4KUXA

Crystal structure of aspergillus terreus aristolochene synthase complexed with farnesyl thiolodiphosphate (fspp)
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title Mechanistic insights from the binding of substrate and carbocation intermediate analogues to aristolochene synthase.
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase
total genus 131
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4kuxA00
5ILDA 2AETA 4H5CF 2QISA 4KQ5A 2ZY1A 4XQRF 1WL3A 4FJQA 5EAUA 3CC9A 2Z4XA 3LMDA 3OYRA 3WCCA 4E1EA 5ILIA 3WEKA 4KUXA 2VF6A 5DZ2A 1HX9A 4LLSA 5EROA 4LFVF 1V4KA 3N45F 4XQSF 3WCJA 4KK2A 4NFJF 4LLTA 1VG2A 4JYXA 4N9UA 5IVGA 3LGZB 3P5PA 4OMHA 2F8CF 2Z7IA 4LPHF 3OACA 4JXYA 3KRPA 4NFIF 4FP4A 3Q1OA 2Z4VA 2E8WA 3SDVA 3WJNA 2OA6A 3VJAA 2J1PA 2RAHA 3KRCB 3WCFA 5IKAA 5KSXF 2AELA 4LXWA 3KRAA 5IMPA 2P1CA 2ZCOA 2F7MF 3WEFA 3WCHA 1VG4A 3SDTA 3SAEA 3P8RA 3LDWA 1YHKA 3AE0A 5A0KA 2F89F 5HNAA 4MC3A 2PS4A 3RBMA 5ILZA 4F6VA 2FTZA 3CKEA 4LUUA 2Z52A 4F6XA 5ERMA 5IL8A 4P0VA 2F8ZF 3VJ8A 3ZOUA 2Z78A 1HXAA 5B0IA 3KRFA 3TS7A 5IL3A 3WEJA 4MC8A 5DJPF 4XQTF 3ICKA 2Z4ZA 3V1VA 4OKZA 3N3DA 5IMNA 4JZBA 3M02A 2F9KF 4DWBA 3ZL6A 4RXCA 1DGPA 4OMGA 4ZQ8A 5IKHA 5ILYA 2E8XA 5DHIA 3WCGA 1V4JA 2PS8A 1YQ7A 1WL0A 5EASA 3OACB 3KRPB 3LOMA 5E8HA 3CP6A 4Q23A 4EA2A 1V4IA 1YYQA 1N24A 5JUZF 2ONGA 4DHDA 1JFGA 4NKFA 3EZ3A 1HM7A 4WK5A 1N23A 3N1VF 2Q9YA 3Q2ZA 3KRAB 3Q2QA 4KWDA 3NF2A 2AZJA 5DHKA 4RXAA 5DGMF 1V4HA 4KQUA 1N22A 4RXDA 4JXNA 5JV0F 4E9ZA 4LPGF 1YYRA 1UBYA 3PH7A 3V1XA 4JZXA 3OABA 1VG7A 3TFNA 2E91A 4RXEA 3N46F 1YYTA 3N49F 4KKMA 5IK0A 2AZLA 4K10A 3KRFB 4GA3A 3ASXA 3ZMBA 4KVDA 4EA0A 5HN9A 1N1BA 3ZCDA 4KFAA 2I19A 3PYBA 5DW7A 4E9UA 4L2XF 3LEEA 3APZA 3RYWA 4QXSF 3SDQA 5HN7A 4H5DF 5B0MA 5DGSF 3SDRA 1YYSA 4NUAA 3N5HF 4DZWA 3M00A 4N1ZF 1N21A 2ZCQA 4P0WA 3ADZA 3KBKA 1KIZA 2J1OA 2Q80A 1EZFA 4NFKF 3RYEA 5CG6A 5JV1F 1N1ZA 4PVYF 4KVIA 3BNXA 3B7LA 3EFQA 2FORA 1UBWA 4OKMA 3BNYA 3Q30A 3WEHA 3IPIA 5H9DA 2ZCRA 3MAVA 4DI5A 5IK9A 5ER8A 1YYUA 3QKCA 3DYFA 2E8UA 4NKEA 3TFPA 4LA6A 2Z7HA 1JFAA 3VJEA 2Z50A 3LGKA 2E90A 2E8VA 3WCMA 3M01A 5DJRF 3AQ0A 2AEKA 5HN8A 4KPDA 3OABB 5B0LA 3S4JA 3M9UA 2E93A 3DYHA 4GP2A 1YHMA 2Q9ZA 4KQSA 3V66A 3M0GA 5ILKA 3KRCA 3AQBB 3AQCB 5ILJA 3ACWA 4DXJA 4H5EF 4F62A 3G4FA 4RNQA 4RYPA 2OGDA 3ACYA 1YHLA 4OGUA 2H8OA 3UCAA 3NRIA 2O1OA 5IN8A 4LFGA 1VG6A 1HXGA 3N1WF 2E95A 3ICZA 3TFVA 3LVSA 4LOBA 5B03A 3WCIA 4MC0A 5JA0F 1HM4A 1KIYA 2J5CA 3MZVA 3ACXA 5E8LA 3KROA 2E4OA 3LZ9A 4QPFA 2OPNA 3TC1A 3NPKA 1V4EA 3ICMA 2Z4YA 2E92A 3WEIA 4LTVA 3KB9A 5A0IA 3IBAA 4HD1A 3VJ9A 3WJOA 2ZCSA 1RQJA 4P0XA 3LG5A 3S9VA 2AZKA 5IM1A 2F92F 5DGNF 3WCDA 3G4DA 3N0FA 2OPMA 4UMJA 5B01A 3PYAA 4LA5A 3WSBA 2PS6A 5ILHA 2EWGA 1FPSA 4LIXA 4NG6A 4KVYA 3LK5A 4LZ3A 5AYPA 3WJKA 3EGTA 5IK6A 2Q58A 3ZMCA 4KVWA 5C05A 3WCBA 1WKZA 5EATA 3NPRA 3ID0A 1RQIA 4GAXA 3LSNA 5CG5A 5B02A 1PS1A 1DI1A 2F94F 3WCEA 2Z4WA 3WC9A 4GP1A 4PVXF 3P41A 4DWGA 5AHUB 3VJDA 2PS5A 1N20A 3ICNA 3N0GA 3PDEA 5AFXA 3VJCA 3WE9A 5B00A 3N5JF 5JV2F 3PKOA 5I1UA 3P8LA 3VJBA 5A0JA 1UBXA 1WMWA 2PS7A 3KROB 3WEGA 1YV5A 3N6KF 5AELA 4LZ0A 3P5RA 4EA1A 2ZEUA 5B0JA 1WL2A 3RMGA 2E94A 5IMIA 4KPJA 2ZEVA 1VG3A 1WL1A 4LTZA 2DH4A 2E8TA 3DYGA 5DIQF 3N3LF 3LJIA 3WSAA 1HXCA 3WCAA 5B0KA 2ONHA 1WY0A 1ZW5A 3LLWA 5E8KA 4LZCA 1UBVA 5ERNA 1YJ4A 3QQVA 3WCLA 3W7FA 3SDUA 1RTRA 4DEMF 4JVJF 4LFEA 5DJVF
chains in the Genus database with same CATH superfamily
5ILDA 2AETA 4H5CF 2QISA 4KQ5A 2ZY1A 4XQRF 1WL3A 4FJQA 5EAUA 3CC9A 2Z4XA 3LMDA 3OYRA 3WCCA 4E1EA 5ILIA 3WEKA 4KUXA 2VF6A 5DZ2A 1HX9A 4LLSA 5EROA 4LFVF 1V4KA 3N45F 4XQSF 3WCJA 4KK2A 4NFJF 4LLTA 1VG2A 4JYXA 4N9UA 5IVGA 3LGZB 3P5PA 4OMHA 2F8CF 2Z7IA 4LPHF 3OACA 4JXYA 3KRPA 4NFIF 4FP4A 3Q1OA 2Z4VA 2E8WA 3SDVA 3WJNA 2OA6A 3VJAA 2J1PA 2RAHA 3KRCB 3WCFA 5IKAA 5KSXF 2AELA 4LXWA 3KRAA 5IMPA 2P1CA 2ZCOA 2F7MF 3WEFA 3WCHA 1VG4A 3SDTA 3SAEA 3P8RA 3LDWA 1YHKA 3AE0A 5A0KA 2F89F 5HNAA 4MC3A 2PS4A 3RBMA 5ILZA 4F6VA 2FTZA 3CKEA 4LUUA 2Z52A 4F6XA 5ERMA 5IL8A 4P0VA 2F8ZF 3VJ8A 3ZOUA 2Z78A 1HXAA 5B0IA 3KRFA 3TS7A 5IL3A 3WEJA 4MC8A 5DJPF 4XQTF 3ICKA 2Z4ZA 3V1VA 4OKZA 3N3DA 5IMNA 4JZBA 3M02A 2F9KF 4DWBA 3ZL6A 4RXCA 1DGPA 4OMGA 4ZQ8A 5IKHA 5ILYA 2E8XA 5DHIA 3WCGA 1V4JA 2PS8A 1YQ7A 1WL0A 5EASA 3OACB 3KRPB 3LOMA 5E8HA 3CP6A 4Q23A 4EA2A 1V4IA 1YYQA 1N24A 5JUZF 2ONGA 4DHDA 1JFGA 4NKFA 3EZ3A 1HM7A 4WK5A 1N23A 3N1VF 2Q9YA 3Q2ZA 3KRAB 3Q2QA 4KWDA 3NF2A 2AZJA 5DHKA 4RXAA 5DGMF 1V4HA 4KQUA 1N22A 4RXDA 4JXNA 5JV0F 4E9ZA 4LPGF 1YYRA 1UBYA 3PH7A 3V1XA 4JZXA 3OABA 1VG7A 3TFNA 2E91A 4RXEA 3N46F 1YYTA 3N49F 4KKMA 5IK0A 2AZLA 4K10A 3KRFB 4GA3A 3ASXA 3ZMBA 4KVDA 4EA0A 5HN9A 1N1BA 3ZCDA 4KFAA 2I19A 3PYBA 5DW7A 4E9UA 4L2XF 3LEEA 3APZA 3RYWA 4QXSF 3SDQA 5HN7A 4H5DF 5B0MA 5DGSF 3SDRA 1YYSA 4NUAA 3N5HF 4DZWA 3M00A 4N1ZF 1N21A 2ZCQA 4P0WA 3ADZA 3KBKA 1KIZA 2J1OA 2Q80A 1EZFA 4NFKF 3RYEA 5CG6A 5JV1F 1N1ZA 4PVYF 4KVIA 3BNXA 3B7LA 3EFQA 2FORA 1UBWA 4OKMA 3BNYA 3Q30A 3WEHA 3IPIA 5H9DA 2ZCRA 3MAVA 4DI5A 5IK9A 5ER8A 1YYUA 3QKCA 3DYFA 2E8UA 4NKEA 3TFPA 4LA6A 2Z7HA 1JFAA 3VJEA 2Z50A 3LGKA 2E90A 2E8VA 3WCMA 3M01A 5DJRF 3AQ0A 2AEKA 5HN8A 4KPDA 3OABB 5B0LA 3S4JA 3M9UA 2E93A 3DYHA 4GP2A 1YHMA 2Q9ZA 4KQSA 3V66A 3M0GA 5ILKA 3KRCA 3AQBB 3AQCB 5ILJA 3ACWA 4DXJA 4H5EF 4F62A 3G4FA 4RNQA 4RYPA 2OGDA 3ACYA 1YHLA 4OGUA 2H8OA 3UCAA 3NRIA 2O1OA 5IN8A 4LFGA 1VG6A 1HXGA 3N1WF 2E95A 3ICZA 3TFVA 3LVSA 4LOBA 5B03A 3WCIA 4MC0A 5JA0F 1HM4A 1KIYA 2J5CA 3MZVA 3ACXA 5E8LA 3KROA 2E4OA 3LZ9A 4QPFA 2OPNA 3TC1A 3NPKA 1V4EA 3ICMA 2Z4YA 2E92A 3WEIA 4LTVA 3KB9A 5A0IA 3IBAA 4HD1A 3VJ9A 3WJOA 2ZCSA 1RQJA 4P0XA 3LG5A 3S9VA 2AZKA 5IM1A 2F92F 5DGNF 3WCDA 3G4DA 3N0FA 2OPMA 4UMJA 5B01A 3PYAA 4LA5A 3WSBA 2PS6A 5ILHA 2EWGA 1FPSA 4LIXA 4NG6A 4KVYA 3LK5A 4LZ3A 5AYPA 3WJKA 3EGTA 5IK6A 2Q58A 3ZMCA 4KVWA 5C05A 3WCBA 1WKZA 5EATA 3NPRA 3ID0A 1RQIA 4GAXA 3LSNA 5CG5A 5B02A 1PS1A 1DI1A 2F94F 3WCEA 2Z4WA 3WC9A 4GP1A 4PVXF 3P41A 4DWGA 5AHUB 3VJDA 2PS5A 1N20A 3ICNA 3N0GA 3PDEA 5AFXA 3VJCA 3WE9A 5B00A 3N5JF 5JV2F 3PKOA 5I1UA 3P8LA 3VJBA 5A0JA 1UBXA 1WMWA 2PS7A 3KROB 3WEGA 1YV5A 3N6KF 5AELA 4LZ0A 3P5RA 4EA1A 2ZEUA 5B0JA 1WL2A 3RMGA 2E94A 5IMIA 4KPJA 2ZEVA 1VG3A 1WL1A 4LTZA 2DH4A 2E8TA 3DYGA 5DIQF 3N3LF 3LJIA 3WSAA 1HXCA 3WCAA 5B0KA 2ONHA 1WY0A 1ZW5A 3LLWA 5E8KA 4LZCA 1UBVA 5ERNA 1YJ4A 3QQVA 3WCLA 3W7FA 3SDUA 1RTRA 4DEMF 4JVJF 4LFEA 5DJVF
chains in the Genus database with same CATH topology
5ILDA 2AETA 4H5CF 2QISA 4KQ5A 2ZY1A 4XQRF 1WL3A 4FJQA 5EAUA 3CC9A 2Z4XA 3LMDA 3OYRA 3WCCA 4E1EA 5ILIA 3WEKA 4KUXA 2VF6A 5DZ2A 1HX9A 4LLSA 5EROA 4LFVF 1V4KA 3N45F 4XQSF 3WCJA 4KK2A 4NFJF 4LLTA 1VG2A 4JYXA 4N9UA 5IVGA 3LGZB 3P5PA 4OMHA 2F8CF 2Z7IA 4LPHF 3OACA 4JXYA 3KRPA 4NFIF 4FP4A 3Q1OA 2Z4VA 2E8WA 3SDVA 3WJNA 2OA6A 3VJAA 2J1PA 2RAHA 3KRCB 3WCFA 5IKAA 5KSXF 2AELA 4LXWA 3KRAA 5IMPA 2P1CA 2ZCOA 2F7MF 3WEFA 3WCHA 1VG4A 3SDTA 3SAEA 3P8RA 3LDWA 1YHKA 3AE0A 5A0KA 2F89F 5HNAA 4MC3A 2PS4A 3RBMA 5ILZA 4F6VA 2FTZA 3CKEA 4LUUA 2Z52A 4F6XA 5ERMA 5IL8A 4P0VA 2F8ZF 3VJ8A 3ZOUA 2Z78A 1HXAA 5B0IA 3KRFA 3TS7A 5IL3A 3WEJA 4MC8A 5DJPF 4XQTF 3ICKA 2Z4ZA 3V1VA 4OKZA 3N3DA 5IMNA 4JZBA 3M02A 2F9KF 4DWBA 3ZL6A 4RXCA 1DGPA 4OMGA 4ZQ8A 5IKHA 5ILYA 2E8XA 5DHIA 3WCGA 1V4JA 2PS8A 1YQ7A 1WL0A 5EASA 3OACB 3KRPB 3LOMA 5E8HA 3CP6A 4Q23A 4EA2A 1V4IA 1YYQA 1N24A 5JUZF 2ONGA 4DHDA 1JFGA 4NKFA 3EZ3A 1HM7A 4WK5A 1N23A 3N1VF 2Q9YA 3Q2ZA 3KRAB 3Q2QA 4KWDA 3NF2A 2AZJA 5DHKA 4RXAA 5DGMF 1V4HA 4KQUA 1N22A 4RXDA 4JXNA 5JV0F 4E9ZA 4LPGF 1YYRA 1UBYA 3PH7A 3V1XA 4JZXA 3OABA 1VG7A 3TFNA 2E91A 4RXEA 3N46F 1YYTA 3N49F 4KKMA 5IK0A 2AZLA 4K10A 3KRFB 4GA3A 3ASXA 3ZMBA 4KVDA 4EA0A 5HN9A 1N1BA 3ZCDA 4KFAA 2I19A 3PYBA 5DW7A 4E9UA 4L2XF 3LEEA 3APZA 3RYWA 4QXSF 3SDQA 5HN7A 4H5DF 5B0MA 5DGSF 3SDRA 1YYSA 4NUAA 3N5HF 4DZWA 3M00A 4N1ZF 1N21A 2ZCQA 4P0WA 3ADZA 3KBKA 1KIZA 2J1OA 2Q80A 1EZFA 4NFKF 3RYEA 5CG6A 5JV1F 1N1ZA 4PVYF 4KVIA 3BNXA 3B7LA 3EFQA 2FORA 1UBWA 4OKMA 3BNYA 3Q30A 3WEHA 3IPIA 5H9DA 2ZCRA 3MAVA 4DI5A 5IK9A 5ER8A 1YYUA 3QKCA 3DYFA 2E8UA 4NKEA 3TFPA 4LA6A 2Z7HA 1JFAA 3VJEA 2Z50A 3LGKA 2E90A 2E8VA 3WCMA 3M01A 5DJRF 3AQ0A 2AEKA 5HN8A 4KPDA 3OABB 5B0LA 3S4JA 3M9UA 2E93A 3DYHA 4GP2A 1YHMA 2Q9ZA 4KQSA 3V66A 3M0GA 5ILKA 3KRCA 3AQBB 3AQCB 5ILJA 3ACWA 4DXJA 4H5EF 4F62A 3G4FA 4RNQA 4RYPA 2OGDA 3ACYA 1YHLA 4OGUA 2H8OA 3UCAA 3NRIA 2O1OA 5IN8A 4LFGA 1VG6A 1HXGA 3N1WF 2E95A 3ICZA 3TFVA 3LVSA 4LOBA 5B03A 3WCIA 4MC0A 5JA0F 1HM4A 1KIYA 2J5CA 3MZVA 3ACXA 5E8LA 3KROA 2E4OA 3LZ9A 4QPFA 2OPNA 3TC1A 3NPKA 1V4EA 3ICMA 2Z4YA 2E92A 3WEIA 4LTVA 3KB9A 5A0IA 3IBAA 4HD1A 3VJ9A 3WJOA 2ZCSA 1RQJA 4P0XA 3LG5A 3S9VA 2AZKA 5IM1A 2F92F 5DGNF 3WCDA 3G4DA 3N0FA 2OPMA 4UMJA 5B01A 3PYAA 4LA5A 3WSBA 2PS6A 5ILHA 2EWGA 1FPSA 4LIXA 4NG6A 4KVYA 3LK5A 4LZ3A 5AYPA 3WJKA 3EGTA 5IK6A 2Q58A 3ZMCA 4KVWA 5C05A 3WCBA 1WKZA 5EATA 3NPRA 3ID0A 1RQIA 4GAXA 3LSNA 5CG5A 5B02A 1PS1A 1DI1A 2F94F 3WCEA 2Z4WA 3WC9A 4GP1A 4PVXF 3P41A 4DWGA 5AHUB 3VJDA 2PS5A 1N20A 3ICNA 3N0GA 3PDEA 5AFXA 3VJCA 3WE9A 5B00A 3N5JF 5JV2F 3PKOA 5I1UA 3P8LA 3VJBA 5A0JA 1UBXA 1WMWA 2PS7A 3KROB 3WEGA 1YV5A 3N6KF 5AELA 4LZ0A 3P5RA 4EA1A 2ZEUA 5B0JA 1WL2A 3RMGA 2E94A 5IMIA 4KPJA 2ZEVA 1VG3A 1WL1A 4LTZA 2DH4A 2E8TA 3DYGA 5DIQF 3N3LF 3LJIA 3WSAA 1HXCA 3WCAA 5B0KA 2ONHA 1WY0A 1ZW5A 3LLWA 5E8KA 4LZCA 1UBVA 5ERNA 1YJ4A 3QQVA 3WCLA 3W7FA 3SDUA 1RTRA 4DEMF 4JVJF 4LFEA 5DJVF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILD A;  2AET A;  4H5C F;  2QIS A;  4KQ5 A;  2ZY1 A;  4XQR F;  1WL3 A;  4FJQ A;  5EAU A;  3CC9 A;  2Z4X A;  3LMD A;  3OYR A;  3WCC A;  4E1E A;  5ILI A;  3WEK A;  4KUX A;  2VF6 A;  5DZ2 A;  1HX9 A;  4LLS A;  5ERO A;  4LFV F;  1V4K A;  3N45 F;  4XQS F;  3WCJ A;  4KK2 A;  4NFJ F;  4LLT A;  1VG2 A;  4JYX A;  4N9U A;  5IVG A;  3LGZ B;  3P5P A;  4OMH A;  2F8C F;  2Z7I A;  4LPH F;  3OAC A;  4JXY A;  3KRP A;  4NFI F;  4FP4 A;  3Q1O A;  2Z4V A;  2E8W A;  3SDV A;  3WJN A;  2OA6 A;  3VJA A;  2J1P A;  2RAH A;  3KRC B;  3WCF A;  5IKA A;  5KSX F;  2AEL A;  4LXW A;  3KRA A;  5IMP A;  2P1C A;  2ZCO A;  2F7M F;  3WEF A;  3WCH A;  1VG4 A;  3SDT A;  3SAE A;  3P8R A;  3LDW A;  1YHK A;  3AE0 A;  5A0K A;  2F89 F;  5HNA A;  4MC3 A;  2PS4 A;  3RBM A;  5ILZ A;  4F6V A;  2FTZ A;  3CKE A;  4LUU A;  2Z52 A;  4F6X A;  5ERM A;  5IL8 A;  4P0V A;  2F8Z F;  3VJ8 A;  3ZOU A;  2Z78 A;  1HXA A;  5B0I A;  3KRF A;  3TS7 A;  5IL3 A;  3WEJ A;  4MC8 A;  5DJP F;  4XQT F;  3ICK A;  2Z4Z A;  3V1V A;  4OKZ A;  3N3D A;  5IMN A;  4JZB A;  3M02 A;  2F9K F;  4DWB A;  3ZL6 A;  4RXC A;  1DGP A;  4OMG A;  4ZQ8 A;  5IKH A;  5ILY A;  2E8X A;  5DHI A;  3WCG A;  1V4J A;  2PS8 A;  1YQ7 A;  1WL0 A;  5EAS A;  3OAC B;  3KRP B;  3LOM A;  5E8H A;  3CP6 A;  4Q23 A;  4EA2 A;  1V4I A;  1YYQ A;  1N24 A;  5JUZ F;  2ONG A;  4DHD A;  1JFG A;  4NKF A;  3EZ3 A;  1HM7 A;  4WK5 A;  1N23 A;  3N1V F;  2Q9Y A;  3Q2Z A;  3KRA B;  3Q2Q A;  4KWD A;  3NF2 A;  2AZJ A;  5DHK A;  4RXA A;  5DGM F;  1V4H A;  4KQU A;  1N22 A;  4RXD A;  4JXN A;  5JV0 F;  4E9Z A;  4LPG F;  1YYR A;  1UBY A;  3PH7 A;  3V1X A;  4JZX A;  3OAB A;  1VG7 A;  3TFN A;  2E91 A;  4RXE A;  3N46 F;  1YYT A;  3N49 F;  4KKM A;  5IK0 A;  2AZL A;  4K10 A;  3KRF B;  4GA3 A;  3ASX A;  3ZMB A;  4KVD A;  4EA0 A;  5HN9 A;  1N1B A;  3ZCD A;  4KFA A;  2I19 A;  3PYB A;  5DW7 A;  4E9U A;  4L2X F;  3LEE A;  3APZ A;  3RYW A;  4QXS F;  3SDQ A;  5HN7 A;  4H5D F;  5B0M A;  5DGS F;  3SDR A;  1YYS A;  4NUA A;  3N5H F;  4DZW A;  3M00 A;  4N1Z F;  1N21 A;  2ZCQ A;  4P0W A;  3ADZ A;  3KBK A;  1KIZ A;  2J1O A;  2Q80 A;  1EZF A;  4NFK F;  3RYE A;  5CG6 A;  5JV1 F;  1N1Z A;  4PVY F;  4KVI A;  3BNX A;  3B7L A;  3EFQ A;  2FOR A;  1UBW A;  4OKM A;  3BNY A;  3Q30 A;  3WEH A;  3IPI A;  5H9D A;  2ZCR A;  3MAV A;  4DI5 A;  5IK9 A;  5ER8 A;  1YYU A;  3QKC A;  3DYF A;  2E8U A;  4NKE A;  3TFP A;  4LA6 A;  2Z7H A;  1JFA A;  3VJE A;  2Z50 A;  3LGK A;  2E90 A;  2E8V A;  3WCM A;  3M01 A;  5DJR F;  3AQ0 A;  2AEK A;  5HN8 A;  4KPD A;  3OAB B;  5B0L A;  3S4J A;  3M9U A;  2E93 A;  3DYH A;  4GP2 A;  1YHM A;  2Q9Z A;  4KQS A;  3V66 A;  3M0G A;  5ILK A;  3KRC A;  3AQB B;  3AQC B;  5ILJ A;  3ACW A;  4DXJ A;  4H5E F;  4F62 A;  3G4F A;  4RNQ A;  4RYP A;  2OGD A;  3ACY A;  1YHL A;  4OGU A;  2H8O A;  3UCA A;  3NRI A;  2O1O A;  5IN8 A;  4LFG A;  1VG6 A;  1HXG A;  3N1W F;  2E95 A;  3ICZ A;  3TFV A;  3LVS A;  4LOB A;  5B03 A;  3WCI A;  4MC0 A;  5JA0 F;  1HM4 A;  1KIY A;  2J5C A;  3MZV A;  3ACX A;  5E8L A;  3KRO A;  2E4O A;  3LZ9 A;  4QPF A;  2OPN A;  3TC1 A;  3NPK A;  1V4E A;  3ICM A;  2Z4Y A;  2E92 A;  3WEI A;  4LTV A;  3KB9 A;  5A0I A;  3IBA A;  4HD1 A;  3VJ9 A;  3WJO A;  2ZCS A;  1RQJ A;  4P0X A;  3LG5 A;  3S9V A;  2AZK A;  5IM1 A;  2F92 F;  5DGN F;  3WCD A;  3G4D A;  3N0F A;  2OPM A;  4UMJ A;  5B01 A;  3PYA A;  4LA5 A;  3WSB A;  2PS6 A;  5ILH A;  2EWG A;  1FPS A;  4LIX A;  4NG6 A;  4KVY A;  3LK5 A;  4LZ3 A;  5AYP A;  3WJK A;  3EGT A;  5IK6 A;  2Q58 A;  3ZMC A;  4KVW A;  5C05 A;  3WCB A;  1WKZ A;  5EAT A;  3NPR A;  3ID0 A;  1RQI A;  4GAX A;  3LSN A;  5CG5 A;  5B02 A;  1PS1 A;  1DI1 A;  2F94 F;  3WCE A;  2Z4W A;  3WC9 A;  4GP1 A;  4PVX F;  3P41 A;  4DWG A;  5AHU B;  3VJD A;  2PS5 A;  1N20 A;  3ICN A;  3N0G A;  3PDE A;  5AFX A;  3VJC A;  3WE9 A;  5B00 A;  3N5J F;  5JV2 F;  3PKO A;  5I1U A;  3P8L A;  3VJB A;  5A0J A;  1UBX A;  1WMW A;  2PS7 A;  3KRO B;  3WEG A;  1YV5 A;  3N6K F;  5AEL A;  4LZ0 A;  3P5R A;  4EA1 A;  2ZEU A;  5B0J A;  1WL2 A;  3RMG A;  2E94 A;  5IMI A;  4KPJ A;  2ZEV A;  1VG3 A;  1WL1 A;  4LTZ A;  2DH4 A;  2E8T A;  3DYG A;  5DIQ F;  3N3L F;  3LJI A;  3WSA A;  1HXC A;  3WCA A;  5B0K A;  2ONH A;  1WY0 A;  1ZW5 A;  3LLW A;  5E8K A;  4LZC A;  1UBV A;  5ERN A;  1YJ4 A;  3QQV A;  3WCL A;  3W7F A;  3SDU A;  1RTR A;  4DEM F;  4JVJ F;  4LFE A;  5DJV F; 
#chains in the Genus database with same CATH topology
 5ILD A;  2AET A;  4H5C F;  2QIS A;  4KQ5 A;  2ZY1 A;  4XQR F;  1WL3 A;  4FJQ A;  5EAU A;  3CC9 A;  2Z4X A;  3LMD A;  3OYR A;  3WCC A;  4E1E A;  5ILI A;  3WEK A;  4KUX A;  2VF6 A;  5DZ2 A;  1HX9 A;  4LLS A;  5ERO A;  4LFV F;  1V4K A;  3N45 F;  4XQS F;  3WCJ A;  4KK2 A;  4NFJ F;  4LLT A;  1VG2 A;  4JYX A;  4N9U A;  5IVG A;  3LGZ B;  3P5P A;  4OMH A;  2F8C F;  2Z7I A;  4LPH F;  3OAC A;  4JXY A;  3KRP A;  4NFI F;  4FP4 A;  3Q1O A;  2Z4V A;  2E8W A;  3SDV A;  3WJN A;  2OA6 A;  3VJA A;  2J1P A;  2RAH A;  3KRC B;  3WCF A;  5IKA A;  5KSX F;  2AEL A;  4LXW A;  3KRA A;  5IMP A;  2P1C A;  2ZCO A;  2F7M F;  3WEF A;  3WCH A;  1VG4 A;  3SDT A;  3SAE A;  3P8R A;  3LDW A;  1YHK A;  3AE0 A;  5A0K A;  2F89 F;  5HNA A;  4MC3 A;  2PS4 A;  3RBM A;  5ILZ A;  4F6V A;  2FTZ A;  3CKE A;  4LUU A;  2Z52 A;  4F6X A;  5ERM A;  5IL8 A;  4P0V A;  2F8Z F;  3VJ8 A;  3ZOU A;  2Z78 A;  1HXA A;  5B0I A;  3KRF A;  3TS7 A;  5IL3 A;  3WEJ A;  4MC8 A;  5DJP F;  4XQT F;  3ICK A;  2Z4Z A;  3V1V A;  4OKZ A;  3N3D A;  5IMN A;  4JZB A;  3M02 A;  2F9K F;  4DWB A;  3ZL6 A;  4RXC A;  1DGP A;  4OMG A;  4ZQ8 A;  5IKH A;  5ILY A;  2E8X A;  5DHI A;  3WCG A;  1V4J A;  2PS8 A;  1YQ7 A;  1WL0 A;  5EAS A;  3OAC B;  3KRP B;  3LOM A;  5E8H A;  3CP6 A;  4Q23 A;  4EA2 A;  1V4I A;  1YYQ A;  1N24 A;  5JUZ F;  2ONG A;  4DHD A;  1JFG A;  4NKF A;  3EZ3 A;  1HM7 A;  4WK5 A;  1N23 A;  3N1V F;  2Q9Y A;  3Q2Z A;  3KRA B;  3Q2Q A;  4KWD A;  3NF2 A;  2AZJ A;  5DHK A;  4RXA A;  5DGM F;  1V4H A;  4KQU A;  1N22 A;  4RXD A;  4JXN A;  5JV0 F;  4E9Z A;  4LPG F;  1YYR A;  1UBY A;  3PH7 A;  3V1X A;  4JZX A;  3OAB A;  1VG7 A;  3TFN A;  2E91 A;  4RXE A;  3N46 F;  1YYT A;  3N49 F;  4KKM A;  5IK0 A;  2AZL A;  4K10 A;  3KRF B;  4GA3 A;  3ASX A;  3ZMB A;  4KVD A;  4EA0 A;  5HN9 A;  1N1B A;  3ZCD A;  4KFA A;  2I19 A;  3PYB A;  5DW7 A;  4E9U A;  4L2X F;  3LEE A;  3APZ A;  3RYW A;  4QXS F;  3SDQ A;  5HN7 A;  4H5D F;  5B0M A;  5DGS F;  3SDR A;  1YYS A;  4NUA A;  3N5H F;  4DZW A;  3M00 A;  4N1Z F;  1N21 A;  2ZCQ A;  4P0W A;  3ADZ A;  3KBK A;  1KIZ A;  2J1O A;  2Q80 A;  1EZF A;  4NFK F;  3RYE A;  5CG6 A;  5JV1 F;  1N1Z A;  4PVY F;  4KVI A;  3BNX A;  3B7L A;  3EFQ A;  2FOR A;  1UBW A;  4OKM A;  3BNY A;  3Q30 A;  3WEH A;  3IPI A;  5H9D A;  2ZCR A;  3MAV A;  4DI5 A;  5IK9 A;  5ER8 A;  1YYU A;  3QKC A;  3DYF A;  2E8U A;  4NKE A;  3TFP A;  4LA6 A;  2Z7H A;  1JFA A;  3VJE A;  2Z50 A;  3LGK A;  2E90 A;  2E8V A;  3WCM A;  3M01 A;  5DJR F;  3AQ0 A;  2AEK A;  5HN8 A;  4KPD A;  3OAB B;  5B0L A;  3S4J A;  3M9U A;  2E93 A;  3DYH A;  4GP2 A;  1YHM A;  2Q9Z A;  4KQS A;  3V66 A;  3M0G A;  5ILK A;  3KRC A;  3AQB B;  3AQC B;  5ILJ A;  3ACW A;  4DXJ A;  4H5E F;  4F62 A;  3G4F A;  4RNQ A;  4RYP A;  2OGD A;  3ACY A;  1YHL A;  4OGU A;  2H8O A;  3UCA A;  3NRI A;  2O1O A;  5IN8 A;  4LFG A;  1VG6 A;  1HXG A;  3N1W F;  2E95 A;  3ICZ A;  3TFV A;  3LVS A;  4LOB A;  5B03 A;  3WCI A;  4MC0 A;  5JA0 F;  1HM4 A;  1KIY A;  2J5C A;  3MZV A;  3ACX A;  5E8L A;  3KRO A;  2E4O A;  3LZ9 A;  4QPF A;  2OPN A;  3TC1 A;  3NPK A;  1V4E A;  3ICM A;  2Z4Y A;  2E92 A;  3WEI A;  4LTV A;  3KB9 A;  5A0I A;  3IBA A;  4HD1 A;  3VJ9 A;  3WJO A;  2ZCS A;  1RQJ A;  4P0X A;  3LG5 A;  3S9V A;  2AZK A;  5IM1 A;  2F92 F;  5DGN F;  3WCD A;  3G4D A;  3N0F A;  2OPM A;  4UMJ A;  5B01 A;  3PYA A;  4LA5 A;  3WSB A;  2PS6 A;  5ILH A;  2EWG A;  1FPS A;  4LIX A;  4NG6 A;  4KVY A;  3LK5 A;  4LZ3 A;  5AYP A;  3WJK A;  3EGT A;  5IK6 A;  2Q58 A;  3ZMC A;  4KVW A;  5C05 A;  3WCB A;  1WKZ A;  5EAT A;  3NPR A;  3ID0 A;  1RQI A;  4GAX A;  3LSN A;  5CG5 A;  5B02 A;  1PS1 A;  1DI1 A;  2F94 F;  3WCE A;  2Z4W A;  3WC9 A;  4GP1 A;  4PVX F;  3P41 A;  4DWG A;  5AHU B;  3VJD A;  2PS5 A;  1N20 A;  3ICN A;  3N0G A;  3PDE A;  5AFX A;  3VJC A;  3WE9 A;  5B00 A;  3N5J F;  5JV2 F;  3PKO A;  5I1U A;  3P8L A;  3VJB A;  5A0J A;  1UBX A;  1WMW A;  2PS7 A;  3KRO B;  3WEG A;  1YV5 A;  3N6K F;  5AEL A;  4LZ0 A;  3P5R A;  4EA1 A;  2ZEU A;  5B0J A;  1WL2 A;  3RMG A;  2E94 A;  5IMI A;  4KPJ A;  2ZEV A;  1VG3 A;  1WL1 A;  4LTZ A;  2DH4 A;  2E8T A;  3DYG A;  5DIQ F;  3N3L F;  3LJI A;  3WSA A;  1HXC A;  3WCA A;  5B0K A;  2ONH A;  1WY0 A;  1ZW5 A;  3LLW A;  5E8K A;  4LZC A;  1UBV A;  5ERN A;  1YJ4 A;  3QQV A;  3WCL A;  3W7F A;  3SDU A;  1RTR A;  4DEM F;  4JVJ F;  4LFE A;  5DJV F; 
#chains in the Genus database with same CATH homology
 5ILD A;  2AET A;  4H5C F;  2QIS A;  4KQ5 A;  2ZY1 A;  4XQR F;  1WL3 A;  4FJQ A;  5EAU A;  3CC9 A;  2Z4X A;  3LMD A;  3OYR A;  3WCC A;  4E1E A;  5ILI A;  3WEK A;  4KUX A;  2VF6 A;  5DZ2 A;  1HX9 A;  4LLS A;  5ERO A;  4LFV F;  1V4K A;  3N45 F;  4XQS F;  3WCJ A;  4KK2 A;  4NFJ F;  4LLT A;  1VG2 A;  4JYX A;  4N9U A;  5IVG A;  3LGZ B;  3P5P A;  4OMH A;  2F8C F;  2Z7I A;  4LPH F;  3OAC A;  4JXY A;  3KRP A;  4NFI F;  4FP4 A;  3Q1O A;  2Z4V A;  2E8W A;  3SDV A;  3WJN A;  2OA6 A;  3VJA A;  2J1P A;  2RAH A;  3KRC B;  3WCF A;  5IKA A;  5KSX F;  2AEL A;  4LXW A;  3KRA A;  5IMP A;  2P1C A;  2ZCO A;  2F7M F;  3WEF A;  3WCH A;  1VG4 A;  3SDT A;  3SAE A;  3P8R A;  3LDW A;  1YHK A;  3AE0 A;  5A0K A;  2F89 F;  5HNA A;  4MC3 A;  2PS4 A;  3RBM A;  5ILZ A;  4F6V A;  2FTZ A;  3CKE A;  4LUU A;  2Z52 A;  4F6X A;  5ERM A;  5IL8 A;  4P0V A;  2F8Z F;  3VJ8 A;  3ZOU A;  2Z78 A;  1HXA A;  5B0I A;  3KRF A;  3TS7 A;  5IL3 A;  3WEJ A;  4MC8 A;  5DJP F;  4XQT F;  3ICK A;  2Z4Z A;  3V1V A;  4OKZ A;  3N3D A;  5IMN A;  4JZB A;  3M02 A;  2F9K F;  4DWB A;  3ZL6 A;  4RXC A;  1DGP A;  4OMG A;  4ZQ8 A;  5IKH A;  5ILY A;  2E8X A;  5DHI A;  3WCG A;  1V4J A;  2PS8 A;  1YQ7 A;  1WL0 A;  5EAS A;  3OAC B;  3KRP B;  3LOM A;  5E8H A;  3CP6 A;  4Q23 A;  4EA2 A;  1V4I A;  1YYQ A;  1N24 A;  5JUZ F;  2ONG A;  4DHD A;  1JFG A;  4NKF A;  3EZ3 A;  1HM7 A;  4WK5 A;  1N23 A;  3N1V F;  2Q9Y A;  3Q2Z A;  3KRA B;  3Q2Q A;  4KWD A;  3NF2 A;  2AZJ A;  5DHK A;  4RXA A;  5DGM F;  1V4H A;  4KQU A;  1N22 A;  4RXD A;  4JXN A;  5JV0 F;  4E9Z A;  4LPG F;  1YYR A;  1UBY A;  3PH7 A;  3V1X A;  4JZX A;  3OAB A;  1VG7 A;  3TFN A;  2E91 A;  4RXE A;  3N46 F;  1YYT A;  3N49 F;  4KKM A;  5IK0 A;  2AZL A;  4K10 A;  3KRF B;  4GA3 A;  3ASX A;  3ZMB A;  4KVD A;  4EA0 A;  5HN9 A;  1N1B A;  3ZCD A;  4KFA A;  2I19 A;  3PYB A;  5DW7 A;  4E9U A;  4L2X F;  3LEE A;  3APZ A;  3RYW A;  4QXS F;  3SDQ A;  5HN7 A;  4H5D F;  5B0M A;  5DGS F;  3SDR A;  1YYS A;  4NUA A;  3N5H F;  4DZW A;  3M00 A;  4N1Z F;  1N21 A;  2ZCQ A;  4P0W A;  3ADZ A;  3KBK A;  1KIZ A;  2J1O A;  2Q80 A;  1EZF A;  4NFK F;  3RYE A;  5CG6 A;  5JV1 F;  1N1Z A;  4PVY F;  4KVI A;  3BNX A;  3B7L A;  3EFQ A;  2FOR A;  1UBW A;  4OKM A;  3BNY A;  3Q30 A;  3WEH A;  3IPI A;  5H9D A;  2ZCR A;  3MAV A;  4DI5 A;  5IK9 A;  5ER8 A;  1YYU A;  3QKC A;  3DYF A;  2E8U A;  4NKE A;  3TFP A;  4LA6 A;  2Z7H A;  1JFA A;  3VJE A;  2Z50 A;  3LGK A;  2E90 A;  2E8V A;  3WCM A;  3M01 A;  5DJR F;  3AQ0 A;  2AEK A;  5HN8 A;  4KPD A;  3OAB B;  5B0L A;  3S4J A;  3M9U A;  2E93 A;  3DYH A;  4GP2 A;  1YHM A;  2Q9Z A;  4KQS A;  3V66 A;  3M0G A;  5ILK A;  3KRC A;  3AQB B;  3AQC B;  5ILJ A;  3ACW A;  4DXJ A;  4H5E F;  4F62 A;  3G4F A;  4RNQ A;  4RYP A;  2OGD A;  3ACY A;  1YHL A;  4OGU A;  2H8O A;  3UCA A;  3NRI A;  2O1O A;  5IN8 A;  4LFG A;  1VG6 A;  1HXG A;  3N1W F;  2E95 A;  3ICZ A;  3TFV A;  3LVS A;  4LOB A;  5B03 A;  3WCI A;  4MC0 A;  5JA0 F;  1HM4 A;  1KIY A;  2J5C A;  3MZV A;  3ACX A;  5E8L A;  3KRO A;  2E4O A;  3LZ9 A;  4QPF A;  2OPN A;  3TC1 A;  3NPK A;  1V4E A;  3ICM A;  2Z4Y A;  2E92 A;  3WEI A;  4LTV A;  3KB9 A;  5A0I A;  3IBA A;  4HD1 A;  3VJ9 A;  3WJO A;  2ZCS A;  1RQJ A;  4P0X A;  3LG5 A;  3S9V A;  2AZK A;  5IM1 A;  2F92 F;  5DGN F;  3WCD A;  3G4D A;  3N0F A;  2OPM A;  4UMJ A;  5B01 A;  3PYA A;  4LA5 A;  3WSB A;  2PS6 A;  5ILH A;  2EWG A;  1FPS A;  4LIX A;  4NG6 A;  4KVY A;  3LK5 A;  4LZ3 A;  5AYP A;  3WJK A;  3EGT A;  5IK6 A;  2Q58 A;  3ZMC A;  4KVW A;  5C05 A;  3WCB A;  1WKZ A;  5EAT A;  3NPR A;  3ID0 A;  1RQI A;  4GAX A;  3LSN A;  5CG5 A;  5B02 A;  1PS1 A;  1DI1 A;  2F94 F;  3WCE A;  2Z4W A;  3WC9 A;  4GP1 A;  4PVX F;  3P41 A;  4DWG A;  5AHU B;  3VJD A;  2PS5 A;  1N20 A;  3ICN A;  3N0G A;  3PDE A;  5AFX A;  3VJC A;  3WE9 A;  5B00 A;  3N5J F;  5JV2 F;  3PKO A;  5I1U A;  3P8L A;  3VJB A;  5A0J A;  1UBX A;  1WMW A;  2PS7 A;  3KRO B;  3WEG A;  1YV5 A;  3N6K F;  5AEL A;  4LZ0 A;  3P5R A;  4EA1 A;  2ZEU A;  5B0J A;  1WL2 A;  3RMG A;  2E94 A;  5IMI A;  4KPJ A;  2ZEV A;  1VG3 A;  1WL1 A;  4LTZ A;  2DH4 A;  2E8T A;  3DYG A;  5DIQ F;  3N3L F;  3LJI A;  3WSA A;  1HXC A;  3WCA A;  5B0K A;  2ONH A;  1WY0 A;  1ZW5 A;  3LLW A;  5E8K A;  4LZC A;  1UBV A;  5ERN A;  1YJ4 A;  3QQV A;  3WCL A;  3W7F A;  3SDU A;  1RTR A;  4DEM F;  4JVJ F;  4LFE A;  5DJV F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...