4KV5E

Scfv gc1009 in complex with tgf-beta1.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSNVISWVRQAPGQGLEWMGGVIPIVDIANYAQRFKGRVTITADESTSTTYMELSSLRSEDTAVYYCASTLGLVLDAMDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a pan-specific antagonist antibody complexed to different isoforms of TGF beta reveal structural plasticity of antibody-antigen interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Transforming growth factor beta-1
total genus 24
structure length 120
sequence length 120
chains with identical sequence G, H, J
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kv5E00
3AREB 5KSAD 4GW5A 4IMLB 3LB6D 1WT5A 2HKHH 3KPPB 4U3XA 2Y07L 1RUAL 3VG0H 5GS1A 4R0LA 4OIIL 5T3ZE 1FH5H 1TENA 4X9BA 3K46A 5TQ2H 3GGWB 1CFSB 2CDEA 2DBLH 3QFJE 4OCRL 5FGSA 3S34H 3L3HA 2MWCA 4NKIL 1T22B 1NJ9B 3OHXA 2GFBA 3V4UL 4YDIH 4HFWA 3IDJB 4Z77A 1DBML 4Z7VE 4M48H 5L9DH 2I25N 3EGSB 2HLFC 5DRNB 5ITBH 4LCCC 4AG4L 5EG6C 2DM2A 2UY7A 5I17A 3O6KH 2WINA 4FQXB 1JTTA 5C6PB 3AS1A 5DR5L 3MJ9H 1RZ7L 2BVQA 5E1AB 4ODWA 2VN4A 1RIVL 5CJOH 3DHMA 4L3CB 3L6FA 4X4MA 4J8RA 4WHYH 1KIPB 3O3EB 3MRNB 1XIWB 1TTFA 4NO0D 1GGIH 2HTKD 4R2GC 5BMFL 1FFPA 1HK6A 3MZGB 2Z35B 5GS2D 1CE6A 2H2SC 4RFNB 3PHSA 4NJ9L 3UP1A 5F7EH 3CZFB 4Y4KA 4GRLC 4M7LT 4MQXC 2MCG1 2IADB 1T83C 5C0EA 3THML 3BWAA 2CKNA 5E8DH 3GBMH 4POZC 4Y1AA 4YHKH 1IGFH 1QVOA 5ILTH 4KTYA 2EE2A 4ACPA 2G60L 2BNQD 5F3HA 2ZJSL 4UOJA 3ES6A 3V5KA 3ZE1F 2R4RL 3MRLA 3T1FA 2D03L 3C5JA 2V2TB 4FP8H 1IKNC 2YSSA 3KPLB 1G7JA 4WCYH 1R5VA 1ODAA 2A83A 2GTWB 2W60A 4O2FB 2C7UB 3KPRA 4L5FH 1EGJA 4N1EA 1XR9A 3GEWB 3HHRB 5T1DL 4G6JH 3NABL 3UPRB 3PV7A 2DYPD 3ZE0E 2DB8A 3ESUF 3GI8H 4MA3A 3S36H 1I1YA 4KQ4H 1KJ3L 1M7DA 3NGBB 4UTBH 5GRXG 4WI2A 3CFBA 1KNOA 3O3AA 4IDJH 2G75A 1PEZA 1NUGA 1W0VB 4DEPC 4KK5D 4LFHG 3QYCA 3UYRL 4BQCA 1J8HB 4DZ8A 3X3GL 3AS2A 3TBVB 4FQXD 4XP6H 4LLYB 2UYLB 5ANMB 4OCMC 3GB7A 4OUUA 5E6IC 1BD2D 1BFTA 2R29L 2MFNA 5ID1B 5IFHL 1OGAA 1YMHB 1KJ2B 3ZYIA 5JZ7D 4U6XB 1YEIL 3LRSB 3V0VB 2VSCA 2VLLA 3NCYP 3GJFK 2G60H 3HPLA 4OD3L 1YMMB 3WS6A 1JK8B 4PJHB 1JGLL 1XCQB 5IK3A 5BVPL 3MRCA 1TLKA 3U4EA 1I9IL 2ZUVA 5F6HJ 4KRPB 3HAEG 1XF3A 2VO5A 3AUVA 1JZ8A 1IGIH 1HH9A 2QJDA 3QULA 3K4DA 2Y6SD 3VFRB 3FQUB 1EO8H 2I9LB 2VLME 1Y18B 3WFBH 1YPZB 4Y2DA 5KN5A 4WI7A 1TZIB 1KYOJ 3B2VH 4MJ4A 2Q7NA 4XPFL 2X89D 4PJHE 4ZS7L 3EOYG 1IAIH 2R2HB 1U8LB 3IDXH 4R26L 3SOBH 4P2YA 1AQDA 1C5CH 4WV1C 4XAKE 1A6WL 4G6KL 3PGDA 1OP9A 1UXSA 2R2EB 2JK5A 1MFCL 1PYWA 2VZOA 2V5SA 5EWIH 3UZVB 1I8MA 1R3IH 4ESKA 5ESVB 3SKUD 2XZCL 1IC4L 1F3DH 2CO6B 4HPYL 3KPOB 3OQ3B 4ODXA 4ONGL 3GSXA 2CIKA 4NP4H 4JFOA 1T21A 3OSKA 1G6RL 2C1PB 4GMTH 3KPMB 1FL3B 1ORQA 3E6HA 2A6IB 2EDHA 5AEAA 1S7SB 3P77A 2DD8L 2WLYA 5FB8A 5GIRB 1RUKH 32C2A 1LNUA 3I02A 5D2NC 1JWSA 3UTSE 5MP6L 4S11A 5DI8A 1HXMA 1J8HD 5I8KH 5DFTA 5C6TL 2DLHA 2JCCA 2MKLC 3VG9C 4N0UB 1BD2B 2HWZH 1DQTA 1MFBL 4Z7UE 1YJDL 5ESAB 1BVKB 3O6FA 4ODVH 1U93B 1QNZL 2O61A 4ODSL 5KANG 4HUUA 4FA8A 4Y4FB 1BZQK 2DI9A 5CJBA 3T0EC 2FO4B 3MBED 1S7VB 2Y5TB 4AH2B 4YHPA 3ROLB 2ITCA 2W9DH 1CG9B 2XY1A 3J7HA 3KS0J 4LFHD 5IVNA 3MMEB 4DQOL 4HC1L 4TTDD 3OTTA 4EI6B 3FO1B 1NDMA 2AABL 1I7TB 1PLGH 1S7WA 1NFDB 5FA3B 3KXFA 4OF0A 5HHMB 2ZPKH 4G6AC 3D39B 5CGTA 4NGHH 3D69B 1HDMA 4FRWA 5FYKL 3D85A 1FP5A 3PABB 5JW4Q 4UQ2B 1INDL 2VIRB 5D72H 1S9KC 4HKJB 1FL5B 3X3GH 1EUTA 3L7EB 5HDQH 4JDVA 1RZGA 3RWGB 2NXYC 1NJ9A 4XH2B 5MERB 3TYGL 3HN3A 2DI8A 2YXMA 4JFZL 5FECA 2BY1A 1BEYL 4U6YA 3NMEA 3REVA 1F5WA 1H0DA 3BP6A 1VB9A 1EAPA 5J9PB 3NIGE 1JI1A 3PJSA 3AY4A 3RDTD 2DDQH 3WJJC 1H3UA 4QTIL 5J4MA 4ZNCD 3SKNB 1D5IH 3BKJL 2A77L 4OF6A 4Z5RB 2Z93A 3VA6A 1M7IB 2IF7A 2HT4C 4M5YL 4HIHA 2Y06H 3ZHLA 3MRNA 3KHQA 2YBRB 4G8EA 3FB8A 5D1XA 3KLDA 5GS0D 1AO7E 1NGZA 3UO1H 1JHLH 2ZJSH 4R7DB 2VDLH 3GBNH 3F7RA 4NQXA 1MFDL 5DD5H 5I73C 1NCTA 2LAGB 1P5VA 5ETUB 3CLEH 4P5MA 3LKQB 3BP5B 1T0PB 2ZOKB 3G5ZA 3GSNL 3ZE2F 1MRFH 1HHGB 1KFAH 5EO9A 4Y4FD 5E8DL 4CN4A 5GSRA 2JIXB 1TJHL 3BPCB 5K9OA 4J23A 3B2UC 1EUUA 2HT2D 1MAJA 4KRPC 5ISZB 5EZOH 2J3SA 3UTPE 1QO3A 5A40E 5KVGH 2VL5A 3NN8B 1PQZA 4E0RB 1QLFA 5GJSL 5ACZA 1MH5A 2WQRA 5T3XL 5IJKC 4UTAL 3T4YB 4XNXH 3PHOB 2NY5L 1OGTB 2DLTA 2NY1C 1BVLB 1K2DB 3QDMA 1LP9F 3LEXB 5D5MF 1DUZA 4WWID 4P3WA 2VJXA 5DO2C 5I0DA 4WHDA 3TO4C 3HC4H 1Z9LA 4QXWA 2F53E 3PWVB 2F54A 1FC1A 1O7VA 4MZ3A 4RISL 5CJ5A 4F37K 1E0OB 3KJ4C 5E8EA 1JPTL 1M71B 2NR6C 1EEQA 3MRKA 4HG4J 2F9BT 3BD3A 2X44D 1A0QH 3L5WB 1JI2A 3IJSA 1J1OH 4Z7UA 1NCUA 5IMOB 1UT9A 3QCTL 1L6XA 3JV4B 3BJLA 4NT6B 3JTSA 3SY0B 5ELIA 1G9EA 5JO5A 1B0GB 1KGCD 5HHOD 3RWHA 3Q1SH 3QG7L 2OSLB 4CU7A 3G6JE 3NFSH 2ITDB 4LSQL 4L4VA 4MDJB 2EH8H 2CRMA 2NY7H 1OAXL 3BYTA 3ZYJA 4BQBA 1CFTB 3SE8H 5DD1L 3GUTB 4NQCD 3ARDC 1T1WA 5TDNA 4RZCA 1N6UA 4LVEA 4M1DL 4XC1L 1KENL 1EHXA 4HJ0C 4TSAH 4BFGA 2DQDH 1NDGB 2OK0H 3G6DL 1U8KB 5EA0H 3QR2A 2FDBP 4F37F 5D6DA 2DAVA 2W59A 2JIXD 3HA0A 4NC0B 1MJ7H 3SKJL 3C09B 3GJFB 3RPIA 4E41D 1N6QH 1CTNA 5DMGC 1NBVH 3QJHB 3HFML 4R26H 3LV3B 4LU5L 4WI9A 5I1GL 3JUYA 3T77B 2A6KA 4D8PB 2Q6WB 2V9QA 2CH8A 3MX0A 4HS6B 1G9NH 3BGFB 1X9QA 2HFEA 1U3ZA 1A3LL 3RY6C 4AEIL 3W11C 3KAAA 2R1YB 3MCLH 3KPOA 2QQKL 5BZDB 2FYYB 3KR3H 2NXYB 4YHNA 2HFGH 4YPGB 1LO2L 1XGQB 3FRPA 1F11A 4IJ3C 4MB5A 3VXOA 2ORBL 2KBGA 5IW3A 2I9TB 5IVXA 3FN9A 2Q1EA 1T04A 2ADGA 4OZGB 3QWQB 5E99L 32C2B 1U91A 4B7LA 2NR6D 3QPXL 2ICEA 4ZUTB 4FFWD 3D0LA 4PJCF 1LMKA 5DJ0B 5KTEH 1OGAE 5SWQB 5T5NG 4IRJD 4Q74A 2IAMC 3O4OC 1E4XI 4ZSOB 3MREB 5CSZB 3RKDD 2YD4A 3MRGA 2IAND 1H15B 3OAUH 4NJAL 3QHFH 1AY1L 3LKRB 5FO8A 5F9WB 1Z5LB 4XP6L 4RX4D 4KDTA 1U3JA 1KENH 4HWNA 5JW3L 3P4NA 5IKCB 1VACB 3ZTJH 4E41A 5MENA 4WY7L 2HH0H 2BC4A 3E0GA 3RWEA 3GSNB 2Y25A 1RUPH 2NW2A 1KB5L 2NY3D 1QRNE 4MXQD 1OTSD 4GQ9L 2Y1VA 5CIPB 2CLZB 5GRJH 5JLZB 5F3BB 4LGPB 3MUJA 1OAYH 4IRSD 3BPNB 4XBEH 3ZL4H 1CDCA 4UOW0 3I84A 3RWGA 1MHHB 5DT1H 1A6PA 4B50A 4YK4B 2FHCA 4XH2A 3S96B 1JV5A 4UNTA 2GTZA 3NCCB 2DIAA 1AJ7L 2EE3A 5EUOE 2PF6A 2BSED 4HKBB 1RPQA 2LAAA 1P2CB 3FT4B 1KEGH 1VFOA 2X4QA 4X6CA 3O2VL 1ERNA 4BZ2L 1H0DB 4AL8L 3OJDB 4AYFA 1T89A 3IDGA 4PGZA 3C2AH 1BHGA 3W9DA 1NCDH 4KKCD 4PPTA 3VXSE 4ZFZA 3MRPB 3SDAC 4QRTB 4G8GE 4LHQB 2OI9B 3T3PF 2APBA 3TZVA 3JWOL 4HWZB 1MFNA 2C5DC 5D7SH 1BQHG 2EO9A 4PRDA 3VFSB 1U8IB 4LSDA 4GS7C 4Y4HB 4NNYA 3RL2B 4JY5L 3VWJB 1BJ1J 2APTA 3QQ3A 1WSST 4IRJB 2DF3A 1UZ8A 5DD3L 3O2DA 1WFTA 3EBAA 4LLUA 1ES0B 2G9HB 1CICA 5MEPB 4P5MB 2YA1A 4RFEB 3HS0B 3P4OA 1LO4L 3Q6GH 2CPCA 4HX1A 4X7EC 1JZ2A 2ZUXA 4DUVA 4Y5XB 4ZXBB 3HZMA 4Q58C 3CPLB 2D03H 4I0KA 5FM5M 2EDWA 1AD9A 3MV8D 1GGYA 3V6FB 4LSPH 1PSKH 4Q6IB 4UV4H 1I8LA 4XCNB 1U8MA 5C0GB 4JFDB 3O3BB 5JR1L 4WI8A 4XNMA 1E4KA 5IB5A 4G42A 1TETH 2FBJH 4WFHD 2MQ3A 3BZ4A 3L7FA 2CMRH 1AKJB 5D5ME 4Z8FL 4RIRA 2J8UA 3I6GB 1KJ2H 4R97C 1T4KA 2VE6A 1DUZB 4KK6C 4HUNB 3GMLB 3LN4A 4EIGB 1TCRA 3QFDB 5F1SA 1BGXH 4NC1E 2HG5A 5J0BA 3LY6A 5I1AB 1MWAH 1MHPL 4DWHA 1Q0YL 1JZ3A 5JW5B 2FWOA 5HD8D 4URTB 3DOSA 5DFWH 4XB7A 4QLRA 2QQQA 2VXTL 4OKVB 1SEQL 2M2DA 5IQ7L 2H8PA 3K80A 3ZKNC 4DGYL 5E4IA 5I1EL 1GC1C 2C3VB 3QNYA 5F7FA 2O93L 3NFNA 5FKPB 4NRYB 5IHUL 3EYUH 4L4VB 3BDXA 4LLQA 4XBGA 4W68A 1JNLL 1MIMH 3GHEL 4QXUL 3ZL4L 4D3CH 3MUGA 4OGYL 1Z3GH 25C8L 3IB4A 4M93B 4G7VL 4GBXC 1GOGA 4PV8A 1G7LB 2FJGB 3BD5A 4JFHD 3HR5B 2XACC 4E5XB 3DNKA 5JOFB 3QI9D 5DS8B 1P4LA 4YBQC 4Z76A 4LGRB 3K1KC 4MQ7A 1X5HA 5CMAB 1MHCA 4U6HB 5I9QC 1IGIL 1GGUA 5EFIA 1C8PA 4LDLB 1ZANH 4XTRD 5BV7C 1AR1D 2J5LB 5J1AA 2DL9A 3SDCC 2CLVA 5T1KA 5FGCB 2BMKA 5C07B 2ARJQ 5ESQA 1UG9A 5F71A 3ZKQD 3GKZA 4HS6A 4D9QD 1S9VA 4H26A 4P2OC 2BY0A 3KPPA 1HH6B 3FO9B 1KELL 4PGJA 3BPNC 2QR0B 2R4SL 4UDTA 1S7UB 3MV8A 5GS1B 5GHWH 4F58L 1J86A 2XYCA 4QT5B 4ZQKA 3E2HC 1KCLA 4KPHH 5ICYA 3AB0B 3IJHB 1ZGLM 3DX8A 4QF1A 2DS4A 2R4SH 2BVOA 3FFCE 2DTSA 4YR6A 3K7UA 4PREA 1BBDH 3FQWB 3O4LE 3DI2B 2MCPL 3P11H 4RA3A 3QQNA 4G6FB 4Z77B 4WJ5A 1JL8A 3WN5C 3IS1X 1O0VA 2RQ8A 3PDOB 1VSCA 2XIDA 1WTLA 3PIQA 1AC0A 4RMUA 5TDPA 2CQVA 1U3HB 2WBJA 5JHDA 5JPMB 1OARH 3T8XA 3VRIA 4GQPH 5I30L 2OM5A 1QBML 1JGUL 5J56B 5GGUB 4HPOH 1D5BB 3IU3A 3ZMRA 1RVFH 1KUMA 1F90H 4LOUC 4KKCC 4JG1H 3WSQL 2YPLE 2UUDH 1WFNA 3HI5H 5MENB 3K8MA 2E5EA 2FBJL 1KB9K 2L7UA 4XXDA 2LU4A 5JLZA 3OWEA 1OHQA 4NM8L 3R06A 3TO2B 5CJQL 4GG6F 1MJUH 5GJSH 3D3VE 2R9HD 1OW0A 3F6IA 3RTQA 5B3JE 1CE1H 1AGDA 2VDQH 1X6NA 4HJ0D 1E6JL 9CGTA 4MVBD 4XVTL 5DMIH 4GBXD 1IVLA 2AXFA 3C5JB 1IGYA 1MCEA 3QI9A 4KMTL 4OCXH 3LKPA 3OXSB 4G9FD 1QSFD 2D31A 3PWLA 2GTWA 2W60B 5LG1A 3L9RB 4YX2H 3G6AA 5HY9A 5T1KD 3QXAB 1NCAH 2WW8A 3B8YA 5GRUH 4NZTL 4BQ9A 1DE4B 3U79A 4O58L 3MYJB 2HMID 4Y5VC 4P48A 3FB5A 1NCAL 1YC7A 4IRJA 3MLRH 4MNHB 2DQIL 5CEZD 1IKNA 2IANA 4Z0BL 1CICB 4FNLH 4LSUH 5T3XH 4QHLA 4XMLL 3V5HA 3GIZL 2EKJA 3W0WE 2VC2L 4UV7L 2QSCH 2VABB 1CQKA 2Q3ZA 1QACA 5EU6D 3LS4H 2F74A 4KI5D 3UXFA 2EC9T 4HWBH 2N7AA 2V5TA 5C0CB 4K71C 4CU6A 4EBQH 3V6FA 1ED3A 3BHBB 4M7ZB 4RMQA 3S5LG 2D7TH 5C0GA 1BM3H 1CDUA 5MEND 4MNQB 1KULA 4FS0A 1LEIB 5IHBA 2OQJB 1DQJB 3P30L 2IG2L 3HUJA 1KXTB 3BP4B 2BNUA 1MJUL 2XKUA 4EUPB 3FQTA 2XPGB 3MBXH 1AGBB 4HKXA 2WUBL 1NFKA 3GKWL 1HH9B 4NUGL 4ZFGL 1VEPA 2YD7A 4LKCB 4J3OC 4D2NA 3TBWA 3ROOB 4HIEA 1PLGL 3T0AA 1N6VA 1OP5K 2CUMA 3SE4A 1R6VA 4WI5A 1E28A 4WHTB 2NY3C 4MXQC 1N7MH 1E27B 2OR9L 3P9LA 5DUBA 4BZYA 3U30B 1IL1B 4WWKC 3D9AL 1D5ZA 2DDQL 2Y5EA 2XNAB 5FYJU 3O11A 4G9FB 1L4IA 2EDQA 5EUOF 3D25B 3GSQB 1BVZA 4I2XB 3PQYD 3BH9B 3QA3B 4YE4L 5D7IF 4XNQB 4MAYC 4F9PC 3H0TA 3ARXA 4CL7A 1QFWM 2PYFB 1UM5L 1C7TA 4R2GD 1LO2H 1FYTA 3RZCA 3W5NA 5IB1A 4XBGB 1FFQA 3E6HB 2J1KA 1IGCH 2BSRB 3O2DH 3PP4L 1S7SA 4Z7WA 1KTKE 5FB8B 3S88H 4JZOB 5DHVB 2EIEA 3ARTA 3N0PB 3UTTA 1D9KC 1V5JA 5GJTH 1JBJA 4NQEB 3CDCA 1T3FB 5FOBB 2PW2A 4UUJA 3GO1H 2VLRD 2Z4QA 1AGEB 3MRQB 4U0QB 4HIXL 4G8FA 1QEWA 4OLWH 3ULVC 2ICWB 2DM7A 5I8CA 3HI5L 3TNMB 2DQDL 1KCKA 2FATL 3BUYB 4LCUA 3VG9B 4KJPD 1D6EB 4P2RD 3O9WA 3ROLA 4WW2C 3ARUA 2DMKA 1KG0A 3VXMB 4XHQA 5C8JB 3IFOA 4NKIH 3MFGB 4XC3H 2FSEA 1FYHB 4YC2B 1OLZA 1XF2B 3KXFB 4JRYD 3HLAA 4KJYB 2QR0A 5D7IA 2VR5A 3UBXI 4O02L 3QEQD 4FQQB 4N9GA 4GMSL 5FYLE 3QIWC 1KN2H 3F7VA 2BVOB 1HCVA 1JNNH 1FL5A 1A3LH 2H9GB 5SV4A 3SPVB 1MQKL 1RZGB 3HNSL 3TFKC 5HVWA 4HXBL 1DN0B 4YPJA 3MLXH 1R3LB 2IALB 1C12A 2R0LL 2FEEL 4AQ1B 5A2KH 4QRRA 1IC4H 3SGKC 5AUMB 3BZFB 4K94H 1XZ0A 5EUKB 1T6VN 2NX5D 5ICZB 1OD9A 4YEEA 5FYKE 1ORSB 4OGXL 4DVBB 2FHFA 3FOMA 4NUGH 4ZFGH 5JHDE 2IGFL 3RIFK 1A5FL 2YPVH 2ZSWB 2YS4A 4UAOC 4PJEB 4LBEB 8FABB 1HNFA 5HYEA 3QRFM 4KDTC 1A6ZA 3PQYA 3NCJL 1VFAB 2EXYD 3TIDB 2KL6A 2CIIB 1T66D 4KRPD 4U0RC 1FO0H 3LZFH 5L2JB 1ZA6B 1D5MA 3VDBA 5C0ND 5T33H 3HPJA 4K55A 1A8JH 4OLVH 4JM4L 1T1XB 1JYWA 1V7NL 4AIZB 5I2IB 4Q9BA 1J87A 1ZVYA 4GKSB 4HWEL 4YNYB 4EN3C 2EDLA 1P5UA 3X12A 1CD1A 3TN0B 1AGDB 4FNLL 1XIWC 2W9EH 3B5GA 3W0WD 2XA8L 3A67L 3VXMD 2HTLC 1LE9B 1S9XB 2O5YH 1NCBL 2V6HA 4ONFH 1CN4A 1B4RA 3T3PE 5DFVD 4DGYH 3QUYC 1S8DB 3EO1B 4QRRE 4U1IA 1YYLH 1RU9H 1XF5B 5ACZB 5HVFB 1MI5B 3JWDC 1NBQA 3QEQB 5JDSA 5CLWA 3ECBA 4LSVL 1GL4B 3QIUB 1LP9E 1A21A 3QXAA 4P2RA 3QDMB 1K2DA 1MJ8H 3U30C 1T0MA 5AAMA 5BMFH 2DJUA 5F44A 3P0YL 2X4PB 1HE7A 1IRAY 4ZO9A 3MV9D 2AV7B 4JFEA 5TH2B 1JYXA 2P1YA 1JWMA 2F54B 5IEKB 2EC9U 5E8EB 5IHZB 2DI7A 3AM8A 5EN2A 4UQ3A 2ESVE 3MODL 3S37H 5E1HB 5JMOC 4ORGB 3UZQA 2DICA 4BSVB 4FTVE 4MD5A 4EJ1C 3QDME 4Z7VF 1VKXB 5SWZE 2NY4C 2OX5A 3A0OA 5I1CH 5GGTH 4DJMA 4PRHA 3K81A 3GSRA 4JLRB 4CRPA 3MOBH 1MCJA 5J6HA 4UIKL 5IR1B 3MBEB 3OKEA 2A74A 1JUFA 3W0WA 2E8ZA 3GUTA 2ESVB 3BP4A 1RJZA 2JELL 1T1WB 5TDNB 4NRXB 5FCUH 5IF0B 4XX1E 3EFDL 5DVKA 4ENEC 1G1CA 4EUPH 3N1GC 4X80L 2WBJD 5JHDD 5IMMB 4KAQL 1U8KA 1LO3H 4WU5A 3BRDA 2AJUL 1T5WB 2IFFL 2GK0B 3U7YL 4Y5YA 1JNJA 3RDTC 3MRDB 4MCYB 5TF1L 4PGDA 2YA0A 4CDGC 4F3FB 1CXFA 1MI5D 2V2XB 3B2UD 4I2XA 1GZPB 4H25B 1JTPA 3LPFA 4XXCC 1U6AH 1S5HA 4FXGA 4Q7DA 3SGDH 1DANU 4IIQB 2LTQB 3QDMD 2P24A 4KPHL 2HJFA 4WV1A 3VFUB 4HXBH 1A2YB 5INCB 5EC2A 5JHLH 1JPFA 4HIJA 3H7BB 3T2NL 2ADGB 2I27N 3MV9B 3H9SA 4NZRL 1IE5A 2F54D 3UTTB 1DUYA 3GIVA 1Y6MR 1QP1A 4U6VL 3DRTA 1HEZB 3WHXA 5IOPB 2Z9TA 1YEFH 5E5UB 4ZYKA 3B9VA 3ZTNH 4DAGL 4Y19E 2PW2B 4PJFA 3GNML 4GXUN 5A16A 1IAIL 4LNRB 4YHIB 1SQ2N 3I2CH 2OTUB 5FO8B 5L8LB 1F13A 4FQCL 1LO3L 4Z7UF 2OZ4A 4C4KO 1A4JA 3OKLA 2WIMA 3C6LA 3TNMA 2IAMB 3O4OB 2P44B 5DVLA 5FOJA 1CS6A 3EAKA 3CFIC 5IKCA 4U0RB 4YHOH 2AV1A 2PTUA 4PJ8B 2IQAA 5C8JA 1XGTB 1MIML 3GHEH 1JPSH 5TPWH 3HLAB 2C3HA 3DRQB 4ODBD 4D3CL 2LV4A 4C83B 2GK2A 4UIKH 5CIPA 4A6YH 4A2MA 4OKDA 3M17B 2VZVA 3BEVB 3IXTB 4Y16B 3NPZB 3GK8H 5HGGS 3GGWA 3NCMA 3WFCH 5IB3A 5IMLA 3NVQA 1T22A 3IDMB 2FX7H 3K74B 1F00I 1Z9OA 3FQNA 1F4WH 1F6LL 4HW6A 4MQTB 3LQZA 5KVFL 4H1LA 4XBPB 3IDJA 1C12B 1H5BB 4XPBL 5HYSB 5AWNH 2VDOL 3S35H 4HKBA 1A47A 5DVMA 2NY4D 5LBSH 3BSZL 3DLQR 1FFOA 4RGMB 1EH9A 1ORSA 5CBEB 1OD7A 4J7RA 2QADD 4P4KC 5L0QB 1IQDB 4EEEA 4R4ND 4WDIA 3NCYS 2NX5E 4P23C 2GYSA 5T1DH 1MFAL 4QHKI 3GHBL 4KK8C 4ZOAA 3TA3A 4LSSH 4LL9A 3KYMA 2ARWA 5FHAL 1KBGL 1NMAL 2YN5A 4PRDB 4PLJC 3ULSA 3F65A 5FGBC 3BPLB 1VFAA 1MNUL 1G0DA 3BGMA 2BSSA 3WO3B 1I8KA 1JGDA 5BJTB 4FFZL 3QXTA 4TPRH 1KJVB 3GSVA 1P7KA 3IETB 5T1LB 3OJVC 2O5XL 3P4LA 2CDGB 2IAMD 4JM4H 3MGTB 1N2RA 2VLKD 3CFCL 3ARGD 3DBXA 2XKSA 3WUWB 1OTUC 4ZO7A 3MRLB 3T1FB 1MHEA 4MDIB 5DJZB 1MCWM 1T0NB 4OGZA 3EYVB 4G42B 2JB5L 2R1XA 1FVEA 4F7CB 5A2FA 4MSWA 1OP5H 3CLEL 1CYGA 3TYFA 2XOTA 3JWDL 5KANI 4FXLA 3N1PC 2J8UB 4QCIB 3QG6B 1HXYB 1G7HB 4JFXB 4AMKL 2V7HB 1VFBB 3QIUA 3ALXA 2WM0A 4QHMA 2W65A 4W6XB 5EU6E 5CJXC 4W81A 3QEUB 3FFCA 3T65A 5SX5H 2X4PA 3GMLA 1M7DB 4HK3J 1DBJH 1UWEH 1MOEA 4JO1L 3N9GH 2BNRE 3MCG1 1V3JA 4QRRD 1L7TH 3UZEA 4DGIH 5J13C 1F3DJ 1I8LC 1D5IL 4UT7H 3SKOA 5DQJA 3DIFB 3MV7E 3RWJB 4OZIB 3CFJB 4ODVL 4BSVA 4OSUH 3I2CL 1AHWC 3FT3B 5EORH 2P48B 4NKMA 1UEMA 4D9RE 4Q6YA 3QUKB 4CU8A 4U2ZA 2AS5M 1UM6H 3D3VD 4JLRA 5EOQH 5C0IB 4NRYA 4DEPB 5C0DB 1NFDF 2X4NB 3K0WA 1DQMH 1JK8A 3OKEB 4S1RL 4LLWB 4H88H 1KPRA 4HAGA 5BQ7A 2X41A 1RJZB 1CZ8H 1YY9D 3DX7B 1BAFH 1IAOA 4HFUH 5E6IA 2B20A 1XF3B 5C0RL 3MRMA 4A6YL 4YHZH 1G7LA 1RHHB 3VFRA 3GK8L 1RIHL 5JOFA 1QLEH 2I5YL 4HBCL 1BOYA 3PWNB 1K4DB 3IKCA 4GUPA 5DK3A 1FNSH 4LDOB 1NAMA 1ZKAA 5CMAA 1H3PH 4CMHB 3ARGB 4P46A 1CI5A 1YNLH 4LKXB 2QBWA 4YDLC 5C86A 2EXWD 1RZIA 4HK3N 4NQVA 3VRLF 1RHFA 3B9KC 4YDIL 5KS9F 4JQXA 2ADIB 4HWBA 1DVFD 4Q9RH 2P8MB 3VGBA 2W92A 4C54A 5ESVA 4L1DA 5D4QA 1S5HB 4P99A 1J0ZA 3SDCB 1RQ5A 4KXZH 2DKSA 1WVZA 5AD0A 1NGQL 2R0WL 2K9UA 4WV1B 4CW1B 1PKQE 5DJAB 4ONHA 2YEZB 3QDGB 3KPMA 4P2OB 1JPFB 4FABL 2R15A 3MV9A 2E7CA 3FQWA 5IJVA 3HB3D 4NOBA 3WIIH 3H8NA 4QOKD 3PP3K 3ULVH 4PRHE 1AXIB 1UH2A 2I26N 4K9EC 3U46A 1MLBB 4NO3B 4PTTB 5DF0A 5EOCJ 3RY4A 3Q5TA 1TIUA 2R29H 5A16B 2E6JA 5IFHH 2HVKB 2GSGB 4XNUL 1A7NL 3X13A 1A4JB 3OKLB 5DO2D 2DQEH 3LH2L 4LQFH 4HEME 4OZHB 1EIBA 1K85A 1N3NA 2YA2A 1IAKB 1J8HE 4X98A 1CG9A 1G7IA 1YN6B 3WFEL 4JPWH 1RJLA 1IGTB 1HSBB 1I7TA 1S7WB 4MNGE 4XMKH 2M1KA 2VZ1A 1KPVB 5CEYA 3IF1A 4U1HA 1NMBL 4KMQA 1DVFA 2NXZC 3ILQD 4LCYB 5C0JA 4APQB 5B38B 3S35X 1X4YA 2YUZA 4FQLL 5HBBA 5FCUL 3WS3A 5B39G 1UZ6F 1LEKA 1JGEA 1H8SA 4Y19A 4GAYB 1RU9L 2FIKA 1BOGB 3HTLX 1Z0NA 4M6ML 4U6VH 4DN3L 3C8HA 3EYFA 5ID0B 2YPLA 5INDB 3MFFA 4X7TA 3CDFA 1R24B 4TRPL 2ADFH 2B1AH 1F4YL 5IW1B 4YO0B 5D1QC 3QB7C 4KDWA 1FFNB 1NMCC 3OGOE 1BX2B 4PP1C 4CMMA 1U2HA 8CGTA 5B3JF 4JPKH 2UZYB 2YWZA 3BIKA 4PJ5D 3VXTA 3QAZC 4BFEA 3WEXB 3EO9H 3CVHB 3R1GH 1BIHA 5BW7A 3PJSB 3LQMA 1A6VL 4PRID 5F9OH 4JFPA 1WLHA 1DSFL 1F6AB 2ARJA 3DTXB 1G6RB 2O26U 1CD8A 1ITBB 1OQOA 4ZAKA 3O6FC 3ZKXB 5JZ7C 5SWZD 2P45B 1H3VA 4XI5C 1HN1A 2X42A 3ME0A 2MHAB 1EFXA 1AP2B 2YZ1A 3P73A 1CFNA 3O45A 3L95A 4OCYH 2YD3A 5E2TL 5E2VL 5SX4H 1G9MC 4M8QB 4WNQB 4KUCF 4M4PA 4L4TE 2JF1A 1I8KB 3MA9L 2XQBL 3CMOL 4NUJB 5E8PB 1GHFL 5IJKA 5CINH 5GISH 4WTZG 3FOLB 1EHLH 4DKDC 1LQSR 4MJ5A 2PN5A 2G5BB 5FUCC 4PJCE 5KOVC 3SCMB 5IFAL 1HOCB 4R96B 3ZDZE 1G1YA 1KC5L 3WHE1 2BOCB 1CFQA 3I3BA 2AK4D 2EDNA 1S5IL 1FHGA 3NIDE 4GS7B 4Y4HC 4R4BB 1ND0A 1HHKB 3O4LD 2PXYD 1AHWA 3FQRB 3H2WA 5HI3C 4K71B 4M6MH 3DETD 3VWKD 4MD4B 1CGTA 1MCBA 1KN2L 5CJ8A 5DQ9A 4X99A 5J11C 1M6OA 4UU9B 4M61A 4E42A 4F9PA 2EDKA 1KIUA 3IDYB 3OL2A 4XCYB 3F8UB 3TNNA 1HYSD 1NLDL 2HVJA 5ANME 3JV0A 2F8OA 2GITB 3GBLA 4FQJH 3T65B 3DROB 3DXAD 4YIQA 3MJ6A 3T0DA 3O81A 4HXAH 2NTFA 1E27A 2E7MA 5HXMA 4QXGL 3GI8L 3D18A 4OFPA 3FB6A 2CO7B 4NC1C 4PRPD 5ADPL 2XXMB 1RZ7H 4XRCA 3CDGA 4XCEA 1BWMA 5J57B 4L5FL 5C0AA 5HDQL 5KW9L 2IH3B 5C1MB 2EDDA 4JZNA 4R97B 1FGNH 3FAXA 1RURL 5IV2B 2EIZA 4XHJC 1D5XA 3K8LA 2UY6A 1OTTD 3ZT6A 5BQ7B 3WYRA 4OBRA 4Z7WB 1MIEH 2FD6H 1QSZA 5GS0H 5CZVL 4LPYA 1V8HA 2DRUA 3PGCB 4OLVL 2GAZB 4D0BA 3SEPA 1DBBH 5HHXH 1E4KC 1WBYA 4JZJC 4QHUB 2OL3A 1H3XA 3VXUD 1K6QL 1XMWA 4WY7H 1QNZH 5IFJB 3BW9A 2CXGA 3AFLA 4L4VE 4HS8L 4LVOB 3RVVC 3F62A 4RMVA 2AK4B 1NFIA 3P2TA 2ZUYA 2AEWA 1JJUA 5F1OB 4LK4A 5LCVH 2NXZB 5KVEL 1KG0B 1DBAH 1LEGB 4GBXB 1E4WL 3OXRA 3ARBD 3LH2H 2P5WB 1NANH 2FB4H 2OS7A 5FHBL 5I75B 4C58B 4OFIA 1QLEL 2I5YH 1F8TH 3C9NB 5D8JH 1CXEA 1QSFB 1DBAL 1FZKB 3ARVA 3VU2A 2DM4A 4OD1L 1YYML 2YEZA 5D2LA 1ZLSL 5L9DL 2VYRE 1UKSA 2XZCH 3NAAL 2NNAA 3HNVL 4JJ5A 1D6VH 4KK9C 4YDKL 4M6NL 1RUML 3OKOA 5BXFB 5I8OH 2MQ0A 3CVHL 4PRPB 4G80B 2W07A 4GKZA 2NLJA 1ZWIB 2DBLL 4DKAA 3DX9B 2EDFA 4P5KB 2PETA 1I3RB 2A1WH 3MREA 5CSZA 4O5LL 3PHQB 1JP5A 5GS1C 4OSUL 2VWEE 1QKZH 4KC3B 1B88A 3X13B 2F53B 3AB0C 2Y7QA 4UIMB 2DQUL 4N68A 1JHTA 3BKMH 2A6DA 4J8RB 3RVXC 1P84J 3QHZL 2BRRH 3Q6FB 4ELME 4LBEA 3CIQA 4X6EA 2H2PD 4NFCA 4G6ML 2C1OB 1A6ZB 5EBWA 2P4AB 1S7QA 4HLZG 5F9WC 4Z7VA 5I1KL 1C1EH 3WO4C 4U1JA 3OB0K 4LCYA 5E2UL 5IQ9B 4YBQD 4IOIB 3GJEB 2WBJC 2MQCA 3LHPL 2WSKA 4FTVA 3L1OL 4WEBH 5ABDE 4UTAH 1U3HC 4PLNC 3BWAB 5K59F 1KCUL 3OAYK 2A6JA 2GSIB 2PR4L 4P9HC 3R8QA 1JV5B 1NC2A 1T2JA 3ABZA 3NOIA 2NXZD 3ILQC 5I1LA 3P30H 2HFFA 4X6BA 3V5KB 1PKOA 4RDQF 4LPCA 2X4OB 3ZT7A 2H1PL 3QO0A 2P5WD 3JV6A 3ARQA 2VTFA 4KHTL 1JHKL 4X5XA 5ICXA 3MQIA 5IB2A 3H3BC 4N90D 4QRTA 4DOHB 4XZUA 5F70A 4TNVF 2M26A 4ELKA 3H9HA 3B5TA 3KYNB 3BKCL 5IVOA 3RNQA 2FJHA 3U6RB 4H8WC 2IWGA 4KKBC 1EFXB 3P73B 1R3KA 3CC5B 2H32B 1U8IA 3VXRD 1WQVT 4M5YH 3SDXF 2G75B 5FAAA 5DK2B 5E8PA 4DTGL 1SY6H 3LMJL 1NUDA 4NQED 3S98A 3P4OB 1J8HA 4J3TA 1MCSA 1WFUA 2UWEA 4MJ5B 1MCQA 1KLUB 3KLAB 5KG9B 1C16A 2DWEB 4DCQA 2VLRB 1TQBC 4FQ1H 1U8QB 1RMFH 3LQAL 4KRNA 3RAJH 4OZFG 4Q6IA 5DD0L 4PRNA 2HTKC 4V1DE 4XWGH 1X4XA 1MEXL 1S3KL 3I50L 1RUPL 3RL1B 3SGJA 4JZJB 4GOSA 4LSRL 2W38A 2LQRA 3U4EB 1EVUA 5I1JL 3OG6B 3WLWC 1RULL 4X99B 4JRYB 2VC2H 3I6GA 2B2XL 3FN3A 4QXTB 3RWDA 3PWPA 4NYLA 3CLFL 1ACYL 1C1EL 1MCHA 2BNRD 1NUFA 2DIBA 1F2XK 4I8DA 2OMNA 4LHUB 4LPTA 1MVUB 2BJML 1AQDB 1U8NB 1N0XH 3MLVH 2BSTA 3FB6B 4OCSH 3G5VA 2AVGA 4NKQB 3F6LA 3MRDA 4MX7B 3CDGB 1CVSC 2RIKA 4R3SB 3ARRA 1NC4D 1CLCA 1Q9OA 3DURA 1WWBX 3X17A 4I3SH 4JO2H 4X8JB 2XWTB 1MWAA 1R0AH 2NX5B 4ZPVA 1N26A 5D9SB 1J0JA 4S2SA 3VGAB 5FKPA 3RVTC 2B4CL 2P5EA 5IBUG 1YNTA 1ETZB 4KY1L 4OZ4A 4PJDF 3DGCR 1U8HA 5EU5A 5EBLA 2A6IA 2AJSH 2ZUWA 4ODHL 2P5EE 2DQEL 3MUGB 4UNVA 3TBTA 2KDGA 2AERT 3ARWA 4XAWH 1HINH 3AS3A 5BRZA 2ERJB 4AEEA 1J18A 4GJTB 4X5WA 3DV4B 2FX9H 5HGBB 4S1QL 4NGHL 4ZYKB 2BDNH 2X4RA 4MWFA 1QFOA 1FCGA 3HR5A 4N90E 5CZKA 3CXHJ 5T5FH 1CXKA 4MAYB 3BW9B 4JVPA 4DQOH 1JZ4A 3MUY1 5DC0A 5SV3A 1A7QH 5DMKA 1QFWI 4OBSA 4FABH 3QUYD 1QBLL 5DQDL 3TN0D 1FVDB 3RGHA 4X6DB 4MCZB 4L29B 2VXVH 2VAAB 3EYOA 4HPOL 2ITCB 3S36X 3U7YH 4QRPA 1RAMA 3AU1B 1JFQL 4YAQB 5GGQL 4HH9B 3FO0L 3DRQA 1SVZA 2BVUA 2VB5A 4ZQKB 2AJXH 3M17A 3S97C 1KXVC 1MCWW 1AO7A 4P9ML 5IBTL 2KZ1B 3QCVL 4OCSL 3RQ3A 1ZSDB 2G5RA 3FCTB 4BFBD 1VEOA 3EJJX 5E9DA 1ZEAL 3RVUD 4LHUD 4YZFE 4YDKH 3VJ6B 3NPSB 5E6ID 4LEOA 5DJCB 3O4LA 4P5KA 4MA7L 5FYJD 1GYAA 1LDPL 5A1AA 4JANA 2FX9L 3WV0A 1QRND 5D7LB 1EEZA 2R69L 3HNTH 1U3HA 2VITB 3DMMA 4DW2H 3WIFA 2A0LC 3CFDA 1MJJA 5HGHB 4PJAF 4ELMF 43C9B 5D1QA 4GRWB 1MFCH 1HWHB 1KB5A 2VKXA 4X5LA 4Z5RA 1MLCB 3BN9C 1HYSC 3WN5B 2YD9A 4JAMA 4ZS7H 4ZUUA 4QRQB 3NACL 1C5DB 4JKMA 4X6EB 1CDGA 1UH4A 4XCCH 1GVIA 5EU3A 3GSWA 5FO7B 2XN9B 3ULSB 4YUEH 4CVZB 3RWFA 5IIEB 5TDOA 3VE0A 2DQCH 2ESVD 1GCFA 7FABH 4PJ7A 2EEDA 1LK2A 4LSVH 4NQXB 4QHNA 1TQBB 3GJEA 2YR3A 1QSED 4MZ2A 1DBBL 2R39A 1P7KB 4JB9L 4KHXL 4NIKB 3FMGH 4DKEL 3X11B 3RTQB 2NCMA 2CDGA 1Z6JT 1SEBB 3C08L 3T4AA 4UAOB 4WUUA 5HPMA 2QKIA 1ROWA 1X3DA 3SGEI 3L3JB 3GKWH 3INUL 5C3TA 3VMNA 2BHYA 5DJZA 2VISA 4BM7A 3OKDB 2VL4A 5GGVL 3JXAA 4H0GA 3PNWA 1QLFB 4KVCL 3HCVA 3VFPA 4MJIA 2NY2C 4LF3A 1QRNA 1V7ML 3EOTH 5CCKL 5F7KC 5HY9B 1OGTA 3BQUC 5FUCE 2GEEA 5GGTA 4E41E 1MRCH 4JR9L 2H26A 1DDHB 3K4AA 4F9LA 2OXHA 2H32A 5E4EC 2WP3T 4O2CA 3LEYL 4GT7A 2X4UA 5CWSB 1C08B 3ESVF 3CCHA 3VGAC 1G7MB 1ADQH 1R5IB 2IQ9H 3ARBC 4U1GC 4OI7A 3X14A 3KLHC 2VXSH 3VFWB 1C16B 1AGFA 3QUZA 4PRBB 3VXPA 3WD5H 3R1GL 3HE7A 2AXGA 2OZ4L 5GZNC 1YEGL 3KNBA 3QIBA 3MLZH 2FGWL 3MRHA 1IGFL 2H6PB 5D2LE 3RL1A 3RGVD 1FBIH 1KPRB 2R23B 1AD0B 4PJ5A 5EC1B 3RHWF 1AQKL 4RZCB 2OL3H 4KMTH 4OCXL 1I9JH 1P4BH 3PXJA 1LO4H 4JPVL 4GMSH 3I3EA 5AWNL 4R90H 4NKDB 43CAA 3WDIA 4P3CH 5C09B 2YK1L 5GRJL 1K4DA 4GUPB 4XP9L 1A02N 3BEWB 1I1AC 5SWSD 4HHAA 1DQQB 4L4TD 3WNKA 1Q1JL 1MFBH 3TESA 4JY4A 1J10A 1JZ5A 3OR7B 4RAVB 3MBEC 1NH6A 2Y9RT 1A1NA 4LQ1A 3I3DA 4FFVD 4I2XE 2QADC 3WXWL 3MJ9L 5T1MA 4NM8H 4N8VA 1P1ZA 1QSEA 4HGWB 3DVFA 4TTDC 5TE4L 1S7TA 3D25A 3GSQA 1AXTL 4X6CF 5IMKB 2Q6WA 2XTJB 5HSFA 4NJAH 4K3EL 4F7PB 2XWTA 4XGZB 4YBLC 1EHNA 4M1CC 3V52L 4DN4H 4L8CB 2R1YA 5EU4A 4AL8H 4S2SB 3RX8A 5HVHC 3GMRB 5DJYA 2B5IB 2OP4H 5MI0B 5DJAA 3D5OF 3QUML 4WWKB 5IROA 1PX4A 5TGBA 4AENB 5F7NC 3T0EB 3G6JA 3SJVB 2KZWA 2XRAL 4R4FH 3PQYE 3N85L 3S4SA 4EDWL 2HRPL 5KVMC 4KQ3H 3QPQD 4KK5C 5AZ2L 2APVA 1F42A 5T1LD 3NCBB 3BYYA 5LGHH 5C7XL 5DMKB 2QQNH 1F3RB 3UX9B 4XVUC 4N8VG 1N3NB 1EV2E 1ZLUH 3W81A 1NAKH 2VLKB 1F2QA 4RFOL 1Q72L 3EHBD 4O51A 3KG5A 3QNZB 1LD9A 3PV6A 1K8IB 4ENED 1FE8H 1XR8A 4F7MA 1WUNT 2ZUQC 4HJGA 1VPOH 1VESA 3V5DA 4OFYD 1BMGA 3EJYC 1YQVH 1NL0H 4J1UB 4X4XB 1CFSA 2CDEB 1J05B 4JFFD 3QUXC 3ULUL 4OZGE 4TUKL 3C8KA 3AS0A 5BO1H 3BZEA 4H1LG 4HUWB 3OHXB 4YFLI 1OP3K 2PKDA 5DSCA 3SDXB 1VFMA 4PJ8C 2NY5C 1OLLA 1P7QA 2AJVH 2DQFA 4QRRB 4G7YL 4OAWA 1BM3L 1A7OH 3VXUA 1DL7H 5I17B 2J8UF 4XP1H 2F5AH 1IM9A 2EYSB 4GSDH 2H41A 3ZKND 4L4TA 5I73B 5JXED 1EPFA 1NMCB 5FUZH 4ZFZB 5CFHA 3PWPD 5E4EB 4K7PX 4WFED 1NCCL 1G6VK 5E94A 1A9BB 3D3VB 1XIWA 2R56H 4XB8A 3ARBA 3TCLA 3MNVB 1UJ3B 4YHLH 4TNWK 5IIEA 1T7WA 4NNYB 3GHBH 4U1GB 4GRWE 1Z9SA 3H9YA 5TQ0H 4R7NA 3VI3E 2CKBA 1UB5B 5C2BH 1KXQE 3BPOC 1EMTL 1TTUA 4JE4B 4KZEH 5HHNA 4F80A 5H94B 4YNYA 3T0XA 3STZB 2NY1B 3SE8L 3UMTA 3EYSH 4WUUB 1MJ8L 1ZHNA 2WIIB 4NQCA 4JFDA 1KJ2L 5FK9B 1OAUL 1YEDB 2P7TA 4MLSA 1JN6B 3OX8B 2Y6SC 4HUKB 2AI0H 4OZFH 4JPVH 1G7JB 3O6FD 2EEBA 1CXLA 1MY5A 1DLFL 4HWBL 3Q48A 1RFDL 4JFHE 2DWDA 5LXGL 5IGXL 1I1AB 5F1IB 3W39B 5KSAC 2CKBL 5CHNB 1AFVH 3KXFE 3QIBC 4JY6A 5FYJE 3PG2A 2OLDA 3CSYB 3F7QA 4G9DA 2AXHA 3RKDC 1ZHBB 5GSVA 1BQSA 3T0EE 3OKMA 3QWRD 5ECJE 2NTFB 1T7XA 2E9BA 4QRSB 3SGEH 2WNGA 3QISA 1T2XA 3MO1B 2F19H 4WW2F 2DLFL 1JWUA 4KUZH 3KYAA 3K2MC 5HVHB 3D87B 4N0UE 4NKOB 4JFFA 2DLEA 3TBVA 2FZ3A 4NM4H 5I71C 4GG8B 4LLAA 5C0AB 2P8LA 1OGAB 1T1YA 1YMHA 2YKLL 4I0PB 4OJFH 3VFNA 1ZE3C 2F58L 2VLLB 3TIEB 1Q38A 3DO7A 1ULVA 3MV9E 3S3JA 5A3IC 5CILL 1RJYA 2FGZA 5DURB 1TQCB 1M05A 1OT1A 2R0ZH 2DD8H 1XF4A 1DCLA 5ISZE 2Q87A 5D96C 1FZJA 1UVQB 4JG0L 4NKDA 2WUCL 2OL3B 5DJ8A 1I85A 1YYMH 4BK4A 3B3IA 3Q5OA 4K3HA 1IM3A 4HF5H 4KROC 4KMLB 4OF8A 4PJAA 3ARFD 1G9NC 4JY4B 4ZPTB 1DLHA 3VCLB 2LABA 4ODHH 4L8DA 2ICCA 3QCVH 2GIYA 4ZNEA 3TFKD 3QFJB 2DQTH 4GG6B 1CLZL 2HLAA 1S7TB 4LASL 1N5AB 1LEGA 4AY0A 2V2XA 5CSGA 4R4NC 2ZNWA 3UTOA 5BOPA 1BZ9A 4WTWA 1CWVA 3P9WB 2V7NB 1S7UA 4IIQA 3U82B 5DJYB 3WKMH 4CADA 5FA4B 4WU7A 3GNMH 3KPQA 5J06A 4PLJD 2C1PA 4WWKA 2E7HA 1OSZA 2R2BB 3S35L 35C8L 4NN6C 3H6JA 4X6DE 3V6OE 5I75C 2NNAB 1Z3GL 3KPSB 4AENA 4KKAC 1Q94B 4MGXA 4NWUH 4O9HH 1LP9B 2IH1A 5HDLA 4NO2A 4NQSB 3QSKB 3G6JB 4G43B 4RMSA 1AR2A 1H9VA 3DRTB 4FOMA 5IOPA 1NEZG 4IIQC 2KQMA 1NEZA 4L9LA 5E00A 3W9EA 1SYSA 1U95B 3KPRD 3ULVL 4LNRA 4YHIA 3FKUS 4AK1A 5ESAA 4I0PD 1TVHB 2WV3A 4LLDA 1A7BA 1OTUD 1CGUA 2R0ZL 3SCMD 1MWAL 3UYRH 5C2UB 1I7RB 1YC8A 1UACH 2DBJA 5KVDL 3RA7L 1JF5A 1FZMB 1UH3A 4YJZL 5KSUB 5F6HI 1EZVY 1NFDE 1A7PH 4JN1L 4KV5F 5D7JC 3RNKB 2V5YA 1UM6L 2AQ3A 4LMQE 2IQAB 4YK4C 3QNZA 3MNWB 3KWWA 3I75B 1IZKA 2C1OA 2QV2A 2BOBB 4TULH 1FSKB 1KIQA 1F97A 4BUGA 3IGAB 3FRPG 3D69A 4LLMA 3IRZA 4JGJA 1CLYL 3DARA 1G7PA 3VFVB 3CVIL 4MB3A 5IVZA 4HKJA 1UQSA 4EOWL 1BZ7A 1FVCA 5IMLB 5E56A 5A3ID 5H35B 4LCCA 4HZLA 4WGVB 4JO1H 2VDML 4HUWA 5CEZL 1NC2B 2YC1B 1ZLWK 3SDXA 2EDEA 5DSCB 2WBWB 2YUVA 4JM2C 4X6BB 3D2UD 3LAFA 2X4OA 5JIPA 1KTDA 2K1MA 2AGJL 4XPAH 4AEFA 2AXFB 3QBTB 4HK0B 4KKBD 5IW6A 1FFOB 5DC9B 4EZMA 3GMOA 1F02I 1CR9H 2X7LB 3RX5A 4CVXA 1H8NA 1L7IH 4JQIH 3GSOB 4NQDA 2H2PC 1ONQA 1GIGL 1A9BA 1B4JH 3CSGA 2B0SL 4PJXA 4OI9A 2YBRA 2B1HH 4YFEA 5CBAA 2RAMA 4D0DA 2F8XC 3WKNA 5I71B 5F1NA 3QZWB 2YPVL 3GZKA 4NCC2 5DYOA 2B1HL 4OV5A 4OZIE 3KJ6H 4PJCA 2PO6A 1AIFB 1JZ6A 1JPTH 3RI5K 5DR5H 2L7JA 3HI1B 3G5ZB 3IETA 5CCKH 5DUPH 2UWEB 4N5ED 1VHPA 1IZJA 2OL3L 4P2QB 4Z0XA 2CMRL 4F9LC 4O2EA 3MLSL 3TO4B 2VLJA 4I18B 3ZYOA 3BQUA 5JR1H 2FGWH 5D1ZA 4LARH 3QPQC 2R4RH 1JF1A 1L6ZA 1B0RA 3BD4A 3HUJB 1BFVL 2R1XB 3HRPA 1OL0A 3ILPB 1XGRA 2LU7A 4NPYA 3LD8B 4PS4H 2AI0L 1CIDA 4P4KD 3UTPD 3D85D 3RVWC 1IEAB 3QQ4B 2IEPA 4XWOC 5C0BE 3GMPB 1JYVA 1WZKA 4RSVA 3ROOA 3F5WB 3LEYH 5C0FB 4X7CC 1FYTE 1X5LA 5KVFH 4WUKL 1NC2D 4IOFD 4UTBL 3U7AA 2Y4SA 4QRSA 4XCCL 3CX5J 4XMKL 2IPKA 5DUBB 5B4MC 1U0QA 1DTUA 3ARDA 1M71A 4PJEF 1RK0A 1N4XH 4F2MA 3ARPA 2XNAA 4FQHB 4JFYB 4YDJB 4BH7B 3C87A 4DTGH 2NY0D 5D2NA 3BH9A 3QA3A 4JKKA 3SY0A 3IDYC 5JO5B 5LAXB 4ERSH 4M8VA 1UYWL 1A7RH 1F3JA 2F53D 2KH2B 2PUQT 5IUSA 1A1MA 4MDJA 4YDVA 3U36A 4XPHL 3AC0A 4N8PA 5EBLB 1FIGH 3OKNA 1OWWA 2ZSVA 5C7XH 2P47B 5LGHL 5E99H 5HHPA 3HI6H 4WUUE 4TSBL 1IAOB 5L8KB 4CDHA 3DYOA 3OR6B 5K33A 5IG7B 4Q9CA 4KRMB 3A6CH 1EGJH 3DECA 1NGYA 1JYNA 4MAYA 4A6YB 4GLRI 4Z9KB 4PIRF 4FXKA 3T0VA 3MRQA 2DQGH 5D7JB 1BBJB 4YUEL 1QEWB 1C5BH 5MEOA 1YN7B 5D1XD 5BV7L 3T2QA 4RAHA 2GT9B 2VAAA 5EBMA 4YQXL 3I6KB 1IEBB 1MRDL 1JPSL 3JTTA 3VFTB 3G9AB 1ZTXH 3ULUE 3QUZD 5M7QA 3CK0H 3ARGC 3MLPA 5BS0E 3Q5YA 4R0LB 4EI5D 2VLJD 5C08A 4W6YB 4FQQA 5C09E 3BMVA 3QDGA 1OSZB 2R2BA 1CU4L 3MNZB 4UT6L 5ERWA 3DSNA 4LSTH 4HUVB 3NZ8A 1YMME 2A9NL 1RSFA 3RZCC 4YZFF 4AT6A 2CUHA 4O9HL 2NYYD 5AZ2H 5DK0B 4KVNH 5CAYB 1SVCP 2GI7A 2FH8A 3CJJA 4H5SB 3MJ9A 4A2LA 1U95A 1EXUB 4PG9B 3WKML 3BUTA 1IC1A 1HKLH 2COQA 3MGOA 2VWEC 1A4KB 1FBIL 2H32H 2RBLA 1KB5B 4PRHD 1SJXA 3MLRL 4KJWC 4JPIA 1FZOA 4M5ZH 1CL7I 1RURH 4P3DB 5E8NB 3SKMB 2EEAA 2OR9H 2BOBA 3GSNA 5TFSL 4GAGH 5GRUL 2HN7B 2CIIA 1WV7T 3AROA 1ZTXL 3KPSE 4LCWE 5TF0A 1I3VA 5CGMA 1LK2B 3RPKA 3HG1D 4G6KH 1NSNH 5C71A 4PY7A 4PY8I 2FIKB 1NBZB 3C60D 4XC1H 3QI9C 3OAZK 4F15C 3S96A 5IGXH 3X12B 5C6WH 1T83A 4KKLD 3IRPX 5F3HB 4NCC1 4NN7B 2PYEA 1LWRA 4HK0A 1A6UH 2V2TA 3RTQC 3GMOB 3WO4B 5CJXA 1LK3H 2W1NA 3PNWB 2RCSH 3JVGC 1A6VH 4EI5B 5JXAL 2XZZA 3IDUA 5I6XB 5E2JA 1JGLH 4FHBD 1AO7D 2O5YL 5GRZA 1Z0MA 3ECBB 1PD6A 1K8DA 4PJ9C 1MREH 3UPRA 2X40A 4Q6IC 3QRGH 1FFPB 2VDPL 4RBPK 1I1YB 1CE6B 4WEMB 3V4VH 4D0DB 1ZT4A 1DQLH 4XWOD 4K8RH 1A3RL 4JG1L 4KDVA 1EHLL 4LLUB 1AIFA 2ZUTA 4NO5A 3KJ6L 3HI1A 4KKAD 2J12B 2Q8AL 4DZ8B 2CKBH 2G5BA 4LLYA 1ZGLA 2P42B 4ZXBA 4JY5H 2Z31B 3E6FA 4PRHB 4YXKH 5IP4A 1W0YT 3ARFC 3GJFH 1A7PL 5J6HB 3MRHB 3O3BA 1WICA 2X4TB 4KJQC 4TUOB 4XNMB 2W0LA 3EZ8A 2FIRT 4G8GB 3MRCB 4HCRH 1H3TA 2SEBB 4MMXC 5E5MB 4R9HA 5EBGA 3SCMC 2ADJB 3QO1B 1FNFA 3TBSA 5D2LF 4J12A 4XCFL 4KGJA 2HT2C 4ZOEA 1E4JA 1M6OB 4UU9A 1GJIA 4HQQL 3OF6D 4MD0A 1PW3A 4PRAB 3QULB 5JTWA 5CJQH 3QDJE 1KNOB 1KPUB 3NIFE 1XIWD 4NO0B 5DEGB 5FYKH 3WDJA 4GW4B 5J12C 4WU5B 2QLVB 4PJGB 1WZ1H 4HZAA 2Q86A 3O9WD 1XF1A 5F89A 2CDFA 5H37H 1VENA 2VOTA 3RU8L 3T09A 4LP5A 4OF3A 5HGDB 3U7WL 4TQEH 5IESH 3WXVL 1UM4L 4FQHA 3GMQA 1KJ2A 4O02H 5GS0C 1N8ZA 4G5ZL 4BH8A 4QRUA 3CVIH 3LRSA 3V0VA 4ZNEE 4PJ7F 2XG4A 3PWUA 5EB9A 3V6BR 4X0KA 2IPTH 1NANI 4FQCH 3MRBB 5E24E 4RMRA 4KHTH 1Q0XH 1UB6A 4MA8H 5AYUL 2EC8A 2HT3C 2B4CC 4X7SH 4XMPH 4OLXH 5BV7B 4NBZB 2J5LC 3CXDL 3P77B 3H7BA 1WBZA 4TVSa 1OSPL 3HAEB 3AMLA 1KCVL 1IT9H 3RA7H 3FO2B 3EDJA 3QHFL 4WW2B 1KTRL 5J1TC 3LHPH 4WEBL 3MJ8B 5HJ3B 1YQVL 4KK6D 4BSJA 1BD2A 3NA9L 1ZS8B 4G9FE 2YRLA 5C0RH 4MQ7B 3F12A 1JRHI 2J7LA 3AMKA 2AP2A 5DRXB 2BRQA 2GUOB 1EX0A 4OCWL 4J6RL 4K07A 1YN7A 3H9SE 1PYWB 4TRPH 2FO4A 2GJZB 3H42L 1FN4A 4P9MH 4TVPD 4JEGB 4EOWH 1OT2A 4PJ8A 2EIDA 4O51B 3MV11 4EI6A 3EFFA 1HHIA 1J88A 1K3IA 3FO9A 2BXYA 4UDTB 4FMFA 3O3DB 1YJDH 5T3ZH 5D6DC 1CLZH 3BEVA 3IXTA 4ISVA 3U9PL 4UQ2A 2EDXA 2HYMA 4OLZH 1YNLL 5BS0D 5K9QI 3C8KB 5LQBL 3QQ9C 3IDMA 3BZEB 1DBKL 4AT6B 4HF5L 3I6LD 5KSVB 3CLFH 1ZVHA 5T5FL 2HJKA 1A1OA 5FYLH 5DGRA 1P7QB 2CK0H 3GI9L 3S9DB 1I3RA 5I6XC 1G6RH 4GMTL 4OAWB 3UPCA 4PLOB 1Y0LA 5E70A 5A2LH 5J9PA 4WO4A 5EOTA 4PJBA 5FGCE 4IM8A 5C07E 2BVPB 3BAEL 3F7YB 1E4WH 3O8XD 1BREA 5M95B 4KI5C 2Z93B 3ZDXE 4PB0L 4HIHB 3HMXA 3BO8A 3QG7H 1XCTB 3QUXA 1QA9B 2IPTL 4WIQA 3MLWH 4CNIA 5F7MC 3EJYD 1IBGL 4Z7WF 3RGVB 4MA8L 3QP3A 4X4YB 3HI6L 2BSSB 1M4KA 1J1OL 5K59E 1RZFH 4PD4J 4R7NB 1KLGB 3UC0L 5JMRA 3TO2A 1FG2B 4NN5B 2ZOLA 1YEJL 3VFOA 2AQ1A 3NABH 3TVMB 1W8OA 3SGJC 4JFEE 1YEEL 1JGVL 3K2UL 3LKNB 3BKYH 3QIUC 3BPCA 3D0VB 4ODUB 3NH7L 3LIZL 1EAPB 1KCSH 3WUWA 2OI9C 3UROR 4AMKH 3V4VL 3IJYA 4QRPE 5TJWK 2V17H 1MCFA 3EYVA 3GBML 2D7OA 2D31B 5IB2B 5C08D 1KV3A 3SBWC 3A6OA 4F33A 5F9DC 3P3YA 3MODH 2D9QB 2W65B 1NGZB 4L3EE 1IAMA 4U6TA 1GHFH 3LEXA 3VH8G 4BFIB 5LJYH 2ICWI 4XPBH 1DQML 2P49B 3IU4H 4LCWB 5HI4C 5FKAA 1ZT4B 5GSVB 1NCWH 1KEMH 4PGCA 2FR4B 4TNWF 4HCRA 3BP5A 1SJEA 3MXVH 1W2KT 4NZDA 1JWUB 3SDYL 4ZO8A 5EO9B 3SKOB 2MJWA 3O6KL 4OZIA 3UBXB 4GG8A 3GSUB 3O8XB 3SDDC 2F8VA 4GRLB 2KKQA 3FJTA 3L3GB 1GZQA 4X4ZA 4PJAE 2Y36L 3BHBA 4K8RC 5E8OA 3IDIB 3NN8A 1JPGA 4YHLL 3EOBB 4K7PL 1CGVA 1Q9KA 4MYWB 1NAKL 4PJFF 4XP5L 1R3HA 2R0LH 1NGWA 4Q9QH 2W0KA 2OMBA 5I30H 4YFDB 2IJ0C 4OF5A 3BKCH 4QRPD 1TZHB 5F8RC 3RP1A 1RZ8B 4OD2A 4L8BB 2EDRA 1HZHL 3QO1A 2NYYC 3RDTB 2ORBH 1FL6B 3WMSA 3MRMB 1OPGH 2AEQH 2UV3A 3VH8A 4LKCA 1RI8A 5D71L 4S10A 4MXVE 1NDGA 3C5SB 4PR5B 4YWGH 1KPUA 5J8OA 4HIEB 2VZ3A 3G04B 1IM3B 1FNGB 3DVGA 1P84K 2WANA 4KTEL 1E28B 3P0VL 4WHTA 1EERB 1FPTH 1J12A 4LHUA 3HE6B 3QUMA 1D5ZB 1FLTX 3G5VB 1UXWB 3EHBC 3LDBC 2UZIH 4GG6A 1VGEH 2ADIA 1N5AA 3QXWA 3LKSB 5IHLB 4DW2L 4XNQA 3O6MH 5K9QG 4X0KB 3SDAD 3HZKB 3C5ZC 4P2QE 2V7NA 4IRSB 4Y1AE 4CADB 1KTLA 4LAJH 1ZLVH 1U8PB 1VEMA 4OZ4B 4M62H 3U2SB 1XGQA 4ONHB 3ZYZA 1JNHB 1QBMH 2DQUH 3G08A 5DTFB 4ZTPH 1WBXB 4YGVB 2VXUH 5E95B 1Q94A 1U91B 4NQSA 3OKKA 5T3ZL 4M02A 2ICEB 4FMKA 5I9QB 1ZEAH 2NPLX 1WZMA 2QQNL 1J8KA 4TULL 5JORB 1KF9B 2HWZL 2VDNH 3U83A 4Q97A 1MLBA 4P2CG 3IAGC 3VXSD 4R4FL 3DUSB 4NQCE 1H15A 4NDMA 2HVKA 3E8UL 2GCYB 2OBGA 1DP0A 4RBPH 5HHOA 4LLVB 4F7TB 4N0YL 3WNPA 2R8SH 4HMCA 4WGWB 2BZDA 3AAZB 5F97E 3ZZ1A 1FN4B 2VXVL 5EZLA 4L29A 5CD5C 5DUMH 5BVJB 5DVOA 4QRPB 4Z7QF 3ULUH 5EIIB 2J88H 1RJLB 3AREA 1GGTA 2FEEI 3LCYA 2EYRA 3B9KA 1WISA 1A7QL 3BE1H 4G8IB 1KPVA 5CEYB 4TSCL 1INQB 5KVEH 4NNXB 4APQA 1IQWL 3WS3B 4H1LH 4L3EB 3SDAA 5HD8C 1JGEB 5L2KA 3C6LC 5EZIL 4QXGH 5E0QA 2H9GA 4GH7B 3SPVA 3MRRA 5E9DB 2KUTA 4HZLB 3L5IA 4N5UA 2GFBB 4U7MA 1NAML 1CGXA 4LEOB 5DJCA 4IS6A 3W2DL 2CRIA 4NCDA 1TJHH 4RWYH 1AKJD 4XVSL 1Y0LB 1QFUH 3MOQA 5EOTB 5I1HL 3AGVA 3CFDB 1KIPA 3U0TA 2ARJB 3DTXA 5GGSA 3CH8A 4EN3B 1OGAD 4PB9L 2FD6L 5GS0L 3MLYL 4M43H 3CU7A 3L6FB 1A0QL 4HG4K 4RGNC 5JHLL 4PJXB 5CBAB 4CNIB 3WD5L 5B8CB 3MYZA 3T04D 3VMPA 5ENWA 2VXSL 3RL2A 2FRGP 3QZWA 1K3ZA 2IADA 1EO7A 2NXYD 4K3EH 5I15L 2PO6B 3ZHKA 1P4IH 1UWGH 4P2QA 3RJDA 5I2IA 4R96A 1RIUH 5I76A 3FHQA 2BOCA 4X6CB 5GS3A 5D7LE 3D0VA 1TFHA 2W0PA 5ADOH 4I4WA 2HA1A 2YSSB 3ULVD 4JJHA 1UJ3C 4K3DH 1NLDH 1A64A 4R4BA 3FQRA 1MFEL 4FQ1L 3NZHL 5JPNA 2A0LD 2A83B 4O2FA 3VFPB 5HYJD 3MLTA 1OAZH 5E9DE 1D9KD 3QQ4A 4Q9QL 1T4KB 3PWPE 1IGJB 4M3KB 4LRIA 3ULVF 1L9NA 1KCSL 3T2OA 1DN2A 1DBKH 2Y36H 2ZCKH 3LN4B 5C07D 3CFBB 5J1SC 4JHZA 2FR4A 1TCRB 2P5WE 3QFDA 2EIBA 4ZAKC 4UDUA 5D70L 2Q3AA 2UYLA 1T5XA 4RX4A 3TLRA 4UQ3B 4IRSC 1ADQL 3JSSA 4XCEB 1AD9B 3N1QC 3TJHC 2FCBA 2VRAA 5CD3B 5J3HD 3GB7B 1WTGT 4OUUB 3GSUA 5FUOL 3NCFB 3EYSL 1VKXA 4PRBA 4WI4A 3EOAB 1WF5A 2H8PB 1UENA 1E6OL 4FZ8L 5HYFA 4HBQA 4L3AA 4WI3A 1J5OL 5GGVY 2M8XA 2X4SB 2HTLD 4KFZC 5EPMB 2GHWB 3G6JF 2A74B 1CFBA 1JUFB 1AD0A 4G6FD 2ZSVB 4J6RH 1T03L 5FEBA 4XP4H 1HHJB 3MGAA 3O3UN 2DN7A 2ED8A 3SO3C 5L7XL 2ENSA 2FNBA 2NY6D 3CNKA 3FQUA 3HE7C 3EO9L 1B3JA 3C5SA 4M5ZL 4OTXH 3BH8B 2YRZA 2MMXA 4XPAL 1FNGA 1UEYA 1X5JA 5DLMH 3CZJA 4LIQL 2QQLL 3HG1E 4J4PA 3BKYL 3PGDB 5EFIB 4BK5A 1NFIB 4K23H 1F4YH 1G0XA 1WT5C 3IDNB 2PXYC 2X09A 1F4XH 2DQHH 2FWOB 4N5EC 1I85C 3QUMB 2H2SD 3LRHA 4OQTA 5T1MB 2BMKB 1A7OL 4MCYA 4OUOA 4HGWA 5SWSE 5J89A 4RWHA 4P5TC 2C3VA 3U4BH 4W6WB 4F7PA 3D1MC 5DMYA 5GPRA 1YECH 4RQQB 1D9KB 4QTHB 4C56E 1QPXA 5KBNC 1T21B 2HJFB 1RK1A 1QUNA 1JNHA 1FL3A 1ORQB 2RFXB 4PGEB 4X6FB 1EA9C 5EZJA 4HIJB 1JWSB 1WBXA 2C26A 3TPUA 3SDXE 5I66B 4G7VH 2QSTA 4E5XA 1TITA 3E3QC 3S4SB 2B5IC 3OF6A 1XAUA 1MCNA 4N0UA 4L8SB 2E27H 1FCCA 3PHQA 1GC1H 1X5KA 3PIQB 4PG2A 1QOKA 4S1QH 3SGDI 4F7TA 5TDPB 5T1KB 5IQ7H 4YHPB 3TEUA 2AABH 3ZKMD 3BDYH 1IGCL 3O41A 3AAZA 2DQGL 3Q3GA 3MMEA 1F58L 2Y5TA 2B7DT 3OGCB 3H9ZA 1FNLA 2EYTA 1PKQB 1FZOB 3N1MC 2AV1B 2OTPA 1LD9B 3PV6B 2HFTA 4Z78B 4U1SA 5FA3A 1S7QB 3IJHA 3WLWD 1FAKT 5F88B 4NM4L 3U4AA 4NNPH 2QSCL 1BQLH 2X9XA 1OAQL 2YK1H 2ATPA 4P4KB 3LN5B 3D85B 3PABA 3WNOA 5EU6B 3TWCH 3DMMC 5L2KB 4Q9RL 4V1DB 3H3KA 4Y8DC 2FATH 2V5MA 3FQNB 4NZRH 5MERA 1BIIB 1CDBA 3VD4A 3BPLC 1JNLH 5HYJE 5FECB 1AXTH 2DQFB 2N1KA 3QI9B 2ZUUA 4JG0H 5ICXB 3H3PH 5DEFB 1IC5H 3PWLB 5E2WL 4XCFH 2Q76A 4XZUB 1MY7A 3PL6B 4RNRA 2EKSB 4ELKB 1CZ8L 1A6UL 1OSPH 3UYPA 3FB8B 4UMGA 3FQXB 1YY8A 3KDMA 1F6FB 3P0GB 3KYMB 5DD3H 4IHOA 1OPGL 5ADOL 5ETUA 1UCBH 5E2TH 3OKYA 5JNYB 4MAUH 5D6CB 4MNHA 5JUEH 4KQ4L 3IVKB 2EO1A 4KROD 1N5YH 3L1OH 5CGYD 2DLFH 4XP5H 3LKQA 3U0WL 4UT7L 2VABA 4ALAL 3B9DA 5ISZA 3O6LH 1YYLL 4ZOBA 3WFDL 1U8QA 1B90A 2JIXA 4FG6C 4I4WB 4PRNB 3LKPB 1XGPA 5C70A 1DFBL 1EHAA 5F6IB 4P49A 4PBVC 5M94B 1F90L 2ZWLT 3B9KD 2OTWB 4JRXE 3SE3C 1T0NA 4M6AA 4JZJA 4G8GA 2K7QA 3C08H 1FVEB 2R0KL 4E0RA 4Y4KC 4WRLA 1Q9LB 2AJ3A 5HGAB 5E5MA 4HQQH 4QEGA 2DTML 5DJXB 4HT1L 1OAKL 5HPOA 3VXSA 1UA6L 1DL7L 1I7UB 3MLTB 4HV8A 4NRZA 5L2KD 1SJHB 1VFBA 1OAYL 4LSRH 1X44A 4QHMB 3TBWB 3CFEB 3CX2A 3FRUA 4KK8D 3RWDB 1ZMYA 5F7EL 1QFUL 3MTRA 2X9WA 3RFZC 1TNMA 3MRFA 4EKXA 3P11L 1RMFL 2Q86B 2CDFB 3FN0L 1MCLA 5F9JA 5C9JA 3ARED 5KSAB 1A6TA 5GGVH 5CP3H 1NL0L 4NKOA 4IRJC 4BYHA 4G3YL 4BH8B 3GFUA 3EJZC 4NT6A 4PJ7E 5F9OL 4ZFOL 1X5XA 2CJUH 4X9GA 4MNQA 2AXJA 3TJEL 3FFDB 4JM2F 1CFTA 4Y89A 1FYTB 1YNTB 5FHAH 3FQTB 1AGBA 2G2RB 4LVOC 2QTEA 1S7RA 4ZDHB 1C5BL 4JZOA 5DHVA 5ALBL 2F5AL 5DT1L 2FH6A 1UWXK 2E3VA 1ACZA 2XFXB 2VR9A 1RHHA 4P5TA 4U1LA 4FN0A 5IBTH 3BH8A 2EZ0D 2AQ2A 3V4PH 2H3NB 4ZFOA 2FJFB 1F58H 1RUAH 2V2WA 1IL1A 3VG0L 1BP3B 1RUQL 4PJAB 3DI3B 3BAEH 3LV3A 2W0FB 1DZBA 3OB8A 4ZTPL 1QTYT 2QQLH 3AXLB 3OBAA 1F45A 2A6KB 3QCUH 4ODTL 5C0AE 4D8PA 4LASH 2V9RA 1ZLSH 1Z9MA 5I1DA 4MCZA 3V6OA 2HFEB 4QOKE 5EZIH 1NBVL 1CIUA 4WFFD 2CLRA 3I85A 1HYRC 4YAQA 2YHGA 3C6SB 5CGYC 5C0CE 4HH9A 1HHIB 3IXAA 3LKOA 4MA1C 3BX7C 5AAWA 3EDFA 4RQQA 1ZHKA 4O4YH 5LGKA 3SDCA 5IVXB 1F8TL 5D8JL 1WIUA 1ZLUK 3WFZA 2E7LC 1VGEL 5DZNA 5ITBL 4CW1A 4OLZL 4KXZI 1WWAX 1AO7B 2EE9A 3HC3L 3VXOB 1SYVB 3ZSSA 4OLYL 3VDAA 5FFLA 4MNQD 4RRPG 5FM8A 3MUHL 3G5XA 3E3QE 3KPSA 1CVRA 1NBYA 3V8CA 2D9CA 4ZSOA 1HI6B 4TN9A 2I60H 5KSVA 4FZEH 5SWQA 4X9FA 4OM1L 3EJZD 1AGEA 4U1NB 4NO3A 5I8KL 3LKRA 4XPTH 1YEFL 3TV3L 4I5BB 4EXKA 1VA9A 1V3MA 4OM1H 1MUJA 4Y7MA 1D6EA 2DTMH 3QIUD 1J1XH 2BNQA 1SBSL 1FYTD 5HGHA 5D1QB 1WEJL 1AQKH 3TT3H 1A14L 2FHBA 2D0FA 1XF2A 3P4NB 2OJEB 4ONGH 4Y88A 4PJEA 2HKFH 4DVRL 8FABA 4RAUA 1HSBA 3UJIL 2VLKE 3ARZA 3DJ9A 3PQYB 1PG7L 3KPRE 5F3BA 5E03A 3VE0B 2CRYA 4HJJH 5F88A 2Z35A 3PXHA 4PRIE 4IOSD 4RRPA 3CFKA 1CDJA 4X7FC 3QDGE 2ZOLB 1W72L 3WHE0 3VFOB 4U05A 1BOGA 3RGVC 1R3LA 3RHWK 4J4PD 4AIZA 4ONOA 4XHJD 4JHWL 4AM0A 1LO5A 1O5DT 1YMMD 3FT4A 5DHYB 5DRNA 2JB5H 3T4AB 1FFNA 1TXKA 3TT1H 2XTJE 3L3JA 4P23B 5MHSE 4DKFL 1RZKL 1IKFH 2WWMC 5DD0H 3VXTB 4HSQA 4GW1A 3FOMB 1XF5A 5JDSB 4F33B 1WITA 4V2CB 5ITFA 3PL6A 1KN4L 4RNRB 1GRWA 2LVCA 3V7AE 3TZVB 3FQXA 1ZHLB 4P2RB 3DV6B 4HAFA 1NLBL 2A38A 5B4MD 4DGIL 1YEIH 1CDHA 1MF2L 2B2XH 5FKAB 4HS3B 3EYUL 4IHOB 4BSWB 4Y4HA 4M00A 2JJWA 5E5RB 2WK2A 4S0SD 4JFEB 1F4HA 4OV6F 5DZLA 1QD0A 3IS0X 1ZT1A 1DEEB 5EN2B 3FOLA 3FMGL 4HX1B 3B83A 4Y5XA 1Q8MA 3HZMB 3REWA 3ES6B 3CPLA 3ZDZF 1U8MB 3L3GA 3P0YH 3TO4A 1ZOXA 4HDIA 3TH3T 2IG2H 5CP7A 3IDIA 2JTDA 1XGPB 4Y2OA 1KACB 1IBGH 3KNBB 3QUXD 5IT2H 4KZEL 2L4OA 2IGFH 1FLRL 4PUBH 3QEQA 1B0RB 1AKJA 1XCQA 2X70B 5IK3B 4YHML 4Z7NF 1NGXB 2LU3A 1PFCA 5TQ0L 2ATKA 4L8BA 3BZ4B 2X1PA 3L7FB 4MD4A 4YXHL 2A73B 3QEHA 1GC1L 12E8H 2JCCF 2EH7L 4ZS6D 5F96H 5J13B 5EH1A 1OCWH 2XA8H 3C8DA 3WE6A 4S1SL 1DBMH 2J88L 5C09A 5HYIA 4P59L 3MRFB 3PUCA 2RGSA 1W0VA 2EXYC 5I1AA 5LQBH 2R2HA 2HG5B 4G6MH 3OR7A 4RAVA 4HD9A 5F9JB 4I1NB 2XI9A 4MA1B 5ALCH 2FECI 4AIOA 2HFGL 3D39D 1P7QD 2C4FU 4K8RD 2ZG1A 3NFNB 4QTIH 1FO0L 4Y16D 1FNEA 3BVNA 3HPLB 5AZEH 5LAXA 4MAUL 1HCFX 3ISWA 1F3JB 4LLQB 1MCOH 2CIKB 3LDBB 3ALPA 1UZ6E 1BEYH 1D5XB 4YH6A 1RY7B 3VA2C 2HRPH 1ZXQA 2G2RA 1UACL 5KVDH 5EC2B 5TGBB 4OGAC 3B4NA 4BELD 4LVHC 4NFDA 5J7CC 3RVUC 3HMXL 2AEIT 1U36A 4JFED 3WLBB 1EVTC 3O0RH 1LNUB 3I02B 3T0EA 1AY1H 1WIOA 1PZ5A 1TTGA 5HI4D 4J4PC 2R69H 1A7NH 1HXMB 1L0XA 4GG6E 2JJSC 1CCZA 1MHCB 2DYPB 2JCCB 4CN6A 1NCNA 1WAAF 2FJFA 1WEJH 1PY4A 3VXNA 2UWEF 4RGOH 5I18L 3CU1A 4DN4L 4U6HA 2BVEA 4RCAA 3CD4A 3RWIB 2DIJA 3GRWH 4JHAL 4QWWC 4KTEH 1T6WA 2CLVB 2YZ8A 5D93C 4AH2A 1J5OH 4MJ2A 2APWA 1IC7L 4XNZC 35C8H 1NDMB 3FO1A 1K8IA 4ODXB 4H26B 3U9UB 3NPSC 4QT5A 4LVNB 3UAJC 1OY3B 1T80A 5F7DA 4WHCA 1TPXB 4U2YA 5C08B 4M6NH 4BA8A 2VDKH 4GRMB 4YR6B 5F8QC 4LSTL 5GIRA 3U4BL 3ZE0F 4UT6H 3U7WH 3G5YA 1DUYB 3GIVB 3HC3H 1A9EA 1CBVH 2JJUA 3RY5A 2ED9A 5E7BA 5H2BA 1BJMA 4UILL 4WJ5B 3HC4L 1EEYA 1UCTA 5BXFA 1CGSL 1VGKB 3TJEH 1AH1A 4PRPA 2J8HA 4MS8C 5DK0A 4XBPA 4PJFB 1ZWIA 1H5BA 3BT2H 4U1NA 1BVKA 3LSOA 2BP3A 3VWKA 5GJTL 2WBJB 4I5BA 3REVB 5JHDB 3VRIB 4XAWL 1PGRB 4J3VA 3KLSA 4ODTH 2E7LA 4JRXD 1S7XA 2VLRE 4FFWC 1JE6A 3MGOB 1YQ2A 2ICWJ 2Y7QB 4UIMA 1IQDA 3ZT5A 1II4E 1OAXH 1D5BA 3DXAA 3IU3B 1WFOA 4XP9H 5I19L 4JM2A 4PJFE 1J1PL 4ZTOH 5EOQL 4UT9H 4PJDA 3H9SD 3D39A 2XA3A 4BQ6A 4RAUB 5EO0A 2P43B 5CILH 1BGXL 3MNVA 1HDMB 5EBWB 4XWGL 5ENWB 3IKKA 3R06B 3L3IA 4XXDB 5ALBH 4UV7H 4F57H 2O5ZL 3CFKB 2K7PA 4PJHF 5E6YA 4ZUWB 4L4JA 3D9AH 3MRJA 1SY6L 3LMJH 3FTGB 3NBNA 2WZPD 4FFZH 4J3UA 4Y0GA 2OYPA 4PP2B 4AZ8A 3P4MB 5D7KE 3MLZL 2XZAL 3LOWA 2DMBA 1OOAA 1IFHL 1LO5B 4U6YB 5HYSG 3QIWB 2B39A 2ZG3A 3QEGL 4NQCB 1J0HA 2OK0L 1J0KA 4KJPC 3TBYA 2HJLA 2IPUG 4F7CA 1EZVX 5JXAH 5A2JH 4MSWB 4HWEH 1U8OA 4F15B 4U3HA 1K9TA 1I1CA 1BF8A 4QCIA 4G8EB 3L3OA 4D0CA 3PHOA 3TVMC 2FJHB 4PTUA 5K93A 1BVLA 3MRIA 5CINL 3DV6A 3QEUA 1G9ML 4H20H 4MS8D 3BGMB 5FIEA 1GAFL 1MCDA 2ENYA 3Q1SL 2YD8A 4DZBB 5HHMD 5JW4N 2YKLH 1PG7X 3FZUC 4KK9D 3SO5A 2R0KH 3VXME 3BGAA 2GJ6A 2V17L 1CR9L 4PJ9B 3MRKB 2Q8AH 4M9OA 2RR3A 3L5WA 4LARL 5GSRB 2QHRH 1FJ1A 5DDHB 3SDCD 2IBZY 3GRWA 2CK0L 1IGMH 2DWEA 2F19L 4DCQB 4U3CA 5T3XE 1LE5A 1QO3B 1KC5H 3MA7A 3WUWG 3RUGE 4XPGH 2OSLA 5DUPL 5C0DA 1QSEE 1M7XA 2BNUB 4EUPA 1RJYB 3AM8C 4TUOA 1TJGL 5EOCL 4GO6B 3VGDA 3BKML 3JWDH 4XVUD 1KJMB 2QADB 4KI5F 4HKXB 1I8IB 2JB6A 3P40A 3FFCB 5TE7H 1J1XL 2RCSL 4GAJL 4XP1L 1V3LA 4QXTA 1W72A 3DSFH 4NHUB 4OZGF 4NYLB 3N85H 1FGVL 1R5WA 1FO0B 4PLKC 5FYKD 3IYLW 1YUHB 1F4WL 2VDOH 1QG3A 4PJGA 4NBYB 4JKPH 4D94A 1D6VL 4ZPTA 4MLIA 3P9LB 2PCPB 4G9FA 3RPIB 5IMOA 2XICA 5D72L 1RZIB 1JZ7A 2YD1A 3HUJE 3HRZA 1TPXC 3QFJA 4R3SA 5JW4M 4OLUL 1B0GA 3RUGA 4HMDA 4JREC 2AJZB 4HLJA 2HP4A 3LEVL 4C4KT 1CL7L 4OZHF 3SQOL 4AJ0A 4LPUA 4EDXB 4NHCH 4YPGA 1WK0A 3KPQB 1RK1B 1F11B 3UJIH 5BCAA 3CXDH 3K3QA 4X6FA 2BSRA 1BJ1H 4JRYE 1WBZB 1W0WB 2PXYA 4ZODA 4PG2C 4K3JH 3FO2A 2J2ZA 5FOBA 4WVRA 5DHVH 4UUJB 5HJ3A 5HHXL 1OTTC 4PTTA 1FQ9C 15C8L 3ARGA 4PRIB 3VFMA 2JKXA 3MRGB 3K1DA 2PO6D 3EFDH 3GJFA 4JN1H 4L8SA 4EIZC 5MP6H 1T7ZA 4GQ9H 3MXWH 5FYJL 1U92B 3VXNB 4TQEL 5IESL 4H0HB 5ALCL 3HMWH 4G8FB 3BDYL 1Z5LA 2E9IA 3QDHA 5SWZB 5DRXA 1MCCA 3TYGH 3F58L 2C3XA 3RWIA 5GS2H 3T77A 3PWJB 3VXUE 1FIGL 3CH1B 3Q3GB 1VFUA 1EDQA 3IFOB 4L8SC 4NFBA 3BRGC 2VXUL 4Y4HD 2FSEB 3VWJD 5IHUH 1CU4H 1I1FA 3DHJA 5BZDA 3FHAA 3VD7A 3EFFB 3U9UA 4Z78A 2FB4L 3FFCD 4U1HB 3BT2L 5D7IB 4QNPE 5J6GB 5TE4H 3SQOH 3MLUL 2CLZA 5B38A 4OZGA 3OJMB 4P4KA 1A3QA 1PX3A 3HZVA 4ISVB 1MRDH 5IJVB 1HIMH 1C5CL 1A6AA 1ZSDA 3B6SA 4NQDE 2WUBH 5INDA 3JV5A 3U46B 4CN1A 1EEYB 2VSDA 5KJRH 3BZFA 4H88L 3O4LB 4HXAL 3MROA 3P0VH 3E8UH 3RUGF 4JFDE 3VWKB 5GGRA 3ZSTA 1I3UA 2Z8RA 3NFSL 2BVQB 2V5RA 2X7LA 2C9AA 5KSBE 5CZVH 5ICZA 1N0XL 3MLVL 5DJDA 2R1WB 2VITA 2N7BA 4Y5VB 4Z7OF 1U9KA 3MACL 5L88H 3MRPA 1VACA 1WZ1L 3BPOB 4E41B 1T2QL 5AG8A 4FP8L 1FNSL 3DXAB 4I48B 2OJZL 3DVNB 1MLCA 4OD3H