4KV5E

Scfv gc1009 in complex with tgf-beta1.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSNVISWVRQAPGQGLEWMGGVIPIVDIANYAQRFKGRVTITADESTSTTYMELSSLRSEDTAVYYCASTLGLVLDAMDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Transforming growth factor beta-1
publication title Structures of a pan-specific antagonist antibody complexed to different isoforms of TGF beta reveal structural plasticity of antibody-antigen interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 120
sequence length 120
chains with identical sequence G, H, J
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kv5E00
1BGXH 4JZJC 3L5WA 3Q0HA 3C09B 3SDCC 4M1GL 1BBDH 2G60H 5A43C 1DBJL 4XMLH 3N1MC 3T2QA 4U3CA 3IFNL 4Y5XA 3H9YA 1D6VH 2EH7H 4UU9A 1OAUH 1E4WH 1MLBA 1U8QA 3VI4F 4WY7L 3D9AL 2AABH 2PW1B 3OKLA 4MWFB 4UAOC 1H0DA 3NN8A 4TTDC 5K9KB 5LXGL 1JZ5A 2UZYB 3QIWD 4PRHB 2OCFD 1W0WB 4WWID 3T1FA 4QHUB 1PJ9A 2UZIH 2CIIB 5IB3A 4S0SD 5INCB 4W4OC 1MJUH 4DKAA 4ODTH 3WNMA 4OI9A 1RK0A 4F7CA 2AK4E 5J0BA 1S5IL 3LV3B 2PO6D 3A67L 1YJDH 4UDTB 3AXLB 2Q7YA 3W2DL 3FCTB 3BZ4B 1ORQB 2BNUA 3EO1B 2EDHA 3L5HA 1MREL 1T7XA 4KKCD 1BQSA 4NQDA 4XH2B 5FCSH 4JVWA 4XI5C 5DRXA 4NT6A 2QKIA 1CLCA 4Y2DA 1RHFA 3HMXA 2PXYA 2VJXA 1CGWA 2J5LC 5IMOA 3WHE1 5IV2B 5JZ7D 3V0AC 4FNLL 1OB1A 1XAUA 3CSBA 1R3JA 5HD8C 5D6CA 3O2VH 4EQ3A 3UYOD 2PUQT 3DUSA 1KXQE 1OQOA 3GMNB 4Q9QH 3RVUD 4WWKB 1MWAL 4M7KH 4EVNA 3QDJB 5DVKA 3VRIA 3TT3H 5C0NC 1HN1A 1JV5B 4ZTPL 3TA3D 4DOHE 4RIRB 2MNUA 4MJIA 2E7MA 3VFWA 4OCLC 1T7YA 2XN9D 3EJZC 1JI2A 5BRZE 1FQ9C 3HUJA 3GMOA 3MLXH 2DYPD 3CFKA 4X6BA 2Y7QA 3LKNA 3P4LA 5LVEA 1XCTA 1QO3B 3G5YA 4JKMA 3CUPB 5HI4C 4P46A 2XWTB 3TCXA 4NYLB 3GB7A 5KG9A 2VUOA 4QCIA 1LO4L 4LAJH 3QFDB 3OZ9L 3MYZA 4PGCA 4Y1AB 5EB9A 1N8ZA 3O3EA 2OZ4H 1KELH 2DM3A 4M5YH 1GGIL 1P4IH 4AM0A 4CU7A 1NMAL 4YFLF 4BZ2H 3ALPA 1J05A 4OUOA 4GRMA 1RZKL 4XP9L 1Q8MA 3LRSB 3EFFB 5DVLA 1KG0B 4KJPC 4HKZA 2H32B 5GSRB 3EYQC 3A6CL 2VSCA 1IC7L 3EIFA 4YQXH 1IL1B 2NX5B 1VPOL 4GW1A 1E6OL 1R6VA 3TESA 4EDWH 1FE8L 3CPLB 4OF8A 4NKQB 4PTUB 1DQQA 1IGCL 4KK8D 4X99A 5GGTA 1GGBH 3MRCA 4FFZH 3KLAB 5HDBF 2UY6A 1PVHA 1CICA 4LARL 5I8OL 5ELIA 4NDMB 2B20A 2UZXB 2ATKB 4GS7B 3UTSB 5DK2A 3AS0A 1J0ZA 4RMUA 1FVCA 2AJZB 1UB6B 1NFIA 2DQTL 3KHOA 5E5MB 5ACLA 3DV6A 4HS6B 4JO4H 5IW1B 1X4XA 2BSSA 1WFNA 3RWEA 3GEWB 5JO5B 2J8UE 4KQ3H 3V4VH 5DDHA 2YS4A 1JNNL 3G6DL 3QCTL 5ABDE 3IDIA 2C9AA 4L5FH 5DJ2B 3VD7A 4NQCA 3O9WC 2EC9U 4Y8AA 4U6TA 2VDMH 2I07A 2WIIA 4QXTB 5E2WH 2F53E 1WGOA 4XBEL 3D87B 4XBGA 4XVSH 4LIQL 2EE9A 4HXBL 1S9YA 4NO0A 5EOCJ 4P2OC 4JREC 4KGLA 4DJMA 1CD8A 1TETH 5E2TH 4KPHH 3P0VL 3CSYB 4HEPG 5D7LB 1F02I 4S0TD 1S7TA 4F15B 5DZLA 4YDKH 2WWKT 3OMZA 5E5RB 3VXSE 1JUFA 4LL9A 1T5WB 4MNQA 1G7MA 4HUUA 3NFNA 4NQEE 1UT9A 1HH6B 2XKUA 3WUZA 1Z3GH 4XBPA 2R29H 3VWJD 1X5GA 2DMCA 2CKBA 1JWUA 3LY6A 1VGEL 4I0KA 2EDTA 3FHAA 1CXKA 4HIJA 3QG7L 4PJ5E 4YHNA 4M00A 5I73C 4HV8B 4APQD 3TH2T 3WXVH 2Z31B 2GJ6A 3F7YB 1WWBX 4YLQT 1I1AB 4FXGB 4OLVL 3MREB 2F8VA 4TUKH 3THMH 2ENYA 5DQDH 3W0WD 4TTGA 5JQHC 1U91B 5KS9A 1YEHH 3AY4C 1AO7B 1MJJA 4DUWA 4XCEA 3FFCD 1ZT4A 4JQVA 5DJAB 4OZGB 3RNQA 1JTOA 2IFGA 4QHMA 1YNTA 5IGXH 1CGSL 3QEGH 4YZFF 3VXUD 5CS7A 4LCYA 3T0EE 2OK0L 5IW6A 1Q9KA 4TOYH 2IPKB 1CIUA 2X89A 3T2PA 3I6KA 4HHAB 5I1DA 2CK0H 4HEME 3B8SA 3GSOB 2FWOA 2FO4B 3W81A 4C58B 1QSFE 1SY6A 4H8WC 3KPOB 4NRYA 3TZVA 2ZJSH 2NXZD 1A21A 1CLOH 4XTRC 3MV9D 5CZXD 5JMOC 4G3YH 5DHYB 3B6SB 1RUAH 3PHQB 2NY1B 2VE6A 4YDVB 4QY8B 3C6LC 4JCLA 1TZGH 1UA6H 2BSTA 1FNGB 3NH7H 2ZUSA 1A6WH 2BXZA 3BAEH 2X05A 3JV6B 4U6YA 5DA0B 5TPWH 4BQ9A 1JPST 2EDFA 4MDIB 5MENE 1XEDA 4JAMB 5ISZA 2R0WL 1YNLH 4Z7UF 5TDPB 2P7TB 4JR9H 1PQZA 3DIFB 5IEHA 1MH5A 1NDGA 1B4RA 4IRJA 5CGYC 5EWIL 1QRNB 2JJWA 5I17B 3DXAD 3QO0A 5GS1B 1IBGH 4HK3N 1E4KA 4LCCC 1PD6A 5AZ2L 1LDPH 3UTQB 4PY7A 5A3IC 3KDMB 2GITB 4B50A 1OY3B 4P5TC 4M4PA 2WBJC 2P45B 2AJYL 2IAMD 4MQ7A 3TIDA 4F7MB 2X70A 4E42B 1KFAH 1NBYA 5DVNA 1KB9K 1U92A 4X9GA 1R5WA 3MLVL 4NNPL 5F9JB 1AIFB 4OLZH 3IF1B 5D1QA 4L4TE 4Y4HB 1Y18A 2GTZA 2JE8A 1S8DA 1KBGL 1FYTE 2GFBA 2YRLA 4FQQB 4LSRL 1X7QB 4NGHL 2FX7H 1NSNL 1PZUB 3NIFF 4X9IA 5F7EL 4Q6IC 3UTTA 2RBLA 4MXVF 3STZB 3PJSA 2IPUK 4EZMA 4FTVB 4GW5B 5J8OA 2R4SL 5I0DA 4UB0L 3I3BA 1X6LA 3WFDL 3MFFB 1MI5E 3EGSA 3BGFC 2CLZB 3PGDA 4U49A 5ALCH 5C86A 1ZHNB 4LPYA 3WLBA 4L8CB 4M7JL 5I66B 1NLBH 1U8OA 4DAGH 4L4JA 1HHHB 5LJYH 3BISA 1F3JA 4MB5A 2L0DA 4HQQL 2ICCA 4LSTL 4PP2A 5E8EB 5HHOE 1KGCD 3E0GA 3LEYL 1G6RB 2I60H 1SJEA 4KHXL 4GAGL 2BFVH 3UPRB 2OR7A 4WEMB 3GSUB 1MHPH 4M62H 3DUHA 4AEIL 1D9KA 4LCWE 1QA9A 4LVHB 3BUTA 2EDLA 5T5FH 2OQJB 1IM9B 1F4AA 4EN3A 2OTWA 1G7PB 3OKOA 3Q5TA 3PQYB 2NXYB 3VXMD 4XAKE 5DD6B 5E70A 1KIQB 2FEDD 1FP5A 6FABH 3V0WH 3QIWA 1G6VK 4RX4D 4AIOA 3IRZA 1CFQB 3LIZL 1NGXA 1P69B 4MNGB 1KTDA 1JPTL 4NC2B 3OJDA 3JVGC 2MPAL 1XF5A 3VW3H 3S3PA 2PO6A 3KPLB 3KYKL 3NABL 4YPJA 4Z6AT 5C08B 2YC1A 2GW5A 1WCBB 2W91A 2AVGA 3DARA 2X4UB 4GRLC 4U1SB 5I1AA 5D9SA 4D0BA 2LU7A 1PX4A 3DPBA 5CHNA 3FQUB 3DTXB 5DMIH 3TGXA 3TNNA 1IT9L 5B8CB 1IEAB 1MFDL 4F7PA 4NO3B 1KJMB 5I30L 2P5ED 4ETQA 4JFXB 2B1AL 3M1BA 3QHTC 3KR3H 2A73A 2VDNH 3S88H 2H26A 3HZVB 3B9KC 4N8VA 3BP4B 1BVKA 4JB9L 5I1EL 3MJ8A 3D69A 4X6DA 1DQJB 1B6UA 2J6EA 3WFHA 1Z0MA 4JPIB 4NQSB 1FAIL 3N85H 4PJFB 4Z8FH 4C83A 4WDIA 1DR9A 2C3VA 2HYMA 1XCQA 2QJDA 2D03H 4OSUL 3TBTB 5GRYA 2APFA 1A9BA 2DYPA 4JZNA 3WJLA 3P30H 1W8NA 4FFWD 4YHMH 1KPUB 4DZ8A 1MIEH 3FQRB 4FA8A 1X5LA 5D2LF 3RP1A 3V8OA 1WTGT 3P9MA 2A83A 4LLWA 3LKSA 3V5DB 3GFUA 3DMMD 1NCAH 4PJIE 5LAXB 3KHQA 2ESVE 2G2RA 5LGKA 2ATPA 3ZO0A 4YAQA 2B4CH 1EJ6A 4O4YL 4QF1B 4OCSH 2HG5A 5FYLD 1FZOB 1MCSA 3D3VA 3DECA 4RAVB 4LSPL 1KT2A 2EDOA 4AIZB 1J7VR 3LN5B 1GOHA 3QEQE 1NBZB 2ZOKB 4ZS7H 3M17A 4NNXA 2RJMA 5D7JC 1A3LH 2H3NB 4HLZH 5KANI 3QCUH 1C08A 4JG0L 5C7XL 4GKSB 5DVOA 1LD9A 5HHVH 4OZHF 1DTUA 4QNPE 4ODHL 3BZEA 1YQVH 3VWKC 1C5CH 3PWVA 4OB5L 4Y2OA 1NUFA 1LP9A 1UXSB 1D5BB 1FHGA 3EOBB 4L8SA 3GI9H 3QQ4A 1A7NH 4OJFL 1DN0A 1GGYA 1EJOL 3WD5L 3BOVA 4FQLH 3L3IB 5F7MC 4JN2A 2FECI 2WSKA 3J8F7 4TSBL 1KC5H 2Z91A 3CH8A 1RURH 5D4QA 1OTUD 4JRWA 5HI3D 1I1FA 3IDXH 3CCHB 4O02H 5KW9H 1IQDB 3S4SA 5MEQB 4X7SH 1XF3A 1S7UB 1HINH 4QRRB 2EYRB 1NEZA 4MD4A 1UKQA 3DV4A 4ZOCA 4JZJB 2MHAA 2AAVA 5IW3A 4EI5C 5BZDB 1NCTA 1Z6JT 2FBJL 3EJJX 4HFUL 4JN1L 1ZA6B 2OJZH 4Q0XL 3TO4C 1OGTB 4G7VL 1ZLUH 1MCLA 3TFKC 3SOBH 3NAAH 5CAYB 1QHOA 1OF2A 2CR3A 1GHFL 3CFEA 5FKPB 3TBWB 4YDJA 3MLZL 3PUCA 1HQRB 3FO2A 3OL2A 1NGQL 1DVFC 4XGZB 1YMHA 4UAOB 1YY8A 5EULV 2UUDK 4R7DA 4PB9H 5IJVA 5ESAB 1FZKB 1LE5B 3VFNA 3IVKA 4CN6A 3IS1X 1KSRA 2ZKHH 1ES0A 2Y36L 4KI5C 2QQKH 5HY9B 4JM4L 5BVPL 4IIQC 5FM5M 4GBXC 2UWEA 1U0QA 3BIBX 3ULSA 1KEMH 3U6RA 3MOAH 3QZWB 5CGMA 5DRNA 3PWLA 4KI5E 3DYMA 2B4CC 1P1ZA 2RIKA 2V9RA 2GCYB 2YA0A 4U33A 1AD0B 1A02N 4I3SH 3VWJA 1HCFX 2NZ9D 4LVOB 5EU3A 3V2AR 4C4KO 3HNTL 3MRIB 4B0MM 2EDNA 1RUPL 1OAZH 4EI6A 1FIEA 2BNQE 4GMSL 2F5AL 4F7EA 2J5LB 2YWZA 2OSLB 4QRPE 4UQ3B 3H3BC 4D2NA 4PTTB 3MRNA 1YMME 4S1QL 5F96H 3HZYB 1JWSB 4RZCB 1KXTB 1S3KH 4G42A 3G9AB 3BWAA 4NSKB 5DQJB 1HSBA 1JNJA 1NCWH 2H1PL 3FFCA 3VFMA 4XVUC 3OAYH 3HE6C 4J7RA 4CKVX 5DJYA 4KMTL 2QSCH 3DSFL 3HNVH 1N7MH 3VXUA 1ZAGA 3KPNA 5T3ZH 4DQOH 4GO6B 5DMYA 2R56H 3P0GB 3U2SA 4L8DA 3L1OL 5JUEL 5SWQB 4LFHG 1ZEAH 5FYJH 2K9UA 1SEBB 1TZIA 2FX8L 5KSBA 1M05A 1Q1JL 3GZKA 4JZOB 2F5BL 4PUBH 2X4OA 3MV9A 4MJ5A 4OV5A 1KUMA 2Y5EA 1RULL 2YD5A 3RGHA 1ACYH 3HG1B 5DD0L 1F4XL 3P11H 3ILQC 5DGRA 3GI8H 1T04B 2VISA 4M43L 5HYIA 1RZGB 1CDIA 1OWRM 4IJ3C 4DKFH 2H8PB 3VFPB 3SKUD 5BMFL 4MNHB 4K8RL 4Y5YA 5KAQF 3FQWB 5F8RC 5MP6L 3KYNB 4KJYA 4N0FA 5DI8A 3H42H 1Y0LA 1LEGA 3RNKB 5CUSH 5DVMA 1WVZA 5JHLH 1BGXL 1T66D 5K9QI 2D31B 3WDJA 1CFSA 2FATH 3JV0A 4NZDA 5E8DH 3SE4C 1BBDL 2XICA 1BEYH 2G60L 3VD3A 1GZQB 4XMLL 5DF0A 2IAMA 2DI7A 5D5MF 3VFGH 3IKKA 5BXFA 1UZ6F 2CQVA 3MUY1 2GJZA 1D6VL 2EH7L 4IS6A 3MZTA 5FYKE 1OAUL 3A0OA 3NFPA 1E4WL 3KPQB 3VXTB 5CP3H 2AABL 2N7BA 1N59A 1Y6MR 3UZVB 5AD0B 1CXEA 3SBWA 2JCCF 1YN7B 1JGDB 3U4EA 2UZIL 1HSAB 5T1MA 1MJUL 4PJ8A 4ODTL 3QO1A 4NQUA 3SDAC 4OT1H 3MLSH 2XKNA 2F53B 3HAEA 1YPZE 3O0RH 4HUXB 4Y1AD 5E8OA 1YJDL 1QFUH 7FABH 1NBQA 3HCVB 3ZYJA 3O9WB 4PP1D 4X5XB 1AHWC 4H25B 1T1XA 5SX4H 1QFWM 4ZAKD 3RPKA 3BPOC 3HPLB 2BHUA 1F4YH 4NRZA 4U3HA 5IB2B 2WWMD 4JREB 3I2CH 3GJFB 5CJXC 2C7UA 1AH1A 5JPMA 1IM3B 3O2VL 3RFZC 2NX5D 4G6KH 1N6VA 1YC7A 4NQEB 5HDBE 1U8IA 4Q9QL 4P5KB 1HK6A 4YNYA 4M7KL 3EYFA 2DLIA 2R2BB 5FYJE 5LWYH 4PJ5B 1J8HA 3DNKA 1BJ1J 3JZ7A 4ZOAA 3TT3L 5IWLA 5T1KB 4ZFOL 3UTSD 1I3VA 4NZJA 3G5VA 4FQ2H 1NAMB 2DRUA 3OF6D 5I73B 1RZ8A 2DKSA 4CVXB 3QWOB 4XPBH 2AEIT 3VXMA 2BVQA 3MLXL 1BOGB 1EO5A 1BFVH 5JOPD 4UUJB 1T20B 3B4NA 3STLA 3ZSTA 4X7FC 3UCRA 3D0VB 4Y8DC 1NKRA 4OZIA 3MRGB 3FZUD 1ZLVH 3OKNA 4LQFH 3LEXA 4AH2B 2OZ4L 1KELL 3AS2A 3K2UH 4P57B 4M5YL 2GSGA 4GXVH 4YPGA 3HR6A 1P4IL 1TDQA 2YPKA 2DTSA 4BZ2L 3F7VB 3OAZH 3QUXA 1E4JA 1V7MH 1N5YH 4XPFH 3MNWB 3GSQA 1YUHB 1FFPB 2AXGB 3QQ9D 1OVZA 3BVNA 1CQKA 2JJSC 5ACZA 4IBLT 5I75C 2FHFA 2IH1A 4YQXL 2P5EA 2OI9C 1UWEH 3WS3B 1Z9MA 1A6UH 4EDWL 3HR5A 3D39A 1QZ1A 2FJHA 2YUXA 4O2CA 5FGBC 5DMJB 1GGBL 4FFZL 1YY9C 1AE6H 3K4DA 4O58H 4WI5A 4LPUA 4PGZA 1ZWIA 2B1HH 3HZKA 3NZ8B 2PYFB 2Z31D 1A7QH 4LBEB 3WDHA 1TZHB 3QUYC 2E7LC 2AEQH 3ARFA 1KNOB 2FSEB 2HFFB 1RZJH 1I1AD 4PJ9A 5TE6H 5KJRH 5HGBA 3EHBD 4JO4L 1UM5H 1AXTH 1WWCA 3R0MA 4LCCB 1WF5A 5F89A 4JJ5A 3E6HB 4YZFE 3DO7B 4KQ3L 3V4VL 4HIEB 1JRHH 3QXTA 2E9WA 5GIRA 4P5TB 4ESKA 2A77H 4L5FL 5D1XB 2WBJB 3DMMA 1NFKA 1RUKH 4N0UB 3GMMA 3X11B 2VDML 4L4TB 3GSWA 2ARJA 1B9ZA 2CDFA 1HDMA 4ZUUB 5E2WL 1FYTB 4XVSL 5T3ZD 1I3UA 3S3JA 1CD9B 3BRGC 3CFBA 4LLDB 1MFNA 3GJFK 5TF1H 4YX2H 1TETL 5E2TL 5EZJA 4KPHL 4MAYA 2I9TB 2VMFA 2APXA 4OKVB 1TITA 4XB8A 1MI5B 4ZOEA 1ZHKA 4Q6IB 5C0FB 4ZS6C 1IC4H 3WEXB 4YDKL 4P2QE 2ADGB 8FABA 2NYYC 4Z7UE 4TUOB 1Z3GL 3BGFB 2A74B 1DJSA 2R29L 1L6XA 4OCMC 3T3ME 3MROA 2AKRA 1KN2H 4JFHE 3GHEH 1U8NB 2FHBA 3U9PH 3WXVL 3PXHA 3LKQA 2W92A 1OL0A 3X3FH 3UAJD 2HMID 2BNRE 4NHCH 4KXZH 5F1KC 3NCFB 4LCWB 4RA0C 4TUKL 3THML 5DQDL 4OFKA 5JPNA 1EUUA 1YEHL 3X3GH 4OTXH 2XWJB 3VFRB 2VTFA 4OLWH 4NIKB 5IGXL 3QEGL 3S9DB 5DSCA 1FRGH 4TOYL 3IU3A 4QHLA 3KS0H 4YR6A 1B2WH 2CK0L 3VFVA 4Y4HD 2B2XH 2P5WA 3S5LA 4OF5A 4MXVE 4HMCA 1EAPB 3L7EA 2ZJSL 3B5TA 4OCWH 1W72A 1CLOL 2ORBH 4G3YL 4RFOH 1MVFA 1RUAL 3EDEA 2X1OA 3MJ7B 1JNHB 1TZGL 4X83A 1IGMH 4M61A 1UA6L 4QRQA 32C2A 3DGGB 3NH7L 4R96A 1WWAX 1A6WL 5SWZA 3BUYA 1SJXA 2EXYD 3BAEL 3FO0H 5TPWL 2VZ3A 4GRLB 3CX5J 2Q86A 4BUGA 5EU4A 1YNLL 2V5TA 4JR9L 1MCKA 1GPOH 5J1AA 4P9HH 4Z7NF 4PLJD 3MGAA 4K9EH 3MUZ1 3QJHB 2NR6D 4ZODA 5L2JB 1IBGL 1BFOA 2H2PC 1URLA 1LDPL 3OB0K 4HJ0D 2CLVB 3ARDD 3WL9B 5ESQA 4K23H 1CQYA 1KIUA 1LO3H 3B9KB 1Y6NR 3QPQC 3RGVD 3C2AH 4Q97A 4CL7A 2VXVH 1IM9D 5EBWB 1KFAL 5I1KH 2ZUYA 2Z0BA 5IOPB 1FLRH 4UOJA 2HVJB 4B41A 1UG9A 3FMGH 1QR4A 5KVFH 2VO5A 4OLZL 1S9WB 2PW1A 4MWFA 4UIKH 2OBGA 5K9KA 4PRHA 1W0WA 1BPVA 3L7FB 3H2WA 4QHUA 5EIVA 1G7LB 2CIIA 1RU9H 2FX7L 1NANI 2AI0H 1JFQH 3W5NA 1VADB 1FZJB 4W6WB 3V7AE 3LV3A 3QPXH 5C0EB 3S96B 1AR1D 4UDTA 3AXLA 3DVGB 3FCTA 3BZ4A 1ORQA 2NY2C 2IPTH 2VABB 5ALCL 4M02A 4NQXB 3EO1A 2PNDA 1MQKH 2C3HA 2R15A 4G43B 1S7VB 3H9SE 5GGQH 4WHTB 5KN5B 1NLBL 2I9LB 4XH2A 4DAGL 1DANU 5D7JB 5E1HB 1JVKA 1NBVH 4K71C 3BEWB 1CDGA 4B7IA 5ID1B 5IV2A 1BWMA 1OOAA 2I60L 3I9GH 1AKJB 1GGCH 4TSAH 3GMNA 1EAJA 2BFVL 3WCYA 1I85C 2P44B 4NKDB 4NWUH 4WWKA 4KDVA 2APBA 5GZND 3VWKB 3QDJA 1MHPL 4M62L 3P9WB 5L2KD 3WNPA 4PJ7B 2YKLH 3OJVC 1JV5A 5T5FL 2YA1A 4RIRA 1O7SA 4AK1A 4JDVB 3FB5B 4H1LH 5GRWA 1HWHB 3S35X 2NTFB 2VLKE 4KK6D 3AMKA 1TVBB 4PD4J 1EZVX 4NC1E 5D2LE 3WS6C 2KZ1B 3AVEA 4L29B 1RD6A 4L3AA 1QO3A 4PJXB 4P9HC 6FABL 3V0WL 4EBQH 4ONGH 3CUPA 2X4TB 1HOCB 2XWTA 4BFEA 4NYLA 2AJXH 5C9JB 4CDGC 4U3XA 5C07E 3BMVA 2VLLB 5T33H 4EI5B 1CGYA 1CXIA 3O2DH 4Y4KC 3TO4B 2P8PB 4PLOB 5HHNB 3VW3L 3QFDA 4Y1AA 3BKMH 1JI1A 2R2CA 1DDHB 3MJ6A 2NY4C 3HRZB 3PV6B 2PCPB 1AR2A 4MB3A 4PJDF 4S1RH 2X7LB 1DVFB 5EOCH 5FV2A 1JHKH 5ACMA 1ND0B 5C0CE 4LP4A 2VXUH 5DMIL 3LRSA 3EFFA 1KG0A 4JFDE 5JLZB 2H32A 5GSRA 5EO9B 3KR3L 1Z9OA 2VDNL 1IL1A 2NX5A 3O11B 4IIQB 5ID0B 4GBXB 2VSDA 3S88L 3CPLA 4BJLA 2VLJB 2DJUA 4PTUA 1QFHA 4H0IA 3KLAA 2BNQB 3MRKB 3IFOB 2A0LC 3R0NA 1OP3H 3MJ9A 4NDMA 2ATKA 4QRPB 3UTSA 4U31A 3QIUC 3N85L 3ARPA 3TVMC 5J3HD 4Z8FL 3RY6A 3RDTC 3P3YA 5IM7B 3OF6A 2AJZA 3MUGB 1UB6A 2D03L 3T0XA 5E5MA 4J3VA 3P30L 1OTSC 4HS6A 4YHML 5IW1A 1MIEL 1I1YB 1D5XB 3R8QA 3RVXC 4QRRD 3VGHA 3U46B 5FGRA 4RWYH 3HHRB 5JO5A 4ELMB 2D7NA 4GXUN 4D9LH 3S3SA 4PBWD 1QP1A 2D9CA 4LHJB 3AU1B 4JFFE 4N8VG 1NCAL 2KDGA 5HDOA 3KPRB 3AGVA 3H3KA 1I1CA 2B4CL 4P23C 5DJ2A 5DUMH 2WBKA 3HE6B 4OCSL 4OIIH 2NW3B 1HQ4B 4QXTA 4L3ED 3QWRD 4I0PC 2CPCA 5DA4A 1MNUH 3MRPB 4ZS7L 2E8YA 3PV7A 3B9EA 1X5IA 1WLHA 1A3LL 3SKJH 3QCUL 3ARQA 3CSYA 5D7LA 5BS0D 5HHVL 2XT1B 5CCKH 1A5FH 4DK3A 5I1IH 2N4IA 4ODWB 4YDIH 1YQVL 4FRWA 1T5WA 1C5CL 4J3UA 2F58H 4EXKA 4W70A 5HYQB 3GI9L 1HH6A 1A7NL 5HYFA 5D1ZC 2VWEC 1K2DB 3BYTA 4FQLL 2MWCA 4XI5D 5IVXF 1H8OA 3UYRH 5GGRY 1I3RB 2E27H 4HV8A 3ZE1E 4IJ3B 1KC5L 4PJBF 4LLVB 1RURL 1LHZA 2Z31A 4F8QA 1B88A 2MQ0A 3F7YA 2VWEE 3C5SB 3IDXL 1I1AA 4O02L 5KW9L 1KB5B 4TVPH 4FXGA 4X7SL 4ONHB 3MREA 4R7NB 1HINL 3ZTJG 1U91A 5EUKB 1AO7A 1RZIB 3SGJC 1V7NH 1XR8B 2OJZL 5DJAA 4OZGA 4UILH 5FV1L 3SOBL 1CXHA 3NAAL 1Z2KA 4M7ZC 5AG8A 5GS0H 1U41A 2IPKA 2V7NB 3HZMB 5J9PB 4HHAA 4C55A 2P24B 4HG4J 3SDDC 3GSOA 1FCCA 4X80H 4PB9L 2FO4A 3S4SG 2CUMA 1YPZB 5HI4D 3KPOA 1WISA 2ZKHL 4K55A 2NPLX 2VAAB 4KRNA 4KMLB 2QQKL 1NEZG 1HHIB 2GY5A 1X44A 5DHYA 2PETA 3B6SA 3SDAB 3D0LB 1GIGH 3PHQA 1KEML 4YDVA 1FSKC 4QY8A 2D7TH 3MOAL 3HG1D 5F6HI 3RAJH 2XXCB 1FNGA 5EOQH 4X7CC 1AHWB 3JV6A 2EYTB 4RSVA 4I3SL 5FM8A 3TC9A 3BPOB 4MDIA 4HZAA 3IYLW 1OAZL 2EXWD 4JAMA 2NLJB 5TDPA 1UYWH 2P7TA 1G9EA 3DIFA 4KJPD 2NY6C 4QHNB 1QRNA 5I17A 5GS1A 2FIRT 4P2RE 5D2NC 2HH0H 4OGAD 3UTQA 3ULVF 1XIWB 3O6LH 5F96L 1R24B 3KDMA 4ZUWB 5D5ME 2GITA 3VFOB 5L0QC 1IE5A 1S3KL 1UZ6E 2OMNA 5D2NE 3W82A 4YE4H 1NCWL 3ZHLA 4Z18A 4F7MA 2PTUA 4E42A 3IDYC 2JCCE 2QSCL 2F54B 4BQ8A 4Z95H 3HNVL 1N7ML 2IBBA 4LSUH 4DQOL 5T3ZL 4HUMB 5F9JA 1WJ3A 2R56L 1AIFA 3IF1A 4AIXA 3QB7C 5DT1H 1MRDH 4H5SB 4Y4HA 2VXQH 4XHJD 1ZEAL 1MY5A 5FYJL 3E3QC 2B5IC 4FQQA 1X7QA 4U6XB 1ZV5A 4ZUVB 1CE6B 1YC8A 5FHAH 1T89C 1V8HA 3STZA 3HI6H 4PUBL 4DN4H 3GIVB 4FTVA 2FYYB 2OL3B 4GW5A 1ORSB 3E3QE 2EZ0C 5J89A 3O9WD 5ENWB 4TVPE 2HT3C 3MFFA 4DVBB 2OR8A 4I2XE 1ACYL 2CLZA 3REVB 1UENA 1CCZA 4PIRF 3P11L 3GI8L 5GRJH 1ZHNA 4L8CA 5I66A 1GRWA 5JA8B 4LSVH 3V0VB 4DKFL 1HHHA 4MXWH 3PDGA 4MYWB 4GOSA 3C9NB 5E8EA 1TVHB 1CDHA 4NQED 4YDLC 4Z7WB 5I75B 2DL2A 1G6RA 4IDJH 3H42L 3HC4H 4ODBD 2OI9B 5CUSL 4JRYE 5JHLL 2YRZA 3UPRA 2JTDA 4NFBA 4TNVF 5E24E 2FATL 3GSUA 3MNVB 5E8DL 4ZNEE 5EO0B 1BEYL 5T1KD 3FT4B 2C4FU 3GO1H 3H9HB 2OQJA 1IM9A 3VFGL 4BFBD 1G7PA 4CN1A 1U8MB 3PQYA 2J8HA 3QUYB 1RAMA 5DD6A 1WBXB 1KIQA 3MGTB 3ARED 3OB8A 4NCC2 1A4KB 1KACB 2BVUA 3NGBC 4KU1A 1CFQA 1DL7H 4QTHB 1DP0A 1BBJB 4MNGA 3MLSL 3O6MH 4OT1L 3DX8B 3O0RL 3DI3B 4K07A 2N7AA 1QFUL 7FABL 1NLDH 3KPLA 2A6IB 5GRVL 5C08A 1F3RB 3ZT6A 2FR4B 1WCBA 1QPXA 1WWWX 5EN2B 2X4UA 3QUZB 4U1SA 1RK1B 1F4YL 1HHGB 1Z0NA 3FQUA 3O3AB 1V3MA 3MBEC 3DTXA 4WUUD 5B8CA 3I2CL 1IEAA 4JLRB 2OYPA 4P2QB 4NO3A 5GGVY 3V6OC 1KJMA 4G6KL 4XTRD 4JFXA 4P4KC 4Z7UB 2VN7A 1AXSB 5I0ZA 3HAEG 4KUCF 3X13B 5DEFB 3V6OE 3HZVA 3BDBA 3BP4A 1J0KA 5LWYL 4AYFA 1DQMH 3EYVB 4HF5H 1DQJA 3PWJB 3L3JB 4FQ2L 4JPIA 4NQSA 5ICYB 1OTTC 4ODSH 4PJFA 2A9NH 3T0BA 4Z7OF 2DICA 4XPBL 2OP4H 5CGYD 3PWNB 3WFZA 3TBTA 4HC1H 3OG4B 1BFVL 3FAXA 1BZ9B 1KPUA 1TNMA 1JZ6A 3FQRA 2XOTA 4JFPB 4RGNE 1J8KA 2DTMH 4OAWB 3V5DA 1AQDB 1L0QA 5D1XD 3CZJA 5LAXA 1YEEH 3NCBB 4LQFL 5CD5D 3QWQB 4QF1A 5C0GB 1FZOA 1MAKA 3MACH 1JZ8A 4RAVA 3OAUH 3K2UL 4AIZA 4HJJH 3B8YA 2EIDA 3LN5A 4GXVL 1NBZA 2ZOKA 1CDJA 4R4ND 4FABH 4WW2C 15C8H 3QI9C 4CMHB 1V7ML 2H3NA 2VQ1B 1N5YL 5FAAA 3QG6B 4XPFL 1S78C 4POYA 1CS6A 2Z92B 4M6NH 2D7MA 4GKSA 2KZWA 1AI1H 3OKMB 4ZSOA 3D2UB 2X9YA 5F1IB 2PYEE 1UWEL 5KOVC 1BWWA 2ZUUA 1A6UL 3TF7C 4U1LB 1PG7X 3MUJA 1UXSA 3MMEB 1D5BA 3EOBA 4MJ4A 1NEUA 4KKBC 3QNXB 3CFJB 2F74B 3RX5A 4CADB 5KSVB 3ESUF 2VZTA 1AE6L 3Q6FB 4O58L 3L3IA 4FXLA 2B1HL 5M95B 5ILTH 4PRID 1A7QL 2AEQL 2L4OA 3FTGB 3BIAX 1RZJL 1R3KB 4NPYB 5TE6L 5KJRL 3CCHA 1IQDA 1UM5L 1AXTL 5MEQA 2FDBP 3RHWK 5IP4A 1S7UA 5IB5B 3U82B 4QRRA 5EUOB 2EYRA 1UKSA 4V2BA 4JZJA 3SDXE 1JRHL 1MY7A 5BZDA 4HUVB 3FN3A 3OQ3B 1P7KB 3FJTA 1ZA6A 2EDKA 3L3GB 2A77L 1OGTA 3VRLF 1RUKL 1AC6A 5DHVH 1TPXC 5ADPH 1F00I 4LSSH 1UVQB 5FKPA 3TBWA 2APVA 3FO9B 1HQRA 3QWRA 1UACH 3RIAF 2VLRE 4XGZA 3KG5A 4N1CA 2CRMA 3CU1A 3I3DA 1QSEB 1VACB 3B5GA 4KUZH 5TF1L 4YX2L 5ESAA 1FZKA 3WNLA 5KSAC 4MA3B 4W4OA 5BV7H 5HY9A 1DSFH 1MCRA 3RZCC 1IC4L 1TQBC 3GSXB 1R5VB 1VFUA 3QZWA 4ZMAT 3HUJF 4LSQH 2NY2B 3IETB 4JY5H 4GRLD 2GCYA 1VHPA 1AD0A 2DN7A 4Z7NE 4ZUSB 5FM4A 1KN2L 1J10A 3FB7B 3GHEL 3MRIA 5ICXB 3U9PL 3UTZB 4LVNC 3X3FL 1F13A 2ICES 4K71B 4NHCL 1BLNB 4QRTB 3NCYP 2OSLA 4JO2H 3VGAC 4UQ3A 1MEXH 4PTTA 4UBDD 3V79C 3ZE2F 1XGYH 4HZLB 1G84A 3HZYA 1JWSA 3B9KD 2HJFB 3X3GL 4RZCA 4PB0H 4OTXL 5SX5H 5E6ID 5J6HB 2MJWA 4RRPG 5IHBA 1NUDA 4NSKA 5DQJA 5C0IB 4AEEA 4OLWL 5D2LB 1CXFA 3ARGC 3O45B 1FRGL 4PRPE 3MV8B 3L6FB 4K94H 2HFGH 3ZKQD 1B2WL 5DJDB 5GZOD 2W60B 5IVZB 2B2XL 2DQCH 1C1EH 5H2BB 1JCKA 5SWQA 2ITDB 2V9TA 3LQAC 1SEBA 3ZKMD 1J18A 4OCWL 4PG2C 4WFFD 5FECB 4MHHG 2ORBL 4NWTH 4JZOA 4G6MH 4RFOL 3STBA 1F3DH 3ABZA 4ORGB 5GGRB 3B2UC 4Y4KB 4JKPH 1IGML 4U7SA 3GBLA 1GVIA 5DLMH 3HG1A 3S35H 2NY4B 3JSSA 1EHLH 2VLMD 3FO0L 1T04A 1RZGA 4IMLB 1GZPB 1ZTXH 1ZVYA 4M5ZH 2H8PA 3VFPA 1GXEA 4KVNH 5ANME 4Q9RH 1GPOL 4P9HL 1FFQA 3QR2A 4LMQI 1I9RH 4MNHA 4K9EL 3WMSA 4JHZA 1AKJD 1ETZB 3CDCA 3FQWA 4EEEA 5DMKB 3KYNA 2ARWA 4RMTA 5EPMB 4K23L 3RNKA 1V05A 3RUGF 3VWKD 4WI7A 2D31A 1WCQA 1LO3L 5TQ2H 1BJ1H 3C2AL 1JF1B 2VXVL 1GZQA 2FLRT 4UINH 3HB3C 3AAZB 4OFYD 5I1KL 4LDEB 5F7NC 3BIKB 3VD4A 2BY0A 1FLRL 4MA7H 3KPSB 3QIUB 5F9DC 3KVQA 3KPQA 3FMGL 3TVMB 3VXTA 5KVFL 5C92A 3RDTB 1HIMH 5AD0A 4UIKL 1YN7A 3FT2B 3NOIA 1QLEH 3RWIB 1JGDA 3CMOH 3T2NH 4Q9CA 1INDH 1HSAA 1RU9L 2AI0L 4P2YA 4EI5D 4OLEA 1JFQL 5CEZH 2F53A 1TCRB 4HUXA 3QPXL 3TFKD 4P23B 4J1UB 2Y4SA 3PWPB 3HCVA 4WFGD 3O9WA 4PJDE 3ROOB 4X5XA 4BFIB 2IPTL 1BD2E 1MHCB 4H25A 1MQKL 4I0PB 4PGBB 4N9GB 4K94C 3HPLA 5GGQL 6CGTA 3CFIC 3LRHA 2I24N 4RGOH 5IB2A 3S98A 1NBVL 2XTLA 2M8XA 3GJFA 4PY8I 1IM3A 4OI8A 4DCQB 4NQEA 5F7UA 3I9GL 4GQ9H 1R0AH 1GGCL 4TSAL 5TF0A 3RWCB 4KY1H 2Z8RA 2OTPA 1B0GB 2NY3C 4P5KA 2VLJD 4NWUL 1WT5C 1H15B 4RFNC 5EU6E 2R2BA 4PJ5A 2YKLL 3UBXB 5IFAH 5T1KA 5D1ZB 5D93C 4QRPD 4WUKH 5H94B 1QVOB 2YPLE 3OXRB 4N90D 3JV4B 4F37K 1WV7T 3PP3K 1NAMA 1KCLA 3R06B 4JVPA 4CVXA 4EIZC 3QWOA 4CAGA 4QOKE 1TNNA 1BOGA 2BY2A 4IOIB 5DJZB 2YZ8A 4UUJA 1T20A 1F42A 3FL7A 4EBQL 4ONGL 4I13B 3NA4A 3D0VA 4C59B 2AJXL 3AY4A 1AY1H 5FGCE 3KPRD 1V3KA 5T33L 2VZVA 3MRGA 4CJ1A 2BY3A 2RCSH 3O2DL 3HE6D 4FFVC 3BJLA 3ULVH 3T0VA 5EOTB 3BKML 5SWSE 4LDOB 4AH2A 2IQAB 3H3PH 3VH8B 35C8H 1IRAY 4M7ZB 4P57A 5HPOA 1MHHB 2X5PA 3P40A 5EOCL 4S1RL 3SDDB 1JHKL 1LO5B 3F7VA 1IGFH 2VXUL 4XCCH 4GKZB 1NH6A 3MRDB 4POUB 2Q8AH 3MNWA 1YUHA 1FFPA 2AXGA 1LWRA 1QFWI 2XWBB 3RIFF 3WS3A 4LAQH 5IR1B 5F97E 5FDWB 5C0RH 1ONQB 1FSKB 5IVXE 5J11C 4PJBE 4D9RE 5MHSE 1FG2B 5CEZE 4P2RB 1UH2A 4HT1H 3NZ8A 3MRHB 2PYFA 4LBEA 1U8PB 1O7VA 1TZHA 4L4VB 4A6YH 3LPWA 1KNOA 2FSEA 2HFFA 2NY6B 1BF8A 3LKRB 1DBAH 1D6EB 3BEVB 5D2NB 3LKPB 1S5HB 4LCCA 1G7JB 3E6HA 4RAUB 4RWYL 3EDDA 4PJHB 1LEIB 2ADJB 3DO7A 2XTJC 4D9LL 2JCCB 1OWWA 4HIEA 5L0QB 4HLJA 5FHBH 4P5TA 1MCHA 5D1XA 2WBJA 1UH3A 4LKXB 5DUML 4N0UA 5BO1H 3WN5C 3IDYB 4OIIL 4L4TA 5C09E 3X11A 4ZUUA 2ZCHH 2IFFH 1FYTA 4XMPH 1MNUL 2LE9A 1D3CA 5CFHA 5HHQB 3GRWA 4LLDA 5CKGA 5I74C 2CO6B 2R0ZH 4X6FB 3SKJL 1F58H 4N0RA 2BOCB 3NACH 5JHDE 3CH1B 2I9TA 4FG6C 2B5IB 4QYOB 3BT2H 3UROR 4CJ0A 3GIZH 3PABB 4OKVA 4GG6B 1PYWB 1MI5A 2AGJH 1EZVY 4G6AC 2WZPD 5CCKL 2Y6SC 3SDAD 1A5FL 4Q6IA 5C0FA 5I1IL 3WEXA 2QHRH 4YDIL 4FQXC 5JIIA 1BIIB 2ADGA 2F58L 3RQ3A 4AL8H 4JGMA 4TUOA 2A74A 1X5KA 5EIQA 1EO8H 1QLFB 1BQHG 3CXDH 2WLZA 1FC1A 5F3HB 3UYRL 1U8NA 2E27L 1BM3H 3D85D 1JGVH 3GBMH 5IROC 1JYVA 5F7YC 5CSGA 1BREA 1OP5H 4AJ0A 4TVPL 4YDLB 3BO8B 4LCWA 5A1AA 3QH3B 2XACC 3TJEH 1XIWD 1CFBA 2IPUG 2XY1A 2XWJA 3QDGE 3VFRA 1V7NL 4R2GC 3GSNB 4UILL 5I19H 1YEDB 1M7IB 3BHBB 1T0NB 4JPKH 4XPHH 2F54D 2HKHH 4TNWF 5E2UH 5GS0L 1BQUA 1EEUA 2ADFH 2I26N 4Y19E 4JVUA 4HG4K 2VL5B 1GGUA 4X80L 1J1PH 2CD0A 3NIDF 1EAPA 2O5YH 1JTTA 1T6WA 3NGBB 4X6DF 3CZFB 3CSGA 2HTKC 4K7PH 3TM6A 1GIGL 1QPPA 4J4PC 5HXMA 3MJ7A 1SEQH 2D7TL 3JVGA 1JNHA 3RAJL 5EOQL 3DGGA 3BD3A 1LK2B 5CJBA 3HA0A 4JRXD 2B39A 2AJ3B 4GRLA 1UYWL 4HIXH 3MBEB 3B9AA 1B0RB 5L2JA 1QBAA 2HP4A 3QJHA 3K0WA 4RFEB 4YK4C 1JK8B 1N26A 2HH0L 5C2UB 3IU4H 4P4KB 2CLVA 4ODXB 2YPVH 3WL9A 3WYRA 3O6LL 5MEPB 3VXRE 2Q76B 1K3ZA 3B9KA 4OQTA 3LQMA 4XC1H 4YE4L 2GT9B 3F7QA 5DUBB 5EBWA 1OPGH 3TWCH 2OX5A 3M8OH 2X40A 4LGRB 1FL5B 4Z95L 3L5XH 5IOPA 2HVJA 4LSUL 3QUYD 4PGDB 4Y0GA 1KYOJ 1S9WA 2E6JA 5D7KE 4HBQA 5DT1L 1MRDL 3QFJB 2VR5A 2VXQL 2A6KB 4S10A 1SMOA 3L7FA 1LP9F 4ZFFB 1G7LA 4YHLH 3CDYA 5IKCB 4TPRH 1UWXK 5FHAL 4YGVB 2B7DT 3HI6L 4DN4L 1VADA 5T1LB 1FZJA 5KOMC 3KYMB 3S96A 2WANA 5C0EA 4X4XB 5GHWH 4ONFH 1A9EB 3DVGA 4Y4FC 1HWGB 1TTFA 5K9OB 2VABA 3QUZD 5B38B 4NQXA 4LRIA 3SHSA 3LMJH 5GRJL 4UTBH 2CDEB 4G43A 1S7VA 4LSVL 1QBBA 4WHTA 1NMCC 2I9LA 5KN5A 5L8LB 3KLHD 3HI1B 4MXWL 4N0YH 3HMXH 3N1QC 4OGXH 3QI9B 3QHFH 4WW2B 4KK9D 5D7JA 3CVHB 3BEWA 1GYAA 5ID1A 5C0BB 2QV2A 2J88H 2R0KH 2CIKB 2MKWA 1VESA 4ZS6D 4IDJL 1AKJA 3HC4L 3WO4C 2XZCH 4NKDA 4NFCA 3PWUB 3UC0H 3VWKA 5C8JB 3LPFA 3VA2C 4MCZB 4PJ7A 4Z7OE 5E8NB 3GO1L 1ADQA 1M6OB 3EYUH 2Z8VC 4JDVA 5L6YH 3FB5A 4HH8A 2NTFA 1TVBA 2O26U 1SVZA 4PJGB 2NY5H 1C8PA 5ECJE 4CW1B 4L29A 3SDXB 1EIBA 4PJXA 2C1OB 3CLFH 4XHQA 5JXEC 3TIEB 2ZUXA 3C5ZC 1KJ2B 2X4TA 1DL7L 1HOCA 5C9JA 1PG7H 5FA3B 1CE1H 3O6ML 2VLLA 4EI5A 3P77B 1W0YT 1A7BA 1ROWA 2JB6B 3TO4A 2P8PA 5HHNA 3Q48A 2BDNH 1NLDL 1TPXB 3T2OA 1DDHA 4YXHH 1AGFB 4NOFA 4E41B 4HKXB 3LQZB 3HRZA 1SYSB 3PV6A 5E2VH 4P9MH 2PCPA 1EV2E 4KGJA 3WJJC 5DC4B 1L9MA 2X7LA 1DVFA 4LOUD 2KH2B 1ND0A 1QUNA 4MHHI 3ZKSD 1A3QA 3N1GC 4NNYB 1E28B 5HTSA 5JLZA 4R9HA 1GH7A 5KSAB 1AGDB 5EO9A 1NCCH 4X4YB 4GRWB 3O11A 3RZCB 4IIQA 5ID0A 1TQBB 4GBXA 4KTEH 5T3XD 4J3SA 1JF6A 5GGTH 2VLJA 1KLFA 1DQML 4CGTA 5GXBB 4OUUB 4X5WB 4F8TA 4HF5L 2BNQA 3MRKA 3IFOA 1JWMB 2YD4A 4XWOD 2IANE 3M45A 1EBAA 4QRPA 4PYHA 4ODSL 1IAIM 2A9NL 2X4SB 1N4XH 5IM7A 1NCDH 4LVNB 4E5XB 2OP4L 3MUGA 3D48R 2PXYC 1F90H 3QT2A 4HC1L 1RZKC 1NC2B 1T2QH 1I1YA 1D5XA 1UJTA 3U46A 3KXFB 2DTML 4JGUA 4ELMA 4C4KT 5KVEH 3QPQD 4PRPB 3AU1A 3KPRA 4WFEE 2PF6A 1YEEL 4Z5RB 3LB6C 3HE6A 2D4FA 2MFNA 1JE6A 3MACL 3ARGB 3X12B 2NW3A 2Y5TB 3OAUL 1HQ4A 2EEAA 4HJJL 1OAQH 4HWZB 4MMXC 3IJYB 4BSVB 3MRPA 3O8XC 1QSED 4FABL 1MQ8A 3ARRA 3ZKNC 5K59F 15C8L 3VDCA 2NY5C 1FFRA 2XA8H 3BQUC 4M6NL 1AI1L 1CT8B 4F9PC 5F9OH 4NQTA 4MS8D 5BZWB 3QIBC 4ODWA 3SKOB 2X1XR 1N0XH 5HYQA 4X8XA 5DHVB 4XX1G 2P48B 2CKBH 4Y7MA 1K2DA 1CVRA 2Y25A 4WFHE 5ILTL 1I3RA 4WO4B 5CJOH 2YUZA 4LLVA 4ZDHB 1OSZB 3ZE2E 1QBLH 5A16B 2GAZB 3C5SA 2KPNA 1KB5A 4ONHA 4R7NA 1S7RB 1S7XB 3ARSA 2Z35B 5EUKA 1RZIA 4BZ1H 1OT2A 2FLBT 5F7FA 4OBSA 1XR8A 3SE4A 3MBXH 1NCBH 5DJ6B 4WNQB 3MV8D 1CICC 5ADPL 1A7OH 4LSSL 4GUPB 2V7NA 5IBTH 3HZMA 1HNGA 4XT1C 5J9PA 2P24A 1UACL 3LPGA 4KUZL 1SY6H 1A1OB 1YPZA 3F58H 5IBUB 5FUZH 5DRZB 4HIIB 1Q38A 2VAAA 4BQ6A 5BV7L 1SYVB 1DSFL 1HHIA 3SDAA 5C6PB 1BD2B 3D0LA 1U8HB 4Y4KD 4L9LB 1ZLWK 1YYMH 4X6CE 2NY4D 1X5JA 4LSQL 1AHWA 2W9EH 4FMKA 4N1EA 4JY5L 4HUWB 5A2IH 2EYTA 5F7KC 4NQDD 1UZ8B 3BP6B 1HKLH 2WWKO 4P2CG 2NLJA 3OHXB 5HBBA 3SJVE 4ODVH 4JFZH 1I7RB 1A8JH 3DURB 3RUGE 3U79A 4OZIF 4QHNA 5CJXA 1H9VA 4JO2L 1MEXL 5IMLB 3ZKXC 5LGJB 3U4AA 3CFCH 1XGYL 2WINB 1XIWA 4G6FB 1R24A 2NY3B 4ZUWA 5C0AE 4PB0L 4MLIA 3VFOA 1T80A 1F4WH 2A0LD 2DB8A 5C2BH 5M94B 1CG9B 1VEMA 1HKFA 4MJID 4XC3H 5D93B 3KPSD 3QIUD 2F54A 4K94L 2HFGL 3TVMD 2QQLH 5J1TC 3RDTD 4MNQE 3DYOA 2DQJH 4WCYH 3V4UH 2DQCL 4H5SA 3DJ9A 1C1EL 4P4RB 1OTSD 2CGRH 5FGCB 3RL2B 5LBSH 1ULVA 2LABA 4P46D 4U6XA 5SWSB 4ZUVA 1CE6A 4NWTL 2GJ6E 4G6ML 1OP9A 4RMSA 3GIVA 2EKJA 2FYYA 2OL3A 1ORSA 4P23D 1CL7H 3PWPD 4JKPL 1A14H 1CU4H 2BRQA 5ENWA 4DVBA 5DHXB 5DLML 2OMBA 3REVA 3S35L 3ARTA 4I0PD 1EHLL 1KTRL 4PREB 1KCUH 5KZCB 5B21A 3FHQA 3T0WA 3TYFB 1AGEB 2CXKA 2OR9H 3K8MA 3V0VA 1ZTXL 2DLGA 4M5ZL 4KVNL 4FHBD 4Q9RL 1INEH 4TN9A 3C9NA 1I9RL 4YC2C 1TVHA 4LU5H 4Z7WA 2JJSA 5HVGB 1REIA 2FB4H 1QKZH 2VC2H 2BERA 3IDUA 3VG0H 2DIAA 3QCVH 1U8JB 4KFZC 4U0QB 4GW4B 3MNVA 5TQ2L 5EO0A 3FN0H 5FGBA 3FT4A 3V7MA 4LLQB 5D1ZD 1NDMB 4UINL 2LFGA 1JL8A 5J11B 3H9HA 1QG3A 1MCEA 3T4AB 4MA7L 4UQ2B 1U8MA 2ICEB 1WZ1H 1XGRB 3ZYOA 1HIML 3QUYA 4KRMB 2E7LA 4Z7QF 2IBGA 4X9HA 1KPRB 1QLEL 3MGTA 3CMOL 3T2NL 1INDL 1E4KC 4HX1B 1A4KA 4F7TB 5ISZE 3UMTA 4QTHA 5C09B 1BBJA 2XTJB 2WV3A 5CEZL 4DFIA 5D71H 2YUVA 3IGAB 3DX8A 1RIUH 1PDKA 3I50H 3B9VA 4NQCD 2XY2A 2A6JB 2Q3ZA 2ZSVB 4N5EC 2A6IA 1UH4A 3WN5B 4DKEH 4G5ZH 4QT5B 4UT9H 5JIKA 2FR4A 2BRRH 4OV6F 4PJEB 1K4CB 2EO9A 5EN2A 3QUZA 1WIOA 3NZHH 4MGXA 1RK1A 1HHGA 1EFXB 4NN7C 4RGOL 3O3AA 2YOCA 5I74B 4QLRA 1UCBH 4JLRA 4P2QA 4QXGH 1SJHB 1UCTA 1R0AL 1EGJH 4GQ9L 4Z7UA 2D7QA 1TJHH 3VMPA 1AXSA 1ZGLP 2VNCA 4KY1L 2E7HA 5J57B 3X13A 5DEFA 4FQXB 3ZDYF 1CF8H 2XA3A 2D0HA 4Y5VC 3EYVA 5IFAL 1T0PB 2J6EH 3RY5A 3V6FB 4WUKL 3PWJA 1IKNC 2VKXA 1CLYH 3L3JA 2FJFB 3UEZA 5ICYA 1NGZB 2M1KA 4L4VD 2X10A 2DIBA 2NY6D 1NGPH 4MZ3A 3PWNA 4U4BA 1KCVH 5HHMB 1RJZB 3HC0B 5HYSB 4JKKA 3BN3B 4XCNB 3BH8B 5E9DB 1BZ9A 5GISH 4R97C 3IJHB 4RA3A 3QQNA 4JFPA 2R1XB 1AY1L 1U58B 1IFHH 1N64H 1S7QB 3ARXA 4OAWA 1XR9B 3RKDC 4AQ1B 1AQDA 2RCSL 2QLVB 4R2GB 3B9DA 3ULVL 1K8DB 3UP1A 5C0GA 1FL6B 3H3PL 5AZEH 5LQBH 35C8L 3ECBB 1A22B 4YGAB 4I4WB 1U3JA 5T1DH 2DI8A 1N6UA 2VUYA 4MSWB 3UTPD 1IGFL 4XCCL 1D5IH 3ARYA 2VQ1A 2Q8AL 3QG6A 3I85A 1B90A 4ZXBC 3CDFA 1HZHH 2Z92A 3QIWC 1SMAA 5F44A 3OKMA 3ZTJH 3D2UA 4GKNB 5F1IA 3ZHKA 2CUIA 2G5BB 4LAQL 2ZG1A 2EZ0D 5F1OB 4X98B 4U1LA 5C0RL 2HT3D 3VJ6B 3FQNB 4JEGB 1OARH 3CLEH 3MMEA 4XCFH 4XNQB 3IFPB 4GAJH 3QNXA 1AD9B 2C3WA 2F74A 3CFJA 4CADA 5KSVA 3Q6FA 4LCIH 3ARBC 3UXFA 5KVGH 4HT1L 1FO0B 1HYSD 4DVRH 4KKCC 3U36B 4N5UA 3FTGA 4PJCB 4A6YL 4R0LC 3VXRB 4G9FE 1R3KA 4NPYA 3JTTB 3L5JA 1DBAL 5I1GH 4YK4B 4LEOB 5CJQH 5IB5A 2AV1B 5EUOA 1T4KB 2V5RA 4HUVA 2M26A 3SQBA 5FHBL 2VN4A 1P7KA 1D7FA 2Q3AA 3L3GA 3BXNB 4KI1A 1KXVC 2R1WB 5BO1L 3RI5K 1ACZA 5DC0A 2HRPH 1QYGH 2ZCHL 2IFFL 1UVQA 3TA3C 2DDQH 4XMPL 3FO9A 4OD3H 2VDKH 4LPCA 2R0ZL 1QSEA 1VACA 1Z9SA 4KRPD 1F58L 2IALB 3NACL 1B3JA 4C57C 3BT2L 3GIZL 4MA3A 4J3TA 2AGJL 2GKIA 4RAHA 2XN9E 3UTTD 1X5HA 1NC4B 2QHRL 3GMRB 3GSXA 1R5VA 5ERWB 2DAVA 4Y4FB 4AL8L 3IETA 1EO8L 2ERJC 3ULUH 4HPYH 4M8QB 3CXDL 4YHOH 5FOJA 3RJDA 4LMQE 1G7QB 4ZUSA 3D5OF 3FB7A 4WHYH 1JYXA 1J0HA 1NMCB 3MBED 1BM3L 1JGVL 1F6AB 2J8OA 4G9DB 5ICXA 3UTZA 5IT2H 2DLFH 3GBML 3TH4T 1G9NH 3VA6A 1BLNA 4QRTA 1Y6KR 3G6AB 5F3BB 4P4KD 1DEDA 4AZ8A 1KENH 3TJEL 3DX6B 4NN5C 4X8JB 1L9NA 4H26B 4AT6B 3WO4B 5JDSB 1M1SA 3TCLB 4HZLA 3LKOB 1I85A 2HJFA 3QRFM 5J6HA 2WUCH 1D9KD 5JW4M 3T65B 4ELKB 5C0IA 1OAYH 1QFWH 4TVSa 5H37G 5I19L 4IEFB 4BH7B 4JPKL 5D2LA 1YEFH 2LTQC 4XPHL 3O45A 4EN3D 2HKHL 5E2UL 4KWUA 3MV8A 3L6FA 1OTTD 2ADFL 5FO8B 1L6ZA 2NQCA 1LP9E 3QFJD 5DJDA 3S97C 2W60A 5IVZA 3WS6A 4ZFGH 3A6BH 2WQRA 3U0TB 1Q0XH 4S1DD 4Z9KB 1J1PL 5H2BA 4U6HB 2ITDA 4EQ2A 2O5YL 4DFHA 5DO2C 2AJUH 1M7DB 3C5ZB 3ZYZA 3GNMH 3ARWA 4U7MA 5FECA 4ALAH 1EXUB 4K7PL 5GGRA 4ORGA 2EEDA 4LVEA 4PRNB 1XF2B 1SEQL 4Y4KA 2QSQA 1MWAB 3AROA 5E00B 4LCUB 1OGAB 4S2SB 4DWHA 2X9XA 4FFYH 1M4KA 4IMLA 1GZPA 3B3IB 3QI9D 4HIXL 4JKWA 3MOQA 2MQ3A 5DJ8B 5C0BD 3VXOB 2WIMA 2KL6A 1JRHI 1ETZA 5DMKA 4G7YH 3IU4L 3WHXB 4P5MB 2YPVL 5EPMA 1OLZA 4OZFB 4RBPK 2W07A 2IANB 3EZJB 5JDJA 1X5YA 4XC1L 1JF1A 2RQ8A 5FO7B 1LMKA 1OPGL 3TWCL 4M6OH 1BECA 1MPAH 2ZCLH 3M8OL 4OGZA 3AAZA 5FKAB 3SCMC 2JJTC 3BIKA 3L5XL 1R3LB 3VWJC 3U1SH 3KPSA 3QIUA 5EU5B 3TVMA 1XMWA 1KYOK 3RDTA 5EBMB 5FB8B 3BKCH 4JFYB 2YZ1A 2YN5A 4JQIH 1ODAA 4APQC 3MCG1 3FT2A 3RWIA 3SGKC 4YHLL 4M7LT 4K8RC 3CK0H 5HVFB 1IMHC 4JFQB 4TPRL 3VD9A 3HAEH 2EC9T 1TCRA 3WNKA 1FJ1B 2EH8H 5GHWL 4ONFL 4P23A 2A6DB 4F57H 4J1UA 3PWPA 4E41D 3HPJB 1Q94B 1HXYB 3D3VD 3ROOA 3SGDH 4EUPG 4BFIA 3W0WE 1MHCA 3LMJL 4UTBL 4I0PA 4WI2A 4PGBA 4I77H 4KXZI 4N9GA 2C1PB 1IZJA 4D0CB 3FFCE 3O8XB 4N0YL 3HMXL 4OGXL 3AM8C 3QHFL 3FB8B 1BIHA 3PXJA 3BQUB 4OZGF 1X5ZA 2J88L 4DCQA 2R0KL 1U36A 3VFSB 4K3JH 1TIUA 3RWCA 1H3TA 2NXZC 1B0GA 5J56B 2XZCL 3P4NB 3QIBB 5IIEB 3UC0L 1H15A 4WI4A 4JY6B 2XRAH 2KQNA 4TULH 5TDNB 1A64A 3UBXA 2CRIA 4YHPB 3FRPA 1YJDC 3EYUL 2HFTA 3U30C 5D1ZA 5H94A 1QVOA 3MV9E 5L6YL 3OXRA 5L7XH 3JV4A 4NBXB 1INQB 1BZQK 3R06A 4JGJA 1WTLA 2WW8A 3EUUA 3H7BB 2NY5L 4YHIB 1NC2D 1VSCA 3ELAT 5GGSB 5DD3H 3CLFL 4IOIA 5DRWB 5DJZA 5DEGB 3KXFD 4NN6C 2DQEH 3FAWA 4PRPD 1PG7L 1PKQB 1CE1L 2LU4A 2HT2C 3SGJA 3BMWA 3C08H 3BESR 2BDNL 3DXAE 5EOTA 2H9GB 2IQAA 3VH8A 4YXHL 5K59E 2IAMC 4NM4H 2BOBB 5D96C 1MHHA 3JUZA 5E2VL 4P9ML 4JO1H 1LO5A 3SDDA 2WM0A 4GKZA 2YA2A 3IDJB 1W2KT 3MRDA 2V6HA 4JFOB 3BW9B 1LNUB 1T03H 4NCDA 4X6CB 1NCCL 2XWBA 4AMKH 3ALWA 3B2UD 5CSBA 3CU7A 4KTEL 5IR1A 3BE1H 5FDWA 1ONQA 5GGTL 5L88H 1ZSDB 3LZFH 3ZDXF 3SJVB 3JWOH 3RUGB 3ULUD 1H8SA 1FG2A 4WGWB 4P2RA 4WO4D 3MRHA 4Y16C 5F93C 1N4XL 1U8PA 1NCDL 3LOWA 1J0IA 4L4VA 4WRLA 5J12C 1V5JA 1F90L 4PJAF 5C0AB 3LKRA 3PHOB 1D6EA 4LLUB 3BEVA 1T2QL 5D2NA 3LKPA 1S5HA 4QHKJ 3ZKXB 1G7JA 4RAUA 4PJHA 1LEIA 2ADJA 3SDYH 3WDIA 1NJ9B 3TLRA 5KVEL 2JCCA 4Y88A 1LO2H 3MZGB 4QEGA 3T0EC 1PLGH 1BAFH 4R3SB 1KGCE 4LKXA 5ICZB 3DVNB 5FYLH 5IWLC 4OKDA 1OAQL 1N5AB 5E99H 5HHQA 2DF3A 4JM2C 4LPTA 1I4FB 4X6FA 4NP4H 1NPUA 1LILA 2BOCA 3HKFA 3CH1A 2XA8L 4QYOA 1RIVH 1F2XK 3PABA 4GG6A 1PYWA 4ZTOH 5F9OL 3VXME 3QEUB 1T89A 2C3GA 5TGBB 2XKSA 1BIIA 1PEZA 1S7WB 1UM4H 1N0XL 5GRZA 4HKJB 1QLFA 2CKBL 2HT4D 4OZIE 5F3HA 3UPAA 1BQLH 1G1CA 4KDWA 5CJOL 3OTTA 4U2ZA 4OFVA 4M03A 1QBLL 3VCLB 2X4QB 4YHZH 3BO8A 4ZNEA 3QH3A 1IQWH 1F4HA 2NY3D 4ACPA 2HA1A 3O3DB 4K3EH 4XPGH 4C54A 4BZ1L 1PY9A 4E0RB 1TQCC 1A7PH 3MBXL 1NCBL 3GSNA 1YEDA 4I1NB 1M7IA 3BHBA 1T0NA 2ICWJ 2P5EE 4KJWD 1I8MB 1A7OL 5IBTL 5CINH 5FA4B 2PW2B 4CBPA 3CGTA 4LGPB 2VL5A 3RKPA 1FFNB 1RVFH 1SY6L 1KEGH 4U1HB 5CSZB 4KTDH 3F58L 5SWSD 3H9ZA 5FUZL 3WLWD 5K93A 1W72H 4PJ8D 2HLFD 3CZFA 1ZMYA 1N2RB 5CKAA 4PS4H 4FFVD 4X6EB 4Z7VE 1NKOA 5F7WC 4L1HA 1JHLH 1S9XB 1TVDA 1YYML 2EE6A 3GSRB 4PJFF 3T09A 1VDGA 4TUJB 1PG7W 2W9EL 5KZCD 1LK2A 2GEEA 4KDTC 3G6JF 2DWDB 4LLAA 2AJ3A 3V52H 1HKLL 4PV9B 1MLCB 4NN7B 3B2VH 4ODVL 3MBEA 4JFZL 3MV7B 4ENEC 5FYLE 2BX5A 2RHEA 1SHMA 1B0RA 3V6OA 5D7IF 5DC9B 4RFEA 3GM0A 1JK8A 4P4KA 3CFCL 4Q6YA 3K1DA 4ODXA 5MEPA 1FNLA 2BVPB 4HD9A 2Q76A 2R23B 5E1AB 5FYKU 1J8HD 1F4WL 2GT9A 2Y06H 4Y5VB 4XRCB 5C2BL 5DUBA 4Z7QE 4XC3L 4GKOA 3P2TA 1FL5A 3QNZB 2QQLL 1CK0H 2IF7A 4PGDA 2DQJL 4WCYL 3NA9H 3OXSB 1ZXQA 3V4UL 3QFJA 2CGRL 2A6KA 5LBSL 2C5DC 3V6BR 1FH5H 4DGVH 4HGWB 5HI3C 4ZFFA 4R97B 1J0JA 4G8GE 4DGIH 2XTJD 5A2JH 3GSVB 5IKCA 4YGVA 4KKLC 3RVWC 3HN3A 5T1LA 3BRDA 1CL7L 1A14L 1CU4L 3KYMA 4X4XA 1A9EA 2P42B 3O4LB 4XPTH 5EG6C 1AC0A 2R69H 5K9OA 5B38A 4DEPB 1KCUL 3V6ZB 4NUGH 2CDEA 1EFXD 5FXCH 4AG4H 5IESH 4M1CC 2OR9L 4QWWD 2O61B 3HI1A 2HN7B 5KSUB 3QUXD 4WW2A 3QI9A 5GSVB 3OG6B 1INEL 2BCKB 3CVHA 1CTNA 2DQFB 4ZXBB 5J1SC 5C0BA 3ZDYE 4LU5L 2Y6SD 5FYJU 2CIKA 4WJ5B 2FB4L 1QKZL 3VDBA 2VC2L 4FQXD 3C8HA 3VG0L 2PTVA 3D39D 1T7ZA 3PWUA 5C8JA 1JMZA 3FN0L 2QEJA 3DI2B 4MCZA 2OTUB 4HH9B 1KTKE 5E8NA 5MI0C 1M6OA 4G9FB 1T3FB 3ARBB 1WZ1L 2GY7B 1LEKB 3ARFD 5HHMD 4PJGA 4PJ9D 4UIMB 4R0LB 4JANB 3OR6B 5E9DD 3SDXA 4CW1A 3RBSA 3QRGH 2C1OA 3TIEA 3VU2A 1EK3A 1Q72H 1KJ2A 2W0KA 5FA3A 5E0QA 5D71L 3P77A 1RIUL 1XGPB 4R2GD 3LS4H 3TNMB 3I50L 1P6AB 2JB6A 3I6LD 2XI9A 2VLRA 4DKEL 3VI3F 4G5ZL 1AGFA 4UT9L 2BRRL 4E41A 1HE7A 4HKXA 3LQZA 3TA3B 1SYSA 3NZHL 3U48A 3E6FB 5F21B 2X44D 3S7GA 43CAB 2E5EA 4O5LH 2XN9B 2WP3O 4I5BB 2HJLB 4NNYA 1E28A 1KIPB 2ID5A 1UCBL 4MAYD 2H32H 4QXGL 1UADC 1IGIH 5KSAA 1AGDA 4X4YA 1FV1B 1FIGH 1EGJL 2EDJA 1ZHLB 1TJHL 3RZCA 5HYJB 4ZSOB 2QTEA 1CF8L 4MD5B 4GMTH 3TYGH 3M07A 4OUUA 3EJYC 4X5WA 5C0JB 3MJ9H 4WI6A 2J6EL 2ERJB 1JWMA 2IMNA 1S7SB 1CLYL 5CZVH 3IB4A 1OLLA 4HS8H 3VXPB 2X4SA 3VXRD 4C56B 3O41B 4E5XA 1NGPL 4L8BB 1KCVL 5IVNA 4DGYH 1NC2A 5GISL 1UKTA 5BW7C 3F65A 1P84J 4NN5B 1I8LC 3KXFA 5KVMC 1IFHL 1N64L 1A6VH 3BJ91 4PRPA 2IGFH 5CJ8A 1T66C 3SDCB 4HWEH 3MXWH 4Z5RA 2LVEA 5MERB 2LTQB 3G04B 3ARGA 3X12A 5AZEL 5LQBL 2Y5TA 5ESVB 1QR1B 4FQHB 4G8FB 4HWZA 5T1DL 1MCOH 3BH9B 3IJYA 4BSVA 1Q0YH 4J12A 2ENSA 2P5WD 5GPRA 1HI6B 1FL3B 4MA1C 1D5IL 2YRPA 1HZHL 1OAKH 2AK4B 5IBLD 1K3IA 3MRJB 1MCDA 1CT8A 4PG2A 5M7QA 5EZOH 1NC4D 2G75B 3OKDB 4BM7A 4LKCB 1MAMH 5BZWA 3WFBH 4FOMA 3LCYA 3MA7B 4Y4FD 1XF4B 1OARL 2DOCA 3CLEL 3SKOA 4XCFL 5SWZD 5DHVA 4GAJL 2JJVA 1JGEB 2NW2B 4PP1C 2P1YA 4G8IB 2FGZA 4LCIL 3RBGA 5KVGL 5JA9A 2DD8H 1MCPH 4DVRL 4ZAKC 5B4MD 1T1WB 4WO4A 2CRZA 4ZDHA 3DX9B 4HULB 1OSZA 1KPVB 4TNWK 5A16A 2GAZA 1BJ8A 4R4FH 2E7CA 5I1GL 3RU8H 4PLKC 4I0CC 4PV8B 2ZUVA 5CJQL 1OD9A 1S7RA 1S7XA 2HLAB 4UNVA 2Z35A 4DOHB 3FQTB 1MCWM 5FF6B 3UTOA 3U7WH 1IEHA 3JTSB 5EBGA 5GRUH 4YH6A 5BRZB 5DJ6A 2NX5E 4WNQA 3VI4E 2DIJA 2HRPL 1QYGL 3SCMB 1NL0H 4GUPA 2DDQL 3C87A 4DK6A 3MR9B 5BOZG 3HFMH 4OD3L 2VDKL 4FP8H 1OW0C 1FLTX 3BKYH 3QDME 4APQB 5JXED 4PRHD 1A1OA 3C5ZD 2DQHH 3U0WH 3UTSE 3QP3A 5DRZA 4HIIA 1YEKH 1SYVA 4GXUM 4PGEB 1WZKA 2XQYK 3W0WB 1BD2A 1U8HA 3QULB 2VDLH 2C4XA 4L9LA 1G7IB 1FVDB 3FZUC 1OGAD 5JOPE 1AFVH 5E6ZA 1XGQB 3ULUL 4HPYL 4HUWA 4YHOL 3VFTB 4OI7A 1CDCA 1DQTA 2ZUWA 1UZ8A 3BP6A 4X5LA 1XZ0B 5IT2L 3OHXA 1MFEH 2DLFL 1CN4A 2V2WB 1I7RA 3DX7B 1G9NL 3DURA 1MCJA 3N9GH 2VYRE 4F58H 5IMLA 4GQPH 1KENL 3QQ9C 5TH2B 4KVCH 1KN4H 1U3HC 5LGJA 1WAAF 1VEOA 2NXZB 4YEFA 2WINA 4WWKD 4O2FB 2ZCKH 1S9VB 3QDJD 1WT5A 2WUCL 1OAYL 4KV5F 1QFWL 1Z5LB 3BPCB 1MCNA 1YEFL 1CG9A 3MRRB 3U30B 1NCNA 4Z0BH 1T7WA 4KZEH 3U7YH 3LVEA 4MXQC 1EEZB 1D5MB 4ZFGL 1KTLB 3A6BL 2Z31C 4KRLB 1Q0XL 4P4RA 2AEWA 2J8UB 3RL2A 4WFED 3PNWB 2AJUL 3MRLB 1U3ZA 4U05A 3GNML 3DXAB 4NN6B 1DUZB 1RJLB 5SWSA 4ALAL 2QQNH 4EJ1C 2EYSB 5D72H 3ZE0F 3O6FC 3TPUB 4Q58C 4A2LA 5B3NA 3QXUA 1A3RH 2IH3B 4LHUB 4PREA 3P4OB 4FFYL 3O8XD 4ZFOB 3TYFA 4YWGH 1AGEA 3OX8B 4OZGE 3ZKND 2A1WH 5DMGC 4I3GA 4YBQC 2V2XB 4HK3J 1JZ3A 2BZDA 1QNZH 3SKMB 4HCRA 4OD1H 4P2OB 2DBJA 3IAGC 5IQ9B 2VXTH 1CI5A 3VXSB 1F5WA 2XQBH 2DL9A 1G6RH 1TTGA 4G7YL 5JW5B 1A1MB 3KYOB 4W4NA 3UJIH 4DTGH 5T3ZE 1U8JA 4WFHD 5IUSA 4GW4A 3TT1H 5E94B 4LLQA 1NDMA 1IC5H 2R2HB 4HWNA 4M6OL 1MPAL 2ZCLL 1T21B 4XCYB 3T4AA 3U1SL 3PL6C 4UQ2A 5E4IA 2ICEA 4Y16B 2Z9TA 1XGRA 1GC1H 4M6MH 3BKCL 4JQIL 5J12B 5CD3B 1KPRA 2HMIC 4HX1A 4F7TA 2GTWB 3CK0L 2R0LH 4H0HB 5C09A 4E9LA 1U93B 5BCAA 3IGAA 3T0EB 2R9HD 4IHOB 2EH8L 4BELD 4F57L 2A6JA 2ZSVA 4AEFA 2IJ0C 3WN5A 3O3UN 1TMCB 5I1HH 4QT5A 3SO5A 1U95B 3IFLH 1CFTB 1DEEB 1K4CA 4PJEA 4V1DE 4I77L 1QSFB 5B3JF 1TCMA 1EFXA 4JM2B 2EDBA 2UUDH 1OAXH 5D7LD 1SJHA 4FZEH 4K3JL 3ZDXE 4FQXA 4KZDH 3MLWH 2XRAL 3C6LB 5MENB 4TULL 1IEBB 3V6FA 4PJAE 2JK5B 5L7XL 2FJFA 2EXYC 4HWBA 1NGZA 4ZPVB 5IB4B 2IBZX 3E1F1 4MLSA 5IROA 4CMMB 3A6OA 1ZLSH 1RJZA 3HC0A 5HYSA 5DD3L 2FGWH 4XCNA 3BH8A 3BZFB 5E9DA 4ZOBA 3IJHA 2DQEL 1G7HB 2E9BA 3BDXA 5LG1A 2R1XA 1AO7D 1U58A 1S7QA 1XR9A 3ARDC 3U0PB 1TQCB 3GMLB 3C08L 3ORJA 1A1NB 3UBXG 1II4E 5E2JA 1K8DA 4OZ4B 1FL6A 4HJGB 3RGVC 3KPTA 1YN6B 2ICWB 3ECBA 4I4WA 4NM4L 2P8MB 3OR7B 2ZP0T 5IFJB 4M48H 4YEEA 4DW2H 2BJMH 4NJ9H 5FCUH 4MSWA 4JO1L 1AXIB 2V17H 1C16B 3B43A 4Z7VB 1T03L 2Q8BH 5TDOB 1QOKA 3OPZH 4AMKL 4GKNA 1I8KB 1E4XH 1Q9WB 2G5BA 2BK8A 2K7PA 2NY1D 4NKMB 2VH5H 3BE1L 4X98A 4J4PA 5HDQH 3U4BH 3WKMH 1NFDF 3ALXA 4F3FB 3VJ6A 3FQNA 5ADOH 2WUBH 3WIHH 5L88L 3LZFL 4XNQA 3VH8G 2JKXA 3IFPA 3JWOL 1AD9A 4F9LC 1KCRH 3OGOE 4WU5B 5HHOB 1FO0A 1P9MC 2YR3A 2VZOA 2YHGA 5BQ7B 3U36A 4PJCA 3VXRA 1QACA 1QRND 3JTTA 2FD6H 1CFNB 5DR5H 4I18C 3LDBC 4LEOA 1JJUA 1DN2A 2AV1A 3SDYL 3SE3C 3MXVH 1Q9OB 4R90H 1T4KA 1LO2L 2IMMA 5KBNC 3CC5B 1DLHB 1JPGB 2ILLA 1PLGL 1BAFL 4WHCA 3BXNA 5GZNC 3TEUA 4JQXC 2R1WA 1VFAB 4QNPF 5FYLL 4ERSH 4J3WA 2LAGB 1ITBB 1PFCA 3RVTC 1TJGH 5E99L 4G8GB 5L2KE 3B5HA 3EOYG 3GUTB 3RWDB 3NIFE 2VDPH 4NP4L 2IALA 3SKNB 2SEBB 1RZJC 3X14B 1RIVL 4PJ7F 4PRAB 4X9BA 4ZTOL 1T1ZB 3GHBH 3W39B 1IC1A 4FTVD 1CDYA 1NC4A 3GMRA 1TENA 1FFOB 3G6JE 5ERWA 1UM4L 4Y4FA 1DE4B 5FOBB 3C6SB 4ZUTB 1DANT 5CILH 1MFCH 4PJXF 3MLRH 4M8QA 1A6PA 1G7QA 1MSPA 5D7IE 4FZ8H 1BQLL 3ISWA 3MV7D 1F6AA 4G9DA 3RJQB 4MQTB 4QRUB 4LSDA 1PZ5B 3KYAA 4XX1E 4YHZL 5C3LD 1IGYB 1PSKH 3LAFA 3G6AA 3FB6B 5F3BA 1IQWL 1XH3B 1K8IB 3DX6A 4X8JA 2P4AB 2UV3A 4H26A 4AT6A 3O3BB 5JDSA 5CLWA 5IJKC 3TCLA 3LKOA 4K3EL 4XPGL 4MVBD 1BZ7B 3REWB 5KTEH 1ZA3B 4H88H 3RWHB 3T65A 4ELKA 1A7PL 4YBLC 2QSVA 4BH7A 1HILB 5MI0B 4XNMB 3SEPA 3B83A 5CINL 3PQYD 1WZMA 2FL5B 2MKLC 2NXYD 3RWGB 5FO8A 1FNFA 2CMRH 1WIPA 3U9UB 3ZLQC 4UMGA 3U0TA 4WI3A 2P8LB 1RVFL 4KKAD 4U6HA 3I6GB 1KEGL 4ISVB 4K3GA 3GK8H 2EIEA 2FJGB 4KTDL 3TV3H 5JXEA 1M7DA 3C5ZA 4PJIB 1W72L 1NGWB 2ESVB 3RKDD 3W9EB 2X9WA 1RZ7H 2YD6A 1EXUA 4PS4L 4JPVH 4PRNA 1XF2A 4HWUA 1JHLL 3QEQB 3O4LD 9CGTA 1MWAA 5C08D 1L0XA 5CBEB 3RA7H 5E00A 4QRRE 4LCUA 1OGAA 1H5BC 3IDMB 2ZNXA 4S2SA 3MODH 4JE4B 3V52L 4CU6A 4WTZA 1F97A 4U1MB 3KS0J 4P3WA 3WJJA 4QRSB 3B3IA 3B2VL 3MRFB 4I9WD 4ELMF 4L3CB 4ZXBD 5DJ8A 3VXOA 2V2TB 4TSCH 4L3EE 1EEYB 1JBJA 3WHXA 4WV1C 4P5MA 1T83C 4OZFA 2DKMA 5KANG 2IANA 2AP2A 3OV6A 5DJCB 5CGTA 3PF2A 5FO7A 2Y06L 4G9FD 5BS0E 4NC1C 3ARBD 5GGUB 5FKAA 4CRPA 1Q9LB 1R3LA 2DS4A 1CK0L 4LVOC 4LLYB 5E4EC 4XVTH 5EU5A 5EFIB 3W11C 4YJZL 3NA9L 5EBMA 1PY4A 5FB8A 4JFYA 1EHXA 2EDDA 1FH5L 4DGVL 1DQDH 1NQBA 3HS0B 1K9TA 4XMKH 4DGIL 4K9EC 4AEHH 2GIYA 4FQPA 4JFQA 4POZD 2DBLH 3VI3E 1A6AB 1T5XB 1CD1B 2E3VA 1I7ZB 5I16B 1FJ1A 5CEYB 2EDRA 2FIKB 4BK5A 1ZT1A 3OKEB 2A6DA 3MOBH 3HPJA 1Q94A 1HXYA 4XPTL 2R69L 3RPIB 3ZTNH 3DRQB 1FGVH 2DLHA 1XT5A 4NUGL 1T7VA 4AG4L 5IESL 2C1PA 4D0CA 2GUOB 3O8XA 3MFGB 3KJ4C 3UX9B 1JHTB 3GJEB 4MA1B 1EPFA 2AXFB 2VITB 3FB8A 3GJFH 3LS5H 4OZHE 3I02B 2YXMA 5ITBH 4S1SH 3BQUA 1BMGA 5HYJD 3VFSA 4J23A 4OLXH 4F9PA 1EVTC 3P4NA 3QIBA 4M3KB 5IIEA 3ZT5A 1KJVB 4JY6A 5TDNA 3G5XB 1F8TH 4YHPA 3DVIA 4MQXD 5B38G 2M2DA 4J3OC 4DN3H 1YPZF 1NAMH 4C56D 1INQA 4OF6A 3GMPB 4ZAKB 2Z93B 3DLQR 3HG1E 3IJSB 4NO5B 2EXWC 3H7BA 1YMMB 4YHIA 5GGSA 4PRDB 3QRGL 4JPWH 5DRWA 3RY4A 5DXWA 1Q72L 2EIZB 5DEGA 3F6IA 2BSRB 2N1KA 5A2KH 1PKQA 4OGAC 1IVLA 1KF9B 3BN9C 3SDCD 3QUMH 3LS4L 4OGYH 2V5YA 4LEXH 4XP5H 2XFXB 3R4DA 3SO3C 2H9GA 1C7SA 1I9EA 3QDMB 1DBMH 1FNAA 5I76B 2AXJA 2BOBA 1EHNA 5DK3A 3ETBF 3MX0A 4HUKB 4LASH 4O5LL 4TTDD 5H35B 3IDJA 2AK4D 5DO2D 3NVQA 4H8WH 4JFOA 3BW9A 1LNUA 1IGIL 4XHJC 4X6CA 1FIGL 4U0RC 4JFEE 2YD2A 5FK9B 3PP4H 4QO1A 3DHMA 4GMTL 3TYGL 1ZSDA 3SJVA 3MJ9L 3WXWH 3RUGA 5CZVL 1FVEB 1BQHB 1J5OH 2QR0B 1FDLH 4HS8L 1AJ7H 5I8EB 4HDIB 1B4JH 1MUJB 5C0AA 3PHOA 4DGYL 5HD8D 4LLUA 5AYQA 3PHSA 3Q1SH 2VIRB 4ZPTB 3OB0H 1U3HB 1P84K 1NJ9A 4M9OA 1A6VL 2VKWA 5FDYA 2IGFL 4CNIB 5BRZD 2UVEA 4R3SA 1GJIA 4HWEL 3MXWL 5C0ND 5ICZA 3HE7C 3SCMD 3DVNA 4Q7DA 5K9QG 4Z7WF 3IT8D 3EJZD 1N5AA 1MCOL 1Q0YL 3GRWH 3Q5OA 3TBSB 1J87A 4IRZH 1PW3A 1I4FA 5IFHH 3D6GA 5IB1B 1OAKL 2WQ8A 2ZWLT 4K8RD 3MUHL 1IAKB 1A6TB 3AREC 5EZOL 3QEUA 4YIQB 1MAML 1QRKA 1RPQA 2D0FA 4HK0B 4NKIH 3T08A 3WFBL 5TGBA 3O6FB 1S7WA 4YHKH 1KCSH 5H37H 1OQXA 3RVVC 1BOYA 1I7UB 4XVJH 5CBAB 1JYNA 4HKJA 1FG9C 2X09A 3FRUB 3S37X 2VQUA 3WSQH 5D6DC 3AS3A 4BFGA 2DD8L 1MCPL 1FORH 3RHWF 1WAAE 1PGRB 4GLRI 5BJTB 3VCLA 2X4QA 2D4DA 4R4FL 3GM8A 3EYQD 3RU8L 4KV5E 2AW2A 2FEEI 3N0PB 1V3JA 2C4FT 1U6AH 3O3DA 1FNHA 1WC7B 4WUUE 4E0RA 3U7WL 3MLUH 5GRUL 4Q2ZB 4OF7A 1NUGA 1I8MA 2KUTA 4RMQA 1NL0L 5JQ6H 3TN0C 3PL6B 3WFCH 5FA4A 2PW2A 3HFML 3S6CA 4WHYG 3VRJB 4UNUA 2CKNA 1E27B 3MC0A 4FP8L 5C71A 3BKYL 3T3MF 1FFNA 1GOGA 5TE4H 2FHCA 4P59H 4U1HA 2DQHL 5CSZA 3U0WL 1T0MB 3ZE0E 4NZUH 4QXUH 5AUMB 1YEKL 3UBXI 4BKLB 2HT2D 2ZPKH 3L95B 4JY4B 2UY7A 3ZMRA 2F53D 1N2RA 4MX7B 4V1DB 2VDLL 4X6EA 3T04D 1C12B 2GHWB 1S9XA 3O6KH 3GSRA 5D1XC 4LHUD 2CH8A 3G5ZB 4TUJA 1AFVL 2ED7A 1YQ2A 1ZLUK 5CD5C 4N8CH 5HYEA 2DWDA 1EH9A 5E08H 4PV9A 5GS0C 1IGTB 1MLCA 4N0UE 4P2OD 5CJ5A 1MFEL 1MCFA 3MV7A 4R4NC 1YA5A 3VXSD 2YN3A 5I71C 5IBUG 4UV4H 5JORB 1KULA 4BYHA 2ZUQC 3N9GL 4F58L 2YD1A 4KVCL 1KN4L 3GBNH 4OF0A 2BVPA 2J2ZA 2ZCKL 3C5JB 4PJAB 2R23A 4OQTH 5E1AA 2IADB 3KPPB 3H0TB 3QXDB 4PJ5D 1N0LA 4Y5VA 4XRCA 4NJAH 4EUPH 4K7PX 5EZLB 1IKNA 4Z0BL 3QNZA 1P5UA 4FQIH 4Y16D 1LVEA 4KZEL 1G0DA 3U7YL 2BXYA 4I48B 3OXSA 4IRSC 4KQ4H 1BX2B 3HI5H 4HGWA 4M93C 5H8DA 3GSVA 5EDXA 4PRIE 1QFOA 2QQNL 2GK2A 3T0ED 3ARDB 5D72L 2ED8A 1ZS8B 3TO2B 3WIFB 2E6QA 4BH8B 5B3JE 1A3RL 1IAIH 3O4LA 3RGVB 3OAYK 1C5DB 5EIIB 3GDBA 1QSFD 3BWUC 3V6ZA 4YWGL 4JM2D 2A1WL 1U3YA 2O61A 4UV7H 4CVZB 2HN7A 5EUOF 5KSUA 1QNZL 5GSVA 2BCKA 4OD1L 2JF1A 2DQFA 2VXTL 4ZXBA 1DCLA 2XQBL 5DTFB 1G6RL 1J1OH 4DZBB 3UJIL 3MJGX 1MFAH 4DTGL 4WJ5A 4XNZC 4NUJB 4TYUA 4K2UH 2EICA 1U8LB 2DQDH 4OF3A 2ADIB 1FAKT 1BF2A 3NCCB 1IAOB 3C6LD 5IEKB 5MEND 3TT1L 3C8DA 2OTUA 3K4AA 3VGBA 1ADQH 4HH9A 1IC5L<