4KUZH

Crystal structure of anti-emmprin antibody 4a5 fab in trigonal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGGINPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARNDGYRGYAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a constrained conformation of short CDR-L3 in antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords antibody 4A5 light chain
total genus 35
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH02
4XMLL 2JLLA 4NCDA 3OJMB 1TNNA 2HJLA 3VFRA 5GRWA 4PBWD 1AO7A 5GGRY 2B1AH 3CFBA 3NFSL 4A2MA 2HH0L 3B5GA 2GK0A 2NY0B 1NDMB 3GJFB 2JELH 3KLDA 3MLSL 4BUHA 3REVB 4L29B 4NQED 4OD3L 1KPUA 1F3JA 4P4KC 1IGTA 1K2DA 2QR0B 4OCSL 5L88H 3QXAB 4HUUB 1JPGA 1JL8A 5ISZA 2AV7B 3DVIA 4HFWA 1RHHA 4HIJA 4ZFGH 5IGXH 5ESQA 1EAJA 1FYTA 2C1PA 5AYUL 3RGVD 1O7SA 3TYFA 3UPRB 3VFNA 3P0VH 3IJYA 4P2OA 5I76B 5FV1L 3LKOB 1RV6X 5JIKA 5GS1B 4JRXE 5TE4L 4OLEA 5EBWA 2DBLL 4CVZB 2IGFL 5BCAA 1A22B 5CSBA 4XPGL 2K1MA 1HXYA 5EOQL 4I3SL 3S34H 4BH8A 5IMMB 4Q9RL 3ARFC 3EO1A 4JM2A 1U8IA 2B0SH 4F3FB 5DQDL 3VD5A 4X83A 4R90H 3RKPA 3BP6A 5C0FA 3B2VH 4P2QD 4WWKD 1EIBA 4KUZH 4M7ZC 5HYSG 3T0VA 5HHOA 1K8IA 3NIFF 3F5WB 1LE9A 1IAKB 3MCLH 4YBLC 2DQCH 3BVNA 1A7OH 4J2XA 1QVOA 4GO6B 1DQML 4JB9H 3FT3A 4U3CA 4CVWA 4TSCL 1RZ7H 4ZO8A 4HKJA 3UBXB 5HSFA 3FQUA 1WZLA 3MZGB 3GM8A 5E6ID 4P5TD 4KRMB 1JWMB 3PGFH 3RL1B 2E8ZA 2J3SA 3QEQD 5JOPD 4KUCF 3VFWA 1CFSB 1U8HA 5HDBE 2HJFB 1I7ZB 1T04A 2LTQC 1RI8A 3GI8L 3RPIA 5KTEL 4XC3H 1GGCH 3WFEL 4EI5C 2E27L 43CAA 5HYSA 2B1HL 3GGWA 4HC1H 5FM5O 4JPIB 2Z91A 2CD0A 3SO5A 4R2GB 3L5XL 5IBTH 1LO5B 3CFKA 4MS8D 5HI4D 4AQOA 4RAUA 3LS5H 3LRGA 3PUCA 2AABL 3HG1B 3V7AE 4XVJH 5IMMA 5E9DE 3T0WA 1MFEL 3S35H 3UROR 4OIAA 1JNHB 5TFSH 5AG9A 3ARGC 1I8MB 2VB5A 1IGYA 4LCWA 1IGMH 4QNPE 1TPXC 1RUPH 3IDGA 4MSWA 4GKSA 5IB5B 2A77L 5GS1A 2A6KA 1J8HD 5JW3H 1NBYA 3B83A 1NGPH 1Y6KR 3RWGB 1Z2KA 2NY0D 4M5YH 4NNYB 5ESQB 3QUML 4R9HA 3Q6GH 3P11L 2CK2A 4PG2A 4QRTA 4LCCA 2Q3ZA 2ORBH 2ZG2A 5L2JB 4O4YH 3MRPB 3VXUA 1JF1B 4PJ7E 2AI0L 2DQIL 2WAHA 5JIHA 1N8ZB 4YHPA 3DX6B 1CGXA 5GQBA 4P5KA 1L9NA 3PP4L 3SDXA 4U6VH 1JGEA 4MCZA 3QDHA 3TJHC 1ODAA 5GS2H 5CS7A 1KJ3L 2ENYA 1XR9B 3MRJA 3VFRB 3JVGC 2MOVA 1Y6MR 2BOCB 3MRMA 4O2CA 3B8SA 3JV5A 4WFFD 1JNLL 5HY9A 3Q5OA 5DJ0A 3TN0B 4KJPC 3IAQA 4ZNCD 2IPKB 4X6CF 1XT5A 3OHXA 1FAIH 2NY5H 3W2DL 3NFNA 3QDMD 2B4CC 3OG6B 4QF1B 3C60A 3V6OE 4BFIA 5I19H 2HVJA 3V6FB 3IXAB 1IAMA 4NKDA 4M6NH 3KPOB 4WFGD 1AR1D 5CJ8A 2PKDA 4OFYA 1GAFH 2IH3B 3CC5B 3ULUH 1G7IB 4IDJH 1I7RA 1EHXA 1TDQA 5IFJA 2XZAH 5ALBL 2VERN 2AJYH 3HG1D 4KZDL 1CN4A 2BOBA 3FFCB 1Q9KA 1PY9A 1EFXA 3DRTB 2QTEA 4NT6B 1TZGH 1H3TA 4HK0A 3HR6A 1CTOA 2PO6B 3MRQA 4KQ4L 4H1LG 5I1EH 2VDRH 3IGAB 4KTDH 1G7LB 2ZCHL 5DRNB 4GG8B 4NIKB 1BZ9B 1KLUB 2DMCA 3C5ZB 1DLFH 3FRUA 4XHJC 3WFHA 4PJGF 1T1WA 4Y1AB 4H20H 1UM5H 3GGWB 3ARGD 2E3VA 1CXFA 4WGWB 1JGLH 2VZUA 4D8PA 1E4JA 2VLME 5JHDA 2V17H 5GGTA 3VFVA 5L8LB 1Q0YH 2H2SD 4MDJB 4JHWH 5ESVA 4YDLC 2CLZB 5GZNC 2OR7A 2DKSA 2ED9A 4U1GC 1J1PL 2P5EB 5GRJH 5CD5C 3H9YA 3MO1B 3UBXA 1ETZB 3QQ3B 4HQQH 3OTTA 1J1XH 1NAML 5C0GA 4HGKC 1QVOB 1URLA 4PJ8C 2G2RA 1KCRH 4LKCA 4OKVB 5JR1L 5H37H 5GXBB 3ARDC 3H9SD 4ODWA 2XKSA 4UV4L 5D70L 5D2LB 4L1HA 1FFQA 2VLKA 4MXWL 5F1OB 1SJVA 4K3HA 3V6OC 1U8LB 2VITB 1LO2L 1FHGA 2YN3A 3JWDC 3VI3E 4WIQA 2V2TA 2V5SA 3IFNL 3S3JA 1C1EH 3TP4A 2NY1C 3FO0H 1OB1B 2HLAA 4XX1E 2UZXB 1Y0LB 1HXYB 2Q8AL 3WXWL 3GSNA 4WNQB 4KJPD 2L7JA 5BRZA 3PWPA 3R06A 4Z8FH 1NPUA 3NTCH 5FHBL 1B88A 1GZPB 3QNXA 3ARDA 3RY6A 3FOLB 1P2CA 2PXYD 3OAYH 4AIZB 3KJ4B 5F1IB 1FAIL 1SYVB 5KVGL 1CL7H 5C2BH 1SY6A 5CP3H 4BH7A 2ED7A 4WJ5B 1EBPA 4OZIF 1BF2A 3QXAA 4P99A 5FOJA 2H8PA 4L3EB 1NJ9B 1MFDH 2EDJA 3OB0K 4XCEA 1YEEH 3GSOA 1RVFH 3U4BH 3ESVF 1JPTL 4GBXD 2F15A 5KVDH 3MLVH 1DUYA 4HH8A 1YEIL 1JHTB 4ZFZB 4XCEB 1M7IA 3PHQB 4LVOB 1GIGL 4URTB 3OAYK 1C12B 1MCKA 3MJ6A 4FQLL 4J3OC 4DOHB 4BH7B 4ZTPH 3S5LG 5EUOE 1BZ7B 1AKJB 5I15L 1AC6A 1WIPA 2DLIA 4PJ7B 4LRIC 1I1AB 1FQ9C 4MQXC 4OD1H 3TH2T 3MV7A 4R4FL 1XH3B 4JKMA 3FHQA 3QG6A 5EO9A 3OF6D 4LVOC 4R8WH 3LHPL 3LKRA 3SKJL 3NH7H 1S7XA 4ZS7H 1U41A 3P3YA 2IPUK 1NL0H 3H3PL 2YWYA 3C6LB 2B8OT 3MXVH 5JQ6H 2VXUL 2QHRL 1W72H 4W4NA 4ONHB 3WIIL 1ZHKB 5DDHA 3MA9L 3GRWL 2ZOKB 5IB2B 1WT5A 3QEUB 4WEBL 4I0PB 1S3KL 4PJXA 5IK3A 4TTGA 3D9AH 3V5DA 3D85A 1U8LA 3E1F1 3EUUA 3EOYG 4RA0C 4YLQT 3BX7C 4DUWA 4LCUB 2EDLA 5DJDB 5E94A 1CDIA 4W68A 2Q87A 4NQSA 1DQJA 1S9WA 4FQXB 4YX2H 5AD0B 1IAOA 1PW3A 1D5ZB 2GHWB 3SKOB 5MERA 4AMKH 3ALPA 4MB3A 2E9JA 1RZFH 4G9FE 1S7TB 4X4ME 3M1BB 1QBBA 4Z8FL 1B90A 2QADD 4JDZA 2B4CH 3QXTA 3OGCA 3DVNA 1PG7H 3BP4A 3B2UC 5C71A 2VAAA 2IAMD 3VE0B 4EUPA 5D6DA 3BXNA 1FVCB 5AZ2L 4YHYB 3ALXA 1LNUB 4N0CD 1FBIL 2WBJA 4WEBH 3QQ9C 1ED3A 4Y1AE 3R8BB 3NA9L 3SEPA 2IANA 1EFXD 1I85C 3O6KL 4JVUA 4WFEE 5CBEB 1NDGA 4JO3L 3ULVL 3GSWB 1A1NB 4U1GB 4WEUD 5INCB 5FK9A 1ZA6B 3LEVH 3ZTJH 4JO4H 4YDJA 4HXBL 1A6TB 1FYHB 1QSEA 4O00A 3UXFA 2XZCH 2H6PB 4Q9BA 4HW6A 4FTVA 4JHWL 2O61B 1B0RB 1KB5H 3KPOA 3ZHKA 4HWBL 4NKDB 5TE7H 4R96A 3ZE2F 4GLRH 1Y18B 3C5ZC 3GKWL 5C07B 3S4SA 2B4CL 3C6SA 1RAMA 1U93B 5F1NB 2FBOJ 4Y19A 4UNUA 1I85A 4TVPH 2VKWA 3OKOA 2C3HA 2PO6C 1HQRA 2DWDB 3U0WH 3IDYC 1A0QH 2YD3A 2V7NB 4LU5L 1S9XB 2EH8L 3HE6A 3QA3A 1D6VL 5DJAB 2XNAA 5C0RH 1F58L 2I60L 3FB5B 3LQAL 2VZVA 3TO2A 3MRMB 1YYLH 1EGJA 1LK2A 4CVXB 1A4KB 3MXWH 2BVUA 1A2YA 4WWKB 3PDOB 1A1MA 1RUKH 4XP9H 2K7QA 5EN2B 5DI8B 2ESVE 2VDLL 4F58L 4JFOA 4JFFA 2ESVA 3PJSB 3BJLA 4HAFA 1OOAA 5DD3L 3OX8B 3B3IA 3WNNA 3UTTD 1RHFA 5FOBB 2YOCA 4KQ3L 1MREL 3V8CA 4OZGA 3SDDC 4XGZB 1FVEA 4JFXA 4JKLA 4V2BA 3KLSA 4HXAL 1OW0C 2H45A 2J4WL 2Y6SC 1D9KB 1SVZA 1OQOA 1EBAA 3S97C 4AZ8A 4J1UA 1RK1B 1MIEH 1XAUA 3HE7C 2ITDB 4X7CC 1CG9A 3D0VA 3VGEA 5ICZB 4LVNC 2NY1D 1ZHNA 4NKQB 3PV6B 3GMLA 5LBSL 1UB6B 3KGRA 1CD1A 4GKZA 2FJFA 1QEWB 5DO2C 3IVKB 3OL2A 5T5FL 3U2SB 5A16B 1YYMH 2O26U 3PP3H 5DK2A 4ODVL 5E9DA 5I1KL 5CD3A 4N9GB 1DR9A 3ELAT 3MLZH 4OSUH 3BGMB 2P7TA 3VXMA 1AGCA 4NO2B 2NY3C 3PWUA 4P3DB 4WHYG 4NDMA 4LLAA 5L2KB 5D5MB 3ILQD 1T1YA 1TPXB 5K9QI 4MJID 2BFVL 4P2CG 1A5FH 2Z93B 3P9LA 4GFTB 1SEBB 3VXRD 2HJFA 3MV7D 5FYJH 4E42B 5D72H 1A64A 1BD2A 2A74A 5FUOH 2C3VB 5MP6L 2W1NA 3V0VB 3GBML 4FA8A 5LXGL 4GRLA 5AWNL 3TT3L 1EEYB 4F7PB 3W9DA 1M6OB 3RGHA 4TOYL 4PB9L 5MENB 4OQTH 5BV7B 2I25N 5J9PA 2PYEA 4KC3B 2O5XH 4EI5B 2O5ZH 4Z95L 5JNYB 1L6XA 2AK4B 3ISWA 4G6JH 1IT9L 4L3EE 3KPRD 3BZEB 3G9VA 2CPCA 1BX2B 1HKLL 2HT3D 4RMVA 1H8SA 3RDTC 2G9HA 5BVPL 1RK0B 4XXCC 4F58H 4DZ8A 2Q6WB 3SCMA 2EIDA 2YEZB 4P57B 3QYCA 2YPVL 1BQLL 4Z5RB 4Z78A 4S1DC 4PJ8A 1YN6A 4OAWB 3E3QE 1PY4A 1MRCH 3OWEA 2BK8A 1HSAB 4PJAF 3O9WA 1Q0YL 5K9JH 2DIBA 3AU1B 3IXTA 4RIRB 2VUYA 3X3FH 2HLFC 3TJEH 5HGBA 1JF5A 2B5IC 2UUDK 4S2SB 3RDTA 3RVTD 1EEZA 3BHBA 2D7QA 3AUVA 4X7EC 4GKNB 2APWA 2VDQL 4WWID 5DUML 1EAPA 3WYRA 4OGAC 1LO3L 2HVKA 1RULL 4JN1H 1DE4B 1NDMA 3GJFA 1LK3H 3IJSB 3UTOA 1QRNB 5EIQA 3G5YB 3TYGL 2ZG1A 3QQ4B 5IJVB 2CXGA 5I6XC 4FQHA 4P23D 1G84A 2VABB 2ZCHH 4F37K 2VLJE 4PJIF 1EA9C 4EN3D 1HZHL 1F4XH 3LPGA 4RGOH 4J3SA 4X7SH 3P0VL 1RIVL 5F72S 4Y8AA 2FNBA 2EO9A 3RUGF 4UT7L 2RQ8A 1W72B 4RISH 1OHQA 3HZKB 2OMBA 3FMGL 2AK1H 4FXGA 1L7IL 4JCMA 1JNJA 1WUNT 1OTSD 1KEML 4L8SA 1ES0B 3AMLA 1KIQB 2F8VA 3IJHA 1S8DA 5F1SA 3VA2C 1XF1A 1JUFB 4LASL 3LY6A 3I9GH 4HS6B 3SN6N 5FYKD 2P42B 2ICWB 4HLJA 1JGDB 2HH0H 1WICA 5IM7A 3SE8H 1MH5B 1IM9A 3L3IB 3RWEA 3SKMA 4PJ9D 4XP9L 3BIAX 3HPJA 3PE9A 4ZFOL 4P59H 5D71H 1AFVH 5DS8B 4EQ3A 3TGXA 4GG6F 3OSKA 1I9RH 4HDIB 4P2RB 5KS9B 4U2ZA 3HMXH 5IVXA 2AJUH 1EXUB 3MRHB 4GQ9H 3WUWB 2UWEA 2R4RL 4PJ5E 3MQIA 3V0WL 1ZHBB 4LOUD 1A7QH 5FB8A 2HKHH 3EDKA 4H0GA 5TPWL 1VGKA 1IKFL 2GITB 2ATKB 3LKQA 3DTXB 3OGOE 4NQEB 3FO1B 2HFEA 4MLIA 5EZIH 5KSBB 4H0HB 1PKQA 4PTUB 1R3LA 1U3HD 2XXMB 3D18B 3GMPB 3RWCB 4DAGL 1TNMA 4U1SB 3D3VE 4BA8A 1U3ZA 2MPAH 4UDUB 3VA6A 2AXGA 2YUZA 2VN7A 1MHHB 4X6DA 3MRBA 5IBUG 5DURD 1A6ZA 3TVMD 2NW2A 4JFDA 4NGHL 1CICB 1J05B 5T1MB 3WNMA 3C8KB 4X4XA 3CMOH 2BX5A 5DD5L 2FATL 2YBRB 5IHUL 3U1SL 4RGND 1JE6A 5D93C 1G7PA 3PHSA 3LB6C 4JFQA 3IU4H 4EBQH 2R2EA 3KYAA 1FFRA 1OGAE 4E0RA 4QHMA 4JY6A 2J8OA 4KDVA 4GAJH 4LVEA 1A6ZB 5C2BL 4EI6A 5KTEH 1I8KA 1NCCH 4DKEL 4J3XA 4HIXL 3D0LB 4N90D 3GB7B 4LAQH 2AXGB 1OF2B 4CBPA 3BO8B 3QEHA 4JZNB 4G42A 5DJXA 5HGDA 1MI5E 1ZLUH 3G6JF 3MJGX 1FL5A 4HBCH 4BKLB 1P7KA 5IVNA 2GK2A 2J6EL 2LFGA 3BWUC 4H5SA 5TDNB 4X5WB 1C08A 3INUH 5F7DA 1KIUA 2VDKL 2X4UB 4L4TB 1CI5A 3ECBB 3X12B 3SE4C 5FB8B 3BD5A 2DI9A 4OIIH 3L9RA 5DYOA 5J13C 3ULVC 1XF4A 4OZFB 2KDGA 3S6CA 4WDIB 2C3GA 1FNEA 2XICA 4M7KH 3UTTE 4TUJA 1N59A 4PJIA 4Z7UB 5IB1B 1GYAA 3H42L 4UIKH 3TFKC 4MZ2A 2ZJSH 1J0KA 5DS8A 4IRSD 3RJDA 3QDGA 5LJYH 3O6KH 5SWZE 5E5MA 1CE1L 4G9FB 3N0PB 1LE5B 1A6PA 2XYCA 3NIDF 5MEPB 4ZO7A 2CUIA 5FEBA 4DVRH 3ET9F 3QH3A 4NOFA 5ID1A 1JUFA 4DUXA 4Z7OE 3UYRH 4NHUB 2J8UE 5ICXA 3UBXG 2ARJA 5KSUB 1M05B 4JQVC 4LCWD 4NQUA 1QOKA 3FTGA 4LP5A 5J1TC 2CUMA 4FXGB 1FP5A 3DETC 1ZTXL 3MCLL 4Y5VC 3I75B 4L4VE 1KC5H 4JN2B 3CCHB 1NFDE 4JKPL 3LS4L 4PTTB 4QT5B 3B9KD 1CR9L 4LCIH 1I8LA 4L9DA 4NN5C 3FQXA 4Z7WF 1HQ4B 4YXHL 2OP4H 4HF5L 5JQHC 3EZJB 4LCCC 5EU7C 4FQCL 3MJ8B 2GJZA 4PLOB 4ZUWA 3WKMH 2NX5B 2FO4A 2J88H 4YGVA 5GGSY 3HC3L 3AROA 1QKZL 5CINH 2UVFA 4X6CE 5JUEH 3BEWB 4TSAL 2OZ4L 4YQXL 4ELMB 1C7TA 1MHCA 5D7JB 3V6ZA 2AERT 4Y2DB 1EAPB 3KPMB 1F6AB 4PPTA 1M7DB 1F2XK 1FFOB 3RIAK 4ONOA 3QUXB 2CIIB 4GG6E 2YR3A 3QDMB 4RQQB 5I2IB 3KJ6H 4ZXBA 5KSAC 4X8JA 5DD5H 3I2CL 4DZBB 2ZPKL 4LSQH 3HLAA 3AB0B 2OZ4A 3FFDB 3O8XA 5L8KB 3MV8B 3LN9A 1EHLL 1BFSA 5CZKA 4I2XA 2Q1EA 2X4NA 1BFVL 1H8OA 2JB5H 4EN3B 4X7TA 2NXZC 2F74A 3C60C 5CZVL 2P5ED 4P57A 1CLOH 3B6SA 4LNRB 2R15A 2VL5A 1FN4A 1JNNL 1W0WA 4ZTOH 4G8GA 5MEQA 2G5BB 4YHOL 1MAKA 3T4YA 3BH8B 4G9FD 5DRWB 4GQPH 3V7MA 5ANME 1CFTA 3WHE0 4MJ4A 3HKFA 4NWUH 3F7YA 4YHIA 5E2UH 3QO1A 1UZ6E 4POYA 5CEZE 3OR6A 2EDTA 4ZXBB 4Y88A 1HILA 3C8DA 1KELH 5IF0A 5JMOC 3QUXA 3JUYA 1VESA 1DVFA 2QEJA 1RQ5A 2W9DH 5IP4A 3W5MA 1MHCB 5HYFA 4TPRH 4GRLB 4AEIH 1MPAL 5FYKE 4MXQC 3NMEA 3BN3B 2RHEA 1SBBA 4B50A 3KXFB 2FEDD 3SDCC 2F8XC 3EYOA 5F21B 3G6DH 1SVCP 1H5BB 1T1YB 3THMH 5D5MA 3FQXB 5ENWA 1UT9A 4WW1B 4BQ6A 3MYZA 1MCCA 3F58L 3PDDA 4NJ9H 5H94B 4HX1B 5FGSA 3QJFA 3RTQB 2FJGA 5D1QB 3MXVL 3QP3A 5JQ6L 1JTOA 4YK4C 3VXSD 3WL9B 1HINH 2Q76B 1C5CH 1X5AA 3FRPG 2X4QA 5LGJB 2A6JA 1B4JL 1FE8L 1GRWA 4XVJL 3DMMA 2DI7A 1NCWL 3VXQB 4PB9H 4I5BB 1WEJH 4LARH 1T6WA 1Z3GL 2CIKB 2AVGA 1D9KA 2OMNA 1HNGA 4XX1G 3MNVA 2OX5A 5BRZD 3QHZH 1YDPB 4HF5H 5E00A 4LQFL 1U8MA 1MJ7L 2F53A 4ZUTB 2XY1A 4XBGB 1HCVA 1A5FL 3B3IB 1V7ML 5MEOA 3A6OA 5F7DB 1OGAA 2ZUWA 3C5SA 1DFBL 1NUGA 3HUJE 3JWNC 2I07B 2DQDL 3TNNA 4IRSA 1YPZF 3K0WA 3WNPA 1MRCL 5CSGA 4DVRL 5JXEA 1T7VA 4G42B 5HGDB 3JUZA 3WIIH 2Z8SA 3QCTH 2AGJH 1QHOA 4AM0A 4MAUL 3T8XA 4LKXB 1N5YL 1CE6A 4DEPC 2AJXL 2ATPB 1RZKH 4NQCE 4KROD 1T1XA 4DOHE 1QSFB 5IB4A 3RAJL 3OKOB 5MHSE 1MFNA 2DB8A 4U3HA 5IGXL 5JLZA 2PYEE 1MVFA 2MCG1 4NM4L 3TBWA 3GJEB 3H0TB 3UTQB 1XR8A 3ARGA 2R2HA 1KXVC 5C09A 4IRSC 4YHLH 4EQ2A 4H8WC 2EICA 2L4OA 3MMEA 3TIDB 3SKNB 3HRZA 5JW3L 4FQJL 3BKMH 4P9HL 2BSTB 3O2VH 5JO5A 1AGFA 3EJYD 3ILQC 1OPGH 4KRPC 3EKCA 4M48H 1JZ6A 5E4EC 2CXKA 1IILE 5KG9B 4U0QB 4DVBB 1TCRB 3QRGH 2J8UA 3BPCA 4PIRF 3D18A 3SDAC 4GT7A 2B2XH 3GIZH 4RWHA 4RMRA 4L4JA 5KSBA 4IHOB 3SQBA 4K94L 4LLVB 3BW9B 4XPTL 1JPST 4UOJA 2W9EL 1U0QA 2ATKA 3GO1L 2F8OA 3LKQB 1FNSH 3P73B 4QOKB 5ERWB 1VKXB 4FQ1L 3DXAB 1KCUH 4Y89A 3SKOA 1D5ZA 4PRPD 2AJUL 2FWOA 4P2RA 4ORGB 4WW2B 1S5IH 4P2RE 4N5UA 4R0LC 3HPLA 4D0DA 4XAWH 2M8XA 3Q6FB 1MH5A 5C0IB 1I1CA 3MLYH 4H1LA 2HG5A 1FNFA 5I9QB 2OQJA 5I18L 3VFOA 4C56D 35C8L 3K8LA 3I9GL 4I0PA 2EECA 4Y4KA 5E4EB 4Y4HA 1I3RB 2ARJB 1SJEB 2YK1H 1FV1B 3KWWB 2NY5C 4YHNB 2DTSA 5JIPA 5J89A 2YS4A 3BIKB 4HAGA 4J7RA 1A7QL 4ZUVA 3P4LA 3T2PA 5D7LE 4I48B 1IC7H 4G9DA 5EA0L 2A9NH 1DBKH 4TUJB 4Z7UA 4H8WH 2IFFH 4MCYA 3CVHH 3VDAA 1J10A 1BFOB 3NPSB 1D6VH 3M07A 4RNRA 2LABA 5D72L 3L9RB 2FH8A 3QFJB 1A0QL 1XIWB 4KI5C 1U8JB 4JQVA 5F9OH 5ERWA 2X4UA 2RCSH 3QI9A 1J87A 1XZ0B 5IB3B 2GSIA 3FT4A 1AP2A 2VLRE 3GIVB 4U1IB 5DMGC 5HHMB 3WDJA 3BHBB 3ZTJG 1Q72L 4PJBE 2X42A 4FMKA 4PJBA 2QQNL 2FX8L 1A7RH 1YJDH 5DJXB 2PTTA 1G9MH 1I4FA 3HUJF 3FO9B 1AXTL 4HPYH 4HJ0C 3KPSD 3JWOH 5TQ0L 1JGUL 3CH1B 1GZPA 2V6HA 3OR7A 3K8KA 1YN6B 1WWAX 4PJGB 3EGSB 1A02N 3QCUH 2KUTA 3R06B 3PWPB 2IMNA 4R4FH 3KYKH 3O3EB 3FO0L 3GNML 1DEEA 3WFCL 4WEMB 3ZYIA 1BP3B 3IYLW 4D9LH 1G7MA 4Q2ZB 4Z0XA 3MV7E 4G6KH 2LV4A 5FCUH 1U3YA 2R2HB 5C09B 3PWJA 2W07A 3N9GL 4P3WA 3JWDH 4LHUD 3Q5YA 4LLDA 4U6YA 5I66B 3MYJB 4X99A 4JFDB 4JDTL 1QYGH 4LLYB 4NZDA 3L3KB 5F8RC 1O0VA 1E27B 4OQTL 1E4XH 1DDHB 4MD0B 3ARSA 43C9B 4OV6F 4LEOA 3MRBB 1U3HB 4MA8H 3M8OL 1OSPL 5GRVL 3V0VA 3C8HA 4HKBB 4PJXE 1R5VB 3LDBB 4L3ED 2Q8BL 3F7RA 4MNGE 4Q0XL 2ADGB 1SEBA 4KI5D 3P9LB 5J11B 3QHFH 5FYKL 1X5LA 4JKWA 3BQUA 5F3BB 2GCYB 7FABH 2J4WH 1IZJA 4R7DA 1G7LA 5DRNA 3EOBA 1XF3A 3O6MH 4U0RB 5KS9A 1NEUA 3FFCA 2C4FU 3FN0H 1P6FA 1YC7A 5IMKB 2I9LB 3DUHA 5IFJB 2UWEE 4NCC2 1NC2D 4J1UB 3DXAE 2IH3A 3KYOA 3C2SA 5D5ME 3ARRA 1KIQA 3IETB 2FX8H 1PSKH 3C60B 4QWWC 3LMJL 3A67H 5E56A 5CIPH 1XF5A 1KYOJ 1OWRM 2EYRA 1K3ZA 4OGYL 5KJRH 4HK3N 3IDMB 2GUOA 1CK0L 1H0DA 2KQMA 3NCMA 1W2KT 1MWAH 3MLTA 4RDQG 3RVVC 1IAIL 1QTYT 3RHWF 1ZLSL 4PJAA 1TETL 1H5BA 3VI3F 5HY9B 1QBLL 1TJGL 5E6IC 1NLDL 1A1MB 1OSZB 1JPFA 4R90L 4Z7WE 1F8TH 1MCSA 5C8JB 1MJUH 5CGYC 4F33B 4PBVC 3U4EB 3C08L 4FQQB 5EBLB 1ZSDB 3UC0L 4YHPB 3VG0L 1DVFB 1MRDL 2GJ6E 4W4OA 5I30L 5DK3A 4LCCB 5I0ZA 5AAMA 3DSFL 5INDA 3HB3C 5C0JA 1J0JA 4DQOL 1EHNA 2OXGA 3TIEB 3TBYA 1PLGL 1RUML 2O61A 5BO1L 3RVXD 1FO0B 4MNQE 1IGML 2G5BA 4D2NA 3IDGB 1N4XH 32C2B 4IOIA 5AZ2H 1ZLSH 5JPNB 4ZD3L 2HAZA 2DYPB 3ARVA 4JY5H 1J9CT 3I6LD 3DNKA 2AEWA 3EYUH 3T0DA 5EULV 1IQDB 3HE6C 2XT1B 4OM0L 1HDMB 4Z76B 2VSCA 2ZSWA 3HZVB 2MTPA 4XNZC 2VDQH 1E4WL 5SX5K 3IT8D 3CIQA 4DWHA 3LPFA 4L5FH 4EUPB 2BSSB 2PW1A 3D3VD 1E4KA 3UDWA 1KLGA 4NZTL 1FC1A 2BDNL 2FBJH 4S1RL 1DQDH 3TN0D 3L95B 2VQ1B 4IIQA 1UVQB 4NRYA 3IDJB 4PRBA 4MD5A 4M1GH 5CCKH 2VC2H 4AIOA 1EO8L 1NGPL 3T0XA 1DSFH 3VRLF 3QFDA 1XIWD 2YD9A 3HUJA 3K46A 4U1LB 4PGZA 3I6GA 3S88H 2W9LA 3N06B 4M48L 1F4YH 5K33A 3HE7D 4TNWK 4KHTH 2NW3B 5LG1A 4LCUA 3MUHL 4ZSOE 5B39A 1RY7B 3V5DB 3MRFB 4PJXB 5IK3B 3WIFA 5DA4A 5HI5D 1VSCA 3DOSA 4OB5L 3U2SA 3STZA 4DCQB 4UT9L 2K7PA 1CDGA 1K8DA 1KGCE 3SDXE 4ZMAT 2XKNA 4EIZC 3D0VB 4X4YB 2DQJL 4HBCL 3BH9A 4ZDHB 3T0EA 3AFLA 3BDYL 2AJXH 3LS4H 4IS6B 1RK1A 1WF5A 1XH3A 4K94H 4S1QH 1JGVH 4M6OH 1N3NB 1OAZH 1WIUA 5AZEL 3CU7A 5TE7L 4FHBD 4Q58C 1V7NL 4OZHF 4WO4D 1MY7A 1T5WA 2E8YA 2FL5A 3CPLA 4JFXB 2ZUTA 1FVEB 4HJGA 3UJJH 5IJKA 3T2NH 1G7JA 1HSBA 3QB7C 4ODTH 1EJOH 5JXAH 3VXRE 1WJ3A 4G8FA 4HMCA 4H5SB 5E03A 4L29A 3REVA 5E2VL 1NJ9A 4ODVH 3T0EC 1MFBH 1YC8A 1MY5A 5EIIB 3MBEA 4XPHH 1JZ5A 1H3GA 1KJ2A 2H2PD 4KQ4H 3IDUA 3E0GA 2LVEA 5I1EL 2E7BA 3BZFB 3KPQB 4JANB 5BOZG 1OF2A 2HJLB 3STBA 4XCYA 2Z8RA 5T1LB 4AIZA 4DN4H 5I71B 2VDKH 5HYQA 1U6AL 2PF6A 2HRPL 2RFXA 3E6FA 3P9WB 1X5YA 2D4FA 3O4OB 3QDJB 4XXDB 2DF3A 5CSZA 5D6CA 4CMHB 3BE1L 1U93A 3BGAA 5F1NA 3C6SB 3L3DA 3RWIA 2C9AA 2AV1B 5F88A 3S96B 2H41A 5MI0B 4FTVB 4U4BA 3K2MC 4CN4A 4GAGL 1RVFL 4XWGH 3GMMB 5F7MC 2DIJA 3OPZH 4OLYH 5EUOB 3GIZL 3HTLX 2EDBA 4F8TA 2ADIB 3OZ9H 5ETUB 2X1XR 3SBWA 1MCDA 4FS0A 5JW4N 3JV0A 1U8PB 3T77A 1S78C 3IB4A 4KGJA 4APQB 4R0LB 1PKQB 1WBZB 4FMFA 2R8SL 5I6XB 3HR5A 5DFTA 4S0TD 3EO9L 1QHPA 3LV3B 1MCBA 1MWAA 2B0SL 2WMPA 3BD3A 4LSPL 5GGVH 1HEZA 4JFYA 2XY2A 1BF8A 3OKMB 4RISL 4JZOA 3RZCB 3KXFE 1EXUA 3MRHA 3OKLB 3NVQA 1R0AH 1ZEAH 3CMGA 3R8QA 1GGCL 1LD9A 4FN0A 1T5XA 5E8NA 4HWZA 5KSAA 1MFDL 5HYIA 1IC1A 1LDPH 1JGDA 2JB5L 4MWFA 4YZFF 3LS5L 3TZVB 5GISL 1OSPH 3S96A 1UA6L 2FGWL 3IXAA 2M1KA 5B21A 1FZKA 1EMTH 3V6FA 1NMAH 5C2UB 4KHXH 3ROLA 4MXVE 2DMBA 2NX5E 1JK8A 3RZCC 1OGTA 1PBYA 1QR1A 1OT2A 4NPYB 5EO9B 1WFTA 5E8OB 1IM9D 4UTAH 5ELIA 4PJ7A 3Q6GL 4RZCB 3G08A 2ZCKL 1FJ1A 4M62L 5EOQH 2CMRL 9CGTA 3B9VA 3BI9X 1AD0B 4PJFA 2GT9B 4LEXL 3WXVL 2I5YH 4XAKE 4P59L 3L6FB 2GSGB 3OAUH 4NWTL 3CFIC 1PVHA 4UMGA 1XCTB 2H8PB 3QQ9D 2YD4A 2UY7A 3LN4B 1JI1A 4RGMB 2YPKA 1JFQL 2R39A 3NABH 2BNRB 3ORJA 4ODXB 4ELME 1R24A 3VFSB 5CJQL 2EIZA 4LSDA 4GJTB 1IEBA 3LRHA 3VMNA 1JTPA 5MI0C 1E6OH 1OAQH 3TVMA 3CFCH 2JCCF 4N0FB 1M7XA 4LSTL 5KVEH 4K23L 3V7AG 4Z0BL 4JGJA 2XOTA 2XKNB 3VXNB 5ALCL 3GSNB 1K4CB 3BISA 4KGLA 4ODHL 3O4OC 3ULVE 1UEMA 3DSNA 4DJMA 1SQ2N 1HYRC 2Y7QB 4X98A 2DQTL 5C0CD 2QSVA 2E7LA 4P5MB 1D9KD 4ORZC 4GMTH 4ZQKB 4XVUD 4EI5A 1J7VR 1IEAB 4GW1A 1I7TA 4UQ2A 5A43C 1MFAH 3RZCD 5MENA 4KK6D 3QFDB 1X5IA 5F7EH 4Y4FB 1V5JA 5KOMC 3GSQB 4YGAB 5DJ2B 4E41E 1IE5A 4Y2DD 2HYMA 2P5EA 1KB5L 3DSFH 4U3XA 5AEAA 1T4KB 4E42A 4KVNL 4ISVB 1U36A 4HUMB 4LHQB 2ZOLB 2Z4QA 5SWSE 1Q8MA 5DUPL 5L2KA 4H26A 1OAUH 5IHBA 4ZQKA 4YZFE 5B4MC 2P7TB 3VXMB 3E2HC 4X6CA 3BGMA 3RI5F 3NN8B 2QQLH 4LOUC 3FRUB 4UIKL 3C5ZA 4UTBH 3VXMD 5JPMA 3WIHH 3F12A 3MX0A 3WXVH 5E1AB 3MRGA 2W0LA 2PO6A 3MRQB 4JM2B 1T7ZA 1KNOA 5DJ6A 2P47B 3WS6C 3GMLB 2O5XL 1T7YA 2ZUUA 3CSYA 2DYPA 3MV11 4P9HC 2HFGL 2WINA 1TJHH 2A0LC 2BDNH 4OZHA 32C2A 1IGIH 3D39B 3QZWB 4M6MH 5HJ3B 4X0KB 1YMHA 4GXUN 1U8NB 1I8LC 1ZHLB 2H9GA 4XCNA 1XEDA 1Z6JT 3TIEA 1FYTB 4KAQL 4X6EA 1JPSH 2BNRA 4JRYA 5HHOD 3VH8B 4I77H 4M6AA 5K9OA 4MJ5A 2AV7A 3I02B 5F97E 5LGHH 3V2AR 4JFEA 3OX8A 1BHGA 5T5NF 4FQ2L 4LIQH 4GRLC 2GSGA 3L6FA 3DI2B 5DI8A 3FCTA 3ARYA 5IQ9A 3S37H 2BOCA 2ICWJ 4ODUA 2GK0B 3MODL 4RCAA 2Y06L 3DRQB 2HKFH 4QTHA 4OB5H 4UU9A 5CUSL 4OJFL 4YO0B 4YEFA 3BUYA 3RFZC 5CP3A 4RZCA 1BIIA 4PJDE 1WIOA 4Y2DC 3IDXH 2DS4A 4XNZB 5D7JC 1U8OB 4DKAA 5L6YL 1FDLL 3NTCL 5E8OA 5T33L 3QA3B 3HE6B 5A2KH 3W9EB 1K5NB 2XQBL 3GDBA 5DUBA 1U91B 4UQ3B 3MRPA 3VXUB 5J1SC 2JJWA 3I02A 3S35X 4CUCA 3MV9E 3DX7B 3ROLB 4R96B 3BP5B 1RZ7L 3I84A 4NN5B 5HI4C 1S7VB 3TZVA 2WLYA 4TUKH 2V2XA 4C56A 2BY0A 3HI1B 1FNLA 5EU6B 4YDJB 5E2VH 4RMQA 5C9JB 1FAKT 5E9DD 3KDMA 2DI8A 1N26A 2A1WL 3IKCA 4Y16D 1NDGB 1IC4H 5DMYA 1VB9A 2PXYA 1R3IH 4MX7A 2QKIA 4R6UA 1NCAH 4MJIA 3HMXL 2AJVH 1UQSA 1YEHL 2DLTA 4YFLF 3R0NA 4LRNH 2D7TH 2Z4QB 1BWMA 2ZOLA 3FQRB 3MLXH 4RMSA 2ADGA 2R0ZH 4G5ZH 4CNIA 5E6IB 3PIQB 4GRLD 1ZLWH 3VFWB 1DCLA 3KYNB 4TQEL 3AAZA 1S9YB 5I73B 1Q9WA 4PV8B 3RY5A 3FRPA 4NFDA 3RVXC 3ZYOA 2PETA 2QQLL 5F89B 1D5IH 4LEOB 5ITBH 2P5WB 1JRHI 1JCKA 3FT3B 1PX4A 2I9TA 1BJMA 3SDXF 2YPLD 2RAMA 4NQSB 3EHBD 3KPLB 3HA0A 1K8IB 3K80A 4GMTL 5HHOB 1F4WL 1KV3A 3WFDH 3MR9B 5HGAB 3R1GL 4UAOC 2WV3A 1ITCA 2C3WA 1A14H 4OQTA 5DJYB 3RL2B 4OBRA 3BP6B 4M8QA 5I1AB 1QD0A 2GTWB 4PRNB 2Z0BA 4F3FA 1U8IB 2D2OA 5A3IC 5MEND 3QUYB 4FQIL 1T22A 3M8OH 3O3EA 3NCCB 2MFNA 5EOTB 4ZFFA 1Z3GH 4JPWH 2O5YL 1V7NH 2CJUL 4UILH 1ZANL 1T6VN 3IDIA 3RIAF 3VGDA 3VWJD 5D5MF 4OGYH 2BRRL 4DKDC 2Y36H 1IEBB 2VH5H 3BJ91 4YPJA 5HYQB 1CD9B 3Q2CA 1CDUA 2X1WL 1KTDB 1BLNA 4P5TC 2Y23A 4UBDC 3VGFA 3P30H 3SQOL 2XWJA 4CW1A 4PJBB 4AT6A 2XN9B 1JZ2A 2XTJD 1TQBC 3PHQA 3CLEH 3L1OH 4HUXB 1UKQA 1M7IB 3GIVA 4U1IA 4OF0A 3P0GB 1RMFL 3F6IA 5F96L 1KIRA 3MREA 1RZIB 1PFCA 3UC0H 4OF5A 3T2OA 4TRPH 1QRNE 3RY4A 4P23A 2X4TB 5E6ZA 1CVSC 2XWJB 2Z31D 3EFDH 4X9GA 1SY6H 4FFYH 1MCFA 3F7VB 3E8UH 1SYVA 4OQ1A 4JVWA 4XPFL 4FQ1H 3T3PE 4MQ7B 3SDYH 4AIXA 3HAEB 4ENED 5IG7B 3TCXA 3QHFL 1X5JA 3ZTNL 1YQ2A 1H3PL 1NQBA 2IAND 4UIMA 2EE6A 3U7YL 2W59A 2FX9L 3SGKC 3ZKMC 2BY3A 3TNMB 4XC1L 3WO3B 2L0DA 1NBVL 4KTEH 1OB1A 2HLAB 4Y4HB 1GOFA 3NIFE 1QLEL 5EPMA 3O2WL 1UJ3A 1QPXA 3P0YH 1HWGB 5EC1A 3WIFB 4XRCB 1QO3A 1RUAL 2PN5A 4OF3A 5TE6L 2VIRA 2CK0L 4WFHD 5B39G 4H20L 3QIBD 2HWZH 4XP5H 3KPLA 4OUUA 1MIMH 1LD9B 4KWUA 4OTXL 1CFVH 4M7JH 3SGKA 1NCDH 1R6VA 3RKDD 2B2XL 4FQJH 4OFYD 5FHAL 4BSVA 4JZOB 1QFOA 4M8VA 3ZHDA 1MCQA 1UH4A 2IH1A 4L8CB 4TNVK 3EYFA 4IMKC 3DO7A 5E6IA 1MHEB 3L3HA 1HH9A 4U33A 3NPSC 4WTWA 2FLBT 1CFNA 5F6HI 4LPTA 4XBPA 1J0HA 4B0MM 4HKZB 1AI1H 4JFFD 1CFBA 3T65A 3A0OA 1MRDH 2XA8L 2QKIB 4JDVB 2P8PA 3JTSA 4Y7MA 4O2FA 5D2NE 3V95A 4ALAL 2EKJA 4M62H 3CFJB 4XP6L 1NC4A 1AO7D 1H3XA 1YEIH 1UKTA 2P5EE 3RWHB 5KW9H 2MWCA 4L4VA 1L9MA 5EZLA 4C56B 2OJEA 5FUZL 1XGQA 2BSTA 1G1YA 1RFDL 5I9QC 1NKRA 4PJCE 3ZKXB 5AAWA 5GGRB 5E24E 4F7EA 4HUNB 4ETQB 3MRDB 2B20A 1UYWL 2VL4A 5INDB 5KVGH 4QF1A 4WUUB 5JLZB 4D0BB 3MUJA 1NGYB 1MF2L 1ADQA 3MV01 4PJXF 4KZEL 4LSSL 2VDNL 1K5NA 5DUBB 2MMXA 2JELL 4IRJB 4C57C 1FH5L 2A38A 4UDTB 5GHWH 1KN4L 4AJ0A 2EE3A 4NWUL 5KVEL 1ERNA 4PGDB 1DTUA 4LSRL 2PTVA 4F33A 4LIQE 3CJJA 3MRJB 5ILTL 4NKMA 5HD8C 5D7KD 1SM3H 3VXRA 3FHAA 1RUAH 5J56B 4GW4A 3V4VL 2ZCLH 5BV7C 3F8UB 2ADFH 3IFNH 1QLEH 2GW5A 1NGXA 1EHAA 4X6BB 5DD6B 5EH1A 4PJHB 3CLFH 3CSBA 3SGDH 4Z6AT 3DX6A 3PXJA 3PABB 3ULVF 1UM6L 2EYRB 3U7YH 3ZYZA 2X1PA 3QT2A 1IC5H 5K9OB 1IZKA 4HJGB 3BUTA 3QUXD 5I1DB 2R29H 4MA7L 1U8KA 4FNLL 1KTLA 4JREC 2A6DA 4KAQH 4MSWB 3D39A 3QZWA 2XQYK 1HOCB 4OM1H 1PZ5A 3D69A 3PHOB 4LPYA 1BIHA 1JNHA 2CO6B 3QPXL 4FFZH 5DUMH 1V8HA 3TBTB 5I1GH 1K8DB 5T1DH 5IEKB 3HS0B 3HG1A 4TULL 4OZIB 2R2BB 1TCMA 3MRGB 5CLTA 5D1XC 5EU3B 2DQGL 4QHKI 4HG4K 4DEPB 1VGEL 1BREA 4BZYA 4UV7L 4AMKL 3VXME 3SGJC 5IFAH 5I1IH 2IG2L 4HWEH 3UPAA 4HUVB 1IC7L 1GPOH 2FDBP 4ZO6A 4RFEA 1MLCB 4KJWC 1HHJB 3E6HB 1CK0H 1X5HA 4HWBH 4Z7NF 2X05A 4GXVL 3SKUD 1S7RA 1FRGH 1P84J 2JJTC 4P4KB 4D94A 1B9ZA 3O41B 5I19L 5E5UB 1P1ZB 4J4PD 1IGFL 3ARBD 1AHWA 2DQUH 1IBGL 2PW1B 2OK0H 5IMLA 4XNMB 1LEGA 1IEAA 1T80A 4GW1B 4LLUA 5K59F 3DUSB 3LH2H 3MFFB 3OR6B 3DLQR 4LVNB 3F7YB 4YHIB 5A2LH 5CWSA 5ECJE 4ACPA 3IS1X 4HFUH 1PAMA 4OJFH 4K71B 4L3CA 1T3FA 5F6IB 1D9KC 3V4VH 4JLRA 4LFHD 2MHAA 5I16A 2IAMA 3IAGC 2F58H 3IU3A 4LPVA 5GGUA 3SDDB 3LKNA 5EBMB 2XPGA 4YPGA 4CVZA 3X3GL 3QUZD 2VXSL 2JB6B 2ZNXA 2WSKA 1FGVH 4P2OB 2ORBL 3O8XB 5JW4M 1R24B 3EW3B 3VFSA 4DZBA 3FQNB 1FVDB 4XHQA 3AC0A 3W39B 3QDMA 3SDCB 4OCWH 4FNLH 4JFZH 5DSCA 3KPMA 5GJSH 2GSIB 1AJ7L 1A14L 1KPUB 5EG6C 2ARWA 2COQA 3OAUL 4IM8A 3AVEA 1L7TL 2XFXA 1CDYA 1SYSA 4MJIE 4BQBA 4NQDB 3IDYB 4NQTA 5FGBC 3CAFA 1T21A 2GJ6D 2VDRL 4GRWE 1EO5A 4P46C 3MJ9H 3IFPB 3FAXA 3NCJL 4CRPA 2AXFB 5D7LB 5C0AE 2NQCA 3K1DA 4XPBL 1LEKA 3PWVB 2JCCA 2O5YH 3VMPA 1I9JH 1CGWA 3BIKA 2RB8A 5JR1H 1KN2L 5DLMH 4YR6B 4QOKD 4HS8H 1H15B 4PP1C 5FUOL 1LP9A 4NHUA 4R7NB 3OG4B 4PRHD 5MEPA 4WHCA 1MAJA 2I9LA 4H1LB 4EOWL 5C0IA 4LLMA 1A4JB 4M03A 4BZ2H 4PY8I 2EYSB 4HWZB 4X80H 3ZDXE 5KSAB 3DVGA 4RGNE 3VD7A 2CUHA 4JPWL 4V1DB 3NZHL 4YHYC 3LMJH 5IBLC 3QUKA 3CZFA 3QEGH 1HKLH 1U92A 1OGAD 3BRGC 4JFYB 4QRRD 3WDHA 4Z7WA 3QQNA 3BEVB 3QCVL 5IOPA 3LEXA 1YEDB 1ACYL 4OLXL 1BBDL 4OZGF 4LDOB 1CLZL 4X5WA 3BP7A 3QXDB 4LLVA 5ISZD 1AH1A 3MGOA 4FQXC 4GW5B 5E1HB 2VKXA 3P4NB 1R5VA 2BVPA 1I9IH 4FABL 3Q3GA 4CADA 3C08H 1YNKL 2GI7A 4POUB 3PDGA 4DVBA 2NY4B 3EZ8A 3MA9H 4PRID 2OR9L 1VFAA 5L2KE 1CZ8H 1BVZA 1QSFE 1G9ML 1VHPA 1A6UH 3S3SA 1VEPA 4AEHH 2BCKB 3QO0A 3L7FB 2AEPL 1T0MB 4HWEL 3L3GA 4U7SA 3SY0B 4F7TA 4P2QE 5TDOB 2W0KA 2FLRT 3TYGH 4OF8A 1VDGA 4X9BA 4Q2ZA 1YN7B 5DMIH 4GRMB 5GRUL 5H2BB 2H32H 4FQLH 1ZVSB 1QLFA 2H26B 4W70A 3T3PF 4MNGA 1OY3B 1S7WA 2IADB 1G9EA 3L7FA 3EGSA 2NY1B 3D39E 3MOBL 2CLVB 3GSXA 1E6JL 1I3GL 3H9HA 2NW2B 1VACB 1T66C 3OF6A 2YA2A 1MHHA 4UT9H 4OUOA 2R0LH 2IBBA 5ACZB 1EHLH 1I4FB 1MI5A 4Y5YA 3I3BA 2NLJB 3MBEB 2OR8A 5EIIA 5CUSH 5HYEA 1NFDB 2YK1L 1BM3H 3DGGB 3MGOB 3NCBB 3QBTB 4R4ND 1DQMH 2JJUA 5C0BE 3FO1A 5D71L 3BP7B 4YWGL 3CXHJ 3SE8L 3VG9B 5JA8B 3CDYA 4LNVA 4P4RA 5AG8A 3LEXB 2AJSL 2V9TA 4DTGL 4XBGA 4KKNA 4KI1A 3QFJA 3T3MF 4HPYL 5HDQL 4ODTL 4RMTA 5JXAL 3HZMB 2GIYA 3CVHL 2FX7L 2DAVA 3HC3H 4DN3H 4Q7DA 4GKOA 4V1DA 4AH2A 2FR4B 4XAKD 4HHAB 3AMKA 5JOFA 2D7NA 3N1QC 4GUPB 2EH8H 1E4XL 3BOVA 1J8HA 5D2LE 2YWZA 5FUCE 4R7NA 2EEAA 2V5TA 1AJ7H 2BVQB 5CJBA 5FKPA 5CEZD 2EDNA 3WLWC 1CXKA 1VEMA 5EORH 1R5WA 3QAZB 5HYJA 1KIPA 2ZKHH 5C6TL 5BS0D 3GMQA 3CNKA 1PJ9A 1YEGL 1UACL 4M6ML 2HG5B 5DD0L 5AYQA 1KUMA 2GJ6A 4PFEA 4M4RA 3OJVC 2H2SC 1I8IA 2AXFA 5GGTH 1CDJA 4K2UH 4K9EH 2DM7A 3MLRL 2GAZA 1N2RA 2DQFA 1CT8A 15C8H 1BAFL 1NMCB 4MA1B 1I9JL 3O8XC 5I8KH 4MA7H 5DTFB 1Z0MA 3F7QA 4MD5B 2I26N 5FM4A 4YNYA 4YH6A 2P8LB 4OKDA 3TN0C 3UTSA 2HT4C 5D8JL 4QOKA 3PNWB 2ED8A 1HCFX 2D4DA 2X4PB 2YMXH 3BW9A 5J06A 3I50H 4IHOA 7FABL 1EERB 2YD7A 5D7SL 1BOGB 3EOAB 4I9WD 1OT1A 2QSCH 3HZVA 1X5KA 5TQ2L 4Z76A 4WY7L 4PRAB 2P5WE 3KHOA 4ZO9A 4O02L 4HUWB 5ILTH 1N7MH 4DGIH 1JYVA 3T4AA 3WS3A 1W0WB 3C5JB 2PYFA 2BFVH 4Z5RA 4C54A 4ZYKA 5HVHC 1QBML 5LKNA 4WU7A 4K3EH 4XWOD 4MD4A 5GGSB 4A2LA 2KQNA 4IOIB 4EDWL 1B4RA 4XBEH 1JGLL 4I2XB 1A1OB 3HRZB 1D6EB 4GAGH 1P4IL 3HNTH 3QWRA 5L2KD 1XR8B 3ARGB 3GJEA 5DEGB 4PJDF 1T1ZA 1LDSA 4X7DC 4NC1E 4PRHB 1C16A 1KJ2H 1LGVA 5IB4B 4O58H 1NFIA 1TZGL 4GBXC 2BP3A 5CAYB 2OI9B 2XWTA 3VDCA 3T8XB 1NCWH 2DM2A 2NXYD 1CXLA 1LO0H 4M3JA 2CRMA 4LEXH 5D1XB 4EXPX 1DQQB 2VXVH 4IJ3B 1YEJL 4S1SL 4QHLA 5C8JA 4XNQA 4X9IA 3PWPE 4X9FA 4NUJB 4WV1B 5GRVK 3MV9B 4NM8L 1KCSH 3U83A 3E8UL 1MCRA 3C5SB 25C8L 1IARB 2GJ6B 4JJ5B 1QSVA 4HCRA 2C4FT 1AGCB 4K9EC 4NO2A 5GGVL 4JREB 5C86A 2JIXD 1G6RL 3BRDA 3VWKA 4KH2A 3CCHA 1UENA 5IROA 1DSFL 1AHWC 1UB5B 3A6BH 5EU3A 1OVZA 2FZ3B 1QEWA 3D3VA 1CD1B 2X4RB 4KTEL 4JM4L 1BD2D 4O58L 3VD4A 3TBTA 5GSRB 4L4TE 3ZT5A 2MCPL 4M7ZB 1MRFH 2F19L 3STLB 3IDNA 1MCEA 1VGEH 1VEOA 3D69B 4G9FA 2A6JB 1U9KA 4GUPA 4N68A 2PCPA 4JKKA 4WV1C 2WUBL 4QCIB 4XPTH 5K59E 1RURL 5C0AA 4JZJC 4IRJD 3MTRA 4IJ3C 1OAXH 1FLRH 1XF3B 4OZGB 2AJVL 1DN0A 3CFEA 4O5LH 3X13A 2JCCE 3QXVA 3LPWA 1U2CA 1QKZH 1FRGL 2H32A 4GBXB 2BSRA 4F7MA 1JRHH 3NIGE 4DGIL 2JF1A 1A7PH 3UYPA 2X9WA 1IGCH 1NSNH 4PJHA 1RIVH 5I1JL 2XTJE 1Q1JH 1OPGL 2BVYA 1ITBB 4BSJA 4QHLB 1LK2B 4W6WB 4NP4H 2QHRH 1RZJH 4U6XB 3B9KA 2BHYA 3X14A 4XTRC 3D0LA 2GKIA 2XNAB 2NY0C 4JFEE 5HVHB 4PJCA 4PJFF 5BW7C 1ZGLM 2NY2D 1NFIB 4X99B 3H2WA 4U6YB 3EYVA 2YKLH 1YPZE 1OWWA 5I15H 1T1ZB 3ARED 5DEGA 1UADC 1X3DA 2APTA 3PWJB 2YC1B 5SWQA 5D2NB 3MGAA 3HE7B 4N5ED 3VXTA 4JFQB 1KB5A 1D6EA 5H2BA 1F11B 5DWUH 3TJHD 4K8RD 5GS1C 3QUMA 4HMDA 3U0PB 1MNUL 5GGSA 2QSQA 4OBSA 3IFLL 1ZLVK 3DARA 2HTKD 1JHLL 2F74B 1CICA 5T3XD 5SWZA 4YFDB 4NYLB 2BCKA 4NRZA 1A1NA 1PG7L 1QLRA 1AXSA 1K6QL 3QUZC 1FIEA 5CHNA 5JHLL 1W8OA 4FXKA 3BQUD 3ES6A 4LHUG 1G7HB 4BQ9A 3LQZB 5IESL 3JWOL 4U1SA 4OI7A 3KJ6L 5GS0L 1CZ8L 1LNUA 4Y2OA 4FFWD 4HKZA 4WWKC 5E99H 5HYJE 5F9WC 5L8JB 1PEZA 4YX2L 1CQYA 5BJTB 3WSQH 2IC2A 3SJVB 4LSUH 1ZLVH 4JFED 4NBXB 4UT6L 4Y4HC 4PREB 1U92B 5DTFA 4LK4A 3IU4L 1MCPL 4RNRB 5E7FA 1MNUH 1CBVH 4AG4L 3BDXA 2DQFB 2GAZB 4FQXA 4G6AD 3PP4H 3GBNH 4LLMB 4O51B 3L5WB 2HKFL 4NZJA 2ICWA 4D9QD 2BNQA 2Y1VA 1KIPB 1NC2B 1XGTA 2EXWD 2A9ML 2L7UA 3UTZB 4YHNA 4KRNA 3SOBH 2NYYD 2V2WB 3FTGB 2NXZD 1JZ7A 4LSVL 1MCWM 4Y19D 3C2AL 4HS3A 4RRPA 4ONHA 5BZWB 4PJFE 3F62A 1RZJL 3ARWA 3JZ7A 4P9ML 5EO0A 1RZKC 2OQJB 5E5MB 5JOFB 1UM5L 1CU4H 3Q6FA 4TVPL 4AEHL 5DD1L 3ZE1E 1IGJB 4B7LA 1S7SB 3GKWH 2W38A 1BZ7A 3P9MB 4G43A 2X4SA 5FO7B 3NGBB 1CD0A 1NEZG 1A9EB 4H25A 4OIIL 4NQDA 4XWGL 4Y4KC 1EH9A 3HI6L 4P46D 3T0BA 1UZ8B 3X12A 1CFQA 5I74C 5AUMA 2VDPL 4RRPG 4YXLL 2VNCA 1MHPH 4M5ZL 4ZNEA 3SE3A 1NLBH 3V4UL 3VXPB 2VR9A 4PGBB 1WWBX 5I1CH 5C7XH 2XN9A 1MCIA 4S2SA 4KK9C 1CD8A 2YKLL 2OYPA 5LWYL 2F53D 1NCBH 4KJYB 4MQXD 2BMKB 4KUCD 5SX4I 1G7HA 3ES6B 2MSPA 4FOMA 5B3NA 1M71A 5KG9A 4UB0H 1P2CB 2RR3A 2XV6B 4JAMB 1WV7T 4KQ3H 1P4BL 3UAJD 4EVNB 4YXHH 5T3ZD 3QI9C 4RSVA 3WN5C 3SCMB 3UTSE 1BAFH 4JFFE 2NY4C 4C83A 1W0YT 4PG9B 3SHSA 4GS7C 4U2YA 1X4XA 1Y0LA 1SJXA 3LEYH 3I3EA 1ZS8B 2OCFD 2EZ0C 4D0CA 1XMWA 2OZ4H 4TUOA 3HC4H 3RY6C 5SWQB 2YC1A 3H9SE 5C9KA 2IPTH 3U9UA 1WAAA 5D2LA 4Q6IA 3SE9H 3EYVB 1F58H 3BPOB 5I1GL 2PYEB 1UXWB 3TO4B 4XVSL 3K4DA 4N9OB 1X9QA 4ODHH 2DD8H 4FFVD 2I9TB 4PJCB 3W9DB 4LSUL 1PGRB 3B9KB 4KVCH 4Z77A 1YY9C 4CADB 3MRLA 1BFVH 4EDXA 3PIQA 2OXHA 5KVMC 4U49A 2QJDA 3VXOB 3MJ9L 5KANG 1I1RA 4S1RH 4NDMB 3GNMH 2JJTA 1INDH 4HIEB 4HUVA 2VISB 5D4QA 4X5XA 2H32B 3EFFB 4MJIB 1ZHBA 4NUGH 1AY1L 3TC9A 2B1AL 2EDOA 2ZJSL 3GMNA 3MLRH 1CICD 1U8MB 1BZ9A 1KLUA 1J1XL 3QFJE 3BGFB 5DK2B 4QRSB 4JGMA 3G04A 4OZIA 4HK0B 5J12B 4G8EA 4XP4L 4OZIE 3UCRA 1LQSR 4OLUL 4YHZL 3HPJB 5ALCH 1ONQA 4WI9A 1UZ6F 3LSOA 1Q72H 2XI9A 2VDOL 3KG5A 3ARFD 4NQCA 4P46B 3NPZB 4PS4L 4L4TD 1JWSB 1XF2B 4MVBC 2Q76A 5GSRA 5CP7A 2IAMC 2IANE 1IAII 5D1QA 3FQWA 2FJGB 3MNWB 2IBZX 1T2XA 4MAYB 3O6LH 5IW3A 2BXZA 3MBED 3Q1SL 5HPOA 4YR6A 1P7QD 1KPVB 2GFBB 1OTUC 3X3FL 5FO8B 2C1OA 4AG4H 5FYKH 15C8L 4Z7VF 5C0CB 1XGUA 1NAMB 1UM4H 2ICCA 2X9YA 4RGOL 4OI8A 1YY8A 1U8OA 1KTRL 1VFOA 3IFPA 3KR3L 3RIFF 3KAAA 1PG7W 4ZOBA 5JZ7D 5GIRB 1I3VA 2WZPD 2KKQA 2ZG3A 3O0RL 4WV1A 3G5YA 4GLRI 1QRNA 5D6DC 5HHXH 4NO5B 3VFTB 3U9PL 1TVBB 1YEJH 1YY9D 2WBJC 5FA3B 1MPAH 3B4NA 2APFA 5F3HA 1AXTH 1AR2A 4P5KB 12E8H 5D7IB 4O02H 5CEYB 1QFWM 4LAJH 1IT9H 1H9VA 5KSBE 2NNAA 2OM5A 3KS0H 3V9FA 4K71C 5IF0B 1DEDA 1C16B 4NGHH 4MJ5B 3DURA 4U7KA 1IFHL 1Q0XL 3DIFB 5DT1L 3QIWD 1FVDA 3QO1B 4QXTA 4NNYA 3MJ7A 4PUBL 3CVHB 1S7UA 3IXTB 3CDCA 4PYHA 3PV7A 1FIGL 5MENE 2I27N 3QG7L 3Q0HA 3HC4L 4F2MA 1NANH 3O3UN 3B8YA 4YPGB 1IGYB 4LCWB 1ADQL 4MNHA 4HS8L 5GSVB 2EO1A 5ICYB 4PG2C 1RIUH 3G5ZB 2J8UF 3QEQE 4KMLB 3TA3D 1R5IB 1LP9F 2HJKA 3MA7B 4Y4FC 3NIDE 4M43H 1AO7E 4XP6H 5JPMB 4L8BB 3B5HA 4AYFA 2NY6B 1ULVA 4WCYL 4BSWA 4H26B 4K3DL 3S37L 1I9RL 4XNMA 1LO0L 3V5HB 3LQAC 3LIZL 4PJ5D 2HRPH 3RPIB 1D5MB 4HSQA 4S10A 4HK3J 3DVNB 1M6OA 4DUVA 4PJ9B 1BVKA 1QQDB 1GPOL 1P1ZA 5D7JA 3MBXL 1MELA 2P8LA 3M1BA 3PXHA 3WJLC 1U8QA 4QRUA 1HYSC 3FQUB 4HKJB 1I75A 5BRZE 1P9MC 3S36H 3U0TB 3E6HA 2IBGA 3QWQB 5H35B 1CGUA 3C9NB 3WEXA 1FH5H 5GHWL 3IFOA 2VZ1A 2BRQA 2BERA 1VENA 3MUGB 3OPZL 1EZVX 3F6LA 2FCBA 3D85B 4JDTH 6FABH 1QO3B 2EKSA 3NFSH 5I8CA 2HP4A 1YMMB 3QEUA 1RUKL 4IIQC 5E9DB 4HZLB 2ZOKA 4JO1L 4BYHA 2I5YL 5JW4Q 2QV2A 5ICXB 2UYLB 2VLMD 3V4PH 1FORH 3PV6A 3C6LA 5L88L 1ORSB 4PV9A 3TVMB 4CN6A 4WHYH 8CGTA 1FLRL 1OAXL 3JWOC 3ZKMD 2UZYB 3RX8A 5EOCH 5I76A 5ESAB 1FL3A 3P4OB 5LQBH 1E6JH 1I3GH 1V7MH 1L0QA 4PY7A 4RWYH 3O6FD 4U1KA 1ZEAL 3RU8H 2LTQB 1C12A 1JZ8A 5F9JA 1JPGB 2CSPA 4J4PC 4GG6A 5ID0A 1GGBH 4N0YL 1FZJA 1CBVL 3QG7H 4KI5F 3WFDL 5DVKA 3GSOB 5EN2A 1JHKH 3P77A 3OJDA 5A40E 1NGXB 4UI2A 4P2QA 3L5HA 4JFPA 1Z9MA 3VU2A 3EJZC 4NKMB 4JZNA 2XRAL 3AY4A 1A6UL 4LGRB 4M43L 1VCAA 1SMAA 4NSKB 1UC6A 4J4PA 4FFYL 2P44B 1LEIB 5D1QD 1Q38A 3NOIA 2ZSVB 3QIUC 1OAYH 2P1YA 3TA3B 4GXVH 4EI5D 1F45A 1CIDA 1VFBB 3PG2A 2CLRA 4KXZI 3OJ2C 5FYJD 3WLBA 2R2EB 4K3EL 1ZVSA 1FZKB 1NGZA 2V7HB 3S37X 2KPNA 5GGRA 5B38A 3AY4C 2FEEI 3HN3A 1QSEB 3QJHB 3WMSA 3OKKA 3RVVD 1A6AA 3FFCE 2FD6L 1T0MA 1ZA6A 5FK9B 1NC4B 2AJ3B 3RGVB 3QDGE 5D96B 3MOAH 3MLYL 5ANMB 1F4WH 5CBEA 1TZHA 1ZTXH 3PL6D 4X80L 4XPFH 3RUGA 3VFMB 5C08B 1YUHA 2XTJC 3QISA 3GHBL 5EU5B 1QZ1A 2DQEL 2X10A 5M95B 3V52L 4LVHC 4V1DE 3HNVH 5CILL 3SDAD 3BXNB 4MDJA 1HE7A 1CFNB 5B38G 5IV2B 4YDKL 4JPKH 4M1DH 2WQRA 3EFDL 4LRIA 1UQSB 1CLZH 4PJAE 5EO1A 4AENB 1NLBL 4BK4A 3WFHB 2VRAA 1OARL 4MX7B 2IH1B 4ZAKA 2H1PL 2VR4A 4OD1L 3TV3L 4QHNB 2Q7YB 3CZFB 5B3JE 2GJJA 2EC8A 2B39A 1IAOB 5FECB 5D1ZD 2FYYB 3ARPA 3JV6B 4G80A 1VADB 1K85A 1AIFA 3HI6H 1ZGLP 4L8SC 3C09B 1MUJB 3DVGB 5D1ZB 3BPLB 3O3AA 3OKDB 1T0PB 1WZMA 3FFCD 3QJHA 2YD8A 5IEHB 1MVUB 3WNKA 4RBPH 3ILPA 4IEFB 2PW2A 4NJAL 5KW9L 4X6DE 1KC5L 5TE6H 4EDWH 5T3XL 2Y5TB 4HBQA 1OCWL 5DD0H 2IQAA 1QBMH 1DANT 4FXLA 1GZQB 3TNMA 5HPMB 4A6YB 4BFGA 4I2XE 3S36L 4ODBD 4DGYH 1LEIA 5JHDE 3GBLA 2BNUA 1SEQL 5L7XL 4WO4B 1JYXA 1I1AA 1OQXA 4KHTL 3U0WL 1QYGL 2GYSA 4V2CB 3F7VA 2KZWA 2VABA 5I1JH 4FQHB 1JV5B 4PY8J 2R4SL 2QADC 4JFPB 5JTWA 4UU9B 1SJHA 4KV5E 1F6LL 4TPRL 1RIHL 3TPUA 5I8EB 1JHTA 2WLZA 3MREB 2W9DL 4NC1C 1R3JA 2F9BT 5GS0C 4EKXA 3MODH 2YN5A 1NCDL 3A6CL 4HUXA 4OLYL 3V0AC 2A0LD 4PBXA 3TH4T 1EEZB 4LHUA 2J6EH 4Z7NE 4PGEA 5JOPE 5BS0A 4OCRL 5DMGD 4D9RE 1BOYA 4U1KB 3VH8A 3A67L 1RZ8A 3NCEB 5KAQG 1FL3B 3P4OA 5F1IA 1YMHB 3VWKC 3PGFL 1HSAA 1KJMA 4GMSH 1WCQA 3BKJL 2DLEA 1JNNH 3KXFD 4D3CH 4ELMF 1WTLA 1IC5L 1ZA3B 4HT1L 5GGUB 3HAEH 2BNRE 5BRZB 5IKCA 1RJYB 5CEXA 4WHTB 2JK5B 1B4JH 1FE8H 2D31A 4PRNA 1VERA 5DC9B 3NZ8B 2GTWA 1RPQA 2Z35B 3DMMC 3MRFA 3EYSH 4P2YA 1HN1A 3G9AB 3VH8G 1INEL 2E7CA 2OTWB 4OGZA 2AK4A 3DUUA 1AFVL 2NW3A 4YC2C 2VZTA 2FHFA 3VGAB 2X2YA 3O3DB 2XZCL 1CWVA 5FYJE 1T4KA 2UZIH 3DWTA 5F89A 4OFPA 4J12A 3DV4A 3AS3A 3MLUL 1Q9WB 4JQXA 4PV8A 3CXDL 4KY1H 2C3VA 4K94C 5JDSA 2FRGP 3WKML 1A3RH 4F37F 1RUMH 5ESVB 4MXVF 1IL1A 2WIMA 2Z93A 1RZGA 2CQVA 5FYJL 2XKUA 2V9QA 4NZRL 2A1WH 2H2PC 1IAKA 3F5WA 1LE9B 5C08E 5D9SA 4WGVB 2EDKA 1Z9SA 4YFEA 5C0FB 4UV7H 3RNQB 4PS4H 3F65A 4NC0B 5BW7A 1NCNA 2YZ1A 3H9ZA 3IGAA 2EXYD 4ZODA 3FB8A 3P4MB 3CZJA 4D9RD 5JW5B 3MCG1 2FJFB 4OF6A 5FF6A 2EH7H 4HEPG 2BOBB 5C9JA 5DEFB 4NO0A 3ZE2E 4JE4B 5JPNA 4M61B 1NH6A 5DO2D 1H3VA 4QRRB 5EBWB 3X11A 3T1FA 3VGAC 2BJML 2ERJC 1FO0A 1FFNB 4GSDL 2WP3T 4KK5D 3TWCH 4U7MA 3CVHA 1KT2B 4B41A 3BP5A 1IGFH 1MJ8H 3VI4E 1RHHB 5KSAD 3DIFA 2Z31A 5K9JL 5HHNB 5HHXL 4M4PA 4RBPK 4UINH 1RIHH 2NXYC 4NRXA 3MROA 4LLWA 3G6AB 2WK2A 1R3JB 5E6YA 2N4IA 5HVWA 4O2CB 5FA3A 5TDPB 4X9HA 1CYGA 1BIIB 2AEQL 1UGNA 5BVPH 3GSRA 5E99L 1WZ1L 5DR5L 2Q8AH 1JV5A 4JFZL 4F9LA 1WBYB 4PGDA 1TZIA 5IQ9B 4X6FA 5DJAA 3G6AA 4RAHA 4IRJA 4MDIA 1KFAH 3DI3B 2VMFA 3MLTB 4NM4H 1QR1B 1PEWA 3BYYA 3VWJC 2FGZA 2YD1A 1XF5B 1HH6B 1F90L 4KKBD 4L1DA 4ETQA 1HZHH 4C59B 3LKPA 3TEUA 4TSBL 1U8NA 2H9GB 2YPLE 4XCNB 1T7XA 1SMOA 2PW2B 4F9LC 3PWLA 5J11C 4PRIE 5K9KB 4NQCB 2Z92A 3HMXA 5E2UL 3C2AH 5JXED 5DLML 3O3AB 1WFOA 2IPTL 4NO0B 5BMFL 3GHEH 1XGYL 2PUQT 1W0VA 3GJFK 4XPAL 5FF6B 5F96H 3GSWA 1VADA 4JRYD 3OAZH 3CFJA 5BQ7B 1OM3H 4QRSA 5C0DB 2OSLB 3F12B 2ICEA 2J8HA 3ZT7A 2G5RA 3LAFA 2E9WA 1ZT7A 3RWJB 3O4LE 4X6CB 1OTTD 5D9SB 3AREA 3GSUA 3RU8L 1Z9OA 4UB0L 5T3XE 1FGNL 1RZGB 1GOGA 5TFSL 2R9HC 1I7ZA 5KS9F 3HCVA 3BPLC 5TF1L 5JDSB 4GXUM 1Q9OA 2ZUVA 2ZUSA 4Z9KB 2CR3A 3GSQA 4OLXH 3RUGB 3VFMA 1PDKA 2IALA 4M5ZH 5E2TH 5IQ7H 4BM7A 3KPSB 4G6MH 3O3DA 1FNAA 3CK0H 3L3KA 4N8VG 4LLYA 1FSKB 1MIML 3F58H 3LQMA 4JY4A 4NJ9L 5IMOB 3LN5A 4Z7OF 4HIIB 4NNPL 3DUUB 4LSVH 5DHVB 1RULH 5F7UA 4LASH 5EPMB 1MQKH 4DGVL 3HC0A 2AV1A 4WFHE 5D7IF 2WIIB 2D31B 5ACMA 1ZHKA 1N64H 1KJ3H 2D9CA 1WWCA 1IM3A 2XQYG 5T3ZL 3ZLQC 2E9BA 1NUFA 2BY2A 3O4LD 5DWUL 1Y6NR 1ZA3A 1YPZA 2YRLA 1G6RA 1RFDH 2J12B 2SEBB 4JAMA 4G8IA 2RFXB 3E6FB 3VXSE 2EC9U 2R1YB 1JYNA 3SKJH 3MV7B 2LU7A 4M1DL 3VFNB 4CU6A 5KS9E 1IGCL 1NSNL 2DOCA 3UPRA 1CXEA 1AKJA 4ELKB 5C0AD 5I1HH 4I4WA 4HIHB 3G6JA 5FDWB 2DWEA 3G5XB 3ESUF 3N1MC 4P2QB 3ZMRA 3MC0A 5F8QC 1MJUL 3GHBH 3VXPA 5D70H 2DJ4A 2HT4D 5IB3A 1GGTA 5EB9A 1YJDL 2XRAH 1FZMA 1WSST 3RX7A 1I1YA 4JG1H 1YQVH 3PL6B 3EOTH 3MCKB 4H25B 4Q0XH 4E41A 4KKCD 1KGCD 4UT6H 2HKHL 3DO3A 3FJTA 4G7VL 3I6KA 1JRHL 4MYWB 3G6DL 1BLNB 3CLFL 1TQCB 4BZ1H 1YMMD 1T83A 3BQUC 4HZAA 5B4MD 3FOLA 1P6AB 1PSKL 5SWSA 4ZOCA 4NN6C 4JHZA 4G8IB 4ZUVB 2DQDH 4K07A 1DP0A 1G6RB 2SEBA 4NPYA 4WW2C 1J88A 4DFHA 4JR9L 4GRWH 1J8KA 1WITA 3QNZA 1KJVB 1QUNA 3AXLB 2RGSA 5IVZB 4MJ2A 1CIUA 4KTDL 2V2TB 2EKSB 1RJLB 4FFWC 2Y25A 5BS0E 3MLWL 1D5BA 5E8PA 5FYLE 3PP3K 2O5ZL 3QIWB 4XMPL 5IVOA 4Y5YC 2F54E 5E8NB 3PGCB 2G2RB 3CGTA 2Y4SA 4WW2A 4KKLC 2R69L 2FWOB 1IEHA 1QFUH 5E08L 4N0CC 3RZCA 3MO1A 1IRAY 2A83A 3O11B 5HI3C 1B0GA 4OIBA 4R4NC 4C4KO 4JFHE 4YDKH 4IIQB 3QZWG 3V5KB 4HXAH 5T3ZH 1NL0L 1UEYA 1KLGB 5ITBL 5CGMA 1O7VA 4G8GE 5D8JH 4MHHG 1EFQA 3RKDC 3ZDXF 1HIMH 5HYJD 1WFNA 2E9IA 1BQHG 1B0WA 1Z9LA 5E7BA 1ND0B 1U8PA 4I1NB 1MFCH 5I1CL 2ZKHL 5C6TH 4CMHC 2VLLB 1N5YH 1RUQH 5C0DA 2CRYA 2CK0H 4CJ1A 3BWAA 3ULUE 3G5ZA 1EFXB 2CGRH 3DRTA 3MXWL 4KPHH 4NT6A 5SWZB 5J1AB 2ZUYA 4IBLT 2MNUA 5I71C 4ZS6D 2EIEA 2Z9TA 3HI1A 5JO5B 2DQJH 3O45A 1G7QA 4NFBA 2AQ1A 2DYPD 3INUL 3QUMB 4U05A 1G7IA 1YECH 3TIDA 3G5VB 1JGVL 4M6OL 4F7CB 1KB5B 1YQVL 3LKPB 1VPOL 4DN3L 1NAKL 5C0JB 4BFIB 3WLBB 1BQHA 1A9BB 2IPUG 4BQCA 4KMTL 4C56E 3QDJA 4XXDA 3SDYL 3TA3A 4IOSD 1T1XB 4PR5A 4ZTOL 1X7QB 2X89A 3H3PH 3E3QC 1L7IH 2P46B 2QSCL 3UYRL 1TTGA 2P49B 5DJ0B 3TN0A 4ZS7L 5CFHA 1NBVH 4AM0B 4F9PC 5C0NC 3X14B 1MHPL 4Q6YA 3U7AA 3LIZH 4JANA 4WUUE 4XC1H 3U4EA 3OB0H 3A6CH 3H9SA 2C7UB 3EIFA 4WCYH 5F6HJ 3WE6A 2IFGA 1E4KC 3UDWC 4NWTH 4NQDD 4ODUB 4PRDA 4XNUL 5KZCD 3CX5J 5TDPA 4RFNB 5C0CE 4KDWA 4QY8A 2WWKO 1A7NL 1NAMA 4ZOAA 1DQLL 5C0CA 4OTXH 2J5LB 1E4XI 5MEOB 4H8WL 1TLKA 2BSRB 4F7MB 3IDMA 2R1WA 4YK4B 5FO8A 4GG6B 2YD5A 2F53B 1P7QA 5BVJB 2Z31B 3UTTB 3X13B 4NFCA 4HMEA 3FQWB 3MNWA 4YQXH 3SGEH 2UZIL 4LFHG 1FZOA 4UZGA 1MF2H 4R3SA 2A6KB 3MV9D 5HJ3A 2FIRT 2MQCA 4I5BA 3T0AA 3X11B 4QRRA 3GSNL 4M61A 3BH9B 1OTTC 2XWBA 4PV9B 1ORSA 1INEH 1ONQB 1JZ4A 1I8MA 3KYMB 2X4QB 3HMWL 5LAXA 1P4IH 4PJBF 3RBSA 2UYLA 4G8EB 3TBVB 2DLFL 1WEJL 1S78D 2LU3A 1AC0A 1MQ8A 5I8CB 5GGQL 1QSEE 3WIHL 1SY6L 5B39B 4ALAH 4JRXA 5L0QB 5F3BA 2VISA 2ERJB 3MUGA 1I1FA 1CDCA 3LOWA 5C07D 1DQDL 4M7LH 5DRZB 3C9NA 5H35A 3EYOB 4R26H 4QRQB 5EC2A 1U2HA 3ABZA 4FQ2H 2FB4H 5DVMA 2X70B 4R97C 3FO2B 4ERSH 3RL1A 1KN2H 4XXCA 3WIHA 4NRYB 2HT3C 1UVQA 4PRBB 1QNZL 2VQ1A 2F19H 1PKQE 1UH3A 1TTFA 1DDHA 4MD0A 4MMXC 4KU1A 1FPTH 2D0GA 2BNRD 2NY7H 2NXZB 2PR4H 4ZFOB 5SV3A 2I60H 4XT1C 1TXKA 1N6QL 3W11D 1HILB 1MLBA 2RJMA 1TJHL 3DECA 1EUUA 1XGRA 4KI5E 4YHZH 4YXKH 3S36X 1N0XH 3GRWA 1ZMYA 3QUXC 4BH8B 1P5VA 1MI5D 4DQOH 1K4CA 5I8OH 3TFKD 2VL5B 3BZDA 4HKXA 4CKVX 1S9VB 3FONB 4LCYA 4LLQA 3FB6B 1X5XA 2P43B 4LL9A 1V05A 3U30C 3CH1A 4XPBH 3LKOA 1TENA 5DJ8B 2EIZB 4YEEA 4PRAA 2EDFA 2M26A 3FO9A 2BMKA 2J7LA 1J86A 1MJJB 3CDGA 1F90H 4QXTB 4CL7A 3FL7A 5LVEA 4KTYA 5I2IA 3MNZA 1BOGA 2DQUL 4HUUA 2OR9H 1G0XA 4PGBA 2DTML 3ULUF 1U42A 1PZUB 1DL7H 4OFIA 1XCTA 4GS7B 4ENEC 4XNUH 3M17A 3SCMC 3VGGA 3WN5B 5D7IA 5CEYA 3TZVD 3PNWA 2YXMA 5I8EA 4HXBH 2BVEA 1AD0A 4KXZH 3D5OF 2BC4A 2W0FA 4M02A 3P9MA 1QRND 4NBZB 1IC4L 4YWGH 3VRJA 4KROC 4WO4A 1KF9B 5DHYB 4I48A 5EZJB 3L5JA 4PJAB 1W8NA 1XGUB 5FHBH 1NLDH 2YSSA 2FJHA 2J88L 1KPVA 2GFBA 5FIEA 3U46B 4GRWB 4U0RC 4GAJL 2VLRD 2R0LL 4Y16B 5HYJB 1R5WB 2VLJB 4X8XA 3QPXH 1DBML 2OJZL 2C4XA 4KK8D 1JYWA 4PJHE 4Y4KB 1CL7L 1ZVHA 5HHVH 1TTUA 3UTZA 1JWSA 3EJYC 1XF2A 4J6RH 4ZPVB 1MVUA 3QUZA 5IEHA 2DLHA 5LGKA 3L5WA 1ZK9A 35C8H 3VGHA 2VO5A 4HHAA 1YMME 4KJQC 3LDBC 3L3OA 4JG1L 3UX9B 4PRPE 4NKOA 2W60B 1JBJA 1U3HC 2BVOA 3GZKA 1IKNA 3GMNB 3HZYA 1SBSH 4FP8H 1YEGH 3D39D 2E7HA 1WAAF 4QTIL 5J8OA 5FFLA 1MWAB 4K3JH 3AS1A 2OP4L 3OKNA 3IAPA 3VXOA 4TOYH 2RCSL 3DGGA 5FYLD 4DW2H 1T89C 1GSMA 3C09C 3OAZK 5EZOL 1I3UA 2Y36L 1K6QH 4NBYB 1MI5B 5EU5A 2J8UB 5E2JA 4DK6A 5ADPH 4XAWL 3KNBB 3RVWC 2YMXL 2DQGH 3VCLA 43C9A 3QWRD 1CICC 1E27A 1I7UA 1JJUA 4HFUL 4NNXA 4IMKA 1UH2A 2ADIA 4JY6B 1P7HL 1KXTB 4ZOEA 5I8OL 3BPNC 5IFAL 1WVZA 2FSEA 5HVGB 3X17A 1MOEA 2D7OA 3EDDA 3N1GC 5LWYH 4JO1H 5DHVH 4PGJA 2VZOA 4OD2A 4LBEA 5J0BA 4TUOB 3SDAA 4L4VD 4K23H 1N5AA 1G7PB 1X5FA 3L3JB 4JPVH 3T0ED 2V7HA 1YN7A 3ZZ1A 1NGZB 2XTJB 3UMTA 1HHIB 3MRKA 1QFWL 1VFBA 4Y1AD 5BXFB 3L3GB 5C07E 1S3KH 5IJKC 2FSEB 3Q48A 4QWWD 5J6HB 1JVKA 2EIBA 3U79A 4EVNA 1L6ZA 4QRRE 1Q9LB 5D7SH 2DTMH 2ATPA 1I7UB 3PWNA 1CE6B 5I1HL 1J0YA 3DGCR 5T1LA 4X6DB 4XCYB 1HHGA 5I18H 2X40A 3EBAA 4FZ8L 2UWEF 1OD9A 1ZT1A 1BGXH 5F9OL 2UUDH 4KJYA 3EJZD 1GGIH 1KJ2B 1J0IA 3IRZA 1KJ2L 3P4NA 1XCQB 4YXLH 3ARBC 3LRSB 3BN9C 4XVSH 1Z5LA 3P77B 3D25A 3QXDA 3OKNB 5IW6A 3DTXA 1JTTA 3TA3C 2GITA 1WBXA 3T3ME 3QIUB 1F00I 1YECL 5T1KD 4BZ2L 3FQTA 1UZ8A 3EO9H 4PRIA 1FO0L 2BVOB 4IDLA 1KCVL 1BFOA 4Y5VA 3GI8H 1QFUL 5E08H 4D3CL 3KPPB 2FL5B 3CPLB 3GMOA 4XNXL 5KBNC 4G9DB 3L3OB 5IIEA 2VDNH 4QCIA 5C6WH 4NKIH 5GJTH 2ITCB 3LD8B 4PJGE 1EVTC 1QA9B 1JWUA 4J6RL 4NQDE 6FABL 4KKAD 1KPRA 3STLA 2EE9A 3RWDB 3UTPD 2AJYL 4KZDH 3KWWA 1FV1A 3D3VB 4HS3B 4IRZH 4K55A 4DCQA 3STZB 1JMXA 3K3QA 4HZLA 4DN4L 3QULA 2W92A 3EDJA 4BFBD 4WENB 4N8VA 4JZJB 4PB0H 3SE3C 2VN4A 2R1XA 1QR4A 3MGTA 4O51A 1HHHB 2GTZB 5I17A 5IT2H 3HPLB 4D0DB 3RNKB 2B5IB 2P8MB 5C1MB 1KACB 4U1LA 5DMIL 1NC4D 3A6BL 1XGPA 1MWAL 1CDBA 2EYTA 4XMKH 3HI5H 1J18A 3WLWD 4OLZL 4XNQB 4MNQB 2WP3O 3DX8B 3O4LB 5J57B 1P4LB 3ZE0F 1LWRA 3QDME 3SGDI 4APQD 2ZCKH 4KRPB 2HVKB 2ZCLL 1K4DB 4RGNB 3WN5A 5DZNA 3S8WA 5BJTA 2BSSA 4J3WA 3RJQB 3GJFH 2DQEH 2NY2B 1QFPA 4L8BA 3VWKD 4F8QA 4ZUSA 4FXKB 1JN6A 5CHNB 3BN9D 3ETBF 3MLZL 3FB7A 4WTZG 3O9WB 1KSRA 1R5IA 4PJ7F 3T4YB 1GXEA 1YZZA 4NRZB 2AKRB 3O3BA 1UYWH 5CJXC 2XPGB 5GSVA 4PJ9C 3FB6A 4LCYB 4LLQB 1LVEA 4ZYKB 3K8MA 1KLFA 3MOQA 1EMTL 4JLRB 4PLKD 3MV8E 1T3FB 1MCPH 1YNLL 1KCVH 4W6YB 1R3HB 2NMSA 2Y07L 3UYOD 2AQ2A 3FB7B 1S7UB 1YEFH 3HFMH 4JY5L 1P5UA 5CGYD 5CMAB 5SX5H 2PR4L 2CMRH 1C5BL 1CTNA 4YIQA 1HINL 1D5IL 5ISZE 4NOBA 1WCBB 3RBGA 2HFFA 3FOMA 1FYTE 4Z95H 3UTSD 1KOAA 3AREC 3MLXL 2NR6C 1P4LA 5ABDE 3DX8A 4W4OC 3REWB 5EU4B 1EVUA 2X70A 5TF1H 1GHFH 4ZUWB 2YPLA 4ZFGL 1CT8B 3LZFH 4A6YH 2YHGA 3O6LL 2VC2L 1HQ4A 1GJIA 4BZ1L 2IG2H 3MGTB 1B6DA 3D87B 2D0HA 4NKIL 5GJTL 3DHMA 4JRXB 4QT5A 2X1QA 4TSBH 5D1QC 4Y5XC 1FG2A 3QWOA 4PJEF 3VXUD 4YE4H 1OAQL 5IEKA 4YUEH 3N85H 4LPXA 2OTPA 3C87A 2VLKD 4OCXH 5ID1B 3BESR 4I18A 1NMCC 5H37G 3P0YL 4P2OD 4P46A 1H5BC 3TM6A 1ORQA 2XWBB 3S34L 1LE5A 1X4ZA 3IDNB 5GISH 5IMKA 2W91A 1FORL 2Y5EA 2FHCA 5FDYA 2KBGA 1HHKA 2X4RA 2DQCL 3ARZA 3KPPA 1J1OL 3RTQA 3QJFB 3QAZC 3DYOA 4HX1A 4MAYC 4Z7QE 4PRIB 2NZ9C 4WW1A 4Q9CA 3SQOH 1S5IL 3PJSA 4S1DD 3ZSTA 4ZUUB 1DBKL 4I3SH 4Q9RH 2J6EA 1Z5LB 5M7QA 3LHPH 1YEEL