4KV5E

Scfv gc1009 in complex with tgf-beta1.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSNVISWVRQAPGQGLEWMGGVIPIVDIANYAQRFKGRVTITADESTSTTYMELSSLRSEDTAVYYCASTLGLVLDAMDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a pan-specific antagonist antibody complexed to different isoforms of TGF beta reveal structural plasticity of antibody-antigen interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Transforming growth factor beta-1
total genus 24
structure length 120
sequence length 120
chains with identical sequence G, H, J
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kv5E00
3ZKMD 1OARH 1GGCH 4KUZL 4WTXA 4ELMF 4L8DB 1JNJA 1XGUB 3MRMB 3QAZC 5HGBB 1ES0A 3KGRA 1UQSB 1F6LL 3BGMB 5CCKL 2X4QA 1XIWA 4XMKH 1UENA 4OLYH 4ELKA 5F72S 3JXAA 4QGYA 4O2FB 1EXUB 4CL7A 3SKJH 4DQOL 4GRLB 1GGUA 4LVOB 2O93L 5A2IH 4XMPH 5J13B 2PNDA 3RGVB 4LSPL 4QHNA 4U1NA 3S37L 4HHAA 2FX8L 3KR3H 5L2KA 4KK8D 5K9OA 1YNTA 2VSDA 3UAJD 4D9LL 3CFEB 1X7QB 3HI1A 3DLQR 2VC2H 3W11D 4NKDA 1QSEB 2A6JA 3TBWA 3ARBB 5E9DA 3BQUA 4JKKA 2QTEA 4MNGE 1BZ7A 3VD5A 2ZNXA 3QUXB 4I3RH 3TNMA 5J56B 4M1CD 2Y7QB 2JK5B 5JNYA 4WHYH 2LV4A 1MCBA 5CEZL 1PX3A 3TLRA 3MV9D 1AC6A 4HWBA 4Y16A 1Y0LB 4LAQL 3VFUB 1FDLH 1HILB 1LE5B 2NLJA 1TPXB 2OR9H 5E6ZA 3TH3T 5E2WL 2BJMH 2FH6A 1GHFL 3EZJB 2GT9A 3QPXL 4J8RA 5CBEA 2A1WL 2V17H 5E1AB 5J3HD 1ES0B 5TH2A 3UYRH 4P3CL 4MHHI 4WW2A 1NC4A 2H6PB 5FKAB 2Z91A 5J8OA 1CIUA 5KSBF 3AS0A 4WNQB 4ODVH 3I3EA 1Z0NA 3MRIB 1BJ1H 1CU4L 5JLZB 4IDJL 4X83A 2B4CL 1O7VA 2C1PA 4Q9RL 1ZVSA 3DURA 4ZQKB 4UT9H 5DGRA 5IFAL 1H3TA 1C12A 1UWXH 3MV9B 4IIQC 1GVIA 5FYJL 5ID0A 2VDQL 2KDGA 5IB2B 4YHNB 2Y5EA 4P2RA 4AEHH 2AJUL 4PV8B 2B1AL 4P99A 1FO0L 4MDIA 4DN3H 2YK1L 1T0NA 4YHLH 2WBJC 3ARBD 5E9DD 1S3KH 3EO9H 1PY4A 4YHZH 4G9FB 1X4XA 3D2UD 3VA6A 4JQXC 5IF0B 1F4YH 4M5ZH 3QCTH 1I3RB 2QQKH 1DFBL 3MLVH 1KIRB 4RWHA 3I3DA 3VMPA 1IL1A 1QSFA 1C5CL 5EU6D 5F9WC 3S88H 5JLZA 3D69A 1IQWL 5TPWH 5HSFA 4PJIA 3QFJB 3C08H 2R9HD 4GKZB 4L4TB 2QQNH 1C1EH 3E6FA 2AV7B 1BEYL 3MLXL 4ZOBA 5HGGS 1E4KC 5E8PB 1HQ4B 4MD4A 1Q38A 1FL6B 1J8HA 3DHJA 1JPFB 4NQSB 4G42B 5HPMB 5IB4A 2VQ1A 3MROB 4G9FE 2QKIB 1PEWA 3MREB 4XPGH 1HCFX 1U8PA 4MSWB 5F7YC 4L3AA 1IGJB 3KJ6L 4NZJA 5B39A 1FPTL 1EBAA 3TA3A 4PJCE 5DZNA 1UM6H 15C8L 4OTXH 5E6YA 1J0HA 4GJTB 1H0DA 2X05A 1KV3A 3SDCC 5C07D 3LDBB 2R9HC 1SJEB 3T0DA 5C9JA 4QY8A 2A9NL 5CJ8A 2DQHH 5T1KB 4OLXL 5EUOE 3FHQA 5E2UL 4NKIH 1S7SA 4OM1H 2CUHA 2FL5B 4KVNH 4WHTB 4H5SA 4JE4B 2NX5E 4P2QD 4PJ9D 4QGTA 2BVTA 1J0KA 1DL7L 4R2GB 4NO0B 1YPZF 5DJDB 2VXTH 5GRZA 1W72B 2UVFA 4RIRA 1NGQL 4NCC1 4OLUH 3U7YH 4EBQL 3NFNA 4ODWB 3MROA 1P4IH 3VXTA 5FUOL 1QFPA 2DMCA 2DKUA 2W92A 4U6VH 4DZBB 1UB5A 2VR5A 4MA1C 1J8HB 5DRZA 1ZWIB 1YN7A 1HSBA 2YMXL 5CJXC 5E8PA 3V0AC 4GBXD 3K1KC 1CFQB 1MFEL 4U6HB 4UU9A 4GMSH 4K23H 3R0NA 1YMME 1CG9B 1TTFA 5GRVL 5CUSH 4PGDB 3LQMA 1DCLA 4JG0H 5BRZE 4P2OC 3BYYA 1AIFB 2P8LA 3TO4C 4UNVA 1IKNA 1W72L 4PJ7F 2C26A 3PXJA 5D4QA 4PREB 2FX9H 3RY6A 3QPQC 1MFBL 1YEGL 4A6YB 3EKCA 3Q3GB 3CCHA 2AJSL 4MB5A 1J88A 2CGRH 1P7QD 3FQRB 4D9LH 4MMXC 4C56B 1NGYB 1JL8A 1PKOA 2VN4A 5JIHA 1CR9H 5EU3B 2BVEA 1RZKH 3U0PB 3HC3H 2GUOB 3NA9L 3EYQD 2FHCA 4LCCC 2I07A 1AKJD 5C7XL 1ZLSH 1V5JA 3ARVA 3W5MA 2HFTA 1DBKH 4X8JA 4P0DA 1JYNA 4XVJL 3MRIA 1TZIA 2IPKA 1KGCD 2QHLA 2MCPL 1PG7X 1MY5A 2EH8H 4WHYG 1IEHA 3U0PA 3TN0C 2PW2B 5IBUG 4RX4D 5T3XH 2NY1D 3O6FB 2IGFH 5E2JA 4WHCA 2W9LA 4HKBA 4WGVB 1HHJA 4N0YH 3G5YA 5FGBA 1ZT1A 2LU3A 3TT1L 3UYRL 1E28B 1DR9A 2H2PD 4LCCB 2RJMA 2IH1B 3F7RA 1DEEA 1AP2A 5IR1A 5D7JD 2IAND 1CBVL 4FQXA 1NCTA 2V17L 4F9PC 1OPGH 4UT7H 1AGBB 4RNRB 2HWZH 3Q2CA 4QXGH 4P3CH 2YOCA 3MR9B 2ICWI 4JFFB 4XXDA 4ZSOB 1U91B 4OSUL 3LKPA 3OXRB 5LGJB 4NHCH 3BQUB 4RDQF 3DX6B 3MACL 4TUJA 2G5BB 4XRCA 1JTTA 2YPVL 1T2JA 4GW4A 5IFJB 4CVWA 5B4MD 2AJUH 1P7QA 1BIIB 3C6SA 1IILE 3BJLA 3GM8A 3QCUL 4UBDC 5TQ2H 2NZ9C 1JRHH 3PHQB 3PWPE 4G8GE 1PX4A 2FJGA 1K5NB 3MV7A 3QWOB 3UTSA 3QPXH 4JPKL 2NLJB 1EHAA 1QPXA 4G42A 1WFTA 4I4WA 5DRXB 1CICB 2Y23A 3S98A 3LIZH 4NCDA 1JYXA 5IVXE 3LQZA 4G8EA 3LEXA 4KPHL 2B1AH 4CU8A 3PQYE 1DBML 1IAMA 4PJCF 1CYGA 3ZMRA 2CLRA 4ZOAA 4MA3B 4L8SC 4ZO6A 2IAMD 3RWHB 4RX4A 5DHVB 4W4NA 4FTVB 1CFBA 4P5TD 3QJHB 1C1EL 3U0TB 4YR6A 1T20B 2W0LA 1G7LB 3PQYA 5EBMA 2HFGL 1JI2A 5C0EB 2ZUVA 5HY9A 3RTQD 4I2XA 4GW1B 3L1OH 5SWSA 3PWPB 2BNRD 1C5CH 1QQDA 5LGHH 1MRFL 5DVNA 4PY7A 4POZD 3WNMA 3MXVH 4HT1H 1T0MB 5L8LB 2APWA 5F1NA 4L3CB 4AM0B 1JZ3A 2GY5A 1CXFA 1N5YL 4X6EB 1TZGL 5D96C 4Y8DC 3CSPA 4RMVA 3BH9B 2EDHA 2VDRH 3S96B 1QRKA 4YHZL 3EOAB 3QEQE 1CZ8L 1JK8B 3QEHA 1DN0A 4QEGA 3MLUH 2DQHL 4L9DA 4BKLB 3RWFA 1MSPA 1BQLL 2R2HB 4N1HB 4HCRL 4ZTPL 2Y07H 1YDPA 4P2OD 4PJFF 1G9ML 2YD9A 4X7DC 2O61B 5KZCB 1B4RA 1B90A 3PIQA 5F44A 2HTLC 4FQ1H 4DVRL 1IGCL 2XKUA 1SYVA 1HHKB 1U8JB 3UP1A 2O5YH 2X41A 3SJVB 1T7YA 3CXDH 5MP6H 2VXVH 4LHUD 2DICA 2K7QA 2E6JA 3VFMA 5EUOA 1BOGA 1IQDA 4M7ZB 1LO0L 4GBXC 3BP6A 3V0VA 4KVNL 3NCJL 4X6BB 4LSQH 2GTWB 3CX2A 4WW2F 5JW5A 4QRQA 5I75C 3BKYL 3GFUA 3MLWH 1YN6A 5DWUH 2PW1A 3P30H 4JO3L 3WNKA 2EDBA 2H9GA 4HIIB 4XPBH 5IB3B 3IVKB 2XFXB 1T0MA 5DK2B 1NMAL 5K59F 4ODHH 2YPKA 5IVXB 4PY7B 4HJGA 2GKIA 4D3CH 4I18C 5GSRA 3Q48A 3QO0B 2F5BL 5I0ZA 3ZKNC 1JGLL 1P7HL 5JQHC 2BXZA 5LQBL 3JV0A 2BRQA 4P46A 4MYWB 4YXKH 3VRJA 5C0FB 1OT2A 2VO5A 1A14L 5H2BA 1L6ZA 3V7MA 3FRPG 2NXZC 4EUPG 4UDTA 3QNZA 1S7UB 4XHJD 1R5IB 4LL9A 3PABB 4YHOL 3AAZB 1OTSD 1RK1B 3RGVA 2A9ML 4FQHB 4G6FD 4X7TB 3BP4A 4I0PC 4HWEH 5E2TL 1FORH 4JG0L 3WFEH 1KCUL 2ERJB 3TO4A 2WQRA 3MFFB 4YDKL 5C0AB 5C0BB 1XIWB 4CJ1A 3QWQB 3MRDA 3QUML 1T2QL 4DCQB 2ZUQB 1K5NA 4LLVB 4JGJA 1I8LA 1VGKA 2Y7QA 5JNYB 5D7IB 3VFPA 5IKCA 3ZKSD 3W0WB 3REWA 2H3NB 4FQ2H 3QG6A 4CW1B 1ZT7A 5ERWB 2AJVH 3DGGA 3O41A 4MJID 4QYOB 5ACMA 1S7VA 3R06A 2N1KA 3IFOA 1VA9A 4APQB 3D2UA 4JANB 5MENA 4RGMC 4HV8B 4OZIB 1A7NL 2VLKA 1XR8B 2IEPA 1KB5A 4LCYB 5CKGA 3QR2A 3IJYA 2NXYB 1WZKA 4DOHB 3SKUD 4ELME 4L8CA 1CS6A 1PJ9A 3KLDA 4K3DH 1YEDA 3VE0A 4LHJB 4Z7UB 1NC2B 1CGWA 1F8TL 4WI4A 3MV7B 3QWOA 4KUCD 2X4QB 1A1OA 3U0WH 1K8IA 3NFPA 1WIPA 1JUFB 4MA8L 4RAHA 1R5IA 4WI9A 3RIFK 3T04D 4GW4B 5IFJA 4ENED 4I18A 4L8DA 4ONHB 3VFRA 1GGBL 5JHDE 5C1MB 4R26L 1UVQB 1NCWH 2E27H 2F8OA 3O3EA 4K2UH 4KJWC 3SKOB 1CCZA 1WBXB 2MCPH 3ILPB 4FQQA 1UH4A 1XZ0B 3ECBB 1J0ZA 1K4DB 2FRGP 1MFDH 3DVNA 3ES6A 1J7VR 2DIJA 5CEZH 1FLRL 2EDWA 2HT3C 4M61A 4IMLA 3K81A 4PTUA 1QACA 3MO1A 4WWKB 3JZ7A 2MPAH 1CD9B 1UYWL 5L2KD 4TVPL 5IROA 3QXAA 3B9VA 1NANI 3RWEA 1IQDB 1L6XA 2N7AA 4M4PA 1T66C 1BAFH 1FNLA 4MJIA 3FRUB 4P9ML 5GHWH 4OLEA 3T3PE 5FKPB 3FJTA 4TNWF 1E6OH 5TJWK 1P4BH 4LLAA 2VLRD 2YKLL 2MNUA 4KJYB 3OBAA 5EU7C 4JANA 4IHOA 1Q94A 5BVPH 4M1CC 1C5BL 2IC2A 5ACZB 1BFTA 5ILTH 4MD0A 5KG9B 3PL6B 2NY6D 3LCYA 1J86A 3BYTA 2DJUA 4X6DA 2AABH 3V8OA 4BZ2L 4F7EB 3ARDA 3O81A 4F7PB 1X9QA 4BUHA 3O2DL 3SPVB 4DK6A 4BSWB 5HHPA 4OCYH 5IK3A 1CZ8H 1F4XH 2MMXA 4KTDL 5EC2A 2CK2A 1ZHBB 4Y1AE 4PJGA 3BUYA 4QOKD 5BZDA 3MUJA 3HI6H 3BH8A 3WS3A 4H25B 1OQXA 1G9NC 4XB7A 1LEKA 1AGCB 1IGFL 3EHBC 1TNNA 3QCTL 3EJZD 1I3GH 3MUGB 4OM0H 5T33H 2IFGA 5GS0D 5EIVA 2FIRT 1DVFC 5E2VL 3QFJE 3QG7L 2NY6C 4Y4KA 3B9EA 5F6HJ 2R56L 3QO0A 3C08L 3LQZB 2H32H 5KSUA 3HI5L 5DEGA 4EI5C 4PB9L 3K3QA 2D31B 1KJVA 1K6QL 4N8PA 3A67L 4O9HL 4Y16C 2VXVL 4Z7WF 1D9KC 3DO7B 3H9HB 4IJ3B 4JM2F 3JUZA 1S9VB 1O0VA 5AAMA 4PP1D 2X1XR 3BKYH 3MLWL 2YA0A 2Y07L 1CTNA 5ICXA 3OJDA 4FQXC 3ARDD 2HJLB 2EIZA 1P69B 1KPVB 3DSFH 5T1LB 3ZE2F 5C09B 1I8KA 1GXEA 3NIDF 4LASL 4OZFA 3RJDA 2EDJA 1NFIA 2OSLA 4JRWA 3ZDYE 2IPTH 4MJ4A 1NJ9B 2Z8RA 1NMBH 5KJRL 4IOIB 5D72L 1KCRL 4NZRH 3WIFB 4BQ9A 3BX7C 4JO4H 1EZVX 1IGJA 5B39B 3DI2B 2H26B 3BDBA 3HUJA 3UPRB 5SWZD 1UCTA 4KKAC 1MIMH 2DN7A 3ARFD 4Q7DA 1G7IA 1JZ7A 5DMIH 5DHVH 4AJ0A 1TVHA 3T09A 1J87A 2X4RB 3TNNA 2R23A 4XNUH 4CMMB 1NMCC 1PDKA 4X9HA 3C60B 2LAGB 1S5IL 1I7TA 1IM3B 1RUML 4XVUC 3WJLC 3EW3B 3ARGB 1QRND 1ZLWK 3GUTA 1X5AA 1CXIA 4AYFA 2NY2C 2BSSB 2HJFB 4WW1A 4IIQA 1UH2A 4JDVA 1BZ9B 2JF1A 3WFDL 4YHOH 4PRPD 4XBPB 4P2RE 4J3SA 4Q74A 2HVJB 3P9MB 4DZBA 4OZHF 2C5DC 5KANG 1FZKB 1T03H 3P4NB 4MMZC 1BREA 1TVHB 3UJIL 3QDGB 3TC9A 3VWJB 1E6JH 3DUHA 3H3KA 5FYKH 2H26A 2DI7A 5INDB 2YD2A 5GXBB 2CKNA 1XGPB 4Y5YB 1IEBB 3WUZA 2XTLA 4BK4A 1DQML 1FSKB 2VMFA 3GK8L 1S7WA 1P6FA 1BJ8A 3QUZC 4GRWF 2R2EA 4HAFA 1T3FA 1IVLA 5AYUH 2IPUG 3GJFA 1T7ZA 4NT6A 4XNZC 4BZ1H 3STZA 2RB8A 4JM2D 4RWYH 4TSAH 4UU9B 3O8XD 1A8JH 2X70B 4Y2OA 5HHVL 3OKEA 3PDDA 4K3EL 1ZWIA 3UBXA 2V5SA 4P2OA 1MJ7L 3MRFA 5SX5H 4E0RB 4AQ1B 1Z9OA 4HS3A 3MV9E 3SE3A 4POZC 3UTTA 3BZ4A 1E6OL 1QR1B 1AKJA 1G6VK 5EC2B 1LO3H 3FRPA 3T0WA 4O2FA 5FGCB 2Y36L 5GGQL 2GFBB 5I8KL 3QUZA 4UQ3A 3E8UH 3O4LB 4MJIE 4Z78A 2BMKB 3RNKA 1MCPH 2VLJB 2NY3B 5IJVB 4P23D 4IDJH 5F88A 3RU8L 1K85A 1M7DA 3HI1B 4RMRA 4BM7A 3TA3B 3RDTA 4L4VE 2R15A 4OCYL 1HZHL 4ETYA 1KN4L 4KI5D 5HGAA 3ZHDA 4K3JH 5HDBE 1B88A 5D70H 1QR4A 1R3KA 3T4YA 1INEL 3VXUD 3F62A 5FGCE 4X0KB 1ONQA 2DS4A 4TVPE 5GS0L 4MCZA 4K71C 1X6LA 2LE9A 3MNVA 4YHYB 3GRWA 1GZPA 3IB4A 1NJ9A 4WU5A 4F9PA 2UZYB 5ABDE 3G04B 4FQQB 4F9LA 2PYFA 1NAKH 1R3LB 3TPUA 5E8NB 1CFVH 1RZIB 4I0CC 4J3XA 3FFDB 4I2XE 2HJLA 2EKJA 3W9EB 5C6PB 1CLCA 3O2DH 4ZXBC 5LGHL 4EUPA 3ZDZF 3F12A 3LB6D 5DHXB 3MRHB 3ZLQC 4J23A 1E4WH 1P84J 5ID0B 5GRUL 1WF5A 2GTWA 3HLAB 5AWNH 2WP3O 3HE7D 1AO7A 3NABL 4KRPD 1HQRA 1ITBB 4U1IB 3QAZB 5FA4A 4N8CH 3CMGA 2K7PA 2OJZL 4N90D 4Y4HA 1IC7L 1HDMA 4HZLA 5CSZA 5HYQA 3BDXA 1A64A 1MCLA 2JIXB 2VLKE 1TQBC 5CILH 2E6QA 3OJ2C 1GL4B 3M8OL 4G5ZL 1V3MA 1FIGL 5KANI 2BSTA 4I5BA 1V3JA 2HJKB 3QXDB 2H3NA 1YNKL 2UY7A 4M5YH 3FT3B 2OMNA 4PP2A 3PGCA 3SBWA 1YMMB 1ZA6A 5ESQA 3WO4C 3V79C 4L4VB 5F7NC 5IBUB 3AY4C 3T0EC 1CGVA 4DCQA 4OD2B 4WFHD 2DIAA 4CADB 1B2WL 5D72H 9CGTA 3QUXC 3MRBB 1FH5H 3KPLA 5MI0B 3DRTA 1I3UA 4HIHB 1NL0L 3LV3B 4XPBL 4DGYH 1BFOA 3N1FC 2QQQA 3GMPA 5ID1A 2XTJC 2A77H 2C4FT 3QQ9C 5HVFB 1CIDA 4JQVA 1Z6JT 3O9WD 4YE4L 1DE4B 1IEAA 4NKDB 4PJBE 1H5BC 1K9TA 1A6UH 2X2YA 2JB6A 2JJWA 3KNBA 3OR6A 4PG9B 5E00B 4JHWH 4KHXH 1P1ZB 4YWGL 3GMPB 2NR6D 5D1XB 4EI5A 1S9YB 3O4OB 3WHXB 4NO5A 5J13C 2MQCA 1B6UA 1EEYB 3FB6B 5EUKA 2WIIA 4YIQA 5ISZA 4HJJL 4LPYA 1YN6B 1SEQL 3RDTC 4LEXH 4MXVF 1BD2A 2JJTC 3PGCB 5KTEH 4MNGB 4K3GA 2X1WL 3IDGA 5F1OB 5L2KE 4TSCL 1HCVA 2EEAA 1I1AD 1NPUA 1F6FB 4J4PC 5HYJE 5ACZA 3DX6A 5FYKL 4MXQD 1UJ3A 1RY7B 1U91A 2DD8H 4KY1H 5ELIA 1AJ7H 1F90L 4N8VG 3ZTNH 1XEDA 4H20H 4KJYA 1OSZA 4MQTB 5GISH 3KXFB 5FUCC 3BDYL 2F54E 4X6DF 5HI5C 4MXWH 1QO3A 3HMWL 1HEZA 4XNQB 5EU5A 3SQOL 4DOHE 2D4DA 4HIEA 1JTPA 4HC1A 1LEIB 3TFKD 3VXQA 1AXTL 5DD6A 3VFTA 3NVQA 5JW5B 5F9WB 5D8JL 1AY1L 5HYSA 1RJYA 2FJHA 5BW7A 5I8CB 5GGQH 1JPGA 4FFZH 1TETH 4LOUC 3VGBA 3M17B 1BQHA 2OTUB 1KLUA 3BP5A 1U3HD 2XN9D 4TUOA 2WP3T 2A6DB 2XZAL 3WFCH 2V5MA 1OPGL 3CVHL 4KGJA 1KULA 2Q20A 2X42A 5F1IB 3ULUE 1UA6L 2EXWC 3KXFE 5B22A 1ADQL 2O61A 2RFXB 3C2SA 3OQ3B 3QUMB 4O5LL 1IAIH 5L0QB 1FAIL 3I6KB 3STBA 1LK3H 1T5XA 2K3TA 5GGTL 1FNGB 5D1ZA 2EXYC 3HFMH 4P4KA 3ROOB 1K8IB 2C7UA 2I9TA 4X6EA 4DN4H 4ONFH 1F6AA 3BH9A 3ZTJG 3M45A 5DD5L 4ZMAT 5LXGH 4P5MA 3AM8C 4HKXA 3QIUB 5C2BL 3TFKC 4GXUM 5BRZD 4Z76B 5F3BA 5L0QC 1I1YB 1ZGLA 3FT4B 5CSBA 4HCRA 4OF3A 2G2RB 1NAKL 5SWZA 2OXGA 3P9WB 3UBXB 2WK2A 3SDAB 3MLTA 3OSKA 4HBCL 3SGKC 4K55A 2X70A 2A6KB 3RNKB 1QLFB 5E99L 5AD0A 5CJXA 1FGVH 2ZSVA 4Z7OF 2OTPA 2P5WD 1TJGH 1FNHA 2O5XH 3HZYB 1NUNB 5IQ9B 2GAZB 1AGDA 1U3ZA 3U30B 5A16A 1QFWH 4Y0GA 3GSXA 1MAML 1VFBA 1A1MA 4LVHC 2FR4A 3JVGC 4CU6A 2F54B 2VE6A 3S5LA 3MRCA 3WN5A 5A40E 2R39A 3UTTB 2H9GB 4HIIA 2BFVL 2VXQH 3NIFF 2EDYA 1MFCL 2HN7B 3KPRB 3MLRL 5LBSH 1VCAA 4U1HB 2R0WL 4PJGF 1T1YA 3LZFL 4NUJB 3SDCB 2HKHH 3KLSA 3NCEB 3ORJA 1JHKL 1S7UA 4DFIA 3QISA 4OFVA 1EHNA 4E0RA 5GGTA 3BKJL 3QIWB 4PJAF 4IS6A 3I50L 3FMGL 4KDWA 3NA4A 4ZG1A 3LRSA 4P46B 3VDCA 3X3FL 2CPCA 1T6VN 3NABH 4P5TC 4M7LH 2ITDA 2K9UA 3L5HA 1BZ9A 5FO9B 5IHUL 5D2NC 4XXDB 3B8SA 4Y5VB 3WSQL 4NZTL 4U0RB 2PYFB 3OGCA 5ECJE 5GS3A 5GGVY 4Y4FC 1H3WM 4M6AA 1LO2L 2VSCA 1QTYT 4QOKA 1DSFL 3DBXB 4PB9H 2FATH 4XZUB 5I18H 5JXAH 4ODXA 2P8PB 1NGQH 5ETUB 2ZCLL 4PY8I 5GRUH 3NFSH 2EYSB 4P46C 3O6LL 2VZTA 4JZNA 5DJCB 5IG7A 5F7DB 3BGFC 1IC7H 5DXWA 1Q1JH 3WHE1 4Y4FB 1SYVB 4Y19E 1YEHH 1FIGH 3HZKA 2BOCB 1YUHB 5HVHC 4QHUB 4YR6B 1G9MC 5J9PA 2DQEH 3MZTA 2DI9A 1MNUL 1PKQA 3ARSA 5KAQF 1A7OL 4JEGB 2XRAH 4W6WB 2DLEA 5T1MA 4C56E 2XG4A 3KLAA 5D7JC 4P59L 5DLML 2V5TA 4MLSA 3VJ6A 1JFQH 3Q3GA 3GSQB 4Z77A 5ALBH 1L7IL 1YEGH 3PQYD 4Q58C 4XGZB 5M94B 4DGYL 1HN1A 1MREH 1KPUB 4WTZG 4S1DD 1JZ5A 1PD6A 2B1HH 3CDYA 3ZE0F 1ZAGA 5HVHB 3GMQA 4WW2C 3KHQA 2NTFB 3ZDXF 1AI1H 2RCSL 1A7QL 3MLYH 2FJFA 4ZAKD 2J3SA 4LK4A 3WMSA 4U1MB 5F88B 4R90L 4H5SB 2FNBA 2E6PA 1Q9WA 3O6FC 3QYCA 3VI3F 3ZYIA 1HSBB 1UB6B 1R3JA 3CPLB 4I8DA 5EZIH 2A73A 3VGHA 1HK6A 5AG8A 4YC2B 5FKAA 3QI9B 3R4DA 1RZJL 5ICXB 4WW2B 3CD4A 4HULB 3KXFD 2OK0H 3KYKL 1IRAY 1F8TH 3UTSB 1CE1L 4F15C 3UJIH 1FFOB 3ZYJA 3WFCL 1ZANL 2NR6C 3S35X 1D6VL 1BIIA 1AXTH 1I7RA 4D9RD 3BWAB 5EOTA 5TDOB 5C0IA 4M6ML 4HH9A 2AERT 5JQ6L 4H26A 3GSWB 4P4KB 1TETL 4PBXA 4Q9QL 2NY1C 4UT7L 5F7HA 5F9DC 5T3XL 5HYEA 3S97C 1I1FA 1S7QB 4XP6H 3RIFF 3SHSA 2EYTB 3FO1A 3MLTB 2C4FU 4WFFE 4JFQA 4BH7A 3A0OA 3O2DA 3FB7B 1QHPA 2HLAB 2VLME 2EIEA 4FMFA 5AZ2L 2DL9A 4I1NB 4X80L 5K9OB 2JLLA 1ZA3A 4EVNA 4R96B 3OKLB 1WQVT 3BUYB 5D2NA 1DEEB 1KSRA 1EO7A 1DP0A 2F58H 3G5ZA 4P5TA 1A22B 2PXYC 3QHZH 4H0HB 1FL6A 5CAYB 3HAEG 4LSRL 2R29L 4ODTH 5DURD 2GSIB 4LLUA 1S5HA 3NZ8A 4EXKA 3O9WB 3QCVH 4P9MH 5GHWL 5J0BA 4NC0B 3EO0B 3O6ML 3EDDA 4ZD3L 5F7UA 4D0DB 2WWKO 1CFSA 2ATPA 1FO0A 5TE4H 2ARWA 3DV6B 4HFWB 1FN4A 5T3ZH 1IKFL 5JPNA 1FAIH 2OXHA 1UJTA 1Q8MA 4XH2A 4L5FH 1IC1A 2OSLB 5GRYA 1WUNT 3KPOA 4OLZH 5I1CH 4Q6IA 3C5ZA 1FVEB 1JNHA 1HKLL 4HBCH 5IB1A 3PP3H 3OR7B 5BV7C 2FBOJ 3R8BB 3UTTD 1YMMD 1FBIL 1PQZB 5JIPA 3LKOB 3BT2H 4I0PA 2FEEI 2ESVE 4BZYA 5C8JB 3EOTL 2VDLL 3G5VA 4MAYA 4U4BA 2YWYA 4UMGA 4XI5C 4E42B 1G7HB 4O02L 2R8SL 4PRID 4FFYL 2CXGA 2VERN 4N1EA 2P8PA 3NCMA 1PLGL 4HIEB 1G84A 3U48A 4OZ4B 4UTAH 4HD9A 35C8L 3RIAF 2AJ3B 4EDXA 43C9B 3MRJB 4D0BA 4WFHE 1I8KB 1FZMB 1J8HE 2LTQC 3ABZA 1L0YA 6FABH 3WUWB 2PYEE 2D4FA 5BVJA 3UO1L 2XI9A 4LDLB 5D1QB 2FD6H 5F7FA 2BVPB 2R69H 2CDGA 5M7QA 4FG6D 1C7SA 2HKFL 3O6LH 3EYVB 1S9KC 5TH2B 4JY4B 2A38A 4WIQA 4APQC 3AC0A 5TQ0L 4ZXBA 1V8HA 3ZZ1A 3ILQD 5I18L 5MEQB 4H1LB 5ENWA 5DJAA 3SDXA 3WIHL 1MCSA 3OKDB 1A3RL 3CDFA 2VLKB 1Y18A 2WW8A 4M7LL 2X4SA 5KVGH 2XN9B 3QSKB 2YD3A 3GDBA 3NCCB 5I1GL 3HA0A 4XPAL 4JHBA 4JHAH 3GI9H 1CT8A 1ZLUK 2ZOLA 4DKAA 2ICEB 1SY6L 3VD9A 1P4LB 3DXAE 3KWWB 3TM6A 4AEIL 1YEFL 4FP8L 2FATL 3VFPB 5IKCB 1JHTA 1RSFA 3W2DL 4HHAB 4HX1B 3P0YL 1DTUA 2AVGA 3FO2B 3JWOH 3LN4B 3AXLB 4QHNB 5ICZA 4WDIA 4Z8FL 3GMRA 3MRLA 4PJXF 4ELKB 1OL0A 4BSVB 3VWKA 3O4LD 1NUFA 4LNRA 4K8RH 3EYSL 4WTWA 4XVSH 5EBGA 5IMMB 1IAOB 3WXVH 3LN5B 3C5JB 4NOFA 3KPSE 4KUZH 1MAKA 3CSGA 1GH7A 1S7RB 1TCMA 1M6OA 4X5XB 3V5KB 2ARJB 3JBG7 5ESVA 1UCBL 2ITCB 1CGYA 4F7MA 5JO5A 5FOBA 1EVUA 4YHKL 1JWSB 5GZOD 3ECBA 1JHLL 2EDEA 4KHXL 4LHQB 4NHUB 3AREB 5KN5B 2BERA 1WBZA 1HIML 4XMLL 4WFFD 5I8EA 3W39B 4S1SH 2CDFB 3P4LA 4M93B 2E3VA 1S7RA 3ARDC 2QJDA 5TF1H 5D1QD 4JM2B 3GGWA 1VB9A 1S8DB 1WEJH 1U8HB 1MRCH 1ZT4A 2UUDH 2VNCA 5GPRA 1ZGLP 4GXUN 1EAPB 4WUUD 3G5VB 2E7MA 1LDPH 4WI7A 3GHEL 3HAEH 3GMRB 1CE1H 2AXFB 5HYJB 4DUVA 4G8FA 4FQPA 1YEKH 5MEND 4OFKA 2VDOL 1SJHA 4EI5D 2HP4A 2FGWL 3CJJA 4TSAL 4RWYL 1ZLWH 5C0GA 2XN9E 2F19L 4OB5H 4OIIL 3PGDA 4X4YB 1N64H 2W1NA 3V5KA 4FTVE 5T5FL 1OGAE 1BVZA 5IMLA 1TFHA 3C6LC 3RZCB 4MA8H 5SX4H 4HK3J 3KLHD 1A4JB 4RBPK 4AIZA 4TVPH 1A6ZA 5IJKC 4MNQE 4M6MH 2CMRL 2XQBH 1KB5B 3P3YA 4LCYA 5T3ZL 3VD3A 5GRJH 4LSTL 3RVVD 3TO2B 5KSVA 5I8KH 1QQDB 5KVEH 3UTPE 4ORGA 1SM3L 1ODAA 4L9LA 5D1XA 4EI5B 1JNNL 1GOHA 1Y6KR 5E8DL 5MENB 5KSAA 43CAB 3UYPA 3QFDA 4QF1B 2GJJA 1RZ7H 3H0TB 3IU4H 4LF3A 2ENSA 3E2HB 1JWMB 4KRPB 4F58H 2FCBA 4KHTH 3RZCC 3TJEL 2P48B 4J3OC 4HF5H 3W0WA 4PJEB 4PRAB 5CD3A 3BP7B 4OD1L 2MPAL 3T4AB 3LEVL 3UJJL 1D3CA 3A6CL 4JN2A 5J1AB 2X7LA 4FQXB 4U1MA 1KACB 3MJGX 5D70L 4OLZL 4JRYB 4NQUA 2XFXA 5DK2A 4PJHF 5HHXL 1JZ4A 1ZOXA 3GJFK 1WTGT 4KRNA 3CFJA 3DO3A 1DBAH 3HLAA 4PGCB 4ZS6D 3MLVL 1MLCB 3PWUB 1MQKH 1RV6X 3WKML 1NLBL 1QPPA 1MVFA 1ZA6B 4LSDA 2LQRA 3TIDB 2XNAA 4NWUH 1A4KB 1GC1C 1I85A 4D9QD 3DIFA 4UV7L 1BOGB 2CRMA 4KFZC 5IUSA 2FD6L 4UDUB 4OKVB 1L0XA 4MHHG 3GMOA 1R3IL 4PTTB 1KEGH 4Z7UF 4NNXB 4DZ8A 1ED3B 3WE6B 4BJLA 1Z9SA 5L88H 4ZOCA 4WUKH 2IQ9L 4DGVL 3OF6A 2R2BB 3L3IB 4R97B 3MODH 5DR5H 1G6RL 4XTRD 3OHXA 4WO4C 1NFDF 2EC9T 5DQDL 3IFNL 4DTGH 2R69L 4URTB 3RWJA 1HSAA 4HUKB 3RAJH 1QFHA 4ZFGH 5F7EH 3TYFA 3KG5A 3BW9B 1AGEB 1YNLH 5C86A 2EYSA 1JHKH 2JCCE 2VLJD 4O2CB 3RZWA 1DVFA 3BEVB 4XPAH 2APTA 4DEPC 4MNQB 5JW4M 1QZ1A 4F57H 2P8LB 4RMQA 4TOYL 1G7MA 3AU1A 4RGNE 4O4YL 1XAUA 1P6AB 5CILL 4F3FA 4N90E 5IHUH 4XNMA 1CL7I 4YNYB 3UO1H 1MEXH 2B2XL 5IW6A 3PQYB 3D18B 5EBMB 3X3GL 1YY9C 3MV11 1UH3A 5J6HB 4OLUL 1N8ZA 5KSBA 1IGIH 3RBGA 4B7IA 3FO9B 2GJ6D 5J06A 3GBNL 3VG9C 1A6AA 4Q2ZB 3T0VA 5EU3A 4LCIH 1TJIL 4JO1H 1S9VA 1FH5L 5FM4A 3WXVL 4WGWB 3KJ4B 1PKQE 4MQ7B 1T6WA 5I1LB 5CP7B 4ELMB 4DVBA 3DSFL 1FIEA 3MGOA 2CO6B 5L6YH 4H1LG 2UYLB 1GGYA 2G75B 2VDKL 2X4OB 4TRPH 5TGBA 4WWKD 3BUTA 4FP8H 3LKQA 4YDVA 5GS1C 3OJDB 5TF1L 3LPGA 5CZKA 2PCPB 4ZUVB 2XRAL 1EEQA 1IGTB 3KS0H 3EGSA 1G9NL 4AENB 1AGCA 1FNSL 2A74B 4HGWB 4R7DA 2IADA 3V6OA 4ORGB 4FFVC 2FX7H 1MREL 3NFNB 4ODWA 1AP2B 1BFVL 4I3SL 1JZ8A 2XZQL 3S7GA 4XPFL 2X1OA 3GMNA 2C3HA 1KCSL 2D7TL 4TUJB 4ZO7A 3O11A 2YD6A 2OR7A 4K7PL 2NW3A 3SE8H 1G7JA 2VB5A 3L5XL 4F33A 3MV7D 2VR9A 4PRIA 3QNXB 5B8CC 1TIUA 5AD0B 3MR9A 5IHLB 1SYSA 4V1DA 3D39A 1N3NA 3QDJA 1AO7D 4CVXB 3RPKA 1D5IL 1YJDH 1L4IA 3B9DA 2BY2A 5KVFL 3IXTA 2EKSA 5CEYB 4XAKE 1AD0A 4NWTL 1H8OA 4LRIA 1WC7A 5CIPB 1JJUA 2OK0L 3VWJA 5CP7A 4RDQG 4APQD 4IM8A 4LSTH 2UWEF 2XA8H 3WJJA 3MLPA 3B9AA 1ORSA 2W59A 2DQIL 5T1LD 5I1EH 1HWGB 3P9MA 4XCNA 1M05B 4XNXH 3SDAD 2EO9A 1T7WA 1XT5A 5HHVH 4F7EA 3QULA 1CE6B 2VXUL 4N9GB 5I1JH 1C12B 1OCWH 4M48H 1MHEB 3IJSA 4NGHH 3MRKA 5BRZB 1KPRA 1MPAL 1EV2E 2VL5A 3PV6A 4WEBL 2BK8A 3BPCA 3DVGA 4U3CA 4LLDB 4UTBH 1KB9K 1U8KA 1G7MB 3QZWA 1XCQB 3IYLW 5IIEB 4P3DA 3B3IB 3TJEH 1YJDC 2R23B 1U58B 2R0LH 5J11B 2YPLA 3FO0H 4DUXA 3FQUB 3HMXA 1X3DA 1AGEA 3QI9D 1BZQK 4LCWE 4M62H 1DBMH 1RZGA 5GSVA 2J8UA 4MJ6B 1IAII 1N0LA 2MWCA 3OJMB 5E56A 2GITB 4YPGA 1A6VL 3S3JA 4OT1H 4Z7QE 1V3LA 4U1LB 1YEDB 4V1DD 3CK0H 3THMH 1R24B 3IDXH 3FQTB 3OPZH 4M6NL 2V2WA 5DD0L 3SKNB 4Y16D 4CU7A 1R3IH 4W4OA 3MLSL 4PGBB 1H9VA 3CU1A 1W0YT 5D7KE 1A6WH 2GQHA 4P48A 1BIHA 4QRRA 5B38A 2ZUUA 5FHAL 1XF3B 4LP5A 3G08A 5IT2H 2QSCL 1Q9KA 1TJGL 1JI1A 4JDZB 4LLQA 1YC7A 1AE6L 1R6VA 3CX5J 3Q6GH 1MUJB 2Z31D 1OW0A 2CSPA 3RVTC 3BT2L 4UV4H 5IV2B 1LMKA 4ZFGL 3OL2A 2QQLL 3O3BA 4D94A 4AEHL 43CAA 1H5BB 1UGNA 5CGMA 5L88L 1GOGA 2NY4B 1FRGH 3ISWA 3I9GH 5CBEB 1ZLVH 4YHMH 3PJSA 3VGAC 2KKQA 3MODL 1BECA 5JA9A 5FM8A 5SWQA 4QRTA 1IC4L 4O4YH 2OM5A 3D0LA 1URLA 2UZXB 2OMBA 3MC0A 5HHPB 5JMRA 3FMGH 3TVMA 2YD7A 3O3BB 1KJ2L 1G1YA 3CXDL 3FN0H 1BVLA 1OAZL 2JB6B 1TENA 3BPLB 1UKTA 1WFOA 3WSQH 1WICA 4ZUWA 2YUWA 4XPTL 4PUBH 2QQNL 3T77A 3MJ8A 2F53A 3L3HA 1GGIH 2YS4A 5DMGC 2B2XH 4L8BB 5ACLA 4HJGB 2GI7A 4KI1A 5D6CB 1OQOA 5DT1L 5BQ7A 2OJZH 1NSNH 4NQSA 2HRLA 3ARYA 1U2CA 3H7LA 2HVKB 5LQBH 1XGYH 2P5WE 1Z3GL 3D25B 5TE7H 4WFGD 3QNZB 2EDLA 4P46D 4X98A 1NGPL 2Z31A 3G6AA 3AGVA 5DDHA 2X44D 3REVB 4C4KT 3B2UC 1JGDA 1HOCA 1NBVH 1MUJA 5EORL 5I8EB 3W39A 3V8CA 3BHBB 3FONB 1DUZB 5FK9A 5E5RB 5L6YL 1UFUA 1FVEA 2B7DT 3C9NB 4DAGL 4Z95H 5ITBL 1KCUH 2EEBA 2PUQT 4PJFA 5AZEH 1UADC 4YWGH 5DF0A 4DGIL 3H3BC 4OCSH 5DUML 3G6AB 1TJIH 3CVHB 1MIEL 5I66A 2Z93B 4JO1L 2XPGA 3ZE1F 4LIQL 4HG4K 3CFDA 3TYGL 5H37H 2P5WB 3EFDL 4OAWA 5A2FA 3QUYC 1NEUA 5FM5O 1RIUL 5KSAC 2V2XB 4WV1A 3N1MC 5CKAA 1GZQA 2AJVL 3IT8D 4XVSL 4IRSC 4CJ0A 3LMJH 1AI1L 3VFUA 3DVNB 3ES6B 3SOBH 4UAOB 2A0LC 5JDJA 3QH3B 1F5WA 3ZHLA 2Q3ZA 4KTEH 3HE7B 2F5AL 4QWWC 5I76A 3I2CH 1A7NH 1X44A 2WAHA 3EYQC 4LQFH 1AJ7L 1F90H 3UBXI 4F7MB 1D5MB 5D7LA 3DI3B 3RWFB 3ARBA 5HDLA 1KPRB 3VFOB 3REVA 3K4AA 5EO9B 7CGTA 1HWHB 1DE4A 1IEAB 3QHFL 4S1SL 4NKMA 1BD2E 4Z78B 4HPOL 1ONQB 4RGOH 2X4SB 1T5WB 4ISVA 4W6YB 5ICYA 3L7EA 3HE6A 4PYHA 4FFZL 4XP4L 4X5WA 5C0BA 1OD7A 2E27L 1CDHA 5D93B 2W60B 2MQ0A 4KY1L 4NRZB 2W9EL 3GRWL 4H20L 3X12A 4XCYA 4S1QL 3SO3B 1G6RA 5IGXL 1X6NA 3MV8A 5FYLD 1P7QB 5TE6H 1OTSC 1RIHH 4QT5A 4IRJC 1TTUA 1ZSDA 4WCYH 5KVDH 3RWHA 1JVKA 5D1QA 1LK3L 5D9SA 2CQVA 4X6CE 4LLQB 5IW1A 1R5VA 3BN3B 4M3JA 1T1WB 2NY0C 4NFCA 3QIUC 5DC0A 2G75A 5CEZD 1C16A 4RAUA 3FQTA 3EZ8A 4RQQA 1RHHA 4UTBL 4UUJB 2R4SH 2Q1EA 1TZHA 1YYML 3GI8L 3SJVD 1UJ3C 4OZ4A 4TNVF 3EYOA 2YKLH 4F7TA 1WT5C 1AD9A 4JRXE 5A2LH 2OQJB 2EH7L 4P2OB 2ILLA 1OCWL 2SEBA 3MCLL 1Q9LA 5EO1A 1IKFH 3MCG1 4LSVL 1KJ2B 5F9JA 4PJEE 2EICA 4OSUH 1I8MB 3DTXB 3IDXL 3OPZL 2DM7A 2ZJSH 5KSBB 3FFDA 5IESL 2HLFD 1D5ZB 4ONFL 1S7WB 2W0KA 1FBIH 2HLFC 2D7OA 1AR1D 3D18A 1BBDL 3S35H 3FO0L 2D7NA 4PJ9B 5C2BH 4JFFE 4IOFC 4LMQI 1KTRL 5JPMA 1T7XA 3VFGH 2AXJA 4I0KA 2J6EH 4M7JL 1CF8L 1OAYL 3PWNA 2ED7A 4OUUB 3EO0A 1OGAB 4JVWA 1EGJL 3PHOB 5FYJU 5T1KD 3T65A 5F93C 4JFDE 4RMTA 5IG7B 1INDH 5HVGB 4LPUA 1M05A 4MJ6A 4N0FA 1YEEL 3SDDD 5A2KH 4HKZB 4P5TB 1NLBH 5DFTA 4WI3A 2Q87A 5EN2B 4PJ7A 4Y5VC 5CSGA 3B3IA 1X5HA 2MCG1 3DMMD 1U8LA 5HPOA 5HHOD 1N5AB 4U49A 2VITB 1ITCA 5ALCL 1NFIB 4EI6A 3L1OL 2P5EA 2BXYA 1R0AH 1K2DA 3PWLA 2VLJE 2LU7A 3MNVB 2DMKA 3TJHC 2ADFL 3LEYH 2A2QT 4XPTH 2X4RA 3UAJC 1GPOH 2H2SC 2HG5A 1QLRB 3DNKA 5FCSH 1W0WB 3RAJL 1DBBH 1MCDA 1OT1A 2W65B 1RU9H 2EDFA 4S0SD 4XTRC 1A2YA 2ZPKL 4DK3A 3GIVA 1GC1H 2AEIT 1Q0YH 2YUZA 3PWNB 4OUUA 3ZL4L 5MERA 4G9FD 4LSUH 5B8CA 2N56A 5JPMB 1MAJA 4WU7A 3N85L 1OAUL 3FTGA 1YPZA 4Z0XA 1LO2H 4DAGH 2E7LA 3V6BR 1AGDB 4FTVA 3VFWB 1R3JB 5B21A 1DQLH 2HTKD 1EMTL 2R0KH 1IAKA 2BNQD 4EIGB 4JDTH 5CJOL 1OGTB 5DYOB 4X6CA 4MX7B 2VLLB 2PTTA 5D7SH 1A6TB 3V6OC 2Z92A 5I2IA 5ITFA 2NY1B 5BMFL 1D5XB 5DLMH 2E9IA 4NJ9H 3JUYA 4ZS6C 3SGEI 3FQXB 1NKRA 5CBAB 3RL1B 3EYFB 3TBVA 4LU5H 3F7PC 4G6AD 2D7QA 1KJVB 4OZGA 4TTDD 5DHYA 1T1ZB 4X99A 4HKBB 1R3HB 2IBZY 2QSQA 2E7BA 4UQ2A 5I6XC 3ROOA 1X5FA 1E4XL 4YC2C 3TBTA 5C9JB 4LHUG 4PJEA 1JFQL 5ITBH 5AZEL 1HH6A 2HA1A 3C87A 5IW6B 1F3JA 1W0VB 3MUGA 4G6MH 3PV6B 3UTPD 4HS8L 4X4MA 4HWEL 1VERA 1A9EA 3GIZH 3CXHK 1F4WH 4XCYB 3AU1B 2I5YL 3V7AG 2JJVA 3WFZA 3K80A 5HPMA 2ZG2A 3QHFH 5L2JB 1HHJB 4CNIA 4GW5A 2XKSA 5AAWA 4LPXA 3L3DA 3VJ6B 4WWKA 5SWSD 4RZCA 2KH2B 1H8NA 1WCBB 1E4JA 4PYGA 4ZS7H 5D1ZB 1A9EB 5DO2D 3I2CL 2B0SH 1ZEAH 1NDGB 3FQNA 4R4NC 3MX0A 3JWNC 4ALAL 4IOIA 3TCXA 3L7FB 5MENE 4X8XA 1EZVY 1FJ1B 1CG9A 4PJDB 1FC2D 5D7IE 2VKXA 2FH8A 3RX7A 2IANE 1D5ZA 1U8LB 1RMFH 3TWCH 3HNVL 1CFQA 3QUYA 2J88H 2VUOA 4R2GD 2YN3A 1OD9A 4JZJC 4MDIB 4KZDL 3GM0A 2NNAA 4A2LA 5I30H 1A7PH 5T3ZD 4NQDB 4JRYE 3VXTB 3C5ZD 3EOBB 5C9KA 3ULUH 1SBBA 4JQVC 5ISZB 2XPGB 3CFJB 3HB3D 4DKFH 3TBSA 4MAYD 1WTLA 4KKNA 2V7NA 3VXOA 5JHLH 4HDIA 4TULL 5CGYC 5CWSA 2EH7H 4WEBH 1MCWW 3F65A 3VWKD 5CFHA 2Q6WB 4FFWC 4U1SA 4OJFL 1ZE3C 4OD1H 1S7SB 4OI7A 1RPQA 1IFHH 1U41A 1GHFH 4J3WA 4LRNL 3M07A 5F6IC 4X6FA 3MRQB 1EGJH 4J6RH 3GBML 1UKSA 3RA7H 3GMLB 3EOTH 2YEZA 5SWZE 4E41A 2J1KA 4U1NB 3TO2A 1XGQA 4PRPB 4NBYB 2YK1H 3HG1E 4Z0BL 1A3LH 2VZSA 4QKXB 3RWCA 4OV5A 3D85D 4QTHB 2LTQB 1QLRA 1YY8A 4PLKC 2A6IB 1A6AB 2I60H 1OB1A 1XCTB 1JHTB 3ARGD 3BJ91 3IAQA 1VACA 4NSKA 4NQXB 5FEBA 1T04B 3L3HB 1D7FA 1JN6B 1F2QA 1T83C 3MJ9L 3LHPL 4AG4H 3F58L 3BESR 1CDGA 2XKNB 3VCLB 1S78C 4Z0XB 1E0OB 1H0DB 4DGVH 1JWMA 2FIKB 3U6RA 4B7LA 3D3VE 3JV4A 5FB8A 4QRSA 5SWZB 5J57B 1ZTXL 1QUNA 4NUGH 4QXTB 3QT2A 1KLUB 1ROWA 4M5ZL 2QQKL 4P5KA 4WI6A 2ZUQC 3ZL4H 2V2XA 4WV1B 1YEJH 4ZDHA 5TQ0H 3V6ZB 3OZ9L 1NCCH 4MJIB 4ZUSA 1J10A 3CIQA 5IVZA 3TH4T 3RWEB 3A6BL 2AJYH 3B6SA 1QVOA 4LCWB 3HNSH 1C8PA 3AAZA 3FT2B 5D5MA 3PGFL 3GB7B 3ARDB 4GMTL 2VRAA 5DJ8A 2Y06L 4YFLI 5F9AC 3V9FA 2FEDC 3FN0L 3HE6D 4M5YL 4ORZC 3X3GH 5C0BD 1D5MA 4KDVA 4YFLF 5D7LB 1RHFA 1R0AL 3AREA 2HFEA 5EWIL 3UMTA 3G08B 3TT3L 3UROR 1DUZA 1ORQB 5FK9B 5KOMC 2J8UE 4M02A 4EDXB 3ALXA 1A3QA 3IXAA 4HC1L 5JO5B 3W2DH 2AXFA 3U4EB 1GZPB 2JB5H 1A4KA 2GTZB 5I17B 4FXKA 1S7XA 1DBBL 1JNLH 2Z8SA 3U9UA 1V05A 2J8UF 2YWZA 1M71A 1ACYL 2ZSWA 5E4IA 2XWJA 3VRLF 4Y4KD 3NFPB 1GOFA 4OGAD 4YPGB 2VISB 4JHAL 3QRFM 5DD6B 3VFTB 5BQ7B 3R1GH 1IM9D 1LO5B 3F12B 5KS9E 4RMWA 1DQDH 3C6LB 5D6DC 3VD4A 5MHSD 2RBLA 3U4EA 12E8L 3SJVA 2Q86B 2QR0B 5DVKA 4NN5C 1RZIA 4R96A 4OZIA 8FABA 2AQ1A 5FYJD 2C1OB 4G8GD 3WXWL 1EDQA 4E41E 5A3IC 3QBTB 3O8XC 2ICWJ 1J1PH 4JM2C 5D7SL 4WWKC 4YHPA 4G80B 5C6TL 3H3PL 1KJMB 1W72H 1MIEH 4QTIL 2KL6A 4NPYB 1LP9E 1BVLB 3ROLA 3HAEA 3X12B 4XCNB 1FFNA 2X1QA 5EU6A 2NY6B 5FO8A 4NN5B 1GAFH 3DRTB 2EC9U 3QEGH 1C16B 4RAUB 2Y25A 5CUSL 4BYHA 2B8OT 4ALAH 4Z7VE 1MY7A 4OGYL 4CADA 4U6TA 1N7ML 5DS8A 5D9SB 3LSOA 5I1AA 1OWRM 1BZ7B 3MXWL 2HJKA 3O2VH 3QXDA 4JY6B 2IAMC 3MRQA 1WV7T 2EECA 4IRZH 3TWCL 4H8WH 4CMHC 5IJVA 5IQ7H 1J05A 4JFED 4TQEH 1JE6A 2FECL 3DV4B 2EE6A 2I5YH 2VUYA 2BNRB 2W0PA 4HPOH 4XVUD 4HWNA 5DD1L 3WFHA 5DRXA 4LFHG 1Q9OA 3C8KB 4U1LA 3DROA 1EAPA 1YEKL 3ZHKA 1B6DA 2VC2L 1S9WB 3E2HC 5DMJB 1UQSA 4OD2A 4PRPA 5H8DA 1CVSC 4OJFH 3LKRB 3V5DB 3LKOA 3MLZL 4WO4D 2PF6A 2HTKC 2IGFL 1CICD 3GSRB 3VGFA 4LAJH 1KIQA 3FQWB 4J6RL 3HRPA 3W5NA 1NGWB 2P49B 3F8UB 2Y6SC 4MS8C 3NMEA 2C3XA 4BSJA 1HDMB 1NC2D 1T89C 5CSZB 5HYQB 5LXGL 1AHWA 2CR6A 3G04A 4NIKB 1UM5L 2GHWB 4MCZB 3HN3A 2X4PB 4XHQA 4OLVL 5F97E 1JNNH 5E8DH 4XB8A 2DQJL 3CU7A 3X14A 1U42A 3KPSD 4PJ8B 1J12A 2UUDK 2CK0L 4NO2B 5KOVC 3WNOA 1S7XB 2UZIL 5F1NB 5DJ6B 2YPVH 4UB0L 3W0WD 3IU3B 1D5BB 2DKMA 4NRYA 1P7KA 2BX5A 3QZWB 2DWEB 1I4FA 3RU8H 3PWPA 1KCVL 5B3JE 5J6HA 3OXSB 2ZJSL 4E5XB 4JPKH 1JF6A 3UXFA 3D39B 1HZHH 1NBQA 4DWHA 2ZUXA 1NCNA 3QUKB 1I7ZA 4X98B 1Y18B 4G6FB 4A6YL 3CXHJ 3QUZB 3IFNH 3MNZB 3GJFH 1IGYA 1INDL 4XNZB 1FYHB 4KJQD 1IC4H 3FHAA 5TDNB 4Y4HC 3OKNA 1KFAH 3OAUL 5IOPA 1AKJB 2FYYB 2HT3D 3G5ZB 3NIGE 3H9HA 4ODBD 5CBAA 3HNTL 5GGSA 2CRYA 4MWFB 4JGUA 4HXAH 1BQLH 5HGAB 2VDMH 2H2SD 2PTTB 2P8MA 3MLXH 4LKXA 4OFYA 1W0VA 5DQDH 2Q76B 2BRRH 5HGHA 3MMEB 1J1OH 3RVXD 5F6HI 2ZCLH 4RFNB 4YDVB 3QEQD 3IDNA 3TBTB 4GAGH 4JM4H 5GJTL 2UWEB 4Y1AB 4JFXB 1BQSA 1JGUH 2ZCKL 2DQUH 1KT2B 2EDOA 5SWQB 2YZ8A 2FJFB 1P53A 1T1ZA 4JR9H 1IMHC 1DQDL 3OKNB 4XC1H 4FQ1L 1NAML 4DVRH 1EPFA 3ROLB 1OTTC 2BSRA 4PJGB 3QXTA 4JFDB 4M4RA 2VZOA 4XVTH 4U1GB 1JPFA 3SCMC 4ERSL 3BPOC 3L5WB 4YHPB 3WEXA 1BJ1J 4BSWA 4F7CA 3C8HA 3CFIC 2DWDA 3E6FB 1A7OH 4XBPA 3WLWC 1CGSH 2ZCHH 4LCIL 3V52L 5DJ2A 1QEWA 2R2CA 1N0XL 2C9AA 4NBXB 3RQ3A 1MLBB 1N2RA 1YQVH 1T22B 4XNMB 4YNYA 4MDJB 5C0CD 4HFUL 1ACZA 4L9LB 2F8VA 1G9NH 3E3QC 4FOMA 4JFEB 3OKOB 5D2LE 4O2CA 4DVBB 3EOYG 3HZMB 3LS4H 2ZSWB 1DZBA 1ORSB 5MEOA 3V5HA 1MRDL 2W65A 5LWYL 5E8EB 4FTVD 4YDJA 4AEEA 2ZWLT 4M7KH 5IIEA 4W4OC 4XZUA 3HTLX 3OGOE 3FO9A 2HLAA 3IETA 3C09C 2HFEB 3ZKND 2NY7H 4KK5C 5J12C 4OF5A 1DQTA 4QWWD 2AK1H 4U7SA 3N06B 2VKWA 3ZTJH 4XAKD 3RTQC 1CE6A 4N9GA 4OZFB 5F96H 1QBMH 3O2VL 2DTML 4XCEB 5DJ8B 1TVBA 4PJBB 4JFEE 4PR5A 5FO9A 1AO7E 1SEBA 5D2LB 3EBAA 4H26B 3ZKXB 1FG9C 2OTWB 4L4TD 3CVIH 1JGVH 4ZNEA 2I24N 3C5SB 5EOQH 3UZEA 1KCSH 2V9QA 2D7TH 5DJCA 1PFCA 1XF5B 5I8OL 1KEGL 4K7PH 3QEGL 2H41A 3SGDI 4AIXA 1A9BB 3D1MC 5E1AA 3BQUD 4MQXC 2FO1A 5KTEL 1QG3A 4D9RE 3RL1A 4OGYH 4PJEF 4UILH 1DBKL 1MLCA 1MCOL 1KIPA 4PRHB 1H3XA 1M1SA 1T22A 3F7QA 1Y0LA 2JJTA 3WO4B 4D0CA 4NO0A 3QDJB 4JRYA 2BVQB 1TNMA 3TBYA 1EHLL 5IQ7L 1GSMA 4Y4KB 4JQIL 4ODSL 2AI0H 1KTLA 3W9DA 1MHHA 5TGBB 2WBJA 2NW3B 4RISL 1F4AA 5AYQA 3U0WL 2Z0BA 1HNGA 1R3HA 4LKXB 3MBEA 1LQSR 1IZJA 2XYCA 3BPLC 4GKSB 3NZHH 5CHNB 4LCUB 4M6OH 2OP4H 3WS3B 4G3YH 2UZIH 4X6CF 4AT6A 4KKCC 5GGSB 2HFFB 3SE4C 3PWUA 5SX5K 3Q5YA 3S36L 2IADB 4H25A 1MPAH 2HN7A 3KPRA 1QLEL 1BMGA 1I3VA 4L8CB 1NANH 3ULUL 3SDXE 2XZAH 5FM5M 3THML 5D1XC 3S36X 4N5UA 1W8OA 4MQSB 3GSNA 4U7KA 3UJTH 1XH3A 1FYTE 5I1HH 5CINL 4YBLC 3UPAA 3WHE0 2QSCH 3CLFL 4NN6C 1SJEA 3T0EB 3CLEH 4K9EH 3I6GA 2XACC 4PLKD 5F7MC 4OLWL 1YC8A 5C0GB 2WWMD 3PP3K 5T1DH 4MWFA 1G6RB 4TTDC 3B2UD 2P4AB 4KTDH 25C8L 2NQCA 2HMID 1FRGL 5HYJA 3NBNA 3DECA 3BW9A 3PHSA 3RRQA 1JPSL 1QSED 2OTUA 3D0VB 4G9DB 5IT2L 5ANMB 3O0RH 4NN6B 4XWGH 5I1DA 1LD9A 1VPOL 5CP3H 4PJIE 3T0XA 3RVWD 1VESA 5FF6B 2BDNH 4HAGA 5EU4B 2RHEA 2MQ3A 3H42L 5F21B 4HXBH 1J8HD 2BC4A 1OLLA 4JJ5B 4YGAB 2XIDA 4R4FH 3E6HB 2FB4L 4RFEB 5EFIB 3ILPA 3I9GL 4I9WD 3VW3L 2DQDH 5IF0A 3H7BB 1ZHKB 4HZAA 2XQYG 1EFXD 2GYSA 3QH3A 5EU4A 4HKZA 3KPQA 2UY6A 3EDKA 1DQJB 4NN7B 4BFGA 2PW1B 4KMTL 3IDYC 5HXMA 5L2JA 4XP9L 1LP9F 3VWKB 1Q0YL 5EO0B 3CUPB 4OLXH 1QA9B 2DF3A 3UTTE 2R2BA 4YUEL 4MAYB 4CVUA 5FCUH 2IFFL 1FV1A 4JN1L 4XC1L 1YEFH 1F3JB 4JN2B 5IB1B 2AGJH 4HGMA 5HBBA 3MJ8B 2ZUTA 3P0YH 2GIYA 2ESVB 1KB5L 2Q7YA 4NN7C 2RR3A 2DDQL 2OYPA 1E4KA 3DETD 3N1GC 4TVPD 5HJ3A 3VA2C 1B3JA 3SN6N 4WO4A 2LVEA 4IMKA 4I77H 1LE9A 3WN5C 3BD4A 4K8RL 1MIML 3SO5A 5EZOL 3SDDC 1NGXA 4AH2B 3WJJC 5DTFA 2HVKA 1NAMH 2W60A 8CGTA 3B9KC 1WGOA 3K2MC 2FO4A 5EOCL 5GS2D 1MFAL 4EQ2A 2WWMC 3H9SB 5EU6B 2H2PC 2FZ3A 3IJYB 4JY4A 5D1ZD 3L3GB 4LVHB 4ISVB 2ARJQ 4OZGE 4Z95L 4YO0A 4JFXA 1K4CA 2FSEA 5SWSB 5ANME 5CIPH 3FT3A 4JFQB 3D2UB 3AB0B 4YZFF 3ULVH 5HGHB 5FYLH 4P23C 3VFOA 3O2WH 5E9DB 2CDGB 2AAVA 1TDQA 2ICEA 1U92A 1WWCA 3D6GA 3H0TA 4JY6A 4LF3B 3MV8B 4RBPH 2J8OA 1RJZB 3U1SH 5MERB 1OP5H 3T3ME 4CRPA 4RGOL 5FDYA 1GGCL 4GQ9H 4NQCE 1PEZA 1F4HA 3ESUF 5HHQA 4JFPA 1ZXQA 4DKEH 4OQTL 1JGVL 4JPWL 5E6IA 3CDCA 4M7KL 5F89A 3VI4F 5LKNA 2GK0B 1CXEA 5SWSE 3VI4E 5CCKH 3C6SB 2W0FB 4N8VB 4E42A 4HUWB 4OIIH 3OMZA 4ODSH 5DZOA 2Y9RT 5KS9B 5E94A 5JIIA 4S1RL 4BZ1L 3N0PB 1IAIM 4IRZL 4PJFB 3UTZA 3BZFB 2P44B 4IOFD 1Q9WB 3ME0A 4MJ2A 3NZHL 3KPPA 3WS6C 3BGFB 5GIRA 3DARA 4OLYL 3VXME 4JJ5A 2N7BA 3SKJL 4X5XA 1NFDB 4UOJA 2NTFA 4OFYD 3S36H 4I48B 3OB8A 3BQUC 1I7TB 3DV6A 4Y19A 3QEQA 3MV8D 1LP9B 5GJSH 4LCWA 4OF0A 5HHME 4FQCH 3OWEA 3LKSA 1U6AL 4PRPE 3UJTL 5J3HC 2FLRT 4NHCL 3MJ9A 5EZLB 3H9SE 4JO2L 4N1CA 5JHLL 4MCYA 2B39A 4U0RC 1QLEH 3K2UL 2DOCA 1IFHL 3KNBB 2J12B 4PG9A 1WCQA 4OKDA 3SDDA 3H9SD 5HHXH 3LRHA 4LNVA 5AZ2H 4EOWL 4GRLD 3OG6B 3GSOA 3QDME 5ADOH 3LVEA 4L8SB 2AKRB 3QNXA 1S9XA 3MTRA 1IGML 4WFED 5I1HL 1MHEA 4GSDH 4KPHH 2F8XC 4MA3A 1DN0B 3D25A 3QDAA 3CFKA 4NP4L 3E8UL 3BIKB 3VRIB 3LN9A 3O0RL 1AHWC 4XWGL 5CEXA 4G6JH 4M8QA 4R0LB 4KAQL 5EOTB 5TDOA 4NQCB 2IQAA 1ZLUH 3CSYA 4LQ1A 3GEWB 5I15H 3HMXH 2GEEA 2BNRA 4L4VA 4C83B 4LKCA 3BSZH 5IW1B 1QFUH 3G6DH 2ZG1A 3G9VA 3VW3H 2ADIA 4ZUWB 4MS8D 1QKZH 3LKPB 2AJXL 1I9JL 1VPOH 5EOCJ 2WZPD 2BSTB 4I5BB 3SE9H 3ESVF 4NT6B 5ALCH 4JFZH 1MHPL 2YA1A 1QNZH 2ITDB 3SCMD 2VXSL 1QHOA 1IBGH 4WEUD 3VXSA 2YD1A 1OLZA 1HINL 4FABL 5DJAB 1AGBA 4RNRA 2BVQA 2OZ4H 2FB4H 3RWDA 4QTHA 1EFXB 1S3KL 1EJOH 3EO9L 3CNKA 4XP5H 3SGKA 3GHBL 1CFNA 3DMMA 3RNQA 4UNUA 2IQAB 4Y5XC 2PKDA 1GIGH 4JKMA 3HPLA 1CFVL 3DX7A 5BS0B 3HNTH 2R1XB 1IGYB 3UC0H 2Z9TA 3EJYC 1PW3A 1T80A 2R56H 2YXFA 2WINB 3MRGB 4JFDD 1HYSD 3NCBB 4ZUVA 3W9EA 2DI8A 4EEEA 2PXYB 4JDZA 4F7PA 3W11C 4JB9L 1UB6A 3T1FB 1S9XB 4LFHD 3C2AL 2X89A 5HI5D 4XCEA 2PR4H 3O9WC 3W82A 1NGZB 1LNUA 1WAAF 4WU5B 4WI8A 1R5WA 5D1ZC 1KB5H 3IETB 4QOKE 4XPHL 4MXQC 3EYUH 4Y1AD 5JHDA 3HS0B 5BMFH 2J8HA 2EZ0D 3BH8B 4Z5RA 4OCNC 2YMXH 4R9HA 1HXMB 4CMMA 1MFEH 3QDGA 5CGTA 1NL0H 3TYFB 1R3KB 2ZUWA 1B0GB 2BCKA 4YXHL 2M26A 3Q6FA 5CJQL 1DQLL 4N9OB 1YNKH 4OIAA 4YHNA 2ERJC 3QDMA 4MZ2A 3VXRB 1XF2A 4M7LT 5DJXA 1DLHA 1CK0H 2DDQH 4NM8L 5DEZA 5GQBA 5E2TH 3QXUA 1DLFH 1J1PL 2QSTA 1OTUC 5TDPB 3V52H 4AQOA 3T1WA 4KI5E 4CVXA 1NKOA 4POUB 4NZDA 1OP3K 3MRNB 5L9DH 3D9AL 4KZEH 1WZMA 1T66D 4PGJA 3S34H 4UIKL 3L6FA 4I18B 4ONHA 1GCFA 1BQHB 3L5WA 3UTOA 2UVEA 4NQEB 1GGTA 3WIIH 5FYKE 2VZ1A 4ZDHB 1H3PH 1OHQA 4RGNB 1A6UL 3L5XH 5F6IB 3WLBA 1ZLSL 5D6CA 3VG0H 3DRQA 4JZOA 1HKFA 3B9KD 1K3IA 3FQXA 5DJDA 2G9HB 5AUMB 1MH5A 1U36A 3QDJD 3O6KL 4UUJA 1KELL 4M1GH 2EH8L 5BV7B 1HH6B 1I1RA 3AY4A 3T0EA 1LEGA 2KPNA 4B0MM 4Y5VA 2JELL 1TQCB 3KPSB 3SGEH 1BD2D 1KPVA 3NIFE 2DJSA 2X4NA 2XZCH 4YDLB 1XH3B 3HC4H 4YX2H 3GSNB 4P4RA 1DANU 5C0RH 4JLRB 3HNVH 3VXSE 3UTQB 2ICWA 4XCCH 2B20A 2M8XA 4OV5B 1OF2B 4PJAB 1NDMB 3MRRA 1VADB 1U8QA 1I1YA 2FYYA 5IEHB 3GHEH 5HGDB 1VGEL 4UILL 3EGSB 1EFXA 1MCOH 2EIBA 2QLVB 2F54A 2VE6B 4JCMA 4MQXD 4OGAC 5DYOA 1JP5A 3HC0B 3FAXA 5D1QC 2NXYC 4EOWH 3QFJA 3HZYA 5EA0H 2NXZB 4L4TA 4ZXBD 1U3YA 4P2RD 4HWBL 4Y2DD 3L5IA 1UYWH 4KZDH 1WZ1L 5BW7C 2ZOKB 1UM5H 5D7IA 3DVFA 3CSBA 2V2WB 3QQ4A 4A2MA 5BO1L 3TV3H 1PYWA 3SGJA 1KIPB 4D8PB 1CGXA 2Z4QA 2CD0A 3C8DA 3MNWB 5DD5H 4MVBC 3DRQB 4JZOB 5GJSL 3QA3B 5HI4D 1UA6H 3MPCA 4ZFZA 4YAQA 4X4XB 4QRRD 3R0MA 4DW2H 2IALA 1J5OL 4R7NB 1WIUA 3B8YA 1PG7L 4UIMB 3SPVA 4LARL 5I8CA 5C09E 1V7ML 2NXZD 2OTWA 1JYWA 2AJZB 5ESQB 1SBSH 2GTZA 5I17A 2VZVA 3U4BH 1QO3B 2DLHA 3OKMB 5JR1H 1T0PB 3OX8A 3MOAH 3NACH 1K4DA 3BRDA 4X4ME 3QDJE 1HHKA 2EDNA 1P84K 1QFUL 1A3LL 1A21A 2EE3A 1DLHB 3E1F1 3FQWA 4F37F 4OLWH 4Q6YA 1Z5LB 4IRSA 1YMHA 5T1DL 1DVFB 3IDJA 4RZCB 5EBLA 5DDHB 1KEML 5JW4N 3V5DA 3VGDA 3CDGB 2CRIA 2DL2A 3KS0J 2VR4A 4PLNC 1MQKL 3F7YA 2X6MA 3OAUH 1OSPH 3MJ7B 4XI5D 2OQJA 1KJ2H 3FB8A 4PV8A 1JPGB 3TVMD 4NFDA 4J8RB 3ZYOA 3PL6C 4LVNC 4Y16B 4I48A 1U8IA 4XAWL 2ATKB 3QA3A 3DX9B 2E8YA 4NYLA 3IAPA 4HXBL 1GGIL 3NTCL 3O3DA 4YDIL 5FGSA 2GAZA 3HG1D 1T1WA 3IRPX 2COQA 5FIEA 1H8SA 3U6RB 3T4AA 1OAQL 3HZVB 5I1IL 3MA7B 5C0EA 3QG6B 4CW1A 1BWMA 2D0HA 3R06B 3AVEA 2AJYL 3TIDA 4AZ8A 4WEMB 5DGQA 2VDRL 4KKLC 4ETQB 1ZGLB 5HYFA 1HHGA 4X0KA 3LV3A 5CJQH 3GNML 1QSFD 5C0AA 3EYUL 5D7LD 4ZPTB 4HK3N 2RQ8A 3IGAA 4HCRH 4ZTPH 3HE6B 2VL4A 1QYGL 1ZMYA 3TT3H 5A16B 3P2TA 1II4E 4HV8A 2WV3A 4ETQA 3IDNB 4Q0XH 4JO3H 1CGSL 4LCWD 2ZCHL 5L8KB 4YFEA 1PBYA 4X4YA 3IFOB 5BVJB 3S34L 1FORL 1QFOA 3T8XB 3WNNA 4TN9A 4PJ8D 3NCJH 5B39G 3ULSB 2Q7YB 2JIXA 4YDKH 4PLJC 1PZ5A 3ZT5A 1G1CA 1VGKB 1B0WA 1OTTD 4PJHB 4RCAA 3O3DB 3OKDA 2D03L 3VG0L 1SVCP 1AO7B 3SKMA 3RY4A 1DBJL 1U8IB 4FNLH 4WENB 1SHMA 1U8HA 3RZCA 4HMCA 1JPST 3MRFB 3ARFC 2PXYD 1OP5K 5E6IC 3BKCL 4K8RD 4WO4B 1ZGLM 3V6OE 3H3PH 4KK9D 4G6KH 4PRHE 4XMPL 3O2WL 4HW6A 1C08A 4UT6H 5ADPH 5C08D 3AM8A 3MYJA 1FFPB 5BS0D 2WNGA 3D9AH 4HJJH 5B3NA 1PG7W 2GW5A 4I3GA 4S10A 3CVIL 3U1SL 3WFEL 3ZDZE 4JRXB 5EOQL 3VH8G 5DJZB 4DQOH 2NTSP 3QULB 1CL7H 1OP9A 4WHDA 5E5MB 5I0DA 3MUHL 4OZHA 4E9LA 4RRPA 4OQTH 5FOJA 4JFHD 5H35B 3PHOA 4WFEE 4PRDA 3EJYD 4PJ5D 3CDGA 2E7CA 1FDLL 1D9KD 3OJVC 4M1GL 2UV3A 4QHLA 4HWUA 3ULVC 1UXWA 1RUAL 4GS7B 4NNPH 3UEZA 5DA4A 5EU7E 1PYWB 4DZ8B 2A1WH 1TLKA 2GJZA 5DD1H 1YJDL 2YUVA 4KU1A 1M7DB 3C5ZB 3HC4L 2R4SL 3KWWA 4R97C 4JFOB 2ZG3A 3GI8H 5HDOA 2XKNA 1G7LA 3DIFB 3ULVD 3C5JA 2F53E 1MWAL 3O45B 4GQPH 3HR5B 4NQXA 4Q9QH 5HHOA 2DQJH 4GS7C 3QIBB 5JZ7D 4Q9RH 4A6YA 2WIIB 4S0TD 5BO1H 5IFAH 5EC1A 1A5FH 5FHBH 5GZNC 1NCWL 1RURH 3P77B 4G8GB 3VH8B 5IESH 5CD5C 4CDGC 2DQTL 2A74A 2PYEB 1P1ZA 3UZQA 3EYVA 4JVUA 1BBDH 3S35L 4C55A 5GRXG 4L5FL 5A1AA 5CINH 4GRMB 4PGEB 4XCFL 3CLFH 2ZOLB 1MFDL 4GFTB 1V7MH 3QHZL 4OCRL 2DLGA 3U0TA 5GRVK 3PV7A 5H94A 2WANA 3NGBB 5HYSG 5F7LB 3PWVA 3PG2A 4Y4HB 4B41A 4ZAKA 2ATKA 3S88L 3VWJC 4H1LA 5ENWB 2PN5A 2X10A 5B8CB 3MOBH 3CC5B 4FFYH 5HGDA 5JXEA 1FZOA 1UXSB 1A2YB 4PJIF 4QO1A 2NX5D 1XF4A 1YMMA 4P2QE 4RIRB 3QG7H 3TA3C 4GOSA 3FOLA 2BDNL 5HVWA 1FVCA 2O5XL 3G5YB 3BSZL 3ZDXE 5BOPA 3MBEB 5D5ME 5GS1A 2EZ0C 3VFMB 2QADB 3NGBC 2YPLB 1AQDA 2FWOB 3S4SA 5HJ3B 1I9JH 5DZLA 3OXRA 2AABL 3KYMA 5FYKU 3ZE0E 4NQVA 4BZ2H 4C4KO 1FL3A 4ZSOA 1B4JL 5K9KA 3MRNA 1IARB 3PIQB 2BRRL 3BFOA 2GK2A 1ZHLB 3HE7A 3I84A 5HTSA 1KFAL 2BHYA 2VL5B 2ZPKH 3VFSB 1R24A 3C6LA 4KMTH 1NBYA 5J12B 2OL3B 2GITA 4U2ZA 4X4XA 4YDJB 5I1KH 1KPUA 3CFDB 2GSIA 1U2HA 3MJ7A 4LLUB 6FABL 2LABA 4U31A 4TPRH 3I02B 1BEYH 3BKMH 2Z35B 2Z4QB 5KVGL 2HKFH 4E41D 1EMTH 4O51B 4GKZA 3RUGF 2DBLH 2YD5A 5BV7L 2YZ1A 3FN3A 3TPUB 1X5YA 3SJVE 3PDOA 5E1HB 4K7FA 1MLBA 1ZV5A 4H0GA 2AK4B 4L9LC 2D7MA 4OGXL 1XGTA 3WE6A 1XR9B 5CEZE 1FGNH 4HUUB 1ND0B 4PG2C 2NZIA 2CLZA 15C8H 3EFFB 4LBEB 5E9DE 4ONOA 4ODUB 1KN2L 1I8IB 1MQ8A 2EC8A 4W6XB 4UQ2B 5HDQL 2D7PA 2YR3A 3UBXG 4HIJA 2WINA 3BEWB 5C0JB 3LS4L 4ZNCD 1P9MC 4Q6IC 4JFDA 3FOLB 4IOSD 3UDWC 5F7KC 1VKXB 1QYGH 4QRPA 3DMMB 3RNQB 1BLNB 2P46B 5ETUA 1N0XH 4UT6L 5F3HA 1LHZA 3ZT6A 3OAYH 2EKSB 3IXTB 5CEYA 4DFHA 4YHKH 2IPTL 5JW4R 3BN9D 4NM8H 1QEWB 5ISZD 3VMNA 4Y1AA 4JZJA 4I13B 3MBXL 5JHDD 4MA7H 1J05B 4P9HL 1RZKL 3LS5L 3V4UL 2R1YB 3T1FA 3ET9F 5MI0C 1OGAD 1J11A 4NQDD 2Q76A 4HMDA 3EYSH 2Z91B 1MCRA 1MRDH 5LWYH 1GYAA 3LRGA 5C0DA 1UB5B 4KC3B 1IE5A 2IF7A 3MRPA 3RY5A 3KYNA 1NFDE 1MELA 1ZHNA 4R90H 4HUVB 1VKXA 3LMJL 4U7MA 1XGQB 2CLVA 3U7WL 5BCAA 1W0WA 5I2IB 2PO6C 3QIBA 4FMKA 5DQ9A 1DDHA 5D6DA 4Z7UE 4AY0A 5C0DB 3TF7C 1N59A 3BIKA 4GXVL 3VRIA 1VFBB 2FX9L 1DQQA 2AV1B 2DJ4A 2X9WA 1MFBH 4Y2DC 1QSVA 3OV6A 2WBJB 2J88L 5DI8B 3VXRE 1TPXC 2HJFA 1MWAH 1S7VB 3N1PC 2AKRA 1KGCE 1QLFA 2P7TB 5IHZA 2PTVA 3ARPA 3RI5F 1OVZA 4IHOB 4PGBA 1T03L 4G43A 2AK4E 3DX8A 4XNYH 5E7BA 2ZZUT 3QQ9D 3S37H 5L7XH 1WT5A 1Q72H 2AEPL 4JREB 3VXNB 2YUXA 2G2RA 2PYEA 1D5BA 3MGTB 1QRNE 4G3YL 1I1AC 5JQ6H 1T0NB 2DLFL 2BZDA 1NCAH 2KUTA 3LH2L 5HI3D 4CVZA 4KKBC 3MFFA 4WI5A 3RVWC 1JRHI 4KI5F 4PD4J 3WYRA 2JJSC 5BXFB 2DM2A 5IVOA 4NQEE 3T0ED 2F53D 1AQKH 3QWRD 2AI0L 4OIBA 1RZ7L 3IU4L 3UCRA 1FVDA 4N0UB 3RUGE 3BPNB 4PJBA 4IIQB 2DKSA 1EUTA 3WNLA 1RURL 5IROC 1FYTA 3LIZL 4PD4K 2VZUA 1FJ1A 4HLZG 1NGZA 4M6OL 3O3AA 5E2WH 5ADOL 1L9NA 2EDRA 2HT4C 2CMRH 2XQBL 3MOBL 1CBVH 1BFSA 1JV5A 3DXAD 2OLDA 2AEQH 3GSRA 1CLZH 3D85A 1I1AA 1FVCB 2YBRB 3VFRB 4JJHA 4FQIH 5K33A 2R1XA 2HFGH 3I02A 2AP2A 5BJTB 3BPNC 4EN3D 1LD9B 4R2GC 1ZS8B 3B6SB 3HMXL 3O3UN 1HILA 1LE5A 3RUGB 3DBXA 4OCWH 2ED9A 4DKDC 4M1DL 4HT1L 3MRCB 3WN5B 1HKLH 3HS0A 2E7HA 1JRHL 1MAMH 3VFSA 5D5MF 3QEUB 1ZTXH 5J1AA 1FL5B 5B4MC 1N3NB 3Q5OA 4JFZL 4R4FL 1LNUB 4PRHD 2BFVH 3QIWC 4Q9BA 3DTXA 4RAVB 4WUKL 2R0WH 4YHLL 1O7SA 4Y5XA 1EO5A 5DUPL 1HINH 2PXYA 4FABH 3VFVA 3OZ9H 1G6RH 4FFWD 4KDTC 4W81A 1N5YH 3QRGH 3BKJH 4ZUTB 1EGJA 3S3SA 5KSAB 3SDAC 4MAYC 3PGFH 3T2QA 4IRJB 4AMKH 2YA2A 4LP4A 3FOMB 1BLNA 5J6GB 4XX1E 3LDBC 5E08L 1VFUA 1I9IL 2EO1A 5JW4Q 4FRWA 3ZT7A 2CXKA 2DBLL 4NZTH 5K9QG 4N0CD 4F57L 5I16B 3OF6D 5DRWB 3HR5A 1G9MH 1QFWM 2A73B 2DQDL 4NPYA 2WBWB 2ZSVB 2VTFA 5DURB 5FDWA 1EX0A 2JB5L 3PL6A 5I73C 1X5JA 1U92B 4PJ5A 3SDDB 2X9XA 1A7RH 1LO0H 2ADIB 3TZVB 4J12A 1HE7A 4LEOA 4I77L 4MA1B 1MI5B 4U1JA 1KJ3L 5EZOH 5C0CB 4EXPX 3H9SA 12E8H 4KKCD 5C92A 3RL2A 2E8ZA 1MEXL 4GRLA 5FO8B 3BO8A 4YXHH 3P73A 3HKFA 4O58L 3PDGA 1U8NA 3LQAL 4OCMC 4R4BA 4ZPVB 3U79A 2P5WA 2BY0A 3KLAB 1UEYA 3OAZH 5BZWA 4LLYA 4OBRA 3GGWB 4LGRB 2ORBL 3ARRA 3GSNH 4G5ZH 3C5SA 3D3VB 2VXTL 1N8ZB 1I7ZB 3F5WB 5EU5B 1OWWA 3QUMH 4EI6B 2A77L 3MA7A 4EBQH 1OSZB 3T2NH 2NY4D 1P5VA 3WS6A 4H88L 4KUCF 1N6VA 3G5XA 5E94B 2OS7A 1REIA 2AW2A 4FQ2L 4NYLB 3AS1A 1KIUA 4QHLB 2Z31B 1P9MA 3BAEH 5I74C 4LLWB 3RWGB 3TP4A 1RJYB 1TVDA 2V7HA 2XZQH 4QRQB 4Z7UA 3GSUB 3X14B 1MF2H 1U93A 3SKMB 2HRPH 3EDEA 1CXHA 3U9UB 4NKQB 3BIBX 3FKUS 1UEMA 4FZ8H 4OF6A 5D2NB 1SEQH 3GKWL 1ZHKA 4MXWL 4HLZH 1AHWB 3VXMB 3B83A 2IPKB 3QO1A 3JTTB 4AEFA 4G6ML 3ARFA 5E8OA 1NGWA 3BHBA 3FONA 3IJHB 4GKNB 4OFIA 3BZEB 3GJEB 3RX8A 2QHRH 5J7CC 2VLJA 1FYTB 3S4SG 1F4WL 1KXVC 3K46A 3WD5H 4GRMA 4PGEA 2XNAB 4GT7A 3LKRA 2OCFD 3D3VA 4Z7QF 3ARTA 3QUZD 4LLVA 4OD3L 1NGYA 3IKKA 2A6IA 1QD0A 3HMWH 4KKAD 4ZPTA 4X9FA 4G8EB 1QR1A 3QQ3A 5KVFH 3P0VL 5I1JL 1JCKA 4YZFE 2DD8L 5D8JH 2CKBB 5JOFA 3K1DA 1V7NH 4OZGF 4MB3A 2E9WA 4U6XB 4HWBH 1EFQA 3H8NA 4JAMB 3ZE1E 3REWB 1F11A 1RMFL 1CLZL 2R29H 2E9JA 3TN0B 4BK5A 1RZKC 3WV0A 3OB0H 4U1KB 4R0LC 1CQYA 1ADQH 1AC0A 43C9A 4FQJL 5F7WC 3TBYB 1C5BH 1DDHB 4XC3L 5JXEC 4QRTB 1D9KA 1CU4H 1ZKAA 1WIOA 1P4BL 2P45B 3L3OB 5JOPE 4M7ZC 5HD8D 1B0RB 3X17A 3DVIA 3VXSD 1ZT1B 3B43A 1RUPL 4AL8H 3FOMA 4UNTA 4LCCA 1A9BA 4GKSA 3QUYD 4XX1G 4NQDE 4KQ3L 1BM3H 3G6DL 3PGDB 3BZEA 5DUPH 3WUWA 5ISZE 5D2LA 1ZLVK 3W9DB 1H3VA 3SEPA 1EH9A 1U8JA 3Q6GL 2VJXA 4DN3L 1YECH 4U1SB 1EUUA 1GJIA 2ESVA 1KC5L 3CFCH 4HZLB 1A6VH 3O3AB 2W91A 1DBAL 1JBJA 2BOCA 2L7JA 3BPCB 1PLGH 4KAQH 1T21A 4F3FB 1HQRB 4U1IA 2Y6SD 2NY5L 3WDHA 2G5RA 1JMZA 3UDWA 1J1XL 1OP3H 1LO5A 1U8PB 2XTJE 4KDTA 3IDUA 4MSWA 1CICC 3EOBA 2VYRE 3P0GB 4OAWB 5EO0A 2A83B 3I50H 4P23A 4NQDA 1BF2A 2IH1A 5BJTA 2WQ8A 4ESKA 5CZVH 3V0VB 3B5TA 1AE6H 3BO8B 1KTDB 4YHIB 4AMKL 4I0PB 1MHPH 3RDTD 4O9HH 5E99H 2FECI 2APXA 1XCQA 1YA5A 1FNFA 3WUWG 4I2XB 5D71L 2D2OA 2NY0D 2OX5A 1QOKA 1TCRA 4UOW1 3T8XA 2ZP0T 4DUWA 5I75B 3CZJA 4JR9L 3VU2A 2GY7B 4PGDA 3W81A 1VHPA 5L8JB 3KJ6H 4PJ7E 4HFWA 3DOSA 4UDUA 2BMKA 1KIQB 5F1SA 2M2DA 4UIMA 5DFWH 3U4AA 5T33L 1CD1A 3EOAA 1NCDL 1NSNL 1WBYB 2VWEE 4ERSH 3SGJC 3U9PL 4F37K 3U83A 3ZDYF 3DUSB 3GSVB 4YEFA 3CCHB 3VMOA 3MUZ1 4X9BA 4M8VA 1FNAA 2BOBB 3KHOA 5TE7L 1EEYA 1VFAA 1KG0A 4PGCA 2O5YL 3Q1SL 3V0WL 5ESAA 4MDJA 4MNQD 2ADGA 2LAAA 5GRWA 4LASH 5LGKA 2IBGA 5KSUB 4V2CB 1MWAB 3QI9A 1AGFB 1U8MA 1K8DA 1N4XL 5IQ9A 3C6LD 3SDXF 4V1DB 1P4IL 1IM9B 1FCGA 1XF1A 1FL3B 4F2MA 1L7IH 4JZJB 1N59B 3FZUC 5DVLA 2R2EB 2WUBL 2BHZA 5D7IF 4HBQA 4L3ED 2BNUB 1NMAH 1TJHL 2VIRA 4OF7A 4D0CB 3BWAA 5C0IB 1NC4D 1VEOA 3D0LB 4H88H 1JPTH 3DWTA 4KJPC 5MEQA 1JGLH 1NDMA 1A7QH 3MLYL 3TEUA 4NRZA 1U8QB 2VDKH 1EEUA 3TESA 1S5IH 4ZOEA 1DLFL 1U95A 4AT6B 1RFDH 2VQ1B 4NDMA 4KGLA 4PP2B 2BNUA 1KELH 1NAMA