4KUZH

Crystal structure of anti-emmprin antibody 4a5 fab in trigonal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGGINPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARNDGYRGYAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody 4A5 light chain
publication title Structural evidence for a constrained conformation of short CDR-L3 in antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 35
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH02
1MHCB 4JHAL 5SWQB 1YPZB 5IB1A 1T0NA 1MI5A 1Z5LA 1JYNA 1K2DA 4XMKL 4NBZB 3A67H 4PJGB 3VWKB 3MBEB 4E41B 2P8PB 3MV8E 3T65A 1JJUA 1S9XB 3SKUD 4QYOB 1I1AA 4PJ7F 4QRTB 5C0ND 1NAKL 1GPOL 1AGBA 3GRWH 4NOBA 5CHNA 2R4RL 4ZFGH 3KHQA 3GB7B 1JNLL 3HI6L 2XNAB 2VDPH 1C5BH 3G5VB 3MUHL 4NWTL 1JHTB 1JPTL 4PJEA 4Y4KA 3O6FD 5SWZA 3S88L 4JG1L 5CJQH 5FHAH 2H8PA 3DXAE 1D9KB 1ZT7A 3DTXA 4MWFB 4EJ1C 4EOWL 3RTQB 1LWRA 3L5XL 3P30H 1KTLB 1OSPL 1YNTB 1ZANL 4C56A 4PTTB 3JWOC 4Z6AT 3TO4D 3WNLA 4BQCA 5D7LD 1BIIA 2UVEA 5TGBB 4NUJB 3EYOA 3CSGA 5DRNA 2XZQL 4QHMB 4FXGB 4NN5B 3J8F7 2XRAL 3TO2A 5C0GB 2CXKA 3QIBD 1S7VA 4MNGE 4MXVE 5ESVB 4YR6A 3S4SA 3QDME 4QRPB 1UACH 3MLZL 1JPST 1KCSH 2I9LA 1CFQA 4YC2B 4EDWH 3KPSA 3U2SA 2AJUL 4PREA 4M48H 5F97E 4P4KD 4PJ7A 1U8HA 4KXZI 3VRIA 2OSLB 4NJAH 4HCRL 3ZDYF 4ELKB 3IFPB 1MFEL 3IETB 1PY4A 1OPGL 4J3OC 5DD3H 3NCJH 4V1DA 3KPRD 3P9MA 2YKLL 5BVJA 4HZLB 4PY7B 4I5BB 3LEVL 1A7QL 3LKSA 3QUKB 1TTFA 4Q97A 2I26N 2RB8A 2VDML 3C09B 3F8UB 1ZGLB 3HMWH 4LLQB 1MLBB 4YHIA 2GCYB 3JXAA 5DQ9A 4ZO9A 1OW0A 3HA0A 1CZ8H 5BXFA 5GSRA 1O7SA 3HI1B 2VLKD 5FAAA 4GAGH 3BZFB 1GHFL 5BS0A 2DLHA 3P4MA 2D9CA 5E4EC 2ARWA 4HUWB 2ZCHH 3RNKA 2MCPL 2YZ8A 2B4CH 3I3EA 4OFKA 4XPTL 1INDH 3MA7B 3O3AB 4DOHB 2K7QA 4M43L 4K2UL 5DZNA 2YUXA 1K4CA 3H7LA 5C0FA 4TULL 1EIBA 5AYUH 1BLNB 1CCZA 4OQ1A 3LD8B 4GKOA 3SE8L 5FKAB 5E08L 5ADPL 4F15B 5IB3A 2P24B 5EU6B 4NRYA 1LNUA 4Q9QH 5E8OB 5EZOH 5HSFA 3BQUA 3RGVB 1BQHG 1EGJL 5DI8B 1U3HC 3BPLB 5C0RH 3WO3B 4JO4L 3WUZA 5D7SL 3L95A 2MKWA 4K71B 4P3CH 2B39A 2ED8A 5F8RC 3RVWD 4AK1A 5FYJU 4YHNA 2IF7A 4PJCB 2CJUL 4YDVB 3DI3B 5DHVH 2ADGB 2DN7A 4IM8A 4OIBA 5EC1A 4WWKD 5JLZA 3MLYH 4M7KH 1AIFA 4PTUB 2J6EH 4K3EL 4UAOB 3PHQA 3DBXB 5IOPB 4M3JA 5TFSH 3T0VA 3EOBB 4PJBF 3KYKH 3X12A 4PJIE 3RVTC 1OGAD 4JQVC 3MR9A 4C83A 3RWHA 2B2XL 2NQCA 5HXMA 2ADFH 4OFYA 4OLWH 3UCRA 4JM2F 3HS0B 4KJWC 4F37K 4Q0XL 5I18H 1EHNA 1WSST 2NXYB 2E9WA 2A1WL 2F9BT 4G6JH 4HIXH 1UA6L 5EFIB 1TMCB 1QNZH 1VFMA 3Q5OA 1IGCL 1N59A 4YNYB 2WK2A 2QL1A 2Q76A 3D9AH 4TUOB 3OKKA 2JJWA 4DUXA 1RPQA 2VDLL 3QWRD 4P5KA 5KS9E 4DKFH 4UNUA 3Q5YA 1F58H 4UT9L 1P9MA 1ZHLB 1FL5B 3EO9H 4U1KB 3KYMA 3QUXA 3UPRB 3U83A 1D6VL 2F15A 4OLXL 4TNVF 4D9QD 1LEGB 4I77H 4QGTA 4G9FA 3REVB 5HHQA 4HWBL 4PRIB 5CGTA 1GXEA 1SJHB 3U0PA 1X5KA 2IH1B 2XQBL 3HZVA 4KKBC 4PJBA 5LGHH 3Q3GA 2PYED 2PXYD 4OZHE 2OJZH 5J7CC 1FLRL 3UBXG 2P5WD 3V5DA 5H37H 3KPTA 4JM2A 5KSBE 2FLRT 4QO1A 5GISH 4PRPB 2VSDA 4MJ6B 3Q5TA 5I19L 3DV6B 3OPZL 3DPBA 4H1LA 1CK0H 5DK2A 1KACB 1S5IL 4N5ED 3BN3B 4XNZC 5EIIA 1DJSA 2XN9D 3C60B 4KQ3H 3IAPA 5DA0B 5KAQG 4PJ8D 5D2NE 2J7LA 5JQHC 4WFFE 4RQQA 1Q9LA 2R0LH 2GJ6E 2NX5A 4WUUD 4MJIE 1BX2A 4U0QB 5F9WB 5L2KD 3V6ZB 1MEXH 1RK0A 1U8MA 2X4RB 5HYSG 1MPAH 1DBJH 1KV3A 2BVOB 4XRCA 1RI8A 2DOCA 3RDTA 5BZDB 4X6DE 1U6AH 5CFHA 3O4LD 1MCBA 4K8RD 1MRCL 1F4WL 1Z3GH 4YFLI 2BNRA 1NGYA 4CMHC 1UJTA 1N5AB 1UWGL 4IRZH 4TNWF 4BFIB 2VOTA 1KIPB 1RUPH 2QEJA 1AGDB 2NY4C 4YHYC 2AS5M 2ESVB 4AT6A 2A6IB 1MJJB 2Y23A 4X7TB 1P4BL 4JZOB 4KRMB 1FZMB 4GBXC 4XAWL 1HDMB 2BVPA 4NO3B 1MREH 4FTVB 1ODAA 4M02A 4Q58C 5FGSA 2IAMD 3VXRE 1OP3K 4MCYA 1DE4B 3AU1A 4ZUVB 5SWSD 3FAXA 2EXYC 1S7TA 2R69L 2QTEA 4CDHA 3T0EE 1NANI 4ZQKA 2Q3AA 1AI1H 3T0XA 5IROA 3ARGC 1WWWX 3WDIA 5J1SC 2G2RB 3MGOB 3QHFL 4OZIB 2VL4A 4KJQC 5I74B 3D2UB 3BIKB 1N64H 2Q6WA 4CVZB 2F54A 3RVUC 4P57A 1XGUB 1LILA 1EV2E 3OAZK 4JZJB 3LZFH 2O5ZH 1OTSD 2IBGA 1QUNA 2O61B 1NAMA 3AUVA 3CIQA 1FFQA 3GMPA 3QDJE 5HHMB 2QQNL 2HMID 4KK6C 3WLBA 3OHXB 2D03L 1K8IB 4RMWA 3SDXE 3WFBH 2HAZA 5DJDA 2VLJE 4ODSH 3G04A 4CDGC 5D96B 2PETA 2R2EB 4TRPH 5EO1A 1U8KA 3QNXA 4O58L 1I8MA 3NIFF 2ORBH 1PX4A 1BD2E 4N9GB 2AJVL 2CRZA 43C9A 4JJ5B 2V7HB 4NDMA 3BXNB 4FQPA 2BHYA 3MV8D 3P73B 1G9MC 3KPNA 5I71B 3SGDI 2PW2A 4HLJA 3LS4H 2J3SA 3VXQA 2XPGA 5T1DL 4Z7NF 4P2OB 2LAAA 4APQC 1V7NH 2HT4C 3OR7B 1R5VA 4X0KA 3TBSB 5I1KH 4JFHE 3G08B 2NY0C 3WDJA 2OQJB 4WO4D 1XH3A 2MQCA 3CZFA 1FGNL 5FGBC 4DKEL 2MWCA 4QXTA 3NAAH 3DUUA 3DXAD 1DQDH 5I1HL 4ODTL 3ZTJH 2Z8RA 4WI8A 4YPGA 4HUVA 1VEMA 4KJYA 3NTCH 1WIPA 3T0BA 2GI7A 4EN3B 4WRLA 5FCSH 1U91A 2YD9A 1FNEA 4LAQL 2NZ9C 5DVLA 3NVQA 3UTQB 3S98A 3KPMB 1F97A 3WO4C 4KGLA 1KIRA 4HAFA 4OQTH 3EOAA 3BN9D 43CAB 3ARDC 1BOYA 5IW1A 1TENA 3FO9A 2CQVA 2XFXA 4YK4C 1I8KA 1YECL 1JYWA 4RMUA 2VL5B 3IJSA 3MZGB 3OGCA 1V8HA 4DN3L 2IBBA 4ORZC 1YA5A 1HHJA 1ZEAH 1PQZA 1UXWB 3HG1A 3MYJB 1JWMA 3NZHH 4HS8L 4HQQH 1TITA 1YEKH 3QDGE 3TN0A 4XCCL 1OTUD 3KPLB 1AD9A 3NIGE 4HBQA 5I2IA 1KG0B 4RDQG 2J88H 1BGXL 4YLQT 3O6ML 1DBAL 3QUZC 2ATPB 4BZ1H 1INQB 4F7EB 4RMRA 2B5IC 1KJVA 3N1MC 3V5HA 1IM9B 5HGAB 5HVWA 3C5ZA 5GHWH 3SBWC 1CFNB 1K6QL 2VZ1A 2W0FA 5C86A 3W5NA 3O11A 3NCYS 5IK3A 4CNIA 4ERSH 3TPUA 4PJXE 2GSIA 3GI9L 4YWGH 3IU4H 1UJ3A 3TFKD 3H42L 5CD3A 2WBKA 5FA4A 4F2MA 5EU7C 3EYFB 3BH9A 4I0PC 5LBSL 1JTOA 4QNPF 4JANA 2C4FT 4Y0GA 4G6AD 1S7QA 2UUDH 3CFBA 4LOUC 3WUWB 3DNKA 1KLUB 2IBZY 4HXAH 3PWNB 3T0AA 5E99H 1KJ2A 1U3HA 2I9TB 4LKXB 4YZFE 3ZTNL 3DX9B 3MV9A 1HSAB 2JCCE 3CFCH 3B9EA 1KB9K 4P5TD 4I18B 1KCRH 3IJHB 4C4KO 2KQMA 2A9ML 4Q9CA 1P84J 5E8EA 1AGFB 4ZFOA 2BY1A 2VZ3A 3B2UC 5IW6A 4NNPL 1QG3A 5FM8A 1NCWL 4OV5B 3SQBA 1SEBA 4OT1H 4FFVD 1H3GA 4GMSH 1L7TL 3MJ8A 4BFGA 4LCWB 1YEHH 5IT2L 3QXVA 5IEKB 2W9LA 1MIMH 1KJ3L 1GZPA 1DZBA 4JQVA 3T2OA 5ACZB 1NKRA 1EJOL 3AMLA 1TETL 2DI7A 2XQYK 4YPJA 4OCRL 3ARED 1FL6A 3LQAH 1QBBA 3TH4T 1EAPB 1SMAA 3MRJB 5F1IA 3RL2B 3MRKA 4NHUB 2G5RA 2X9YA 4KQ4H 4DQOH 1HI6A 4Y5VB 4MNHB 3U7YH 5DFVD 1YDPA 5FYJL 3OX8A 5CCKL 2EDHA 4ODWB 2JIXA 3SEPA 1KNOB 3QEHB 4NGHL 1BF8A 4JPKL 1TZGH 1NLBH 4YX2L 2I27N 2W9DL 2QSVA 3QO1B 3H2WA 4KZDH 1QLEL 1Q94B 1FH5L 2IANE 1FORL 5I8OL 3WD5L 5IBUG 4KFZC 2NY3D 4TSBH 1FAIL 3PL6C 4O4YH 1KT2A 1MNUL 1G9NH 3THML 3MRGA 3G6DL 2HRPH 3E3QC 2VB5A 3QG6A 1S9KC 5IB1B 1T0NB 2B0SL 1MI5B 1Z5LB 1ZV5A 1K2DB 4R97B 5FGCE 4POZD 4POYA 1F3RB 1RUKH 3G5YA 3D3VE 1BMGA 3T65B 1QFPA 1GAFH 2YD2A 1L9NA 1N4XL 4JPVL 4UIMA 3O2VL 1I1AB 1AGBB 5CHNB 2IG2H 3MNVA 3DIFA 5GGSY 3S9DB 2Y07L 1DFBH 1JWSA 4L8SC 1NCDL 1G6RA 3WDHA 4GT7A 3ZLQC 2WLZA 3DXAA 5LWYH 1L6XA 4UTBL 4NIKB 4M1CC 4PJEB 1U2CA 4Y4KB 5SWZB 5D93B 1EAJA 2H8PB 1WBYA 2AJ3A 4WFFD 3WFHA 1G7IA 1ZT7B 5DGQA 2GJ6D 3DTXB 4GW1A 4MJID 5DMGC 5D1ZC 1UC6A 1QBLL 2Z0BA 3WEXA 1PZUB 3FFDA 2GY7B 4C56B 1A6UL 5F7FA 3CFDA 2WIMA 3EYSL 5IB5A 5D72H 5T5NF 1BIIB 1ZTXH 5CGYC 3EYOB 5DRNB 5D2LF 5IB4A 4ISVA 3QPQC 1BFVH 3QDMA 2DD8H 3NN8A 3RGHA 4EIZC 3TO2B 4JY5L 5FUZH 4JREC 4MB3A 1S7VB 4YR6B 5F7NC 1UT9A 1ONQA 4PGBA 3TBVA 3S4SB 4P3DA 3GM0A 4JQIH 1PGRB 2I9LB 5EH1A 1GIGL 3NFSL 4XTRC 3VH8A 3KPSB 3U30B 3U2SB 1OOAA 1ZVSA 4PREB 3VG0L 4PJ7B 1U8HB 3K2UH 3U9UA 3VRIB 4XNQA 2WV3A 3Q6GL 1MFDH 1DL7L 5CMAA 2YC1A 4KAQH 3VXRD 4DGVH 2UY7A 3QNYA 1OM3H 5J0BA 5HHXL 2WWKT 1IE5A 3KPQA 3FOLA 2R8SL 1B3JA 1NLDH 5KANI 1A3LL 4V1DB 3P9MB 3T0ED 1JGVL 5BVJB 1VHPA 4GQPH 3LKSB 5DEGA 2BJML 3B2VL 4XCEA 4Q6YA 4JY4A 4YHIB 1CBVH 4UOW0 5DQ9B 3QHTC 4CVWA 1X5ZA 3IDYC 1HQ4A 1ROWA 1KPUA 4NQTA 4L5FH 1KN4L 3DX6A 5GSRB 5BXFB 1NSNL 2APFA 3DUSA 4XC1H 1NDMA 1CDYA 5BS0B 1YNKH 3P4MB 3CC5A 3EJZD 4IMKC 1KSRA 5T3ZH 4MHHI 3QDJD 4S11A 5D2LA 5DD5H 4LQFH 4M6NH 3O2WL 3I9GH 1QKZH 4MJ5A 3HPLA 4D0CA 2VLJD 5T3ZE 3V95A 2VXQL 3DECA 4NQDB 4UDUA 1HXYA 4Y16C 1K4CB 3LH2H 3QQ4A 4P2QA 1BD2D 1YN7A 5FOJA 5C0FB 3QP3A 2WBJD 15C8H 12E8L 2XZAL 4HIIA 1BOGA 3C6SA 4AG4L 2DIAA 4M62H 1CDCA 5IB3B 4APQA 5BRZA 4NRYB 1LNUB 4AMKH 4KPHL 1VEOA 4WEUD 1T1ZA 3BQUB 3WJJC 2FGWL 5DJ8A 5TE7H 2LU7A 1MCQA 3GEWB 5EZIH 3L95B 3ZSSA 2OI9B 1IGYA 4JFHD 1U95A 4N8CL 5B38G 4AYFA 5IHUL 4YHNB 1TJIH 5GJTL 1AGEA 1JPGA 1JMZA 5EC1B 5JLZB 5D1XD 4XNYL 4MLSA 1AIFB 5TF1L 5K93A 1KPRA 4FQ2L 3PHQB 2BFVL 4X9BA 4XHJC 3N0PB 1CGTA 4D3CH 2ILLA 4O2FA 1VEPA 5EOQH 3X12B 3ARDA 2YMXH 3MR9B 1RD6A 4POUB 4C83B 4RZCA 3RWHB 5HHNA 1RZ7H 4G7VL 4G3YH 1BM3L 4YXKL 4Z76A 4TUKL 4PLKC 1IEHA 3BPNC 3MLWH 1HHHA 1GGCH 1N59B 3L3KA 3RZCD 2Q76B 3OKKB 5DD0L 5L8JB 1AR1C 4P5KB 3QEQE 1QPXA 1WZ1H 4AEFA 1K5NA 4ZD3H 1WVZA 1W72A 4RAVA 4S1DC 3KYMB 3QUXB 1FAKT 5DHXB 4UB0H 4KHTL 1P7HL 3DWTA 4XPHL 4Z7VF 4X6DF 3SBWA 1HIMH 1JK8A 1E4JA 2DAVA 4B41A 4G9FB 4P9HL 1D5BA 3G5ZA 5HHQB 3R1GL 4K3DL 3D0VA 3O6KH 3TVMC 5LJYH 3U0PB 3HZVB 4PJBB 3VXUE 1KN2L 3Q3GB 2PR4L 2HTKC 2DM7A 1QRNE 1TJGH 3CLFH 3U46A 5I1GH 4HJ0C 5E9DE 5HYJA 3V5DB 3TNNA 1IGML 3MLXL 5MP6H 4JM2B 5C3LD 5J3HD 2VISA 3QG7L 1U3JA 3X3FH 1ZS8A 3R8QA 3MUY1 1QOKA 1PYWA 2AJXH 4H1LB 5HI5D 5DK2B 3UYRH 2FO4A 4ORGA 4U49A 5EIIB 4Y4FC 2BRRH 4U2ZA 4KK8C 5F1SA 1A64A 1C7TA 4YHMH 3TYGH 2XA8L 4EI6A 5EDXA 5GS1C 4RQQB 1Q9LB 4UOJA 2NX5B 5DJYA 5JQ6L 3ZT5A 1GGUA 1BX2B 2H2SC 4MNQD 1RK0B 1QSEA 1RFDL 1RUAH 1U8MB 3K8MA 1GRWA 1LD9A 4Z7VA 3VD4A 4DWHA 4XRCB 3GHBL 1DQLH 3MFGB 1MELA 1OAUL 2IQAA 4GJTB 3RDTB 1BAFH 1W8NA 2YA1A 4M4PA 1R24A 1G7JA 5FYKL 2BNRB 1NGYB 4Y7MA 4ZUTA 2GK0A 3MRLA 1QBMH 2CXGA 4AT6B 1OAKL 1XMWA 4OCYH 3AB0C 4N0CC 3EBAA 3IDIA 4GUPA 4YHKH 1FNSH 4O5LH 5DVNA 3P2TA 5EPMA 3V4VH 4TVPL 3VXRA 2GT9A 2BVPB 2B1HH 4WHYG 4WHDA 2IFFH 4MJ4A 5K9JH 2W60A 4MZ3A 4XB8A 4LRNH 2CLRA 4MCYB 3AU1B 4RGNB 1TZHA 1FNLA 1S7TB 1NGPH 4S10A 4ZQKB 4L8CA 3QIWC 2NY5C 2FX8H 4M8QA 3MRQA 4FFYL 2YBRA 3VG9C 1X44A 3BGMA 1P7QD 3TO4C 5T33H 4QHUA 1S78D 3EJJX 4YGVB 1JV5A 2Q6WB 3MRCA 4O2CA 2F54B 4P57B 3A0OA 3B43A 1PKQE 3DI2B 2DQCH 3BZEA 1XGQA 1NAMB 4DEPC 2MTPA 2ZUYA 3GMPB 3JV6A 4WTXA 4HK3N 3WLBB 3O3BA 5DJDB 3P0VH 2IAND 4DUWA 2EH7H 4TPRH 3G04B 3WXWL 5EO0A 4BZYA 5EO1B 1U8KB 3QNXB 1I8MB 2B1AH 3H9SE 4P4KC 3S4SG 1Q0YH 4RFNC 2N7AA 5KVGH 1T6VN 1CR9H 1MAJA 3WXVL 1KLGA 3S34L 3V8OA 2FR4A 3QQ3A 1VADA 4RMVA 4XX1G 4K7PL 4HXBH 4U1JA 1X5HA 4NDMB 3P4NA 5MENE 1S7RA 3D3VD 3BAEL 5E1AA 3EYUH 3KPNB 1RZFH 3NIGF 2PW2B 4MAYD 3VXQB 4L8SA 5I1LA 2XPGB 4JVWA 3PWPD 2EIDA 1J18A 2CMRH 3DRQA 4KKNA 2O93L 3JUZA 1R5VB 5CEZH 2AABL 4X0KB 3WSQL 5D7JD 1UB5A 1XH3B 3CZFB 4CVUA 1MFCL 7FABL 3ORJA 4NN7C 2Z9TA 3SGEI 4QXTB 1FBIH 4NKDA 4R2GD 3DUUB 5J12C 2EC9T 2J8UF 1IC4L 5BVPL 5IF0A 2APWA 4OBRA 5KTEL 3C2AH 4YPGB 4HUVB 4KJYB 5A43C 5HYFA 5JXAL 1DN0A 1U91B 2W9EH 1FNEB 4IRJD 4L8DA 5LCVH 1EFXD 4KDVA 5A1AA 3GBLA 4N5UA 4JR9H 5ID0A 5HVGB 4JO3H 1T1YA 1BFSA 1CLOH 1KIRB 3EOAB 5IW1B 3ABZA 4BSWA 2DI9A 3FO9B 4NZJA 1CD1A 2XFXB 1ZWIA 1I8KB 3IJSB 1EO8H 3D1MC 3OGCB 1C8PA 5J9PA 3PWLA 3QDGA 1YJDH 1HHJB 1PQZB 4KRPD 3HG1B 1JWMB 4J3SA 5ILTH 4O02L 2HN7A 3EHBD 3TN0B 3RVWC 3MA9L 1F8TH 5FYLH 2VDRL 5ALCH 1AD9B 2LU3A 1MHPH 5I2IB 4LPVA 3RWDA 4XVTH 2O5XH 1JNNH 4KROB 3MGTA 1J12A 1HYRC 4N90E 5FYLE 4YDKH 1I9IL 3W11D 1KJVB 5FUCC 2J8UA 4F80A 3V5HB 5CJXC 2HVKA 4I4WA 3C5ZB 2PXYB 1CFVL 4M00A 2HA1A 3WCYA 4IMKA 1FZKA 2DWDA 2XWBA 3NOIA 3MODL 1E28A 1FLTX 4JHAH 2W0FB 3O11B 1Q1JH 4R8WL 4QXWA 5IK3B 4CNIB 3QCUL 1KIQA 2FL5A 3TPUB 4HLZG 4XMKH 3S97C 5I17A 2GSIB 4LPWA 5DYOA 1UJ3B 2X89A 5T3ZD 3FQWA 5CD3B 1NAKH 1TCRA 1GPOH 5FA4B 4F2MB 3BH9B 4JDVA 4OJFL 5ANMA 3KJ4B 2ZNWA 1D3CA 4JANB 4M6OL 2A6KA 1S7QB 3CFBB 3HI6H 3QAZC 3O2DA 4NWTH 4ESKA 1EXUA 5CSZA 1KJ2B 1U3HB 3JWDL 4A2LA 2VJXA 3EYVA 1JPTH 5JA9A 5DJCA 3MV9B 2ITCA 5BO1H 2MPAL 2DQDL 4JG1H 2V9RA 4RFOH 1F00I 3FO2A 2OMBA 3QCVL 4ENEC 5DJAB 1BFOA 1YMMA 4EOWH 1N6VA 3L5XH 4UTAL 4OLEA 5E2WL 1FCGA 5E8EB 4UOW1 4ZFOB 1OSPH 5IW6B 3UROR 1ZANH 4KH2A 1SEBB 3RWGA 2F5BL 4X6EA 4LLYA 4TTDD 1M71A 3CFKA 2EZ0D 5JW4R 4J4PC 4PBXA 3MJ8B 4RFEA 2NY7H 4QWWD 1U0QA 4HIJA 3RL1A 1GZPB 2XTJE 2XZQH 2GUOA 3S5LA 3CK0H 3CH1A 1KTKE 4JFYA 4GRLD 3N1PC 3TM6A 4UQ2A 3MLZH 4N5EC 1MFNA 3P77A 4LKCA 2AJUH 1DUZA 5SX4I 2GSGA 1FL6B 2FO1A 1FN4A 4H1LG 3CMGA 4CU8A 5F1IB 4WEMB 9CGTA 3MRKB 4LSVL 4Z7OE 2ZUTA 1CL7L 1GOHA 1TCMA 1JPSL 4MMXC 4MA7L 3C6LC 3VFSA 4UMGA 1OPGH 1HI6B 3QIUA 3ZE0E 3VGDA 4K3JL 2YKLH 3QEQD 1YDPB 3LEVH 3OX8B 1T7ZA 4YFLF 1A7QH 4RSVA 2VDMH 2F19L 2Q3ZA 2C4FU 2JIXB 1JWUA 2VZUA 5JZ7D 4W68A 1CFTA 1ND0A 2R39A 4K8RC 5I75C 5I1IL 1CE1L 2IANA 1GHFH 2HG5A 2ZUQC 3BRDA 3IJYA 3TVMA 5IWLA 2MCPH 3W0WA 1G7HA 1O5DT 2DKSA 1A14L 3MUZ1 4XPTH 1VENA 1WTGT 1GC1H 3IFLL 1KT2B 4M43H 3EDFA 4K2UH 3B3IA 3MRGB 2Y5EA 3QG6B 1QRND 2ZP0T 1LO4L 1AFVL 5E9DD 3TLRA 3G5YB 4O2EA 3SE8H 1SJEA 3MRPA 5E08H 5ADPH 4UIMB 4XNZB 4Y4FA 1KELL 2L4OA 1EGJH 3RI5F 2OP4L 3MNVB 3DIFB 1RVFL 2BRQA 4JO4H 1JWSB 5D7SH 2EDEA 1G6RB 3F7QA 3DXAB 2VQ1A 1ZLWH 1JZ2A 2HFGL 3P4OA 2CGRL 2NXZB 4OD2A 5C9JA 2CJUH 4YHPA 2D4FA 3ES6A 1WBYB 2AJ3B 1UFUA 3WFHB 1G7IB 5EC2A 4LSQL 4GW1B 1JF6A 2OTUB 1WCBA 4K3EH 3GSVA 3HZMA 3WEXB 3FFDB 4N0UE 3VI4E 2UZIL 2VLME 3CFDB 5IB5B 1NAML 4CMHB 4H25B 5I76A 3SE4C 5KVDL 3T8XA 2NY4B 3V6OC 4YHYB 2B2XH 3O8XD 5HD8D 3WIHA 5IB4B 5IV2A 2VRAA 4ISVB 3QDMB 5HHVL 3NN8B 3K1DA 4LLWA 5GZOC 4Q0XH 1T03L 3SGJC 3OXSA 2OXHA 1ONQB 4PGBB 3TBVB 4P3DB 4PJHE 1KUMA 3A6BH 2AEPH 1UA6H 4NC0B 3VH8B 1ZVSB 1QFWH 3U9UB 4XNQB 1T2JA 4N8VA 3BYTA 4HS3A 3K81A 1FHGA 5CMAB 2YC1B 1EEZA 2BSRA 2PTVA 4G43A 3QIWA 3QNYB 1YY9D 3HNVL 4IOSD 2YA0A 3KPQB 3FOLB 4URTB 2FEDC 2WP3T 4NQEE 3MV7E 3EOYG 1D6VH 4OLXH 1H9VA 4JPIA 5DEGB 1EUUA 2W1NA 4YHZL 3QH3A 1R0AL 2VLRE 1MVFA 4XCEB 4JY4B 2HFEA 3NACL 1HQ4B 3JWOL 1KPUB 3DX6B 3NIDE 1FRGH 3DUSB 1J1PL 3BN9C 5D7KE 1NDMB 3FKUS 2XQBH 1EHXA 4R4NC 4WWID 1CICD 3CC5B 1A7BA 1FLRH 2VDKL 5D2LB 3GBML 2ITDA 2VXVL 3HPLB 4MJ5B 4QF1A 4D0CB 1P6AB 4ZAKD 3VFWA 3FOMA 3H9SD 4UDUB 1HXYB 5F6IC 1OAZL 1WWBX 3OPZH 4RBPK 4CAGA 5I19H 2E6QA 3QQ4B 4KWUA 1YN7B 1S5IH 2EE2A 4OF8A 4HIIB 1GGTA 1BOGB 3C6SB 5E2VL 1PDKA 4QHNB 4Y4HC 1XIWD 5MEND 2GK2A 3RIAF 1R5IB 4PUBL 4APQB 5BRZB 4M7LT 5F9DC 4PLNC 5HGBA 1T1ZB 2OCFD 3L5IA 3QUMA 3QZWA 5DJ8B 5HJ3A 2QHRL 1FFPA 3OBAA 3VXSA 4NT6A 1J0JA 1ZLSH 3PXHA 4JCLA 1IGYB 1U95B 1H0DA 1K3ZA 1BPVA 4Y19A 1AGEB 1JPGB 2COQA 3IXTA 1MRCH 1KPRB 1SEQL 1OARL 2Y5TA 1UWGH 1A3QA 5FM5O 4KK5D 2CO6B 3HE7D 4O2FB 25C8H 3LEXA 3ARDB 2Y6SD 2B4CC 5C0IA 4NQXA 2EDYA 2OLDA 4RZCB 1P4BH 1F02I 4G6AC 4YK4B 5HHNB 1S7XA 4XAWH 1YC7A 3UPCA 3BEVA 1YPZE 2OL3A 3VDAA 2EXWD 1H15A 4E41E 1U8IA 4JFXA 4Z76B 4ONGH 1B88A 4G42B 5IVOA 5C08A 4PBVC 1HHHB 3L3KB 2R69H 1PFCA 4YBLC 4O9HL 1KJ2L 4PP1D 3SDAD 4HEME 4H0GA 1V3LA 4I1NB 5KVEL 3CDCA 1DQJA 1K5NB 1Z6JT 4FFVC 4JCMA 2NY1D 2PO6D 4OBSA 1W72B 3QHFH 4RAVB 2D7NA 5JW5A 1ZT1A 2YD7A 1XF4A 2B5IB 3UYOD 3BE1L 3WFDL 5EN2A 5FYLD 1HH9A 1ZXQA 2HTLD 4UU9A 2OMNA 5DD1L 3I84A 4ZFOL 1CDIA 1J7VR 1J10A 1GGIH 5DJ6A 2NY3B 1JK8B 1TLKA 1T7YA 4Z0BH 1D5BB 3G5ZB 3U36B 3ULUH 3EYQC 3VXUA 4D94A 1WAAF 2MNUA 3D0VB 2QQLL 4X6BA 3DYPA 1E4XL 5ENWB 3AREC 2XOTA 3NH7L 4XVJH 3OAUL 3U46B 5HYJB 5IUSA 3TNNB 3MCLH 1BJ8A 1CGWA 3R0NA 3IGAA 1XF1A 2VISB 4OZGF 2DJSA 1AKJD 2Q86A 3N85L 1KB5A 1ZS8B 4QRPE 1PYWB 2IFGA 5A16A 2FO4B 1DQML 1AXTH 5T1DH 4ORGB 3GO1H 2L7JA 3X11A 3HFML 2BVUA 5L2JA 2AJZA 2NY2C 4C4KT 5FECA 3TF7C 2D4DA 1BECA 3HN3A 4EI6B 5I1JL 1FGNH 4X4XA 1G0YR 5DJYB 1CXIA 2FHFA 3EDJA 3DOSA 4BELD 5I1HH 3M17A 4DJMA 4ODTH 2IPTH 3T2NL 1QSEB 4ELMF 1CS6A 2R1YA 4F37F 2Z4QA 4OSUL 32C2A 4Z7VB 1JRHH 4J4PA 5L9DH 3BKJH 3ULVE 5GGQL 3IFNL 2X2YA 4LAQH 4M6ML 2IQAB 2ED9A 2EYTA 1WAAA 1G7JB 4POZC 3O41B 4S0TD 2XTJD 2FX9H 1XT5A 5CINH 2IQ9L 4ZUTB 5JO5A 2GK0B 3MRLB 1I75A 3VRJA 4R26L 3RKPA 1YECH 3IDIB 4GUPB 3UJJL 5DMYA 3MRNA 1IBGL 4DN3H 4DOHE 5EPMB 4I3SL 1GVIA 4OZGA 1QFHA 4WDIA 1JHLL 5HDQH 3VXRB 2GT9B 1E0OB 1MWAA 3FO0L 4HS8H 2B8OT 5E95B 4F9PA 3GMLB 2W60B 4PRHA 5IEHA 3C6LA 2CLRB 4G6FB 1LHZA 1TZHB 4U0RB 5EU6E 1G6RL 3O6MH 2FH8A 3ARBC 4L8CB 1DBAH 4OCWL 3C5SA 4M8QB 2FHBA 3MRQB 4XZUA 2YBRB 3BGMB 1GSMA 3LDBC 4AENA 4C55A 1MQKL 4QHUB 4ONOA 1PKQA 1F45A 1LDPL 4ELMA 1JV5B 2X4OA 3MRCB 4O2CB 1K6QH 4PJCE 1Z9MA 5IJKC 2AK4A 3PJSA 2FIKA 3MRHA 3BZEB 1XGQB 1HOCA 3CXDL 3UTPE 1GH7A 5HY9A 3JV6B 5J8OA 1KULA 4HUNB 2WUBL 3OV6A 3O3BB 3WE6A 1S7WA 3KHOA 2P45B 3DYOA 4XP1L 5DLML 5EO0B 3GI9H 1ZLUH 2Q8AL 1JGUL 4MQXC 3H42H 5IHLB 1FJ1A 1KLGB 5LBSH 1AJ7L 3VH8G 5E5MA 2FR4B 3QQ3B 1VADB 4U1JB 1OT1A 5FK9A 1OAXL 3BP5A 3P4NB 1S7RB 2YZ1A 5GSVA 1UENA 4U3CA 5E1AB 1J11A 1S9WA 1G1YA 4YIQA 3MLPA 1F4HA 3C5JA 1GOFA 4L8SB 5IQ7L 5I1LB 4F33A 3DRQB 2HJLA 2XV6B 4U1LA 4KTEL 3FRUA 2D31A 4Y1AA 1UB5B 2A9MH 2OM5A 2A77L 3IS0X 1UM5L 4NKDB 5BMFL 1L7TH 1L7IL 5IF0B 2AEWA 2IADA 3HE7A 1KJ3H 5D1QC 3TYFA 3O4OC 4WI7A 4JFFA 1DN0B 4L8DB 2VLMD 3V6OA 2OTWA 3NABH 3LN9A 4PRIE 1EJOH 5ID0B 3Q1SL 1T1YB 2WBJC 6FABL 3SGJA 4WCYL 1TETH 4XMLL 1CD1B 3MNWA 1RZ8A 1ZWIB 4PRBA 3O9WD 4JN1L 2X70A 3LRSA 4M1DL 1T1XA 4R9HA 3F7YA 4AQOA 5D5MF 5J9PB 3PWLB 3TZVD 3QDGB 1G9ML 3AY4C 3GRWA 3X17A 2C1PA 1DSFH 3GI8H 4UZGA 2YPKA 5C6TL 5DVOA 1BWMA 2HN7B 3PWVA 5A2FA 2M8XA 1I85C 3RWDB 4KKLD 4LDEB 3MGTB 1G6VK 3OKNA 1A6AA 5D1XC 4LNVA 5FYJE 2BMKA 1IQWL 2X4PA 4L4VA 3MXWL 4U1IA 4NGHH 1D7FA 1YEEL 5F6HJ 1N6UA 4JPKH 4NQED 3Q48A 5CIPA 4YX2H 2FBJL 1CIUA 2Z8VC 3IDYB 2J8UB 1RULH 3VXOA 1QLEH 3GMOA 1UZ6E 1FH5H 2AI0L 1JGDA 4EXKA 4LSSH 2HVKB 4I4WB 5I8OH 3NCFB 4J8RA 4HULB 1I1RA 1FZKB 2DWDB 2XWBB 1KYOK 4N1EA 3VDCA 1FAIH 1A21A 2VZOA 5D7KD 4NBXB 5GS2H 1E28B 2DBJA 1MNUH 3THMH 1DUYA 1AKJA 3IU3A 2B0SH 1KIQB 2EC9U 2FL5B 4DAGL 5I17B 3D25A 1Z2KA 2Y1VA 2ESVE 5DYOB 1AO7A 3FQWB 5GRXG 3O2VH 2GKIA 3MJ9A 1TCRB 5IFHH 1OAQL 4JDVB 1LE5A 5ANMB 1R3IL 5D5MA 4Y4HA 1LO3L 2A6KB 5MHSE 5FOBA 4GXVL 4ODBD 4FTVE 1NCDH 4ZXBD 1CFBA 4RWHA 1EXUB 3B8YA 5CSZB 3EYVB 2H2PD 4UTBH 5DJCB 3ISWA 2ITCB 3QBTB 5JIPA 4Z77A 2J1KA 3FO2B 1T2XA 1W72L 4FP8L 1V5JA 1BFOB 1YMMB 4P0DA 3RX7A 3VGAC 2ZOLA 1A7NL 1NMCC 2CPCA 2G75A 3MV01 1QBLH 1RZKL 4OZIE 4U1GC 4U6HA 3RWGB 3BP7A 4X6EB 4LLYB 1M71B 3CFKB 4NKMA 1ITCA 1MCKA 4RFEB 4HIJB 3RL1B 4WTWA 1NBYA 4UILL 4HPOL 5D7IF 2GUOB 1KEGL 2V2TA 4NFCA 3S5LB 4BYHA 4JY5H 3CH1B 5J57B 4JFYB 1SQ2N 4UQ2B 2W65A 3WS3A 4P59L 1GIGH 3NFSH 3P77B 3NBNA 4LKCB 1CDBA 1ULVA 3UZVB 1DUZB 2RFXA 3VG0H 2GSGB 1OTTC 1FN4B 3WHE0 5E8DH 1NGXA 3BPNB 1LP9F 1DL7H 1A4JA 3AFLA 2HKHL 4E41D 3MBED 4OD3L 3U0WL 5HHXH 3VFSB 4ZYKA 5LXGL 5EBWA 1OAYL 3QIUB 4XCYA 1DTUA 1A3LH 1JGVH 2K3TA 1A1OA 1T20A 2BJMH 5C07A 1JWUB 4CL7A 3F58L 4WY7L 4K07A 1CFTB 4MS8D 5DHVA 1ND0B 1KN4H 5DF0A 4JEGB 3QQ9D 5KVFL 2IANB 2HG5B 3QEUA 1D9KD 2DTML 3IJYB 4PYHA 3RTQD 3TVMB 1F11A 3VI3F 3W0WB 4IS6A 1G7HB 5D7IA 4X98A 3O2WH 2XT1B 5DUBA 4BSVA 3B9AA 3OTTA 3UJTL 1BFTA 3B3IB 5ITBH 4OM0L 3P0YL 4QTHA 5HHPA 4KUCD 4LQ1A 1DP0A 12E8H 3W9DA 3V4PL 1A9EA 4O2EB 1SJEB 3LQAC 3MRPB 1LP9A 4K94L 4QRPD 4Y4FB 3F62A 4KPHH 3UJIL 4HMEA 2FGWH 4HW6A 4BQ6A 5E24E 4B53A 4ZFZA 2DIJA 2V2WA 3M8OL 1TQBB 2IALA 4YQXL 3ZHKA 3QDHA 2DBLL 4HKBA 2VQ1B 4B0MM 4XWOD 5F7EL 3P4OB 4LSUL 4RMQA 3SCMA 4N8CH 5IHUH 4OD2B 5C9JB 4YHPB 5B39A 3ES6B 4JDTL 4WVRA 5GJTH 1RJYA 3KXFA 4B50A 5EC2B 4PLJC 3NIDF 4XNYH 2NY6C 3GJFK 4DFHA 1WCBB 2OJEA 3TJEH 4FQ2H 3GSVB 3HZMB 4FQLL 1EHLH 2BFVH 1L0YA 2VAAA 4V2CB 1KCUL 5I76B 1I9JL 3T8XB 2D0HA 5IV2B 3AS3A 1T89C 2EEAA 3AB0B 1G9NC 4LLWB 4G7VH 3G6JF 3MOAH 2BX5A 1CVSC 3GSUA 1BM3H 3OXSB 4YXKH 1EZVX 1NGQL 3SGKC 4MAYC 1UM6L 4TUKH 3E2HC 5KOVC 3VXPA 3VFGL 1P6FA 4PG2C 1GZQA 2AJYL 5C0AA 5DD0H 1E6JL 2I5YL 4HS3B 4N8VB 2QSCH 4XCFL 3UTSA 3MLUH 4PY8J 1EEZB 2BSRB 3ARBA 4G43B 4PB0H 1Q9OA 3MV7A 4KDTC 2X40A 5ESQA 4I3RL 5EU6D 4OF6A 4KHTH 2VLRA 3RGVD 4GQ9L 4XT1C 4HG4K 5L7XL 4XPHH 4YDLB 4JPIB 3VFOA 4ZOEA 4F8QA 3T4AA 4IRJC 3QH3B 2VWEE 1CIDA 3W2DL 1CYGA 2HFEB 3QFDA 2ADJA 3R1GH 4K3DH 3SO3C 4NYLA 1HH6A 1KN2H 2DQJL 3D39A 1I7ZA 3HTLX 4LCWE 1ZE3C 5A2LH 3U4EB 5BCAA 2WIIA 5JIKA 3MLXH 4Q2ZA 1KENH 2ITDB 4QF1B 3G6JA 3QG7H 1P7KA 3VFWB 3FOMB 5I16A 2WQRA 3LEYL 3MOBL 4NWUL 4XVUD 3FQUA 4FQCH 3DLQR 1OVZA 1VFBA 2NXYD 4U6XA 3L3DA 5HGBB 5J1AA 5EZLA 4ZG1A 3QUMB 3BD3A 3QZWB 5HJ3B 1FFPB 4PV8B 1IAIL 3V9FA 5JQ6H 2PYFA 4NT6B 1EMTL 4KI5E 3CLEL 4NN7B 5KSVA 1J87A 1RFDH 1IAOA 2M2DA 1BVKA 1QFWI 1H0DB 5LQBL 3PABA 1I7UA 4A6YH 4Y19B 1V3MA 4CN1A 3GHBH 1FYHB 5D1QA 1A5FL 1KFAL 4Y5XC 1YY8A 3IXTB 1HKFA 4NQUA 5FYKH 1A6WL 2Y5TB 4Y89A 2DJUA 4D8PA 3L3OA 1A7PL 4PRDA 4QRQA 5J11C 1OAKH 4RMSA 3LEXB 5FYKE 2QADC 3WJLC 1VFOA 4X7DC 5C0IB 3BPCA 4NQXB 4PRID 5HPMA 4KV5F 1M7DA 1S7XB 1H3WM 2CLVA 4M61A 3ZKNC 4TVPH 2GJZA 3BEVB 2OL3B 3HB3D 1MI5E 1MJ7L 1H15B 4WHYH 1U8IB 1CLZL 2E7BA 2UY6A 4JFXB 4TVPE 2WAHA 5C08B 5JXED 2EKJA 2BY3A 5GJSL 5BV7C 4FG6D 5GS3A 3O2DL 4DVBA 4OF5A 2DL2A 1CTNA 2H41A 3U7AA 3UBXI 4F58L 5A2JH 4WENB 3LN5A 1DQJB 1U8LA 3C60D 4UI2A 5DSCA 3TA3D 3EO1A 4LGSB 4TTDC 5EUKA 5LG1A 5JW5B 4JRXE 1ZT1B 1XF4B 4PJEE 1G0DA 5SWZE 3ULVF 1CGSH 5EN2B 5FYJD 1HH9B 3L9RA 3DETC 4UU9B 4ZOAA 5L0QC 2EYSA 5DJ6B 4GRLC 4PRAA 1SM3L 2EDBA 2EE6A 3PDGA 2DKUA 3VXUB 5AG9A 1EUTA 1S9VA 4C56E 3UEZA 3S5LG 4O00A 4X6BB 1JGLL 5CZXC 4LEXL 1NGZB 4OIAA 4OQTA 1H5BB 1TQCB 3WXVH 2E27L 4MXQD 3Q0HA 3BKML 5IG7A 1ZHBA 4YHLL 3IGAB 2H9GA 4XBGA 2Q86B 3BAEH 2ESVD 2P46B 3CH8A 1OQOA 3QAZB 3DHMA 4KK9D 4M4RA 1WT5C 5A16B 4XX1E 3OF6A 3X11B 5L2JB 5MHSD 4JFDE 4PJ7E 2AJZB 2DM2A 3SJVA 5FECB 4BKLA 4FTVD 3WSQH 5AEAA 5BZWA 2R1XA 1MFCH 7FABH 4X4XB 1QA9A 1H3VA 3NGBC 2XI9A 3FZUD 3MXVL 3RP1A 3EIFA 2CDFA 3T0WA 1IC4H 5BVPH 2YRLA 4V1DE 3TT1L 4AIZA 1UYWL 1ZGLP 3M17B 4IDLA 5KTEH 2VXSL 2R1YB 2Z4QB 32C2B 5CP3A 3QA3B 1CDHA 1CFSA 1UCTA 5H35A 3D2UD 2EYTB 3GBNH 3FQXB 2LVCA 5BS0E 5J4MA 5C0BA 3T3PE 3WNOA 5MEOA 5JO5B 1T80A 1F42A 4D0BA 3VRJB 3F65A 4NZUL 5EA0H 5K9OA 4GRMA 4ZOBA 1JI1A 3MRNB 4JG0L 1EEYA 1BEYL 2PKDA 1GYAA 4OZGB 4WDIB 4I8DA 1A6VL 1OQXA 1MWAB 2BP3A 4XP4L 4OKVA 5H8DA 4O02H 4WHCA 4PRHB 5HGDA 3MA9H 5IEHB 4G8IA 5E2UL 3O0RL 4EUPA 1N7ML 5E2JA 3QI9A 3VMOA 3MJ6A 2Y7QA 3ZDYE 1TFHA 3LKPA 4FXKA 3PG2A 3C5SB 4XZUB 3PIQA 3RFZC 5DUML 1I9IH 4P2OD 1RIVL 4X9IA 4AENB 3S3JA 1FIEA 1I8LC 3MLSL 5I75B 1IKNC 1PKQB 5KN5B 3RA7L 3TJHD 4ELMB 1DVFC 1CFVH 2X4OB 3B9VA 2ZUQB 5KZCB 3P4LA 2AK4B 3PJSB 2FIKB 1I9RL 3MRHB 5AG8A 3MODH 4H8WL 1A7OH 1HOCB 1J1XL 5HY9B 1NUNB 3CX5K 4R8WH 3WE6B 1A22B 1FDLL 1S7WB 3IDMA 3WIHL 4HX1A 1JTPA 4EN3D 4HLZH 5IVXE 2GTZA 3UYPA 3LS5L 4XBEL 1JRHI 3BRFA 3CGTA 1FJ1B 3WHE1 2I07A 4HC1L 3ARYA 2P8LA 3F7VA 4M6OH 5E5MB 1LO0L 4YDJA 4Q9RL 5FK9B 3BP5B 2DYPA 5GSVB 4IIQC 4ZNEA 3JWDH 4N8VG 3VFVB 1SBBA 1S9WB 4YIQB 3D69B 3C5JB 3CXHK 2MPAH 2DQDH 4F33B 1DBML 2X4TA 2HJLB 4U1LB 1FYTA 1OP5K 2NY5L 3QCVH 1FSKC 4NKQB 2ZJSL 3FRUB 1FV1A 2D31B 4UTAH 4Y1AB 5E2WH 4UUJA 1AE6L 1UZ6F 1UWXK 2F5BH 3IDJA 5I9QC 2P4AB 5ITFA 1KTDA 2IADB 4XH2A 3HE7B 2X05A 3TYFB 3PNWA 4MVBC 4CW1A 4JFFB 2ZPKH 4G9FE 1INEL 1IM9D 4JFEA 5AUMA 2OTWB 3FAWA 4UV7L 5DC0A 2EDRA 4PJBE 2ERJC 2EDWA 5SV4A 5FM4A 3SGKA 1P5VA 3CFEA 3L6FA 1CGUA 3EZJB 3MNWB 1RZ8B 4PRBB 4O51A 2X70B 3LRSB 1A02N 4H1LH 1T1XB 3SDDA 3F7YB 2K7PA 1CL7H 2C1PB 4MA7H 5F9AC 3G6AA 3FQTA 3TA3A 2YPKB 3UC0L 2XY2A 3QZWG 3PWVB 4K3JH 5HGHA 3DURA 4GRWF 5E6YA 3QUML 5CEYA 2F19H 3EDKA 2QR0A 4BQ9A 2DM3A 3OKNB 2AK1L 1A6AB 5I6XC 1JE6A 2BMKB 8FABA 2X4PB 3OB0K 4L4VB 4U1IB 5T5FH 5F88A 5I1IH 1CE1H 2NX5E 5CIPB 1QYGL 1IC1A 3VXOB 1N0XL 3GMOB 1JGDB 5HDLA 3IVKA 5JMOC 1A14H 4J8RB 2JLLA 2E7LA 3BKCL 4JKWA 3V52L 3BWUC 1CDGA 3SDCA 1DUYB 5ID1A 1AKJB 3IU3B 4LCWD 1HKLL 2BNRE 3TBTA 2VDNH 1AFVH 3MTRA 3D25B 1MSPA 1J86A 1AO7B 1NUGA 5HVHB 3BDYH 4ZS6C 3SDAC 2OL3L 1LE5B 1KELH 2VQUA 5D5MB 4Y4HB 2OP4H 3SKMA 1OP9A 1RVFH 5FOBB 2K9UA 2BY0A 4AEIL 3TCLA 2OBGA 2HFGH 2CGRH 2R0ZL 1Y6MR 4RGNE 3OKLA 5KSAC 3SPVA 1IGIL 4Z77B 1VGEL 1FFNA 4JQXC 4LSQH 2DQUH 5I8EB 2ZOLB 4KI5D 4PB9L 5INDA 5DMJB 2Y36L 1X3DA 1BQUA 1FZOA 2G75B 2WWKO 3MMEA 5JHLL 1EEUA 5C6WH 2UZIH 4U6HB 1XGPA 3BP7B 3UO1L 3OSKA 1NAMH 4NKMB 5HHOA 2F54E 5KVDH 1NBYB 2HJKA 1QACA 3EZ8A 4M6AA 4J3UA 2HT2D 2WINA 5HHVH 2V2TB 2J8OA 5C2BL 3B5HA 1IKFL 3BZ4A 1T03H 3VA2C 4AIXA 3MV11 5E8NA 4JPWL 3STZA 4OGXH 5FYKD 2W65B 5E6ID 3WS3B 2A0LD 1X4ZA 1CD0A 3LB6D 1QFUL 2I60L 4J3VA 4ZTOL 1WZKA 2RFXB 4W81A 4FN0A 4AH2A 3BISA 4G6KL 1NGXB 3KG5A 2DQFA 4MA1C 1KCVH 1A4JB 1MI5D 4FQXA 4YBLB 3TNMA 3KPPA 4IHOA 4TVPD 5TQ0L 4PGJA 3HNVH 4EBQL 4ZYKB 5EBWB 4XCYB 1I1AD 5IBTL 4E9LA 2MHAA 1A1OB 4OCSL 3U48A 4I2XA 4LL9A 1T20B 5C07B 1NGWB 2OR9L 3MO1A 4YHZH 1R0AH 1ZSDA 5F96L 3NACH 5DHVB 5GRJL 4JRXD 2ICWA 3WS6C 4Y4KD 5SWZD 3AXLA 1J1PH 4JDZA 2XTJC 1FG9C 3QEUB 4S1SL 5FB8A 4W4NA 1OT2A 1NCCL 3S35L 3W81A 2AV1A 2R2BA 3DJ9A 1IL1A 1F11B 2VDKH 4IS6B 4FZEL 5D7IB 3GBMH 1HEZA 4L9DA 4X98B 5MI0C 5DUBB 2VXVH 4BSVB 4C56D 4H0HB 5HGGS 2G5BA 3OKDA 1OAZH 1MCPL 4XGZA 4ZO8A 3CVHA 4QTHB 5HHPB 1T66C 1ZVHA 3W9DB 1I7RA 1SY6A 1A9EB 4XNXL 4Y8DC 5SX5K 1YNLL 1RZJL 5E2VH 1MWAL 2V5TA 1LP9B 5GGRY 4PUBH 2XKNA 4HUKB 2NY2B 1X5AA 3CFIC 4J3XA 3ZDXE 4NO5A 2IC2A 1CXFA 4ZFZB 4HAGA 4JHWL 4ODHL 3HG1E 2V2WB 4OGAD 1MVUA 2IALB 1NJ9A 1KEMH 4Z7NE 2YD1A 3SCMB 1N5YH 2NMSA 2FDBP 3OJVC 4M7LL 2G60L 5B39B 4KMTL 1MAML 3FRPA 1RJYB 1OD7A 3KXFB 1BVLA 4X83A 4AEHL 1A1MA 4AY0A 2LTQC 4V1DD 4HBCH 2OJEB 4G6ML 1OARH 2ZUSA 1B2WL 3IF1A 4X9GA 3BOVA 1JZ4A 2YPLE 4X7EC 4ZPTA 2VAAB 1BIHA 1JZ6A 3MBXH 3ZKQD 3VXMA 4WI4A 1T7WA 4TOYL 4HSQA 1QTYT 1GC1C 5BS0D 2OX5A 4LHUA 1G7QA 2SEBA 3GSUB 2EH8L 3QSKB 2A6DA 2H1PH 1QP1A 1QBAA 2P5EA 3RKDD 5IMMA 3VXPB 1PSKL 4QLRA 5I1DA 1GZQB 3BZDA 5C0AB 1L4IA 3S36L 2C3XA 1KJ2H 3FO1A 2YD8A 2ZUUA 1S7UA 3UTSB 5JA8B 3ZO0A 5KVEH 2RHEA 1JIBA 2YUWA 3ARBB 5DVKA 1BZ7A 1Q9OB 3MV7B 2BNQA 2V5MA 5ESQB 3BE1H 1IC5L 3LDBB 3MV9E 1AXIB 3QULA 3WFDH 1I8LA 2VLRB 3BQUD 1Z0MA 5DD1H 3U1SL 1PZ5A 3VFOB 1DVFA 3T4AB 1PEWA 3RI5K 2RJMA 3QFDB 2ADJB 2X41A 4FHBD 3K4DA 2QQLH 4NYLB 1HH6B 3ZDZF 1E4XH 4R0LC 1ZLVK 2UWEE 3NH7H 4ZS7L 1EVUA 3D39B 1I7ZB 1TZIA 3O9WC 3OAUH 1FFOA 5GGTH 2WIIB 2KZ1B 4NZRL 4Q2ZB 3TZVC 3G6JB 3S6CA 5HDBF 5HI4D 1P7KB 1S9YA 3KLHD 1F6FB 5FO9A 5I16B 3A67L 1WISA 3OJDA 2X1WL 1XCTA 4IIQA 1DQMH 5ACMA 2YD6A 3HFMH 4OFYD 4EQ2A 4KKLC 3FQUB 5KSUA 1GL4B 3GRWL 3E6FA 4QNPE 1FFRA 3ZE2E 3WHXA 1PVHA 5DR5H 1VFBB 2VDPL 3INUL 4U6XB 5J1AB 3CSYA 5EZLB 5I1JH 3ZKXB 5DHYA 3NMEA 2VABA 2HLAA 4LPTA 3O45A 2PYFB 3VGBA 2NZIA 4KMQA 5CJQL 5FHAL 5KSVB 2O5YL 2A83A 3T2NH 1IAOB 1BVKB 4OSUH 3T2PA 3PABB 1I7UB 3DO3A 5GGQH 5D1QB 1G0XA 4M6MH 3QUXD 1YY8B 1QD0A 1B4JL 1J0ZA 1HHIA 4MD4A 1XZ0A 1QR4A 3DSFL 1J1OH 5E6IA 4D8PB 3L3OB 4PRDB 5DA4A 2IQ9H 4QRQB 5IIEA 2NW2A 4R26H 4P46C 4G9FD 2DLTA 3UJJH 1OGTB 3UZQA 3BPCB 5HPMB 1IBGH 1M7DB 4YBQD 5HTSA 1QFOA 4I3SH 2CLVB 1ACYL 2DJ4A 4LSTL 3WKMH 4M61B 1OF2A 1UACL 4MQTB 2GJZB 3FO0H 2QV2A 1F4XH 4R3SA 2H2PC 3MJ9L 2BCKA 4M48L 4NJAL 2NYYC 4JM2D 1EDQA 3OAYK 5C1MB 4XPBL 4DVBB 1G6RH 1F4AA 1TIUA 1OWRM 3GFUA 5DVMA 5IFJA 1N26A 4OI7A 4JRXA 5DD3L 3FONA 3LN5B 1U8LB 3NCJL 3U6RA 2Q20A 3BKYL 3WIIL 1MQKH 5DSCB 1OY3B 3EO1B 1KGCE 5EUKB 3T1WA 4HGKC 5F7MC 3C2SA 5D6DC 3NCYP 4YHOL 3L9RB 1YC8A 3PUCA 1XGYH 2YWZA 3GSXA 3OJMB 2EYSB 5F6HI 2NX5D 3RIAK 1U8NA 1LDSA 4PRAB 2E9JA 3HPJA 4GAGL 1IARB 3HMXA 2WUBH 3T3PF 4UT6L 1S9VB 2EICA 4XP1H 5JOEA 2Q8AH 2Z31A 1JGUH 3EJYD 1JZ5A 3PQYA 4NKIL 2B4CL 3RDTD 1M6OA 4ZTPL 2KDGA 1T0PB 3CVIH 5IG7B 3VWKC 3MROA 2BNRD 1ZHBB 1OAXH 2H9GB 1I3VA 3JV5A 4XBGB 2GQHA 2YUVA 3CXHJ 5C70A 3HLAA 1X5JA 4JFDA 1DLHA 1YYLL 4LU5H 4QHKI 5IQ7H 4LMQI 2DQHL 4XMPL 1F90L 1XR9A 3CSBA 1EZVY 4KTEH 3SJVB 1T22A 5GRWA 4BKLB 5KSAA 4HWEH 4MS8C 5BZWB 1IZKA 2GIYA 2R1XB 4JQXA 1QA9B 1FVDA 1GOGA 1UM5H 3VGAB 4RGND 1B6UA 5LVEA 1D9KC 4XPFL 2CDFB 1L7IH 4AIZB 2D7TL 1IZJA 4GS7C 3MRDA 3ARFC 3MOQA 3FCTA 3V8CA 1V3JA 4DTGL 4F9LC 3BVNA 4M7KL 1CFSB 1JHKL 4NKOA 5H35B 5J06A 5FCUH 4UBDC 1VKXA 3ULUC 3Q1SH 2BSSA 1W0VA 5JORA 2F54D 2FECI 5IVXF 3TP4A 4XI5D 1MQ8A 1UQSA 4NN5C 3DSNA 4Y2DA 5C0BB 1WV7T 4CMMA 1EO5A 5MEOB 3N9GL 4Z5RA 2D0FA 4D0BB 5B8CC 5D2LE 4JN1H 3RAJL 5K9OB 4GRMB 4M1DH 1UKQA 3R4DA 1EEYB 1PKOA 3VDBA 4RA3A 3FB5A 1RZIA 5AWNH 4P2QE 3P11L 4OKVB 5C6TH 2YD4A 4KTDH 4MMZC 3RJQB 5HGDB 1P1ZA 4G8IB 3UTTA 4I9WE 5CUSL 4EUPB 1CXLA 2VO5A 3QI9B 7CGTA 4YE4L 1TXKA 4LVNB 2V9TA 4PJ9C 3CMOL 4JFQA 5BRZE 1F58L 2Y7QB 1UVQA 4U7KA 3IDXL 3LKPB 4FXKB 1IQWH 3RRQA 3QUYC 3MXWH 1TNMA 3PIQB 5B39G 4MQSB 2VKXA 2JB6A 2FBJH 2EEBA 5HYQA 2FJGA 3N1GC 4YFEA 2AI0H 4NO0A 4BFEA 4GKZA 4PS4H 3VD3A 5FIEA 5E1HB 4P3WA 1VERA 1ERNA 5IVXA 4DAGH 5JW4M 4KKAD 1WUNT 3IDMB 3GKWL 4HX1B 2GTZB 1OAQH 2N7BA 2I07B 2MCG1 5GISL 1R3IH 2YRPA 2P8LB 1X6LA 2ZZUT 2W38A 4YDJB 3BPOC 1LO3H 4EI5C 2XICA 2DYPB 1T4KA 3RIFK 4F7TA 4KQ3L 4S1RL 1KXQE 4LCIL 2X4TB 3BPLC 3KDMA 1X5XA 1QHPA 1T3FA 1FYTB 1WFNA 3HG1D 1W72H 4FP8H 4WU5A 4PLOB 1CVRA 1FV1B 3TN0D 2VMFA 2OR7A 4JAMA 3HUJA 1RZKH 4UUJB 1T04A 2NY6B 3IDJB 4KROD 1JGEA 3QXWA 2XQYG 3VCLA 5ITFB 5CSBA 1KTDB 4QXUL 4XH2B 2N1KA 3LQZB 3PNWB 1KEGH 5EORH 5CLWA 4CW1B 4LF3A 1C08A 1Z3GL 3AS0A 1KIUA 4JFEB 5AUMB 4L8BA 3C5ZD 5JNYA 4P59H 4G8FA 5DDHA 3BYYA 4XVUC 4K9EC 2AXGA 3S96A 3CFEB 3L6FB 4R96A 3E2HB 4O51B 5HYJE 5TDPA 1QFWM 2HKHH 3SDDB 5EU7E 4D2NA 4OD3H 1QVOA 4WUKH 3MUJA 1SJVA 4L9LA 5ICZA 5LXGH 2A74A 2ARJA 3G6AB 1OAYH 3FQTB 4ZUWA 2FEEI 3B6SA 3S35X 3TA3B 1BQHA 3HNTL 3TV3H 3DURB 4MD5A 3ARQA 3HI5L 3RUGF 4LVHB 5CEYB 1AI1L 2DI8A 4P23C 2NR6C 1Z9SA 2KQNA 2QR0B 2NPLX 2XG5A 3F58H 4WY7H 4NFDA 1U3HD 1X5IA 2J2ZA 8FABB 3GSNH 3MV9D 5F88B 5KVFH 2EDQA 1NMBL 1N64L 4NHCL 1F2QA 3CNKA 4OZFG 3V7AE 5C3TA 4E0RA 1QSEE 1FE8H 1EK3A 3BIBX 3K80A 3TGXA 4Z7VE 3IVKB 1NEUA 4UT7H 3D18A 4X99A 3UJTH 5L88H 3CDGA 1AD0A 1P5UA 3DVFA 4OM0H 4ODSL 3IXAA 3P0YH 3HB3C 4LFHD 3SDCB 5I8KH 5ID1B 1YEIL 4TRPL 3K46A 5FKPA 2RR3A 1HYSC 3TBTB 3UPAA 3V4PH 2Y4SA 4I0CC 3RVTD 5JXEC 3QQNA 5GIRA 2NNAA 2ICEA 4K94H 4KJWD 2GY5A 3LQMA 2I24N 3SKMB 5ECJE 3C60C 3M8OH 5IESL 3RY6C 3LS4L 3X13A 3TCLB 2DBLH 5EOTA 4GRWB 1V7NL 4LSUH 4JKMA 4HK0A 2VERN 2Z35A 3NFNA 3RUGA 3ZE1E 3OKLB 5IHZA 1MCFA 3SPVB 5I1KL 1J8HA 4PBWD 1JMXA 1FFNB 1Z0NA 1CL7I 3P0GB 4N1HB 5INDB 1FZOB 3MMEB 3L5JA 4FQLH 3MLTA 2WBWB 4OCLC 1MOEA 2MJWA 2E9BA 3JZ7A 1XGPB 2JIXD 2WP3O 3HC0A 5HHOB 1KCUH 3ZYOA 5EB9A 2RBLA 2NW3A 4MXQC 2Q7NA 4D0DA 2HJKB 3IDGA 5DRZA 4U6YA 2WWMC 4P46A 5J11B 1P4IL 4PD4J 2WINB 3ARZA 2QADB 1MY7A 1DEDA 5E00A 1N6QL 3BZ4B 1JBJA 4FNLL 5E8NB 4R7DA 4OQTL 1OHQA 3STZB 4KKBD 1UM6H 3TBWA 3BMWA 5CJ5A 3PDOA 3VFGH 1QZ1A 3SY0A 1NL0L 3EW3B 4AH2B 1E6JH 3ZDXF 5C0CA 2DQFB 3ALWA 4XCFH 1ZEAL 3TNMB 5BV7B 4FQXB 2E3VA 3MRRA 4WFEE 3KPPB 3CJJA 2MQ3A 1NC4A 4IHOB 3FZUC 1NQBA 3IFOA 4EEEA 4P2RE 1ZA3A 2XXCB 3MRBA 4QRRA 4JO1L 3AROA 3OXRA 2MHAB 5L7XH 4I2XB 5D6DA 3UAJD 3MO1B 1UKSA 5I74C 3B9KC 1PG7X 1H8NA 1ZSDB 1KGCD 3W2DH 3ULVL 2AXHA 2XWJA 3WNMA 1YUHA 2ICWB 3JTTA 3C87A 3AXLB 2NXZD 4JZJC 4JDZB 4RGMB 1RMFL 1PX3A 5FB8B 5I1AA 3ULUF 2Q1EA 2AV1B 2X9WA 2DQJH 4P2YA 2R2BB 1IL1B 3JWNC 4PJDF 3LKRA 5I1EL 1YEJL 2QQKL 5D96C 1AQKL 2H3NA 2G5BB 4PP2A 3OKDB 4XGZB 3LEYH 3MOBH 3CVHB 3VMNA 4NWUH 5ACLA 4J2XA 2R2HA 2NY4D 5DJ0A 1I7RB 5C9KA 4QXGH 3QDMD 2YA2A 2CR6A 3MZTA 2NCMA 4J1UA 5GRUL 5GRZA 3CAFA 3FB6A 1FL3A 1XF5A 1YQ2A 4J6RL 3BW9A 5JHDA 2XKNB 3BGFB 2DQTL 5H94A 4P2OC 4NO5B 3ARSA 1JHTA 1JFQH 1IAIH 4LCCB 1MVUB 5IFAL 1EMTH 1NJ9B 3CLEH 1R3JA 1SVZA 3NGBB 3TJHC 4CGTA 4BM7A 1IGTA 1KCRL 5LQBH 1TTGA 1F6LL 3ARFA 3M07A 2HLFD 1BVLB 1I3UA 4N0YH 1AY1L 1A1MB 2YPLA 2ZG2A 4HF5H 4G5ZL 3LIZL 5CZVL 2UWEF 4HWNA 4KJQD 3IF1B 4YXLL 2DQEH 2J8UE 1A7PH 4ZPTB 1B9ZA 3Q2CA 3KS0J 1MIML 3RVUD 3KVQA 2CRMA 4PJDA 2P49B 3CCHA 3VXMB 5MEQA 5C0GA 4JKPL 2LABA 5B8CA 3L7FA 1UCBL 1MFAH 2CRYA 4ONHA 4LHUB 1HZHH 2PUQT 1NBVL 1G7QB 2SEBB 1B0RA 1NFDF 2QSQA 1MJ7H 3DARA 2A6DB 1CLZH 3C9NA 3H3BC 3LQAL 3AGVA 2P5EB 2X10A 2OS7A 5F7UA 5IMMB 3ZE2F 5I1DB 3RX5A 5GJSH 4RGOH 2CIIA 3H3KA 3PGCA 4RIRA 3VW3H 1JNHA 3O2DH 1K8DA 5ANME 3FO1B 4F58H 4L4TE 4P2QD 1MH5A 1S7UB 4U1NA 3L5WB 4PJ9A 4RAHA 1BZ7B 1JP5A 4I9WD 5ALBH 3QUYA 5EIVA 4LEOA 2BNQB 1OLLA 4APQD 1MCIA 5BRZD 3QULB 2FATL 1FP5A 1PZ5B 2H32A 1DVFB 5GRVK 1WC7B 1YMME 2UVFA 4OLYL 1SM3H 3LMJL 1TZGL 3ESVF 2UWEA 4KZDL 3O6LL 4U7MA 4KY1L 5E7BA 1JGLH 1DDHA 4LEXH 3TESA 4IOFD 2X44D 1TZIB 4LLDA 2HT3D 2E27H 1FFOB 1A2YA 1LO5A 3BKMH 2NZ9D 1IC7L 1L0XA 1NFDA 1S9YB 5FO9B 4NM4L 4BK5A 4EI5A 1MCEA 3ARDD 3OJDB 3QCTL 3N50A 1GGBL 1XCTB 4IIQB 4K3GA 1XFPA 1CXEA 4LP5A 3RPIA 3RU8H 2HVJA 5KSUB 3HZYA 3E6FB 4IRSC 3WHXB 4P5MA 4LLVA 3UDWC 3GZKA 3VA6A 3CSYB 5DHYB 5FF6B 4G9DA 2VABB 2R23A 3MXVH 2HLAB 3BRGC 4TVSa 3O45B 1GGYA 4I18C 3H9ZA 3TT1H 1UYWH 1CU4H 1JZ7A 1RHHA 3E1F1 2VXSH 1AR2A 3O3DA 5I9QB 4ETQA 5MERA 1C5CL 5FFLA 2VE6A 4D9LL 5IOPA 2KBGA 4LVEA 2Y25A 4CU7A 1HHIB 4MD4B 2F53A 5D72L 1XZ0B 1ZTXL 5E6IB 3U9PL 4ODUA 4MA8L 5F71A 3RBGA 5IIEB 2NW2B 4NNXA 4J3WA 4NZUH 3W0WE 2ERJB 2DD8L 2CK2A 4JG0H 3WNPA 5FUZL 5K9QG 1BEYH 4ACPA 4XP6L 2EO9A 5AZ2L 1OF2B 1TDQA 1A6VH 2E7CA 2CR3A 4XP4H 4R3SB 1E4XI 2A73A 2BCKB 4JZNA 4A2MA 1FNHA 5FO7A 5GRYA 5HYJD 2M1KA 3O0RH 5E2UH 2P42B 3VFTA 5JR1L 1N7MH 3GJFA 2CLZA 4ALAL 5I1CL 3BHBA 4WNQA 1G7MA 3T1FA 3DMMC 4LOUD 5KVMC 4P23A 5IFJB 2EDNA 3Q6FA 1P2CA 2YRZA 5DUMH 4JRXB 3VFPA 1ES0A 3FONB 3U6RB 5I6XB 3PP3H 1LK3H 2E8YA 5F3BA 5I30H 1M7IA 4GSDL 4LP4A 3RA7H 3DVIA 4MDJA 5IMKA 4Z9KB 3HCVA 3MJ7A 4GFTB 2X1PA 2HT2C 2XG4A 5CZKA 3REVA 4H8WH 1W0YT 2CK0H 3GSXB 2FB4L 4Z0XA 1U8NB 2DIBA 4HZAA 3HPJB 4KZEL 3B83A 3RVVC 1QSED 2YK1L 1YNKL 3GIZL 1FDLH 3K8LA 2A0LC 4M93B 5E4IA 3LB6C 2BK8A 3WIHH 2Z31B 5HI3C 3VWJC 4HT1H 3LS5H 3PQYB 3I9GL 4OLZL 4U1SA 1M6OB 4HC1H 4ZOCA 2LFGA 2HP4A 4R97C 1LO0H 2CO7B 1CE6A 3MROB 1BQLL 4GBXA 2BERA 4Q9RH 2Q8BL 1CFQB 2C3HA 1KJMA 5C09E 1I1AC 3SKJL 3HLAB 4DKDC 5HYEA 4JFDB 1DLHB 5BV7L 3H9HA 5F7DA 1XR9B 1N8ZA 3MJGX 1T22B 4EZMA 4S0SD 5KSAB 4M5ZL 3ARGA 3MCKA 3S3SA 4HJJL 4Y4KC 3HNSL 3LVEA 2HH0H 4J23A 5D93C 1AE6H 4PJAF 1FVDB 4GAJL 1BZQK 4G6FD 1MCOL 1UH3A 4ZO7A 4N0RA 3IB4A 3MRDB 3FCTB 4OF3A 3NCBB 3BVNB 1INEH 4WFGE 4NKOB 2ZCKL 2GYSA 2FBOJ 1VKXB 4UV7H 3SGDH 2BSSB 1W0VB 4L3EE 5JORB 2GITA 3RNKB 3K3QA 5EOQL 3ME0A 1UQSB 5ADOL 4Y2DB 3S37L 3ESUF 4JJHA 4Z5RB 1LGVA 1QEWA 4NM8L 3CVHL 3U30C 5EG6C 1SY6L 3FB5B 4MA1B 2A9NL 1FO0A 1RZIB 2ICCA 3UC0H 2BVEA 1P1ZB 1I7TA 2ZG1A 3MACL 3QEGL 3UTTB 4U2YA 5IQ9A 3QUMH 4WFED 1J88A 5E5RB 5E94A 2BY2A 4JFQB 4FMFA 1JPFA 1UVQB 4BUGA 4ZD3L 2ICES 4JY6A 5FGBA 3UTOA 4PJAA 3B9KA 3KS0H 2JB6B 3FRPG 1QYGH 5FUOL 1T2QL 3VXSE 2UUDK 5HYQB 1N0XH 2FJGB 5GGUA 4Z7UE 4NO0B 1OW0C 4GKZB 4X7SL 2ZUXA 1T5WA 4HPYH 3WFEL 3JVGC 4C54A 4Y19E 3OHXA 5DMGD 3BKCH 5D1ZD 3V52H 5MI0B 2FGZA 4MDIA 3LHPL 3RWJA 5IVXB 3CU1A 3QFJA 1TVHA 3OZ9L 4NJ9L 4LARL 3RKDC 4LHUG 5I1GL 3V5KA 5CGYD 5IBLC 5DQDL 3QPQD 3FN0L 3I3BA 4QOKA 2FZ3A 4R90L 3P73A 2GAZA 1ZVYA 3WUWG 3UYRL 3ZHDA 1FQ9C 1T4KB 4XTRD 4BH8A 3PF2A 2BRRL 4F7TB 4N1CA 1U8QA 5D70L 3BQUC 5C08E 4CN6A 3EOTL 3VXNA 1IGIH 3QDGD 2QKIA 1T3FB 4MA3A 2Y72A 1VGEH 2EDDA 4WU5B 3QUZA 4PB9H 1E4WL 2Y36H 3KYNA 4JAMB 3HE6C 3ILQC 3LN4A 1WIUA 3HUJB 3B4NA 5JHLH 1V7ML 4N8PA 3ARVA 1T04B 4X8JA 1RUAL 3UO1H 3OR6A 1JGEB 3VCLB 4CKVX 5FUCE 5DTFA 1VESA 4RA0C 2B20A 5DK3A 4LLMA 5DUPL 4XP5H 3OWEA 4GKSA 3SOBL 5C2BH 1IKFH 3UP1A 2C3WA 3L1OH 2GHWB 4LF3B 4CBPA 4JHBA 1C08B 2LAGB 3IKKA 4JPWH 4L8BB 1VSCA 1D5ZA 1LK2A 2MQ0A 5JNYB 5LKNA 3TCXA 1QFUH 4G8FB 2JB5H 4OCYL 5DDHB 2I60H 3S96B 2AXGB 2GFBA 4ZTOH 3WYRA 4R96B 4DW2L 4UNVA 4I0PA 2BHZA 5DT1L 4LSRH 3BSZL 5HVFB 1G7PA 1YEGL 5C2UB 5TDPB 1B0WA 3EO0A 3MYJA 5DMIH 4MAUL 1I4FA 4Y16D 5TQ0H 5BOPA 1QVOB 3V0WL 4EBQH 2YUZA 4L9LB 5ICZB 2X89D 3JWDC 2A74B 2ARJB 2BVTA 5E5UB 4ZUWB 5AAWA 3ZE1F 5ELIA 3B6SB 4OM1L 1BQHB 5IBTH 3MLRL 4MD5B 1NGPL 4L4TD 3IDNA 4ODXA 5GZNC 1P9MC 1MHHA 2FX8L 2OR9H 1X5FA 5F9OH 3QYCA 4TUJA 1RUML 3QUXC 5GRJH 1F3DJ 5B38A 1HCVA 2R0WL 1IAMA 5AAMA 2AGJH 4K23L 2W0LA 35C8L 4HWZA 4S1SH 1NCCH 3S35H 3D85A 4E0RB 1YMMD 4PGDA 1VPOL 2NTSP 3RPKA 4FZEH 1E4KC 4WTZA 1T6WA 3D18B 4L1HA 4YBQC 4X99B 3CDGB 3P0VL 4Z8FH 2EH7L 4TPRL 1WAAE 3IXAB 4M7JL 2VXUL 4L1DA 4JB9L 5FKPB 2B1AL 5C0NC 4XNXH 2XY1A 1BREA 1YNLH 2H45A 3QR2A 1RZJH 5GIRB 1MWAH 2NNAB 2ICEB 1KLUA 2J4WL 3VRLF 5GS0L 3IAGC 4OZGE 4IRSA 4P9MH 3O6FC 4JHWH 1W2KT 4ODHH 2R4SH 3UDWA 4PLKD 3X13B 5T1LA 2C3VA 4PRHE 2CMRL 5EOTB 2K1MA 4HK0B 3RUGB 3NFNB 4Z7WA 3NPZB 5IHZB 3A6CH 5CEZL 4M7LH 1AR1D 4I13B 1A1NA 1J8HB 1HK6A 4KMTH 1MAMH 2BOBA 4GOSA 4AEHH 2AXFA 3QIUD 2FLBT 4C59B 3KWWA 4G6MH 4S1DD 1B2WH 1H8OA 3MLTB 1MCJA 3GSOA 4GKNA 5ESAA 3EJYC 4OGYL 3HC0B 3RDTC 4CUCA 4X9HA 4ELME 3TBYA 1D5MA 4GMTL 3HMXL 2NW3B 3QIBC 2W9EL 2AK4E 4D0DB 4TOYH 3IDGB 5DRZB 1XF3A 2VDQL 4U6YB 3PL6A 4P46B 5E2TL 3OB8A 4JO3L 5E00B 4KJPD 2DF3A 3TVMD 4R7DB 2EH8H 2VZSA 3UTZA 3W0WD 1RIHH 2V5YA 2CUHA 3TBWB 43C9B 3BI9X 1PSKH 3PDOB 1T7XA 3SY0B 4HJ0D 4WI6A 3S36H 5C0CB 1YN6A 4AQ1B 4P2RA 1UB6A 3MRRB 1KB9J 4LASL 3DMMA 4LPCA 4OI8A 1NC4B 4RGNC 5EUOF 5ILTL 3P40A 3IFOB 5ALCL 1ZA3B 5I15L 1IC5H 3MRBB 4Y4FD 4QRRB 1Q9WA 1U92A 3WL9A 5IROC 4KK8D 3OXRB 3U1SH 2ARJQ 3AS1A 2AEQL 2XKUA 4OD1H 3FN9A 3ZHLA 1F4YL 1ZT4A 3LV3A 4HS6A 4Y1AE 5D1ZA 4A6YA 3WMSA 2XWJB 1YUHB 3JTTB 1OSZA 3SKOA 3GSWA 5CAYB 4W70A 3NCEB 1HNGA 4ZNCD 5ICYA 5I1AB 4TQEL 2JE8A 3VWJA 1FNFA 3LKRB 4NZRH 1U41A 4MB5A 4JFFE 1Q1JL 3PP4L 2H3NB 1PG7H 3V6OE 3F6LA 4PP2B 4HFUL 3DHJA 2W91A 2R2HB 4UV4L 5DJ0B 2A6JA 2WZPD 4N0CD 4X6CF 5I73C 4J1UB 1RIUL 2J8HA 3FB6B 1FL3B 1XF5B 5K33A 5C09D 3BW9B 3INUH 5JHDB 1VFAA 2D7QA 4LCUA 5EUOA 5H94B 4NC1C 1LO2L 3LCYA 5AD0A 1DBBH 2MOVA 1WZMA 1NCAL 5BO1L 4JRYE 4RFOL 1R3JB 2O5YH 2KUTA 1DN2A 3HAEA 3VD5A 4WWKC 4ZODA 5EBMA 1IGTB 5T1KA 3RX8A 4OLVH 3HZKA 3QIWD 4GS7B 5CIPH 3ARFB 2X4NA 1YEFH 1P53A 1QSFA 2WUCL 4L4VE 2YPLB 5L6YH 1B4JH 1P84K 2VH5L 5F70A 2UV3A 4KKAC 5E03A 1XR8A 1ZHNA 3DSFH 1WF5A 5E4EB 2NY7L 1A7RL 4PJFE 4X4ZA 4BSJA 3GK8H 4OI9A 1OP3H 2AERT 4PJDB 3CCHB 4WFGD 3TPKA 5MEQB 5IVZA 2EYRA 2C3GA 3CK0L 2APTA 1YZZA 4L3ED 5B8CB 2W07A 4LSTH 2RAMA 3BX7C 1ACYH 3B5GA 3L7FB 5CKGA 1N3NA 1NCBL 4ONHB 4Y16A 2Q7YA 1B0RB 2JJTC 1H3XA 3MJ9H 3MLVL 3T3MF 1NMAL 3C9NB 3BESR 3GGWA 4X6CA 1AO7E 2LVEA 2R4RH 4L4TA 5JW3L 1JNLH 2CIIB 3FMGL 4YUEL 3PGCB 5J13C 4RIRB 4XPBH 1JNHB 1K8DB 3OAZH 1KXVC 3TN0C 5D5ME 3WJJA 1MH5B 1RY7B 4U1NB 2EO1A 3U0TA 4PJ9B 5K9KA 3WN5C 3MX0A 3S88H 3WIIH 3BKYH 1FVCA 3QUYB 5F7YC 4DZ8A 1SHMA 4KROC 4LEOB 3VMPA 3BD5A 2IPUG 4YHOH 4WV1C 2V6HA 2H32B 3VXSD 5J89A 3JVGA 4HK3J 1WIOA 3C5ZC 2PXYC 1IAII 2UWEB 4UT6H 1J8KA 2FYYA 2DQIL 1KF9B 1XCQA 1DDHB 4Y19D 2VR4A 4NKIH 2XRAH 4JFZL 4LLDB 3STLA 1GC1L 4ZTPH 1A2YB 1LO5B 4NQDA 3QJFA 3TC9A 5T3XL 1SMOA 2X09A 1UJ3C 1NFDB 4K55A 4OCNC 3BPOB 4EI5B 1RK1A 4M3KB 4RRPA 5AYQA 1YYLH 1QQDA 3KJ4C 4PJ8C 2DQHH 3H9YA 4XMPH 4HCRH 1F90H 3MQIA 2AP2A 3RPIB 2HVJB 1MLCA 1RJCA 3HZYB 1DCLA 1F3DH 1MFEH 1WWAX 4P5MB 3ET9F 4LLVB 1NC2A 3MREA 4NPYA 4X4MA 4G9DB 5E70A 5C08D 4ZPVA 2R23B 5DMKA 4XPFH 1WEJL 3HE6A 3S37X 2XZCL 5ISZA 2D7TH 1MIEL 3FQRA 1RHHB 2KL6A 4J7RA 3KNBA 2X4QA 5C07E 3O3DB 4ETQB 2KZWA 4DTGH 5MERB 2WSKA 1NKOA 1JHKH 2VE6B 3WBDA 3DYMA 2IEPA 3H6JA 4WHTA 4RX4A 2F53B 3QWQB 3QXAA 4L3CA 5FXCH 5JIIA 2RCSL 3GSQA 4H88L 5EO9A 1U3ZA 1KTRL 3WLWD 2CKNA 4ODUB 3TIDA 3N9GH 1BVZA 4WEBL 4NNXB 2X4UA 3K4ZA 3RAJH 4CJ0A 4ZMAT 3WIFA 5D7IE 3VXUD 1XF2A 2IAMC 3GNML 4TULH 2VR5A 4OIIL 4GO6B 1IT9L 3A6BL 2AEPL 3P11H 4HKZA 2CUMA 3BUTA 2A73B 4FZ8L 4RWYL 4JZNB 3I6GA 1QFWL 5FO7B 4OB5L 3VFTB 5CUSH 3GJFB 5IW3A 4YE4H 4S1QL 2CLZB 1LP9E 3CMOH 3BHBB 1CLYL 2JTDA 4WNQB 1G7MB 3T1FB 5K59F 1FG2A 3IDXH 4P23B 5GS1A 3Q6FB 1P2CB 3VFPB 1ES0B 5CJ8A 5F3BB 3X3GL 1M7IB 4F7CA 4J12A 1OTSC 2YSSA 4MDJB 5IMKB 2HMIC 3MRIA 3HCVB 3MJ7B 4ENED 4IJ3C 1RU9L 3KXFE 5FV1L 2JELL 5F9JA 4R7NA 5ICXA 4Z0XB 1E4KA 4ZSOE 1FRGL 2C1OA 3VGGA 3NA4A 1LE9A 3L7EA 4H20L 3GKWH 4J4PD 4HKJA 2EECA 2X42A 3VFNA 4MB4A 3QXUA 4E5XA 3VI3E 1CD9B 2HRLA 4U1SB 3UXFA 1CTOA 3ZZ1A 4HGWA 5C09A 1CE6B 4GBXB 2A1WH 5EZJA 1N0LA 2IGFL 4MSWA 1ZOXA 4DFIA 1KJMB 1IGCH 1OB1A 4BQBA 1HINL 3O6FA 5B21A 4S1RH 1C5DA 4S2SA 2VDLH 4LCIH 3H9HB 5F7DB 4WO4C 5EULV 5GGRA 5C0AE 5CJOL 4UT9H 3UAJC 1N8ZB 2ZCLL 3MNZA 1MF2L 2NLJA 4M1GL 3UTSE 3ARGB 3MCKB 4PRHD 1NBZA 3C6LD 2NXZC 5I8CA 2E6JA 3T0DA 3TO4A 5D7LA 1JTTA 4Z7UF 2EDXA 1ZLSL 3I75A 5IMOA 2YXMA 3EUUA 4QXUH 2W59A 4QTIL 2JK5A 1BWWA 4HWBH 1MY5A 3QIBA 3K74B 4L3EA 4XXCC 4HH9A 5IBUB 2ATKA 2GITB 5KZCD 2AK4D 25C8L 4P4KA 4QGYA 5F8QC 3ZMRA 3D39E 5DWUL 1QEWB 4ZFFA 4TTGA 4OFIA 1TPXC 2AW2A 3RWEA 4P2QB 3G6JE 1QPPA 1OTUC 3SGEH 2BDNL 2FX7L 4F3FA 4YAQA 1FO0B 4ONGL 3KPRA 3H0TA 4HMDA 1ZHKA 2F74A 3HNTH 4N0FA 4X5WA 1I7TB 3HI5H 5IQ9B 1O0VA 5E94B 2HLFC 4QHLA 4RISL 4DGIL 2NY0B 3LKOA 1JPFB 2VLKA 2P1YA 4JY6B 4FXLA 4PJAB 4Z7UA 3B9KB 3I6LE 1NMBH 4JO2L 4YGVA 4NHCH 1MCNA 5GGUB 4UIKL 3AVEA 1GGIL 4OZFH 1HNFA 4Y1AD 1I3GL 1T5WB 4KRLB 4Z0BL 5F21B 1J0HA 1ADQA 4BQ8A 1F4WH 3ULUL 2R15A 4MDIB 1YYML 5DO2D 3TFKC 1YEIH 3RWJB 3VGHA 3WO4B 3QFJB 1TVHB 2VUYA 4XVJL 3RWFA 2L0DA 3V5KB 4JFFD 4OV6F 1Q72L 5TF0A 1NUFA 5JTWA 2GW5A 1BP3B 3MCLL 5B22A 4QOKB 3OKEA 1UG9A 2FZ3B 5GZOD 5A3ID 2GAZB 5IESH 1A6TA 4DZBA 1X4YA 4FS0A 1AXTL 3RZWA 3GO1L 5JPMA 4P5TC 3AAZA 4BH8B 1IGJA 4LGPB 1U8QB 3GMQA 3VXNB 5DURB 2QKIB 3L3HA 4MA3B 4WWKA 1IRAY 1MJ8L 3SDYL 1RJZA 3QUZB 4JRYD 4OF7A 3KYNB 3LN4B 1ZKAA 4QY8A 5DFWH 4N90D 1DQTA 2IPTL 2EE3A 2FEDD 4X8JB 4Q7DA 4IOFC 3OR6B 2CKBA 4R4BA 4K7PX 1OGAA 5CJXA 1JRHL 2HT3C 4W6WB 3ARUA 4LFHG 3F7RA 5DTFB 3RVXD 3BKJL 4UQ3A 3PWJA 5B3JF 5L9DL 1SVCP 3LKQA 2BNUA 2QQNH 4L4VD 2D03H 4LLMB 2EIEA 1P4IH 4GKSB 2X5PA 1N6QH 4QT5A 2Y9RT 3ELAT 4FNLH 4O58H 2Z93A 1D5ZB 4MCZA 2FX9L 1LK2B 5CINL 4R4ND 4U6TA 5DJ2A 2AJVH 2JJTA 2GFBB 4U3XA 1NL0H 3QWRA 1O7VA 2XACC 2YHGA