A;  4B6M A;  1UEB A;  1BB9 A;  2LCS A;  2E65 A;  1TOV A;  2G3R A;  2VAS A;  3PVL A;  4E7J A;  2KXD A;  1VQL A;  3I55 Q;  2FRW A;  4RG8 A;  2DLP A;  4P5N A;  4OGE A;  4ZN1 A;  1RAE B;  1AWW A;  4JPB W;  4RCC A;  1QVG A;  5AYF A;  2L3Q A;  3CME T;  2XU8 A;  1M2O A;  1X6B A;  3ZEH A;  4D6W A;  4C5H A;  2J05 A;  5FW9 A;  4EMH A;  3PIP A;  2BIV A;  1LJO A;  3THK A;  5CQX A;  3UDC A;  2K2M A;  2DYI A;  1U8R A;  1LNX A;  1M2V B;  4ZGE B;  3OYL A;  3CEY A;  3OYE A;  2GFA A;  1UGQ B;  2VWF A;  2C0T A;  3QYG B;  1G3W A;  2KQW A;  1ZX6 A;  2JW4 A;  5GAN g;  5GMK e;  4EMK A;  1WZO A;  4AFZ C;  4C0F A;  2FPF A;  3P8H A;  4XAX B;  4ESR A;  1ZUK A;  4JS5 A;  4X34 A;  4HKE A;  4KGV B;  2Y4Y A;  3N5B B;  1KQS S;  1GL5 A;  5LJ5 g;  3REA B;  1T3S A;  4JRK A;  2ROL A;  2GCX A;  1AWJ A;  2RD1 A;  2XID A;  1VQ5 A;  2E41 A;  1S72 T;  4M78 C;  1LVK A;  2O9S A;  3OYB A;  4N4H A;  1SHG A;  1Q81 R;  1WHK A;  2DF6 A;  2JMC A;  3JCM g;  3VS5 A;  4ANJ A;  4M78 F;  5DLQ E;  1J3T A;  1ZA1 B;  1JXM A;  3PFS A;  1BI2 A;  3CD6 T;  1YN8 A;  1M1K U;  4BAC A;  1WA7 A;  4TVR A;  4OVA A;  2JTE A;  2LJ3 A;  1OI1 A;  1D1B A;  2GTO A;  2VKN A;  3L2Z A;  4M7D D;  3VJP A;  4HCZ A;  1Q82 R;  2QEX Q;  2LQW A;  1RL2 A;  3QJY A;  4JZ4 A;  5HY6 A;  2LP5 A;  2MAM A;  2JTM A;  5GMK j;  1VQL T;  1Q81 U;  3OA6 A;  1A0N B;  3J80 E;  3JCM c;  1FYN A;  1Y07 A;  2CUB A;  3DKM A;  2D0Q B;  4M7D B;  4CC7 A;  3HFN A;  3C12 A;  1EIF A;  3M56 A;  3RUX A;  4FYX B;  1N6A A;  4PKC C;  1UGV A;  4XTV A;  4B9W A;  1CKA A;  2Y90 A;  2ED0 A;  1K73 R;  1RLP C;  2M16 A;  1VA7 A;  2MK5 A;  4HT9 A;  5KYW A;  3MPU B;  3CCM A;  1VOM A;  1WLP B;  2K79 A;  3M0R A;  4HT8 A;  1YCS B;  1M27 C;  1YWP A;  2X4W A;  2CZ6 B;  2J6F A;  2RA2 A;  2QAS A;  1VQ7 A;  1QVF S;  3KBG A;  3PE0 A;  1NE8 A;  1M30 A;  1DJ7 B;  3UA7 A;  4AFU C;  4O6J A;  2NUT B;  1YJN A;  1QP3 A;  4J6X A;  2RHU A;  4DEY A;  1N8R C;  1IHW A;  3MJX A;  1K73 U;  3TRE A;  1JB0 E;  1D09 B;  1NLP C;  2D9T A;  4HVW A;  3TSW A;  5GJW B;  3OYI A;  3A5Z B;  1RAI B;  1PRM C;  3I55 A;  2K5I A;  1YHQ Q;  1AZG B;  1GBQ A;  3JCM V;  1R8O B;  3PGG A;  4OMM A;  1MND A;  4F04 B;  1U1T A;  5I22 A;  2D6F A;  2V8I A;  2AIR B;  3FB9 A;  4M7A E;  5GAN 6;  1BI1 A;  1HD3 A;  2EYY A;  1SPK A;  1K76 A;  2DZ9 A;  2MOX A;  1CSK A;  2VGN A;  3UA6 A;  2HEQ A;  4OMO A;  2HNI A;  1X01 A;  4E47 A;  5FRN A;  4XU2 A;  3EFS A;  3ZL7 C;  5GAN d;  2WSF E;  2DE0 X;  3NPF A;  2F1L A;  5GAO p;  4Z02 A;  4F7U A;  1Q7Y R;  3VU3 C;  4BE2 A;  3ZBD A;  3CCJ Q;  1MGQ A;  3MCA B;  5LJ5 d;  4V2S A;  2K7A A;  4PJL A;  3VRY A;  1WHH A;  1ZUY A;  4C8Q B;  1FWZ A;  1D0Y A;  2MF2 A;  1EX4 A;  3OBY A;  1OX8 A;  3WVE B;  2A36 A;  2PVD B;  2PNI A;  1M90 C;  2OTJ Q;  4C0Z A;  4BB7 A;  5KYX B;  1AVZ C;  3QZ5 B;  2M1H A;  5EG2 A;  4Z88 A;  1MV0 B;  2E6N A;  3C94 A;  4HCK A;  1NPR A;  3BY7 A;  3M4Y A;  1VQ7 T;  5DLO A;  2V1Q A;  2XMF A;  1B34 A;  3QDF A;  1QCO A;  4BI8 B;  2DIL A;  2WSE E;  5GAN 5;  2DXU A;  3VS4 A;  4M7A A;  2DAQ A;  4ELZ C;  4QW2 A;  3SWN C;  3QHS A;  3OSV A;  4J6W A;  3JCM b;  3J81 E;  1AWX A;  2E4H A;  4RTW A;  1ZA2 B;  1YJN T;  5KYU A;  1AEY A;  1D0X A;  1JQQ A;  4IUR A;  4KH0 B;  1KG1 A;  4AFS C;  4HXJ A;  1OOT A;  2DL7 A;  2XHC A;  3FJ5 A;  3TCJ A;  2QEX A;  3G71 A;  3V7S A;  4AMC A;  4JJN K;  3EG2 A;  1PG5 B;  1NG2 A;  3I55 T;  2IPO B;  4OP0 A;  2FYK A;  1PKS A;  5KYW B;  4RTZ A;  5GMK m;  2YUO A;  2YDL A;  1MHN A;  3CCQ Q;  2B86 A;  3EG1 A;  4D8D A;  2A28 A;  3LYI A;  4XTZ A;  2RH2 A;  1PCX A;  2LJ0 A;  2M9U A;  2QDL A;  4J5Y A;  2DPP B;  2LCC A;  2CH4 W;  1VQP Q;  2VV5 A;  3AT1 B;  2DXC A;  3FRN A;  5IXB A;  2PQW A;  1X2K A;  4GBQ A;  3OS5 A;  2LT1 A;  2JT4 A;  2FVU A;  5I2S A;  4PJJ A;  2DL8 A;  1UEC A;  3MKD A;  4OGC A;  2JMA A;  3OS2 A;  3G6E A;  1TUC A;  2LQK A;  4PJN A;  3CCV A;  2RHX A;  1H8K A;  2IG0 A;  4M78 A;  4Y91 A;  5GMK i;  3FJP A;  5KE2 A;  3CXC S;  2FZG B;  1WFW A;  4DBH A;  1PD1 A;  1H64 1;  3QO3 A;  2K4Y A;  4M4Z A;  2YLB A;  1LPL A;  3PT9 A;  1FMV A;  3RES A;  3SD4 A;  3H8Z A;  1SRM A;  4YTL A;  4C0D B;  1IGQ A;  3VYG A;  5KH6 A;  4KT0 E;  5IN1 A;  1N27 A;  1NJI R;  2YRD A;  3VS2 A;  1OV3 A;  2XDB A;  1G83 A;  4KRT A;  2KRN A;  2LC4 A;  2ESW A;  2CUD A;  4BI4 A;  2DD5 A;  3C95 A;  4XQ3 A;  3H0F A;  2QEX T;  3G71 T;  5KCO A;  1QVP A;  3QII A;  2CZ1 B;  4NL2 A;  1VQ8 A;  2NUZ A;  1WNL A;  3VS3 A;  4K11 A;  4C8Q C;  2B8A A;  4FT4 A;  3CCJ A;  1WXT A;  1QKX A;  4M7A D;  3L2W A;  3QPH A;  1FMW A;  3TSZ A;  2OI3 A;  2YRC A;  2XKO C;  3OY9 A;  1PD0 A;  2CYZ B;  1K9M R;  3NTK A;  5A0L A;  1NJI U;  1XOV A;  4FSS A;  4C8Q F;  1UJY A;  2G6F X;  5GMK h;  2BZ8 A;  5HCK A;  1RLQ C;  5CKH A;  1PWT A;  4DBQ A;  4M7A B;  2EWN A;  3M0T A;  1SEM A;  3JB9 I;  2L5Q A;  3ZFJ A;  4XTX A;  2HKN A;  1UGS B;  1D0Z A;  5KYU B;  2KXC A;  1R77 A;  5L8R E;  4LXC A;  2DX1 A;  3QSU A;  4OB3 B;  3LX7 A;  3KXT A;  2RHZ A;  3GNF B;  3EG9 B;  2D8H A;  5LJ3 h;  3U23 A;  4NL3 A;  1PSF A;  3E9F A;  2YRV A;  1VQO A;  3OMG A;  4HVV A;  8ATC B;  1BKB A;  3TVT A;  4N4G A;  1OUL A;  5FRO A;  9ATC B;  3M0S A;  1VQ5 Q;  3C4S A;  3G4S A;  2F2X A;  4LUE A;  2PZ1 A;  2MMP A;  3PMI A;  1WHG A;  5KYN A;  2C0O A;  2EJ9 A;  2DVJ A;  4J83 A;  3MEV A;  3RBB B;  3CBO A;  2ZGW A;  1HJD A;  1KC8 C;  2CDT A;  2H3J A;  2EBP A;  2ENM A;  1UG1 A;  3CCQ A;  1KD1 R;  1ZSG A;  2RN8 A;  1VQK A;  1UUE A;  2HKQ B;  3EH2 A;  2K3X A;  2M0Y A;  2K57 A;  2QQS A;  3M58 A;  4LDX A;  4HVU A;  1X69 A;  2CT4 A;  5EC7 A;  4LDY A;  1VQ8 T;  3VYH B;  1I1J A;  3M0U A;  1H3Z A;  3CCJ T;  1W2B P;  4JS4 A;  2DL4 A;  4Q5W A;  3CBP A;  1KHI A;  2H8H A;  2EPD A;  2CP5 A;  1TUD A;  2OTJ T;  3KFV A;  4NOY A;  1JJ2 S;  1ARK A;  5IHI A;  4C0D C;  4DBF A;  1SG5 A;  3CCM Q;  2DTO A;  4MMK A;  1Q86 R;  3MP6 A;  4FT2 A;  4JDS A;  1RAH B;  2EIF A;  2ED1 A;  1IRE B;  1OZ3 A;  3SWN A;  3QXE B;  1W6X A;  3DLM A;  4E7H A;  1X2Q A;  2K3Y A;  3M54 A;  2O4X B;  1ZUU A;  1GXI E;  5GAO q;  1VQO T;  2BZY A;  2D8J A;  3BDU A;  3H0I A;  3CCR Q;  4M75 G;  2QYZ A;  4PNO A;  2D1X A;  1BIB A;  2KEA A;  3HRU A;  4QQ6 A;  1Q86 U;  3JCM P;  1ZSZ C;  2EAY A;  4XTU A;  3UAT A;  4PJO E;  4FM4 B;  1MMA A;  3CCU Q;  3CCQ T;  3V7C A;  2KT8 A;  3JB9 G;  4OB0 B;  4XU3 A;  5A2Q E;  1OU9 A;  2XDP A;  2QTV A;  3HRT A;  2QTX A;  4CC3 A;  2DYB A;  1VQP T;  2DVE A;  1SSF A;  4PFO A;  1Q82 C;  2EYW A;  4E7L A;  4FU6 A;  5FU7 B;  4HCB A;  3EGU A;  2QDY B;  2X51 A;  3R6O A;  2YUN A;  4M77 E;  3A8M B;  2A7Y A;  1KQS P;  3M5A A;  1VQ4 Q;  2J7I A;  4JLG A;  3QDR B;  2KGT A;  3V7R A;  3L2V A;  2BE9 B;  3NFC A;  1MV3 A;  1M1K R;  4L59 A;  4C5E A;  2NLU A;  1RUW A;  2CH4 A;  2DXT A;  3VUB A;  3T9N A;  4N0A A;  5GAM e;  2DET A;  3MO8 A;  1QWE A;  1KIK A;  1OEB A;  1VIE A;  3OW2 S;  2DBM A;  1YCY A;  1ZBJ A;  3FIF A;  2RJD A;  5D6X A;  4PFP A;  2CP2 A;  1N5Z A;  4PJO A;  1YIT Q;  2E3H A;  3JAM E;  5LJ3 e;  3E2U A;  4R0K A;  1I81 A;  4C92 E;  4QVC A;  3DLL A;  3JV3 A;  3M57 A;  3UPU A;  2R5M A;  2E64 A;  2MWO A;  2EYQ A;  4BDZ A;  1AWO A;  1D3B A;  4M75 C;  1ACM B;  2C06 A;  1UE9 A;  3EGD B;  1G3S A;  4M77 A;  3G71 Q;  2R5A A;  4OML A;  3QWX X;  4M75 F;  4KGZ B;  1QVG S;  3PTA A;  4DBR A;  1NYG A;  3DB3 A;  4NS5 A;  4ZTJ A;  1WHJ A;  1UGP B;  3E19 A;  5DY9 A;  4ORZ A;  5GAM j;  4XU1 A;  4RCB A;  2QQ9 A;  5GMK l;  2QXF A;  1ZBX A;  1K8A C;  2GNC A;  2JUF A;  4J8O A;  3VKI A;  1YNZ A;  4E7K A;  3LGF A;  3JB9 F;  2AT1 B;  3VS7 A;  2BUD A;  1LCK A;  1VYU A;  3BDL A;  1QVF P;  2QQB A;  3H6Z A;  3JCM e;  1TWB A;  4OMN A;  5LJ3 j;  4O5V A;  4VUB A;  2KBT A;  1R0B G;  1Q7Y C;  5CIU A;  4C92 A;  3ULR B;  3FC3 A;  3IQL A;  2COW A;  4LD6 A;  1M3C A;  1Z9Z A;  4EPC A;  3LGL A;  2E5Q A;  4F7U E;  3G6E Q;  2RQT A;  3CCV Q;  3HKS A;  1W1F A;  2L3S A;  1QQJ A;  2BE7 D;  3CCR A;  2MI6 A;  1VQ5 T;  1KK7 A;  2RHI A;  3CBM A;  3SDZ A;  1IO6 A;  5I11 A;  4M7D G;  1XNI A;  3OYH A;  2AKL A;  1KHC A;  5J26 A;  4LDW A;  3X24 B;  4C0G A;  5CO7 A;  2X9H A;  1IZ6 A;  1C6V X;  3VS1 A;  3CCU A;  4XK8 E;  1WQ7 A;  1M1G A;  4AFQ C;  2FRY A;  2EQM A;  5A0D A;  3RMQ A;  2PUO B;  4XTY A;  2A08 A;  1NEB A;  3JCM W;  1KQ1 A;  1D1C A;  1SRL A;  2M51 A;  1ZHI A;  4EMK B;  4WF2 A;  1OX9 A;  4KH1 B;  4BD3 A;  1F1B B;  2X3X D;  3EFO A;  2WSC E;  2CZ0 B;  1IHV A;  3MET A;  2HL3 A;  4PJO D;  2FZC B;  2L3P A;  2ZAE A;  4IKF A;  4JZ3 A;  3CCE A;  2YT6 A;  2QG9 B;  1M4Z A;  1VQ8 Q;  1U5S A;  1VQ4 A;  4PLL A;  2KI7 A;  2GQV A;  2RJF A;  1K4U S;  3I5S A;  2KDS A;  2L0A A;  4PJO B;  4R55 A;  2I2L A;  1K0S A;  3CQT A;  1SHF A;  5CKE A;  1GCQ A;  3DB4 A;  5CAI A;  2DIQ A;  2QGF B;  2KSS A;  4M77 D;  2CP0 A;  3CCM T;  4E7Z A;  4C5I A;  3X20 B;  1V76 A;  1D3B B;  1WXB A;  5C6S A;  3GLX A;  2IIM A;  1YIT A;  3L42 A;  2R58 A;  2VXE A;  1YI2 Q;  1Y7X A;  2AHJ B;  2OAW A;  4M77 B;  1X27 A;  2LMJ A;  2HAX A;  4LD9 K;  3M59 A;  3JB9 H;  1YBY A;  2E6Z A;  3NGP A;  1K0X A;  3UF4 A;  1N8R R;  1W4S A;  2LTO A;  1VQO Q;  1O9S A;  3CCR T;  1AOJ A;  1IXD A;  1ZSZ A;  4M78 E;  1Y57 A;  2HBP A;  3G4S Q;  4M7D C;  4C92 D;  2QGG A;  4QVD A;  4X9C A;  3OYD A;  3KUF A;  3QZ9 B;  5J39 A;  4RUG A;  4C8Q G;  1VYV A;  4M7D F;  4J9H A;  3CCU T;  3JCM J;  3A1P A;  3R6N A;  4LDU A;  2VGM A;  4C92 B;  1CKB A;  1VQM A;  3CCS Q;  3UT1 A;  1N8R U;  1G8X A;  1VQK Q;  2PU9 B;  5IHK A;  2LQN A;  3I56 A;  3HHT B;  1UGR B;  3SFM A;  1VQ9 Q;  1HYO A;  2FPD A;  3RR6 A;  1PKT A;  1UTI A;  3VUZ A;  4FW1 A;  2CZ7 B;  1OPL A;  2P4T A;  1VQ4 T;  1UJ0 A;  4QQG A;  1K9M C;  2EGE A;  1WPY A;  2DJQ A;  3CXC P;  1GFD A;  1WDX A;  3CPW S;  2K5F A;  3EG0 A;  4EDU A;  3M0P A;  4JJD A;  1M90 R;  3JCM Q;  1PSE A;  5CKD A;  3VV0 A;  1BYM A;  2ZPF B;  2M0O A;  1PNJ A;  2HD0 A;  4BUG A;  1LOJ A;  5DM7 R;  5D7U A;  4LE9 A;  3S3M A;  2KYM A;  1NEG A;  3LH0 A;  4J6Y A;  1BIA A;  4J9G A;  2EJG A;  4KUL A;  5L23 A;  1YIT T;  2RQV A;  3TQ7 P;  3GF5 A;  4F14 A;  4A53 A;  3OYY A;  1W70 A;  3OSS C;  4EMK C;  3L2R A;  1VUB A;  4M75 A;  1I5O B;  3C0C A;  3MEA A;  4DOW A;  4BE1 A;  2FO0 A;  2C0I A;  4E6R A;  1M90 U;  3TEE A;  3F70 A;  2LVM A;  4F7U B;  4ZNX A;  3V8L A;  2FHD A;  1GCP A;  3EGX A;  1SSH A;  2BKD N;  2O31 A;  2PTK A;  2ZPI B;  2JM8 A;  3EH1 A;  2L8D A;  1JU5 C;  2KAF A;  4KGX B;  4E7I A;  2LZ6 B;  2W0Z A;  2L2P A;  3GP8 A;  1X6G A;  1X43 A;  5GJV B;  2F2W A;  3PIO A;  5IAY A;  1B07 A;  1NBE B;  4EIK A;  3SB2 A;  2EJF A;  2CP3 A;  1VIF A;  4JJB A;  1G3T A;  2YSQ A;  4F16 A;  1BI3 A;  1VQM T;  3A8O B;  4PFZ A;  2DK3 A;  4Z89 A;  2WAC A;  1PHT A;  2DO3 A;  1B34 B;  1HK9 A;  2LX9 A;  2RMO A;  2JZ2 A;  3M9Q A;  1QKW A;  5GAM h;  2ROT A;  1XTD A;  3O5Z A;  4OMP A;  1HXD A;  2CS7 A;  1GBR A;  3LW5 E;  1RAA B;  1XJW B;  1YI2 A;  1WYX A;  2XK0 A;  3WVD B;  2K9G A;  3L2Q A;  3G6E T;  2FB7 A;  2XI9 A;  3FDR A;  2RB6 A;  3CCV T;  4CRI A;  2SEM A;  3VRZ A;  2ZPB B;  3G1J A;  5D6Y A;  2MCN A;  4J9I A;  4C5G A;  4WCI A;  2ZCF B;  1W2B A;  1MMN A;  2M02 A;  3A8H B;  1JJ2 A;  3QUI A;  1KJW A;  3URG A;  2EKO A;  4N4I A;  4HCC A;  1JXO A;  2LDM A;  1QMC A;  4RKU E;  1TS9 A;  1N9S A;  1M2V A;  2ABL A;  1T0H A;  2PUK B;  1QP2 A;  5GAM f;  1WIE A;  2RI2 A;  4Y28 E;  4GY5 A;  1KSW A;  2MIO A;  3OS1 A;  3Q1J A;  3CCS A;  3ER0 A;  4M78 D;  2RF0 A;  4M7A G;  3PNW C;  3P8B B;  3GOX A;  2EFI A;  3MHX A;  1M1F A;  1VQ9 A;  2JJ9 A;  2R57 A;  3GPL A;  5LL6 S;  5LJ3 f;  1GFC A;  2ECZ A;  4FW2 A;  2AK5 A;  4MZM A;  2EW3 A;  3BE3 A;  3CMA Q;  1WHM A;  4M78 B;  3A8G B;  1NLO C;  3JCM X;  4MDX A;  3JCM h;  2OX7 A;  2DM1 A;  1FXX A;  3QKJ A;  5HKC A;  1QW1 A;  1RAB B;  1I4K 1;  5FWC A;  1JJ2 P;  4BY6 B;  2DD4 A;  4DEX A;  1OU8 A;  3S3O A;  2BZX A;  3LLR A;  2YWW A;  1UHF A;  2CSQ A;  4LUD A;  4DQ2 A;  2KE9 A;  2X4J A;  4DA4 A;  1P92 A;  2RI5 A;  2A37 A;  1E6G A;  1EZZ B;  2AZV A;  2K6D A;  1QCN A;  5I21 A;  2CKK A;  2EYZ A;  5C0M A;  4MZT A;  3QBY A;  3GBQ A;  2HSP A;  1YI2 T;  3FEO A;  2X4X A;  3OYJ A;  2XD0 A;  1SF9 A;  1M1K C;  2YUQ A;  3O8V A;  4ZN3 A;  3VS6 A;  4D8K A;  3LWI A;  5GAO l;  2RNA A;  1KQS A;  3L1A A;  1TH7 A;  1M8V A;  2MPX C;  2JN0 A;  3OQ5 A;  1IRX A;  1GRI A;  4OMQ A;  3G4S T;  5HK0 A;  1MNE A;  3RKX A;  2P0Q A;  1Q81 C;  3QG1 A;  3HFO A;  1OQK A;  3GNG A;  3CD6 A;  3CCL Q;  1TSF A;  2KRM A;  3V8K A;  1BBZ A;  2F69 A;  6AT1 B;  2DJZ A;  2YLC A;  1Y96 A;  2RK2 A;  3PVQ A;  3CCS T;  4A4G A;  4M7A C;  1YWO A;  3E1S A;  3JRZ A;  1VQK T;  4R56 A;  1M9S A;  2DRK A;  3UWN A;  4J9B A;  1VQ9 T;  5GAM g;  4ZGD B;  3WXM B;  2DBK A;  1YJW Q;  2ZPH B;  4M7A F;  4AG2 C;  1C0M A;  1VQN Q;  1BCM A;  2NUT A;  2YHT A;  4RG2 A;  3S3N A;  4C8Q E;  3CCE Q;  2VXF A;  4KUD K;  5LJ3 g;  1KC8 U;  4E2F B;  4QKU A;  2GTJ A;  2QQA A;  1WX6 A;  1BK2 A;  1UDL A;  2LCL A;  1H3H A;  3SHW A;  1YIJ Q;  1RAC B;  2KYB A;  3OW2 P;  5FRM A;  4QVZ A;  5A0G A;  8AT1 B;  2EQU A;  2P0P A;  1WJR A;  2DEQ A;  3EG3 A;  1K73 C;  4XTW A;  3HPW A;  3OYK A;  4J7I A;  3VS0 A;  2OTL Q;  2A0F B;  2KMT A;  4FYW B;  2ATC B;  1KQ2 A;  4MZP A;  2EKH A;  4HA8 A;  2DZC A;  3BFM A;  3NTH A;  5FWB A;  1QVF A;  3D7S B;  2E70 A;  2XDD A;  1TG0 A;  3REB B;  1E6H A;  4IUQ A;  4JLI A;  1IGU A;  5GAO n;  2Z0W A;  2J6K A;  1U1S A;  1UHC A;  4RTV A;  5IXF A;  2GF7 A;  3ASK A;  1AT1 B;  4BI3 A;  3CC2 A;  2EYX A;  2K5L A;  4A63 B;  1OPK A;  4RTT A;  1QVG P;  4C8Q A;  3HSB A;  5D6W A;  5GAN e;  2GBQ A;  3CMA A;  5GAN 2;  3OS0 A;  4BY6 C;  2RPN A;  5KYX A;  4J9F A;  1G5V A;  3RIR A;  3G7Z A;  2X35 A;  5LJ5 e;  1FMK A;  4IUV A;  3I9Q A;  4OF1 A;  2P0K A;  2RHY A;  2X4Y A;  1VQM Q;  3SWN B;  1UFF A;  4ZGJ B;  3TU4 K;  1OYX A;  1R0C B;  3I56 Q;  2EGA A;  2E10 A;  2QA4 Q;  7AT1 B;  5CK9 A;  1I07 A;  3EHR A;  2I0N A;  3GIB A;  2H3E B;  1I5L A;  2PVG B;  2HQE A;  2RM4 A;  2F5K A;  2ZZD A;  5GAO m;  4LDV A;  1VQ6 Q;  2J06 A;  1V1C A;  2EVR A;  2CGH A;  5KCH A;  3PMT A;  4A4E A;  1OZ2 A;  1NM7 A;  1NPP A;  1YFN A;  4IUP A;  1Q82 U;  5GAN j;  1Y96 B;  3NTI A;  2F2V A;  3JB9 J;  1JRI A;  2KT1 A;  4IIO A;  2LJ1 A;  2SRC A;  3EFR A;  5LJ5 j;  1G3Y A;  3JSC A;  4A4F A;  2ZPG B;  3CCL A;  1UB4 A;  2CT3 A;  3RNJ A;  4Z8A A;  2E1H A;  2FEI A;  3M4G A;  4MDW A;  2QI2 A;  4FYV B;  3E9G A;  2HDA A;  5GAM d;  1RAD B;  2FG0 A;  1C1A A;  5FU7 C;  1N9R A;  1B3Q A;  3H9N A;  2O01 E;  2Y4X A;  3V8J A;  4X1V A;  2E5K A;  4XU0 A;  3CC2 T;  5FU6 B;  1YJW A;  2RK1 A;  2E12 A;  1QCF A;  1U06 A;  4E7S A;  1VQN A;  4MML A;  1AZE A;  5LJ3 d;  3CMA T;  3OBW A;  1Y71 A;  4CC4 B;  3EHQ A;  3SEM A;  1D1A A;  2RO0 A;  1B7T A;  1WJS A;  3MEW A;  1I8F A;  4RTU A;  1YIJ A;  2V1R A;  1K8A R;  2YUP A;  4KBM B;  4FYY B;  5FLX E;  3M0Q A;  4FL6 A;  5CVI A;  2DXB A;  5GAO r;  3CC4 Q;  4C8Q D;  2DMO A;  2K2V A;  3I5R A;  3OYN A;  2DL3 A;  2LT4 A;  2OTL A;  2EQK A;  1ZQ1 A;  4J9D A;  2J6O A;  4L5G A;  3MP8 A;  3FLG A;  4PLI A;  1WJQ A;  3J7A F;  2CP6 A;  4JJC A;  1M3A A;  4RTY A;  3RDV A;  4LNP A;  4A54 A;  3CPW A;  2CP7 A;  4PJM A;  1K8A U;  2QK0 A;  2COY A;  2JVV A;  4PL6 A;  1BU1 A;  1M5Q 1;  1K9A A;  3EAE A;  3JCM d;  2JTF A;  2L89 A;  5KYY A;  1YJ9 Q;  1O75 A;  3NMZ C;  3CXC A;  2V26 A;  1I0C A;  4EMG A;  1Q7Y U;  2AZS A;  1BCO A;  1MMG A;  2X3W D;  3X26 B;  3A98 A;  3CCL T;  5IH2 A;  1TTH B;  2QQR A;  4PJO G;  3OYA A;  3CC7 Q;  2XG8 D;  1YP5 A;  3OYC A;  1NJI C;  2F5T X;  3HTR A;  1MMD A;  3LH5 A;  5CKB A;  2P4R A;  4M75 E; 
#chains in the Genus database with same CATH homology
 4FM4 B;  2RA2 A;  2ZPB B;  5D6Y A;  4C5G A;  2VC8 A;  4II1 A;  1YJW T;  1VQ7 A;  3CCQ T;  2ZCF B;  2DIG A;  2QA4 A;  3V7C A;  1W2B A;  1QVF S;  2GFU A;  2OAU A;  3JB9 G;  5M9O A;  1VQN T;  2IVW A;  4OB0 B;  3A8H B;  3KBG A;  4XU3 A;  5A2Q E;  1JJ2 A;  3QUI A;  1FX7 A;  2XDP A;  1NE8 A;  3HRT A;  2QTX A;  4UC4 A;  1VQP T;  1DJ7 B;  3CCE T;  2DVE A;  4M77 G;  1SSF A;  3MP1 A;  4O6J A;  3URG A;  1Q82 C;  1NZ9 A;  2EKO A;  4N4I A;  1YJN A;  4HCC A;  1QP3 A;  1RI0 A;  4E7L A;  4J6X A;  4FU6 A;  2RHU A;  1N8R C;  1VQ6 A;  5FU7 B;  4HCB A;  2LDM A;  4RKU E;  1YIJ T;  1K73 U;  3TRE A;  1N9S A;  1JB0 E;  2QDY B;  3R6O A;  2D9T A;  2EQJ A;  1QP2 A;  2PUK B;  3A8L B;  5GAM f;  3OYI A;  3A5Z B;  2RI2 A;  4M77 E;  3A8M B;  2A7Y A;  4Y28 E;  4GY5 A;  3M5A A;  2XIC A;  3QDR B;  3Q1J A;  4JLG A;  3OS1 A;  3V7R A;  3I55 A;  3CCS A;  2K5I A;  3ER0 A;  4DOV A;  4M78 D;  3L2V A;  4M7A G;  4IUT A;  3PNW C;  2OTL T;  3NFC A;  3P8B B;  3AHU A;  2VUB A;  5KE3 A;  5GAN 3;  4JUV A;  3JCM V;  3GOX A;  4L59 A;  1R8O B;  3PGG A;  4C5E A;  2EFI A;  3MHX A;  1M1F A;  1VQ9 A;  3GPL A;  2R57 A;  2NLU A;  5LL6 S;  5LJ3 f;  1U1T A;  2DXT A;  3VUB A;  3T9N A;  4N0A A;  5GAM e;  2D6F A;  2V8I A;  4MZM A;  4CI0 C;  3MO8 A;  3FB9 A;  4M7A E;  5GAN 6;  1BI1 A;  4M78 B;  3A8G B;  3RMS A;  1VIE A;  4C92 G;  3JCM X;  4IUU A;  2DZ9 A;  3OW2 S;  2VGN A;  4MDX A;  1YCY A;  1AHJ B;  3FIF A;  2RJD A;  5D6X A;  3JCM h;  5FU6 C;  1FXX A;  2HNI A;  3QKJ A;  1X01 A;  4E47 A;  5FRN A;  4XU2 A;  5HKC A;  2KY9 A;  4PJO A;  1QW1 A;  3EFS A;  1VQ8 A;  5GAN d;  1I4K 1;  3JAM E;  4BY6 B;  5LJ3 e;  2WSF E;  2DD4 A;  2JOY A;  3S3O A;  1VQK T;  3LLR A;  5GAO p;  1I81 A;  4C92 E;  4QVC A;  4N0A C;  4Z02 A;  4F7U A;  3DLL A;  1JBM A;  3M57 A;  3UPU A;  3VU3 C;  1YHQ A;  4BE2 A;  1XQH A;  3M55 A;  3ZBD A;  1MGQ A;  3HRS A;  5CQY A;  4DQ2 A;  2R5M A;  2X4J A;  3MCA B;  5LJ5 d;  4BDY A;  4V2S A;  4DA4 A;  2E64 A;  1P92 A;  2RI5 A;  2KVQ G;  2MWO A;  4L6V 5;  2EYQ A;  4BDZ A;  4C8Q B;  3X28 B;  1D3B A;  4M75 C;  1FWZ A;  5I21 A;  2MF2 A;  4BE0 A;  4PJO C;  2CKK A;  3OBY A;  5C0M A;  4MZT A;  3WVE B;  2C06 A;  2PVD B;  1M90 C;  4C0Z A;  4BB7 A;  3QBY A;  3QZ5 B;  1G3S A;  2M1H A;  4M77 A;  2R5A A;  1YI2 T;  5EG2 A;  2V8J A;  3FEO A;  1KD1 C;  3QYH B;  4M75 F;  2X4X A;  3OYJ A;  2XD0 A;  2E6N A;  4PJO F;  1M1K C;  1BI0 A;  3C94 A;  3O8V A;  1NPR A;  1QVG S;  3BY7 A;  3M4Y A;  4ZN3 A;  5GAN 7;  3CC4 A;  3PTA A;  3DB3 A;  4NS5 A;  4ZTJ A;  3M53 A;  3I56 T;  3HP9 A;  1VQ7 T;  3LWI A;  5DLO A;  2QA4 T;  5GAO l;  1UGP B;  3ME9 A;  1KQS A;  3E19 A;  5DY9 A;  5GAM j;  1B34 A;  3L1A A;  1TH7 A;  4OB2 B;  4BI8 B;  1M8V A;  4XU1 A;  2O4X A;  4RCB A;  2QQ9 A;  2WSE E;  5GAN 5;  2DXU A;  5GMK l;  2JN0 A;  4M7A A;  2QXF A;  1ZBX A;  4KUI A;  4M77 C;  3OQ5 A;  2DAQ A;  4ELZ C;  2JUF A;  1K8A C;  4J8O A;  3VKI A;  4QW2 A;  4E7K A;  3SWN C;  3QHS A;  3LGF A;  3OSV A;  5HK0 A;  3G4S T;  3JB9 F;  4J6W A;  3JCM b;  3RKX A;  3J81 E;  2BUD A;  4J7F A;  2P0Q A;  1YJN T;  1Q81 C;  3BDL A;  3QG1 A;  2QQB A;  3H6Z A;  3HFO A;  2RI3 A;  4IUR A;  3JCM e;  3INZ A;  1VQ6 T;  3GNG A;  5LJ3 j;  4F7U G;  4M77 F;  4O5V A;  3CD6 A;  1KG1 A;  2OTJ A;  4VUB A;  1Q7Y C;  2XHC A;  3TCJ A;  3V8K A;  2QEX A;  3G71 A;  5CIU A;  3V7S A;  4C92 A;  4JJN K;  3FC3 A;  4LD6 A;  2F69 A;  2ZPE B;  2DJZ A;  3OYM A;  2YLC A;  1Y96 A;  4ZTF A;  3I55 T;  2RK2 A;  3CCS T;  4M7A C;  4A4G A;  4OP0 A;  4EPC A;  1YJ9 A;  3E1S A;  2FYK A;  3LGL A;  2E5Q A;  3BW1 A;  3JRZ A;  3P8D A;  2RJC A;  4F7U E;  1M9S A;  5GMK m;  4RMO A;  4R56 A;  4X9D A;  5IT9 E;  3HKS A;  3UWN A;  1VQ9 T;  5GAM g;  4ZGD B;  3WXM B;  4JRP A;  4ELY C;  1Q86 C;  2ZPH B;  1MHN A;  4M7A F;  4JRQ A;  2RJE A;  3LYI A;  4XTZ A;  2RH2 A;  4OMF B;  2LNV A;  3CCR A;  2M9U A;  3OMC A;  1WQW A;  2YHT A;  2MI6 A;  4JRI A;  4RG2 A;  4C92 C;  5CKF A;  3S3N A;  1K9M U;  2RHI A;  1VQ5 T;  4C8Q E;  3CBM A;  5GAN h;  4J5Y A;  2DPP B;  2LCC A;  3SDZ A;  3CC7 A;  1V29 B;  3OB9 A;  2VV5 A;  3FRN A;  2DXC A;  3RKW A;  2VXF A;  5CR2 A;  4KUD K;  2MWP A;  5LJ3 g;  1XNI A;  3OYH A;  4M7D G;  1KC8 U;  1KHC A;  5J26 A;  4LDW A;  4C92 F;  5GAN 4;  2PQW A;  4OB1 B;  2QQA A;  3X24 B;  3OS5 A;  5CO7 A;  4C0G A;  5LJ5 h;  2LCL A;  2LT1 A;  1IZ6 A;  2FVU A;  4ME7 A;  3MEU A;  5I2S A;  5FRM A;  4QVZ A;  5A0G A;  3CCU A;  4XK8 E;  1WQ7 A;  1M1G A;  1YHQ T;  2EQU A;  2P0P A;  1WJR A;  2DEQ A;  2EQM A;  3RMQ A;  2PUO B;  5A0D A;  4M7D E;  4XTY A;  4OGC A;  1K73 C;  3OS2 A;  3G6E A;  4XTW A;  3HPW A;  2A3L A;  3OYK A;  2L3R A;  4J7I A;  2DTH A;  2LQK A;  3JCM W;  2FL7 A;  1KQ1 A;  3CCV A;  2LQ8 A;  2RHX A;  1ZHI A;  4EMK B;  4WF2 A;  4BD3 A;  2IG0 A;  2KMT A;  2WSC E;  4M78 A;  2CZ0 B;  5HK3 A;  4Y91 A;  4ATO A;  5GMK i;  1KQ2 A;  4FIB A;  4M75 D;  2KK4 A;  3FJP A;  3MET A;  4MZP A;  5KE2 A;  3CXC S;  4PJO D;  4HA8 A;  3CME A;  2DZC A;  3BFM A;  3NTH A;  1QVF A;  2XDD A;  2E70 A;  1VQP A;  2K4Y A;  1H64 1;  3QO3 A;  3CCE A;  5GAN 8;  4IKF A;  1M4Z A;  4IUQ A;  2YLB A;  4FSX A;  3PT9 A;  4JLI A;  2DTI A;  1VQ4 A;  2VYT A;  5GAN f;  3CC4 T;  3OYF A;  3RES A;  3CPF A;  4PLL A;  3SD4 A;  2LRQ A;  3H8Z A;  3RKY A;  5GAO n;  2GQV A;  4YTL A;  4C0D B;  2RJF A;  2JNG A;  3VYG A;  5KH6 A;  4M75 B;  2KDS A;  4KT0 E;  4A4H A;  4PJO B;  1U1S A;  5IN1 A;  3X25 B;  1X6O A;  4R55 A;  1N27 A;  2I2L A;  3JB9 D;  2GF7 A;  3ASK A;  4BI3 A;  3CC2 A;  3RER A;  5LJ5 f;  2K5L A;  5CKE A;  3HL8 A;  4C8Q A;  2XDB A;  3DB4 A;  5CAI A;  3HSB A;  2DIQ A;  2KSS A;  5D6W A;  5GAN e;  3L2U A;  3CMA A;  4M77 D;  5GAN 2;  3OS0 A;  4BY6 C;  2LC4 A;  3S6W A;  4GLK A;  1KD1 U;  3CCM T;  1G5V A;  2V8K A;  4BI4 A;  2DD5 A;  3RIR A;  4C5I A;  3C95 A;  1W2B S;  3X20 B;  4XQ3 A;  1D3B B;  2DKG A;  3G7Z A;  5C6S A;  3G71 T;  5KCO A;  2QEX T;  3GLX A;  1WGS A;  5CCA A;  2X35 A;  1YIT A;  5LJ5 e;  1QVP A;  3L42 A;  2R58 A;  3JCM f;  3QII A;  2VXE A;  2CZ1 B;  4NL2 A;  1Y7X A;  2AHJ B;  2HQX A;  4IUV A;  1WNL A;  4F7U F;  3LWH A;  1YJ9 T;  4M77 B;  2P0K A;  4OF1 A;  4C8Q C;  1S72 A;  4M7D A;  2B8A A;  2RHY A;  2X4Y A;  3SWN B;  2HAX A;  4FT4 A;  4LD9 K;  4M78 G;  3M59 A;  4QQD A;  4ZGJ B;  3CCJ A;  3TU4 K;  3JB9 H;  1OYX A;  5I2M A;  4M7A D;  1YBY A;  2PVO B;  2E6Z A;  3QPH A;  3L2W A;  3OW2 A;  3OY9 A;  2XKO C;  2E10 A;  1W4S A;  2CYZ B;  3NTK A;  5A0L A;  2LTO A;  1NJI U;  1XOV A;  5CK9 A;  4C8Q F;  1X75 C;  4B9X A;  1O9S A;  3CCR T;  3OYG A;  5GMK h;  3GIB A;  3CC7 T;  4M78 E;  5CKH A;  2HBP A;  4M7D C;  1I5L A;  4M7A B;  4C92 D;  2EWN A;  2PVG B;  2HQE A;  4QVD A;  3JB9 I;  2L5Q A;  3ZFJ A;  3QJ6 A;  5J3B A;  2RM4 A;  2F5K A;  2ZZD A;  4XTX A;  5GAO m;  4X9C A;  4LDV A;  3OYD A;  1UGS B;  3KUF A;  2CGH A;  3QZ9 B;  3PMT A;  4A4K A;  5KCH A;  5L8R E;  1UEB A;  5J39 A;  4C8Q G;  3QSU A;  4M7D F;  2E65 A;  3CCU T;  4A4E A;  1OZ2 A;  2G3R A;  1NPP A;  4OB3 B;  3JCM J;  3LX7 A;  4IUP A;  3KXT A;  4E7J A;  4LDU A;  2RHZ A;  2VGM A;  1Q82 U;  4C92 B;  3GNF B;  1VQL A;  1VQM A;  4RG8 A;  5GAN j;  1Y96 B;  3UT1 A;  1N8R U;  5LJ3 h;  4P5N A;  4OGE A;  2PU9 B;  4ZN1 A;  3NTI A;  3I56 A;  3HHT B;  3JB9 J;  4NL3 A;  1UGR B;  1PSF A;  3E9F A;  3SFM A;  4RCC A;  2YRV A;  1JRI A;  1VQO A;  3OMG A;  1QVG A;  1BKB A;  3EFR A;  5AYF A;  5LJ5 j;  4N4G A;  1G3Y A;  2XU8 A;  3JSC A;  4A4F A;  2ZPG B;  3CME T;  3ZEH A;  1UB4 A;  3CCL A;  4D6W A;  4C5H A;  5FRO A;  2E1H A;  3C4S A;  3VUZ A;  4EMH A;  3G4S A;  3PIP A;  2BIV A;  3M4G A;  1LJO A;  4MDW A;  2MMP A;  2CZ7 B;  2QI2 A;  5CQX A;  2P4T A;  1VQ4 T;  3PMI A;  3UDC A;  3E9G A;  2EJ9 A;  5GAM d;  1U8R A;  1LNX A;  4QQG A;  1K9M C;  4ZGE B;  3OYL A;  3CEY A;  4J83 A;  3OYE A;  1WPY A;  2GFA A;  1UGQ B;  5FU7 C;  3CPW S;  2K5F A;  1N9R A;  3MEV A;  4EDU A;  3V8J A;  2O01 E;  2Y4X A;  3CBO A;  3QYG B;  1G3W A;  4XU0 A;  3CC2 T;  2KQW A;  3JCM Q;  1PSE A;  2ZGW A;  5FU6 B;  5CKD A;  1KC8 C;  2H3J A;  1YJW A;  2RK1 A;  2E12 A;  3VV0 A;  3CCQ A;  1BYM A;  2ZPF B;  5GAN g;  2M0O A;  5GMK e;  2HD0 A;  4BUG A;  4EMK A;  1LOJ A;  5DM7 R;  1VQN A;  4MML A;  4C0F A;  5LJ3 d;  3CMA T;  1VQK A;  3OBW A;  3P8H A;  1Y71 A;  4XAX B;  3S3M A;  4JS5 A;  4X34 A;  3LH0 A;  4HKE A;  4J6Y A;  2Y4Y A;  3N5B B;  1BIA A;  2K3X A;  1KQS S;  2RO0 A;  5LJ5 g;  2EJG A;  2K57 A;  2QQS A;  3M58 A;  4KUL A;  4LDX A;  4JRK A;  1YIT T;  1WJS A;  3GF5 A;  2GCX A;  2XID A;  2RD1 A;  3MEW A;  4LDY A;  2E41 A;  1VQ5 A;  1I8F A;  4A53 A;  3OYY A;  1YIJ A;  3VYH B;  1VQ8 T;  1S72 T;  3OSS C;  4KBM B;  4M78 C;  4EMK C;  5FLX E;  3L2R A;  1H3Z A;  1VUB A;  4M75 A;  3CCJ T;  4JS4 A;  3OYB A;  4FL6 A;  4N4H A;  5CVI A;  2DXB A;  5GAO r;  4Q5W A;  3MEA A;  4DOW A;  4BE1 A;  4C8Q D;  2K2V A;  3OYN A;  1M90 U;  3TEE A;  3F70 A;  2LVM A;  4F7U B;  3V8L A;  2LT4 A;  2FHD A;  3CBP A;  3JCM g;  2EQK A;  2OTL A;  1KHI A;  1ZQ1 A;  4L5G A;  3MP8 A;  4M78 F;  3FLG A;  4PLI A;  5DLQ E;  1WJQ A;  3PFS A;  1BI2 A;  3J7A F;  3CD6 T;  2BKD N;  2OTJ T;  1M1K U;  2ZPI B;  4BAC A;  4NOY A;  2L8D A;  4TVR A;  4OVA A;  1JJ2 S;  2KAF A;  4C0D C;  4E7I A;  1OI1 A;  3L2Z A;  3GP8 A;  4A54 A;  4M7D D;  3VJP A;  3PIO A;  2DTO A;  3CPW A;  4HCZ A;  4MMK A;  5IAY A;  3MP6 A;  4FT2 A;  4JDS A;  1RL2 A;  2EIF A;  3QJY A;  5HY6 A;  3SB2 A;  2EJF A;  1K8A U;  2JVV A;  1IRE B;  1OZ3 A;  4PL6 A;  1VIF A;  3SWN A;  2MAM A;  3QXE B;  1M5Q 1;  2JTM A;  3EAE A;  5GMK j;  2JTF A;  3JCM d;  2L89 A;  1G3T A;  1VQM T;  1VQL T;  1BI3 A;  3OA6 A;  1Q81 U;  3J80 E;  3DLM A;  4E7H A;  3A8O B;  1O75 A;  3JCM c;  3CXC A;  2DK3 A;  2WAC A;  2K3Y A;  1Y07 A;  3DKM A;  4M7D B;  2D0Q B;  3M54 A;  4PJO E;  2DO3 A;  1B34 B;  1HK9 A;  3HFN A;  2LX9 A;  4EMG A;  2O4X B;  3C12 A;  1Q7Y U;  1GXI E;  1EIF A;  3M56 A;  3RUX A;  2JZ2 A;  5GAO q;  1VQO T;  3M9Q A;  1N6A A;  3X26 B;  3BDU A;  3CCL T;  5GAM h;  1XTD A;  4M75 G;  4PKC C;  4B9W A;  4XTV A;  2QQR A;  4PJO G;  1HXD A;  4PNO A;  2Y90 A;  3OYA A;  2CS7 A;  2XG8 D;  3OYC A;  1NJI C;  1BIB A;  2F5T X;  3LW5 E;  2M16 A;  4HT9 A;  1YI2 A;  3HRU A;  4QQ6 A;  3CCM A;  1Q86 U;  2XK0 A;  3JCM P;  2EAY A;  3WVD B;  3L2Q A;  3G6E T;  2FB7 A;  4HT8 A;  4XTU A;  2XI9 A;  5CKB A;  3FDR A;  4M75 E;  2X4W A;  2RB6 A;  3CCV T;  4CRI A;  2CZ6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...