4KUZH

Crystal structure of anti-emmprin antibody 4a5 fab in trigonal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
220
structure length
220
Chain Sequence
b'EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGGINPNNGGTSYNQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARNDGYRGYAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody 4A5 light chain
publication title Structural evidence for a constrained conformation of short CDR-L3 in antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 35
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kuzH02
2XWBA 4M7JH 2OJZL 4WUUB 3VRLE 1NBQA 1FORH 4KGJA 3V4UL 3FTGA 4MB5A 4ODVH 4AEIH 4N0UA 2NY4D 4TULH 5IWLC 3MTRA 1J86A 2J4WH 3GSWB 1KN2L 5C0CE 3ARBD 5F1IB 1T5WA 1SJHB 1BJ8A 4OGAD 4B7LA 2AXGA 4NQVA 1ZSDB 4EUPG 1EEQA 3D3VE 4Y19E 5GGVL 5AG9A 2QSCL 5IB5A 3CFKA 4PJ7B 3EYVA 2LVCA 2OL3B 5IMKA 1AGEA 5E00A 1N6QH 4PJDA 1UB5A 2ZSWB 3QDHA 5BRZD 3T0EE 4GRWF 5HHPA 4WO4D 5I1KH 3BJLA 4G6MH 3TC9A 4DGIL 4OKDA 1J18A 1D9KB 4M93C 2AXJA 1D6EB 1OP5H 3S97C 4PJ9D 1M1SA 4MA8L 4QXUH 3FN0L 5GJTL 1A4JB 1N8ZB 3HKFA 4FQHB 1S7SA 2XYCA 3U1SL 3R06A 1JGEB 3GO1L 3VDBA 2HT3C 1CFSB 4LCCC 4R2GC 2Z8WC 2NTFB 3S35H 2ESVA 2R29L 1KLUB 3D85D 2B2XH 2CLZB 1RZIA 4RDQF 5E70A 5F1OB 5GGVY 3ZMRA 1CXLA 1BOGA 1ITCA 3DXAA 4H26B 2E7BA 4LSPL 1ZV5A 3G5YA 1WBXB 3MRMA 4PJBE 4KJPC 3W2DL 4Q9BA 2XA3A 1PLGH 5EUKA 4S1RL 2JJTA 4YIQA 1E4JA 3WKNA 1UFUA 3LN5A 3PL6D 1HKLH 3MRJB 5BW7C 3P11L 4MLIA 5J57B 1QP1A 2JTDA 1AD0A 3LSOB 4WW2B 4PRPD 4KRPB 3RTQA 1NC2A 1MAJA 5C7XL 4EN3A 1T7YA 4F7CB 1GH7A 4X7FC 1HHIB 5JW4M 2R15A 1CYGA 3QUZB 3V7AE 3RVTD 4QXGH 4BFIB 1WZLA 4PJXA 4M8QA 4JFPB 2P8PA 4ZUUA 1XGPA 1DEDA 4XWOD 4LGSB 5EB9A 4PRPE 1ZHLA 4OCMC 4XPGL 3BVNB 2G5BB 1S8DB 2IH1A 2V9RA 1IGTA 4AIXA 5F7FA 3O9WA 2GTZA 3SQOH 2FZ3A 4YDIL 4G6KH 4TSAH 4WEBL 2D0HA 3EO9L 5E1HB 3PGDB 4XT1C 2X1OA 3T0DA 4KTDH 1CE1L 2YRLA 4XP5H 1QRND 5FV2A 4XP6L 4DJMA 4NKQB 5FGRA 3AS2A 4X6EB 3U6RA 1AKJB 1BLNA 2G5RA 1HHGA 3IFNH 4PD4K 1NAKL 1IGFL 2NY3D 5D96C 4JJ5A 3MJ7A 2HKFL 2GUOA 1WCQA 1J8HA 3HE7B 2FNBA 4ZOBA 4NFDA 4PY8J 1ZANH 3OKEB 1I7TA 3PXJA 1OGAE 4PJ8C 5ANMA 3PABA 5IROA 4YDLB 4L5FH 3HFMH 4OD2B 5HHOA 3SJVD 1J1XH 2X4QB 3GRWA 4F9PA 1F42A 1QRNE 3G5XB 2WUCL 3HMXH 2YPKA 2E8ZA 3AB0B 5CP3H 1EGJH 5DS8B 1PW3A 2WINA 5ENWA 4MMZC 3UZQA 4M6NL 4YWGL 4IRJD 2YUVA 5SWSB 1Y0LA 4LLVA 5HPMB 4P57B 4NRYB 3SDYH 3TIDA 5HVFB 32C2A 3CZJA 3UJIH 3VFMA 2ZOLB 4FZ8H 2VZ3A 5GGSA 1QSEA 2FATH 4WWKC 4UZGA 5FAAA 4H25A 4WHDA 5E9DE 2F54B 4MQ7A 2X44D 1OAKH 4HIEB 4M43L 1TJGL 2NY2B 3UTZA 3GMNA 1INEL 5JLZB 1TFHA 1W0WA 4LLUA 2Z9TA 1T1WA 1RUKH 1GC1L 1EMTH 1JUFA 1K2DA 1X6LA 3EBAA 2P5ED 3OKNA 3O41A 5DT1L 3SDXA 3IVKA 2HVKB 1HIML 5DYOB 5E7FA 3WNKA 2VLRD 3DX8B 3CFEA 2GJJA 4OQ1A 3GSNH 1XCTB 3CFBA 4UMGA 1C1EH 4H5SA 3AVEA 2VAAB 1TNNA 1LEIB 1SBBA 4G8FA 1Q9WB 3OR6A 1DVFD 2MJWA 4AM0A 5M95B 5I1JL 4BFGA 1A7RH 5ECJE 1J9CT 2MCG1 3P9MB 5LWYL 4LPVA 3KPQB 1IQWL 1G9ML 1T0NB 5F7EH 4BUGA 1EK3A 1RZFH 4ZAKA 2QV2A 3BDYL 4RGMB 1G6RH 3GK8L 5C1MB 2MNUA 3HNTH 3OQ3B 5CLTA 4M7JL 3O2VH 4MX7B 5DMYA 4PJAE 2CQVA 1FORL 4N5EC 4WFHE 3MRQA 5DZOA 1TCRA 5I9QB 3ARWA 4ODVL 4AEIL 2W9DH 3DUUA 4TULL 3V5DB 2J4WL 4HUWB 1ZHKA 2G9HB 3PGFH 1CF8H 4S1DC 3ETBF 1P5VA 3CCHB 1N5YH 3KPMB 1BVKB 4R96A 3NH7H 4NOFA 4KV5E 3U0TA 4OF7A 3MV7D 3L3OB 3OXSA 5EUOB 2JJSC 4R3SA 1N6QL 3P4OA 1MJ8H 2HT3D 3CDFA 4PRHE 4IMLB 4K94C 4R2GD 1GZPA 2B4CH 4L3CB 5I1KL 2ADGB 3MNWA 4G6ML 1K3IA 1IKNC 4MAYB 4L4TB 4Y1AA 3ZT7A 4F15C 2XTJC 1H3UA 2GSIA 2Q3AA 2FEEI 5JNYB 2CDFA 3IDIB 4PY7B 4QXUL 5EZJB 4Q6IC 3VFGH 1T2XA 4K8RH 5F7NC 5D6CA 2EEAA 4KJPD 2KQNA 1JPSH 2HFFA 4TNWF 2MPAH 3IT8D 4LEXH 2AQ3A 2GHWB 5B38G 3S35L 2YXFA 4BH7A 3QIUA 4GKZB 2B2XL 3EDJA 2AAVA 4I0PA 4N8VG 4OUUB 4NZUH 1O7VA 4L4VA 1MHCA 3MLTA 2P5WB 1KIQB 3RVUC 1BIIB 4ZDHB 3WJJC 2CLVB 1HYSC 3FOMB 2QBWA 4TUKH 3RUGA 4X4XA 3S96A 3WFDH 2V6HA 2EKJA 4XX1G 1BJ1H 1PLGL 1CFVH 2ADJA 2CXKA 3DTXB 1ZXQA 3HE6C 1OP3H 1HKLL 4U1KB 5IVZA 4L3EE 4HMCA 2IPTH 5J12C 4QTHB 3PJSA 1LP9E 2VC2L 4JY4B 5EC2A 4ELMB 5CWSB 3QB7C 4NQSA 1VFBB 3DVFA 5IUSA 2X9XA 1EV2E 1U8KB 1HOCB 1JZ2A 4MD0B 4WW2C 2Y36H 1DBJH 4F7PB 3SDDA 2VLKD 4QXGL 3DMMA 1EVTC 1DUZB 1WBZB 2BNRE 5HHQB 4XCEA 2IALB 1OM3H 4GJTB 3NACL 2BP3A 4NQXB 1GCFA 1R5VA 2F53D 4PJCA 2O61A 3W9DA 3G6JF 4K7PX 3VH8G 3T65A 2A2QT 4ORZC 3SQOL 1TZIB 4LRNH 4TNWK 1OB1A 2WZPD 1Q0XL 2B1AH 4ZTPH 3RY6A 4TSAL 5EU5A 9CGTA 3QUKA 2E3VA 4I9WD 3MLXL 4U6XB 3VCLB 3IF1B 2FSEB 4KTDL 4PJ8D 5F1SA 3HI1A 3VFWA 4XP5L 2HAZA 4NBZB 5DFVC 2NX5B 3WIFA 4MZ3A 3QDJB 4XPAH 4G6AC 3SBWA 2F53E 5IFJB 1JNJA 1CICA 3P73B 5DUPH 4LNRA 1MHPH 1T1ZB 3IFNL 3ARDC 3UPCA 4GS7C 2BVUA 4EJ1C 1CXKA 1REIA 4G8GE 1MVUB 3MJ8A 1GGCL 3CJJA 5LGJB 4P4RB 5H8DA 4DWHA 3CSYA 4WU5B 3W81A 1NCWH 1ZANL 1WIPA 4FTVB 2DIBA 3BH8B 1BX2B 4L5FL 3HFML 5I17B 1P6AB 4U2ZA 4WWKD 4PBVC 2UYLB 4JFED 1J1XL 2OJEB 1LEGA 1ZOXA 3RBSA 2Z4QB 3HMXL 3HE7C 1JTOA 4GKSB 1EGJL 1Q9OB 4OV6F 3ZTJH 4QRPD 4HFUH 1JNLH 3VWKA 3G08A 5KSVB 1K3ZA 4HS6B 4CJ1A 3T4AA 2IWGA 2DQUH 3BQUB 4LPCA 1MLBB 1A2YB 3SDYL 1DTUA 5GGRB 3UJIL 3BOVA 4Z77A 3OGCA 4FZ8L 4P46A 2P8MB 5I8KH 1L0QA 5DVKA 2FATL 5GGUB 1IM9B 1FCGA 4NPYB 3SE3A 1OAKL 1K85A 3PHOA 5JHDE 4QHLA 1U8LA 1KCUH 5B39A 4PRNA 1RUKL 5C07B 4O2FA 1FV1B 5BZWA 5HGBA 1EMTL 1JYXA 4BSWA 1AGFB 2EH8H 3L3IA 5E6YA 1ZHBB 2A1WH 4Z7NE 4RMUA 1NCCH 2A6IA 3REVB 3FQWA 4JFQA 3V6ZB 2BNQA 4Z78A 5EIIA 4Y5YA 2RHEA 3ZKMC 4MHHG 1KTLB 4TPRH 3VD3A 4LKCA 3GSNL 1S9YB 4NUJA 4OQTA 1C1EL 1CTNA 3VRJB 2C4FT 1Q0YH 3U4EB 1RJYB 1F6FB 2GITB 3GSRB 2NW3B 2DM3A 5HI3C 4BH8A 1N59A 2A6KB 2E7LA 3IFOB 4XPTH 4GUPB 4N5ED 1YY9D 4X6CF 3KWWA 4A6YB 1A7RL 5A2KH 1I7ZA 1BD2B 5JW5B 2AK4B 1K5NB 1FL6B 4PJFB 3VFPA 4S1DD 4L9LA 5F7EL 1X5ZA 2GSGA 4JJHA 1RZFL 1CK0H 5FDWA 4JZJA 4JZNA 1G6RL 4MMXC 3TO4A 3EW3B 4HC1A 4ETQA 3HNTL 1SYVB 1R6VA 3O2VL 2CR3A 4U1JA 4RGMC 2MQCA 1HSAB 4HUKB 1LNUB 2W9DL 3LKSA 1JI1A 4K3HA 3MRLA 4G9FA 3KPTA 3PGFL 1CF8L 2XTJD 2PW1A 4JQVC 1N5YL 3DRTB 4G7VH 3NH7L 3VFNA 5I9QC 3SOBH 1N6VA 1EXUB 3IXTA 5C0AA 4ZO6A 4NQEE 1KTRL 1MJ8L 5DK2A 1KJMB 4QRUA 1CD1A 2B4CL 4NQDE 4D0CB 3SDCC 3SN6N 3VGHA 2W0FA 3L3DB 1OY3B 5DMKA 2BRRH 3MX0A 3T3ME 2XTJE 4PJEE 4FNLH 3RVUD 1V8HA 5HJ3B 1LWRA 4K8RL 4O51B 1HYSD 1KCVL 1U6AH 2H3NA 1IGIH 3C5ZB 1JPSL 3ME0A 4MAYC 3RZCB 3V6OC 1AGBB 5F6HI 3IU4H 2MPAL 2ZNXA 3J8F7 4Z7UE 4LEXL 4YGAB 3HE6D 4HCRH 1A6AB 1N0XL 2CK2A 4EDXB 4KGLA 2DB8A 1JTTA 3PHQB 4EUPB 4NZUL 3TZVB 2X2YA 5C0GA 1EAPB 1IC4H 2VDNH 5AZ2L 2V2TA 2W0KA 4JO2H 3I75A 1F58H 3QDMB 4H8WC 4TUKL 2J6EH 3WFDL 3NGBC 4KDVA 4Z0XA 4Z9KB 1CFVL 3WFHB 4LDEB 4WI3A 2E9BA 3U0PB 2UZXB 2W60B 3HI5H 5IF0A 2IPTL 2WSKA 4QOKA 4XGZA 1TVBB 2Z91B 5C6PB 2VUYA 2VSDA 1M6OB 3MLYH 4NBXB 3D0LB 3RL1A 2A38A 4GAYB 5GHWH 4MDIB 4YR6A 1RU9H 4U1MA 2Y36L 4ODUA 1DBJL 1OPGH 2IPUG 5IVXF 5A43C 1R5IA 3CC5A 2OTWB 5EBMA 3AY4A 4X0KA 1W72H 5DJDB 1OM3L 4ZPTA 5F8RC 3ZDYF 4MJIB 5DFVD 4G6AD 4M3KB 3BESR 2MHAB 4NUGH 4ZSOA 5MEQB 3ARDD 5GRWA 1GGBH 4LRNL 5J6HB 3BP5B 2B1AL 4ZTPL 1T6VN 4XNZC 5E03A 3FO9A 1AKJD 2Z31B 5HD8C 2H26B 4HUMB 4P0DA 4JFDE 2WBJC 4P5KA 4RIRB 1NAMH 5K9OA 4XPAL 4GO6B 1KPRB 3P0GB 2BVPA 1S7UB 5E2WH 3SGKA 5FM4A 3HE7D 1U36A 5DUPL 3G9AB 4XCCH 1MHPL 3UTTE 2FECL 3PWPD 2I5YH 3EYUH 3P0YH 5J1TC 2VN4A 1R3JB 3RPKA 4XNMA 1NCWL 3QI9A 5D1XA 1UWXK 5C0BA 2VLME 3PXHA 1WK0A 1OP5K 5ERWA 1D5ZA 4ZXBB 4X6DF 3O4OC 4OKVA 1H3WM 4HFUL 1UQSA 4XBGA 1JNLL 5L8JB 4RRPA 2DQUL 3PWPE 5ELIA 4C58B 2F54D 3OB0H 4L8BB 3OKDB 5I1LB 4CUCA 4IMKC 3SY0A 3MLZH 3NN8B 5I8KL 4HAGA 3X12A 3G04A 4WHCA 5HHNB 1A9EA 1XGYH 4LPTA 3TWCL 3WCYA 1IZJA 1I1AB 3ZKMD 5DVNA 2FD6H 3D2UB 4DW2H 1KCUL 2N1KA 4PRAB 1M71B 2FHFA 1WFNA 1N64H 4K9EH 3UTSE 3X11B 1J5OH 2A1WL 3PG2A 1YY8B 2BVEA 4EI5A 1NCCL 5HI3D 3B5GA 2APVA 2OX5A 3ZSSA 4CVUA 4GG6A 3H9HA 3CUPA 4TPRL 3IXAA 2XZZA 3MPCA 4LVHB 2ZSVB 3OZ9H 1Q0YL 3OKOB 4M48H 3VD4A 4DUVA 1V7MH 3OBAA 4RX4A 1TCMA 5IVOA 5TQ2H 4PIRF 4WHTB 3WUWA 4XPTL 1MWAB 2ZOKA 4CDHA 5F97E 1RJLB 2MKLC 5I1AA 1AO7B 4N0CC 1TDQA 2XXMB 1JIBA 5I16A 3TO2B 1OW0A 1CK0L 2BMKA 4IS6A 4MNHB 4HIIA 4PJBF 4IIQB 2GK2A 3MFFB 3H8NA 1WT5C 4ZODA 2XKNB 1FP5A 5D1QA 4NYLA 3BT2H 8CGTA 3QAZC 3FO0H 2BSSB 3Q3GB 4YX2H 2WMPA 4X6FA 3SDCD 3CPLA 4X98A 5L88H 5JTWA 3QDGD 1AHWA 3G6JA 5CMAA 1HN1A 2VZTA 2VXSH 1YUHB 2PW2A 1N5AB 4GBXB 5IJVA 2WNGA 4G7VL 5D5ME 2BY2A 3KNBB 3SOBL 3FT3A 5T3XD 1MCJA 4MAYD 5C0IB 1J8KA 4POZC 2WW8A 4F58H 4Y4HA 4J23A 1I3VA 3AREA 5TJWK 4D0BB 2DYPA 5KOVC 1MRCH 2IANE 2BRRL 1FN4B 4TTDC 3QHFH 2ENYA 4FNLL 1S9XB 1E27B 1JRHI 1SBSH 3F7VA 1UXWB 3O6KH 5ISZA 3K74B 4QRTA 1G7IB 1IGIL 4CVZB 3IU4L 1MY7A 2V2XB 1JRHL 2P5WD 4HCRL 3RWHA 3C9NA 4PLNC 5KS9A 1HH9B 3BPLB 3T0VA 5IHUH 3CXHK 4PGJA 2EYRB 3C5ZC 2BZDA 3RZCC 2WWMC 1MPAH 4JGUA 4OZ4B 1OAXH 4NHUB 5E7BA 2YC1A 2VDNL 4JO2L 1F58L 1ROWA 1FZJA 2J6EL 1T0PB 4YHIB 1D7FA 4GSDH 4E41A 1VFAA 4ETYA 5IJKC 5E2UH 1N6UA 1KPVA 3MGTB 5EZIH 3S36X 5C8JB 4Y4FA 4CBPA 4M4PA 3HI5L 5SX5K 3FN3A 5FUOH 2J8UE 2XWJA 4XPHH 1JYWA 4OLVH 3U82B 3MLYL 4UIMB 4IJ3B 2OZ4H 4QRRA 3JWNC 3RBGA 2LU7A 5GHWL 1I7UA 4V1DD 5B38B 3E6FB 1RU9L 4C56E 4IRZH 5IQ9A 1NGZA 2H2SC 3B3IB 1HE7A 4N8VB 3BMVA 3QNZA 2BCKA 3FB7B 3VXUD 1W72L 3H6JA 4X4YA 2FJHB 3DUSB 1CVRA 1T1XA 5HD8D 1A14H 2WBJD 2GT9B 3GMPB 5D2LE 1UH4A 5JPNB 4KQ3H 5FKPB 2ITDA 1IEHA 1GGYA 4HS3B 4NUGL 3QWQB 1DP0A 1FO0H 4V1DE 2Q7YB 1GGBL 5INCB 2RB8A 3LQAC 1XAUA 3UZEA 3EO1B 3LKOB 1VERA 4Y5VB 1LHZA 4X6CA 4RFNC 4NCDA 4OIAA 1AQKH 3HZVA 4BKLA 3ROOB 5HYJB 5T1MA 1NAML 5H35B 3QIBB 2X05A 4NZDA 1F8TH 3P4NA 5SWZD 5E2WL 3MR9B 1EUTA 2Z31C 5IOPA 4XCCL 2VE6A 2DLEA 4FTVD 5KZCB 4JFXB 5F1NB 2EE6A 3O45B 2I5YL 4P2RA 5F21B 1ORQA 3EYUL 3P0YL 3KPNA 4HWEH 3KDMB 5A2JH 2AJVH 5CJBA 4YHNB 1G1CA 2CRYA 2VQTA 3U48A 3H42H 1GIGH 1OT2A 2ZKHH 1QRKA 3NCFB 3QWRD 1RPQA 3VH8B 1E28A 2JK5B 3TNNA 3FQTB 1DANU 5SWZE 1HHJB 3DO7A 2APBA 1VHPA 1IM9D 4OFPA 4PP2B 4HLZG 1FNGA 1ZGLA 4ZXBC 2X4RA 4XZUA 1I1FA 4OAWB 3MLZL 4NN7C 2OTPA 2I24N 4PJAF 5B39G 5C07D 1XGYL 1J7VR 4PG9A 1U92A 4DKDC 1U8OB 4AY0A 2FD6L 2EDYA 3MRKB 4DW2L 4I0CC 4YDVA 5BS0E 4RQQA 4KV5F 2VDQH 3B83A 3D39D 1N64L 1OLZA 1I1AC 4K9EL 5DJ2B 2GTWA 2EYSB 3WLBB 1J5OL 3O8XB 2UWEB 4P3CH 3I9GH 4HX1B 4UU9B 4AQOA 4GXUM 3U36A 5JZ7C 3OKYA 3MREB 3MV8B 3H9YA 1NEUA 3HC3H 4N0CD 3N85H 4Z7VF 2X6MA 4X7CC 3R0NA 1KEMH 3OZ9L 2VZOA 4M48L 3D39E 1V7ML 1FC1A 3ZTNH 1CD0A 1S5HA 4AZ8A 2FWOB 4R97C 3AUVA 1FIGH 2EIZB 4FMFA 5TQ2L 4HWZA 1PGRB 3T2OA 3T08A 4CNIB 1RJZB 4YPGA 2PO6A 4HUUB 1X5XA 5E8EB 1I75A 1X5GA 1NFDB 3RWEB 4LEOA 4FQXC 5IVXA 3TYGH 3G5VB 4HKBA 1JNHB 5C70A 5IMOA 4HEPG 4OIIH 4POZD 3BT2L 3FO0L 1IAOA 2EIBA 3PDOA 4YX2L 3BHBA 5I1DB 5E8DL 1EO8H 5L88L 1GYAA 3RKDC 4ODBD 1DDHB 1LP9F 3QFJA 2V7NA 3T77B 3DBXB 2VXSL 4TTDD 3DX6A 1KJ2H 4UINH 3SDAA 3QG6B 2EE3A 2CKBA 1BBJB 5EO1A 1FVDA 1NANH 4LIQE 1FLTX 1OAZH 4B50A 5CHNA 4J3WA 3T2PA 2EC9T 1LO5B 3N1GC 3TT3H 3FRUB 3VFRB 1NGQH 4F58L 3W0WB 4K7FA 4HUXB 5KAQG 2AJYH 4QTIH 2XWBB 4ZOEA 1MRCL 3C5ZD 3I84A 3RZCD 2WWMD 4X9HA 3FTGB 3QHFL 1JPTL 4LNVA 4N0UB 1SBSL 3ARGC 3L6FA 3BXNA 3O6KL 3TV3H 4WW1A 1T5WB 5J9PA 4HV8A 3CMOH 2AXGB 1NLDL 4IEFB 1ODAA 5IB5B 3QNYA 3CFKB 4NQTA 5IHUL 1U41A 3EYVB 2OR7A 1C16A 1AGEB 5E00B 5IMKB 5JQHC 1XGUA 4GLRH 1UB5B 4PJDB 4X6DA 2M2DA 2R1YA 5HHPB 1MCHA 1OAXL 1WICA 3EYQC 5FYJU 4P2YA 2LU4A 4U3HA 3FFCD 4GSDL 5HVWA 4HJ0C 5E2UL 3QXTA 4MA3A 4JFHD 5GSVA 1S7SB 2H2SD 3CMGA 3ULUE 4KKCC 3VWJC 3R06B 2HFEA 5JXEC 5I8EA 5CUSH 4PD4J 5FUOL 4XPHL 5C0CA 4OLVL 1BEYH 2ESVB 3C2AH 2OZ4L 3D3VA 4Y19A 1RZIB 5JUEH 4Q0XH 3C5SA 3ZHLA 1BOGB 5DQ9A 5KVFH 3DXAB 5CGMA 2XKUA 1J1OH 4IRZL 4O58L 2QL1A 3G5YB 3MRMB 2CUMA 4MJID 5KTEH 5EUKB 4YIQB 3E8UH 3VGBA 3LKQA 3HMXA 1MAMH 3LN5B 3TH4T 5CP3A 1A14L 2MTPA 4PGEA 3ARBA 1RHHA 1OD9A 3RJQB 4KQ3L 1AD0B 2FBOJ 3WS3A 1T7XA 5IFHH 3RTQB 4JQXC 1NC2B 2Z31D 1FO0L 2DDQH 2H9GA 3GJFH 4EN3B 2IBZX 4XMPH 4WO4A 2IMNA 1JPFA 2E6JA 4CW1A 1AQKL 4Z7NF 4HG4J 4ZFOL 2YD4A 2WP3T 4PJXB 3VG0H 3DX9A 3WL9A 4M8QB 1F8TL 4PJBA 1RFDH 2P8PB 4ZUUB 1XGPB 4BZ1H 2QQKH 5DXWA 3P4LA 3NMEA 4PUBH 1ZHLB 2FIKA 2MMXA 1QSVA 1WGOA 3QIBC 2IH1B 1D5XA 4HWEL 4HW6A 2AJVL 2X4UA 1IGTB 4LIQH 3O9WB 3FHAA 4ZXBD 2GTZB 4LVNB 3H42L 2FZ3B 5BMFH 1GIGL 3GSNA 4X6BA 2ZKHL 1MUJA 1YYLH 4HIXH 4RRPG 1FZKA 2EDFA 4TUJB 4ZUTA 1AGDA 3EDKA 1YA5A 3DSFH 3MQIA 1BQHA 5KVEH 3U6RB 3PL6A 1BLNB 3EGSA 1I1AD 4KMLB 5MENE 1HHGB 4KXZH 4DOHE 1JK8A 4GAJH 4JJ5B 3MJ7B 4PRPA 4V2CB 1EZVY 1IMHC 2GUOB 5JZ7D 1J8HB 1A6UH 2FH8A 1I7TB 1G6RA 4U49A 3LZFH 3CGTA 3PABB 5ANMB 3BGAA 3TCLA 5HHOB 2VLJE 3KHOA 2VDQL 4L9DA 2YPKB 2WINB 5ENWB 1KCRH 2FX8H 4P3CL 3I9GL 1G7QA 1Y0LB 5EU7C 4LLVB 3SQBA 1GGUA 3QUYA 5JXAH 3TIDB 3ULUH 32C2B 2DD8H 3VFMB 1I85A 1E4XI 3B9DA 5GGSB 3HC3L 1QSEB 3O8XC 1QVOA 1H3VA 5IG7A 4BM7A 4DAGH 2Q7NA 4H25B 4KVNH 4PJEF 5D2NE 1KEML 3WIIH 4MQ7B 2ZUYA 1JF1B 4FQXD 3WUWG 3UTZB 3GMNB 5INDA 4GH7B 2ZUUA 3ZTNL 1W0WB 2DI9A 4LLUB 3KPSE 2BVQA 3OKKA 1T1WB 1KXTB 3PQYE 4Z7UF 1FIGL 1F3JA 3ZYIA 1B2WH 1JUFB 4ZFFA 1K2DB 3OKNB 1T83C 3O41B 4C4KO 1QRNA 1I3UA 3SDXB 2NY6B 3RKDD 3IVKB 43CAA 2KZ1B 5EOQL 1A5FH 4NC1E 2R69L 3CFEB 3TYGL 1TITA 3CFBB 3GMLA 5IB4A 4HD9A 3GM0A 1CFNA 4H5SB 1QEWA 2IC2A 4G8FB 5E9DA 1KELH 1EO8L 3VMOA 1H15A 4AM0B 4OD3H 4XCFH 3RWFA 5F3BA 3QUMH 1KJ2L 4UINL 1BM3L 2BNUA 4U1HA 2BXZA 3ARGD 1OAZL 2EC8A 4KUZH 3K4AA 4P48A 1Y6MR 3ALWA 1VKXA 4ZAKB 3LB6C 4YHOH 5SV3A 1FIEA 1HQRA 2K9UA 5HVGB 3TT3L 5FK9A 1NGQL 3TJHC 5I18H 2AJYL 2YS4A 4QTIL 4S0SD 1AC6A 3RAJH 2VDRH 4WTZA 1P84K 5FHBH 5KSBE 1DQQA 3MRQB 4K07A 1JFQH 1TCRB 3EYQD 3V4PH 3DUUB 2NPLX 5F44A 3TV3L 3KPLA 1ZHKB 1DBMH 4XC3H 3CMOL 4HPOH 3IAGC 2ZUTA 4HJ0D 3HLAA 4R96B 5BJTA 3U0TB 1CLYH 3OXSB 3UYRH 1BF8A 1JF5A 3FQXB 4KKCD 4R3SB 3VWJD 5JXED 3P4OB 2QQNH 2FRGP 1Z5LA 1PYWA 1GZPB 3BGFB 1A1MA 2YD2A 3MNWB 1BGXH 4Y1AB 1RURH 2GSIB 3DECA 5FUZH 1XMWA 2CDFB 5E6ZA 2OI9C 3TBYA 3DVGA 3BDXA 4N1CA 5D6CB 2HFFB 1GAFH 4OZIB 3C87A 3UYPA 5IWLA 1H8SA 2QSVA 2XZAH 3ARRA 1BEYL 4NZRH 4OZHF 4BH7B 3C2AL 3QIUB 3VI3E 3LEVH 5JUEL 4I0PB 1DBAH 3G5ZA 4JRYD 5HDBF 4LLWA 3WFCH 1TZGH 4L4VB 5KVFL 1MHCB 3MLTB 4AEFA 1J1OL 2L0DA 4PRHA 5HHVH 5I8CA 3RUGB 3S96B 4X4XB 4ALAH 5KTEL 3V5HA 3MA7A 2ADJB 3E8UL 3JBG7 1MAML 4NKIH 5IVZB 1YEIH 4CMMA 3MRNA 2PETA 1A7BA 2X1PA 5D1ZA 1JYNA 3PJSB 1F4YH 4U2YA 5EH1A 2JJTC 5EC2B 3MV7A 4LQFH 1VGKA 4JRYE 2XG4A 3GSQA 2DDQL 4NQSB 5HYJD 4YO0A 3QIBD 3M1BA 4XMPL 4LCCA 3W9EA 3K2UH 1RV6X 3SDDB 4I4WA 5KZCD 3KS0H 2JCCA 4LFHG 4R4FH 5ACLA 3DMMB 2PYEE 1JBJA 3VG0L 1M05A 4U05A 4XCEB 1RFDL 4BZ1L 3P2TA 1FL5A 2QQKL 2D7QA 4PUBL 2PXYA 2A9NH 2FIRT 5JOFA 4UNVA 1R5VB 3CVHH 1BMGA 3GI8H 4CKVX 5KN5B 4PJCB 5J13B 2O61B 5L2KD 3CFJA 1A3RH 1SMAA 4LIQL 4L3EA 2YUZA 5BMFL 3BEVA 3ZYJA 1LP9A 1OB1B 3RI5K 4J7RA 3BMWA 1YYLL 2APWA 2KPNA 1EBPA 4HIXL 2L7UA 5FYJE 5C71A 3SCMC 5EU5B 3BISA 3O9WC 3TLRA 2XOTA 3O3BA 3HB3C 3HI1B 3VFWB 3DSFL 2WBWB 4HKJA 3WIFB 5KVEL 1CICB 5L2KE 4LNRB 3HG1B 1CGXA 1PG7X 4GAJL 1EERB 4YH6A 1ZKAA 4NN6B 3MJ8B 4MAUH 3WBDA 3CSYB 5HVHC 1QUNA 1A6UL 2MFNA 4NT6A 4Z0BH 1B0GA 4KHXH 5T1KD 1NMAH 4JAMA 4PGDA 3LZFL 4DUXA 4I2XE 3RX7A 3O8XD 1GOFA 3SEPA 4XWGH 1U0QA 1LEGB 3QEUA 1UKQA 4KI5C 2AV7A 4NHCH 3N9GH 3Q2CA 3MV8D 1KCRL 2FX8L 3VWKB 3G08B 1X9QA 3V2AR 3OG6B 4ONOA 4F9PC 5JXAL 3ULUL 4XMLH 3UBXG 2O5YH 2DD8L 4Z77B 3OGCB 4JKPH 2W9EL 4P46B 4U1LA 2F53A 5K33A 1HHKA 2XXCB 4DAGL 4KVNL 4MXQC 3WIIL 2YN3A 3PHOB 4QHLB 1U8LB 5ICYA 5B39B 4PRNB 3RWDA 3GM8A 4O2FB 4P2QD 5HGBB 4PJ8A 1B2WL 4BSWB 2DS4A 4GG8A 3L3IB 4M5YH 2EDXA 4PP1C 3FQWB 4AJ0A 4JFQB 1P1ZA 2V9TA 2BNQB 4Z78B 5EIIB 2GQHA 4Y5YB 5I71C 3CLFH 3BPCA 1KFAH 4LKCB 4Q6YA 2HMIC 4HCRA 3LB6D 2HA1A 3QPQC 4GAFB 4P2QE 4MNQD 1A6ZA 3TJHD 3SE8H 4U1SA 3KXFD 1KELL 2PYFA 4BH8B 4OD3L 1N59B 2J6EA 3QUML 1I9RH 5D71H 1EA9C 3KWWB 1I7ZB 4DZBA 1JZ3A 1ZVSA 1NGPH 1MFCH 3VFPB 4KUZL 4L9LB 2GSGB 4YHOL 3UMTA 4UTAH 5FDWB 4JZJB 3QRGH 4JZNB 4J4PC 3TO4B 2Y6SC 4W4OC 3T4YB 3V6FA 1DBKH 4ETQB 5I18L 4MNQE 4ZUVA 1RMFH 2Y07H 2DWEB 2N56A 3VDCA 3RAJL 2VDRL 1JHTA 2VUOA 4ZAKC 5FHBL 3GIVA 4HT1H 4U1JB 3WNPA 2PN5A 4WV1A 1H0DA 5FYJH 3BRDA 2CDGA 1JFQL 3V4PL 3BH9A 2YA1A 3LKSB 3QEHA 4FS0A 2VXUH 3MRLB 1C5BL 1WJ3A 1DBML 4XC3L 2AJSH 1W72A 2PW1B 1EAJA 4HPOL 4WUUE 2BC4B 5GRVK 3VFNB 1CLYL 2B8OT 3UYRL 3IXTB 2ZZUT 2QQNL 5DK2B 4QRUB 1HINH 1CD1B 2CXGA 2W0FB 2H32H 1BGXL 2X89A 2OLDA 5DMKB 1RURL 2ICEA 1N26A 4BJLA 5LAXA 4YFDB 2ESVD 4HGMA 5ILTH 2H3NB 1NAMA 1CDJA 3TVMC 1GAFL 2EE9A 2R0KH 4P4KA 4RGOH 3DXAD 3ULVF 3QZWA 2XZAL 1E6OH 4NZRL 4EBQH 3LEVL 4X5LA 1DBAL 1NEZA 2BHYA 3WFCL 5C0GB 1TZGL 3LHPH 4TSCH 4NQEA 5EOCH 5GS2D 2JJSA 1XZ0A 2V2TB 3I75B 1SJHA 4Z7WE 5HHVL 4ALAL 1M7XA 1EHNA 3QXUA 4Z0XB 3FT2A 1NC2D 2DL2A 3F62A 4NKIL 4N8PA 1IKNA 1YEIL 3FRPA 4PJEA 5IF0B 5MI0C 3FB6B 4QOKB 4XGZB 1F2QA 4LOUC 2DM2A 1F4YL 4LQFL 4Q6IA 5E2TL 5CZXC 3RL1B 1WTLA 4Z7UA 2YK1H 3AU1A 1ZAGA 3K2UL 4U1MB 3M07A 4ODUB 1N8ZA 4OUOA 1A4KA 3HC0A 3CC5B 5ADOH 5TPWH 4R4FL 5EBMB 5DRZA 4X0KB 2Q6WA 1LMKA 3SCMD 3T1WA 3UDWA 3H3BC 3O9WD 2NTFA 3PDGA 5T3ZH 4ZPTB 3WJJA 2E6PA 3BKJH 3HB3D 2A9NL 2YXMA 4KZEH 1BFVH 3CVHL 3GI8L 1CFTB 4Z95L 1IEAA 3DMMC 4TNVF 4YNYA 1A3RL 3HE6A 4KPHH 4ZSOB 5HGDA 4UUJA 1WBXA 5I0ZA 2HFTA 1PQZA 2DBLL 5DJYA 4OI8A 4MJ6A 4EXPX 3FO9B 5CJOH 2NY0B 3V7AG 1BQHG 3V8CA 3NVQA 4ENEC 4PLOB 5K9OB 2BVPB 4KI5D 1NBVH 4UAOB 3MZTA 3RY5A 3BZ4A 3L3KA 5L2JA 2R8SH 3IDJA 5HHOD 4MAUL 1HHIA 1FJ1A 1BFSA 2ZUVA 4XNMB 5J7CC 4Z0BL 4KHXL 1NMAL 2AERT 3QI9B 3PWUA 5D1XB 3G6AA 2RCSH 5C0BB 1FFRA 2GW5A 2OM5A 1G7LA 2XZQH 4NN6C 4MXQD 1QLRB 5ERWB 1D5ZB 4G42A 3OAZH 4KTYA 1QFPA 4NHCL 3N9GL 5HYIA 4OKVB 4I48A 4KI5E 1BZQK 1UQSB 4XBGB 1QSED 4FQQA 4OT1H 4XMLL 2O5YL 1BFTA 4R8WH 4JKPL 3ARVA 3SY0B 3X12B 2CIIA 4PP1D 3VWKC 3G04B 3IFPB 3UTTA 1A9EB 1CXHA 3ARDA 4QHUA 2HMID 4P46C 4TNVK 5BXFA 1DQDL 1JWUA 4LF3A 2XT1B 5DD0H 2AK1H 4F33A 2DQDH 4OIBA 3SE3C 1S7QA 3QPQD 4JGJA 3WD5H 5C9JA 1NQBA 4M5YL 1OAYH 1XR9A 4EI5B 3LEXA 4HMDA 3HRPA 4OCWH 4GG6B 2AQ2A 3H9HB 3CUPB 3CLFL 3IXAB 3PWPA 1KFAL 4M8VA 2QSQA 1P4BL 5GZOC 3L5IA 3FHQA 1DLFH 1G9NH 3O2WH 4CVWA 4Y5YC 3MXVL 4J4PD 1K6QH 1NMCC 2Y6SD 3ULUF 3SE8L 4ZMAT 1U8JA 5EOTA 5HPMA 3MOBH 4PPTA 1KYOK 4ZAKD 3WUWB 1I9RL 4NNYA 1YEEH 3EYFA 3GMOA 5D71L 4U6YA 5DA4A 4P59H 2ZOKB 1VSCA 4PB9H 5I1AB 1QYGH 2ZUQB 5JDSA 1NGPL 1MFCL 4GOSA 2HTLC 5I16B 2D03H 2F54A 4PJGF 4MA1B 2E7LC 4UTAL 3QBTB 1P69B 3QRGL 4IS6B 4HIIB 1OLLA 5EO0A 1DBKL 4E42A 2OZ4A 1RMFL 2C9AA 2Y07L 3REWA 4DKFH 4YJZL 4L9LC 4NYLB 4HT1L 5DD5H 3OWEA 5FYJL 4X6FB 3ALPA 5A1AA 3CPLB 4X98B 3R8BB 1X4XA 1QLFA 2UVEA 2VXUL 3N1QC 1AHWB 3G6JB 5CMAB 3PP3K 5DC9B 2AJSL 2PW2B 5IJVB 1WZ1H 1PG7W 3OF6D 4KK9C 2NQCA 5GJSH 4Y7MA 3VXSE 4EI6A 4F8QA 3FT3B 7CGTA 1V05A 3H7BA 1SQ2N 1HINL 1FE8H 5F7MC 3ZYOA 4Y4HB 5TGBA 3TBVB 1FO0A 3AREB 2DYPB 5DJ0A 4AQ1B 1UXSA 3C8DA 3SO3B 2DQEH 3FOLA 4RGNC 4KZDH 1OTSC 3IFLH 4RCAA 4ZFOA 2VWEE 3F7VB 5ISZB 5ILTL 4QRTB 4HUVA 2ADFH 3WMSA 3N06B 3KPOA 4MD5A 2R0KL 4L4VD 4RGOL 5DURD 4RWHA 1DUYA 3C9NB 4JGMA 3RWHB 1U2CA 1E6OL 1T0MA 4Y2DC 4EBQL 5D5MA 2EDWA 4JQVA 4JO4H 4LOUD 4U3XA 1RAMA 4OF5A 5GIRB 3LHPL 4TSCL 2YC1B 5CZXD 2EDBA 1FZJB 3CCHA 4X80H 4E41B 1VFAB 1KPVB 3SDCA 2IANA 1FGNH 5F7DA 2F15A 4PJ5E 3QDGA 1PVHA 1I8IA 1OTUC 2XWJB 1LO2H 4NP4H 5DD6A 4ISVA 6FABL 1C7TA 4QRRB 3V6OA 2YK1L 3DMMD 5FB8A 5JOPE 1I7UB 5CEZD 5DMGC 1QO3A 3JWDC 5IQ9B 1TETH 1NGZB 3IDUA 4P9HH 1WZKA 5ADOL 1BJ1J 3QNZB 2BCKB 4MHHI 5IMMA 4X4YB 3N50A 5FO9A 1JN6A 1T1XB 4ENED 3BKJL 4KZEL 1BFVL 3PWJA 1FNFA 4X4ME 2BVYA 1LD9A 3DYPA 4QHNA 2ITDB 3GBNH 4KPHL 1UWGH 3K81A 3MRIB 4ODTL 4CJ0A 1XF2A 2J8UA 1DL7L 4FFYH 1ONQA 3D48R 2C1OA 3BPOC 4X6CB 3FFDA 3BP6A 5CJOL 3HZVB 4BKLB 1IGYA 3EAKA 3HG1D 1JHLH 1OCWH 3BFOA 4O5LH 5T1MB 4AIOA 4NRXA 3K3QA 4GMSH 4C56A 3LV3A 3I3BA 2N4IA 3P4NB 2NY0C 1NBVL 1T20A 5IOPB 1GPOH 1XIWA 2VE6B 3W5MA 4KROC 4P2RB 1DZBA 1ORQB 1U8KA 3RHWK 2R8SL 3KPNB 3A6BH 1S7TA 5D2LA 1ZVYA 3QDJE 3GKWH 4P2OA 3VXTA 4UAOC 4X9BA 3BKCH 3K4ZA 4JHAH 3MV9D 2RCSL 3KVQA 3OL2A 2YPLD 3VWKD 2HH0H 5D4QA 3BO8A 2XZQL 4OZGE 4V1DA 4U0RB 3TNNB 3ZKNC 1KTKE 2LE9A 5J3HC 1T6WA 1OAUH 4YGVA 5JA8B 5D1XC 4P46D 3DO7B 5MEOA 3VXUA 5AAWA 3HZMA 1GSMA 4OT1L 3CU1A 4HJJH 1FNGB 1ZGLB 2WBJA 4XAKE 1KJ2A 2X4RB 1CXEA 4R8WL 1I1FB 4XZUB 3S35X 1IBGH 1P4LA 3MV9E 4MA7H 4U6XA 4PG9B 1U92B 1PKQE 4GRWE 5JQ6H 4J1UA 4YDVB 2Y72A 5DD0L 2AK1L 1P7HL 4RQQB 2DQDL 3GNMH 2B0SH 3WD5L 2GTWB 5DQJA 5CJXC 5KVDH 1OAYL 1RZKC 4F9LA 4FA8A 5SWZA 4OCWL 3B5HA 3U36B 5ABDE 4YFLF 4OM0H 1BX2A 2EDLA 3OXRA 4D8PA 4EI5C 2Q1EA 1ZWIA 2OJEA 1DLFL 2HTLD 2JELH 3UBXB 1G9NL 5C0JA 3O2WL 1Q9OA 3Q6GH 1K6QL 3X3FH 1CQYA 4G6FB 1S5HB 3H9SD 5EC1A 1CDBA 1QBMH 4HMEA 3MOBL 2F5AL 4LLDA 3EOBA 1YEEL 5BS0A 5CILH 4HWZB 1C5DA 4YQXH 4P59L 5FM8A 4PB9L 3TO4D 3RGVC 5IGXH 4YPGB 5GGUA 4PGBA 1IM9A 1QYGL 2PO6B 1S5IH 1JTPA 2D03L 2IADA 3MRCA 4KK9D 3EOAA 4Z7OE 4LEOB 3A6CH 5IVXB 2ED9A 4HKBB 4YHLH 5HDLA 3LH2L 2IMMA 3I6GA 5IMOB 2AK4E 2OMNA 4DKFL 1Y18A 2DKSA 1OW0C 1HILB 4APQA 5DD5L 3O3AA 1IAOB 3PDOB 3BHBB 5MERA 4FQ2H 2YWZA 3SHSA 3QFJB 3D39A 2V7NB 2F74A 1BWMA 3DX6B 1WZ1L 4RGND 3SDAB 3BP4A 2GIYA 5GJSL 2CKBB 1CFQA 5EO1B 1OTSD 1FVDB 1OAQH 3MO1A 5TF1H 4NN5B 1AHWC 4P5TC 1YN7A 5CHNB 2PF6A 2VR9A 1PEZA 1HH6A 4MDJA 1FAKT 2NYYC 1FE8L 1HDMA 3DGGA 1CDCA 4K7FB 4Y2DD 3GJFA 1TNMA 1LILA 4LVEA 3NCBB 2DQEL 4KZDL 3MLPA 4QCIA 5DJZA 1UZ8B 1FVCA 1K5NA 4HKXA 3IFLL 4Y4HC 1WT5A 2RIKA 1JGDA 3L6FB 4DFHA 1IAKA 3BXNB 1GGTA 3QZWG 5JDJA 1OSZA 4KRMB 4WW1B 2ADFL 3HUJF 4HV8B 4KFZC 5HGGS 1LO3H 5J9PB 1NEZG 3D5OF 3SO3C 1HI6A 1YEHH 3CAFA 4NNXA 3LKPA 1C16B 4JO4L 3OPZL 1XGUB 3WKMH 4M61A 3NPSB 4X6DB 1OTUD 4YAQA 4ZD3H 1JGVH 1OD7A 1XFPA 5I6XC 4Q2ZA 1VENA 1CFBA 1FGVH 4GRWH 5HDQH 3FRPG 4X80L 4MNGA 4QOKD 4YE4H 4D9LH 1FGNL 5DMJB 4MA3B 5DMGD 5GSVB 2OXGA 5C3TA 4LSRH 2HFEB 5I8EB 1P9MC 4I3RH 1LO2L 3V79C 1J05A 5C0CB 3J7HA 4NP4L 1MNUH 3QO0A 1YQVH 4Y19B 3D3VB 3ECBA 2WP3O 1KIPA 2D3VA 5DQ9B 3DV4A 5HJ3A 5D72H 2IBZY 1HNFA 5IHZA 1TETL 4P9HL 4PYGA 3T0EB 1YEJH 4E0RA 1S7VA 1Q38A 3LKQB 1F4XH 2NY4B 3Q48A 4PGEB 3ARBB 4UDTA 1RHHB 5I15H 4ZUSA 5IJKA 3WS3B 2P1YA 3GBNL 2NY0D 1UWGL 1FNAA 2VQ1A 4JPKH 2H9GB 1EJOH 4KROD 2XPGA 1ZEAH 4JHZA 5AG8A 4FFYL 4A6YH 5E94A 2DAVA 3EDEA 1JPFB 4CW1B 3AXLA 1JHLL 1OCWL 4O5LL 4F37K 2MWCA 2YZ1A 2AABH 4GMSL 3FFCA 3WL9B 3DX9B 3GI9H 1FYTE 3ZKND 1JPST 5J3HD 4PJBB 3X17A 3C5JA 2ZG3A 1DQJA 1GPOL 5D1XD 3QXAA 5F93C 2FIKB 5C0BD 5KG9A 2NW2A 3A6BL 1D5XB 1PAMA 2X4UB 5EFIA 1QPPA 3GKWL 4JO3H 1KCSH 4RMTA 4OM1H 4J3VA 1AGCA 3MUJA 4KKAC 3LDBB 3BKCL 4GAGH 4JHAL 3BN9C 2HWZH 3GSNB 4X6BB 5J0BA 2HH0L 1MUJB 2VR4A 4Y89A 2E8YA 1FZKB 3RWCA 4P3DA 4ZUTB 5DWUH 3GMRA 1KTDA 1AGDB 4DKEH 1Z9SA 5LBSL 2UV3A 2MHAA 2ZNWA 1BQHB 2CDEA 4HJJL 5DEGA 5H37H 5C6WH 3PL6B 4X99A 5DGQA 3EGSB 5FUCE 3TPKA 1DQTA 4MQXC 4MXVE 4IRSA 1JK8B 4D9RD 4UT9H 4QNPE 1IBGL 4CRPA 2IPKB 4PRPB 4MA7L 3WFBH 4F57H 2WIMA 4FXKA 2CK0H 2XG5A 1YDPA 1G6RB 2AKRA 5IP4A 2K1MA 5JQ6L 1W0VA 2EDQA 5JIPA 3TCLB 3U2SA 1H5BA 4EI5D 1CWVA 3VGAB 3GNML 3OTTA 4ZTOH 1CLCA 1A3LH 2B0SL 5KVDL 5JIKA 1TTFA 5ESVA 1MRDH 1G7QB 4JVUA 1FNLA 2DIAA 4N9OB 3QUYB 4HSQA 4OM0L 1ZA3A 1FPTH 1QSFE 2ZG2A 3RGVD 3VFVA 2DMKA 1U3JA 1QVOB 5IG7B 5MENA 4RX4D 4HFWA 2JELL 4WTXA 1ZMYA 4ERSH 3W82A 4ZXBA 3IDGA 1IAMA 3BW9A 4UQ2A 3Q6GL 1F13A 5INDB 1AXSA 3MSPA 3X3FL 4OZFA 5JW3H 3RWGA 2BVQB 1QBML 3OKKB 1OGAB 2VIRA 1XCQA 1G7HA 4M5ZH 1F3JB 1RY7B 3JWDH 4ZFFB 2VLJA 3U7WH 5CILL 5IEKA 4YQXL 5TE6L 1KJVA 4S1SL 3ZYZA 1QRNB 5IGXL 3WNMA 4LASH 1S5IL 2Z0BA 43CAB 5DEFA 1Z9LA 2Y1VA 3MMEA 3A6CL 1A7OH 1DQLH 4QLRA 4Z7WF 4YHLL 3GMLB 2PO6C 4RMWA 5IB4B 3GB7A 1TVHA 3C09B 4P5TD 1CFNB 4HBCH 1UH2A 3QCVH 1QEWB 2YEZA 2NYYD 5E9DB 1R24A 4FQ2L 1H15B 2EDOA 3W5NA 4I18C 3RWFB 5H94A 5F3BB 2ICWJ 4ZYKA 3PQYA 1R3HB 2BNUB 3OJDA 1OAQL 4U1HB 4Y4HD 1KB5L 3ARED 5TF1L 3H0TB 1J11A 2IJ0C 4GW4A 4ELKA 5BQ7A 3HN3A 5CEYA 1VKXB 2EXWC 3VE0A 1HQRB 1WAAA 2LTQB 1MCIA 1MCWM 3NA9H 5E5UB 4TSBH 4GMTH 5FK9B 4QT5A 2FB4H 5DEZA 1MJ7H 4FQXA 5IKCA 3MNZA 3LEYH 1DQQB 1NCNA 3KPLB 1LO3L 5D6DA 3T09A 1H3XA 3HLAB 5BJTB 3ZDZE 1YEHL 3LKRA 1B90A 3P40A 3UO1H 5FGCE 2YD1A 2ARJA 2M26A 3CVHA 1MLCA 4TUOA 2IH3A 4YHZH 3WKML 1Z5LB 5F6IC 4ZD3L 3MROA 1JGVL 1KC5L 1PYWB 3RVVC 5HYQA 4IM8A 4O2CA 1A1MB 1TMCB 2JJWA 1FGVL 1EEUA 2D4DA 5HDQL 1FSKB 4GKOA 1LVEA 2YA2A 1OL0A 4J8RA 4YE4L 4D9LL 1U3YA 1FFPA 5DLMH 3TBYB 3DVGB 4JANA 3X13A 1S3KH 5KSBA 4KWUA 5C0IA 4LSRL 4I3RL 3OJ2C 5F71A 3QDAA 1MNUL 3RVXC 1CI5A 3ARGA 3K8MA 1YQVL 5EBWA 1V3KA 3G5ZB 4LLWB 3UPRA 3QIWA 5D72L 1DJSA 4PRHB 4WGVB 1INQA 1C12A 1VACA 5FO8A 2DM7A 5I8CB 1YEJL 3V5HB 2A0LC 3MA7B 4M9PA 1E4KC 3B4NA 4FMKA 2EO1A 1F4XL 3WHE0 3D25B 4CMMB 3AC0A 4M93B 5I15L 3T0EC 3MRNB 1YEDA 5D1ZB 3BAEH 1A3QA 2WWKO 2B1HH 2YD7A 3MV7B 5LQBH 1VGKB 3LQZA 3GSQB 4Q9RH 1CL7H 4JPKL 3VWJA 1EJOL 1F4WH 1ZEAL 3L1OH 4YO0B 5JXEA 3M1BB 1IC1A 1MWAH 1A7PH 4A6YL 2WLYA 4LCCB 3W9EB 4S1QH 1MCCA 4R2GB 5JW4Q 4LP4A 4LU5H 4KKAD 4LFHD 2O5ZH 4I4WB 1AJ7H 1YMHA 3BN9D 2JCCB 2YPVH 2AXHA 2AABL 1J0YA 1M05B 3GI9L 4MQTB 5B8CA 4W6YB 5IHLB 4ZFGH 1FL5B 5FYLE 1ZT7A 2PXYB 4PRDA 5JOFB 3MOAH 4ZNEE 3CFJB 5B38A 4L3EB 4JO3L 1KCSL 4OM1L 3BEVB 3SGDH 1LP9B 1N0LA 4GAGL 4MQXD 4Y4KC 2HWZL 1T1YA 4XI5C 4F3FA 3S4SA 1I8KA 4JDZA 4JRYA 3HZYB 2FGZA 5HYSA 5T1LA 4XPBH 3O3BB 5DWUL 4DKEL 3KLSA 1CS6A 4HKJB 4HKZA 1FAIH 4JPVH 1ETZA 2X4PA 4PREA 2BNRB 1DN2A 4LCWE 4PBXA 4UT9L 2FYYA 4PG2C 4F57L 4TVPE 3WFBL 1UM5H 1YC7A 2C4XA 4NT6B 3JTSA 1B0GB 3LCYA 3QR2A 4JAMB 4PGDB 1CE6A 2NXZB 3BEWB 2FGWH 3QEUB 4ZTOL 1A3LL 5B4MC 3DETC 2WUBH 5KW9H 3CDCA 4MZ2A 5FFLA 1QFWI 1MRDL 5EZLA 3BZFA 3IU3A 3PV7A 4FN0A 5T5NF 5D9SA 5EWIH 4U1LB 1FPTL 3OX8A 2F53B 5LXGH 1OT1A 4G6FD 3GFUA 3EJZC 3MCG1 1HHKB 3SE9H 4F8TA 5L2KA 3L9RA 4JO1H 1LE9A 3L7FA 4ERSL 2YSSA 3QUYC 3PHSA 5JW3L 5D96B 4QHMA 5ICYB 4HQQH 1KENH 2PO6D 1SJXA 3RWDB 2H32A 4M5ZL 3WXVH 2Y9RT 4N0RA 4I2XA 3JWDL 4PJ8B 3U7WL 4GG8B 2B4CC 4I0KA 4LASL 1P1ZB 5CD3A 1RHFA 3VG9B 3KJ4C 1U8OA 3BPCB 2YD9A 1A7OL 1DQLL 4WI5A 1L7TH 4K8RC 3QFJD 3GJEA 5AD0A 4HBCL 2EXWD 3QCVL 4NQUA 5T1KA 3U30B 3QO1A 1NFDE 3SDAD 5F3HA 1A6ZB 5J89A 4NKOA 4U1SB 1RUPH 2PYFB 1HZHH 1G9EA 3TP4A 1C5CH 4EQ2A 4DZBB 5TH2A 1ZVSB 3AM8C 5FYLH 1EIBA 3PV6A 3ZDYE 5FGSA 4ELMF 3VXRD 4X4ZA 3NA9L 4TSBL 3V7MA 4GMTL 5CJ5A 3V6FB 5MEPA 4ZUVB 5HGHB 3GBMH 5DRWA 4U1NA 1XF4B 4PR5A 2FB4L 1JHTB 1MJ7L 3GIVB 4WV1B 3LEYL 1H0DB 2R2EA 2W92A 3RVVD 1WFTA 2CDGB 3BH9B 3QEHB 1QR1A 4KTEH 4P2QA 3RWEA 1W72B 2KL6A 2NNAA 4YHMH 3UO1L 3VXRE 1F3DH 4YHZL 4KDTA 2YZ8A 2PTTA 4MLSA 4M1CC 4TVPH 3RVXD 5DFWH 4MJ5A 5FKAA 4P5MA 1NGYA 5TE4H 1FZMA 2ICEB 4MNQA 5C0CD 3KXFA 5DLML 2HP4A 1S3KL 3HTLX 5K9QI 1NAMB 2A0LD 1I4FB 4P4KB 3ARUA 3FRUA 1UM4H 3QZWB 1OARH 4FQJH 3T0ED 1NEZB 3LIZH 2Q76A 4NQEB 3EO0A 1UG9A 5C09E 3MUZ1 1XZ0B 4RFOH 3ROLA 3C60C 1T89C 3K1DA 3OAYK 1R5WA 3FT2B 5SX4I 1MH5A 4C55A 4OCRH 4F7EA 4F15B 1WIUA 2XTJB 4PJEB 2P8LA 1A6WH 3BAEL 5T1DH 2B1HL 5LQBL 4Q6IB 1UWXH 1OF2A 5D8JH 4L1DA 4Q9RL 1CL7L 4Z7UB 3L1OL 2OXHA 1F4WL 1B4JH 1ULVA 1MWAL 2K3TA 1A7PL 5D1ZC 4U0QB 4JM4H 3AU1B 4S1QL 3DX7A 3F58H 4LU5L 1A4KB 3HC0B 5KSAA 2O5ZL 1AJ7L 4Y4KD 4XI5D 2YPVL 5DRZB 3S8WA 2Q6WB 3KG5A 4U6HA 3VJ6A 4ZFGL 4JZOA 3I02A 5CINH 4LSTH 1YECH 1IEAB 4YNYB 1E4WH 3HE6B 2C7UA 5HGDB 4UUJB 3HAEH 2PXYC 5J12B 1PQZB 2BY1A 5IW1A 5DJYB 4MJ6B 5GRYA 3ILPA 1ADQL 4A2MA 1ITBB 5DJAA 1W2KT 3NFSH 4XPBL 2QTEA 1QR4A 2Q86B 3JUYA 3HPJA 3GSOA 5EU4A 3CD4A 4Z7OF 1UC6A 1FAIL 1U8HA 4JPVL 4KHTH 2KDGA 5B4MD 1VGEH 2ICWB 3BZ4B 3DETD 4L8SA 1UENA 1HXMA 3L3KB 5L2JB 3IDJB 4G43A 2ICES 4OF8A 1RZGA 4JB9H 5DHXB 1UM5L 1FJ1B 1NCBH 5L9DH 2VDLL 2X41A 3PWUB 3G6AB 5DJCA 3EJZD 1G7LB 2FGWL 1AP2A 1F4AA 4G42B 3QUYD 1NKRA 2AJ3A 2VDMH 1J8HE 43C9A 2WUBL 4I48B 2NXZC 5KW9L 2XQYG 4C83A 5CBEA 2E7MA 4FQQB 1W0YT 3QFDA 3SCMA 4JFDB 1AI1H 2DMBA 3V0WH 4LSSH 1HCVA 5EWIL 2CIIB 5LXGL 3FMGH 2CO6B 1GXEA 4OZFG 3SE9L 1OGAD 4JO1L 3UTTB 5L7XH 2I26N 1XGQA 4TUJA 3ARDB 2EH7H 3PF2A 4GS7B 4QHUB 1U8PA 5ACZA 1L6ZA 4HQQL 1MCPH 1KENL 4M00A 1JWUB 4LF3B 5BXFB 4K8RD 3S6CA 4F33B 4PTUA 1S7QB 1NDGA 4YXHH 3FO2A 5C9JB 1D5BA 1XR9B 4NO5A 2XA8H 4JKWA 3LEXB 5DGRA 4J12A 1R0AH 3PWPB 1C7SA 3F6LA 5E9DD 5HTSA 3VG9C 2R39A 1RUPL 1U8JB 5EOTB 2BJMH 2A83A 4QF1A 1HZHL 4NNYB 3EYFB 3GMOB 4U6YB 3U30C 1C5CL 1EZVX 1DSFL 2BOCA 1FC2D 1H8NA 3V0VA 1P7KA 5JDSB 5FYLL 1ZLWK 1FDLH 1JF1A 8FABA 4K3JH 5EO0B 1GGIL 4E42B 3REWB 1QFOA 3GBML 3VXNA 1UVQA 1ES0A 3IKCA 4XTRC 3CX5K 4FXLA 4M1CD 3AMLA 3SGEH 3STLA 2H2PC 1S9WA 3MLUH 3R1GH 5SX5H 4ZS6C 1QLFB 2ARJQ 4KTEL 3ISWA 3VW3H 5FA3A 3TJEH 1Q1JH 1MFNA 4WV1C 3EDFA 2GFBA 4EI6B 4YHML 1Z3GH 2L4OA 4TQEH 4CN1A 3RJDA 3H7BB 1NBYA 4YEEA 2C5DC 3KPRE 5D7SL 4TVPL 1MSPA 4IDJH 5TGBB 1FO0B 1MCWW 3U9PH 4WHYH 2VDPH 4WFHD 4RA0C 5DJ0B 3JWOC 5TE4L 1U8NA 1UXSB 3AFLA 3NTCH 5C0EA 4J4PA 4OF3A 3FOLB 4NCC1 4N90E 1FBIH 4W4OA 5B21A 4Z6AT 4Y16A 1TLKA 4ZFOB 3GZKA 1AR2A 1IQDA 3RZWA 2RJMA 3C60D 4HUVB 2PCPA 1UWEH 4MVBC 3KPOB 4MD5B 5DRNA 4C4KT 4NKMB 1DUYB 2J12B 1UM4L 1OARL 1X5IA 1T0MB 3GSUA 5IMLA 4PRHD 4FQJL 4HWUA 5D5MB 5D7KE 3CSPA 3VXSA 2NZIA 3QJHA 3LIZL 5CS7A 4P4KC 3JVGA 4RFOL 3BDBA 2DQJH 1BIHA 3UBXI 2H45A 2ZCKH 3CZFA 3TA3C 5D1ZD 2F8VA 1JYVA 4MXVF 3SDCB 3U4BH 2IANB 5F7DB 4OCRL 4QNPF 3EYOB 3FQXA 3QDGB 1I8IB 2CRMA 4OFDA 1K9TA 1QFHA 3OF6A 1A6WL 2I25N 4FFZH 5T1DL 2X1WL 5DD6B 2XKSA 2DRUA 4ISVB 1HEZA 5DJ6A 2BSED 2D7MA 3E3QE 3TVMA 1BAFH 1B4JL 4Z7VE 2V2WA 4HS8H 5FB8B 4JM4L 3F58L 5E8NA 1QO3B 4HWBA 3OSKA 2PXYD 3D69B 3B2VH 3MRRA 5IMMB 4OZIA 3F7RA 2MCPH 5T5FH 1CLOH 3RIAK 5FO9B 5IW6A 4L3ED 1CGTA 2GI7A 1JN6B 4HEME 3QG7H 3PWJB 4KJYA 4LSTL 3NGBB 5CINL 5I19H 1YECL 1E4WL 1LD9B 2ID5A 4PJ5A 4QHNB 3S4SG 1ZT1A 4IHOA 3UDWC 5HYSG 4L8CB 1Q94A 2E7HA 3EZJB 2OQJA 4K9EC 1XF2B 2J8UB 5IEHA 3DJ9A 3BRGC 4QXTA 3VXOA 1ONQB 4JCLA 5FECA 2C1OB 3FFDB 3HZKA 3BP6B 1JWSA 1JJUA 3HC4H 4FG6C 3MRHA 3KS0J 3NFSL 1IGYB 2BNRD 4E9LA 2R56H 4M6MH 4NRXB 3QCTH 4C56B 3LV3B 2FBJH 3D1MC 4L29A 4KHTL 1T20B 4MSWA 1VGEL 1XIWB 4JM2F 2NXZD 4W70A 1S7TB 5DJ8A 5D2LB 4JB9L 3VXTB 4P2OB 4ODWA 3ET9F 1NCBL 2PTUA 4X4MA 5L9DL 2ZWLT 3QEGH 3NAAH 5DD1H 2E27H 4POUB 4UIKH 1AD9A 4NO2A 4UNTA 1IT9H 3BO8B 1FFNA 1I7RA 4XCNA 3PP4H 4V1DB 3BGMA 1ZT4A 2ZUWA 5D93B 2CLRA 2G75A 2VDML 4YGVB 5HI5C 5KN5A 4ONGH 4HF5H 5FYKU 5MEOB 3VXUB 3HZMB 1B4RA 3IS1X 4XNZB 3F7QA 1T4KA 3NIGE 2JJUA 1CN4A 1AI1L 1AIFB 5FCUH 2WBJB 2E9JA 5D7LE 4G8GD 1KJ2B 4LSSL 1XT5A 4MGXA 3V0WL 4AMKH 3HS0A 1J1PH 2I07A 3BUYA 4G6KL 3FMGL 5A2IH 1KB5A 2I9LB 2VXQH 1P4LB 5L7XL 4G80A 1DN0A 3Q1SH 3ULSA 2WIIB 1G1YA 1VESA 2EH7L 2YMXH 5IM7A 1MCPL 3U0WH 4J1UB 1QG3A 5DTFA 3ZDZF 2HJFA 1CU4H 4LCUA 3CFDA 1MCBA 4YXHL 3VMPA 2GJ6E 3HG1A 2XN9D 1QFUH 5DQJB 4OZGA 1G7PA 5K59E 3JV4A 2XA8L 2DM4A 5SWZB 1SY6H 1R0AL 3O4OB 1VB9A 3QULA 3S7GA 3BN3B 3OXRB 4D8PB 4GFTB 1ZWIB 5JHDD 5A40E 4JN2A 5C0JB 3MV9A 2VXVH 2YPLA 3QRFM 2D2OA 5EIVA 1J0KA 2XN9E 4N68A 5EC1B 3QT2A 1MI5E 4HDIA 1PKQA 4OLZH 1EFXA 2BJML 2P7TA 3BD5A 4LLDB 5E4EB 3EOBB 4G5ZH 4XTRD 5BS0B 1C5DB 1EJ6A 2H2PD 2JF1A 4PGBB 4ZS6D 2X5PA 3QYCA 1W8NA 1FDLL 4RMVA 2IADB 3GSXA 2YA0A 3MRCB 3EOAB 3RPIA 1Z9OA 1SHMA 4K3JL 1CCZA 3AROA 3I6GB 4XNQA 3I6LE 4LCIH 3VGEA 5K9KA 1Y18B 2EIDA 2YUWA 4APQB 3O3AB 1UH3A 3R1GL 4KDWA 5MERB 4OGZA 3B9KA 4WFFE 3VW3L 3D39B 3O11A 3TJEL 1Q1JL 1NSNH 2F74B 5BZDA 2C3VA 5D7JC 3BP4B 1CFQB 3MO1B 5BV7C 4QO1A 4OCLC 4YXLH 5HHMD 2X89D 1YN7B 1Z3GL 4KJWC 4N0YH 4MVBD 4NGHH 4TQEL 3RA7H 4G9FE 1CR9H 1HH6B 3I85A 4MDJB 1HDMB 3DGGB 2I9TA 4IDJL 1S7RA 3CH1B 3GJFB 1F02I 3U9PL 2VDPL 3KYAA 5F8QC 3S34H 3IJSA 3K0WA 3NTCL 5C0AE 4BK4A 1II4E 4P4KD 4QCIB 5DJZB 1FBIL 4RMQA 1FVCB 2JIXA 3H9SA 4HKXB 1JGDB 2V5YA 1IAKB 3MRDA 1OSZB 1UWEL 3TA3D 5E8PA 5KJRH 3QAZB 4JFYA 5HHME 1HI6B 2M8XA 1KB9J 3T4YA 4NQED 4LP5A 4XP1H 2VZ1A 1IGJB 4NNXB 1CZ8H 2DWEA 5HHXH 2VKWA 3LKPB 4FQ1H 4NQDD 4WUKH 4M61B 2R1WA 4WCYH 4YAQB 5FGBC 4Y8AA 5E6IC 4DCQA 4Q2ZB 2DQJL 4PS4H 5IFAH 1U42A 2ZCKL 4MNGB 2O26U 3P9LA 2BC4A 4AG4H 1EFQA 1NUGA 3EIFA 3U4BL 3MLVH 5EU6D 1FFQA 1QTYT 1IRAY 4XPFH 1TIUA 5J4MA 1T03H 3CNKA 4FFZL 4PTTA 3OV6A 4HZLA 1NFKA 1J05B 3LN4B 3QO0B 2NY5H 1BAFL 3ECBB 3MRFA 4HS8L 1KIPB 2P43B 2EDJA 5I1EH 3PNWA 5EOCJ 3DV4B 1TTGA 4H1LH 1T7WA 3VFGL 3MACH 4Y2DA 5IHZB 1D6VH 3WHE1 3B2VL 5EU6E 4HLJA 2MCPL 5T5FL 1CLOL 5A3IC 4O2EB 1S7VB 4E0RB 1CDIA 4FG6D 4UT6H 1TZHA 4JRXE 4BQ8A 3AMKA 3P0VH 5DHVH 2GYSA 1B6UA 4CN6A 5C08E 2UWEF 3O4LE 4UDTB 3QG7L 5I19L 4R26H 3WLWC 1WCBA 4ZUSB 1FNSH 1RI8A 3NCYP 4XRCA 4JE4B 2VQ1B 3F7YA 2IQAA 4YXKH 5CLWA 2XPGB 3WO4C 5KANG 5E94B 1ND0A 3QH3B 1RD6A 5I74C 3HC4L 3AXLB 35C8H 3FB6A 2R56L 4LLQA 4M6ML 3QCTL 3FFCB 2FBJL 1MCEA 3C5JB 3MFGB 1DQJB 3QXAB 5HI5D 3RVWC 5KG9B 4RNRA 2NW2B 1KGCE 3S3PA 1LO4H 1NFDF 5EFIB 2HKHH 5CSGA 5IBLC 3NBNA 1AGCB 3QEGL 3NAAL 3TF7C 5DD1L 1XIWC 2E27L 2IG2H 4UIKL 4JY5H 3O81A 1IT9L 2AJUH 2DBJA 3PP4L 1BVLA 3WDJA 4JFDD 2DJ4A 3OG4B 3ZL4H 4CU6A 4P2OC 3RWCB 3RX8A 4P3DB 1A8JH 4IOSD 5CFHA 3GMRB 1KTDB 3JWOH 1NCDH 4ONGL 1CFTA 4NOBA 2FR4A 4YLQT 4RFNB 3UTTD 4ZOCA 5BVPH 1AH1A 4LHQB 2CDEB 2FLRT 5DEGB 4X99B 3QUMB 5D93C 5FCUL 2AJXH 4AMKL 1FYTA 1J1PL 2Q8AH 4IRSB 1F6AA 2J3SA 5LKNA 5CD5C 1FFOA 4M62H 1T5XA 3Q1SL 4FXKB 4M3JA 3WFZA 2VLMD 5CIPA 1YDPB 2AKRB 3UPAA 4WGWB 2YMXL 3T3PE 1W0VB 2FECI 4A2LA 2AP2A 4OJFH 3U2SB 3U0WL 3QPXH 1H5BB 1QKZH 1WISA 1P53A 1NBZB 1CU4L 4U7MA 1DANT 4JG1H 3ZHDA 1QFUL 1XEDA 5ESVB 1SY6L 1T2JA 2WM0A 3ULVC 4YPJA 1ZA3B 3EOTH 3VFVB 4OZHE 4YHYC 2XFXA 5MENB 4HFWB 4F9LC 1QLRA 2XRAH 4PJDF 4DOHB 5HDBE 3QHZH 3IDGB 3BW9B 4UQ2B 2VXVL 1AXSB 1QBLH 4OZFB 4NN7B 2GEEA 2J7LA 2AGJH 3RWGB 1INDH 3LN9A 2WV3A 2VIRB 4OLZL 1XCQB 1G7HB 3UTSD 4G5ZL 4ORGA 2VLJB 5IEKB 1KJVB 3MUHL 3IFPA 4QRQA 2E9IA 5DEFB 5J11B 4PLJC 1U3ZA 5E4EC 5F96H 5D7JD 5CJXA 4XBPA 3MMEB 1CG9A 2VDKH 2Y7QA 3GB7B 1TVHB 4LCIL 1NKOA 1QSFA 3PIQA 4OI7A 2YEZB 2EH8L 4PV8A 4YDJB 1YN6A 4Z76A 1R24B 1MCNA 1URLA 2W9LA 2R2CA 4DVBA 5FYKE 5H94B 1U8QA 1NSNL 1NUDA 4ZYKB 3KPSB 3C6SA 4X83A 4APQC 3PQYB 1WFUA 4HK3J 4XC1H 3OJDB 3KLDA 3WXWH 4R97B 4GW4B 4YXLL 4ZUWA 4ELKB 3RA7L 4N0YL 4NGHL 3TM6A 5GSRA 5CEYB 5BQ7B 1MCRA 1CR9L 3VE0B 3RGVA 1P7QD 3WE6A 2X1XR 2HT2C 2AXFA 1MJUH 2AV1A 5IHBA 4QT5B 3S34L 3IDMA 4FQXB 5IKCB 3MNZB 4R7DA 5EULV 4JM2A 5E6ID 1UJ3C 3EFDH 4NQCE 1RJCA 2W65A 4F7MA 3WUZA 4PJXF 3B6SA 2MQ3A 5KJRL 4DZ8A 3HA0A 3LKRB 3A6OA 1RZJH 4XP1L 3TCXA 1CZ8L 1R3IH 1OGTA 5HHXL 2ARJB 3CVHB 4LLMA 1MLCB 4TUOB 2IH3B 4WUKL 1KACB 4WCYL 3MROB 5KVGH 1FCCA 5HYQB 2IAND 1JWMA 1ZA6A 2X4NA 1I1CA 4O2CB 5T5NG 5TQ0H 4P5TA 5IFAL 5KS9E 3MODH 4J8RB 4KK6C 4AG4L 1ADQA 4KUCF 1C8PA 1PZUB 1FFPB 3BIKB 3IGAA 3K7UA 3MLVL 4JANB 2EE2A 3D9AH 3X13B 5KSBB 1KULA 1NH6A 4NJ9H 3MGAA 4FQCH 1L9MA 4XPFL 1T03L 3IETA 5A3ID 1IEBA 1CD8A 4E41E 1YMME 4O4YH 3FQNA 3TBVA 3ARGB 2NY5L 3ZT5A 3U9UA 2HTKC 5EBWB 1K8IA 3WLWD 2ATKA 3EJJX 3UPRB 1HHHA 5I1EL 3VFOA 1I8LC 4I3GA 4QHKJ 3C6LA 1JMXA 2XNAA 3QIWB 5I2IA 3MACL 5E08H 1U6AL 1INQB 1C12B 1VACB 5FO8B 1D6VL 5AUMA 4QRRE 2YUXA 5GGVH 2QSCH 4UT6L 4JG0H 3P0VL 4NWUH 3H3PH 4R26L 1YEDB 3QQ3A 1FNSL 2X9WA 5IT2H 5GIRA 1IC4L 3D0VA 4ZPVA 4DGIH 1KPUA 4MB4A 5IESH 3LQZB 5M7QA 3VWJB 3RVWD 4YXKL 5ESAA 3K4DA 1P9MA 3WYRA 3JUZA 1QBBA 1WV7T 4C56D 2IPUK 5IBLD 3ULUC 4BUHA 2QLVB 35C8L 1XIWD 1E6JH 1YMHB 2BSRA 1RIVH 2NY1B 1EHAA 4BQBA 5B8CB 4P2OD 5FYKH 1KIRA 1ZT7B 3TN0C 4PRDB 2BVOA 1CVSC 1LO4L 3LD8B 2HKHL 5BV7H 1OPGL 1WWCA 5F7KC 3W2DH 2IG2L 1T1YB 1UYWH 4JY5L 1GL4B 5GS1C 3S4SB 4F3FB 1I8KB 4JDZB 4JRYB 2AJUL 5E8OA 4JFFE 4P2RE 1Z9MA 5CD5D 5HYSB 5JIHA 3FCTA 3VI4E 1PDKA 5T1LB 5FO7A 1MHHA 1XF3A 3JWOL 1NCDL 3BWAB 3NZHH 1I1YA 3T04D 4TRPH 3EKCA 4HKZB 5BVPL 2K7QA 2X4TA 4U7KA 1J87A 3MRIA 1ETZB 2X4PB 4LQ1A 4PREB 2AJXL 3MLSH 2Q8AL 4J6RH 2VTFA 3ARFC 3DNKA 1FQ9C 2FYYB 3TPUA 4K71C 4M62L 3ULVD 3PGCA 3JTSB 4ZNEA 2X4OA 1CE6B 3G6DH 4OJFL 1IC7H 4IRSC 1CGVA 3QPXL 1QKZL 3OAUH 4D94A 4YDKH 2VMFA 5ID1A 3IKKA 1I9IH 4JG1L 3K1KC 3I3EA 4N1EA 3V5KA 1HSBA 2ERJB 1IE5A 1H5BC 12E8H 5EZLB 3BZFB 4YHPA 2GJZA 3IU3B 1L4IA 4XNXH 5D9SB 3EOTL 3OX8B 4XB8A 3ULVE 4BZYA 4JVPA 1A6VH 1NGWA 2KH2B 1JCKA 1WWWX 5L2KB 3BYTA 3L9RB 1LE9B 2XRAL 3V6BR 1WVZA 2AQ1A 4PLJD 3L7FB 2YSSB 3LOWA 4LCWA 3QHZL 5BS0D 1QBLL 4QHMB 2BHUA 2AGJL 5JPMB 4EIZC 2FDBP 2H32B 1INDL 2F8OA 1NGXA 4I2XB 3RQ3A 2ORBH 3L5HA 3MRGA 3WJLC 2X7LA 4U1GB 5CD3B 4FP8H 4J3XA 5F96L 4APQD 1A0QH 4RDQG 2VDKL 4LSVH 3VGFA 4ZS7H 3U7YH 3GJEB 5HYEA 4PRID 5J11C 5AD0B 1GVIA 3RL2A 5T1KB 2FLBT 3QO1B 5I1IH 1P2CA 5F3HB 2HT2D 4NKOB 4HJGA 3OJMB 4HH9A 5DVOA 4JREC 5GRZA 5CP7A 4XC1L 4MJ4A 5D2NC 1TPXC 3Q6FA 2JE8A 5F7YC 5TH2B 3UC0H 3WXWL 5I66A 3PV6B 3UBXA 4FXGA 1YPZE 2VZUA 5EORH 1BREA 4I5BA 1CD9B 4CMHC 2ICWI 4NDMA 4PRIE 2DQGH 4U7SA 5MEPB 1MJUL 2A73A 2IEPA 1GC1H 5DRWB 4U1NB 4PR5B 3WFEH 3U4AA 2R2EB 4WI9A 4N5UA 3EFDL 4NC1C 4IOIA 1QR1B 4P2QB 2HVJA 5DUMH 2FX7H 4KK8C 1G7MB 2QKIA 1B0RA 1RZJL 2NNAB 5ITBH 3FJTA 3ZKXC 2W0LA 4I18A 4WNQB 1R3IL 4PJCF 1HILA 1Z2KA 2JB6A 5D6DC 1PX4A 2PTTB 4G6JH 4JPIB 1BQSA 5KVGL 5TQ0L 1TJIH 4MJ5B 3HAEA 5FKAB 2HTKD 5DHYA 2G2RB 1NGYB 4K3EH 4P5MB 3MODL 1J88A 1FZMB 2MKWA 4MNQB 3F6IA 3ARSA 2NCMA 1DFBH 4LLAA 3KXFB 5H37G 1IQWH 3D9AL 4KVCH 3EUUA 3VXME 3HNSH 4NJ9L 1MVFA 3MV01 2J8OA 4FQCL 4WJ5A 3GK8H 4PLKC 4O4YL 5KSUA 4N9GA 1EHLH 2CKNA 4KKLC 4R4NC 2Z93A 3ULVH 2XV6B 5AYQA 3VXRA 1UZ8A 2Q76B 3EO0B 3WN5C 5E08L 3NIGF 3CVIH 5GXBB 3ROLB 3HMWH 1QA9A 1R5WB 3WS6C 3ULUD 3MUGB 1MH5B 3QIWC 4PGZA 4JG0L 4F7EB 5AAMA 2P8LB 4NWUL 2BDNH 1MPAL 3H3PL 1MCDA 3IAQA 2CSPA 5IT2L 2OI9B 4ZOAA 1BP3B 1OF2B 5IESL 3TN0D 1AE6H 4XVTH 2VZSA 4WI4A 1U3HC 4L4JA 1NJ9A 3DX7B 2RQ8A 5EBGA 3DOSA 5EZIL 1DLHA 5K59F 3SKNA 3BP7A 5ITFA 5KSAB 1E6JL 5AZEH 1RIVL 4PGCA 5C09A 1ORSA 4U6HB 3OB8A 4WTWA 1IGMH 3VJ6B 4RBPH 5LCVH 5FYKL 2J8HA 2OTUB 4Z7WB 5BRZE 3QQNA 2AEWA 1SYSA 4JZOB 3I02B 4BYHA 1AXTH 1E4KA 2NY1C 4PJGE 3WNLA 1CTOA 2C7UB 4HIHA 5B8CC 5BV7L 5I1CH 1SVCP 3WDIA 3FQRA 3T0EA 1UYWL 3ARFD 5IW1B 3LS4H 1XR8A 2CKBH 3ILPB 5E95B 3LD8C 5DJAB 1EGJA 5TF0A 3DLQR 4K2UH 3NZHL 3HPJB 4YBQC 4U33A 4IRSD 3GSOB 4XCYA 5EU4B 2VC2H 4TRPL 1U8HB 4XXCC 5A16A 3U83A 2Y5EA 2NXYC 2G60H 3DRQA 3HCVA 5F7WC 3MLSL 4L8SB 3MA9H 1HXMB 1UEMA 2LABA 1G0YR 4J6RL 4G43B 1RZGB 3TBSA 5LG1A 4M1DH 2EDHA 3O6LH 4L8DA 5DJCB 3G6DL 1IC7L 3N1MC 3CX5J 4YDKL 2HN7A 3OAUL 3NACH 1AP2B 3QQ4A 5CKAA 1I9IL 15C8H 5L0QB 2AJ3B 4Y4KA 43C9B 3S37X 1VEMA 4C83B 5CBEB 5MEND 12E8L 5GISH 3QFDB 5DMIH 3SCMB 5FM5M 3L95A 4MQSB 2X40A 2YD6A 1F3RB 3KLAA 1AFVH 4M4RA 1Q0XH 2LAGB 4XNXL 4W68A 1BECA 3FB8A 2ERJC 1A6VL 4XHJC 2EEBA 3FAWA 3MLXH 4HWNA 1XGQB 4NM4H 2VLJD 4JDVA 3BKYH 2X4SA 1FHGA 1E0OB 1U8PB 5ACZB 2FHCA 4PG2A 3PP3H 5JOEA 5DRXA 5HVHB 3VDAA 4PTUB 5GRVL 1NDGB 2ORBL 1KOAA 4GKNA 3FO2B 5KAQF 1D5BB 1GGCH 5I75B 4Z18A 4NO5B 1KUMA 5ID0A 3GBLA 5CCKH 1MRFH 2IPKA 4O00A 4UB0H 4FP8L 3WIHH 3H2WA 1VA9A 3AS1A 3QEQD 3RDTA 5K9QG 2R0ZH 5I1HH 1D5MA 4DEPC 3RIFF 1A0QL 1JZ4A 4LSVL 4U1GC 4ZS7L 2R0WH 3U7YL 5EIQA 3O3DA 4X8JA 1YNKH 3KPSD 3VRIA 3ES6A 3RU8H 3PQYD 1W8OA 5I1IL 4DFIA 5TDPA 3QNXA 1VDGA 2A83B 4QF1B 4JDTH 4Y0GA 4XHQA 5C86A 3W39A 3QEQE 2BOCB 2ENSA 3V0VB 1P7KB 3N85L 3UC0L 3TH2T 2CIKA 3DVNA 3SJVE 1ZS8A 4KK8D 4OF0A 5EORL 2DLGA 3E0GA 2R4SH 2DQGL 8FABB 4I77H 4HG4K 1ZHNA 3PWNA 1OGAA 5JW4N 3VXNB 1UVQB 3WFEL 1ES0B 3IKCB 5I71B 3STLB 1S9WB 3RNKA 3BZEA 5FA3B 5DUML 4GRLA 2FX7L 3LMJH 2GFBB 5ITBL 5IV2A 4OIIL 3PWVA 1MFBH 4PLKD 1NBYB 1JF6A 4G6JL 2XACC 4WFED 2P5EE 1TJIL 3AM8A 1NANI 4R4ND 4KKLD 4K3EL 1GOHA 1U8NB 1IZKA 5C0EB 5K9JH 4KDTC 5BOZG 2VLRE 1R3HA 2CH8A 5ALCH 2JLLA 3RIFK 1XF1A 1DFBL 4Y16B 1U9KA 3H0TA 4KVCL 1IQDB 3HNSL 1Q8MA 1T7ZA 2PCPB 4KRLB 2ZJSH 4LBEA 4P23C 4NKDA 5DRNB 3QIWD 2V5TA 3GSUB 5IMLB 2ZUSA 4BK5A 2LVEA 1EHLL 4WFEE 2C3GA 1OHQA 3VXSB 4B7IA 3ULVL 5GRXG 1J10A 1YY9C 3QJHB 1K4DA 5D7IE 3WEXA 1VADA 2BRQA 4G7YH 3EJYC 1YNTA 1IAIM 5F9DC 2P48B 3CVIL 2R2BA 3KPRA 3QXWA 1U3HD 4PJHE 3CZFB 3HMWL 5F1KC 4GLRI 5F7LB 3IS0X 4HPYH 4UT7H 4EEEA 1DE4A 2BDNL 3RRQA 1FL3A 1PZ5A 1FVEA 1MCKA 3MCLH 3T3PF 4DVRH 2OP4H 1MAKA 1HEZB 1IM3A 5DJ6B 4DQOH 1AE6L 4XVTL 3TVMB 3V95A 2Y06H 4XB7A 2V2WB 4WY7H 4XMKH 2NY1D 3IB4A 3SKUD 4NSKA 5E8NB 4PJAA 1KCVH 4GQPH 3MV7E 3IDXH 5AZEL 5TE7H 1D9KC 2FEEL 3RI5F 1RUMH 4PB0H 3MRRB 5CUSL 1WC7A 5IW6B 2EDDA 1IGML 4KC3B 1N0XH 5LCVL 3L5JA 5EO9B 5KSAC 3C60A 4YBQD 4Q0XL 1T89A 4KJYB 5CJQH 1AXTL 2EIEA 2JCCE 4PJ5B 2A6DA 1ZT1B 4GG6F 1SY6A 4IHOB 5DURB 1ZVHA 5AZ2H 5I1CL 3SKJH 2FCBA 1Q94B 2NXYD 5T1LD 2OQJB 5MI0B 1S7WA 2GAZA 4LMQE 5IEHB 1LEKA 1MELA 3LS4L 4QXTB 3VXOB 5FECB 2CKBL 3HZKB 1JWSB 2DI8A 3MRHB 4Z7VA 1NC4A 4RMRA 3D25A 2PUQT 1N7MH 2PYED 2IAMA 3DGCR 4K2UL 3E6HA 5IFHL 4L29B 4UOW0 1G9NC 4MSWB 2G60L 3MA9L 3EZ8A 5DJ8B 4KRPC 4R90H 2R0LH 1RZ7H 4ODWB 2VL5B 4M1DL 3O6LL 5FYJD 1NPUA 4L8SC 3QA3A 3M17A 1AD9B 4NO2B 4XHJD 1FFNB 1I7RB 4PJIE 4XCNB 1LDSA 1T7VA 3BGMB 1ZT4B 2CLRB 2ITCA 15C8L 2G75B 3QUZC 2NR6C 3MLWH 5IB1A 2CMRH 4G9DA 1T4KB 5GISL 5DMIL 3ARTA 3HUJE 1RK0A 4OFVA 5L0QC 1AFVL 4ONHA 3H3KA 3TESA 3HS0B 2I07B 3BUYB 1ED3A 2VLKE 2EECA 3HZYA 1KB5B 2WWKT 4G80B 5HSFA 1DN0B 4JVWA 3ULSB 4NM4L 1JI2A 3BKYL 4S11A 2DQCH 4KXZI 4M03A 4LARH 1KCKA 5IM7B 1PY9A 5DTFB 2HJFB 4LCUB 3CFDB 2XWTA 2BNRA 5DSCA 4OFYD 4OZGB 1G7PB 5F9WB 2NY7H 1HYRC 3JV4B 3MV11 5CCKL 1MRFL 4UB0L 4P3WA 1PJ9A 4FRWA 1M7IA 4QRSA 3WIHL 3MBEA 3F5WA 4Q9QH 1D3CA 2R0ZL 4I9WE 1KN4H 5I1HL 3QJFA 3QULB 2LU3A 3BEWA 3BKMH 3T8XB 3TGXA 5KS9F 1WIOA 2CUIA 4Y8DC 3U79A 5I75C 5D7LA 2R0WL 1CT8A 4C59B 1YNKL 2X9YA 1U95A 4JN2B 1QBAA 4YDLC 3RU8L 3MV9B 2YPLB 4M6OH 4HDIB 1PKQB 2AI0H 4GRWB 1EFXB 1QLEH 4M7LH 2P7TB 4JDTL 1KNOA