4KUZH

Crystal structure of anti-emmprin antibody 4a5 fab in trigonal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGGINPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARNDGYRGYAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a constrained conformation of short CDR-L3 in antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords antibody 4A5 light chain
total genus 35
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH02
1N26A 5E8EB 2DQFA 1NMBL 1YNTA 4LEXL 4NCC1 5EUOA 4X6CF 2YBRB 1C08B 3OAYH 4ELME 4F9PC 1AD9A 4PJ5E 1X6NA 4U6TA 4NN6B 4QRPB 3INUL 1FBIH 2BSSB 2MJWA 3ARBB 3RL2B 5IESL 1HDMA 2NX5B 4UOW0 2A6JB 2HYMA 1WISA 5GGTA 2XWTB 4YHLH 3V52L 4JPKL 4MCZB 3X11A 1R5WB 3U46B 2VAJA 1F42A 2JK5B 1O0VA 4RIRB 4LIQE 1BJ8A 2FYYB 3VRJB 5C0JB 1FFOA 1VADB 2K7PA 3UPCA 1U8QB 1AIFA 4OGAC 1KJ2A 4JM4H 3U9UB 1JGVH 4WW2B 5DLMH 2FD6H 4M48H 3GSWB 1JGEA 4JKKA 4Z7UA 1LHZA 2D7MA 1IGFH 4NC1E 3H9SD 5IBLC 1V8HA 3RIAK 1CXEA 4MAYC 3DBXA 5GGVY 3QO1A 4NC1C 3SE4A 5E70A 5CJQL 4ZTPL 1INQA 5TDOB 4AJ0A 5I0DA 3QG6A 1J1PL 2QQQA 5BS0B 4P0DA 5GGUB 5J06A 1MHCB 1MEXL 4Q9QH 3HB3D 3BT2L 4PG2A 1MQ8A 4P2RD 1UJ3B 1EK3A 1KG0B 4NQSB 4UV4H 4LQ1A 5E94A 1RU9H 2P8PA 3U4BL 2IBBA 4LLQB 2EIZA 4H25A 3SDDD 1UH3A 3EYVA 3HPJA 4M8VA 1IE5A 4UNVA 2YN3A 4HJ0D 3HAEB 5I1DB 4QRPA 2FYYA 2W65A 5T33L 2PO6B 4OLVH 5JDJA 4L8DB 1MJJA 1S7XB 2X5PA 4PJDB 5IVZB 4K94H 3T77A 4LEOB 3S36X 4A6YL 4QRPE 1T7ZA 5IBTH 4M1CD 3FOMA 1WWAX 1KJMB 1AGFB 1FRGL 3OMZA 3CGTA 4F58H 4MAUH 5IB4B 4GLRH 1J0YA 1INQB 4OB5H 5E1HB 3NCCB 4FFWD 3DVGB 4P5KB 2JELL 5D9SB 5F1NA 2QADB 4WI4A 3M07A 2XTLA 4XNZB 3TF7C 3JWOL 5FO7A 3B6SA 5F6IC 1ZS8B 3PP3K 1INDL 4JDVA 2Q8AH 3T1FA 1T6VN 4UBDC 4DZ8A 2IFGA 4Z6AT 3A6CL 4PP1C 4JZJB 4TSAL 1Q9OB 3SDCA 3ZYZA 1TETL 2APTA 5JPMA 3W9EA 2ENSA 4BFIB 5DZNA 1J10A 3KPMA 4WI6A 1NGQH 3X13B 5JIKA 4U1HB 1KBGH 2BVOA 4TUJB 3QIBA 5ESQB 5DMKA 5AG8A 3GIVA 4WUUB 3SKNA 4K3JL 1F6LL 1MCJA 1UM6H 2GI7A 2JCCF 4ZO8A 4UU9B 3WE6B 3CLEH 1GGCH 4MD4B 4JM2C 2R0ZL 3F6LA 2R2BB 4HPOH 1CK0H 1YC7A 25C8H 3MLRH 5C7XL 5GQBA 4GW1B 3U2SA 4HS8H 4LQFH 2GCYA 2BHUA 1FLRL 5E1AA 4L8DA 3LMJH 5HYQB 4PG9A 5C2UB 2NLJB 5T3XE 3QA3A 2NY5C 4ZFZB 2ZOLA 3CFJA 5TQ2L 3PQYD 1B4JL 1YJDC 1J1OL 5HBBA 1IZKA 3BKML 3BPCA 3MCG1 4OD3H 1IQWL 3GMOB 5B22A 3UPAA 5J1AA 1KT2B 2NY0C 2DOCA 5IGXL 4XTRD 3T4AB 3IXTB 3BQUA 2YPLD 5HHXH 5A43C 3PWPB 1GZQB 1WIOA 1UWXK 5LBSL 3RPIA 3QCUL 1JGVL 4JPIB 3FAWA 4XH2A 1NUDA 1U8NB 1UQSA 1DUZB 2VDML 5EOQL 3MLUH 2J8UA 1FN4B 1SBSH 2KUTA 3QDJE 4LSTL 1CGXA 1T4KA 4ZODA 5JORA 4FZ8L 3ALWA 3LKRA 2VL4A 3VWKA 4XCFL 3ARGD 3QP3A 3LEYH 3IDJA 3PE9A 1B0GB 4N5ED 3QDJA 1ZGLM 5EU4B 1JHTB 3LIZH 3KYAA 3TIEA 2FEEL 4ZUTB 2V7NB 1RZIB 4MJID 3P77B 4AIZB 2WWKT 2OL3B 2D0GA 2YRPA 1OD7A 3C09B 2P46B 4Q6IC 3HNVL 3DGGA 1HZHH 3P4MB 4DN4H 2H8PA 1MY5A 1Y18A 1NMBH 1NBZB 2H2SD 3VFPB 5EU3A 5IHBA 4X6DF 3ULVF 4PJAA 4XWOD 1R5IB 2X7LA 3SDCC 2VXUL 2F19H 1F6AB 3QUKB 3WDIA 2X4RA 4KPHL 1OTSC 4X6CE 1JPGB 5GRWA 2X1OA 5IBUG 2VWEE 1MREL 1PG7X 1F4YL 1J0ZA 3T0ED 3RTQC 3U1SH 4JQXC 2CD0A 1PG7H 3OF6D 2AJXH 4G6ML 3EAKA 5C0NC 1AJ7L 5ALBH 1KIPB 1MCSA 2CXKA 1TQBC 1NC4B 2ARJQ 4NWTH 2R2EB 4WEUD 4QHKJ 1EZVX 4R7NB 1NAML 1AFVH 3QUXA 4JB9H 3U9PH 5CIPB 2D7OA 3C5ZC 5DJYB 1IT9L 1MCPH 2D31B 1A6AB 5FGSA 3RY6C 3LPFA 4YAQB 1VDGA 4AIOA 1F02I 3TPKA 3HG1A 3CFCH 5J7CC 1P4IH 1FIEA 5F9JA 1CQKA 4NUJA 3DX9A 4U6XA 3F7VA 3FFCE 4I2XB 3HC0B 3FOLA 1T2XA 2Y36H 5C09D 1DUYB 2YZ1A 1CD1A 5JHLL 3D39D 5FYJU 3D18A 2VISA 1IC5L 2DLTA 5BMFH 3LKNA 1KCUH 5ESAB 3QO1B 1G7QA 2XG4A 1PZUB 2ATPA 4HAFA 5T1KA 5J9PA 4XNXH 5B38A 1CXIA 4MAYA 4X7CC 1X44A 5SWSB 3WS3A 4POZD 2VLKE 2VZVA 4GQ9L 2APWA 1KXTB 1YY9C 3MJ9H 2VJXA 1MRCH 2IPUG 4ZTOL 4V1DA 3L3KA 3DMMD 4KI5D 4WO4C 1RJZB 5D7IE 4MA1B 1ZLUH 5F1OB 5FGCE 3OKEA 3L5WB 3MUGB 1ZTXH 2E7MA 4OD3L 3T0AA 3UAJD 2J5LB 3MLYH 4YAQA 2YC1A 5D72L 3WFDL 5KANI 3Q5TA 3V5HB 4NO0B 3PGDB 3MLPA 3IF1A 5F7KC 4JAMB 1YEEH 3C60A 1DQML 3D1MC 2W92A 3PDGA 2DM7A 4JREB 4LDEB 8FABB 1NDMA 4KK6D 3V5KB 3V5DA 3H7BA 2FB4L 4H88H 4OZ4B 3CVIH 5LGKA 1WC7B 2ZSVA 3V6FB 2DIAA 4N8VG 5E5UB 1ND0A 1A3QA 1FO0L 4S1DD 5E8NB 3FN0H 3PJSA 4P2OB 1BZQK 2GTWB 3DXAD 4KVCH 1MFNA 3H3PH 3TBYA 1X7QB 1HH9A 2F8XC 2YXFA 1JRHI 3PP4H 3TA3C 3VJ6A 4JZJA 5CGMA 5C0FB 4LLDA 2QQLL 5MENB 5BCAA 2BY1A 2LABA 2RFXB 3MJ9L 4F57L 4LRIC 5CSBA 1D5MA 4JO3L 4ZQKA 1MQKH 2CK2A 4ZO7A 5E2JA 1J11A 3SE3C 5ADOH 4IBLT 3V0AC 5EC2B 5KN5A 2R0ZH 1WZKA 4GAGH 2NY6B 4M9OA 2A1WH 1ACYH 4XNXL 3KDMB 4F7EB 5FYJE 1A6WH 1XGRB 1KEGL 5C2BL 2VABA 4FQXC 5I1GL 4P3DA 3I6KB 4HX1B 4QNPF 3ILPB 1FO0B 2RBLA 1VGEH 3G5YB 1DBBL 3FB7B 2EE6A 2AJYH 4ZNCD 4PJEF 3DX7B 4OLVL 5F3HA 1B6DA 1E4WH 2CLRB 2YD1A 1P4IL 4UIMB 2OR9H 5FIEA 3VFRA 1J0IA 1KT2A 2AKRB 4AEIL 4NWTL 1YEKL 3E2HB 3ALXA 5EBWA 3JZ7A 4M6MH 4LSUH 3O9WA 4MAUL 1U36A 3EGSA 3GNML 4UQ3A 3TCLA 3O4LB 4MDJB 3LQAH 1ETZB 4LNVA 5GPRA 1AD0B 1CGSL 1FORL 2APBA 3TO4C 1SJHB 4HK3N 3MRKA 5DMKB 3V95A 2A6IA 1A6UL 4NQEE 1CGVA 4GKZB 3GSOB 4OGYL 5EU6A 3ARFC 3HE6B 3QDMA 5D7IF 4D0CB 5E56A 4UV7H 1IQDB 2R29L 2A6DB 2QKIB 3RWGA 3PP3H 4Y4FC 2M1KA 1FNFA 3KXFA 3L5XL 5L88L 2WM0A 1TJGL 2VDNH 1N8ZB 2XFXB 1N5AB 1S8DB 1O7SA 5CD3B 2CUIA 3WIIL 5KSUA 1T04A 3K8KA 4KPHH 5E2VL 3WEXB 4H20H 4N0CD 3H7BB 5DD1H 4YXLH 3C5SB 4Y4FD 3AB0B 2IJ0C 1RZ7L 4LSDA 3D87B 2UV3A 4PJ9D 2ZG3A 4PRIB 2NXYC 1YEHH 4ZO6A 4Z7QF 4YUEH 4IRJB 5DJDA 3GJEB 2V5MA 3PUCA 1U8LB 2XPGA 1YPZF 3MLTB 4KVNL 4M1GL 4QHKI 5DUPL 2BVPB 1XIWC 3RP1A 1HH6B 5GS0D 4IRSC 5HDQH 4PJ7F 2AGJL 2VXQL 1CFVH 3OBAA 2UUDK 2NYYC 1KJ3H 4KROB 5IGXH 5DD3H 5E5RB 5KS9B 2UZIH 4OZHE 3TN0B 4YXKL 5FYJL 2PTVA 3VI3E 3HAEG 4XP5L 5CJBA 1OY3B 2E7BA 4AEEA 3UTSB 3RGVD 1EO5A 1VHPA 4F3FA 3UROR 1NFKA 2YPKA 1OSPL 1QFUL 4DVBA 3AMLA 5HHOE 2XTJE 3FOLB 4NKOA 4YXLL 4UB0L 1N64H 2D7PA 4EXKA 1R5IA 2ZOKB 3A6CH 3OKYA 1JPTH 5GS2D 4O5LH 1M71A 5F70A 3BPOB 4N0YL 3H9HA 5HHQB 1NL0L 1F45A 3MNVB 3QPXL 2IBGA 3W0WD 1M05A 3P4NA 4LOUC 4HUXA 4YQXL 5T1KB 4KK9D 2NW2B 1NGPL 1WLHA 2CMRL 3HRPA 4HPOL 1G7MB 1A6TB 3W9DB 4KKBC 1MI5B 1SQ2N 1ZANL 5C08D 4AG4H 2JCCA 2IFFL 4PY8I 5GGRA 4Y4FA 3BO8B 1P4LA 1XT5A 3HE7D 5T3ZL 4OF7A 1F58H 4TSBH 1FRGH 2KL6A 3CMOH 2NNAB 5CBEA 2B8OT 4FG6C 5FCSH 1U3JA 1QEWA 4XI5D 1YNLH 4L3AA 5CIPA 3PIQA 4M7LH 1NCBL 4DAGL 4Z7NE 4FNLH 1K5NA 4J3TA 4RAVA 4F37K 1C5DB 3NIDF 5BZDB 4MS8C 4UNTA 4UTAL 5D1QA 5BXFB 1MNUH 3RBGA 1WEJH 5F7FA 1IGCL 3GSRA 4KJQC 3QDHA 3ARQA 3FB6B 2QSCL 5MHSD 2MHAA 1CT8B 3KYNB 3L7FB 4YFEA 3MJ7A 3W39A 2RB8A 3P9MA 3EOTH 4UV4L 4Y5VC 4D9RD 4X9GA 4ACPA 3OPZH 4MX7B 5EBMB 4I0PD 1BX2B 1CFSA 1MAML 5E6IC 32C2A 4EI5D 2NW2A 4V1DE 4CAGA 4P4RA 3NA4A 1QSFA 2J8OA 3EFFB 4Y4HA 1GRWA 5FEBA 4N5UA 4KK5D 4N90E 1OW0A 2IANB 3SGEH 4PJCE 5CZKA 1HSAB 3VH8G 3ZKMC 1ITBB 1X5YA 4JDTH 2I60L 1RV6X 4R96B 1D6VH 2GSIB 2HKFH 3LH2H 2HRPH 5CJXC 1DQQA 5CWSA 2Z8VC 3O45A 1NMAH 4JKPL 1BQHB 4LCUB 5D8JL 1OP5K 1MI5A 5CKAA 1I8IA 1IEBA 4NKQB 3E6HB 2DS4A 3SBWC 5TDPB 1TZIA 4LLAA 2O5YH 5TH2B 1P7KB 2NZ9C 4B7LA 4I3SH 3CD4A 1MI5E 4OJFH 3QXAA 3MNZA 2OMBA 3KHOA 4K07A 1AHWC 4GAYA 5CGTA 4QXUH 1JV5A 5AZEH 3JVGA 4RAUB 4TUKL 5IKCB 4KH2A 4Z0XB 4PV8A 2F5BL 1G7IA 4GMSL 5D1QB 5BXFA 4JVWA 2W59A 1TENA 3V7MA 4PJIF 1QR4A 3SDDB 2R9HC 3OX8B 3ZE1F 1RIUH 3OXRB 5ERWA 3QQ3A 4EOWL 4KDTC 5F9WC 1FZJB 2GKIA 1YZZA 1JJUA 4R4FL 4KKAC 3SDAB 3SGKA 1QSEB 5D1XB 1CF8L 3D3VA 3IFNL 2EDKA 1I7TB 1HWHB 1XGUB 1OGAA 1OSZA 5JA9A 2OQJB 3OKDA 3TM6A 1EMTH 3AS1A 4UOW1 1G9MH 4A6YB 2DLGA 1BIHA 1YEDA 4FHBD 1AGBB 2XA3A 2V5YA 1FAKT 3KPRD 4HC1A 1A7OH 3I2CH 2NW3A 3MV8A 3MRDB 3C60D 3SCMB 1I3VA 2O26U 2G60H 1FCCA 1U58B 4P3CH 1W0WA 1A3LL 3RBSA 4ZXBD 1VACB 2ITCB 4HBQA 5CEZH 1ROWA 8CGTA 5C0GA 2QKIA 5L2KE 4NHUA 4LP5A 3SCMD 4AMKL 4Z8FH 3BPNC 1S8DA 3HZMA 3G6AB 4JHBA 5SWZB 4WI3A 5HHVH 4HKBB 5J12C 3W39B 3MRFA 3IRPX 1JV5B 1RZKL 3O3AB 4JN2A 1AI1H 4HJGB 1K9TA 4Q58C 5CZVL 5DI8A 2C3VB 2ADJA 3TWCL 4WY7L 5FGRA 3DV6B 5DDHA 1OGTB 3QQ4B 4M6OH 1KG0A 3J8F7 5TF0A 4ZXBA 1HNFA 4ZFGL 5ITFA 3Q6FA 2CRYA 1K8IB 3ARBA 5EBGA 3ZDYF 2SEBA 5FV2A 1CL7I 1V3KA 4XT1C 3QI9C 1JZ6A 2VB5A 3SEPA 1KIRB 3WN5C 2QR0A 4PBXA 3BGFB 1J8HE 2VQ1B 3SCMA 4HLZH 2P42B 1IKFL 5IV2B 2PO6A 5BRZD 4PJ5B 2EDDA 3T0WA 4MSWB 1BOGB 5IMOA 5SWSD 2NY2D 1UH2A 1F5WA 1KELH 5EFIA 3WFCL 5FGCB 4RMRA 5KSAC 1A9EB 4M3KB 4YFLI 3FO1B 3VRIA 5KZCB 1JHLL 3HUJE 4H0IA 5ESVB 3OF6A 4Z7VE 4TRPH 2FO1A 3KPQA 3RWIB 4A2MA 1NH6A 1T2QH 4LGRB 3QEGH 2ZOKA 3O0RL 1BGXL 2DRUA 3MV9E 5KSBE 2A77L 3QH3A 2HTLD 3RIAF 4WUKH 3EFDH 2X4NA 5I75C 5EUOE 4K3HA 5B3JE 2XPGB 1GAFH 1CICD 4RGND 4M43L 4ODBD 4OGXH 4FZ8H 5ITFB 1X5LA 2DI8A 1KEML 4LSSL 3DVFA 1DEDA 5F9OH 4XAWH 1K3IA 2NZIA 2NY7L 2D7TL 3TBWB 1ZWIA 2GK0A 5ACMA 3RVWC 2VIRB 5C3LD 4XNUL 1FZKB 5I2IA 1MCOL 3WKML 5I1DA 5C08B 4K7FB 4R97B 3DTXA 4LLVA 4ZYKA 3WBDA 3CFBA 3WKNA 3BRDA 4NZDA 1E6OH 2EEDA 2R2BA 2H3NB 3M45A 2Z8WC 3H3BC 1CDGA 1M7DA 1MCWM 4K8RL 5IQ9A 4KJWD 4PRDA 1ZHBA 4JY5H 3ARED 1U8KB 1HK6A 2GUOB 5HXMA 1MIMH 4DVBB 4FFVD 3N1GC 2GITB 2FSEB 2F53D 2Q20A 4IEFB 5EUKB 2HFTA 2C3VA 2MKWA 3DHMA 4TRPL 2XQYG 4MNQD 4OF0A 2B2XH 3BRGC 3OKMA 2CIIB 3L3OB 3U36B 4K7PX 2ZCKL 5DD0H 5GISH 3GMOA 5EO0B 3QIUB 1S5HA 1S78D 3X14A 1MFCH 2C3HA 4FZEH 1S9WB 4C4KT 1N4XH 3BKJL 1V3LA 4UDUA 4WFEE 1T20A 4P2QD 5D7JB 1S5IL 1TZHB 3UYOD 4P57A 4XXCC 35C8H 3MBEB 3IDMA 4U4BA 2EO9A 1MCRA 5D6DC 3SOBH 1K2DB 1IM9D 5DEGB 4XC1L 2A6JA 2Q8AL 5I30H 4PY8J 1MCNA 4PGZA 4U7SA 3RWJA 2FEEI 5CS7A 3BUTA 3RI5K 4XB7A 3MLWL 4P2CG 2F53E 3O3DA 3MA7A 1P1ZA 3GBLA 3TYFA 5EA0H 3LOWA 5ANME 4N8CH 5IB1A 5D2NA 4Z0XA 4G6KH 1ZLWH 4LAQH 3GI8H 1HKLL 4YNYA 3F65A 4OCRH 1B2WL 4OZGA 1NJ9B 4JFFD 3GSWA 1ZLSL 3VW3L 1YMHB 4N8PA 4XVSL 1CD0A 1KCLA 5EBLA 1MWAL 3RY5A 1UYWH 4IRJD 2AI0H 4LMQI 1JTPA 4KY1H 1HINH 4OAWA 3S5LA 3NIFF 4UDUB 1HHGB 2FIRT 4XP5H 1YNKL 1JUFB 2GSIA 4MJ2A 1PZ5B 4L9LB 4HWNA 1EO7A 3PWLB 1S5HB 3X14B 2Z31C 1CFNA 1P2CB 2IADB 1NCNA 2Q76B 4OI8A 3F5WA 5C0IB 3GUTB 3RWHB 4ZUSA 3BWAB 5E03A 2NY2B 1HCVA 5HHXL 2QSTA 3T2OA 4PJ5D 3ULVD 2F8OA 3K74B 2Q6WB 4EXPX 2P4AB 4YHLL 5IG7A 1MRFL 4Y5YA 4I0KA 1KN4L 1U8KA 2I25N 3BH8A 3V8CA 5EZIH 4Z7UE 5IEHA 4X9HA 1J1OH 5DJ0A 1BGXH 5ISZD 4YX2H 4F7CA 5DD1L 1B9ZA 4X7EC 3MYJB 1QZ1A 1FVEB 1AO7A 1RZFL 1X4XA 1WFOA 1A47A 4HKJA 3MGOB 4S1SH 3QUMB 3T0XA 1T1WB 4P4KD 3VFNB 4UV7L 4OFVA 3ISWA 5FHBL 4R2GD 4XMPH 4MMXC 4YK4B 2JB5L 1MFEH 4LK4A 1PJ9A 2XZQL 4M61A 4MVBD 5EZJB 3KYOA 4HBCL 1JWSA 5C0IA 4U3HA 4ZUWB 3V8OA 3TN0C 3QDGA 1H8NA 1FYTB 2X05A 5H8DA 5IVNA 1D5XA 2VXSL 3RWJB 3KPOB 1A7RL 4YHYC 1FFQA 4C56E 1UADC 4OUUB 4UDTA 3TYFB 4KKCC 1LEIB 1KPVB 5M7QA 4X4YA 2XNAA 3RVXC 4BZYA 1E28B 1ZHNA 2HMIC 3G08B 3BDBA 4JVUA 2R1YA 3SO3B 3V79C 4PJ7E 1RMFH 2BVQB 4NT6A 1V7ML 1VCAA 5JIPA 4LKCB 1TJIH 2PCPA 3O9WD 4HZLB 1TQCC 3UMTA 4JHWL 1NLDL 3MNWB 3OKKB 4JFFE 4KK6C 2R4SL 2Q86B 2E6PA 3SGJA 2VR9A 2VLRE 2VDOL 2D9QB 2AXFB 3PWJA 1QVOB 1IGCH 2P7TB 2FGWL 4LASL 4KRPD 5I1JH 5TDOA 3QCVH 1EGJA 2WLYA 3ZDZF 1Z9MA 3HNSH 1KTLA 2DQHH 4QCIB 3IXTA 5GS3A 4V1DB 3F6IA 1FYTA 1RY7B 2DTSA 5DT1L 3OV6A 2AXHA 5A3IC 1A7OL 4LVHB 2P24B 4XHJC 4J4PD 4W6XB 5C6PB 3KYOB 4NQCA 1N4XL 2YEZA 3NIGE 3UXFA 1P84J 3HG1E 2YD4A 4KI5C 4YLQT 3RGHA 3WO4B 3JTSB 4M4PA 4NO0A 1Z9OA 3ARVA 4I48A 3VI4F 4CMMA 4PGEA 2BMKB 3MRLA 3NPSB 2X9YA 1EHLL 4J2XA 3NGBB 5D2LE 2CQVA 5FECA 1KB9K 4JFFB 4L4JA 3MLXL 4J7RA 5AYUH 1IAKB 1S7QB 4K2UL 2XYCA 2FD6L 3V2AR 3GRWL 2MOVA 4S1QL 4WGVB 5H94B 2AEIT 4HZLA 1CFBA 4KRNA 5EU7E 5CMAB 5JOPD 1SEBA 1V3MA 4JZJC 2XT1B 3MXWL 1R3JB 4FXKA 5ISZB 3RIFK 1RZJL 3VFRB 4NP4L 5DQ9A 1XF4A 2E8YA 1JWSB 1P5VA 2C1PA 1JGUL 3ZLQC 4YDKL 4OBSA 4KK5C 2EC9T 4LKXB 5HYSG 5KBNC 2H2PC 3CLFL 3TBWA 4OLYL 4JFPA 1F2XK 1GGIH 4Y1AA 2X4SB 4AM0A 4D9QE 5FB8B 1DQMH 1GXEA 4U1LB 4D0CA 4NJAL 2PW1A 3ZT7A 2ZUYA 3OL2A 4U2ZA 4X5XB 2IH3A 5D72H 5IJKA 4X9BA 5FECB 4LRNL 3RTQD 3B8YA 4ELKB 3AXLB 2V7NA 4BKLB 3HE7B 1KF9B 3GM8A 4NN7C 4PGEB 1JF1A 1OTSD 3WSQH 3HMWL 1JZ7A 3ULUE 2NY0B 1TITA 3PL6D 3EUUA 1HN1A 2CLRA 2X6MA 4W4OA 1AR1D 3U36A 3LV3B 4M6ML 5HGBA 5L0QB 4LVNB 3EO9H 3BGMB 4HMDA 1J1XH 4NNYB 4G5ZL 1CR9H 4JFDE 5F96H 3T04D 1INEL 1AI1L 3U83A 4FXGA 3AAZA 3OR6B 4RNRB 1JUFA 1A14L 4M6AA 2C7UB 15C8H 4TQEH 2IQAA 3LN5B 1V7NL 2VQUA 3UPRA 1P7QD 4X7DC 2V2WB 5ICZB 1KIPA 4EJ1C 3T0EE 1ZLWK 3P30L 5LWYH 4POYA 3BHBA 1K4DB 2BVOB 4TUJA 2PXYC 5BRZA 3V9FA 4ALAH 4PGBB 3T0EA 4U0RB 3TZVC 4P59H 2MQ3A 4AMKH 2UWEE 3T09A 5HYQA 4BK5A 2AP2A 5MEPA 1BZ9B 1DQJA 2ZOLB 3CFJB 5JO5B 3DV4A 2EDEA 4ORGA 4F2MB 4UTBL 3R1GL 3ZKXC 3EHBD 1DUYA 1CE6A 3UJIL 8FABA 3QEQB 4BFBD 3DMMB 3PP4L 4ELMA 5BV7B 3I2CL 2W91A 1NBZA 5I15H 2E9WA 3VGHA 1KFAH 2ICES 3RRQA 2OTUA 1D5BB 4U6HB 1DN0A 4C83B 3SHSA 5DJAB 3BSZH 4E9LA 5EN2B 4ODUB 4RMTA 4IOIB 3UTSE 3MRGB 4OZHF 3GUTA 1QNZH 3L3KB 1Q0XH 1UQSB 3DGCR 3F8UB 4HXBH 5C07A 2DD8L 1NGYB 4TNWF 2DQJH 3OKEB 4LBEA 3T0DA 1WTGT 1BQSA 4Y16C 1XF5B 3LEYL 1UB6A 4WO4A 4DGIL 4NOFA 3MA9L 5HHMD 5C07E 3DSFH 1PKOA 3NAAL 4RGNB 3S3SA 2GJ6B 3BDYL 5CILL 1VB9A 4XP9L 3BFOA 4XBPB 4ZMAT 5EU3B 5IMLA 2XTJC 4NQXB 1EFXB 4Z7UB 5DHYB 4YO0A 5T1LD 2JE8A 4JANA 1TCRB 3FONB 4Z0BL 3DV4B 4NUJB 4PTTB 4QNPE 4NO3B 3WV0A 2PYFB 2ICWJ 3HC3L 3R8QA 2HWZH 1JWMA 1HHIA 5IK3B 3S34H 5L88H 4OZIF 4PRHA 1T66D 2Z91B 3OKNB 4C83A 3SJVA 3P9LA 2B7DT 4Q0XH 2WP3O 1QBLH 1C8PA 5HYJA 3ARDC 2ADIB 3O2WH 4QY8A 5CZXC 1MI5D 2DLFL 4UQ2B 4J8RB 1CDHA 5F71A 3MBXL 2BRRH 4M02A 3VU2A 5D2NC 3RUGF 4OCRL 4G8GA 3HS0A 1QBAA 4G6AD 1F3RB 3O9WC 1EVTC 1VGKA 2YA1A 4P49A 5JTWA 4TVPH 4NRYB 5E9DD 1Z0MA 2HT2D 4MJIB 4JGJA 5JO5A 3QO0B 2AJVL 1CD8A 4YPGB 3BPOC 3ZE2E 5CD3A 4ZUUA 2EH7L 2HMID 5DRXA 4XC1H 1ULVA 3LQMA 2W38A 5J6HB 2V17H 1HWGB 6FABL 35C8L 1IRAY 3RZCC 3IDUA 1AJ7H 5I9QB 5KSVA 3ARGC 4BH8B 2PXYD 3GSXA 4GT7A 3S6CA 4NO3A 5F8RC 5IMLB 4KHTL 5L7XL 5CSZB 3HZKB 5DURD 4KQ4L 2ESVE 2PW2B 5FCUL 5DJDB 1I7RA 4I0PA 5BQ7A 4QHNA 5GZND 1MFDL 2CKNA 2JTDA 3CDCA 4DAGH 2PYFA 1I85A 4M7KL 1RZGB 4YDIH 5F6HI 4X6DE 5MEQB 5EUOF 4KJWC 5I8EB 4MXWL 3A6BH 3JWDL 4G6JL 1A5FL 2H1PL 3KPMB 2BY0A 5GGSY 1F58L 4TSBL 1UWXH 2DLFH 3QAZB 1WVZA 5I1HL 4CU7A 3OB0H 3JVGC 2X1XR 2GT9B 5CJOH 1R3LA 1BM3H 1T7WA 4UINL 5CJQH 4G8GB 5C1MB 1IQDA 3B2UC 4NOBA 1UM4L 5BV7L 4PJHF 5HDOA 2XN9A 3RDTA 1VGKB 3BD3A 4QRPD 1XF1A 2JB5H 1JPTL 1XGYL 1N6UA 2CPCA 5HGDA 4H8WL 1JGDA 3S37H 1FQ9C 2VDMH 5EOQH 3MRRA 5E4IA 3W0WE 4UIKL 3DECA 4R7DA 3ZE2F 4MB4A 2YD8A 3UJTL 2LU3A 2DQDH 3QXVA 3D69B 3OR7B 1DLHB 2W0KA 3QNYA 4OIIH 3V5DB 4HKZA 5DQ9B 1WZ1H 3P4NB 3GJEA 4EKXA 5C0FA 2BNQA 2AXJA 4HUXB 2I9TB 3V6OA 1AGBA 4J6RL 4EUPH 1C5BH 1G7MA 4FXGB 4LGPB 4B50A 4CKVX 4JM2B 5L2KB 1B4JH 4PRAB 3DX6A 3GKZA 4ZAKC 1JTTA 5ID0B 5DQJA 4EDXA 3SO5A 1A4KB 5HGAA 2BNQE 5DFTA 1IC4H 4CDGC 2R2HA 4HUMB 5DJZB 1H5BB 3MOAH 1F00I 5ANMB 3EDJA 2VZOA 4JRWA 5DS8A 4NM4L 1DSFH 1OHQA 3RZCA 3SKOA 2EDNA 4HKXA 5F9WB 1I3RB 1QSZA 3RWFB 3QUZC 3KXFD 2PTUA 5BV7H 1KCUL 1H8OA 1BEYH 1PSKH 2EKSB 4LFHG 5D7SH 2AEPH 3SDXE 3GGWB 1M1SA 3C2AL 4PJ8C 4NNPH 1J7VR 2GHWB 4IOFC 4QXGL 1MH5A 3WEXA 2I07A 2W60B 3VXMB 3UP1A 2WW8A 4LIQH 2C3GA 1IGYB 2YRLA 4PJDE 4U1SA 3U4AA 5E2TH 4KZDH 3GSUB 1BFVH 3GMRA 4DUWA 5TPWH 2CIKB 1A22B 1VFAB 3TVMD 1G7LB 5EG6C 1IAIM 4KRPB 2Z92B 1MWAA 4P4RB 1YEKH 1FZMB 3LCYA 4AEIH 1KCRH 1GH7A 4ZXBB 3GHBH 2HJKA 5T3XL 4EDXB 1HSAA 3JTTA 4L29B 5GSRA 5I1GH 1TJHH 1BVLB 1W0VA 3VMPA 1QPPA 4C55A 5FKPB 1S7TB 1WBXB 3FQXA 1DBBH 3REVA 4WNQB 5DEZA 1CDCA 1I1YB 2ENYA 3FRPG 1N8ZA 3WUZA 4O2EB 1KNOA 4RRPG 4BQ9A 3C6LA 2IPKB 2Y5TA 3RWGB 1PKQE 5LG1A 2EDYA 3GSQA 4ODWB 5B39A 2EICA 4PV8B 5H37G 1L7TH 4N5EC 4YHML 3QNZB 1OL0A 3Q5OA 2W9LA 3RWIA 3TJEH 4B0MM 5J3HC 3OX8A 5DWUL 5IEKA 1IGYA 3C2SA 4U1SB 4IJ3C 1TVHB 1KEGH 5DD6B 1BF8A 3CVHA 4M7LT 4IRSA 4ZUVB 1TNNA 4QKXB 4PJCA 4GG8A 4IOFD 1ZVSB 4PJ9C 5EO0A 2NXZD 5TF1L 3IFOA 4FTVA 1I7ZA 3BEWA 2E6QA 2VXTL 4N90D 4N0RA 3STZB 3SGKC 3UTTE 3V4UH 4PJFE 4DN3H 2WBJD 3P0VH 1RUKH 4KI5F 3WO4C 3RWCB 2KKQA 1LO3L 4NSKA 4BFGA 5HHMB 4XNMB 2OXGA 1G6RB 1NGWB 4F9PA 4R0LA 2P48B 5B38G 3NCJH 3TN0A 3UJTH 4JAMA 2VSDA 2Y7QB 5T1DH 5I75B 1C7SA 5DRXB 1LP9A 2B4CC 4L4VB 2FECL 2YUVA 2Y5TB 1YEFH 3GRWH 3BYTA 4S1QH 1W0YT 4PRID 4JFYB 3DUSA 4Y19D 5C0BB 4CN1A 5KVDH 1I9JL 4AK1A 2DN7A 4PJAF 3DROB 1UM5H 2L4OA 3PWUA 4NWUL 3N06B 1MCFA 4EN3A 1ONQB 3TNNA 3GMLA 3NIGF 4LCYB 1IGTA 2R2CA 3QXDA 2EXWD 2VNCA 4M7JH 5BQ7B 5IMKA 2VZTA 5JHLH 1ZLSH 3EOTL 2BNUA 3QQ4A 1TCMA 1QBML 1KBGL 3MBEA 4XMLH 1HILB 4P5MB 2DYPB 2P1YA 3D39A 3MRNB 4PJXE 1EGJL 5DR5L 2EH8L 4L5FL 1FBIL 2NPLX 5A2LH 3KR3H 4ZPTB 4WI9A 1MCDA 4PJGB 4XBEH 4G42B 4U1NA 3IJSB 2ORBH 4HGKC 3IJYB 1BQHA 3O3DB 1BWMA 5DSCA 2Y72A 3SDXB 3FB5B 4D8PA 4DOHE 4R8WH 2P5WA 2AJZB 5E9DA 2VQ1A 5D1ZC 1HHKB 1U3ZA 3TC9A 5IB1B 4H26B 5DJ0B 1DEEA 2F5AH 2VABB 4GFTB 3VXOB 4YR6A 4FQIL 1P7QB 4ZPVB 1UXWB 2L0DA 4K71B 3BEVA 4P2QB 5I1IH 3CMOL 3D2UD 5T3ZH 3L5JA 1JBJA 3TA3B 4J3XA 4PJCB 1MREH 3CH1A 5T1LA 3AREA 4XAKD 4HK0B 5IW3A 2GYSA 3KPQB 4EUPB 4OCXH 1WCQA 3P9MB 4LNRA 2F74A 1K8DB 5FKAB 5BZWA 3MBEC 3U48A 4CVXA 1NFIB 4WU5B 1WV7T 4O4YH 1Q9KA 2AQ1A 2ICWA 1F8TL 1A21A 1PZ5A 2VE6A 4O5LL 1AFVL 1NAMH 1JIBA 2AEQH 3GKWH 2KZWA 3QSKB 4HMCA 4XXDA 3ETBF 4GBXD 3RWHA 1OT2A 3O11B 4NO2B 1CG9B 1HQRA 4PJBB 3GRWA 3BZDA 4BSWA 1R5WA 3L5IA 5FOBB 3ZYJA 4KGLA 1GZPA 2XZQH 2ZUUA 3MXVL 3W5NA 3BH8B 1EBAA 3LKPB 4GKSB 4OQ1A 3SGEI 3CFBB 5I8OH 5TFSH 4HUUB 1G9ML 3VDAA 3VXOA 1WJ3A 1CU4L 2CUHA 3BXNB 3I3EA 3QFJB 1ZA3A 5IIEA 2GJZA 1EFXD 3FCTA 3IDGB 3BVNB 3Q1SL 5BV7C 5DUBB 1MCCA 5DC0A 3CH1B 5D7LA 5T1LB 1PLGH 1AXSA 3GBMH 3OKMB 2BHZA 3L3GA 4JFOB 4HFUL 3O3AA 3EYUH 4WTZG 1AR2A 2WQRA 1I7UB 2F5BH 2E27H 3MRIB 3B9VA 2BVTA 1FHGA 4ESKA 3ARFB 1DQLH 4JO1H 4R2GB 2BNUB 4UILH 4QXUL 3RVUD 1Q0XL 3V52H 1S9WA 2BVPA 3CFIC 4OI9A 3JTTB 1EXUA 3MV8D 4U1GC 4LARL 3UTQB 4GBXA 3NFPA 3PNWA 1RIHL 3QEUB 4YHIB 4MCZA 1D5ZB 1DE4A 3SDXA 5DSCB 1EFQA 4XCCH 1E4XI 3QDJD 4KJYB 5GGRY 4WEBH 3ARGA 5I1LA 4HKXB 4HUUA 4W68A 5JW4Q 1HINL 1KNOB 1SY6H 2NXYB 1NAKH 3CSBA 4RA3A 3THMH 3RJDA 3QUYC 5EZLB 5I8OL 2PYEE 2NY1B 1XGQB 1RJCA 1TETH 3DSNA 1HXYA 3QUML 1RVFL 4XNYH 1KTKE 3VXUD 3C5ZA 5GJSL 5IT2L 2H1PH 4R9HA 2YPLA 1XIWB 5I18H 3C8KB 1ORSA 5JPNA 4WFFE 4CVWA 4NFDA 1YMHA 2VLKB 3MTRA 1FH5L 2NR6D 4K9EL 3MLZL 3RHWK 4PY7A 3GDBA 3RAJH 3UTZA 3VRLF 3EO0B 3QIUA 3E8UL 3QH3B 1DQTA 2DQFB 3BPLB 5L7XH 1IKNA 3L3HB 2P8LB 4O02L 3X13A 3TZVD 2IADA 5FKPA 4YDJB 2Y1VA 4KK9C 4K94C 1OAZL 2NTFB 3H0TA 2V2XB 5C0AE 4Z8FL 1NFDE 4MQ7A 4JRXA 2Z4QA 4G9DB 4FABL 4PB0L 2WWKO 2G5BB 4ONHB 1MJJB 2P5WD 3SO3C 3HA0A 3BE1H 1ZANH 2GK0B 4AG4L 5MHSE 5E2UH 3ALPA 3O4OC 3FQUB 4OTXL 4PRIE 2WNGA 5FYKU 5CUSH 4Z7WF 1RU9L 2APXA 2IH1B 1QBMH 5KJRH 4XZUA 3B9DA 5BW7A 1HQ4A 2VH5H 3MRJA 4Y16A 2X4NB 3MACH 3HMXH 3UO1H 3HPLA 3O2WL 1TIUA 3DBXB 2W1NA 4GG8B 5D1QD 2P44B 4P4KC 4EUPG 3QUMA 1F6FB 1QA9B 1MIEH 4RGOH 3B6SB 5AWNL 3T1FB 3VXUE 1E6OL 3QG6B 3HUJB 3ZKND 1W72L 3BKYH 5CP7A 3E0GA 5GS0C 4JPIA 5T5FL 1DP0A 5HYSB 5I0ZA 3TIDA 4CL7A 2EECA 2J4WL 3FQTA 1C12B 3AU1A 2D3VA 5I1EL 1LWRA 2WBJA 4Y8DC 5J13B 3WFHA 4ENEC 5DMGD 2EIDA 3DTXB 1H0DA 4ZYKB 1LP9E 3EYSL 2VC2L 5FYKE 4I3SL 3FL7A 1MPAL 2WQ8A 3RUGA 2XQYK 3MXWH 5JW5A 3G9VA 2C3WA 2NY4D 5EU4A 5EU5A 3VE0A 3KNBA 3CK0L 1GAFL 4NO0D 4Z7WA 2ZNWA 5TE4L 3C6LD 1NCAH 4C59B 4AIZA 5TGBA 3LKRB 3HRZA 3INUH 4X4ZA 2A77H 1MRFH 2Y7QA 3T77B 2PUQT 1LE9A 4KUZH 4P4KA 4HFWA 4YUEL 4K7PY 3QDJB 5E8PA 2QLVB 2DQEL 4XPAL 5F21B 2IH1A 2KZ1B 1G7JA 3QZWB 4Y2DD 3ZE1E 4DEPC 4B5EA 4L9LC 1ZSDB 3T4AA 4XXCA 1F4XL 2Z31B 4WFHE 1IM3A 3VGFA 1MY7A 5IMKB 3G5ZA 1SEQL 2CO7B 5GGUA 4FP8L 1TZHA 1C12A 3AU1B 3E1F1 2F54E 3F7PC 2AQ3A 4JVPA 5L6YH 4F33B 4OBRA 2BVYA 3S36L 1NC4A 3GFUA 3IT8D 1G9NC 2Y36L 1A6UH 3IDYC 2F54A 3ZHDA 1X5JA 4I0PC 1K4DA 3LRGA 4YWGH 5C07B 3IKCB 3U7WL 4NQCB 4OM0L 2FLRT 4EBQL 5T3XH 4RISL 2H32H 3ARYA 3WFHB 1LDPL 2XZAL 4FNLL 4I0CC 1UG9A 1PW3A 2MCPL 1KPVA 1HSBB 5EA0L 1WSST 1U8QA 4R4ND 2YPVH 4GW1A 4YR6B 4JRYD 4FABH 4GAJL 1RVFH 4XNYL 2OTWB 3ZZ1A 3ESVF 5ADPH 5TDNB 5JXED 1IAKA 3L6FB 4QXGH 1HHJB 1YEGL 5JOFB 1KJMA 4GKOA 4JFFA 3FTGB 3WN5A 4PGJA 1LE9B 1IEAA 5TQ0L 4U1MA 3AS0A 3CDFA 3D0LB 5HD8C 3AY4A 4MD0B 3MLSL 1CD1B 1BLNB 3E8UH 4XMKL 5LGHL 3IB4A 2VL5B 2QEJA 1BD2E 2BNQD 4K7PL 4EI6A 4D9LL 4D9QD 2ZUVA 1CFNB 1P2CA 3LPGA 2VUYA 1UJ3A 3G6DL 3RPIB 5IP4A 5GRUL 1H3WM 4H25B 3WSQL 2FJFB 3BPNB 4FMKA 2JB6B 4PTUA 3QHTC 4G8EA 1FNSL 1T80A 4IM8A 4WUUA 3TV3H 1MLCB 3DIFA 5SWQB 1MIML 1HDMB 5IEHB 3TFKD 4X0KB 3RZCD 4D3CL 4DKAA 3PQYB 2O5ZH 3O8XB 2F8VA 4E41A 4ZUUB 1I1RA 4MA8H 3EYSH 2XXCB 4ODXA 4YHZL 3LDBB 1HHHA 3GBNL 1YY8A 2IC2A 3O6LL 4PJ9B 2NR6C 3QFJE 4I4WA 3QCUH 4KMTH 1KJ2H 1ZEAL 3SPVB 3VXRA 1AKJA 3BP6B 2WAHA 3PG2A 4P2OA 4PRHB 3JUYA 1RUQL 2OLDA 1IBGL 1LNUA 4LU5L 4FQLH 4OJFL 1A6VL 5T3XD 1FG2B 5B3JF 5HYJB 1GHFL 4WDIA 1T66C 3VFMA 5C0DA 3G04B 5DTFB 1J86A 2VH5L 4JFPB 1QTYT 4GRLA 5D5MA 2ZWLT 3QULB 1B90A 5C0BD 2ERJB 5KVGH 2DF3A 1S9YB 2NXYD 3EOAB 4YZFF 1R3LB 1F11A 2WSKA 3ELAT 3JV4A 4G7VL 3X3FL 5I1EH 2ADFL 2Z8SA 4X6BB 1GGCL 3PXJA 5F1IB 4JFHE 4QOKA 4JY6A 3EZJB 4RRPA 5HGDB 5B4MD 4OZGF 4JRXD 5D71H 4MHHG 3LN4A 4MNGB 4U1MB 2Z93B 3EO1A 1S7SA 4UINH 2J12B 3QIWD 4L8SC 1HCFX 4FXLA 4WTXA 3T3ME 1T3FB 1A9BA 2X09A 3ZDYE 1AKJB 2F53A 5HGBB 4F9LC 2BVQA 3ARTA 4NT6B 3TO4D 4EI6B 3B2VH 4J4PC 4N0FB 3V0WH 4I4WB 4NNYA 1KB5L 2ADGA 4XVJH 2NY6D 4R97C 3O9WB 4ZNEE 3RWDA 2EH8H 3LD8C 2EDHA 2EE2A 4K9EC 4OB5L 1MCPL 1FJ1A 2P24A 1D5MB 4OD1L 3I02A 4GRLB 3AM8A 3UC0L 4Q97A 4Z7NF 1JZ8A 2BRRL 3UPRB 4Y4KB 3MRGA 1A2YA 3J7HA 4LCIL 1UWGH 1VERA 3GMMA 3MV7D 4LBEB 4KV5F 3H42L 3LVEA 4Y1AB 2XN9B 3RDTB 2OP4H 3FFCD 4XRCA 2CXGA 1TZGH 4N68A 2KQMA 4JHAL 3BI9X 4PJHA 3HE6A 3QDMB 4PRNB 1E4KC 4CW1B 5IMMA 1OPGH 4RX4A 1KJVB 4LEOA 3VXUA 2Q3AA 5DD5L 2ESVA 2ZUSA 4JQVA 1CGWA 5FUOH 5D7JC 2VISB 4E0RA 1NLBH 5I1CL 3MGTA 2FLBT 4PTTA 5CHNA 1BEYL 4ELMB 1CFQB 2C1PB 1S3KL 2IF7A 4XP6H 1N3NB 4GG6F 5E8NA 1IM3B 2ADFH 4HT1H 1R3JA 1AH1A 5EWIL 1NDGA 1J0KA 1QO3B 1NAKL 4POUB 1HH9B 1ZK9A 4L9LA 4AL8L 2AJUL 1LEGA 1PYWA 3SJVB 4HIEA 2NX5D 2VDRH 2X4SA 5DRWA 2NY5H 3MRKB 4X8JA 3QUYA 3V4UL 3WDJA 1UZ8B 5IVXA 3ECBB 4PD4J 5FGBC 5IW6B 2DLHA 4DZBB 1J12A 1OQOA 1U92A 4C54A 5EO1A 4WU7A 1N5AA 1TTGA 1KN4H 5GSVA 3D48R 5KN5B 2YC1B 3EDKA 2BCKB 4JQVC 2N4IA 5DK0B 3BHBB 1YECH 5HHME 5C07D 3ZKSD 4F7EA 1YEHL 1OAYL 2XY2A 2AV1B 4R4NC 2BJMH 4CN4A 3BKMH 4NKOB 1MJUL 4HFUH 4Z7OF 3HFMH 2A74B 2EXWC 4BZ2H 3FO9B 4UIKH 3G5YA 1RUKL 5FHAL 3O2VH 3VFNA 5T3ZE 3G6JF 4CNIB 4Q9RH 1ZSDA 2R0LH 3ZL4L 4H5SA 3HKFA 1IMHC 5C0CE 3MLTA 2DB8A 3N85H 4JFXB 4QEGA 2FWOB 5FGBA 3BGMA 25C8L 3U7YL 1G6VK 2V6HA 3VD4A 2GAZB 1X7QA 4UBDD 2FX9L 2MFNA 5IVXB 5CLTA 1OWRM 3CFKA 5MEOB 3F7QA 4M93B 1KENL 3QUZB 2F54B 1FL6B 4PRBA 3B2UD 1FPTL 4ZS7L 1FDLL 4QT5A 3T8XB 3S88L 2VDQH 5TPWL 4FG6D 3VDCA 5HVFB 2R8SH 1VPOL 2E9BA 1CR9L 1AC0A 4M5ZH 5DJYA 1C1EH 1JYNA 5E6YA 1DBKH 1E4WL 1A7NH 5K9OB 3WL9A 2B39A 1J8HA 4H0GA 3N1QC 3D3VD 2PETA 3H8NA 2BCKA 1L0YA 2Y9RT 3C2AH 4DUXA 5JMRA 1CDUA 3DUSB 5C0BA 1I8KA 3OZ9L 1INEH 1AC6A 2AABH 4ZUVA 2WBWB 2O5XH 3MNVA 2R1XA 2EYRA 5T1MB 3BKJH 1BQHG 2DM4A 2HLAB 3LSOA 4KKLC 3BPLC 3ARDB 3DVNA 4ENED 4L8BB 3REWA 1TCRA 3FONA 3WHXB 1KB9J 4UIMA 3E6FB 2X4RB 4HIEB 4HH8A 1I9EA 4LLWB 4W70A 4EN3D 3IYLW 3QIWA 2IGFL 4G6FD 5DZOA 4HXAL 1T22A 1T6WA 1OTTC 2Z91A 4H0HB 5FAAA 4MDJA 1U8JA 4BJLA 5L8JB 1PQZA 1QD0A 5C0CB 2V7HA 1A4KA 5F7NC 3S36H 4K23L 1KIQB 3TPUB 1RFDL 3T8XA 2DBLH 1XF5A 1QFWI 2QQNH 3QNXB 5IJVA 5KS9A 2BOBB 2A2QT 1F4AA 1L0XA 2P5WB 4GAYB 2J8HA 1IFHL 4ZFOA 4RFOH 4KU1A 4OQTH 4CVZA 4NKMA 3EDEA 1LP9B 5CZXD 1RUML 3DWTA 4QRTB 3W82A 3QWOB 4LHQB 3VG0H 4OLYH 4ODSH 2FJGA 1GGYA 3M1BA 4JFZH 5D96C 1WUNT 1YMMD 3OXRA 1MOEA 2PO6C 4H8WH 5IHUH 2J2ZA 2J3SA 4JFQB 3N1FC 2X41A 3HC0A 1IFHH 3D18B 1ZLVK 1U93A 4G9FD 4JM4L 1TLKA 1LMKA 2FR4A 5DHVH 5DYOA 1G7LA 2YK1L 2ARJB 4Q6IA 1LVEA 3CFKB 1O5DT 1RZKC 2DQJL 3QG7L 3OJDB 1A1NA 3LKQA 4YBLC 5EDXA 4V2BA 2Y25A 1QLEL 2QADC 3NPSC 4L29A 5GSRB 3B5GA 1NPUA 5T5NG 1RK1A 3TNMA 4G42A 5BVPH 1MFDH 3NZ8A 2BOBA 5E95B 1GZPB 2GJ6D 5DJCA 1KB5B 4TTDC 3P4OA 4FTVD 4JGMA 4JRYA 3TPUA 4P23C 1C16B 4KMQA 3VWJD 2EDOA 4NUGL 3TT1H 1FNGB 3HC4L 1KSRA 1TJGH 4HKBA 1UJTA 5JNYB 1KLUB 5I73B 4JEGB 3GSQB 3ES6A 4XBGA 4BELD 4I5BB 1LK2A 2B1AL 3CPLA 4GMTL 4JFDA 3PABA 3HE6C 1CT8A 5MP6L 1TMCB 2FZ3A 1FORH 3WUWB 3M1BB 4E0RB 3CVHB 5DQDL 4JFOA 3CU7A 3V6FA 1NLDH 2JJUA 4HJGA 3VXSD 1RZ8A 4QXWA 2XKUA 1T03L 1C5CL 4F7TB 2Z31D 5K93A 5HHOD 1YNLL 4N1HB 3TWCH 1DBKL 2ICCA 4LASH 4YGAB 1FPTH 4G3YH 1A3RL 3NVQA 2C7UA 1BIIB 1PYWB 2OZ4H 1D3CA 4YDVB 3QEUA 2EDQA 3KWWB 3VFTA 1LO4H 4UQ3B 4JM2A 5L2KA 3RWCA 3PIQB 4NQDE 4UT7L 1T1YA 1YDPA 1QHPA 1F4YH 3IFLL 4CVZB 4UZGA 4EVNB 1RK1B 1W72A 5MEPB 3VRIB 4EDWH 4WFGD 1OTUD 5DVOA 5ISZE 2OSLA 4NC0B 3QDME 4K3GA 3QB7C 5GRZA 1FG9C 1J9CT 4JO3H 1A1MB 4HD9A 1DBML 3PDOA 4DK3A 4OZIA 2P5ED 2XA8L 3D0VA 4WW2F 3VXSE 4EN3B 4LRNH 1GGTA 2ZPKL 4S0SD 1EMTL 3PL6C 4X5WB 2ZP0T 4PJXB 2XN9D 3RDTD 5BOZG 1CD9B 3H3PL 3FO0L 4HG4K 3NCMA 3MCLL 3T2NH 5JXEC 5KSBF 1JHKH 4KHXH 1BFTA 1CLOH 3EOBB 3EYQC 3HB3C 3NFSL 4KDVA 5KOVC 5I17A 2I9LA 3EDDA 5J6GA 3ECBA 1RHHA 1MHHA 3KLDA 2IMNA 1BQLL 1XGTA 4X9IA 2W9DL 5DJ2B 5I19L 4GMSH 5EH1A 3JV5A 2QJDA 5JOEA 3K0WA 4WHCA 5E6ZA 1AGEB 5SV3A 2BHYA 5JMOC 4G9FA 4JPKH 3MROB 3DMMC 2EEAA 3IXAA 4P46A 2D7QA 4GKNB 4KJPC 3UJIH 5TE4H 1U3HC 2VLLB 4IRZH 1MVFA 3WNKA 2YXMA 1VA9A 1YYMH 3FO9A 5A40E 2DICA 3SE3A 2P8MB 2AK4E 5E99H 2X4PA 2GSGB 5EULV 2IGFH 1RZ8B 4J3OC 4U1GB 1EHLH 3WD5H 3RVWD 4G8IB 1LO5A 4NYLB 2BC4B 1XGUA 4PJ7A 3MLWH 1Q9KB 5GIRA 1NFIA 2ID5A 1J88A 4HIIB 4IMLB 4NZRL 4K3JH 1UM6L 1CVRA 5ENWB 3LS5L 3L3IA 4X6CA 2VIRA 5I2IB 5JDSB 5HPMA 5MERB 2SEBB 2QSCH 4P5MA 2EDRA 4LLYA 4OCYL 5JZ7D 5HI3C 4HIJA 1CGUA 3C5ZD 3E6HA 1YQ2A 2XV6B 3B2VL 2DKSA 4P46B 3WIFA 4NSKB 4P59L 5I8CA 3P3YA 3MGAA 2VXVL 1ADQL 4OCSL 3UEZA 5E5MA 3VI3F 4FRWA 4NKDA 4PR5A 2J5LC 1Z2KA 3BP4A 4G8GD 4K3DH 5GS0H 1P1ZB 2AERT 1T0NB 2RQ8A 2ZSWA 4X6DA 2VKWA 5I66B 4BUHA 3HZKA 4X8XA 3WNMA 3B8SA 5I76B 3S8WA 2FH8A 4XWOC 3EHBC 3MUZ1 2AJXL 4Z95H 5GIRB 1NGPH 5DFWH 1HHGA 1N2RB 5DRNB 2HVJB 3N85L 1I9JH 3MODL 3DLQR 1YEJL 4BH7B 3CC5B 4TSCH 1OP5H 2I27N 3MCKA 3BISA 5BS0E 3VXQB 1GL4B 5GRYA 2VLRB 1PKQA 4CGTA 4LOUD 3BN3B 5D1ZB 3STLB 5E99L 5D7LD 3WNOA 1T5WA 4WRLA 4I3GA 4IDLA 4OCWL 5IMOB 2C5DC 3OKOB 5FDWB 4RAVB 4DUVA 5EORH 3IJSA 4PR5B 1G6RA 1F90H 2BSRB 3HZMB 3WIFB 5JNYA 1WICA 4X7SH 2GCYB 4XPHH 5D70H 4Y4HC 3I6GB 4MJ5B 2X9XA 3L6FA 4R7DB 1EO8H 1ERNA 5KANG 4X80L 5HD8D 3WFZA 1GHFH 2DQTL 4RWYH 1IGJA 4Y5XC 1XF3A 3FT2A 1X5FA 2AK4D 2C9AA 1JNLL 4X6DB 3W81A 4HT1L 1JF5A 1KLGB 4HXBL 1UCBH 4NKIH 1C08A 4HG4J 1F2QA 1K8DA 1GOGA 5FKAA 1H3PL 4OKDA 2A6KA 2FATH 2X89D 1MRCL 4LLYB 3ZT5A 4OLUL 2YD9A 3G5VB 4HZAA 4WTWA 2UYLA 5IF0B 3TVMC 1DUZA 1T1XB 43C9A 3Q48A 4EDWL 3JWDC 1DQQB 3CFDB 4KGJA 1Z0NA 1T1ZA 5KG9A 4KKLD 3D2UA 4JN1L 5J89A 4ETYA 1JHKL 1FC2D 3OG6B 1T1YB 4NM8H 3BQUD 3BESR 2EYTB 5HPOA 1DEEB 3CXDH 5HI3D 3T1WA 5EPMB 3V0VB 4MSWA 2PR4L 4OLZL 2DI9A 2EO1A 3IDIA 4OGYH 3CX2A 1RD6A 2CRIA 3ZO0A 3SDAD 5C0JA 4GKSA 2HKHH 2YUWA 3HR5A 1S7XA 3SGJC 1HQ4B 5GJTH 3BGFC 1G9NH 5FYLH 1A7PH 2WWMD 1U8IA 1E4KA 3GSUA 3KPPB 1D6EB 3DVIA 1LDPH 4WJ5A 1QUNA 43CAA 5DGQA 2DQIL 1QFPA 4X5WA 4EI5B 1IGMH 2HLFD 4FQ1H 4R8WL 5IBUB 5E94B 1KTLB 1WIUA 3FT2B 2ORBL 3G5VA 3BRFA 4X7TA 3BZEB 5DZLA 2ICWB 4EQ3A 3ARFA 2A9NH 1WK0A 4U3CA 5EOTB 4Q74A 4MA7H 4UMGA 2IPTH 3MC0A 3RVVD 2W65B 3D9AH 4LGSB 1NFDF 2VDPL 3JV4B 1XH3A 1CVSC 3GHBL 4FQXA 2NY1C 4G3YL 2YSSA 3BOVA 3FAXA 3BZ4B 4FFZH 3FMGH 2A1WL 2BMKA 3MRLB 3K2MC 4P5TB 3MROA 6CGTA 1MLBB 2GJZB 2HH0L 4RMWA 2G9HA 5BVPL 1P4BL 3EYQD 4KRPC 2EZ0C 4HWUA 4JO2H 3F7VB 3CFEA 4NFBA 4GUPB 4LVOB 1N7MH 2YK1H 2XZCH 5GGQL 4PJEA 5D6CB 4PLJD 4YDKH 3X3GH 3VGDA 1MFBH 3IFNH 3BKCH 3NCJL 3BH9A 1JPSH 3HUJA 4NP4H 4Y4HD 1J8KA 3ARRA 4FA8A 4O2CB 1F3DH 2NX5E 4M61B 3W5MA 3PWLA 4OGAD 5HYSA 3DYPA 5DVKA 4NBYB 2A83A 4JDVB 3QR2A 4PRHE 1RHHB 2OTPA 2DL2A 3O6LH 1IC4L 3HI5L 4K2UH 3L3HA 1CE1H 4LKXA 4OQTL 3HAEH 4G43A 1EX0A 1KEMH 2LVCA 4DQOL 4ISVB 4U1KB 4E41E 5LVEA 1ZXQA 2YUXA 2HT3D 4M43H 4P2OD 3FB8A 2Q7YA 1WZ1L 3KJ4C 4D3CH 3BIBX 4XP6L 1FVCA 5HGGS 5JW4R 5D1XD 4MVBC 1Z9LA 4RMUA 2OJZH 1M7DB 4ZOBA 3GM0A 3IJHA 4FQ2H 4OZFB 4QLRA 2FEDC 1ZGLP 3GI8L 5BOPA 1IGIL 3MOBL 2DBLL 3DXAE 4MZ3A 3MGTB 4CU8A 3D0LA 2HTKC 3BE1L 1PGRB 4ZUWA 3RVVC 2BY2A 1U8HA 4YBLB 3KPSE 2RR3A 4Z7VB 5D93C 5FYKH 4IRSD 1ZHLA 2YMXL 2FBJL 4XP1L 4LL9A 4D94A 4ERSH 2VLKD 1PEZA 4MB3A 3VJ6B 4F33A 4Z5RA 5IB2A 1HXMB 3S4SB 5LGJB 2CRMA 1QQDB 1DBJL 2Q76A 3EIFA 5A2FA 4HJJL 3SE4C 4YEEA 1A7NL 3GSVB 4P23D 3QISA 1JFQL 1H9VA 3KPLA 5CEXB 3ARSA 3HI1B 3D25B 3JSSA 4W6WB 3QYCA 4QRRB 4IHOB 4MQ7B 1FH5H 2HFGH 1AGCA 4RQQB 5E2UL 2ITDA 1N0XH 2FDBP 4O51B 4M00A 1DZBA 3SKJH 5BRZB 3U0WH 4M5ZL 4XCYA 5E2TL 4BQ6A 3CZFB 4LIQL 1E28A 3RVUC 1JN6A 4HGWB 1A4JA 5DVMA 4DEPB 5IUSA 3TIEB 5EB9A 4DOHB 2ZJSL 4L3EA 2Q8BH 3WUWG 2P49B 2BZDA 4YNYB 1AHWB 1SMOA 4DWHA 1J0JA 1F6AA 2BXYA 4JQXA 5E8PB 2OI9B 3QFJD 3DX7A 5D7SL 1MJ8H 4FQJL 3P4LA 3OJ2C 2CK0L 3HC3H 2XWBA 3NIFE 1MFCL 2FRGP 2FWOA 4YHPB 1L6XA 1I75A 4PV9A 5C0ND 3ARPA 1N6QH 2KBGA 2P5EA 1IL1A 5EBWB 2YA2A 4JFEE 1GVIA 1BVZA 1BAFH 4IDJH 3T0EC 3SE8H 3H6JA 4OM1H 4DN4L 1YYML 4PGBA 4IRZL 1WTLA 1K2DA 1MJ7H 3QULA 4Q0XL 2ITDB 3GSVA 1LEIA 5ITBL 2DJUA 3HZVA 1PY9A 1RI8A 3DUUA 3DX9B 3MV9B 5IB5B 4S11A 3QFJA 2HJFA 1SBSL 5DMIH 3VXRE 1RIHH 1WAAF 2C4FT 2W9EH 5H94A 3PL6B 3GBML 2UWEB 3ZE0E 4HDIA 4GRWF 1MCLA 2W0FA 4KHXL 3C09C 4J3WA 1S3KH 3TLRA 4TPRL 4UT9H 4N0FA 3I75A 5JR1L 3UDWC 1N5YH 1AXIB 5IB2B 1HI6A 1NCAL 1R5VB 4XGZB 2XZCL 4YBQD 5GGQH 3SDCB 2Y07L 4CADA 4E42A 2YPLE 4XCEA 4TUOA 4Y5YC 1UCTA 4CMHC 1RJZA 4PRBB 4S2SA 4PV9B 2FHBA 5ALCH 4Y4KD 1GCFA 5ICZA 1TQCB 2APVA 2PNDA 4AH2B 5FUOL 4NCDA 4WY7H 3WE6A 1HKLH 1CQYA 3O2DA 5DFVC 3GMMB 3SE9H 4FFZL 3QI9B 2DMBA 4BYHA 1NANI 4HUVB 4JRXE 1MIEL 4RGOL 5AWNH 3ZKMD 1LEKB 1CICC 3R1GH 3PGFL 5ID1A 1YEGH 1BPVA 3VXMD 2NTSP 3DI3B 2HTLC 3WIHA 4NZJA 4YHOH 1G6RL 3KLAB 2YKLL 2EH7H 5D6CA 3EW3B 4GXUN 1A6WL 1INDH 1QP1A 1M71B 2GTWA 1IEAB 2R69L 3GNMH 1N0XL 1N3NA 1QRNE 3LKOB 3OKKA 3VXRB 5ABDE 1KB5H 3OJDA 4Q9BA 5FCUH 4NQEB 4QHNB 3WLBA 3ULUF 4ZQKB 4XGZA 4LSPH 2NTFA 1H3GA 1TDQA 5JHDE 1NEZG 4FFWC 2PW1B 4NFCA 1EHAA 3SQOL 1DQDH 1KCKA 5IB5A 3F12A 5FYKL 5T33H 3QEQD 4XRCB 3GJFB 3OAZH 3I6KA 5EC2A 5C0BE 2DJSA 4APQA 2BVUA 4M62L 2AV1A 2J1KA 4XCCL 3RL1A 3ESUF 1KPRA 4G7YH 3VFPA 4LSQH 1ZT7A 5C6WH 1Y18B 1Q1JH 2YS4A 2NY4C 1UM5L 2BNRA 2R1WA 4LLMA 5JW3L 1NBVH 5DK2B 2K3TA 1LO0L 5IB4A 1G7QB 3CSYB 4ZO9A 3VFWA 4HV8A 1LILA 3ZTJG 3S5LG 2BNQB 1JPGA 1U8HB 4GRLC 3ARZA 3WIHL 3VFMB 3EYFB 4PRAA 1EPFA 3MRHA 1MF2L 4R96A 4DZ8B 3QRGL 1LD9B 2R2EA 2C3XA 1EV2E 1QRKA 5IHUL 2HT4C 3RDTC 2N1KA 3IGAA 2EC9U 3PWPD 4H8WC 3FO2A 5DS8B 3DX6B 5ID0A 2HN7A 3C6SB 3VG0L 4ODSL 5MENE 3MUGA 4I3RH 5EU7C 1I8MB 4QOKB 2YEZB 5DMIL 5DJZA 1A6AA 1RULL 1X5IA 4PJDF 1I1AD 3VH8B 3IAPA 4OGXL 4Q2ZB 2VERN 4R6UA 2KDGA 3PHOA 1AQKH 3C60B 4GSDL 4YH6A 2AV7A 4L8CB 1XR9B 3EYUL 2VZSA 3WL9B 4PRNA 2DYPD 2NY6C 1EFXA 2FZ3B 4CJ0A 2D2OA 2PXYB 5LXGL 4HQQL 3LN4B 1UEYA 3TBSA 1T0PB 3FT3A 5ESAA 1CN4A 3OKLA 5EIIB 4X6FB 2R4SH 3MREA 3Q1SH 4ZG1A 3CMGA 4H1LA 4FOMA 2LVEA 1OAXH 5D9SA 4FXKB 5F1NB 1I7RB 5EOCL 5J12B 1P6AB 1PX4A 2OQJA 2CR3A 5GRXG 3TVMB 1N6QL 2EDFA 4GQPH 1CFQA 2OTUB 2CKBL 4O58H 3P9LB 1RZGA 3UBXA 4P23B 3ZKXB 5CEZE 4LF3A 2YR3A 3RWDB 3WNNA 1FZMA 3MV8B 2VWEC 1H3UA 2J8UF 1LE5A 1MVUA 5LJYH 3BZFA 2JCCB 2CMRH 3U0PA 4YC2C 4L4TD 2IALB 5FF6B 5ESQA 4NQED 5GRJL 3M17B 3U1SL 1IT9H 1T4KB 1G7HA 4CW1A 3IF1B 2D03L 4MJIA 3OXSB 1I9IH 2Q7NA 2WANA 4PS4H 5DJ8A 4HC1H 5BO1H 4RA0C 4XBPA 2JJWA 3G6AA 1A7PL 3TYGH 1JZ2A 4JCMA 5KSAD 2OZ4A 4TULH 1OSPH 1I8LC 1QFUH 1S7RB 3AC0A 2EEBA 3DHJA 4HLJA 5GJTL 2P8MA 4HGMA 3P4MA 5E6ID 4EI5C 3GMRB 3D0VB 5MP6H 3C08L 3IKKA 4CRPA 4GS7C 3QQNA 4L1HA 3KYKL 4HW6A 3OJMB 4OZGE 4ZSOB 4YXKH 2IAMB 4IIQB 1OAXL 2QL1A 3VWKD 5GGRB 5KSBA 4X8JB 5MEQA 4FQXD 5L9DL 2HP4A 4Q9RL 2OCFD 5EZOH 3W11D 3LEVL 4ZS6D 1DR9A 1T0MA 5D7KE 4P5TC 4EEEA 2APFA 1FVDB 4MWFA 3MOBH 5T1DL 1RZJC 3WO3B 2A9MH 2IPKA 4FQ2L 3K81A 1SYSB 4M6NL 3IDJB 1FAIL 5BVJB 1BJ1H 3PGCB 3WYRA 2WUCH 1C5DA 5BZDA 1PEWA 1SY6A 4JPWL 3WHE1 1A0QL 3QWOA 3TBSB 2L7JA 2E7HA 4NBZB 2DQEH 5ESVA 5T5FH 2R23B 3OB8A 1G7IB 2XI9A 1RK0A 5ICYA 4TNWK 2FIKB 4WCYL 4LPXA 5I1AB 4JANB 2G75B 4KY1L 1LO2L 2XXMB 1J18A 5C8JA 1A64A 1AO7E 2B0SH 1QSFD 5D5ME 5DRNA 4FQQB 4NQVB 4OCWH 3BP5B 2X4UA 1QSEA 3MACL 2B1HH 4GJTB 4NPYB 3MFGB 4I1NB 3OKNA 4HF5L 3I3DA 2HRPL 3A6BL 2ZCHH 3OAUH 1AD0A 5DWUH 1BAFL 2H45A 5F89A 5CCKL 9CGTA 1S7TA 1WBXA 3KJ4B 2QQKH 4G7YL 5MEOA 1J05A 1U8PB 3QT2A 1T5WB 2HG5A 5EO9A 1OT1A 5KJRL 3PGCA 1NFDA 5HVGB 3VFUA 2C1OB 4NRYA 4NDMB 3B9AA 5DJXA 3MV7B 5FUCC 3QAZC 5B8CB 2J88L 1UB5B 4POZC 2Z0BA 4YPGA 3MRBB 1FYTD 4Y19A 1OW0C 3O6KL 5J56B 5FA3A 4PLKC 1MH5B 2HLFC 5I1IL 2BVEA 4LHUB 4HCRH 4NRXB 3MRQB 4MNQE 3D3VB 5IW1B 1IC7L 3SDDA 5C9KA 3K3QA 4PJHE 3PDOB 1YN7A 5ACZB 2XRAL 4NQVA 4TOYL 2V17L 3TA3A 2HVJA 3TH4T 5H35B 4XVJL 2X4UB 1W8OA 2ERJC 3DVNB 2IAND 5HHNB 3FJTA 4Y5VB 2NW3B 5HVHC 4RZCA 1MCIA 3Q2CA 1FCGA 4RCAA 4OLXL 2VLRA 1VGEL 1B4RA 3ULUC 4QRRE 1H5BA 2RFXA 1MHHB 1NQBA 5CCKH 1V7MH 1A1NB 3K80A 1SYSA 3LKQB 3X12A 5C2BH 1IAIL 3LKPA 4QRRD 1JYVA 4EVNA 1S9KC 1OB1A 1XF2A 1NKRA 1PBYA 4I2XE 3THML 1JZ5A 2E3VA 2AVGA 3WD5L 4Z7OE 1KPRB 5SX4H 1DVFA 2VN7A 2VYRE 5EU6E 2NY2C 1X5HA 3BP7A 2C1OA 1RK0B 3Q3GB 1NDMB 1FFRA 4P2RA 1BF2A 4Q9QL 4OT1H 3MRRB 3OQ3B 1BX2A 1CFSB 2VTFA 5D1QC 2A38A 5I8KH 4TVPE 4JQIL 1JYXA 5F44A 2V5TA 2AEPL 12E8L 1IBGH 4LU5H 4FQLL 3D85B 2BC4A 5D5MF 5H37H 3IU3B 3LQZA 3L3GB 4ZD3L 3ZSTA 3KYMB 2C4FU 2J8UE 5D1XC 3UTTD 5FDYA 4LVNC 1MUJB 3H9SB 1NAMA 2WK2A 1JHLH 3NFPB 3PNWB 4X99B 3GJFK 1MCWW 2PKDA 1YC8A 3TCLB 5HPMB 2NNAA 3L3IB 2VLJE 4LARH 4X6CB 3RIFF 1X5KA 1N59B 1SMAA 3Q6FB 3Q0HA 2H32A 5F93C 2YA0A 2H6PA 2NY3B 5L9DH 1EAPA 1G9EA 3TNMB 5L8KB 1X6LA 4NDMA 1MFBL 3QXAB 5J3HD 2GJJA 1EA9C 1KC5L 3VH8A 2EIEA 3L5XH 2VZ1A 3BN9C 4U2YA 3BVNA 4WUKL 1T21B 2AV7B 3SDYH 1PFCA 4OKVA 2D9CA 3RGVC 3WUWA 3MJ7B 4MDIB 1T7YA 3KYNA 3L7FA 4GO6B 3TBVB 3FRUA 3BAEL 4KDWA 1UVQA 2B5IB 3RNKA 1XGQA 1BBJB 2OR8A 3CPLB 3JWDH 4JFDB 5H35A 3LZFL 1YUHB 4BK4A 4X6FA 3GHEL 4WI7A 3N9GH 3SQBA 2HT4D 1ORSB 1EEZA 4YPJA 4IRJA 4P46D 3MMEA 1E4XL 3B9KB 3CAFA 3IAGC 1EIBA 5JUEH 1AKJD 1VFOA 3ARDD 5FV1L 4YHIA 4G6MH 2V2XA 1FE8L 4ZSOE 3QZWG 4QYOB 5DXWA 3V6BR 2LTQB 1TZIB 4HH9B 1U2CA 4M5YL 5I1LB 4KKAD 4P99A 3V6ZB 3HI6H 1ORQB 4XP4H 3WJJC 15C8L 2ED7A 1ZHBB 4TQEL 3T65A 1XGTB 1OAQH 4KTYA 4D8PB 3OSKA 2XQBH 3GMPA 4G80B 4BQ8A 5BVJA 3WS6A 3GSNL 1YY9D 1J8HB 3FFDB 3EBAA 2DQUH 5CLWA 4OD2B 4WV1C 5IFJA 1U3YA 1UC6A 1W72B 3C8KA 1NCUA 4WUUD 4KUCF 5KS9E 1AY1H 1RURL 4P2QA 5E2WL 3DRTB 1BFOA 1YA5A 3U7YH 4M7ZB 2V2TB 4K94L 1R24A 4PREA 5DJ6B 1QKZH 3WHXA 4PGDB 2GSGA 4GRMB 1UEMA 5I6XC 4WU5A 4ONFL 4QTHA 3FKUS 1RULH 4JN1H 4FZEL 3T0VA 1MCBA 3L5HA 1ZS8A 2X2YA 3AS3A 1PG7W 4M1CC 4NQSA 3B5HA 1QFOA 1N59A 2DMCA 5KVEH 3B9KA 4OFIA 1R3HB 4XPBH 3CXHJ 5C70A 5LBSH 5C0EB 1T1XA 3TP4A 43C9B 3NH7L 2G5BA 4ONHA 5KS9F 4X9FA 4KVCL 3RI5F 3HI1A 3U6RA 4HQQH 2HTKD 4XP9H 5HY9A 1QEWB 5KG9B 1JGLL 1NCCL 4DW2H 3BT2H 5C9JA 4NHUB 5DMGC 3QDAA 2EDJA 3UTTA 1KTDA 4KUCD 2CGRL 5IVOA 5D7IA 4ZAKA 3C5JA 4XCFH 1M6OB 3NFNB 3NZHH 5IIEB 4NWUH 1N0LA 1A4JB 3BXNA 5F9AC 3SGDH 2X4PB 4FTVE 4YGVA 2COQA 5HYEA 2ZZUT 5E5MB 3VXPA 5GS1C 1RJYB 4L4VA 4HUWA 1BQLH 2VXTH 5I74B 1S9XA 4F7CB 3QWRA 4OFPA 2HT3C 5CMAA 1K6QH 4XI5C 1IAOB 5INDA 1TVHA 3O6FA 1CXKA 3QIUD 3DV6A 5DDHB 1JPSL 3HE7C 3MRIA 3EO0A 1IKFH 3GMLB 4FS0A 4JKMA 4Z9KB 1KPUA 3ULSA 2XG5A 4DCQA 1Q9OA 4G9FE 3MLYL 4LSQL 1EBPA 3ZDZE 4HH9A 5GZNC 5C09A 4ETQA 2ZG1A 3DJ9A 4KI5E 3RU8L 4KJYA 3LY6A 3S37X 4U3XA 1CZ8H 3P4OB 2K1MA 4HWEL 5I16A 5CJ8A 1KACB 2VRAA 4P5TD 3VXME 4YHKH 4MCYB 4OI7A 4HWBL 2PYED 1EERB 3W11C 1RUPL 2R0WL 3VGAB 4PFEA 1SJEB 1WAAE 4Y5XB 3L95B 1BFOB 4JHWH 5GS0L 5I66A 2BXZA 2NY0D 3QZWA 4RBPK 1UKSA 1S9XB 2UWEA 2H8PB 1SM3L 4AEHL 1LK3H 4ZPVA 1DL7H 3RHWF 5INDB 2EE9A 1L4IA 2VXVH 3G6JA 1S7VA 2ZUXA 4YGVB 3QCVL 3LV3A 5JLZB 3OAZK 4YHPA 5K9KB 1WBZA 7CGTA 1IGTB 1OSZB 1OGAB 5BZWB 4PB9H 1A3LH 3A6OA 3QHFL 3ZDXF 4KK8C 1IC7H 1UA6L 2FECI 3U6RB 1BBDH 2DBJA 4ODHL 1UH4A 2BSED 5C9JB 4FFYH 2VXSH 1IKNC 4JCLA 5D2LF 4QHLB 5IBTL 2OL3H 1OOAA 4TTDD 4A6YH 4R3SA 4JFEB 4MLSA 4C57C 4HPYH 2DLIA 3KPOA 4G43B 3O3EA 3N9GL 4JZOB 4S1RL 3X3FH 1JNNL 4U49A 2BFVL 5IWLA 4PJFA 4TTGA 3FB5A 3MJ8A 3I6GA 1CFVL 2XACC 3P77A 2EIBA 2OSLB 4OKVB 4H26A 1FNEA 1U9KA 1VFBB 1ZHKA 2FX7L 1HE7A 1AIFB 2BSRA 4MQXC 2AJ3B 4YDLB 3SE9L 1QRND 1CLZL 3T2QA 2XN9E 1DCLA 1Q0YL 2IAMC 2CDGB 3OAUL 3MRJB 4Y16B 2D0FA 3L3OA 5CKGA 2Z35B 4R0LC 2N7BA 1YUHA 4Z7UF 2ZCLL 2H26A 5TE7H 1JL8A 1T83C 3JWOC 1LDSA 5E00A 2N56A 1U3HA 3JV6A 1R5VA 2CO6B 5F7EL 5FO8A 1IQWH 1EEYB 5F3BB 3KPPA 4NN6C 1T20B 3F58L 3BP6A 4NZUL 5KTEH 1UWEH 4F7PB 4E5XB 3FQTB 5EIVA 5CEZD 1FG2A 4OIIL 5D8JH 1BQUA 1EO8L 2UY7A 4GRWE 3W9EB 2DM3A 3ZKNC 2X4OB 1I1AC 2D4FA 2DQDL 1NSNH 3JTSA 1IVLA 3MLUL 3IKCA 4X7SL 2H6PB 4XPHL 4PJFF 4KZEH 4LQFL 5MEND 1C5BL 1NBYA 3CH8A 4NZUH 5FK9B 4X6BA 3D25A 5KOMC 3TBTB 5TFSL 1UYWL 1FAIH 5EU5B 3VE0B 3MA7B 4TUKH 4NGHH 5IV2A 4QGYA 3AVEA 4LVOC 1VKXA 2YSSB 3O3EB 4X4MA 4F80A 5D2NB 4GW4A 4FQJH 2OBGA 4O9HH 4WI5A 5HTSA 3RL1B 5J8OA 3EKCA 3G9AB 5GRUH 3SY0A 3EYOB 3SE8L 1A6ZA 2GTZA 4HKJB 5JOFA 3MBED 1TXKA 3TFKC 1CLZH 3S96A 4M7KH 43CAB 3P0YL 3V6OC 4AYFA 2AEQL 3GKWL 4U6YB 4CMHB 1G7JB 3HNSL 3WIIH 1WC7A 4LCWB 2OK0L 3N0PB 3VDBA 2V2TA 2LFGA 3CLEL 1ODAA 2QSQA 2HKFL 1A9BB 3STBA 3MSPA 1JWMB 5AUMB 3FZUC 2OP4L 1I1AA 4WDIB 2IQ9H 4WJ5B 4ZOAA 4NQCD 4ZOCA 2BSTA 1FJ1B 5IHZA 5I9QC 5F8QC 3ROLA 5LWYL 4XVSH 1GPOH 3QUZD 2OZ4L 1MAMH 3QCTH 4QWWC 3F5WB 1D5XB 4L4TA 3MQIA 5IR1B 4BFIA 3KPSD 4WWKD 5EUOB 2VITB 5HHPB 1JYWA 1A6PA 4JFHD 4UDTB 3PWNB 2VKXA 1QYGH 4OLXH 4O02H 4ZFFA 5B8CC 5IB3A 2ZCKH 4MMZC 5DD0L 1XAUA 5IG7B 1VADA 4G5ZH 5J57B 2DWDB 1CBVL 3SKUD 2EZ0D 4MNGA 3QJHB 1X9QA 4U05A 3VFGL 3EO9L 5HJ3A 4RGMC 4Z18A 4I77H 3T4YA 1MRDL 3ARXA 4ZUTA 4PP2A 2XRAH 4PJHB 5A16B 1QYGL 4W6YB 2KPNA 3V5KA 4LSRL 1S9VB 2DAVA 4RGNE 1KJ2B 1QSFE 2NLJA 2PCPB 1WT5C 3I85A 4K3EL 5H2BB 4JG1H 3C8HA 3SPVA 5DJ6A 2W0FB 2H41A 3MLVL 5E8EA 4PJEB 2DIJA 1N2RA 5D2NE 1NDGB 2ED9A 1J1PH 2VZUA 4PPTA 5HDLA 5F72S 5D6DA 3UBXB 3FQNA 3O4LD 1XMWA 2I5YH 5IJKC 3RL2A 2VMFA 1REIA 2R0LL 2X1PA 3UJJH 4S0TD 3HI5H 4PTUB 5SWSE 2GQHA 5DLML 4IOSD 1OARH 3DRQA 5HDQL 2DM2A 3V4PL 3DSFL 4AIXA 4F15C 2R0KL 4H1LG 4WU7B 3VMNA 1MLCA 1KCVH 1MJUH 3QUXB 5HYFA 4ZTPH 5DK0A 5J11C 1X4ZA 5D7IB 4ZAKB 1QR1B 1GGBL 1MFEL 5JW5B 3JXAA 2VR4A 5TE6H 3LPWA 4P3WA 1L7IH 3DO7A 2OI9C 5GZOD 3RFZC 5F88A 4KKBD 2DWDA 4S10A 5CD5D 1HEZB 2GITA 2DIBA 3QHZH 3AS2A 3LEXB 3MLXH 4BSVB 1SEBB 4LEXH 1I1FA 3NABH 4LFHD 3ME0A 1MHCA 2ILLA 3LKNB 3SQOH 5IQ7L 3S3JA 2A9ML 3DETD 4QOKD 1KLGA 5FUZL 3S35X 2G2RB 2AXGB 5GGVH 5J9PB 1NANH 1CS6A 4HPYL 5L0QC 2N7AA 2XA8H 3QEGL 1YPZB 2E9JA 2OJEA 3TH2T 4HXAH 4DTGL 3DRQB 5FO7B 3QDGD 1LE5B 1T0MB 1QNZL 4EIZC 1NC4D 4JFDD 2HFFB 2ADIA 3RVTC 4G6KL 1ZE3C 3DIFB 5SWZD 3BWAA 5SWQA 2M2DA 4EZMA 2F15A 2W07A 3L3DA 3QJHA 3FN9A 5EZOL 3NBNA 3UTSD 5F1IA 4MCYA 3QDMD 2O5XL 4WGWB 4UU9A 1CTOA 1GIGH 4K55A 1HEZA 1XIWD 3AREC 4NHCH 2A9NL 4HUVA 3QIBC 2DL9A 4P9HL 3RVXD 3LEXA 4C56A 1OCWH 1VEOA 2FHCA 5I71C 3DVGA 1CGSH 3WDHA 2FIKA 4RAHA 4RWHA 5DK2A 2XKNA 1ADQA 5E8DL 1XF4B 5CEZL 3OG4B 4NHCL 3K1DA 5EOCH 1JPST 1JI1A 1RUAL 4F8TA 2G60L 3ILQD 4FQPA 1YQVH 5E08L 3MOQA 4IS6A 3HS0B 1PQZB 1RHFA 1R3KB 2JJVA 3P11L 2NZ9D 4R2GC 3ZHKA 1ZVHA 4YIQB 3SDYL 1GC1H 4MD4A 1U8NA 1FV1A 1OAKL 2JKXA 5AZ2H 2XWTA 1M7IA 1MCEA 4TPRH 4PD4K 2J7LA 2IPUK 4PRPA 3P9WB 5C0RH 4BKLA 3VWKB 2FJGB 3GHEH 4DKFH 1P6FA 3PHOB 4BSVA 4OLUH 4F2MA 3F7RA 4TVPD 1ZT7B 1HZHL 5TDNA 4MA3A 3VG9B 4P3DB 1BZ7A 4OIAA 4PUBH 1VESA 1KIUA 1YN7B 2JJSC 1T1WA 4JHZA 4DKEH 3CXHK 5ACZA 3NZHL 1QPXA 1RZJH 2DLEA 3LHPH 3IETA 3ULUD 3ARBC 5JR1H 3TESA 3EFFA 3VFSB 1JGUH 1T22B 3V4PH 1PLGL 4AZ8A 4F7PA 5DJAA 1FGNH 1FL3A 5HDBE 4MA1C 2AKRA 3STZA 2HAZA 1L6ZA 2X4OA 1MF2H 3I3BA 5IW6A 2W9EL 2BOCB 3BW9B 4AT6B 1U95A 3V4VL 3G04A 3PWPE 1F90L 3T3PE 1R3KA 4FN0A 4NN5C 3M17A 1JHTA 5AYUL 2O93L 4ZDHB 1DVFD 1LGVA 3HG1D 1D6VL 1WWCA 1A7BA 1T7XA 4QWWD 1YMME 3MJGX 4PJGF 1FZOB 2GFBB 3CDYA 1ZAGA 1LK2B 4Y1AE 2ZNXA 1ZV5A 1G1YA 3FQRA 5E9DE 1CE6B 5TQ2H 3T3MF 2GTZB 3HNTL 4Y88A 1NCDL 4NRXA 2OYPA 4L3CA 4D2NA 3C5SA 1FNSH 4KXZH 3MODH 4HKZB 1LEKA 2I5YL 1WZLA 4XNQB 1TZGL 4XPBL 5DYOB 5B38B 4PJCF 5E8OA 3WHE0 2X44D 4GBXC 5F7DA 3CSYA 4LCIH 4HCRL 2DQCL 3ZE0F 3R4DA 2IEPA 4JB9L 2MPAH 1HXMA 3S4SA 5LGJA 1G6RH 1BECA 2CJUL 3WXWL 4LCUA 1HILA 3O4LA 2VQTA 1FE8H 3WLBB 4JRYB 5HGAB 1FP5A 2FBJH 4JJ5B 5CINL 3UAJC 3PWNA 4ZDHA 2FX8H 3T08A 1W0WB 4PJBF 3JUZA 3V0WL 1OM3H 3VFTB 4WO4D 2DQIH 1CLCA 1NMCB 3B3IA 3MYZA 4YHOL 1KCRL 5HGHA 1OVZA 4NQXA 1NCBH 2VXUH 3VXSB 4JR9H 4WUUE 4F3FB 5D93B 4ELKA 3QPXH 4DFIA 4N0YH 5EC1B 2KH2B 5IT2H 2VLRD 4OF5A 3DYMA 1JF1B 3VXUB 3CX5K 3EZ8A 4HV8B 1RJLB 3H9SE 3S9DB 4JY5L 1U91B 2V5SA 2XY1A 2XICA 1F4WH 2KQNA 3REWB 4PJBE 4TN9A 3VGGA 5F97E 1IGFL 2V5RA 4KRMB 5KVDL 2C4XA 4WEBL 4QY8B 4MXQC 1QRNB 1F97A 1U8MA 4Y2OA 5FHAH 3O2VL 4UB0H 3QUZA 3UTPE 1YN6B 4BZ2L 3U4BH 4Y4FB 1G7PA 1LD9A 3KPNA 3F58H 4LLDB 3CVHL 4HK3J 3ARFD 5JXAL 3ZYIA 4AQ1B 3MJ9A 3NFSH 3T3PF 1I1CA 4HS3A 3QNXA 4NIKB 4UT9L 2RIKA 5JHDB 2Y6SC 3U0PB 3QJFB 7FABH 1QBBA 2CLVB 2W9DH 1AGEA 1RZIA 5I8KL 2I26N 1KLUA 5E7FA 1JGDB 3T0BA 4DKEL 4GS7B