4KUOA

A superfast recovering full-length lov protein from the marine phototrophic bacterium dinoroseobacter shibae (photoexcited state)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
120
structure length
115
Chain Sequence
DIADLRALLEMSVVFSDPSQPDNPMIYVSDAFLVQTGYTLEEVLGRNCRFLQGPDTNPHAVEAIRQGLKAETRFTIDILNYRKDGSAFVNRLRIRPIYDPEGNLMFFAGAQNPVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords blue-light photoreceptor
publication title Structure and function of a short LOV protein from the marine phototrophic bacterium Dinoroseobacter shibae.
pubmed doi rcsb
source organism Dinoroseobacter shibae
molecule tags Signaling protein
total genus 30
structure length 115
sequence length 120
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4kuoA00
3LIDA 5HDSA 5A8BA 4GHIA 2BASA 4LRYC 1V9ZA 5F68A 2A24B 3B33A 5J4EA 1TS6A 2PYRA 3NOTC 3ZQ5A 1F98A 1S4SA 2CMNA 4RQ9A 1TS0A 4WUJA 3CWFA 2J80A 1XJ2A 3E4PA 4HJ6A 5HWTA 5IS1A 4JGQA 5DJTA 1S1ZA 4GS9B 3FC7A 1T1CA 3F1OA 4NXGA 2OWJA 4EEUA 1LL8A 1EW0A 5DKLA 1XFNA 1KOUA 3IS2A 2ZBBA 1UGUA 4EQ1A 1UWNX 2WKRA 3F1NA 4LPZA 2W0NA 1GSWA 5HDDA 1T19A 4YWZA 4HNBA 3UB9A 3NOPC 2A24A 3H9WA 4HY8A 1P0ZA 5G4ZA 4DJ3A 1OJ5A 3H82B 4GCZA 3MXQA 3RTYA 1LSVA 3NHQA 3A0RA 2D01A 3FG8A 3KX0X 4EXOA 3SW1A 5DJUA 2KX6A 4BBUA 4KQDA 3UB8A 5J7EA 1OTDA 3MJQA 1S4RA 4H6JB 3E4QA 1S67L 3T50A 4MN6A 3H7WB 3MFXA 3CAXA 2H28A 4LRZE 1XFQA 3IBRA 4R3AA 4KUKA 1F9IA 5F6AA 1N9NA 4EEPA 2P7JA 4R70A 4WN5A 5HSQA 2PD7A 2L4RA 4DJ2A 3UMEA 2QKPA 5HZHA 2WKQA 3PHYA 2PR6A 3F1PB 3NJAA 4HHDA 2I9VA 5AVEA 5AVFA 3VOLA 4HI4A 4I5SA 5TBMB 5G4YA 2V1AA 2B02A 3VE4A 3MR0A 1T1AA 5HDCA 5J3WA 2PD8A 4LLOB 1UWPX 3EEHA 5I5LA 3VE3A 4F3LA 2V1BA 1MZUA 4XT2A 3LI9A 2VV7A 1GSXA 3BWLA 4JGOA 4HH2A 4NXEA 1Y28A 1S1YA 3LUQA 2INWA 3E4OA 4HQAA 1OTIA 4HP4A 1ODVA 4GW9A 1WA9A 1T1BA 1OT9A 2JHEA 3LI8A 4LRXC 1DRMA 2VLGA 2QHKA 3MQQA 2QJ7A 5IU1A 4GHIB 5DKKA 4HOIA 4B9OA 3CLOA 1D7EA 2L0WA 3G6OA 4BBTA 1DP8A 4GS9A 3A0VA 1D06A 2Z6DA 3D72A 1S66L 2YKHA 1GSVA 3BY9A 4M4XA 2JN7A 2PYPA 5F69A 3UE6A 3HJKA 3F1OB 4JGRA 1XJ6A 1XJ4A 3EWKA 4NXBA 2EA9A 3IS2B 1X0OA 4R38A 2VV8A 4HP9A 4E04A 1V9YA 4KUOA 1OT6A 3H82A 3F1NB 3RH8B 2QJ5A 1XJ3A 3UMDA 1LSWA 4I3JA 1N9LA 4EETB 4K08A 4WL9A 2V0WA 1JNUA 2HV1A 4I3AA 3ULFA 3PYPA 3HJIA 2VEAA 3ICYA 3C2WA 4HIAA 2PR5A 4PKYA 1DP6A 2QWSA 4WLAA 5HWWA 3LIBA 4MN5A 5HD3A 2K7SA 3UB7A 4H6JA 2V0UA 4EW7A 3H7WA 4HH3A 3OLOA 1P97A 1BYWA 1N9OA 2ZOIA 1OTBA 4I39A 3A0SA 3LIEA 1VB6A 4R6LA 5HWVA 4I38A 2WKPA 3F1PA 4JGPA 2KDKA 2L1MA 1OTAA 1LSXA 2OWHA 5TBMA 1NWZA 3LYXA 2D02A 2R78A 2W27A 2VV6A 4L9EA 2V9AA 3MQOA 5EFWA 3K3CA 5F5YA 2ZOHA 3K3DA 2YKFA 1OTEA 4BBVA 1TS8A 3LICA 2PDRA 1LT0A 1OJGA 2OOLA 4PKYG 3NOUC 4EERA 3BY8A 2Z6CA 3P7NA 5HD5A 4L9GA 4F3LB 4NXFA 3LIAA 4HJ4A 1G28A 1DP9A 1TS7A 1T18A 3C8CA 4XT2B 3GDIA 4WF0A 3GECA 4I3IA 2GJ3A 4L9FA 2PHYA 3UB6A 4EESA 5KIZA 2M1CA 4HJ3A 3LIFA
chains in the Genus database with same CATH superfamily
1LI0A 4GHIA 3UDIA 4K0XA 2X01A 4JF5A 3SS5A 2A24B 2PYRA 1L0GA 3S7NA 3T4QA 3AGDA 3FPVA 5F1FA 1DJBA 2IA2A 1S4SA 3Q7VB 4IBXA 2IWCA 1XJ2A 1ACFA 2DCFA 3VP3A 3E2KA 3I7JA 5FQ9A 2H10A 1FSWA 4X55A 1S1ZA 4ZRRA 3LR0A 1TVFA 3ZNYA 2ZC4B 5EVIA 5DF9A 1LL8A 4RA7A 2ZQDA 5J8XA 4KZ7A 2HF6A 4LFUA 5EECA 3EGXC 2ZBBA 4QB8A 1RGZA 3LO7A 3RFBA 2P9VA 3CUEA 4S2NA 5HW3A 3C30A 2W0NA 1GSWA 1NYYA 4DKIA 2HDUA 4JKTA 1T19A 2WAEA 4AFIA 1LHYA 2A24A 4EUVA 1CEGA 4E3MA 5G4ZA 2K31A 5EVIC 4DJ3A 3D3OA 3LCEA 3G34A 3A0RA 3FG8A 1H8ZA 1YLWA 4S2NC 3WRZA 5L07A 2KX6A 5BOHA 2J3TD 4KQDA 4ETXA 3BFDA 1IKGA 1JTGA 4WYYA 1S4RA 3E4QA 3LR3A 1S67L 3T50A 4MN6A 1K0KA 3H7WB 3MFXA 5HFOA 5A93A 3WS1A 4XUZA 2XEPA 2Y79A 3VSLA 2LB5A 5E2EA 4R70A 2HPBA 3BQ8A 3E2LA 4U0XA 5FQMA 2QKPA 2V8FA 3PHYA 2XF3A 5EVEA 4FUWA 3WS2A 1FCOA 2KLIA 3VOLA 3NECA 5TBMB 3FYZA 4N1XA 4UQIS 5EM1A 4IHQA 4WEJA 3MR0A 4P85A 3G4PA 4B93A 1ZTUA 3T1QB 2PD8A 4IUKA 1PFLA 4F3LA 1NRJA 5HX9A 2XH9A 5CRFA 1EWZA 4WELA 4GOGA 3LI9A 3OZHA 4BLMA 3BWLA 4F94A 3CI6A 1CI9A 3CG5A 4ME4A 5DTKA 4OPYA 2B95A 4N92A 5EM0A 1ONHA 4LV3A 4IUHA 3ITBA 1YLYA 1ONGA 2XQZA 4LRXC 1NYMA 3GV9A 2A49A 1W7FA 1W5DA 4LV0A 3S7QA 2EX8A 4HESA 4RX3A 1ZG6A 3TRCA 5CEDA 4NEED 3TJZC 3G6OA 1MWRA 4OKPA 4DE3A 4GS9A 4EBNA 4GDNA 2H5SA 3IWQA 3V5MA 1VEUA 5FEGA 4Q0HA 5CERA 1MWUA 3PTEA 2VZWA 1E3UA 4M4XA 5EOOA 2PU4A 2EXBA 2JN7A 4GZBA 5GHYA 5L2FA 5FQKA 1YMSA 3SZTA 2J9PA 5F69A 3HJKA 5TR7A 4OQ0A 4JGRA 1ES3A 2Y2NA 2JKRM 2HJEA 4DE2A 2XROA 5FQJA 2XA7M 4FCFA 3OOVA 1NRFA 5D3OA 1KVLA 3Q82A 1OT6A 3LR5A 1AWIA 2VKSA 4NETA 1N9LA 4PM5A 3ULFA 3MQ0A 1NXYA 3ZG7B 2OSUA 3HLCA 1SCWA 4PKYA 3BLMA 1DP6A 5HWWA 3QP5A 4MN5A 3UB7A 4H6JA 2V0UA 4MBKA 5GHZA 4EW7A 3OLOA 4K91A 1N9OA 1VETB 3N8RA 4QJGA 1OTBA 2ZMFA 3LY3A 1GHPA 4R4SA 4JXSA 4MLLA 1ALQA 3T4TA 4I39A 3MMHA 4S2MA 4R6LA 5FI6A 2ZD8A 4E3NA 5FAOA 2QZ6A 3KO6A 3C4OA 3EQVA 2WKEA 5DF8A 5FAQA 4G3KA 3IHBA 3SOIA 5EVID 5GLCA 2XDMA 1W63M 2C5WB 4GN2A 1TF1A 1YLPA 1G5UA 2ZJ9A 2XFSA 3LYXA 3JVVA 3NC8A 2CC1A 2R78A 2PT7A 3TW8A 2VV6A 4QPRA 3GSGA 4BL2A 1Q2QA 4WZ5C 2GZAA 4OVDA 4HBUA 5F5YA 5AQ7A 3HUOA 1OTEA 4BBVA 4CLCB 3UPPA 2PDRA 1LT0A 1YKDA 3R7WB 2VK3A 2Z2MB 3G31A 3PBNA 3T4KA 4Y0UA 3NBLA 3M6HA 1FIKA 3V39A 3ZVTA 1CEFA 1Z09A 2BG1A 3OPRA 1M6KA 4YINA 3K2NA 2Z6CA 3T4JA 2VA0A 3IWOA 1LI9A 1JTDA 4XXRA 4Y5FA 1IKIA 2J3TC 4L9GA 4OQIA 3UE0A 3CMZA 4NXFA 3LIAA 3W4QA 3C8CA 3KSHA 5DTTA 3CZDA 3PBTA 3O5YA 2WADA 3E98A 2E8JA 3GDIA 2Y91A 1FOFA 2O0YA 4I3IA 5DFXA 4MMNA 2ZQ9A 3VP2A 1UGUA 3LIFA 3O86A 5TFQA 3IWIA 5F68A 3VP4A 3A3FA 3B33A 3OPHA 1G6AA 5J4EA 3OCLA 1TS6A 3ZQ5A 2B5RA 2Y2LA 3MKFA 5G18A 4OLGA 2VGKA 1MY8A 1XKZA 1KDSA 3MF0A 2WYXA 1ERQA 2HDRA 4GJ4A 4FH2A 4JXGA 2W1TA 5KSCA 3E4PA 4HJ6A 5HWTA 1BLHA 4JGQA 3VOZA 3HLBA 2XGNA 1HTZA 2XA7S 3B42A 3F1OA 4UEYA 4KZ8A 4E6WA 4EEUA 3GR2A 1EW0A 5AQBA 3EOIA 4O7DA 3KYEA 3Q07A 3S4XA 1UWNX 4IJGA 2WKRA 4ARZA 3IX3A 3CPTA 1ES2A 4EQIA 1HVBA 4RX2A 4HNBA 4BMWA 4R3BA 1PWDA 4HY8A 4L0LA 4MNRA 3O3VA 1K54A 4P87A 1OJ5A 3H82B 2ZC5B 1LSVA 1Q2PA 2RL3A 1L0EA 3KX0X 4KG5A 3IXHA 5F82A 4EXOA 3SW1A 1W79A 5C5KA 5U47A 2ZQ8A 4Y3IA 3T4OA 3TG9A 4DRTA 4BBUA 1TDLA 3UB8A 5J7EA 2Y2PA 3IXGA 1IFQA 2DRWA 5TGFA 2I72A 1XX2A 1SKOB 1BLPA 1FCNA 1K54C 3SH7A 5IT5A 5AQAA 1AXBA 1BUEA 4R3AA 5CTNA 3OPPA 1F9IA 4EEPA 2P7JA 3V67A 5CTMA 5CX7A 3VFFA 4WN5A 5HSQA 2JKGA 4DJ2A 4HBTA 1NZUA 3RXWA 3V50A 1HZOA 1PI5A 3N7WA 2WKQA 5M18A 3F1PB 2IWBA 1IYPA 3NJAA 2I9VA 2MJ6A 3FWLA 3BYDA 4GKUA 1EI5A 3VP0A 4I5SA 4GLQA 3DTMA 2HJ9C 4FH4A 5GLBA 5FA7A 3FZCA 5GHXA 4H8RA 1T1AA 3A3DA 3EGDC 4DMZA 1C3BA 2G2WA 3OCNA 1LLBA 5I5LA 2W1RA 4UHUA 1ZKJA 1FILA 3IQAA 3VE3A 1MZUA 3S7PA 4QD4A 1KGGA 1FCMA 1K25A 1PRQA 2R9XA 4XT2A 3HREA 4N1HA 1YLZA 2H0TA 1NLYA 4JGOA 2WGWB 1Y28A 2IWDA 1MC0A 4KZ9A 2HZ5A 2Y2IA 1MPLA 2Y2HA 3IT9A 4OOLA 1ODVA 2JHEA 4O0PA 3EQUA 1DRMA 2VLGA 2QHKA 3GRJA 1D1JA 1U60A 3Q7VA 4JF6A 2QJ7A 2EX6A 1H5XA 4Q0IA 3IF5A 5M19A 3LR4A 4HOIA 3FV7A 2Y2GA 2EX2A 3CUEC 4GD6A 5HAQA 2JCHA 2PU2A 2L0WA 1SDNA 4E6XA 2WGIA 4B88A 2GDNA 4PAUA 4UA6A 4OLDA 4OQHA 4WEKA 4S2KA 2BLSA 2Z6DA 3D72A 1PW1A 1S66L 3NDEA 2PBDP 3G30A 5M1AA 2Y2QA 1GSVA 2KOIA 1KE4A 4OP5A 1MWTA 3KYQA 3NULA 5EOEA 4FD8A 3UE6A 2WAFA 1XJ6A 1XJ4A 3EWKA 3SS4A 2EA9A 5TJJA 2W3EA 3JYIA 4X56A 3VSKA 3IS2B 2VV8A 2EWVA 4S2LA 5HPFA 5IHVA 5DFYA 4KUOA 1XA7A 3F1NB 3B47A 3M2JA 4JLFA 3RH8B 3UMDA 4WL9A 1JNUA 1M40A 3D9YA 4II7A 4E3LA 3HJIA 3ZHHA 2VEAA 4XUXA 3BFCA 4DE0A 4ZDXA 1GA9A 1NLZA 2QWSA 4CLCE 3LIBA 1VHMA 3NDGA 3UDFA 4PM6A 3ZG5A 4CLCD 3H7WA 1P9WA 3FKVA 5FL3A 4WZ4A 1BYWA 2OLUA 3BM6A 2ZOIA 1WYCA 2HP5A 3QP8A 4KG6A 2ZM8A 3VV4A 3A0SA 3LIEA 1VB6A 3CJMA 3CITA 1K4FA 3SS3A 4X1LA 3PBQA 2WKPA 1W8QA 3DTKA 4Y2FA 1DJCA 4NG2A 2B18A 2Y55A 3IH8A 4UA7A 3IH9A 1Y4OA 1YSPA 3UE1A 1LSXA 1YQSA 1I2SA 5TBMA 3U4LP 2WZZA 4X25A 4KQOA 1IELA 5JYOA 2ZC3B 3MQOA 2V2FF 3QP4A 1L0FA 3BFEA 2EX9A 4CQHA 4MBFA 2J3WA 2ZOHA 1BTLA 3MZEA 1TS8A 3LICA 1OJGA 2ZQAA 3BFFA 1K38A 4GDBA 5HL1A 1RCJA 2OOLA 2UV0E 2A2LA 4EU0A 1PWCA 1RGYA 1IYOA 4PKYG 4UA9A 3NOUC 1ES4A 1GHMA 3BW6A 4C6YA 3GMWA 3T4SA 1P9RA 3P7NA 1K56A 4HJ4A 1G28A 4JXVA 1PI4A 4PM9A 4EWFA 4YNRA 2JKRI 2Y2OA 3WS4A 5CECA 3G32A 4X1MA 1W8YA 2E8IA 2PHYA 5E2GA 3UB6A 2ZMVA 3GTCA 2EFXA 2HDSA 3LIDA 5A8BA 3T12B 4MN7A 1V9ZA 3GVBA 2HGVA 3BECA 1ZHHB 5L10A 4BWIA 3N4IA 3NIAA 3CHWP 4R0QA 2R9WA 2NUTC 2XRNA 3QNBA 2Q0OA 2X02A 5FQIA 2P08A 5FAPA 3C4PA 5KSHA 1YM1A 4UAAA 3BLSA 4EV4A 2WKHA 2O9AA 5FSRA 1YPRA 3R4KA 4S2PA 3P01A 3W2ZA 5FI7A 3MS6A 3A3IA 3C7VA 5DJTA 3N6IA 3FC7A 3T1SA 3WS5A 5CGXA 1A0KA 2OWJA 4LV2A 5K5BA 1SZVA 4Y0OA 4LENA 2M7VA 3ZNTA 2J9OA 2P74A 1KGFA 5AJGA 2Y2JA 3O87A 3C5AA 2JKTM 3AGEA 1JWVA 5HDDA 1G68A 1GA0A 5HAPA 3UB9A 3NOPC 3ZCZA 2RCXA 4GCZA 3MXQA 5FDHA 2V8CA 4OPRA 1VETA 3VOYA 1KE3A 1MXOA 5DJUA 3RXXA 3IX4A 3HLWA 1YLTA 3SH9A 2FFFB 3HBRA 4JF4A 4X68A 2ACGA 3HL9A 3IBJA 1O07A 3KSGA 1OTDA 3MJQA 3ZVWA 1FR6A 1PWGA 5EPHA 3CAXA 2H28A 3QP1A 5L8MA 1JWZA 4OPZA 4R23A 2GX5A 3DBAA 2ZM2A 3IBRA 3S1YA 4KUKA 1N9NA 1H0MA 3UPNA 4QY5A 2PD7A 2L4RA 4FOFA 3UMEA 5E2HA 2Y8HA 2PR6A 3LEZA 3TSGA 3IF6B 4HHDA 5AVFA 1PZPA 4CLCA 2WK0A 5F1GA 1OPXA 3R7WA 5G4YA 3NCKA 4U0TA 4EBLA 1ZC2A 3C38A 1XGJA 3VE4A 3AGFA 5J3WA 2FH5A 1Y54A 2QPNA 1H3QA 4KZ3A 1BULA 4S2IA 2V1BA 1LL9A 1ESUA 3HLGA 2VGJA 3DTIA 1ESIA 1W63Q 1NY0A 2ZL1B 4KQRA 3KSIA 5DF7A 4CLCC 3G2YA 3UE3A 2G7UA 2VV7A 4P6BA 3LY4A 3JVUA 4HH2A 4NXEA 3MXRA 2FFYA 4CPKA 2XK1A 2INWA 4HQAA 1OTIA 3V3SA 1MBLA 3LEQA 5CXWA 3BJNA 5F83A 4HP4A 1E4DA 3N8SA 2M7UA 2XSSA 1WA9A 1T1BA 1OT9A 4Y13A 1PNEA 1XA1A 4O8GA 2Y2MA 2VX8A 5FI2A 3ITAA 4YOFA 4MEZA 4OPQA 1G6OA 1GCEA 1DY6A 4CJNA 4GHIB 2WUQA 1KGEA 5DKKA 4B9OA 2Q9NA 1D7EA 4A5RA 4D2OA 4BBTA 3ZDJA 2BTFP 1D06A 3WRTA 1JWPA 2V20A 5EV0A 2XLNA 1IOUA 5FATA 4N9KA 4QHCA 1L2SA 4MCWA 4DXBA 4C75A 4KZ5A 3C7UA 4ZJ3A 5EVIB 2ZMAA 4NXBA 3IX8A 4RYEA 1K56D 1X0OA 4DDSA 4HP9A 4E04A 1V9YA 2ZC6B 2P9VB 3WS0A 3H82A 2K2NA 4JBFA 3PAEA 2QJ5A 1LSWA 1STZA 4I3JA 4EETB 3OBFA 4K08A 2NUPC 3PYPA 4Z1WA 1KE0A 3ICYA 3L7HA 4HIAA 2PR5A 4OOYA 3VFHA 5HD3A 3HLFA 1VM1A 1SKOA 3Q1FA 1K57A 4HH3A 5CGWA 5CGSA 3SH8A 4IEDA 1WE4A 3DW0A 1I5QA 4ETZA 4WBGA 3PBRA 4O01A 1F5MA 2DNSA 3G35A 5HWVA 2VGLM 3Q81A 4I38A 4IVKA 3F1PA 4JGPA 4JXWA 1K55A 3B3XA 1OTAA 2PRFA 1EROA 4LCLA 2OWHA 1K57C 3BQAA 1NWZA 4DE1A 1MKMA 5JYPA 2V9AA 4KZAA 1FSYA 2XD5A 3K3DA 1VQQA 1ERMA 1LL5A 2GNXA 1MWSA 1K55C 1JVJA 1J9MA 4BENA 2PBYA 5LBRA 4DXCA 3WWXA 4WMCA 2G2UA 2Y4AA 5EUAA 2WGWA 4Q8IA 2W3HA 3M6BA 4OP8A 4S2OA 4LV1A 3W8KA 3PAGA 4JPMA 1XXMA 4F3LB 3JPUA 1K4EA 1TS7A 1DP9A 1H8YA 1YT4A 3MFDA 1IYQA 2LB9A 3OPLA 1BSGA 3GECA 4KENB 4EUZA 2EFUA 4PPRA 4HJ3A 4YFMA 5HDSA 2J7VA 2BASA 4M3KA 4LRYC 2XFTA 4QY6A 4X53A 3ZFZA 2O9BA 3DAVA 5L09A 2OAP1 3NOTC 3P98A 3MZDA 3HVFA 3UDXA 4EBPA 1F98A 4K0WA 3ISGA 2CMNA 4DF6A 3FPWA 4RQ9A 4B4XA 1HD8A 1YSQA 4D60A 3O88A 5GL9A 1TS0A 3E0YA 4WUJA 1YMXA 3CWFA 4Y17A 2J80A 5IS1A 4Z9QA 1PZOA 1E25A 4ZJ2A 1XP4A 4GS9B 1F2KA 1T1CA 4NXGA 4X69A 3TOIA 4LCMA 2HP6A 1VEUB 5DKLA 1XFNA 1KOUA 3IS2A 4DN0A 5EE8A 3QNCA 4EQ1A 2VJWA 4P6ZM 2WKIA 3F1NA 4LPZA 4YWZA 4BD1A 3G2ZA 3H9WA 4E3JA 2ZM0A 1P0ZA 3UPOA 3HLEA 3GQZA 2PAVP 5E43A 3RTYA 3NHQA 1MKIA 3N8LA 5FEFA 2D01A 4B4ZA 1N9BA 2VGLS 1S6RA 1SKFA 4LGWA 4G3WA 1NJ4A 1NZOA 2W3FA 4KZ4A 2OAQ1 2FZ0A 4H6JB 4BL3A 1J3WA 2ZQCA 3KSFA 3S7OA 4P0MA 3NY4A 2WGVA 5CEBA 4E3IA 3ZGAB 2EWWA 4LRZE 1XFQA 5A90A 5F6AA 5KMWA 3A3JA 4R3JA 2O99A 4BJPA 2ZQ7A 3MSHA 4KG2A 3P09A 5HZHA 2A3UA 1IEMA 1Z6FA 3HLDA 5AVEA 4DDYA 3TE8A 2UWXA 4N9LA 4HI4A 4ESPA 3PXPA 4U3TA 1L0DA 2X71A 2HDQA 1K6RA 2V1AA 2B02A 1PYYA 5HDCA 5FDSA 5HL6A 3UN7A 4OH0A 4R1GA 3UY6A 1FR1A 4LLOB 5FASA 4ID4A 5MC7A 1UWPX 3EEHA 3L9KA 1HLUP 4R4RA 5CHMA 2EXAA 5GLAA 1CI8A 2H0YA 2O9CA 3MBZA 3BRMA 1BZAA 2Q9MA 1SDEA 1DJAA 2W3GA 1GSXA 4IBRA 4FSFA 1S1YA 3UNWA 4WZ5A 4KQQA 3IXBA 2W3DA 5DTSA 2JKTI 3LUQA 5EVLA 2Y59A 3E4OA 4GNUA 3PBOA 4KZ6A 5CHUA 3ZG9B 5FQQA 2ZLYA 3NI9A 4GW9A 3UB5P 2P04A 3LI8A 1N4OA 4NK3A 1XPBA 2JBFA 2Y2KA 3MQQA 2XR0A 5IU1A 3VMAA 5HAIA 3PR6A 1QMEA 3D4FA 3CLOA 1CF0A 1I2WA 1BT5A 1XGIA 1DP8A 1YLJA 3IHAA 3PBSA 3A0VA 5HARA 1S0WA 3FKWA 4P6ZS 2J8YA 4ZAMA 1SHVA 3M2KA 1L3LA 4G3VA 2YKHA 1TEMA 2W1TB 4WM9A 4E3OA 3BY9A 5HPIA 4X6TA 1OMEA 4ZTKA 3RJUA 2PYPA 4WMCD 2XD1A 1BLCA 3DTEA 3F1OB 1TD5A 3IXDA 3DWKA 2OLVA 3UO9A 3MKEA 4Q0JA 5I94A 4R38A 4ZJ1A 3MZFA 1CQAA 4C3QA 4ARZB 3CPTB 4RVAA 3LFVA 1XJ3A 3ZYTA 2V0WA 3QP2A 2HV1A 4I3AA 3U2AA 3QHYA 2QYBA 3C2WA 4PHTA 4WLAA 1CJFA 1IYSA 4BD0A 2K7SA 5KZHA 4OOMA 3W4PA 4GD8A 4PM7A 2JE5A 2AVXA 1P97A 3V3RA 2JC7A 1QMFA 1KVMA 1GHIA 3VP1A 3QP6A 3MXSA 1ZG4A 4S2JA 2ZC7A 4PM8A 2DMWA 2OV5A 1KDWA 3ZG0A 2C6WB 2QMIA 4IVIA 4MBHA 4ZBEA 1PIOA 2KDKA 3IF6A 2L1MA 4OONA 3A3EA 5DVAA 1TDGA 3BEBA 4HEFA 3Q7ZA 5GLDA 3DWZA 4FTXA 2D02A 4Y7PA 5AQ9A 3KYZA 5A92A 2W27A 3EEAA 3BFGA 4L9EA 1CK3A 4QU3A 1RP5A 1WYBA 5E2FA 5CHJA 1K6SA 5EFWA 5A91A 3K3CA 2YKFA 3HCYA 3W4OA 4QWOA 4PMAA 4NKPA 1YAXA 3T4LA 1O7EA 1ES5A 1PW8A 3IF6C 4GB7A 3OC2A 4E3KA 2ZL1A 1FQGA 1BLSA 4EERA 3BY8A 4OQGA 4Y15A 3HUMA 2HP9A 5HD5A 2JKFA 4UQIM 3T1RA 1T18A 3S22A 3ZG8B 3LGOA 2V1ZA 3HUNA 4XT2B 4MDZA 4Y0TA 4WF0A 2WZXA 2GJ3A 4BQMA 3T1XA 4L9FA 1E3UD 2Z2LB 4EESA 5KIZA 1H8MA 2M1CA 4KZBA
chains in the Genus database with same CATH topology
3LIDA 5HDSA 5A8BA 4GHIA 2BASA 4LRYC 4MN7A 1V9ZA 2HGVA 5F68A 1ZHHB 2A24B 3B33A 4BWIA 2O9BA 5J4EA 3OCLA 1TS6A 2PYRA 2XRNA 2NUTC 3S7NA 2OAP1 3NOTC 3T4QA 3ZQ5A 3FPVA 1F98A 2IA2A 2P08A 1S4SA 2CMNA 3MF0A 3FPWA 4RQ9A 5KSHA 1YSQA 4GJ4A 1TS0A 3E0YA 2O9AA 4WUJA 2W1TA 3CWFA 3R4KA 2J80A 1XJ2A 3E4PA 3P01A 4HJ6A 5HWTA 5IS1A 3W2ZA 4JGQA 5DJTA 1S1ZA 2XA7S 3B42A 4GS9B 4ZRRA 3FC7A 3LR0A 1T1CA 3F1OA 4NXGA 4UEYA 2OWJA 4EEUA 5DF9A 1LL8A 1EW0A 5DKLA 5K5BA 1XFNA 3EOIA 2HF6A 1KOUA 3IS2A 4DN0A 3EGXC 2M7VA 2ZBBA 3RFBA 3CUEA 4EQ1A 1UWNX 2VJWA 4IJGA 4P6ZM 5AJGA 2WKRA 3F1NA 4LPZA 3C30A 2W0NA 4ARZA 1GSWA 2JKTM 5HDDA 1T19A 4YWZA 4AFIA 4HNBA 3UB9A 3NOPC 2A24A 4BMWA 4EUVA 3H9WA 4HY8A 4L0LA 1P0ZA 5G4ZA 2K31A 4DJ3A 1OJ5A 3D3OA 3H82B 4GCZA 3MXQA 3RTYA 1LSVA 3NHQA 3A0RA 2D01A 3FG8A 3KX0X 2VGLS 4EXOA 3SW1A 5C5KA 3T4OA 4Y3IA 5DJUA 2KX6A 4BBUA 4G3WA 2J3TD 4KQDA 4ETXA 3UB8A 5J7EA 2W3FA 3IBJA 2OAQ1 1IFQA 3KSGA 1OTDA 3MJQA 1S4RA 2FZ0A 4H6JB 3E4QA 3LR3A 1S67L 3T50A 4MN6A 3KSFA 3S7OA 3H7WB 3MFXA 3CAXA 2H28A 2EWWA 5L8MA 5IT5A 4LRZE 1XFQA 2Y79A 2GX5A 3DBAA 3IBRA 4R3AA 2LB5A 1F9IA 4KUKA 1N9NA 5F6AA 4EEPA 2P7JA 4R70A 3V67A 5CX7A 2O99A 3BQ8A 4WN5A 5HSQA 4BJPA 2PD7A 2L4RA 4DJ2A 4FOFA 3UMEA 2QKPA 2Y8HA 5HZHA 2WKQA 3PHYA 2PR6A 3F1PB 3NJAA 4HHDA 2I9VA 2MJ6A 5AVEA 2KLIA 5AVFA 3TE8A 4CLCA 3VOLA 4HI4A 4I5SA 3PXPA 5TBMB 1OPXA 3R7WA 4GLQA 5G4YA 2HJ9C 2V1AA 2B02A 4UQIS 3C38A 4IHQA 4WEJA 3MR0A 3VE4A 1T1AA 5HDCA 5HL6A 5J3WA 3EGDC 4DMZA 4B93A 1ZTUA 2FH5A 2PD8A 4IUKA 4LLOB 5MC7A 1UWPX 3EEHA 3OCNA 5I5LA 2W1RA 1H3QA 3VE3A 4F3LA 2V1BA 1NRJA 1MZUA 3S7PA 4WELA 2O9CA 1W63Q 4XT2A 3LI9A 3KSIA 4CLCC 3UE3A 2G7UA 2VV7A 2W3GA 1GSXA 1NLYA 3BWLA 4JGOA 3JVUA 4HH2A 4FSFA 4NXEA 1Y28A 1S1YA 3CI6A 2W3DA 1MC0A 2JKTI 3LUQA 4ME4A 2INWA 3E4OA 4HQAA 1OTIA 3PBOA 3BJNA 4HP4A 4IUHA 4OOLA 1ODVA 2M7UA 4GW9A 2XSSA 1WA9A 1T1BA 1OT9A 2JHEA 2P04A 3LI8A 4LRXC 4O0PA 3EQUA 4O8GA 1DRMA 2VLGA 2QHKA 2VX8A 4YOFA 3MQQA 2QJ7A 5IU1A 1G6OA 4Q0IA 4GHIB 3S7QA 3LR4A 3PR6A 5DKKA 4HOIA 4B9OA 3CUEC 3CLOA 3TRCA 1D7EA 4NEED 3TJZC 2L0WA 3G6OA 4PAUA 4BBTA 1DP8A 3PBSA 4GS9A 3A0VA 1D06A 4WEKA 2Z6DA 4P6ZS 3D72A 1S66L 4Q0HA 4G3VA 2VZWA 2YKHA 2W1TB 1GSVA 2KOIA 1IOUA 3BY9A 4M4XA 5HPIA 3KYQA 2JN7A 4MCWA 2PYPA 5F69A 3UE6A 3HJKA 3F1OB 1TD5A 4JGRA 1XJ6A 1XJ4A 3EWKA 4NXBA 2EA9A 2JKRM 2W3EA 5TJJA 2HJEA 2XROA 3IS2B 4Q0JA 1X0OA 2XA7M 4R38A 2VV8A 4HP9A 4E04A 3OOVA 1V9YA 2EWVA 5HPFA 5DFYA 4KUOA 1OT6A 2K2NA 3H82A 3LR5A 3F1NB 3B47A 4ARZB 3RH8B 2VKSA 2QJ5A 3LFVA 1XJ3A 3UMDA 1LSWA 1STZA 1N9LA 4I3JA 3OBFA 4K08A 2V0WA 1JNUA 4WL9A 3ZYTA 4EETB 2HV1A 4I3AA 4II7A 3ULFA 2NUPC 3PYPA 4Z1WA 3HJIA 3U2AA 2VEAA 3MQ0A 3ICYA 2QYBA 3C2WA 4HIAA 2PR5A 4PKYA 4PHTA 1NLZA 1DP6A 2QWSA 4WLAA 5HWWA 4CLCE 3LIBA 4MN5A 1VHMA 5HD3A 2K7SA 3UB7A 4H6JA 2V0UA 4OOMA 4EW7A 4CLCD 3H7WA 4HH3A 1P9WA 5FL3A 3OLOA 1P97A 1BYWA 1N9OA 2ZOIA 1OTBA 2ZMFA 3VV4A 3T4TA 4ETZA 3PBRA 4I39A 4O01A 3MMHA 1F5MA 3A0SA 3LIEA 1VB6A 4R6LA 5HWVA 2DMWA 2VGLM 3CITA 3KO6A 3EQVA 4I38A 4G3KA 3PBQA 2WKPA 3F1PA 4JGPA 4Y2FA 2KDKA 2B18A 2L1MA 1OTAA 1YSPA 1W63M 1LSXA 4HJ3A 2OWHA 5TBMA 3BQAA 1NWZA 1TF1A 3LYXA 4KQOA 2D02A 3JVVA 1MKMA 3KYZA 2R78A 2PT7A 3TW8A 2W27A 3EEAA 2VV6A 4L9EA 2V9AA 4QPRA 3MQOA 2GZAA 4CQHA 5EFWA 2J3WA 3K3CA 5F5YA 2ZOHA 3K3DA 2YKFA 3HCYA 1OTEA 4BBVA 1TS8A 4CLCB 3LICA 4NKPA 1YAXA 3T4LA 2PDRA 1LT0A 1OJGA 1YKDA 3R7WB 2GNXA 3PBNA 3T4KA 2OOLA 3OC2A 2A2LA 4EU0A 4PKYG 5LBRA 3NOUC 3K2NA 3BY8A 2Z6CA 4EERA 3BW6A 3T4JA 2W3HA 2VA0A 3T4SA 1P9RA 4Y5FA 3P7NA 5HD5A 2J3TC 4L9GA 4F3LB 4NXFA 3LIAA 4UQIM 4HJ4A 1G28A 1DP9A 1TS7A 1T18A 3C8CA 3KSHA 3O5YA 3PBTA 4MDZA 3E98A 2LB9A 4XT2B 2JKRI 3GDIA 4WF0A 4YNRA 3GECA 4I3IA 2O0YA 2GJ3A 5DFXA 4L9FA 4MMNA 2PHYA 3UB6A 2ZMVA 4EESA 5KIZA 1H8MA 2M1CA 1UGUA 3LIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LID A;  5HDS A;  5A8B A;  4GHI A;  2BAS A;  4LRY C;  1V9Z A;  5F68 A;  2A24 B;  3B33 A;  5J4E A;  1TS6 A;  2PYR A;  3NOT C;  3ZQ5 A;  1F98 A;  1S4S A;  2CMN A;  4RQ9 A;  1TS0 A;  4WUJ A;  3CWF A;  2J80 A;  1XJ2 A;  3E4P A;  4HJ6 A;  5HWT A;  5IS1 A;  4JGQ A;  5DJT A;  1S1Z A;  4GS9 B;  3FC7 A;  1T1C A;  3F1O A;  4NXG A;  2OWJ A;  4EEU A;  1LL8 A;  1EW0 A;  5DKL A;  1XFN A;  1KOU A;  3IS2 A;  2ZBB A;  1UGU A;  4EQ1 A;  1UWN X;  2WKR A;  3F1N A;  4LPZ A;  2W0N A;  1GSW A;  5HDD A;  1T19 A;  4YWZ A;  4HNB A;  3UB9 A;  3NOP C;  2A24 A;  3H9W A;  4HY8 A;  1P0Z A;  5G4Z A;  4DJ3 A;  1OJ5 A;  3H82 B;  4GCZ A;  3MXQ A;  3RTY A;  1LSV A;  3NHQ A;  3A0R A;  2D01 A;  3FG8 A;  3KX0 X;  4EXO A;  3SW1 A;  5DJU A;  2KX6 A;  4BBU A;  4KQD A;  3UB8 A;  5J7E A;  1OTD A;  3MJQ A;  1S4R A;  4H6J B;  3E4Q A;  1S67 L;  3T50 A;  4MN6 A;  3H7W B;  3MFX A;  3CAX A;  2H28 A;  4LRZ E;  1XFQ A;  3IBR A;  4R3A A;  4KUK A;  1F9I A;  5F6A A;  1N9N A;  4EEP A;  2P7J A;  4R70 A;  4WN5 A;  5HSQ A;  2PD7 A;  2L4R A;  4DJ2 A;  3UME A;  2QKP A;  5HZH A;  2WKQ A;  3PHY A;  2PR6 A;  3F1P B;  3NJA A;  4HHD A;  2I9V A;  5AVE A;  5AVF A;  3VOL A;  4HI4 A;  4I5S A;  5TBM B;  5G4Y A;  2V1A A;  2B02 A;  3VE4 A;  3MR0 A;  1T1A A;  5HDC A;  5J3W A;  2PD8 A;  4LLO B;  1UWP X;  3EEH A;  5I5L A;  3VE3 A;  4F3L A;  2V1B A;  1MZU A;  4XT2 A;  3LI9 A;  2VV7 A;  1GSX A;  3BWL A;  4JGO A;  4HH2 A;  4NXE A;  1Y28 A;  1S1Y A;  3LUQ A;  2INW A;  3E4O A;  4HQA A;  1OTI A;  4HP4 A;  1ODV A;  4GW9 A;  1WA9 A;  1T1B A;  1OT9 A;  2JHE A;  3LI8 A;  4LRX C;  1DRM A;  2VLG A;  2QHK A;  3MQQ A;  2QJ7 A;  5IU1 A;  4GHI B;  5DKK A;  4HOI A;  4B9O A;  3CLO A;  1D7E A;  2L0W A;  3G6O A;  4BBT A;  1DP8 A;  4GS9 A;  3A0V A;  1D06 A;  2Z6D A;  3D72 A;  1S66 L;  2YKH A;  1GSV A;  3BY9 A;  4M4X A;  2JN7 A;  2PYP A;  5F69 A;  3UE6 A;  3HJK A;  3F1O B;  4JGR A;  1XJ6 A;  1XJ4 A;  3EWK A;  4NXB A;  2EA9 A;  3IS2 B;  1X0O A;  4R38 A;  2VV8 A;  4HP9 A;  4E04 A;  1V9Y A;  4KUO A;  1OT6 A;  3H82 A;  3F1N B;  3RH8 B;  2QJ5 A;  1XJ3 A;  3UMD A;  1LSW A;  4I3J A;  1N9L A;  4EET B;  4K08 A;  4WL9 A;  2V0W A;  1JNU A;  2HV1 A;  4I3A A;  3ULF A;  3PYP A;  3HJI A;  2VEA A;  3ICY A;  3C2W A;  4HIA A;  2PR5 A;  4PKY A;  1DP6 A;  2QWS A;  4WLA A;  5HWW A;  3LIB A;  4MN5 A;  5HD3 A;  2K7S A;  3UB7 A;  4H6J A;  2V0U A;  4EW7 A;  3H7W A;  4HH3 A;  3OLO A;  1P97 A;  1BYW A;  1N9O A;  2ZOI A;  1OTB A;  4I39 A;  3A0S A;  3LIE A;  1VB6 A;  4R6L A;  5HWV A;  4I38 A;  2WKP A;  3F1P A;  4JGP A;  2KDK A;  2L1M A;  1OTA A;  1LSX A;  2OWH A;  5TBM A;  1NWZ A;  3LYX A;  2D02 A;  2R78 A;  2W27 A;  2VV6 A;  4L9E A;  2V9A A;  3MQO A;  5EFW A;  3K3C A;  5F5Y A;  2ZOH A;  3K3D A;  2YKF A;  1OTE A;  4BBV A;  1TS8 A;  3LIC A;  2PDR A;  1LT0 A;  1OJG A;  2OOL A;  4PKY G;  3NOU C;  4EER A;  3BY8 A;  2Z6C A;  3P7N A;  5HD5 A;  4L9G A;  4F3L B;  4NXF A;  3LIA A;  4HJ4 A;  1G28 A;  1DP9 A;  1TS7 A;  1T18 A;  3C8C A;  4XT2 B;  3GDI A;  4WF0 A;  3GEC A;  4I3I A;  2GJ3 A;  4L9F A;  2PHY A;  3UB6 A;  4EES A;  5KIZ A;  2M1C A;  4HJ3 A;  3LIF A; 
#chains in the Genus database with same CATH topology
 1LI0 A;  4GHI A;  3UDI A;  4K0X A;  2X01 A;  4JF5 A;  3SS5 A;  2A24 B;  2PYR A;  1L0G A;  3S7N A;  3T4Q A;  3AGD A;  3FPV A;  5F1F A;  1DJB A;  2IA2 A;  1S4S A;  3Q7V B;  4IBX A;  2IWC A;  1XJ2 A;  1ACF A;  2DCF A;  3VP3 A;  3E2K A;  3I7J A;  5FQ9 A;  2H10 A;  1FSW A;  4X55 A;  1S1Z A;  4ZRR A;  3LR0 A;  1TVF A;  3ZNY A;  2ZC4 B;  5EVI A;  5DF9 A;  1LL8 A;  4RA7 A;  2ZQD A;  5J8X A;  4KZ7 A;  2HF6 A;  4LFU A;  5EEC A;  3EGX C;  2ZBB A;  4QB8 A;  1RGZ A;  3LO7 A;  3RFB A;  2P9V A;  3CUE A;  4S2N A;  5HW3 A;  3C30 A;  2W0N A;  1GSW A;  1NYY A;  4DKI A;  2HDU A;  4JKT A;  1T19 A;  2WAE A;  4AFI A;  1LHY A;  2A24 A;  4EUV A;  1CEG A;  4E3M A;  5G4Z A;  2K31 A;  5EVI C;  4DJ3 A;  3D3O A;  3LCE A;  3G34 A;  3A0R A;  3FG8 A;  1H8Z A;  1YLW A;  4S2N C;  3WRZ A;  5L07 A;  2KX6 A;  5BOH A;  2J3T D;  4KQD A;  4ETX A;  3BFD A;  1IKG A;  1JTG A;  4WYY A;  1S4R A;  3E4Q A;  3LR3 A;  1S67 L;  3T50 A;  4MN6 A;  1K0K A;  3H7W B;  3MFX A;  5HFO A;  5A93 A;  3WS1 A;  4XUZ A;  2XEP A;  2Y79 A;  3VSL A;  2LB5 A;  5E2E A;  4R70 A;  2HPB A;  3BQ8 A;  3E2L A;  4U0X A;  5FQM A;  2QKP A;  2V8F A;  3PHY A;  2XF3 A;  5EVE A;  4FUW A;  3WS2 A;  1FCO A;  2KLI A;  3VOL A;  3NEC A;  5TBM B;  3FYZ A;  4N1X A;  4UQI S;  5EM1 A;  4IHQ A;  4WEJ A;  3MR0 A;  4P85 A;  3G4P A;  4B93 A;  1ZTU A;  3T1Q B;  2PD8 A;  4IUK A;  1PFL A;  4F3L A;  1NRJ A;  5HX9 A;  2XH9 A;  5CRF A;  1EWZ A;  4WEL A;  4GOG A;  3LI9 A;  3OZH A;  4BLM A;  3BWL A;  4F94 A;  3CI6 A;  1CI9 A;  3CG5 A;  4ME4 A;  5DTK A;  4OPY A;  2B95 A;  4N92 A;  5EM0 A;  1ONH A;  4LV3 A;  4IUH A;  3ITB A;  1YLY A;  1ONG A;  2XQZ A;  4LRX C;  1NYM A;  3GV9 A;  2A49 A;  1W7F A;  1W5D A;  4LV0 A;  3S7Q A;  2EX8 A;  4HES A;  4RX3 A;  1ZG6 A;  3TRC A;  5CED A;  4NEE D;  3TJZ C;  3G6O A;  1MWR A;  4OKP A;  4DE3 A;  4GS9 A;  4EBN A;  4GDN A;  2H5S A;  3IWQ A;  3V5M A;  1VEU A;  5FEG A;  4Q0H A;  5CER A;  1MWU A;  3PTE A;  2VZW A;  1E3U A;  4M4X A;  5EOO A;  2PU4 A;  2EXB A;  2JN7 A;  4GZB A;  5GHY A;  5L2F A;  5FQK A;  1YMS A;  3SZT A;  2J9P A;  5F69 A;  3HJK A;  5TR7 A;  4OQ0 A;  4JGR A;  1ES3 A;  2Y2N A;  2JKR M;  2HJE A;  4DE2 A;  2XRO A;  5FQJ A;  2XA7 M;  4FCF A;  3OOV A;  1NRF A;  5D3O A;  1KVL A;  3Q82 A;  1OT6 A;  3LR5 A;  1AWI A;  2VKS A;  4NET A;  1N9L A;  4PM5 A;  3ULF A;  3MQ0 A;  1NXY A;  3ZG7 B;  2OSU A;  3HLC A;  1SCW A;  4PKY A;  3BLM A;  1DP6 A;  5HWW A;  3QP5 A;  4MN5 A;  3UB7 A;  4H6J A;  2V0U A;  4MBK A;  5GHZ A;  4EW7 A;  3OLO A;  4K91 A;  1N9O A;  1VET B;  3N8R A;  4QJG A;  1OTB A;  2ZMF A;  3LY3 A;  1GHP A;  4R4S A;  4JXS A;  4MLL A;  1ALQ A;  3T4T A;  4I39 A;  3MMH A;  4S2M A;  4R6L A;  5FI6 A;  2ZD8 A;  4E3N A;  5FAO A;  2QZ6 A;  3KO6 A;  3C4O A;  3EQV A;  2WKE A;  5DF8 A;  5FAQ A;  4G3K A;  3IHB A;  3SOI A;  5EVI D;  5GLC A;  2XDM A;  1W63 M;  2C5W B;  4GN2 A;  1TF1 A;  1YLP A;  1G5U A;  2ZJ9 A;  2XFS A;  3LYX A;  3JVV A;  3NC8 A;  2CC1 A;  2R78 A;  2PT7 A;  3TW8 A;  2VV6 A;  4QPR A;  3GSG A;  4BL2 A;  1Q2Q A;  4WZ5 C;  2GZA A;  4OVD A;  4HBU A;  5F5Y A;  5AQ7 A;  3HUO A;  1OTE A;  4BBV A;  4CLC B;  3UPP A;  2PDR A;  1LT0 A;  1YKD A;  3R7W B;  2VK3 A;  2Z2M B;  3G31 A;  3PBN A;  3T4K A;  4Y0U A;  3NBL A;  3M6H A;  1FIK A;  3V39 A;  3ZVT A;  1CEF A;  1Z09 A;  2BG1 A;  3OPR A;  1M6K A;  4YIN A;  3K2N A;  2Z6C A;  3T4J A;  2VA0 A;  3IWO A;  1LI9 A;  1JTD A;  4XXR A;  4Y5F A;  1IKI A;  2J3T C;  4L9G A;  4OQI A;  3UE0 A;  3CMZ A;  4NXF A;  3LIA A;  3W4Q A;  3C8C A;  3KSH A;  5DTT A;  3CZD A;  3PBT A;  3O5Y A;  2WAD A;  3E98 A;  2E8J A;  3GDI A;  2Y91 A;  1FOF A;  2O0Y A;  4I3I A;  5DFX A;  4MMN A;  2ZQ9 A;  3VP2 A;  1UGU A;  3LIF A;  3O86 A;  5TFQ A;  3IWI A;  5F68 A;  3VP4 A;  3A3F A;  3B33 A;  3OPH A;  1G6A A;  5J4E A;  3OCL A;  1TS6 A;  3ZQ5 A;  2B5R A;  2Y2L A;  3MKF A;  5G18 A;  4OLG A;  2VGK A;  1MY8 A;  1XKZ A;  1KDS A;  3MF0 A;  2WYX A;  1ERQ A;  2HDR A;  4GJ4 A;  4FH2 A;  4JXG A;  2W1T A;  5KSC A;  3E4P A;  4HJ6 A;  5HWT A;  1BLH A;  4JGQ A;  3VOZ A;  3HLB A;  2XGN A;  1HTZ A;  2XA7 S;  3B42 A;  3F1O A;  4UEY A;  4KZ8 A;  4E6W A;  4EEU A;  3GR2 A;  1EW0 A;  5AQB A;  3EOI A;  4O7D A;  3KYE A;  3Q07 A;  3S4X A;  1UWN X;  4IJG A;  2WKR A;  4ARZ A;  3IX3 A;  3CPT A;  1ES2 A;  4EQI A;  1HVB A;  4RX2 A;  4HNB A;  4BMW A;  4R3B A;  1PWD A;  4HY8 A;  4L0L A;  4MNR A;  3O3V A;  1K54 A;  4P87 A;  1OJ5 A;  3H82 B;  2ZC5 B;  1LSV A;  1Q2P A;  2RL3 A;  1L0E A;  3KX0 X;  4KG5 A;  3IXH A;  5F82 A;  4EXO A;  3SW1 A;  1W79 A;  5C5K A;  5U47 A;  2ZQ8 A;  4Y3I A;  3T4O A;  3TG9 A;  4DRT A;  4BBU A;  1TDL A;  3UB8 A;  5J7E A;  2Y2P A;  3IXG A;  1IFQ A;  2DRW A;  5TGF A;  2I72 A;  1XX2 A;  1SKO B;  1BLP A;  1FCN A;  1K54 C;  3SH7 A;  5IT5 A;  5AQA A;  1AXB A;  1BUE A;  4R3A A;  5CTN A;  3OPP A;  1F9I A;  4EEP A;  2P7J A;  3V67 A;  5CTM A;  5CX7 A;  3VFF A;  4WN5 A;  5HSQ A;  2JKG A;  4DJ2 A;  4HBT A;  1NZU A;  3RXW A;  3V50 A;  1HZO A;  1PI5 A;  3N7W A;  2WKQ A;  5M18 A;  3F1P B;  2IWB A;  1IYP A;  3NJA A;  2I9V A;  2MJ6 A;  3FWL A;  3BYD A;  4GKU A;  1EI5 A;  3VP0 A;  4I5S A;  4GLQ A;  3DTM A;  2HJ9 C;  4FH4 A;  5GLB A;  5FA7 A;  3FZC A;  5GHX A;  4H8R A;  1T1A A;  3A3D A;  3EGD C;  4DMZ A;  1C3B A;  2G2W A;  3OCN A;  1LLB A;  5I5L A;  2W1R A;  4UHU A;  1ZKJ A;  1FIL A;  3IQA A;  3VE3 A;  1MZU A;  3S7P A;  4QD4 A;  1KGG A;  1FCM A;  1K25 A;  1PRQ A;  2R9X A;  4XT2 A;  3HRE A;  4N1H A;  1YLZ A;  2H0T A;  1NLY A;  4JGO A;  2WGW B;  1Y28 A;  2IWD A;  1MC0 A;  4KZ9 A;  2HZ5 A;  2Y2I A;  1MPL A;  2Y2H A;  3IT9 A;  4OOL A;  1ODV A;  2JHE A;  4O0P A;  3EQU A;  1DRM A;  2VLG A;  2QHK A;  3GRJ A;  1D1J A;  1U60 A;  3Q7V A;  4JF6 A;  2QJ7 A;  2EX6 A;  1H5X A;  4Q0I A;  3IF5 A;  5M19 A;  3LR4 A;  4HOI A;  3FV7 A;  2Y2G A;  2EX2 A;  3CUE C;  4GD6 A;  5HAQ A;  2JCH A;  2PU2 A;  2L0W A;  1SDN A;  4E6X A;  2WGI A;  4B88 A;  2GDN A;  4PAU A;  4UA6 A;  4OLD A;  4OQH A;  4WEK A;  4S2K A;  2BLS A;  2Z6D A;  3D72 A;  1PW1 A;  1S66 L;  3NDE A;  2PBD P;  3G30 A;  5M1A A;  2Y2Q A;  1GSV A;  2KOI A;  1KE4 A;  4OP5 A;  1MWT A;  3KYQ A;  3NUL A;  5EOE A;  4FD8 A;  3UE6 A;  2WAF A;  1XJ6 A;  1XJ4 A;  3EWK A;  3SS4 A;  2EA9 A;  5TJJ A;  2W3E A;  3JYI A;  4X56 A;  3VSK A;  3IS2 B;  2VV8 A;  2EWV A;  4S2L A;  5HPF A;  5IHV A;  5DFY A;  4KUO A;  1XA7 A;  3F1N B;  3B47 A;  3M2J A;  4JLF A;  3RH8 B;  3UMD A;  4WL9 A;  1JNU A;  1M40 A;  3D9Y A;  4II7 A;  4E3L A;  3HJI A;  3ZHH A;  2VEA A;  4XUX A;  3BFC A;  4DE0 A;  4ZDX A;  1GA9 A;  1NLZ A;  2QWS A;  4CLC E;  3LIB A;  1VHM A;  3NDG A;  3UDF A;  4PM6 A;  3ZG5 A;  4CLC D;  3H7W A;  1P9W A;  3FKV A;  5FL3 A;  4WZ4 A;  1BYW A;  2OLU A;  3BM6 A;  2ZOI A;  1WYC A;  2HP5 A;  3QP8 A;  4KG6 A;  2ZM8 A;  3VV4 A;  3A0S A;  3LIE A;  1VB6 A;  3CJM A;  3CIT A;  1K4F A;  3SS3 A;  4X1L A;  3PBQ A;  2WKP A;  1W8Q A;  3DTK A;  4Y2F A;  1DJC A;  4NG2 A;  2B18 A;  2Y55 A;  3IH8 A;  4UA7 A;  3IH9 A;  1Y4O A;  1YSP A;  3UE1 A;  1LSX A;  1YQS A;  1I2S A;  5TBM A;  3U4L P;  2WZZ A;  4X25 A;  4KQO A;  1IEL A;  5JYO A;  2ZC3 B;  3MQO A;  2V2F F;  3QP4 A;  1L0F A;  3BFE A;  2EX9 A;  4CQH A;  4MBF A;  2J3W A;  2ZOH A;  1BTL A;  3MZE A;  1TS8 A;  3LIC A;  1OJG A;  2ZQA A;  3BFF A;  1K38 A;  4GDB A;  5HL1 A;  1RCJ A;  2OOL A;  2UV0 E;  2A2L A;  4EU0 A;  1PWC A;  1RGY A;  1IYO A;  4PKY G;  4UA9 A;  3NOU C;  1ES4 A;  1GHM A;  3BW6 A;  4C6Y A;  3GMW A;  3T4S A;  1P9R A;  3P7N A;  1K56 A;  4HJ4 A;  1G28 A;  4JXV A;  1PI4 A;  4PM9 A;  4EWF A;  4YNR A;  2JKR I;  2Y2O A;  3WS4 A;  5CEC A;  3G32 A;  4X1M A;  1W8Y A;  2E8I A;  2PHY A;  5E2G A;  3UB6 A;  2ZMV A;  3GTC A;  2EFX A;  2HDS A;  3LID A;  5A8B A;  3T12 B;  4MN7 A;  1V9Z A;  3GVB A;  2HGV A;  3BEC A;  1ZHH B;  5L10 A;  4BWI A;  3N4I A;  3NIA A;  3CHW P;  4R0Q A;  2R9W A;  2NUT C;  2XRN A;  3QNB A;  2Q0O A;  2X02 A;  5FQI A;  2P08 A;  5FAP A;  3C4P A;  5KSH A;  1YM1 A;  4UAA A;  3BLS A;  4EV4 A;  2WKH A;  2O9A A;  5FSR A;  1YPR A;  3R4K A;  4S2P A;  3P01 A;  3W2Z A;  5FI7 A;  3MS6 A;  3A3I A;  3C7V A;  5DJT A;  3N6I A;  3FC7 A;  3T1S A;  3WS5 A;  5CGX A;  1A0K A;  2OWJ A;  4LV2 A;  5K5B A;  1SZV A;  4Y0O A;  4LEN A;  2M7V A;  3ZNT A;  2J9O A;  2P74 A;  1KGF A;  5AJG A;  2Y2J A;  3O87 A;  3C5A A;  2JKT M;  3AGE A;  1JWV A;  5HDD A;  1G68 A;  1GA0 A;  5HAP A;  3UB9 A;  3NOP C;  3ZCZ A;  2RCX A;  4GCZ A;  3MXQ A;  5FDH A;  2V8C A;  4OPR A;  1VET A;  3VOY A;  1KE3 A;  1MXO A;  5DJU A;  3RXX A;  3IX4 A;  3HLW A;  1YLT A;  3SH9 A;  2FFF B;  3HBR A;  4JF4 A;  4X68 A;  2ACG A;  3HL9 A;  3IBJ A;  1O07 A;  3KSG A;  1OTD A;  3MJQ A;  3ZVW A;  1FR6 A;  1PWG A;  5EPH A;  3CAX A;  2H28 A;  3QP1 A;  5L8M A;  1JWZ A;  4OPZ A;  4R23 A;  2GX5 A;  3DBA A;  2ZM2 A;  3IBR A;  3S1Y A;  4KUK A;  1N9N A;  1H0M A;  3UPN A;  4QY5 A;  2PD7 A;  2L4R A;  4FOF A;  3UME A;  5E2H A;  2Y8H A;  2PR6 A;  3LEZ A;  3TSG A;  3IF6 B;  4HHD A;  5AVF A;  1PZP A;  4CLC A;  2WK0 A;  5F1G A;  1OPX A;  3R7W A;  5G4Y A;  3NCK A;  4U0T A;  4EBL A;  1ZC2 A;  3C38 A;  1XGJ A;  3VE4 A;  3AGF A;  5J3W A;  2FH5 A;  1Y54 A;  2QPN A;  1H3Q A;  4KZ3 A;  1BUL A;  4S2I A;  2V1B A;  1LL9 A;  1ESU A;  3HLG A;  2VGJ A;  3DTI A;  1ESI A;  1W63 Q;  1NY0 A;  2ZL1 B;  4KQR A;  3KSI A;  5DF7 A;  4CLC C;  3G2Y A;  3UE3 A;  2G7U A;  2VV7 A;  4P6B A;  3LY4 A;  3JVU A;  4HH2 A;  4NXE A;  3MXR A;  2FFY A;  4CPK A;  2XK1 A;  2INW A;  4HQA A;  1OTI A;  3V3S A;  1MBL A;  3LEQ A;  5CXW A;  3BJN A;  5F83 A;  4HP4 A;  1E4D A;  3N8S A;  2M7U A;  2XSS A;  1WA9 A;  1T1B A;  1OT9 A;  4Y13 A;  1PNE A;  1XA1 A;  4O8G A;  2Y2M A;  2VX8 A;  5FI2 A;  3ITA A;  4YOF A;  4MEZ A;  4OPQ A;  1G6O A;  1GCE A;  1DY6 A;  4CJN A;  4GHI B;  2WUQ A;  1KGE A;  5DKK A;  4B9O A;  2Q9N A;  1D7E A;  4A5R A;  4D2O A;  4BBT A;  3ZDJ A;  2BTF P;  1D06 A;  3WRT A;  1JWP A;  2V20 A;  5EV0 A;  2XLN A;  1IOU A;  5FAT A;  4N9K A;  4QHC A;  1L2S A;  4MCW A;  4DXB A;  4C75 A;  4KZ5 A;  3C7U A;  4ZJ3 A;  5EVI B;  2ZMA A;  4NXB A;  3IX8 A;  4RYE A;  1K56 D;  1X0O A;  4DDS A;  4HP9 A;  4E04 A;  1V9Y A;  2ZC6 B;  2P9V B;  3WS0 A;  3H82 A;  2K2N A;  4JBF A;  3PAE A;  2QJ5 A;  1LSW A;  1STZ A;  4I3J A;  4EET B;  3OBF A;  4K08 A;  2NUP C;  3PYP A;  4Z1W A;  1KE0 A;  3ICY A;  3L7H A;  4HIA A;  2PR5 A;  4OOY A;  3VFH A;  5HD3 A;  3HLF A;  1VM1 A;  1SKO A;  3Q1F A;  1K57 A;  4HH3 A;  5CGW A;  5CGS A;  3SH8 A;  4IED A;  1WE4 A;  3DW0 A;  1I5Q A;  4ETZ A;  4WBG A;  3PBR A;  4O01 A;  1F5M A;  2DNS A;  3G35 A;  5HWV A;  2VGL M;  3Q81 A;  4I38 A;  4IVK A;  3F1P A;  4JGP A;  4JXW A;  1K55 A;  3B3X A;  1OTA A;  2PRF A;  1ERO A;  4LCL A;  2OWH A;  1K57 C;  3BQA A;  1NWZ A;  4DE1 A;  1MKM A;  5JYP A;  2V9A A;  4KZA A;  1FSY A;  2XD5 A;  3K3D A;  1VQQ A;  1ERM A;  1LL5 A;  2GNX A;  1MWS A;  1K55 C;  1JVJ A;  1J9M A;  4BEN A;  2PBY A;  5LBR A;  4DXC A;  3WWX A;  4WMC A;  2G2U A;  2Y4A A;  5EUA A;  2WGW A;  4Q8I A;  2W3H A;  3M6B A;  4OP8 A;  4S2O A;  4LV1 A;  3W8K A;  3PAG A;  4JPM A;  1XXM A;  4F3L B;  3JPU A;  1K4E A;  1TS7 A;  1DP9 A;  1H8Y A;  1YT4 A;  3MFD A;  1IYQ A;  2LB9 A;  3OPL A;  1BSG A;  3GEC A;  4KEN B;  4EUZ A;  2EFU A;  4PPR A;  4HJ3 A;  4YFM A;  5HDS A;  2J7V A;  2BAS A;  4M3K A;  4LRY C;  2XFT A;  4QY6 A;  4X53 A;  3ZFZ A;  2O9B A;  3DAV A;  5L09 A;  2OAP 1;  3NOT C;  3P98 A;  3MZD A;  3HVF A;  3UDX A;  4EBP A;  1F98 A;  4K0W A;  3ISG A;  2CMN A;  4DF6 A;  3FPW A;  4RQ9 A;  4B4X A;  1HD8 A;  1YSQ A;  4D60 A;  3O88 A;  5GL9 A;  1TS0 A;  3E0Y A;  4WUJ A;  1YMX A;  3CWF A;  4Y17 A;  2J80 A;  5IS1 A;  4Z9Q A;  1PZO A;  1E25 A;  4ZJ2 A;  1XP4 A;  4GS9 B;  1F2K A;  1T1C A;  4NXG A;  4X69 A;  3TOI A;  4LCM A;  2HP6 A;  1VEU B;  5DKL A;  1XFN A;  1KOU A;  3IS2 A;  4DN0 A;  5EE8 A;  3QNC A;  4EQ1 A;  2VJW A;  4P6Z M;  2WKI A;  3F1N A;  4LPZ A;  4YWZ A;  4BD1 A;  3G2Z A;  3H9W A;  4E3J A;  2ZM0 A;  1P0Z A;  3UPO A;  3HLE A;  3GQZ A;  2PAV P;  5E43 A;  3RTY A;  3NHQ A;  1MKI A;  3N8L A;  5FEF A;  2D01 A;  4B4Z A;  1N9B A;  2VGL S;  1S6R A;  1SKF A;  4LGW A;  4G3W A;  1NJ4 A;  1NZO A;  2W3F A;  4KZ4 A;  2OAQ 1;  2FZ0 A;  4H6J B;  4BL3 A;  1J3W A;  2ZQC A;  3KSF A;  3S7O A;  4P0M A;  3NY4 A;  2WGV A;  5CEB A;  4E3I A;  3ZGA B;  2EWW A;  4LRZ E;  1XFQ A;  5A90 A;  5F6A A;  5KMW A;  3A3J A;  4R3J A;  2O99 A;  4BJP A;  2ZQ7 A;  3MSH A;  4KG2 A;  3P09 A;  5HZH A;  2A3U A;  1IEM A;  1Z6F A;  3HLD A;  5AVE A;  4DDY A;  3TE8 A;  2UWX A;  4N9L A;  4HI4 A;  4ESP A;  3PXP A;  4U3T A;  1L0D A;  2X71 A;  2HDQ A;  1K6R A;  2V1A A;  2B02 A;  1PYY A;  5HDC A;  5FDS A;  5HL6 A;  3UN7 A;  4OH0 A;  4R1G A;  3UY6 A;  1FR1 A;  4LLO B;  5FAS A;  4ID4 A;  5MC7 A;  1UWP X;  3EEH A;  3L9K A;  1HLU P;  4R4R A;  5CHM A;  2EXA A;  5GLA A;  1CI8 A;  2H0Y A;  2O9C A;  3MBZ A;  3BRM A;  1BZA A;  2Q9M A;  1SDE A;  1DJA A;  2W3G A;  1GSX A;  4IBR A;  4FSF A;  1S1Y A;  3UNW A;  4WZ5 A;  4KQQ A;  3IXB A;  2W3D A;  5DTS A;  2JKT I;  3LUQ A;  5EVL A;  2Y59 A;  3E4O A;  4GNU A;  3PBO A;  4KZ6 A;  5CHU A;  3ZG9 B;  5FQQ A;  2ZLY A;  3NI9 A;  4GW9 A;  3UB5 P;  2P04 A;  3LI8 A;  1N4O A;  4NK3 A;  1XPB A;  2JBF A;  2Y2K A;  3MQQ A;  2XR0 A;  5IU1 A;  3VMA A;  5HAI A;  3PR6 A;  1QME A;  3D4F A;  3CLO A;  1CF0 A;  1I2W A;  1BT5 A;  1XGI A;  1DP8 A;  1YLJ A;  3IHA A;  3PBS A;  3A0V A;  5HAR A;  1S0W A;  3FKW A;  4P6Z S;  2J8Y A;  4ZAM A;  1SHV A;  3M2K A;  1L3L A;  4G3V A;  2YKH A;  1TEM A;  2W1T B;  4WM9 A;  4E3O A;  3BY9 A;  5HPI A;  4X6T A;  1OME A;  4ZTK A;  3RJU A;  2PYP A;  4WMC D;  2XD1 A;  1BLC A;  3DTE A;  3F1O B;  1TD5 A;  3IXD A;  3DWK A;  2OLV A;  3UO9 A;  3MKE A;  4Q0J A;  5I94 A;  4R38 A;  4ZJ1 A;  3MZF A;  1CQA A;  4C3Q A;  4ARZ B;  3CPT B;  4RVA A;  3LFV A;  1XJ3 A;  3ZYT A;  2V0W A;  3QP2 A;  2HV1 A;  4I3A A;  3U2A A;  3QHY A;  2QYB A;  3C2W A;  4PHT A;  4WLA A;  1CJF A;  1IYS A;  4BD0 A;  2K7S A;  5KZH A;  4OOM A;  3W4P A;  4GD8 A;  4PM7 A;  2JE5 A;  2AVX A;  1P97 A;  3V3R A;  2JC7 A;  1QMF A;  1KVM A;  1GHI A;  3VP1 A;  3QP6 A;  3MXS A;  1ZG4 A;  4S2J A;  2ZC7 A;  4PM8 A;  2DMW A;  2OV5 A;  1KDW A;  3ZG0 A;  2C6W B;  2QMI A;  4IVI A;  4MBH A;  4ZBE A;  1PIO A;  2KDK A;  3IF6 A;  2L1M A;  4OON A;  3A3E A;  5DVA A;  1TDG A;  3BEB A;  4HEF A;  3Q7Z A;  5GLD A;  3DWZ A;  4FTX A;  2D02 A;  4Y7P A;  5AQ9 A;  3KYZ A;  5A92 A;  2W27 A;  3EEA A;  3BFG A;  4L9E A;  1CK3 A;  4QU3 A;  1RP5 A;  1WYB A;  5E2F A;  5CHJ A;  1K6S A;  5EFW A;  5A91 A;  3K3C A;  2YKF A;  3HCY A;  3W4O A;  4QWO A;  4PMA A;  4NKP A;  1YAX A;  3T4L A;  1O7E A;  1ES5 A;  1PW8 A;  3IF6 C;  4GB7 A;  3OC2 A;  4E3K A;  2ZL1 A;  1FQG A;  1BLS A;  4EER A;  3BY8 A;  4OQG A;  4Y15 A;  3HUM A;  2HP9 A;  5HD5 A;  2JKF A;  4UQI M;  3T1R A;  1T18 A;  3S22 A;  3ZG8 B;  3LGO A;  2V1Z A;  3HUN A;  4XT2 B;  4MDZ A;  4Y0T A;  4WF0 A;  2WZX A;  2GJ3 A;  4BQM A;  3T1X A;  4L9F A;  1E3U D;  2Z2L B;  4EES A;  5KIZ A;  1H8M A;  2M1C A;  4KZB A; 
#chains in the Genus database with same CATH homology
 3LID A;  5HDS A;  5A8B A;  4GHI A;  2BAS A;  4LRY C;  4MN7 A;  1V9Z A;  2HGV A;  5F68 A;  1ZHH B;  2A24 B;  3B33 A;  4BWI A;  2O9B A;  5J4E A;  3OCL A;  1TS6 A;  2PYR A;  2XRN A;  2NUT C;  3S7N A;  2OAP 1;  3NOT C;  3T4Q A;  3ZQ5 A;  3FPV A;  1F98 A;  2IA2 A;  2P08 A;  1S4S A;  2CMN A;  3MF0 A;  3FPW A;  4RQ9 A;  5KSH A;  1YSQ A;  4GJ4 A;  1TS0 A;  3E0Y A;  2O9A A;  4WUJ A;  2W1T A;  3CWF A;  3R4K A;  2J80 A;  1XJ2 A;  3E4P A;  3P01 A;  4HJ6 A;  5HWT A;  5IS1 A;  3W2Z A;  4JGQ A;  5DJT A;  1S1Z A;  2XA7 S;  3B42 A;  4GS9 B;  4ZRR A;  3FC7 A;  3LR0 A;  1T1C A;  3F1O A;  4NXG A;  4UEY A;  2OWJ A;  4EEU A;  5DF9 A;  1LL8 A;  1EW0 A;  5DKL A;  5K5B A;  1XFN A;  3EOI A;  2HF6 A;  1KOU A;  3IS2 A;  4DN0 A;  3EGX C;  2M7V A;  2ZBB A;  3RFB A;  3CUE A;  4EQ1 A;  1UWN X;  2VJW A;  4IJG A;  4P6Z M;  5AJG A;  2WKR A;  3F1N A;  4LPZ A;  3C30 A;  2W0N A;  4ARZ A;  1GSW A;  2JKT M;  5HDD A;  1T19 A;  4YWZ A;  4AFI A;  4HNB A;  3UB9 A;  3NOP C;  2A24 A;  4BMW A;  4EUV A;  3H9W A;  4HY8 A;  4L0L A;  1P0Z A;  5G4Z A;  2K31 A;  4DJ3 A;  1OJ5 A;  3D3O A;  3H82 B;  4GCZ A;  3MXQ A;  3RTY A;  1LSV A;  3NHQ A;  3A0R A;  2D01 A;  3FG8 A;  3KX0 X;  2VGL S;  4EXO A;  3SW1 A;  5C5K A;  3T4O A;  4Y3I A;  5DJU A;  2KX6 A;  4BBU A;  4G3W A;  2J3T D;  4KQD A;  4ETX A;  3UB8 A;  5J7E A;  2W3F A;  3IBJ A;  2OAQ 1;  1IFQ A;  3KSG A;  1OTD A;  3MJQ A;  1S4R A;  2FZ0 A;  4H6J B;  3E4Q A;  3LR3 A;  1S67 L;  3T50 A;  4MN6 A;  3KSF A;  3S7O A;  3H7W B;  3MFX A;  3CAX A;  2H28 A;  2EWW A;  5L8M A;  5IT5 A;  4LRZ E;  1XFQ A;  2Y79 A;  2GX5 A;  3DBA A;  3IBR A;  4R3A A;  2LB5 A;  1F9I A;  4KUK A;  1N9N A;  5F6A A;  4EEP A;  2P7J A;  4R70 A;  3V67 A;  5CX7 A;  2O99 A;  3BQ8 A;  4WN5 A;  5HSQ A;  4BJP A;  2PD7 A;  2L4R A;  4DJ2 A;  4FOF A;  3UME A;  2QKP A;  2Y8H A;  5HZH A;  2WKQ A;  3PHY A;  2PR6 A;  3F1P B;  3NJA A;  4HHD A;  2I9V A;  2MJ6 A;  5AVE A;  2KLI A;  5AVF A;  3TE8 A;  4CLC A;  3VOL A;  4HI4 A;  4I5S A;  3PXP A;  5TBM B;  1OPX A;  3R7W A;  4GLQ A;  5G4Y A;  2HJ9 C;  2V1A A;  2B02 A;  4UQI S;  3C38 A;  4IHQ A;  4WEJ A;  3MR0 A;  3VE4 A;  1T1A A;  5HDC A;  5HL6 A;  5J3W A;  3EGD C;  4DMZ A;  4B93 A;  1ZTU A;  2FH5 A;  2PD8 A;  4IUK A;  4LLO B;  5MC7 A;  1UWP X;  3EEH A;  3OCN A;  5I5L A;  2W1R A;  1H3Q A;  3VE3 A;  4F3L A;  2V1B A;  1NRJ A;  1MZU A;  3S7P A;  4WEL A;  2O9C A;  1W63 Q;  4XT2 A;  3LI9 A;  3KSI A;  4CLC C;  3UE3 A;  2G7U A;  2VV7 A;  2W3G A;  1GSX A;  1NLY A;  3BWL A;  4JGO A;  3JVU A;  4HH2 A;  4FSF A;  4NXE A;  1Y28 A;  1S1Y A;  3CI6 A;  2W3D A;  1MC0 A;  2JKT I;  3LUQ A;  4ME4 A;  2INW A;  3E4O A;  4HQA A;  1OTI A;  3PBO A;  3BJN A;  4HP4 A;  4IUH A;  4OOL A;  1ODV A;  2M7U A;  4GW9 A;  2XSS A;  1WA9 A;  1T1B A;  1OT9 A;  2JHE A;  2P04 A;  3LI8 A;  4LRX C;  4O0P A;  3EQU A;  4O8G A;  1DRM A;  2VLG A;  2QHK A;  2VX8 A;  4YOF A;  3MQQ A;  2QJ7 A;  5IU1 A;  1G6O A;  4Q0I A;  4GHI B;  3S7Q A;  3LR4 A;  3PR6 A;  5DKK A;  4HOI A;  4B9O A;  3CUE C;  3CLO A;  3TRC A;  1D7E A;  4NEE D;  3TJZ C;  2L0W A;  3G6O A;  4PAU A;  4BBT A;  1DP8 A;  3PBS A;  4GS9 A;  3A0V A;  1D06 A;  4WEK A;  2Z6D A;  4P6Z S;  3D72 A;  1S66 L;  4Q0H A;  4G3V A;  2VZW A;  2YKH A;  2W1T B;  1GSV A;  2KOI A;  1IOU A;  3BY9 A;  4M4X A;  5HPI A;  3KYQ A;  2JN7 A;  4MCW A;  2PYP A;  5F69 A;  3UE6 A;  3HJK A;  3F1O B;  1TD5 A;  4JGR A;  1XJ6 A;  1XJ4 A;  3EWK A;  4NXB A;  2EA9 A;  2JKR M;  2W3E A;  5TJJ A;  2HJE A;  2XRO A;  3IS2 B;  4Q0J A;  1X0O A;  2XA7 M;  4R38 A;  2VV8 A;  4HP9 A;  4E04 A;  3OOV A;  1V9Y A;  2EWV A;  5HPF A;  5DFY A;  4KUO A;  1OT6 A;  2K2N A;  3H82 A;  3LR5 A;  3F1N B;  3B47 A;  4ARZ B;  3RH8 B;  2VKS A;  2QJ5 A;  3LFV A;  1XJ3 A;  3UMD A;  1LSW A;  1STZ A;  1N9L A;  4I3J A;  3OBF A;  4K08 A;  2V0W A;  1JNU A;  4WL9 A;  3ZYT A;  4EET B;  2HV1 A;  4I3A A;  4II7 A;  3ULF A;  2NUP C;  3PYP A;  4Z1W A;  3HJI A;  3U2A A;  2VEA A;  3MQ0 A;  3ICY A;  2QYB A;  3C2W A;  4HIA A;  2PR5 A;  4PKY A;  4PHT A;  1NLZ A;  1DP6 A;  2QWS A;  4WLA A;  5HWW A;  4CLC E;  3LIB A;  4MN5 A;  1VHM A;  5HD3 A;  2K7S A;  3UB7 A;  4H6J A;  2V0U A;  4OOM A;  4EW7 A;  4CLC D;  3H7W A;  4HH3 A;  1P9W A;  5FL3 A;  3OLO A;  1P97 A;  1BYW A;  1N9O A;  2ZOI A;  1OTB A;  2ZMF A;  3VV4 A;  3T4T A;  4ETZ A;  3PBR A;  4I39 A;  4O01 A;  3MMH A;  1F5M A;  3A0S A;  3LIE A;  1VB6 A;  4R6L A;  5HWV A;  2DMW A;  2VGL M;  3CIT A;  3KO6 A;  3EQV A;  4I38 A;  4G3K A;  3PBQ A;  2WKP A;  3F1P A;  4JGP A;  4Y2F A;  2KDK A;  2B18 A;  2L1M A;  1OTA A;  1YSP A;  1W63 M;  1LSX A;  4HJ3 A;  2OWH A;  5TBM A;  3BQA A;  1NWZ A;  1TF1 A;  3LYX A;  4KQO A;  2D02 A;  3JVV A;  1MKM A;  3KYZ A;  2R78 A;  2PT7 A;  3TW8 A;  2W27 A;  3EEA A;  2VV6 A;  4L9E A;  2V9A A;  4QPR A;  3MQO A;  2GZA A;  4CQH A;  5EFW A;  2J3W A;  3K3C A;  5F5Y A;  2ZOH A;  3K3D A;  2YKF A;  3HCY A;  1OTE A;  4BBV A;  1TS8 A;  4CLC B;  3LIC A;  4NKP A;  1YAX A;  3T4L A;  2PDR A;  1LT0 A;  1OJG A;  1YKD A;  3R7W B;  2GNX A;  3PBN A;  3T4K A;  2OOL A;  3OC2 A;  2A2L A;  4EU0 A;  4PKY G;  5LBR A;  3NOU C;  3K2N A;  3BY8 A;  2Z6C A;  4EER A;  3BW6 A;  3T4J A;  2W3H A;  2VA0 A;  3T4S A;  1P9R A;  4Y5F A;  3P7N A;  5HD5 A;  2J3T C;  4L9G A;  4F3L B;  4NXF A;  3LIA A;  4UQI M;  4HJ4 A;  1G28 A;  1DP9 A;  1TS7 A;  1T18 A;  3C8C A;  3KSH A;  3O5Y A;  3PBT A;  4MDZ A;  3E98 A;  2LB9 A;  4XT2 B;  2JKR I;  3GDI A;  4WF0 A;  4YNR A;  3GEC A;  4I3I A;  2O0Y A;  2GJ3 A;  5DFX A;  4L9F A;  4MMN A;  2PHY A;  3UB6 A;  2ZMV A;  4EES A;  5KIZ A;  1H8M A;  2M1C A;  1UGU A;  3LIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...