4KUZH

Crystal structure of anti-emmprin antibody 4a5 fab in trigonal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGGINPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARNDGYRGYAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords antibody 4A5 light chain
publication title Structural evidence for a constrained conformation of short CDR-L3 in antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 35
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH02
1KIQA 5KSVA 1J1XL 3OJDA 5KOMC 4FG6D 3TNNB 5E6IB 2WQ8A 1D9KD 1XZ0A 1MRCL 1K8IA 3O6LH 5BZDB 3C8DA 4JG1H 4FZEH 3PP3K 4X6CB 1NSNL 5IHLB 4BH7A 4BZ1L 1C12A 4L4VE 5H35A 1MFBL 3GMRB 5CCKL 4KMTH 4M5YL 4MDJB 2CIKB 2G75B 1F5WA 3KYKH 3LY6A 3MLVH 2YD7A 3KPLB 4Y2DB 1I9JL 4JFDD 3QHZH 3EO1B 4FHBD 4OFVA 3BFOA 3BP4A 4HUWB 3HTLX 2XWBA 4Q0XL 1TQCC 2BXZA 5T5FH 3VCLB 1UADC 4NC2B 3GDBA 3X11B 5IEKA 2UVEA 1IRAY 5FA4B 1KPRB 1WUNT 4FQ2L 1ACYH 1NMBL 3BN3B 2J8OA 1X7QA 4KKLC 1C7SA 1HIMH 2GFBA 4D0CB 1PG7W 2AEWA 1KGCD 2CIIB 3E0GA 3GO1H 4JJ5A 5GRUL 1LO0H 3K8KA 2W65B 1HHHB 1KCSH 4HPOH 3HUJB 2X4NA 1MHEB 3VG0H 3SOBL 1XF2B 3ME0A 3HG1D 3P3YA 3WLWD 3VWJB 3BP7A 4IIQA 1HNGA 2DM2A 2X41A 4NN6C 4HS6B 5IOPB 3ZKQD 3ZKXB 2BVEA 1IGIL 5GS1C 3NIFE 3VFOB 4ZUVA 3U4BL 3L5WA 2EDOA 3STZB 2DYPA 1GPOH 3C08L 5E9DA 3CFKB 3PL6D 5EUOB 1GGCH 5F9WB 4BK5A 4NZUL 4P4KB 4UDTA 4YGVB 4U05A 4XB7A 1FE8H 4NRYB 1NGZB 5BVJA 4BJLA 2IFFL 4NQCB 3ZZ1A 1KB5H 1CWVA 1V7ML 5T3XH 3RJDA 3OKDB 4M1GH 5TF0A 4R2GB 1Z9OA 3SQBA 1XF4B 5JUEL 3IJHA 4CU7A 4APQB 4F58L 2W91A 3MRFA 4JN2B 5BRZD 3TBTB 3AMLA 3V0WL 1YMME 2NY5L 3TO4A 4RDQF 3Q6GH 3MZTA 3QUKB 5B3JF 1HWGB 3MBXL 2ICEA 5FB8A 5HHMB 1A6VH 2BY1A 3NZHH 3PDOB 5JORB 4HJ0D 1AD9B 3QEQA 1X5XA 2PYFA 1KIQB 1YNLL 5KSVB 3OAUL 1AFVL 4H88L 2JELL 2FX7H 3H2WA 2R8SH 5GGRB 2E6JA 3GB7B 5JXEA 1I8MA 1XZ0B 4NZTH 1A7PH 4K3JH 5T3XE 3P9WB 5D2LE 3EO0A 1T03H 2FEDC 4WO4D 3QHFH 4H8WL 4BH7B 3MRNA 3VGAB 2FZ3A 3TO2B 1HDMA 3L3DA 3DXAD 4LCUA 4YUEL 3O2VL 1WEJH 2Y07L 4NQED 3MLSH 4WHYH 2ATPA 3EZJB 2XWBB 1GL4B 3PGDB 4N8CL 4RFNB 5KS9E 3MCKB 5E99H 5IEKB 1RULH 3OF6A 1OARH 4JKMA 1U8NA 3RQ3A 3ZDXE 5EOQL 2VLMD 1MAKA 3O0RL 4EOWL 1IKFL 2GK0B 2BNQD 1OAZL 1G7IA 4NPYA 3G9AB 2GFBB 2R0KL 4QRSB 4JJ5B 1PVHA 3QUZC 1OLLA 4AT6A 4LLUA 3MFFB 4XMPH 3D2UA 2X4NB 2KBGA 5DVOA 2XWJA 1S3KL 1HSAB 4PLKD 4F9LA 2H2PC 3BP7B 4JDTL 4IIQB 4U49A 1KJVA 1UM4L 4Y16A 3FB6B 5DRXA 5I74C 4JAMA 4W70A 4IBLT 2BVOA 3TF7C 1LP9A 3QWRA 3HE7B 3WJLA 1FAIL 1ES0A 4WUUD 5SX4H 4WU7A 4ODHH 3L5WB 4KDTA 3MJ8A 3W82A 2PXYA 5GS0L 4PJ7A 2B0SH 3T4AA 1T0NA 4Z7WE 1UZ8B 4UDTB 3GZKA 3KPRE 3HCVA 5DYOA 2ICWA 1JHLH 1A2YB 3FO0H 2JJTA 5BVJB 4RMVA 3ILQC 1RJCA 4NJAH 5KSAC 5IVXA 4WW1B 5CGTA 1PBYA 4PJXF 5E8EB 2C26A 4FOMA 5TF1L 4NQDD 3MRFB 1D5IH 5C9KA 4I3SL 2YK1L 5C09D 1EH9A 1QSEA 4PJGF 4XTRD 1KCVH 5BO1L 1JGLL 2SEBB 1ZT7A 1BQSA 3QJHA 4GBXD 2F5AH 2HYMA 2D4DA 2RIKA 2ICEB 5I30H 1EHLL 2FRGP 4U7SA 1HYSD 5KSBF 2QHRL 1BLNA 2OXGA 3QEQB 4DWHA 4HUMB 3NPZB 2F19L 2PYFB 3ESUF 5CZVH 1G1YA 1U91B 4EIZC 2JJSC 2D4FA 5D1ZD 5ITBL 1Z2KA 3QAZB 1OTTD 4HS8L 2VLJB 1SY6L 1LWRA 3IKKA 1L7IL 5DJYB 1NGYA 4XBPA 4ZFGH 1S5HA 3EO0B 4HBCH 1BBJA 4C55A 4OV6F 1JUFA 2W0KA 3MRNB 3QUMH 4PB0H 5EU6E 2R56L 4KK9D 1B4JL 4KROB 2X70A 5E5RB 3AM8C 1INDL 3BX7C 4HD9A 4OQ1A 1OGAD 3MXVL 2AK4D 3UTTE 3VFTA 5EB9A 1F90H 1QSFA 1EV2E 4KTDH 4RRPA 3U0WL 2BP3A 4WV1B 3OGCA 4S11A 1X6NA 4X99A 5B21A 1U8NB 1EX0A 4EUPG 3WEXA 3HNSL 1G7IB 4YDLB 1CIDA 4NPYB 3C60D 4PRPD 1KPVA 2YD5A 1RZKL 4JDVA 4AT6B 1U3HA 1DQLL 3D2UB 1CN4A 1AI1H 1MEXH 1WF5A 4ODBD 3SDAC 3WLBB 2YN5A 4P2QD 1RUML 4JAMB 5EUKA 1EEQA 2OK0L 1BWMA 2BVOB 3E6FB 5J12B 1LP9B 2X4SA 3IAQA 3Q1SH 4S2SA 1ES0B 5DC4B 4JB9L 4WU7B 2DL9A 2XNAB 5HHOE 4C54A 4J23A 4HCRL 1Q72L 3MJ8B 1HINL 2BDNL 2YPVL 5C0FB 2PXYB 3ZE1F 3VI3F 2E6PA 3O6FB 4PJ7B 3T4AB 4XAKE 4R26L 1HHGA 1Z6JT 1FH5L 3S35X 3HCVB 2ICWB 3BEVA 4MLIA 1YEDA 2CSPA 2HVJB 4FA8A 2NXYC 3WIIL 3TT1H 3T0EC 4ZD3L 4U1GC 3CX2A 4HFWB 1VFOA 2MPAH 5J56B 3NIDF 1KACB 1IAII 1ZT7B 3KVQA 5ALCL 5F1OB 3AS1A 5DFVD 4HWEH 1J11A 1S7XB 4G3YH 1GOGA 5CJBA 2VDMH 1BLNB 1P69B 1KEGH 3JBG7 1RIVL 1CYGA 4PRIE 4LDLB 5F9AC 5CUSH 3EYVA 4J3OC 1I9RH 1C5CH 4LASL 2I60L 4X6FA 1YQVH 1NGYB 4XBPB 3WFBL 1A6AA 1BBJB 3RA7H 5IBLD 2VQUA 2VXQH 1JUFB 3QIBC 3VRIB 3WXVL 3QWOA 2RB8A 5E6IC 1UACH 1HH9A 4MNGE 3S96A 4C83A 3MLUH 3VFTB 4PJFF 1KXQE 2IJ0C 1J0ZA 1YC7A 1QSFB 5M95B 4X6BB 5HGDA 4P2OD 1NPUA 3PHQA 4LCWA 1CGSH 1MREL 3IDYB 2ED7A 3EYUH 3VXMA 1CLOH 4NKQB 4PPTA 4OLZH 3ARVA 2HG5A 3IDMB 4NZRL 3RWCA 3WEXB 4M1CD 4RAHA 2EH7L 4JANB 4UT7H 5ILTL 1KPVB 2DKUA 3ZHKA 1CFQA 5I1EH 1U2HA 2VMFA 4I9WD 4JDVB 5D1XB 43C9B 1U3HB 4JVUA 1YEKL 4K71B 3X12B 1BM3H 1IT9L 3MUY1 4MHHI 2EDQA 2GSIA 4NWUH 1FC2D 5GGSB 5EUKB 4KY1H 2VKWA 1AQKH 4HMCA 4S2SB 4MX7A 3KPSA 4M62L 2MCPL 4K55A 1JGVH 3OX8A 3PQYE 3RKDD 4CN4A 4HK0A 3VWJC 1ZE3C 2A1WH 2K9UA 3T0EE 4O4YL 3EYOA 1UM6L 4AQOA 2VDLH 1I9EA 2VDOH 3KXFD 2DLIA 1HHGB 4I0CC 3LQAC 2APXA 3OR6A 3BEVB 4LFHD 3UCRA 2CXGA 5BV7C 3CGTA 2R29H 4L9LA 3FQXA 4Y4KA 1KC5H 3R8QA 4R7DA 2XICA 2WANA 2XA8L 4P4KC 3W81A 3VWKD 1LNUA 4OSUH 3MJ7A 3UJIL 1QFWL 3WCYA 2N4IA 5AAMA 4DUVA 2ZCKL 4EN3C 4PJ8A 2R2CA 4I18C 4M43L 3MRGA 4PP1D 3TBYA 4R2GC 4WFEE 1WFNA 3SGDI 4PJXA 5LBSL 4A6YA 5GSVA 3F62A 3UTSA 1EPFA 1AR2A 2APFA 4KRNA 5SX5H 4OFYD 2B5IC 5DMGD 3STLB 1HQRB 5DD5L 1FORL 3NCYP 1A7QH 3EYVB 2UY7A 5F3HA 4K3HA 1YYMH 2C9AA 3TJHD 2DS4A 2VXVL 2BSSB 3KYOA 2FIKA 1DN2A 1HSBA 2ZSVA 4ISVA 1S7TA 1AGDA 3T0BA 3QWOB 5DJ2A 1RMFL 1U8MB 5E7FA 1QFUL 5J3HC 1F8TL 3S96B 1H3XA 2DM3A 2D7QA 3SE8H 3BT2H 2ADFL 5ESVA 3B5HA 3LQAH 2ZUQB 4D2NA 4F57L 1OAUH 5BV7H 5HGDB 3ALXA 3PHQB 4LCWB 1AGFB 5IROA 2AJZB 4MAUL 4IRJA 2HG5B 3AVEA 4FQPA 1MHHA 3FONA 3RWCB 3MLWL 4XPTH 1T80A 5HYSG 1H8SA 3RKPA 3NZ8A 1ED3B 2EXWC 5DZOA 4AG4L 4RZCB 5IQ7H 1CFQB 2WINA 4RFNC 3QIUA 3NFNB 5FV1L 3O6LL 1BPVA 4I0PD 3WFHA 1X6LA 2V5MA 4JG1L 5AEAA 3S37X 1KLFA 2GSIB 4FZEL 4XC1L 1MCNA 2DLEA 2WWKT 3CVHH 5SWZA 4KK8D 1A3RL 1N6VA 1VEPA 1J05A 2JF1A 4JRXD 3KYKL 3MLZL 4QWWD 4MX7B 3KPSB 1U95B 3ECBA 5F8RC 4GT7A 5HGHB 4DCQA 4N0CC 4YDKL 5T1MB 4HK0B 1S5IH 2NXZC 4IIQC 3S88H 4QRQA 3V5HB 1A3QA 4EVNA 4NQCE 4JLRA 4NNYA 5IB1A 1CLYH 1SBSH 4OF5A 2E9IA 3S3PA 3HNVH 2HN7B 1JGDB 4JFEA 1A9BA 3BPOB 5C0AD 3UXFA 3BKYH 1HIML 2ATKA 3FQXB 4Y4KB 3RVUC 3GO1L 4R7DB 1LO0L 4U33A 4YHOH 4U7KA 3MJ7B 4HPOL 2VLKA 3VG0L 5JOPE 4LF3B 5D7LD 4PJ8B 5IM7A 1FHGA 3TBYB 3T0AA 4PJXB 1UKTA 4A6YB 5GSVB 5GGQH 3P77B 3P4NB 4JQXA 4LHUB 3RWHB 4BKLA 3PXJA 1DBKH 1W72A 3TO4C 5F3HB 5HYJB 4AM0B 2WBWB 2GY5A 1GGCL 1HSBB 5H37H 3PP4L 2ZSVB 4ISVB 5KSBB 4Y5XA 3ZT7A 1FE8L 1KN4L 1ZXQA 2B2XL 1AGDB 4U4BA 4EEEA 4TRPH 3NIGE 4G8GD 1KB5L 5A2KH 3TZVA 1WSST 5T3XL 1HHKA 1NGXB 3K8MA 5JXEC 4HDIA 1AC0A 4ZOEA 2ZKHH 5HYQA 4X7EC 5E4EB 2QSVA 2CH8A 4JPVH 1BVZA 1CU4H 1MCOH 1NMCC 4YC2C 4KROC 4CU6A 3N1QC 3B83A 3VXSA 4X98B 3MLXH 4TQEH 2NTFA 4TPRH 2IQAA 2HLAB 2ZUSA 4IRJB 1Z3GL 1A6VL 4HXAL 1MHHB 2Y7QB 3FONB 2VDPL 3C8HA 4PJFA 1R5WB 5E94A 1PJ9A 1KCRH 3NZ8B 2FX7L 3V5KA 2R8SL 4PG2A 4KDWA 4MCYB 3VFWA 2ESVA 2X7LB 2YPKB 2BY0A 4NZTL 1UM5H 4S10A 3B9EA 1GC1C 4OLEA 5DDHB 3WFHB 5C6WH 1T03L 3BIBX 5F44A 2AQ1A 5I1HH 3EDJA 3QHFL 4I77H 2AJXL 1J9CT 4YDLC 4M3KB 4YFLI 3UPRB 1TZIA 2FJHA 1J05B 2PETA 4GAGH 3QI9B 3BP5B 2YMXH 3UZQA 4J2XA 5E9DE 3ECBB 2BHUA 5DHXB 3RVTD 2DQCH 2V5TA 2VRAA 1T4KA 4DCQB 1EFXA 5INCA 4F9LC 1JPGA 4QRQB 4CGTA 4Y16C 1S7WA 4EVNB 1U3JA 3WJLC 1P1ZA 1BQLH 3QBTB 2W59A 3DWTA 1CG9A 4JLRB 3EW3B 3QDJB 4KDTC 1XR9A 3VRLE 4L1HA 2PXYC 5E24E 1EUUA 3BPLB 1RJZA 3LD8B 1MFAH 5GGUA 4KDVA 1DBBL 1AGCA 2NX5D 1FP5A 2HLFD 2E27L 2JJTC 3BRDA 1KLUA 4LVEA 2FECI 3QNXB 2WLYA 2H41A 2W0FA 3QEQE 5MHSD 2V6HA 3D3VA 3HMWH 2IBZX 4YX2L 3WD5L 5LAXA 4X9BA 1YDPA 3IT8D 5J89A 1JE6A 4ODHL 1GC1H 4AIZA 4Q2ZA 2ILLA 3EDFA 5FYKH 3CSYA 3VGDA 1W72B 4JQVA 5BMFL 2B0SL 2VZUA 2EC9U 3S35H 4EDXB 2GJ6A 1A64A 2J6EH 3FTGB 4X8XA 1EAJA 1KXVC 3FO0L 1PKQA 2VITA 4PJ9D 1NCAH 1OT2A 5TQ2H 3THML 5TQ0H 2EYSA 4NRZA 4QLRA 4HDIB 2DLTA 5EZLA 5HYQB 3KNBB 4HWUA 2Q6WB 5IIEA 3SE4A 1KIPA 2HRLA 3QG7H 5JZ7D 3C2AH 3VXSB 3G08B 4L4TA 2PW1A 5F9JA 4MMXC 2F5AL 2NTFB 2IQAB 1E6JL 5I30L 5JTWA 3PJSA 3WE6A 4PJFB 5E94B 2JIXD 5CZVL 1XF5A 2UZXB 5IT2L 1I3VA 2IH3A 3SDAD 1AJ7H 2ED9A 3T2OA 3MLTA 4R4NC 3VFWB 4MS8D 1LQSR 3GSNL 3O2DA 3TIEA 1II4E 1W0VB 1YUHA 4JPWH 4ZFGL 4OM0H 4CW1A 1IEAA 1GGIL 2QQKL 3K4ZA 5L6YL 2FR4A 2FJHB 4LLVA 3S4SG 1AC6A 1TTUA 1G9NL 1U3HC 4LKCA 2Y4SA 5EIQA 4LK4A 5IMLA 5ANMA 4OI8A 4MA7H 4PJ7E 5ACZB 1E4XH 1T7VA 1EFXB 5INCB 1EGJL 5CHNA 1JPGB 4KTDL 4MD4A 1TXKA 4OT1H 1S7WB 2Y5TA 3QNZA 4OBRA 1BD2B 1P1ZB 2NXYD 3PWJB 5L7XL 1CG9B 3LPGA 2NY6B 4JE4B 2FJGA 3SKOA 5IVXE 2ZUYA 2EDXA 1XR9B 3ZT6A 2ORBH 3E1F1 4Q6YA 1MFEH 4QO1A 3GSNB 4ZTOH 3QT2A 4MNHB 1KELL 2XZAH 1QSEE 4NUGH 1R24A 3MNWA 1H8NA 1AGCB 1A7NH 3B3IA 3ARUA 3CVIH 3G9VA 3QDGA 1AI1L 1KLUB 2YKLH 1ORSB 4WEBH 3ARYA 2CKBA 2EDRA 4O9HH 1VGKA 3RWIA 5C0BD 1A5FH 1X5FA 3D3VB 1KJ2A 1YY8B 3MRQA 5H94A 1FYHB 5LAXB 5FHAL 3Q1SL 1YDPB 3AY4A 3GBNH 3L3IA 1LK3H 4JZJA 4YWGH 2X40A 1OP3K 2GKIA 4AIZB 4Q2ZB 4NZDA 1ORQB 3FAXA 4WFED 2BVPA 2MKWA 4WFGE 1X5ZA 1S7VA 1ZVHA 1S9YB 4UT6H 3RWGB 1I3GH 3JWDC 1CR9L 2GJ6B 1ZS8A 2FX8H 5EO9A 1NQBA 1S8DA 3QDAA 4NBYB 1EAPB 2J8UA 2NY0D 3ZHLA 3UC0L 2EYSB 4NRZB 3WN5A 1UZ6F 1QSFE 4OJFH 1BQHG 1NC4D 2DQJL 4Y2DD 1UVQA 2XTJB 5IIEB 2GSGB 4Z7UA 1J8HA 3JUZA 2WUBL 4EDWL 2PW1B 5F9JB 5ETUA 2ZZUT 4HWEL 4GS7B 5HHNA 2VDML 5IQ9B 3FT4A 4TUJA 3WV0A 1LE5A 5DS8B 2ZUQC 5FOBA 4K94C 1J0YA 2IQ9H 4O51A 4HV8B 4QTIL 4KUZH 4YNYA 5DC9B 2N56A 2EDTA 1WGOA 5IHBA 4PLNC 3MLTB 4FXGA 5GGTA 1I9RL 4KKCD 4WFFD 3ARFD 1YUHB 3IXTA 2OR9H 5F7EL 1QKZL 2VXQL 4YZFF 1A4JA 1U8JA 1ZT1A 4LLWB 2DD8H 1OD9A 1XT5A 5TPWL 1UACL 2WWMD 5GPRA 5MEOA 3TN0A 3JWDH 5JHDA 5IMLB 5ANMB 4QTHA 1NBVH 3H3KA 3U36A 1IGFL 1WZ1L 4WHTA 5CHNB 2Z4QA 5F7YC 4MD4B 5KTEL 4AH2B 1VEMA 4P48A 4C59B 4AEEA 5CSBA 1I7TB 3EYUL 4CADB 4XNXH 3ARXA 2FJGB 5LXGH 4G9FD 2QL1A 3SO3B 3QDMA 3WHXB 4A2LA 1GHFL 5CWSA 2H26A 5DK0A 4UT7L 2GCYB 2HP4A 4F7PA 3GK8H 3MNWB 3S37H 4KJYA 3B3IB 4NN5C 2DBLH 5CJQH 5CGYD 4YXHH 4U2ZA 2ZUVA 5BW7A 4MZ3A 1MCKA 4APQD 3IVKA 4YQXH 3ISWA 3VD4A 3ROLA 4K3EL 4K94H 4NCC2 2CKBB 3DVNB 4ALAH 4L9LC 4ZPVA 4Y4KC 1MELA 2VSDA 4HT1H 3CLEH 5H94B 2NY7H 1JGEA 1ZLWH 4JZJB 1AGBA 5HHMD 2IBZY 2PUQT 5LGHH 4PJ8C 1F4WL 3EYQC 35C8H 4ZFFB 2BVPB 1S7VB 2J3SA 4KQ4H 3HC0A 2VDLL 4XVTH 2XZCL 4JFYA 4G8IB 3W11C 4WNQB 1ZS8B 4JN1H 2O5ZL 3VXQA 1PSKH 3MO1A 5DEGA 1NUNB 5I8EA 3VGBA 5KAQG 3TEUA 5CSZA 3GMMB 4ODTL 2R29L 4Z0BH 3WN5B 2W9EH 3MMEA 1OSZA 3TFKD 1UVQB 2RBLA 1KTDA 1I8KB 4LCWE 4D0BA 2X9XA 3F7PC 3VXME 1SEBA 4Z7UB 3E2HC 5AWNH 1J8HB 3BUTA 3VXRA 3AC0A 4YHZL 3LN4A 4O2CA 4GRLA 3J8F7 2JJWA 5HHNB 1SJVA 5E4EC 3VFRA 4TUJB 1KF9B 2CUIA 5FOBB 4O51B 1G1CA 2A0LD 2VE6B 4YNYB 2X44D 4YK4B 5K9KA 1A7QL 5IROC 5D7JA 4HZLA 1U9KA 5LG1A 1YYML 3P9LA 3N50A 4IRJC 1C1EH 3VH8G 1KTRL 1WBZA 3IXTB 4IRSD 3RPIA 5E95B 3H9HA 2LABA 4I48A 4CBPA 2WV3A 1ZT1B 3KPSE 1A6UH 1CFVH 2FYYA 5AZ2H 4N0CD 4JG0H 1X5KA 4MJ6A 1F11A 1D5MA 2X2YA 3CSGA 4CU8A 3TN0B 5EZOL 4TSAL 4A6YH 3HE7D 2BFVH 2LQRA 3L3KB 1G7QB 3LQAL 3U36B 4WHTB 2Z4QB 4WU5A 1J88A 5I16A 1JWMA 4XH2A 2RJMA 4KZEH 3L6FA 3UX9B 4U1JA 4F7EA 2BY2A 2RGSA 2QQLH 5FFLA 3VI4F 4PB9L 2H26B 4HH9A 4WI6A 2GY7B 1MIMH 3P9MA 5EU7C 3CMOH 4GRMB 2H45A 4AL8L 3HS0A 5IQ7L 2XN9E 1QFHA 4BSWA 3FQUA 2XPGB 3GI8H 3IFNL 2NY2D 2V7NA 1OAYH 1EXUA 1P4LA 1JF6A 3KPOA 5KJRH 1GAFL 4LRNH 1P5UA 3UTSE 4BFBD 1HXYB 4DVBA 3BPLC 5A3ID 4DN4L 3LD8C 4XNUH 5CEXA 3NCJH 4QRRA 4OCYH 1AGBB 1OTUD 2H2SC 1A6WH 4GFTB 3ZDZE 3FFCB 1F6LL 1G9EA 5GS0D 3K0WA 1GJIA 1QR4A 4QCIA 2VLJD 1T7WA 4JQXC 1A7OL 3CFDA 3VXQB 2HRPH 1N5AB 1MLCA 3IDJB 4XMKH 5DEGB 1KCLA 2CUHA 3L3HA 3HNVL 2WUCH 1QHOA 2BK8A 3QR2A 5CSZB 3WS3A 1QPPA 4KROD 4MVBC 1OSZB 3DX7A 5D6CA 2DLHA 3IU3A 3P73A 4Y5XC 1R3KB 1YEJL 5K33A 2X5PA 5GGVL 4EUPA 4H0IA 3SPVA 3TZVC 4X4YA 5I8OL 4H26A 3MLRL 1QO3A 4GRLB 4NO0A 1QHPA 3EIFA 5GHWL 3BKJL 3ARGA 3VFRB 5GGQL 3RL1A 1RHHA 2DQUH 5LCVL 3GKZA 3BRGC 2IPTH 4K8RH 1FNFA 5D7JB 1WBYA 4XRCA 1CGXA 5SWZE 2DICA 2I9LA 1WBZB 3RPIB 1GGUA 5DD1L 3H9HB 4PIRF 2XKSA 4I48B 1BVLA 4KUCD 4L8BA 2FYYB 2D03H 4TRPL 1ONQA 4PG2C 4MJ6B 2YHGA 4OZFG 5E08H 1L0YA 3HFMH 4HEME 3UYRH 5T3ZD 5EU7E 3WKMH 4UV7L 5TE7L 1EZVY 1ZGLP 1CU4L 3D85D 4LGRB 4WU5B 2WBJD 4L8SB 5C7XH 5I16B 1UH3A 4MGXA 3LS5H 3BWUC 3O6FD 1WCBA 3H9ZA 5JA9A 5DMIL 3CLFH 4JFEE 5DJCA 5T1KA 5K9QG 5J4MA 1X4ZA 4U1JB 4F7EB 4NSKA 3VI3E 5I1GH 4V1DB 3O3EA 4XNMA 4HH9B 1A9EB 2VLKE 3D39B 4I13B 1JI2A 3HS0B 1MVUA 4S1RL 2C1OA 3I3BA 2P4AB 3FQUB 2NY6C 2V7NB 2R39A 1P4LB 3KPOB 2EDEA 4KKNA 4I77L 5FO7A 3TA3D 2J88L 1HEZA 4N9OB 4GAGL 4PTTB 5CEXB 4QRRB 3S3SA 4PJCA 3KAAA 1L0XA 1HKFA 2DQCL 3NFSH 4XCFH 4ZXBD 3BW9A 3PE9A 3NABH 2Q8AH 4D0DA 3QUXB 2BNUB 2VC2H 1NFDF 4QCIB 2EIZA 3CFIC 5IFAH 1H3PH 4LFHG 5J7CC 3CFDB 1BQLL 4HGWA 1OD7A 1MLCB 12E8L 3WIHH 3OGOE 3L3HB 4XAWH 2QKIA 2Z0BA 1LK2A 4JQVC 5GRZA 1QFPA 3WS3B 4PJ5A 1OPGL 4X7CC 4NHUA 3DX7B 4L3AA 5D6CB 2HJKA 3P73B 1OWRM 3VXSE 2EDKA 4HX1A 4P2RA 2E7HA 1RK0A 2AEQH 3V8CA 3TBSA 1KEML 4LPUA 4X0KB 2OYPA 4PJFE 1QO3B 2IADB 4NO0B 1DQMH 4Q9BA 4XWOC 3PWUB 1DBJL 3ARGB 3HMWL 3DYMA 3NBNA 3RL1B 1RHHB 4PRHA 1ZHBA 3SE4C 2HT4C 4OKVB 2ESVE 4ODWB 1N4XH 5D72L 4FFWC 4GW5B 5FYKL 4BFIA 5DT1L 4U0RB 1WBYB 2ITDA 3S35L 5D1XD 1AXSB 1U3HD 3HNTL 2DAVA 2J6EL 2VXUH 4B7IA 2YSSA 3T3PF 3BPCA 1IC5L 4PJHA 1CD0A 2VLRD 5I0DA 2O5XL 1ONQB 2O93L 4M4PA 1XIWA 5TQ2L 3RI5F 2ZSWA 1FNGB 4M6ML 4GO6B 1WVZA 5JLZB 3KYNA 2EE3A 1IGYA 2R1XB 4X4XA 4R8WL 3BZ4B 4FQLH 3UDWA 4RCAA 1QUNA 1WCBB 4N1HB 3EFDL 5DJCB 5T1KB 4JKWA 1JNLH 3GJFA 3BJ91 4XC3H 1S7UA 2VXTH 4U1NA 5I1AA 4NSKB 5DSCB 3CC5B 4P9HH 4XNMB 4ZUWA 3NA9L 1ZTXH 1MVUB 2C1OB 2VJXA 2V17L 1MI5B 3SO3C 4BSVA 1VENA 3FHQA 4X9HA 3D3VE 1QLFA 4G43A 3RIFK 3F7YA 5FO7B 4FQIL 3BEWA 6FABL 1HEZB 2LU4A 1KSRA 3NAAL 5DGQA 1YEHL 4GXUN 3HAEG 4JRYA 5EOTB 2GJ6E 4FTVD 1CD8A 5D93B 3QFJD 1WZMA 2V2WA 4L3ED 2HFGH 2NMSA 1PKQE 3V6ZB 4HLZH 3QULA 3AY4C 4JZJC 4HGWB 3P4MB 2HKFH 5FCUH 1EEUA 3CDYA 4JHWH 5CJ8A 4MB4A 2QKIB 1LK2B 3BN9C 5E5UB 2C1PB 2ORBL 5ELIA 2ADJB 1MFEL 3D6GA 4HIIA 2XZAL 3N1GC 4MQXD 1JZ8A 4MD0B 4H1LB 1A7NL 3ULUH 1I7RB 2C3GA 4L4TE 4P23D 3CVIL 4P2RB 1FFPB 1RK0B 2E7BA 2YKLL 4Q9RH 3BXNB 3TBSB 3WDIA 1QYGL 1T7ZA 2D7MA 2VZSA 3C09B 4JPIB 5HYSA 4TSCH 3WN5C 3RZCA 1A5FL 5F21B 4RWYH 1TCMA 3IJYA 2MQ3A 2OI9C 1MCWW 3E6HA 4PRHB 2HAZA 3T65A 1ZHBB 4XP5L 4ACPA 2OJEB 3DYPA 1OWWA 3QXTA 4BFIB 5E03A 2EXYD 5IMKA 3SE3A 4JKPH 4W4OA 2ITDB 4F3FA 1JPTH 4ZSOA 1FSKB 1RZ7H 5HVHB 2YSSB 5A2LH 5D7KE 1UEMA 3LCYA 2FX8L 3C87A 3MV7D 5CINH 3BPCB 3DO7A 2APTA 2JTDA 5ANME 2R69L 2JJUA 3T0VA 1XIWB 2ZSWB 1KJMB 1F02I 1B3JA 5B3NA 1KJ2H 1IGYB 4X4XB 1NGQH 1QFOA 1WLHA 2YZ8A 5FDYA 2C3XA 2UWEF 1H15B 5EWIH 4ERSL 3WNMA 1NLBH 3TN0C 3DETD 1IC4L 3GJFB 2VQ1A 1S7UB 4U1NB 5K93A 3LSOA 3OKKA 4S1QL 3BESR 3OKEB 2IQ9L 5I73C 4KUZL 4V2BA 3HLAA 5E7BA 2MFNA 4OIIH 3QDGE 5E2WH 2EO1A 4KKBC 3V7AE 2B1AL 4G8FA 4UNTA 3MRHA 5I8CA 2OR9L 1FNLA 2VL5A 1QFWI 4BSVB 2YA2A 1QLFB 1RD6A 3EFFB 3RNQB 1EMTH 3MBED 2ENYA 2DD8L 3BEWB 4JREB 4OQTL 1ZVYA 4YHLL 5I8KH 2Z31B 5CEZL 2A9NL 5IB4A 3LHPH 1H3TA 2R2EA 1IMHC 1A3LL 1KPUA 5BW7C 1JYNA 3L5IA 1JRHL 1ND0A 4M6OL 3PGFH 4LHUD 1VFMA 1U2CA 5ISZD 1QSVA 3JZ7A 3HR5B 4G6AC 1I8IA 1LEGA 2EDJA 2V2WB 5GGTH 2YD9A 5HYJD 2J8UE 5J6HB 4Y4FB 2FHBA 4YDIH 5SV4A 4R90L 4XNXL 3ZE0F 5C0CD 1W0WA 5LXGL 1RIHH 3WUWA 3O9WA 4G6KH 1DANU 2DWDA 4NDMA 2OMNA 3VMOA 1R5VA 1QEWA 4HIIB 1KJ3H 4Z7UE 3GK8L 4ZO6A 1FYTE 2EDYA 5EIIA 2CLRA 3BGMB 1FZJA 5FDWA 4NO3A 2IC2A 4MQ7A 2DLFH 1I9IL 1TITA 3RZCB 3CDCA 3FRUA 3IJYB 1KOAA 3CLEL 4TN9A 1EVTC 3T65B 5D7IA 2BJML 5EULV 1NDMA 4HBQA 4UIKH 5KVEH 3L3GB 1SJHA 1GZPA 5HVGB 1L0QA 1DFBH 1RK1B 2E8YA 15C8H 5IMKB 1BF2A 3VJ6A 4GRLC 4U6TA 2XG5A 4EQ3A 5JA8B 5F96H 4K3DH 4JO3H 4ZSOB 4DUXA 3ARBA 2X4UA 4CVXA 1WQVT 3T2PA 4P4RB 3DTXA 4EZMA 3DO7B 5JHDE 4G6JL 4KQ3L 1T22A 4Z18A 2FSEA 1GXEA 1IC7H 5D7JC 4Z0BL 2HFEA 4HUKB 4OFIA 1A6ZA 1L9NA 3MGOA 3QI9D 5DTFB 1P9MA 3U30B 4PGZA 2JLLA 4FFVD 4KRMB 2XTLA 4W6XB 3UAJC 3BE1H 2AABL 4AK1A 3U1SH 2Z9TA 4K07A 5F7FA 3UPAA 5AWNL 3FQWA 1MLBA 2PTVA 3QDME 1BECA 2HTLC 3SDXF 3EOBB 5IVZB 2VQ1B 3QH3B 4W68A 3D0VA 3F58H 4POZC 1HQ4B 2QADB 3LSOB 1MCQA 3QDJD 3HLAB 3S6CA 3JTTA 4X5XA 4DW2L 4G8FB 1GRWA 3TIDA 3MRHB 1C1EL 4G7VH 3RVXD 3EUUA 3ZKNC 4F7CB 5I8CB 5FOJA 2VL5B 4NO5B 1CE6A 4JKKA 2FLRT 3B8YA 2KDGA 5SWSD 5L88H 1CFVL 2XOTA 3K74B 5AZ2L 5HDQH 4TOYL 4JG0L 3GRWA 4LSRH 3DHMA 1G7MA 5IB4B 4MJIA 2R2EB 4QRPA 1ND0B 3SGEI 2BFVL 3VFVB 1TTGA 1INEL 3I3DA 3HMXL 4WEUD 1I8IB 1LEGB 4G80B 8FABA 5BJTA 1NAKH 4TNVF 1JGUH 2AXJA 5CSGA 4ETQA 4ELKB 5EORH 2YUWA 2WP3O 1FGVH 3WUWB 1UXWB 3KLAA 3O9WB 3HI6H 4EXKA 3MOAH 2DWDB 4NDMB 1MIML 1R5VB 3IYLW 2PR4H 1NFDB 4QOKB 3VXRE 2P8LB 3GI8L 5EIIB 4Z7VF 2K1MA 4JQIH 4MA8H 5T33L 1FZJB 2CO6B 5FDWB 3GBLA 4QF1A 4MQ7B 3RI5K 4LSDA 5HI4D 4HSQA 1KTLA 2VXSH 3FRUB 1D9KA 5C71A 4YDJB 4HIEA 1NDMB 4PGBA 4ZDHA 3NFPA 5CKGA 3VDCA 4F8TA 4P49A 4ZMAT 1FV1B 1FDLH 3VJ6B 3QEUA 4LNVA 4Z7QF 5E2JA 5MP6L 2FH6A 4JFDA 3LH2H 3ARGC 3S4SA 1NFKA 2Q8BH 2CMRH 2WLZA 2X4UB 4OZGF 5FUZH 4BUGA 4H0GA 4CVXB 1CLZH 2R23A 1H0DB 3DTXB 3C6SA 2WUCL 3WDJA 1T22B 4U0RC 2FSEB 4TUOA 4KAQH 3WNNA 2HFEB 1FNEA 1XCQA 3MGOB 3VGFA 4AEIH 3IDXL 1O0VA 2LU3A 1OM3L 3MJGX 1JHKH 3UEZA 5CBAA 2MJWA 3FQWB 5ENWA 1MLBB 1H5BA 3T3MF 2P8MA 1JNHB 2Y5EA 2IBGA 4ORGA 1BD2D 4N68A 1T2QH 2UYLA 5E6ZA 2EC8A 1U8QA 3C5ZD 3HG1A 1A1OB 3IS0X 4ZS7H 1IGMH 2OL3A 1VEOA 5HTSA 4K8RL 5ID1A 3RNKB 1VKXA 4G5ZH 4C4KO 4J3UA 4CMHB 3TIDB 2EDNA 3GIZH 7FABL 1B9ZA 4OIAA 5L8KB 4KTEL 1S7RB 2VZOA 4QRRE 4KGLA 1V3JA 5DD6A 4FFZH 4W4NA 4EUPH 5FO8B 3PL6A 4P99A 3U7WH 3QXDA 3QO0B 4MJIB 1YN6B 1G9MH 1QLRA 1JBJA 3D3VD 4QRPB 3MACH 2H8PA 4YXKH 5SX4I 2ZOLA 3WKML 2DQHH 3GIVA 2HMID 4X6DF 2J12B 3CK0L 2CK2A 4UUJA 5T5NG 1EFQA 1CCZA 2F8VA 5BJTB 3CLFL 4F37K 3GMPB 2YRLA 2ZPKL 3O6MH 5BRZA 1YMHB 1EBAA 3KLAB 1ZA3A 3VDBA 3FMGL 5KW9H 2MMXA 5D93C 1J1OH 5FF6B 5J6GB 4RFOH 1Z5LB 5DUPH 3VFGH 5C92A 4DEPB 1F4XL 4GW4B 4NRXA 2GJZA 1I1FB 5TDOA 3DUUA 3JV6A 5ADOH 4PGDA 5JW4M 5JXAL 4EXPX 2XTJD 4JM4L 2VR5A 3SBWA 4Z77A 2V5RA 2DIJA 4NBZB 1KTLB 1RZJH 2M8XA 4I8DA 1D9KB 4RAVB 1GCFA 1JJUA 4OZIF 4HIEB 3MRPA 1G6RH 1FVCA 1VESA 2LE9A 5E8NB 1PQZA 3NFPB 4WO4A 2DM4A 3FB7B 3NFSL 3QEGL 4X7SL 3NABL 2YZ1A 4QHKJ 3QEUB 5ALBL 3S4SB 1H3PL 1XGPA 3KPNA 4NQEA 4MA3B 1IFHH 2ZUWA 4W6WB 1IL1A 3WIHL 1QD0A 3QPQD 5IR1A 3RIAK 4XAWL 4IS6B 5CAYB 4TUOB 4U1KB 1MCEA 1DTUA 3WSQH 3MSPA 5TFSL 1IARB 4M6NH 4I4WA 1RZIA 3BH9B 1FSKC 1BIIB 5F1KC 3UJJL 4LAQL 3CDGB 4QGTA 5CBAB 3QCUH 4M48L 4EBQL 2BNQA 3U6RA 5HSFA 4HQQL 5CJ5A 5EFIB 5ENWB 1XIWC 1AE6L 2P8MB 3G6JF 5CZXC 5ECJE 3V52L 1DQML 3HB3C 5F6HJ 4ORGB 3ZYJA 3UMTA 2XRAH 3OL2A 2UYLB 3S36X 4AEHL 4M7LT 3HG1B 2IPKA 4H5SA 1BF8A 2UWEB 4OF6A 2OL3B 2OJZH 3UDWC 2ZUUA 3RVWC 4NO2A 1EHXA 5ID1B 3MUHL 3BISA 3IGAB 3SDXA 4P5KA 1NMAH 4HIJA 3IETA 1QBBA 5FYLH 5DD6B 4PJCE 4YFEA 5IMMA 5F97E 5I0ZA 5IWLA 1AXIB 4MD5B 4GH7B 4BA8A 5IHUH 3QXDB 1S7QA 2HT2D 5DD0H 1QLRB 4L5FH 1SYSA 3DX6A 4I2XB 2H8PB 2YD8A 4DGYH 1TETL 2X89D 2ZOLB 4PRNA 4QXTB 3GIVB 4XNZB 1E4WL 5CMAA 2AXFA 4JREC 1V7NH 4UUJB 3L5XL 5JQHC 4NQDA 4XC3L 4PJ5E 5IGXL 2VXTL 4AJ0A 4XXDA 1RIUH 5C09A 4IDJH 2BMKA 1ZA3B 3GSWA 4O2FA 4P9HL 4Q9CA 4GBXA 4JFFB 1BZ7B 4P2RE 1YNKL 4OCXH 4ODVH 5FYLE 3P40A 3V8OA 3ZDYF 2GJZB 5TDOB 3DUUB 2OSLA 2DMBA 3MNVB 1C16A 4PGDB 4PRBA 1RFDL 3TYGH 1W2KT 4OD1L 2CUMA 4Z77B 2E3VA 2EYRA 1J8HD 4PRHE 5D1ZA 2EH8L 1U58A 3D9AH 1L7TL 4A2MA 3SCMA 3E8UL 1FVCB 2BRRH 3GJFH 1PQZB 4KJWD 4WO4B 1IQWH 5EG6C 4Z7VA 3CH1A 5HHXL 5BS0D 2IMNA 4MCZA 1KXTB 3RZCC 5L2KB 2YUVA 1OGAA 1RURL 1IAMA 4P57B 2AK4A 2VIRB 5I1CH 2FX9H 4M6AA 4HK3J 4PJHE 4PTUA 1XGPB 3KPNB 4NQEB 3FO9A 5FCUL 1IL1B 4KI5C 1Q1JH 2EKSA 4ENEC 5HD8D 3H42H 5T1DL 4QRUA 5J1AB 3SE3C 2OM5A 4W4OC 1HK6A 4I4WB 3A6CH 1RZIB 4YXLH 2VDKL 3MJ9L 3TN0D 1NCBH 1QBAA 1SHMA 3HPLA 4WW2F 3ULUL 3OV6A 2BNQB 4NYLA 5ESQB 3U6RB 2UUDK 3C60A 4PRPA 2ITCB 5FYJL 1EEYA 4TSCL 4M3JA 4RWYL 2OTUB 1CTNA 2I5YL 4EQ2A 3OWEA 3GSUA 1PZ5A 4LHQB 1WTGT 4P2QA 4H5SB 3MPCA 2HJFA 1S9VB 1TJHL 2EKJA 4JY6A 4JKLA 4ZO9A 5D5MF 4WTXA 3SDXB 4P5KB 4YBQD 1NGPH 2HFFB 1JPTL 4X4MA 3TBVA 1RZ7L 2QADC 4HIJB 1HNFA 3IETB 4Q97A 3AAZA 4NGHH 2YPLB 3LKNA 4OI7A 4D3CH 1CF8L 4LSVL 5F88A 2DQGL 2H32A 4HGKC 4JRYE 3MV9A 5B8CA 1S7QB 4IEFB 3VRJB 3C9NA 4XI5C 3DX6B 5BVPH 4YPGA 4YFLF 1NGQL 4NNXA 5J0BA 2V2XB 5CMAB 2D0GA 5EWIL 1F3RB 1OGTA 5D8JL 3FFCD 3U2SA 1NLBL 3WJJA 1QBLL 4JFQA 3LEYL 1OAXH 3I6LE 4OLXH 4XGZA 4XXDB 4RIRA 5C09B 1JF1A 2NY4B 2BMKB 2VABB 4GW1B 4O2FB 1SYVA 1IAIL 2ED8A 4GBXB 2YRZA 4CNIB 3RUGF 1MCRA 5E2WL 4GUPA 3GFUA 4PJIA 1C16B 2NPLX 4WDIA 3O9WC 1JP5A 5DJXB 1YYLH 2EYTA 5D1ZB 4FQJH 2D31A 3VXOA 3FQNA 1U58B 1I85A 5I8KL 4WIQA 4IOFD 4KI5E 3SCMB 5C2BH 1DQJA 4J8RA 5J57B 4IRZL 1HXMA 1T66D 2QR0B 4U1MA 1JK8A 4Z7VB 2LVEA 3MOBL 4ZSOE 3AS0A 5JO5A 4U1HA 5LWYL 3IS1X 1FFRA 4LEXH 5KVDL 1LO2H 1OGAB 1Y18B 4GKSA 2AK4B 4PTUB 5D7JD 1T7YA 4OZFA 1F6FB 4YDIL 3B9VA 4OZIA 4F2MA 3REWA 2R4RH 2EKSB 3UAJD 4G6KL 5GJSH 3KJ4C 4P2OA 2LTQB 1NBZA 1IQDA 4JO4L 1KJ3L 1CZ8L 1V8HA 3ARBC 4G7YH 1QLEL 4PRDA 1IGCL 1RZ8B 4OZGB 2AERT 4NYLB 4PGCA 1D6EB 1RZGB 4NKIH 3C60B 4ODUA 4E41D 5C0RL 2XKUA 2VLLB 3GGWA 1EEYB 2Y06H 2DLFL 5IV2A 4KK6D 4WTWA 4HF5L 4HS3A 1P9MC 3ZYZA 5DRWA 1F4YL 1MIEH 1G7PB 3GSUB 4F7TB 4UIKL 4RGND 4GAYB 1KBGL 1R5IA 4M5ZL 2CKNA 2EC9T 1GYAA 15C8L 4U3HA 1HZHL 4V1DD 4JY6B 3IXAA 4HUVA 5IKCA 4GQ9H 1ZLSH 3D39D 2KH2B 1OSPL 3ES6A 4FQHB 4JO3L 5HI3C 3M1BA 3KJ6L 3AB0B 3GSRA 2ZCHL 3SDCB 4OCSH 2Z92A 1ZEAL 1MCIA 3EDKA 3QJFB 1FC1A 3R1GH 2B4CL 2JB6B 2H32B 5F88B 1IC7L 3MV9B 3DVIA 5B8CB 4CMHC 3KXFA 2LU7A 3LKRA 4YPGB 3MUZ1 4NNPL 4NNXB 3ZKSD 3QCVL 4F9PA 1B6UA 2APVA 1RZFL 5FK9B 4LVHB 2Y1VA 1LEKA 1LDPH 5EC2A 1G0XA 4OGAC 3U2SB 1S9WB 3QUXD 4JFQB 3NCYS 2P5WB 3VWKA 2EEAA 1N0LA 3TCLA 1BP3B 2FATL 4WEMB 2ZJSL 3RTQA 1MJJA 3KLHC 2GUOA 1ZMYA 1NLDH 5D9SA 4X6DB 4MXVE 1VSCA 1EK3A 4NJ9L 2BCKA 4PJDF 2Z8SA 3B2VH 3QPXL 4OFYA 4WDIB 2I26N 4WENB 3HZMA 5J9PA 4S1SL 1IC1A 1W0YT 5HBBA 1MJ8H 4JFHE 4HHAA 5D7IE 3FQNB 4B0MM 4NWTH 4M7JH 4DEPC 1QRKA 5E5MA 2CRZA 4GKZA 4HJGB 4NO0D 1DQJB 4J8RB 3U4EA 5GISH 2DRUA 1HXMB 1NAMA 3HI5L 2OP4H 2EDBA 4Q9QL 3ZO0A 1VHPA 4FG6C 4FXLA 5E8OA 4RDQG 1D9KC 3PV6A 1G6VK 1A22B 3GSQA 4RX4D 1NAKL 4F2MB 4OZIB 3REWB 3P0GB 1T21A 1FGVL 2Y36L 3H3BC 4RFEA 5C0DA 3HI6L 4MNQD 1NBZB 1IQDB 4MA1C 1DQDH 4LLYB 2P42B 3GRWH 5FHBL 3W9EB 1BBDH 2PR4L 1CXFA 4UNVA 4U1IB 2LFGA 2MNUA 2GAZA 1TPXC 1MCLA 4ODUB 1TNMA 1JNNL 3GGWB 1OL0A 4Y1AD 4UIMA 1I7ZB 1U8IA 5DRWB 5C0GB 4I0PA 3KS0H 4HC1H 3DSFL 4CL7A 3KWWA 4K23H 3DURA 2VR9A 4LLMB 4WW2A 5HHPA 1WWBX 5E8PA 4Y5VB 1A1NA 4ZG1A 1H5BC 1FDLL 5EPMA 4JRXA 5IKCB 4FNLH 4LVNB 5C2UB 4JHAL 3ES6B 3G6JB 1ADQA 1K4CA 1ODAA 3LN5B 1MJ7H 3GSRB 2CMRL 3HR6A 4DAGH 1CLZL 1MI5D 3WLWC 2CLZA 4MJIE 4PJBF 5CIPA 2V7HA 4Z7OF 2Z92B 4QRPE 2D3VA 1QNZH 4GG8A 3MV11 3X14A 3U79A 4KAQL 3PWNA 4OF8A 1D5ZA 4XCYA 3MRMB 4KHTH 3DUHA 4L8CB 1B0RB 4RGOH 1ZHNA 1JHKL 4CJ0A 3OPZL 3W5NA 5IEHA 4R4BA 5C0AA 3PL6C 1FN4A 1I1AB 5EC2B 5BOZG 4HIHA 2H6PA 4UINH 3VGGA 1FQ9C 5CILH 3MNZA 3VWKB 4LHJB 5LKNA 1T2QL 4YHIB 5I15L 1YEEH 3HZKB 4PLJC 1SBBA 3TCLB 3GI9H 2F53D 3RTQB 5D7LA 4XNZC 3HC3H 3MTRA 2UZYB 2GUOB 4UB0H 5D9SB 3BKCL 3G04A 1N0XH 4WWKB 1WFOA 2AI0H 5AZEH 1OF2A 4FP8H 3PXHA 3PABA 5IHZA 2RFXA 1AR1D 3TPUA 4HHAB 1AY1H 1HHJA 4IHOA 3RUGA 4P3WA 4GKZB 1T1XA 3U4EB 4LSTL 2AEPH 1DR9A 4HJ0C 4LHUG 1G9ML 1NCDL 1U8OB 4WI8A 1NAMB 4YXKL 2O61A 4JFDE 3SBWC 2IFGA 4K7PX 1DEDA 2DIAA 4G8GA 4TSBH 5E8OB 2OL3H 1EERB 1JWUB 2A74A 3PV6B 4BELD 1YC8A 1U0QA 3GSQB 4U6HA 4XP1H 1DVFD 4JPKL 4WO4C 3O6ML 1W8OA 2A83A 2W60B 4RFEB 5C0DB 1WBXB 3BO8A 1U8PA 4IJ3B 1KGCE 5HYIA 3OKNA 1RAMA 5CJOL 2QEJA 1F6AA 4TVSa 1Q9OA 4OGXH 4N9GA 3ZHDA 4ZS6D 2FO1A 4UIMB 1RZJL 2VUYA 3MA9L 1T5WB 3BP6A 3HG1E 1U8IB 3BQUD 5I19H 4ZODA 4I0PB 4FABL 1WZLA 3HHRB 3H3PH 3KWWB 1G6RL 5HGAA 1CFSB 3DURB 5D4QA 5CEYA 5DMKA 4WW2B 5HHPB 4FZ8H 1NJ9A 4RSVA 5IB3A 1AIFA 5E8PB 1NCCH 1A1NB 2JK5B 5E2UH 1EEZA 5EPMB 2UZIL 2VN4A 4Q58C 4LSPL 4G6ML 3DX9B 3RFZC 4ZOBA 3IFLH 3G6AA 1IFHL 4PLKC 3BAEH 1ULVA 4UOJA 2V7HB 2YD2A 3O41A 1IZJA 3KYAA 3X14B 4NQSA 1J0KA 2NQCA 2Q7YA 1D5ZB 1FZKA 5D5MB 3IU4H 4NQVA 5I17B 2Z31D 1VGEH 2MOVA 5DJDA 3MRBA 4X7TA 1ZHNB 4PJEA 3MRRA 1E4XI 3QCUL 5IEHB 4R4BB 1FVDA 4HUXA 5C0AB 5IWLC 4HIHB 2H6PB 5BRZE 2P43B 2NX5A 3I2CH 3O4LD 4LPWA 4Y4FD 6CGTA 2R2HB 1FO0L 5D7LB 4N90D 2A77H 2OJZL 3ZE0E 3G04B 5FAAA 3BPNB 1CL7H 2MKLC 4P59H 4OGYH 1XGYH 2ZOKA 2NY4C 1NMAL 3PABB 4XTRC 5F1NA 2PNDA 5HDBF 4OCNC 3TPUB 1ETZA 4S1DD 4GBXC 5IW6A 2D7TH 2AXHA 2EICA 4IHOB 3RUGB 5CEZD 5IHUL 1HYSC 4WUKL 4WI7A 25C8H 4PJDA 1CGTA 2B1HL 4TUKH 2G5BA 1PYWB 4H25B 4ONHA 2O61B 4AENA 4OLUL 4PJ9A 5D1ZC 4G8GB 1OTTC 4NKOB 4NQEE 3UTZA 1V7NL 2A74B 3SCMC 3M17B 4PJAA 5I1IH 4WY7H 4U6HB 1FO0B 3RRQA 1H3WM 2R2BA 4OD3H 1AD0A 2A83B 4IDJL 4WI9A 4XZUA 4LIQH 2VLME 4ZUSA 5F9OL 3DBXB 5I75B 2BNQE 4ODVL 3BO8B 1H8OA 1U8PB 4LU5H 1FNHA 2JIXA 2R0LH 5J8OA 1S9KC 3TYGL 1JPSH 1RUQL 3T1FA 4XPFL 1F6AB 1OHQA 2W9DH 2LTQC 2G2RA 4N9GB 3RY6A 3V4PL 1U6AH 4J6RL 3NCBB 4Q6IB 5DQ9A 3ZE2F 1DL7H 1E4KA 5HGAB 3B9KB 5DO2D 1IQWL 3TVMA 3W9DB 2FO4A 1AIFB 1MWAA 3OAZH 1MFDL 3C60C 5DC0A 1I1YA 4WUUE 3SDXE 1TVBA 4HKZA 5C08B 2QJDA 3R06A 1PG7H 5I1CL 1FRGH 2HH0H 4KPHL 5E0QA 2KPNA 5MEQA 2DQTL 1Q1JL 5F7LB 2FHFA 4WFHD 1P53A 2GJJA 2BSRB 4NQSB 2Q7YB 4NCC1 2VDQH 3A6CL 4P3DA 5DJDB 1YECH 4KZDH 4HGMA 1NCBL 1C5BL 1X4YA 1FAKT 4N0FA 2K7PA 1FVDB 4NQDE 3T1WA 2RAMA 1HOCB 2NNAA 3MYZA 5C09E 5B8CC 4RGMB 5I6XB 2R0ZH 1K6QL 3I6GB 1HCFX 2DQFA 4UDUA 2IG2L 4M61B 4P9MH 4DKEH 1A4KB 2AK1L 5E8DL 1WAAF 2C3VA 2J4WH 2IBBA 5C0BA 3EDDA 3I84A 4UQ2B 3WJJC 5DJ8A 4DVRH 5T1LB 4QOKD 5IVNA 1NGPL 5E70A 1M4KA 2F58L 3PGCA 5CP3A 5F1NB 4NP4H 2AJSH 2HWZH 3EO9H 4NGHL 3B8SA 5DK2A 5IW6B 2MQCA 2DOCA 5DFVC 4LCCB 3TNNA 4Z7VE 4MJ4A 3GKWL 1BREA 3G5XB 3PWVA 4PJDB 3UZVB 5BVPL 1OGAE 2M2DA 3CU7A 2AK4E 4AENB 4HK3N 1EO8H 3NTCH 4K7PY 1I85C 3UTZB 5C0JA 3U0PB 1PZUB 1NC4A 3KPLA 4Y2DA 5IBLC 3U83A 1OAXL 2R2BB 4OLXL 2WIMA 4HUWA 3VXNB 4Z7QE 3V0AC 4ZFZB 4XNYH 4L8DB 4RBPH 4O5LH 1FG9C 2R4SH 3VCLA 4PRPE 3X11A 4AMKH 2JIXB 5FA4A 4TVPL 2DKSA 1TJIH 1KPRA 1JIBA 1S78D 2G2RB 1R3IH 2R15A 2BOCB 3L3OA 4P2QE 4D0CA 2CIIA 5DQ9B 2HFTA 3ARFA 5C2BL 4ZFOL 3MA7B 5TDNB 3VGEA 4Y4HB 5JIHA 4M1CC 4UILH 3TVMB 2FO4B 3OKLA 1MWAB 3EHBD 2VAAA 1XF2A 1I1YB 1IEHA 1CK0H 4X4ME 4HKZB 2VYRE 4XCCH 3R06B 4NUJA 4DUWA 1CXKA 2XZQL 4UAOB 1BJ8A 5MEQB 3DV6A 4DQOH 3MV9E 1M1SA 1FG2A 1WIPA 2FGWL 3ZLQC 3PWLB 2DKMA 3CFKA 2GI7A 3A6BH 5C0IB 5EUOA 4S0SD 5FO9B 2X1QA 1PEWA 2WBKA 1A0QH 2VISA 3B6SA 3BKML 1YEGH 4G9FA 4I3GA 1JZ5A 3RKDC 2AJUH 4YGVA 2AS5M 1NGZA 1S9XB 4N0FB 4PJBB 4NQXA 1MFNA 4TULL 2Y06L 5IW1B 4JR9L 3MRLB 4UDUB 4C57C 4PFEA 2CJUH 3OZ9L 4OZFH 4R96A 1MF2H 3EOAA 4XPHH 4HFUH 3TJEL 2IANB 4APQA 4DKDC 1JWSA 4F9PC 3TBTA 3CZJA 4PJIE 1B0GB 4OF0A 4K8RD 1RUPH 4YHPB 5ESAA 4XMLH 1Z9LA 4GQ9L 1ZLSL 3VWKC 2E9BA 4ZNCD 3RX7A 5EZJA 3PGCB 1AD9A 3RTQC 5DK2B 1D3CA 4PP1C 3O11B 5GGRA 3VFMB 4ELME 1MPAH 3D87B 3IDIB 3GB7A 3FB5A 3PWVB 2V9RA 1JHTA 4D9RD 1KTKE 2X1OA 1MNUH 5DMGC 4L3CA 2NY0B 3JV4A 3NCEB 4NN7B 5TE4H 5C0JB 3TJHC 3H9SB 4I5BA 4GRWB 1NC4B 3TO2A 3AROA 5BZWA 2VZTA 3RWEA 5D2NB 5JOEA 3A0OA 4YHKH 1TVHA 1LEIB 2V2TB 4O2EB 4ODSL 4MSWA 3PGDA 3EJYD 3V4UH 2JCCF 3MCKA 3WUZA 4I9WE 1UWEL 3ZMRA 3W0WB 1CGWA 2LV4A 2YD3A 1SJXA 1N8ZA 5GZNC 2GK0A 3L3JB 4GQPH 3T0XA 3L3OB 3TH3T 4QRSA 1UYWL 3ARQA 3ARFB 3NCCB 5GISL 3MFFA 5GRXG 4IJ3C 4IRSA 5DHVA 4DN3H 1KENH 3ULVF 1UT9A 2OP4L 4E5XA 3OKLB 5DJAA 4J4PD 2VAAB 3UP1A 1HSAA 3O81A 5F6IB 2N1KA 4OM1L 5ICZA 2EE6A 1AQDA 3FB6A 4NUJB 2N7BA 2IH1B 4GKNA 3PIQB 2AEIT 4I0PC 3VDAA 4ONGH 2WK2A 3HE7A 1FL5A 4PS4H 3DV6B 2E9JA 4WW2C 5EN2B 3KXFE 4KK8C 3WO4B 1FG2B 3UBXI 1DSFL 1N6QH 1E27B 1UXSB 1Y6KR 1T1WA 4QWWC 5EU3A 1FNSH 4N0YH 1DQDL 1DEEA 2WAHA 4ESKA 5I1KH 2XV6B 3GHEH 3B6SB 2VISB 4G9FB 3GNML 3T2NH 1UZ8A 4ZPTA 1NAMH 3K2UH 4PLJD 1A2YA 5A2IH 3P30H 1PX3A 4GXVH 5B39B 4NQXB 3DSNA 3X17A 2AJ3B 3LDBB 4WW1A 1P4BL 3CUPA 1KFAL 2P49B 5I71B 5E8EA 4R96B 3EOAB 4HC1L 2OZ4L 1JWSB 3RDTD 2P46B 3I50L 4DKFL 1V3LA 2IF7A 2X10A 1MAJA 4OF3A 3VA6A 3TWCH 2SEBA 1VPOL 5ESAB 4JFFD 4XWGL 1FLTX 3V4VL 2ZWLT 1KN2L 2OTWB 2XY1A 2H1PH 5EZJB 1GGBL 2JB5H 3MGAA 4R97B 3MRIA 2FD6H 2IPUK 1U91A 4FQXA 3UTPD 3OJMB 1UQSB 5H8DA 3LEVH 4MAYD 2CR6A 3BPNC 2VLJA 5C1MB 5DXWA 2F54B 3FB5B 5DJYA 4MJ5A 4KHTL 1JHTB 5C6TL 3DRTA 2DQDH 2DMCA 4L3CB 3QIWD 5JDSA 3JV4B 3RWDB 1KG0A 5K9JL 4OLYH 1NKOA 3LAFA 4CAGA 4KRPB 1K5NA 4I5BB 4LLAA 5KVGH 4JFXA 1T20A 5L2KD 1ADQH 1LO5A 1EUTA 4XPGH 2PTTA 4HKXB 5BZWB 1YNTA 3OKMA 3RWEB 3G5ZA 3JWOL 2AKRB 4HXBL 5CIPH 4CVZA 3HAEH 1TVHB 2DQIH 4JO1L 4MSWB 4WV1A 3STBA 4R3SA 4DJMA 3ARTA 1QR1A 2AI0L 3O6KL 5C07B 1JPST 4FP8L 1N8ZB 1AKJA 5GQBA 1SY6A 4OCWH 2YS4A 3FN0L 4KC3B 4FFYL 1OCWL 4IRSB 5DHVB 4JRXE 3LV3A 4E5XB 3GSOA 3H9YA 5DJAB 3WLBA 3L5HA 4DK6A 1EBPA 2Y23A 1KIRA 5ICZB 4TSBL 3N9GH 1AQDB 4GKNB 1MFCH 3BSZL 2HJLB 1AP2A 3E6FA 2EZ0D 1E28B 1YEIH 5CD5D 4XP1L 1FL5B 1DANT 1A6PA 4OFKA 3D85A 2XNAA 1BGXH 3MV8B 4IMLB 3OMZA 1ZLUK 2WBJA 4TYUA 1G0YR 1MJUL 1TLKA 2QSCL 2YPLD 5EU3B 1T1WB 4YIQB 4KV5E 4LQFL 4P3CL 5C0FA 1DEEB 3O6FA 3FQRB 1FLRH 1R0AH 4LPCA 1IBGL 5CZKA 4JZNA 3RVTC 5C0AE 3ULUD 4ZPTB 1DLHB 3D5OF 1IZKA 1F4HA 3WFEL 4ZO8A 2EIEA 1RVFL 2YC1A 5FYJD 4OGXL 2HVJA 4RQQB 2ENSA 2NY1D 3KG5A 3M8OH 3MXWH 3MRCB 5D7LE 3CUPB 4K9EC 4LL9A 2NY2B 1G7LA 2IAMB 4HFWA 4OB5L 4EI5A 2NY4D 4FZ8L 1NCCL 3NIFF 3TA3A 1OAQH 4RGMC 1MQKL 4LCIL 1UA6L 1S7XA 2HLFC 1EO7A 3MRIB 4FQXB 4ZXBA 3JVGA 1CT8A 3WFDL 3WNKA 1RU9H 3BGFB 1HI6A 1KB9K 4MJ5B 3SCMD 4G8GE 3KGRA 3IU4L 3DRTB 5C8JB 2PCPA 5JDSB 5EBGA 1KG0B 4MLSA 1PAMA 3OJVC 3VRIA 1K5NB 1UWXK 4JFXB 4MYWB 1T20B 2M26A 4QHNB 4CDGC 3WFCH 4PBXA 1LO5B 2MQ0A 5ID0B 2PTTB 3RU8L 1YNTB 3I2CL 3OKMB 3ZTNL 3G5ZB 1JN6B 1PX4A 4PJ9C 4C56B 4IOIB 3V9FA 3WL9B 4CVZB 4X6BA 2F74A 1SEQH 4R3SB 1QR1B 4XCEA 4Z7NF 1X5JA 4XP4H 5E2TH 1M7IB 1P4IH 4P59L 8CGTA 4OGYL 1I75A 4K9EH 2Q7NA 3IDMA 5JZ7C 1QBMH 1AKJB 4DK3A 5D2LF 4JANA 2D7TL 4KVNL 4XVUC 5D1XA 43C9A 2JCCA 3FRPG 2RHEA 1BAFH 3VFUB 3X12A 4XVSH 3LV3B 4LARL 3GSOB 5I1JH 5JHLH 2VLRA 3RY6C 5TGBA 3X3FL 1KIRB 5GGSA 1Y0LA 4MS8C 4HW6A 3V7MA 2CGRL 1AP2B 1E4KC 4JCMA 3TVMC 3D85B 3NGBB 5KS9F 2F5BH 4QNPE 2WBJB 1DE4A 3SDCD 3ZDXF 5FXCH 4LIQL 4PJEE 2QSTA 4JZNB 3MV9D 4DGVL 3FO1B 1J1PL 1U92B 2FB4H 1ERNA 2NX5E 2YC1B 1TZHA 4Z0XA 5FUOH 1EJOH 1U6AL 5D6DA 4R4FH 3MOQA 4M93B 5BOPA 5JIKA 1DL7L 1MHPH 5MHSE 1G7LB 2P5WD 4HJJL 1EO5A 3OTTA 4EI5B 3EDEA 4KMQA 4BZ2H 2J8HA 2P8PB 3TA3B 1YJDC 3U7YH 1PG7L 1N2RB 5KVMC 1AO7D 1TCRA 2HH0L 3N06B 1YQ2A 4ZXBB 4X9GA 4FTVA 3STLA 4Z7WF 1HQRA 5IB2A 4PJDE 3QFJA 1CT8B 5F7HA 5JPNA 2L4OA 4L3EA 5I76A 3EJJX 1HI6B 3MX0A 3EYSL 5EZIL 2BSSA 2BNRB 2DB8A 2PCPB 4X83A 5M94B 3Q3GB 4PJAE 4YHML 5E00A 1MWAH 1CICD 3Q6FB 2H9GA 2YUZA 1U8MA 1HKLH 1BEYH 4HKBA 1E0OB 4P23A 4DKEL 2NY0C 1ZSDA 4NN7C 1EJ6A 2F74B 4J3VA 4OTXH 3ULVL 2J4WL 5GSRB 1NL0H 1QRND 2AGJL 1AGFA 4Y2DC 1TQBB 2AJZA 4XCEB 4H1LG 5E1AA 1NCWH 2R1YA 3WYRA 4DVRL 4E0RA 3GMOA 5EBMB 5GGRY 3SHSA 3ABZA 5IFJB 4Z76A 3EO9L 1ED3A 1NEUA 5LJYH 1JMZA 4RZCA 3WMSA 4OZHE 4JFZL 1AXTH 1K3ZA 1YJDH 3NFNA 5I1DA 2JCCB 4UBDD 1ZWIB 3MV7A 4P5MA 2VLRB 1BFOA 3OAYK 5TGBB 3VW3L 3MC0A 3W2DL 3HKFA 1UGNA 1Y0LB 4KKCC 1JFQH 3ARFC 2YD4A 3TV3L 2BC4A 1I3RA 1U95A 2WQRA 1CDIA 3HE6D 1M71B 1BHGA 4XPAL 1BOGB 3DYOA 5HGHA 5CP3H 3DO3A 5F6IC 5T1MA 1DE4B 2WWMC 3ZKXC 3V5HA 2NZIA 1TVDA 1WC7A 3T0WA 1UKQA 3IAPA 1GSMA 5AYQA 4AMKL 3WO4C 1CXLA 2HN7A 1JGDA 1G7HB 1TZHB 2XIDA 4Z0XB 1JNJA 1R3IL 4WWID 1RV6X 1I1AD 1DBAH 4WI5A 4GRWH 5F9WC 2R9HD 5C0BE 3I75B 3PWPB 4LF3A 3RTQD 3MBEA 1CK0L 2DJ4A 4O02H 3LDBC 4XCCL 4WWKD 5CGYC 1TCRB 2VDRH 4APQC 5DLMH 3P77A 3P4NA 4LHUA 3RWHA 5ISZA 3A67L 3CU1A 4FTVB 3GBML 5IB2B 1OVZA 3QFJB 1CIUA 4PJGA 5JPNB 4OLVH 4L3EB 3PG2A 5I76B 5HYJA 4X6CE 4AM0A 4FQQA 4X80L 5J06A 3ET9F 4O58H 5C0CA 5M7QA 1A0QL 2VL4A 1YEGL 4R97C 5KSBA 5FEBA 1NSNH 4GRWE 3ARRA 3QQ4A 1MFBH 5E00B 5DD3L 4M5YH 4BFGA 3VXUD 3EOTL 2H9GB 4ZO7A 2RCSH 3PP3H 1NGXA 1I9JH 4DOHB 4HKBB 1NCTA 4P23B 3BH8B 4K2UH 1ZSDB 3L9RA 2D7NA 1ZGLA 2QBWA 1CLCA 3VGAC 3OR7A 4Q0XH 4X9IA 4X8JA 1WFUA 1OP9A 4KRPC 5GZND 4X98A 1RUPL 4XMLL 3TFKC 3BHBB 5E1AB 2R1YB 3SKJH 1YMMA 4E0RB 2HLAA 3GMOB 4FQ2H 2Y7QA 4WFFE 1R5WA 2NY5C 4Z76B 4WTZG 3HUJE 4LMQE 2BSTA 1T3FB 4NIKB 4M1DH 5GRUH 4MCYA 3VFSB 5I1DB 2X7LA 2YPKA 2BERA 2MHAB 3SOBH 3MV7B 4POYA 2A0LC 2DWEB 5DDHA 4EI6A 4P5MB 1J12A 3ARPA 1KB5A 1BFOB 3S5LA 5GXBB 4KMTL 3BI9X 3UPRA 2YA1A 1IGIH 3MLVL 3QI9A 1CGUA 3BP5A 2YBRA 4L4VB 4IRSC 2BC4B 2A6KB 1I3RB 4ZYKA 4H8WC 3QHZL 3U4BH 3P4LA 4N1CA 5F89A 3BYYA 5EUOE 4PP2B 4OI9A 1A14H 3C08H 3PNWA 2AJYH 2DF3A 4G9FE 3KYMA 1KNOA 1R6VA 1UC6A 5T5FL 1XH3A 3HE7C 4NZUH 2BXYA 4JM2D 1WC7B 4KJPD 3REVA 4TTDC 3VD7A 3QDJA 1ACYL 4LOUD 4S0TD 1BWWA 3GM8A 4LKXB 5C0ND 5JUEH 2XKNB 2QQQA 5JMRA 1VADA 1KCSL 4DN3L 1KENL 3TC9A 1OB1B 5SWSA 3S3JA 3MBEB 3QNXA 5HHME 4ZUUB 3MGTA 2V9TA 4AIOA 3MBXH 3K7UA 2NY2C 4ONGL 3C6LB 4JJHA 4PS4L 5ISZB 1YNLH 4H88H 1AFVH 1J86A 1FZMB 1GPOL 4PJGB 1JZ6A 5A3IC 4RMTA 1N6QL 3PHOB 5FM5M 4FQQB 7CGTA 3KLDA 3HRZB 1OTUC 1YY9D 3GHEL 5C0CB 3RGVB 4EDXA 3KR3H 2NW2A 4QT5B 3ROOA 4HULB 5DHVH 4LP4A 3FTGA 5EOCH 4FQXC 4WI2A 3QQ4B 5GS0C 3P30L 1OQOA 2I9TA 4FXKA 3QAZC 1CXHA 3VD3A 3BGFC 4M1GL 2ZUXA 3AU1B 3KPPB 1MHCB 2G60H 3O2VH 3OQ3B 3KNBA 4XCNB 1DCLA 4Y5YB 3WUWG 2Q6WA 3QG6B 1FNAA 3MCLH 3L9RB 1ZGLB 3BGAA 3OR7B 4J3TA 4X8JB 4N0RA 3RHWK 3D0LB 3TWCL 3G08A 4N8CH 3Q6GL 3QXAA 4MXQD 1QVOA 1YMMB 2B7DT 4KU1A 3NZHL 5EOQH 1T0MB 3O0RH 4EOWH 2JB5L 1IKFH 4K7FA 2FD6L 1OAZH 5I18H 3ORJA 3RX8A 1K8DB 2BSTB 3CAFA 3LEVL 4WV1C 2AXGB 3X13B 1LO4H 9CGTA 5KANG 1A7PL 4K3JL 1W0VA 1S3KH 4EI6B 3BZFB 4OFPA 3B9KD 1KB5B 2CDEA 3S5LB 4OLYL 5D2LB 2GQHA 5C08D 4U1SB 1QPXA 2YBRB 1FAIH 4HH8A 4GSDH 4ZYKB 4PD4K 4XPGL 3ETBF 5F89B 1F45A 1WEJL 3VE0A 5ACZA 4FQCH 1A47A 3MLSL 3QXWA 3PNWB 5GS0H 3KYMB 1KNOB 3QISA 3I85A 3KHOA 5J12C 1BD2A 1XH3B 3KDMA 1F42A 3PWJA 3B2UD 5E99L 3REVB 2VWEC 1RULL 1IAOA 1OARL 3NGBC 3C5ZA 1T04B 4E9LA 2WBJC 5KS9B 5F7DA 1A21A 4OCWL 3O6FC 1XCTA 3GSNA 4MNHA 1N6UA 5EO1B 4XMPL 5GS1B 1VADB 2CDGB 2YK1H 3OJ2C 5GRVK 3KLSA 1NC2D 5GGSY 2DTSA 5SWSB 4NM8H 5BO1H 1ORSA 1DUZA 1RZKC 3MGTB 2Y25A 2V9QA 5GRVL 4UMGA 4YO0B 4M93C 5K59E 1YY8A 5JW3H 2QHRH 3IAGC 1CQYA 5T1LD 2F19H 1EGJA 5FKPB 2VLJE 4EI5C 3LS4H 1ORQA 1WWWX 3KPMB 4YR6B 1Q9LA 3TA3C 5ITBH 3DROA 4HS8H 5DVKA 3U4AA 3B43A 1S9YA 5MEND 3RWGA 2NW2B 3ROOB 1RPQA 3MUGA 2I27N 3OXRA 4ZXBC 3JVGC 1JHLL 1EAPA 1YZZA 2I9TB 2R56H 3AREA 3MYJA 1B4JH 2X1PA 4FXKB 4Z7WB 1INDH 4NJAL 1SMOA 3I6KA 3S34H 3M8OL 4MDIB 3MJ6A 5T3ZH 1D5IL 2GSGA 4TTGA 1KCVL 5B22A 3QXAB 1QVOB 3UBXG 4XVUD 2NYYC 5IQ9A 4K7FB 5DS8A 5I2IA 4PYGA 5CLTA 3HNSH 4HV8A 3PF2A 4B41A 5I66A 2Z8VC 3BOVA 1RZKH 3IDYC 1MVFA 1T0PB 3JSSA 5KSUA 3NIGF 5IF0B 3P11H 2X09A 1UCTA 4HBCL 4XBEH 4Y4HD 2FHCA 2CDEB 3TVMD 1LP9E 4R7NA 5T3ZE 1RUMH 3QUML 4LLWA 4PB0L 1CQKA 2VWEE 5D1XC 4QYOA 3WFCL 4K71C 3LQZA 1D6VH 4RA3A 2JJVA 4KHXH 3U9UA 4JB9H 3SE9H 2PW2B 3VE0B 5CD3B 1F90L 5GS2D 1HINH 2BDNH 1OP5H 4AH2A 1SEQL 5FYKU 3KDMB 1I7TA 1LILA 4CADA 4XP4L 4TVPD 1P4IL 3Q48A 1IAOB 3C5ZB 4K9EL 2A6IA 4QXWA 2ZNWA 3WHXA 1QBML 1N64H 2XYCA 3OKOB 5F7DB 3EJZD 2CLVA 1XCTB 2GCYA 5EO0A 4ZD3H 2W0LA 3WHE0 4PYHA 4KRLB 3SQOH 1MEXL 3QUMB 2IAND 5I1JL 1QZ1A 3RX5A 5HYEA 1DUZB 1P84K 3CZFA 3ZSSA 5ALCH 3DVNA 5D6DC 4PV9B 5JIIA 4UZGA 2J7LA 2X89A 4NKMA 4LLDB 1UWGH 1BIHA 1FIEA 1Q9LB 3DROB 4ZFFA 2C3WA 2I60H 4LASH 5HHOB 3WFBH 3LKQA 3VRLF 1VFBB 3MUGB 4G8IA 4PG9B 4WNQA 3OXRB 1M7XA 2YUXA 4YAQB 4BQ6A 3O45B 4E42A 3AREB 3MYJB 3WXVH 3GMMA 1IGTB 1CVSC 3I6KB 5F70A 3H9SD 3CCHA 4XHJD 1UB5B 4KKAD 1ITBB 3X3GH 3TT1L 3GHBH 1I8KA 3O4OB 1J5OH 2C4XA 2MPAL 1FCGA 3T8XA 3BZEA 4MQXC 2VAJA 3U7YL 1B0WA 1QOKA 5HGBB 1BVKB 4G3YL 5HI5D 4P23C 4EKXA 4PREA 4NZRH 5HY9A 1MUJA 1IEBA 5I2IB 1KEGL 5BS0A 3W0WD 1D5XB 2VE6A 2JCCE 3V0VB 4DGIH 5HGGS 5I66B 3D25B 5CUSL 1LDSA 1IAIM 1C5CL 2VN7A 2VLRE 1YEKH 5KSUB 1YQVL 2XXMB 1IT9H 3RA7L 3GEWB 4R7NB 2EXYC 2Q86B 4KGJA 5AUMA 4QYOB 3MROA 1ZHLA 1YN7B 3LQZB 4M62H 2MCPH 3U9UB 5KVFH 4RMSA 4XP9H 1BJ1J 1EZVX 3MLUL 3L3KA 4PBVC 1G7QA 4MNGB 4DZBA 2ZG3A 3K80A 3CFEA 4O4YH 1F2XK 1N59B 1XR8B 1MCHA 1CGSL 1VERA 1CLOL 4OLZL 2A6IB 2O5YH 3KPQA 4P46A 5A2JH 1G7JA 3EGSA 2CLVB 4GRMA 3DETC 5I1EL 5EO0B 2XA8H 1WZKA 3ZKMC 2XPGA 3UJIH 1BM3L 4NWUL 3BPOC 3CZFB 2D0HA 3DV4B 1HXYA 3DRQA 5ICYA 3QSKB 4KY1L 1JFQL 4FTVE 1AQKL 3QFJE 1A7RH 4L3EE 4NKMB 1JGVL 4M7KH 5L8LB 3MRDA 4V2CB 3MBEC 5B3JE 3FFCA 5IVXF 2A1WL 3LKQB 2VXVH 4HMDA 4LDEB 4YLQT 2VDOL 2F54D 2UY6A 1KB9J 3T0EB 1IGJB 3IDJA 1N5AA 4LPYA 4ZUTA 3MLPA 2ARWA 4DKAA 4E42B 4XX1G 4QHMA 3DECA 1RMFH 2OQJB 3RIFF 1UJTA 1TZGH 4KRPD 3CCHB 5EBLA 4CDHA 2LAGB 1KC5L 4M9OA 5IUSA 2ADFH 4OSUL 5DJ0B 1R3KA 4I1NB 4F57H 2PO6D 3ZTJG 4X6EB 3T8XB 3G5VA 3BZEB 3AXLB 1BZ9B 5SX5K 4PREB 5DLML 5HY9B 1MUJB 1IEBB 3IDNA 5C07D 5JQ6H 5BS0B 3QIBB 1UB6A 4AG4H 1Q38A 3MV7E 4J3SA 4OLVL 3QQ9D 5HPMA 2CR3A 4O58L 4X7DC 3DNKA 2GITA 4XC1H 2D7PA 4DFIA 2AJVH 2MWCA 1A3RH 2P24B 5FUCC 5IB5A 4HLJA 3GMNB 1M7DA 4WCYH 3MLZH 2RCSL 3BUYA 5AUMB 2BX5A 3F8UB 3MROB 3SY0A 1ZHLB 3ESVF 3RZWA 3SE8L 1TENA 1XGRB 4Y8AA 3BT2L 3MR9A 4N8PA 4K2UL 4YDKH 4DZBB 4OV5B 4TTDD 4E41A 3CFEB 3MV8D 1J0HA 3QUYD 4L8SA 4ZOAA 5D70H 1OAUL 4EJ1C 5BV7L 1SVCP 3ARDD 3QI9C 4PV8B 3FFDB 4FFVC 2VQTA 3SKJL 1EVUA 4HIXH 4XPTL 3KPQB 4V1DA 4P46B 1G7JB 3EGSB 3F7QA 1A9EA 1ZA6A 5HVWA 3D39A 4M1DL 3QWQB 2X4QB 2OMBA 5FGRA 1F3JB 3SDDD 3F5WA 2IAMD 4PJXE 2NZ9D 3CVHL 3LRGA 5ACLA 3DRQB 5ISZE 5ICYB 3D48R 1NBQA 1OOAA 4GOSA 3RVXC 4PTTA 3SGEH 4PJGE 5C3LD 5HYJE 3MRDB 4QHUB 5BV7B 4FQXD 1A14L 5C0CE 1FBIH 1S5IL 2AJYL 3O3BB 3QUXA 5KSBE 3S88L 2BNUA 3FL7A 4TNWF 3PP4H 3DGGA 4KH2A 3NA4A 1KN4H 4ZUTB 1JV5B 1CLYL 1SBSL 2B2XH 4QHMB 4ZQKB 4EN3B 5IESH 3CDFA 4I18B 4HAFA 3BKYL 5EBLB 4MHHG 1I1CA 2WMPA 4YHOL 5SWQB 3CVHB 5AG8A 3VG9B 5FM4A 1P6AB 2EIBA 2CRIA 2XZZA 4NHCH 2B5IB 2PYED 3G5VB 4C56D 5DUMH 2VH5H 3MODH 4X0KA 4BUHA 2IADA 2NY3B 3PWUA 1Z3GH 4OCMC 5FUCE 3C5SA 4HXAH 2VDPH 3IDNB 5LQBH 3FRPA 4OKVA 4ODWA 2HT3D 3CXDH 3HPJA 4GW5A 4U2YA 5HI4C 4Z7NE 1UB6B 3OJDB 1AKJD 1JTPA 5MEPA 1DBKL 4OCRH 1T2JA 5HPMB 1K8IB 4RX4A 1N7MH 1AXSA 4Y19D 3KR3L 4UOW1 2NW3A 2GITB 3FT2A 4WHDA 5EOCL 1C12B 2AJXH 4MNQA 5H35B 3V5DA 5LVEA 5IB5B 1M7DB 3O8XD 4JFPA 4ZAKD 3BUYB 3SY0B 1FNGA 5DQJA 2ZKHL 5JLZA 2G60L 3BP4B 5HDLA 3MREA 3MR9B 2R1XA 4AEFA 3TGXA 4JPVL 3MCLL 4E41B 3BZ4A 1MCOL 4Y1AA 3TBWA 2B20A 1W72H 3QDJE 3MLXL 4TQEL 4TPRL 1OTSC 2OTPA 4RGNB 3ZE1E 5DSCA 5DF0A 1X7QB 3CC5A 2Y6SD 4OUOA 5I18L 1KCRL 1LD9A 4P2CG 1ZA6B 5SWSE 1DBBH 2J6EA 1LO4L 5DZLA 4MWFA 5EDXA 1UM5L 2E27H 3C5ZC 1MI5A 1P7QD 3F5WB 1TDQA 2GYSA 5I1HL 4EI5D 2NXZB 3FOLA 3ULSA 5GZOD 4YX2H 3WD5H 3RWJA 2YMXL 3NIDE 5J1TC 4GSDL 4ZUVB 3U46A 1O7VA 4FQCL 3QQNA 2DYPB 4BQ8A 5EOTA 1ZOXA 5E9DB 1G9NC 1CDCA 4U1LA 1JI1A 5BMFH 3B5GA 3V6ZA 3AGVA 1K3IA 1OT1A 3DGGB 3P4MA 2BNRD 2F53A 3Q5OA 3N1FC 2HMIC 4IMKA 2C1PA 3THMH 3SGKA 2ADJA 2ARJQ 2YEZA 3JXAA 3IJHB 1MFAL 1MH5A 4MD0A 4H1LA 5F7KC 1I7RA 2NYYD 1FFPA 3H7LA 3AREC 3RPKA 2P1YA 4NM8L 3LB6D 3BXNA 3OSKA 4JPIA 3TO4B 4LQ1A 1E6JH 5FB8B 1CL7I 3ZDZF 5F7MC 5JW3L 3C5SB 2XTJC 2XG4A 2P5ED 3O4OC 2OJEA 1GOHA 5IT2H 1GC1L 3HPJB 3LS4L 2C4FU 5MEPB 4B7LA 3GSNH 1I8MB 5F3BA 4GS7C 1DVFA 2FNBA 2NW3B 3ZL4H 4N0UA 3FT2B 1GGIH 2QQKH 3VGHA 4MNQB 3V5DB 5L6YH 1NMCB 4YC2B 1NCAL 1VFAA 2FZ3B 1KV3A 4JFPB 2PN5A 3U9PH 1G9NH 1HDMB 5TQ0L 3L3DB 3S34L 5DQJB 3DIFA 4LCUB 1KJMA 3DLQR 3MREB 3QPQC 5T3ZL 2ATPB 1EGJH 1BD2E 1H15A 3ULVD 1F58H 4Y1AB 3QG7L 4H0HB 1K4DA 3C8KA 3C2AL 4KJQD 3TBWB 1XGTA 1OY3B 3HZVA 2X4PA 3BQUA 5L7XH 1H3VA 4AYFA 1WT5A 4LPXA 1MY7A 1YPZF 3R4DA 3UZEA 4HWZA 3OKEA 2E5EA 5E4IA 1LD9B 1KELH 4POUB 2K3TA 2A6JA 1AJ7L 4LLUB 2APWA 2HTKC 4MWFB 5KOVC 3P11L 2XWJB 4JPWL 4MB5A 4D9LH 1C5DA 4OM0L 4XBEL 1URLA 1P5VA 1DUYA 4WHCA 1CFBA 3FOLB 3PWPD 3ULSB 3EFFA 3RNQA 1KJVB 4Y16B 5DRXB 4KK5D 4KI1A 4ZTPH 2Z31A 4NT6A 3RWJB 4X7FC 5FHAH 1OP5K 2DDQH 5LGKA 1D6VL 4KHXL 3DMMD 3U46B 3SE9L 4MA7L 1E4XL 1ZLVH 1O5DT 1GIGH 3HR5A 2P7TA 4U1LB 2HT2C 4OT1L 1OP3H 1CR9H 1T0NB 5IG7A 3O4LA 5J6HA 4Y4FA 4ONOA 2AAVA 2VERN 3O2DH 2X9WA 2F53B 5DYOB 3KPTA 1MCJA 2AV7A 5INDA 1NGWA 1N64L 1RI8A 3UC0H 2XTJE 5IVXB 4ZTOL 2KKQA 2YEZB 2DQJH 4NCDA 3VFNA 5KZCD 3V79C 4NUGL 5DVMA 1MH5B 2YXMA 1QSEB 3SQOL 3L95A 1CDYA 4OQTA 3BGMA 4CVWA 2WUBH 4WEBL 4EDWH 4DTGH 3QJHB 4JGMA 1WITA 4O9HL 4WTZA 1CXEA 1QACA 3BDYH 4F37F 3GBNL 3L3GA 1LK3L 2XQYK 4QTIH 4YWGL 1UWGL 5BQ7A 2DMKA 1RK1A 3ZYIA 3RWFA 3FO2A 3RBGA 4UT6L 1KYOK 3MRJA 5F3BB 3UJTH 1I3GL 1RHFA 1DVFB 4LSUH 4KJWC 4N5ED 1S5HB 1DN0A 4N0UB 3BVNA 5F7EH 1X5IA 1QKZH 2NCMA 4P4RA 4IDLA 4NC0B 1VFAB 2X70B 4YK4C 5TPWH 3V95A 2WNGA 3K4AA 2CKBH 1CGYA 5IMOA 4OJFL 3DIFB 5DTFA 3VXPA 4L4VD 5HD8C 3X3GL 1Y6MR 2EEDA 3GHBL 4PD4J 5DHYA 1IGFH 1WZ1H 2LVCA 1J5OL 1PKOA 5KTEH 1K4DB 3C8KB 1XGTB 3HZVB 2X4PB 3BQUB 3OGCB 4X99B 1Z0NA 3EOBA 3U48A 1ROWA 5IVZA 1B88A 3B5TA 1DP0A 3QH3A 3CH8A 2BHZA 3ZKMD 1HILA 1HQ4A 4M00A 4HWZB 4M7LH 1GHFH 4HUUA 5EU4A 3RIAF 4DGIL 1MY5A 5FGSA 2A6JB 4TNWK 3QRGH 2FIRT 2NR6D 4F7CA 1C5DB 2JKXA 4NO5A 1DUYB 4K3EH 1FFNA 4P46C 2WWKO