4KV6A

Crystal structure of staphylococcal nuclease variant delta+phs r126q at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLQKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS R126Q at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4kv6A00
5CV5A 3OWFA 3TP5A 5DEHA 1TT2A 3VA5A 4KV6A 2RDFA 3H6MA 2KQ3A 3SK5A 4NP5A 1SNCA 5CV7A 4YIJA 5EKKA 2SOBA 4QF4A 4QB4A 5CV6A 3TMEA 3TP8A 3NK9A 4K5XA 4R8NA 5CV9A 4J1MA 3P1HA 5IODA 4IALA 5C5LA 3C1FA 1KDBA 1EY7A 1KDAA 3R3OA 1JOOA 1U9RA 2EYFA 2NUCA 5EGTA 3NP8A 3ERQA 3T13A 2KHSA 5ISRA 1SNPA 1SNOA 1EYCA 2O4XA 4MIUA 3ITPA 3D4WA 2F0OA 2WACA 2EYPA 4HMJA 4WORA 2F0SA 4B9WA 4KJOA 2EYOA 2OEOA 4PMCA 1JOQA 3QOLA 2F0WA 2F0UA 2F0QA 3P75A 2PW5A 3LX0A 1SYEA 3BDCA 1KAAA 2EY6A 5IIFA 4KJNA 5CV8A 4DFAA 5I6YA 3D8GA 1NSNS 5IGFA 1EY8A 4K6DA 5IGGA 3NUCA 5KIXA 1EYAA 3EVQA 2RBMA 2PW7A 3DHQA 3OSOA 3HEJA 4LAAA 3D4DA 4PNYA 5K5PA 4F7XA 2PQEA 4ZQ3A 2M00A 4J6HA 5IGBA 1SNMA 2ENBA 2F0KA 2F3VA 4KY6A 4RKLA 3TP7A 1EY5A 4HMIA 4N9TA 2F0HA 3EJIA 4ZUJA 4DGZA 4ME5A 5J39A 2F0PA 1AEXA 4B9XA 2EYHA 3MEHA 1SYGA 4ZUIA 4DU9A 1A3TA 1IHZA 1STGA 1STHA 3NQTA 3SK6A 4F8MA 4EQOA 3MHBA 4RKBA 3MXPA 4HTHA 4ID6A 4NDXA 4S3SA 3QB3A 5M9OA 2SNMA 5IGDA 5E1FA 4G57A 3MZ5A 5CGKA 4OL7A 5KRUA 3NXWA 2F0TA 2F0NA 4N9PA 5CC4A 1SYCA 2PZWA 3E5SA 3V2TA 2QDBA 5CV4A 3SR1A 5I6WA 1SNQA 3HZXA 5C3WA 1EY0A 1JORA 1STBA 2F0FA 2LKVA 5C4HA 5J1ZA 2SNSA 1NUCA 1STAA 4NMZA 5JOBA 1EZ6A 3NHHA 3DMUA 2PZUA 4KD4A 3SK8A 1SNDA 5EKLA 5C6AA 5HURA 5I9OA 2F0LA 2F0IA 3BDLA 1EQVA 4K5WA 5E3FA 5IGCA 1STYA 2PYKA 4K2KA 4K5VA 4ODGA 1F2MA 4TRDA 1EY6A 2EYLA 1II3A 4DF7A 4E6IA 1STNA 3D6CA 5IGEA 2RKSA 4I65A 4H7BA 5J22A 5KYIA 4KHVA 5KYLA 1JOKA 2F0JA 1EYDA 2F0GA 1A2TA 4K2LA 2EY2A 3QOJA 4KY5A 5DAUA 1TR5A 1KDCA 1EY9A 3OMGA 2PZTA 3OMCA 3RUZA 4EVOA 1A3UA 4K8IA 2F0VA 5KEEA 4PMBA 1EZ8A 1SYFA 2HQEA 5HGTA 2EYJA 3TP6A 1ENAA 2EYMA 4K14A 3S9WA 2EY5A 5I9PA 5C5MA 5KGUA 1TQOA 2F3WA 2EY1A 4KD3A 4KY7A 2F0DA 4QMGA 5F2DA 3SK4A 5IOCA 3U9OA 2EXZA 4K8JA 1SYDA 3EROA 5C3XA 1F2ZA 4IZ8A 1F2YA 1KABA 4IUNA 2F0MA 4EQPA 4WRDA 1SYBA 5JAVA 3PMFA 1A2UA 3C1EA 1A3VA 5NUCA 1ENCA 4NKLA 3T16A 2F0EA 2OF1A 3SXHA 3MVVA 2OXPA 4EQNA 5CR3A 4KTAA 3SHLA 1RKNA 1EY4A 5C4ZA
chains in the Genus database with same CATH superfamily
1Z47A 4GOPB 5DEHA 1MGSA 4ZKBB 2DN8A 1I4QA 1Q1BA 4WJ4A 1HA5A 3OTOQ 2ZJRA 1X56A 4RGNA 3CC2A 3GTQB 1DOLA 2L9HA 2PMZB 4MIUA 5JEAG 2F0OA 4LF5L 5IP9H 1VQAA 2MP1A 2OEOA 4PMCA 1PV4A 2IJ0A 5JJLA 1Q46A 3CU7A 2HUGA 1HQRD 1PFSA 4JOIA 2F1MA 1O80A 1MJCA 4DFAA 3CCRA 4JI7Q 4BY7G 2DJGC 3DHQA 1B1ZA 1HNWL 1X3FA 2B8GA 3G6EA 1SNMA 2VQFL 2AWOA 5LHY1 3F2UA 5FLXc 3FKIB 4DR7L 5EPLA 3AFQA 4DAPA 2DY7A 1EQTA 2CQAA 1F9QA 1B2TA 3HKZE 1G2TA 2VXWA 2BDNA 4BS9A 1EL0A 4JBJA 4RH6A 4ID6A 3VR3A 1T5XD 1H9MA 5FO7B 4RWSC 2K04A 4K6LA 4ZKCB 4C3JG 2QDBA 3SR1A 4KK7A 1JORA 4R8IA 4K0KQ 2X6LA 1SSOA 4G7ZC 3A74A 1QVCA 2NN6H 5JOBA 1I5FA 3A54A 2F0IA 5C44G 4BY1B 4JV5Q 4K2KA 3AB9A 1BDOA 1CI3M 1XMOL 1GUSA 3S15B 1CHQD 4IJLA 1JWMD 2QA4A 1SBBB 1A2TA 5E7NA 3TRZA 4C3HH 1BBXC 3M4YA 3J7AF 1FD7D 3KJOA 1R4QB 1B8AA 2Q2HA 5IP9G 4LFCQ 4DV3Q 4O0AA 4XTCS 3RZOB 3IFTA 3ULPA 1PH8A 2C35B 1STEA 2KENA 1F2YA 1KABA 1XX8A 3NE5B 3BDOA 2GVAA 2KECA 4KHPQ 2H5XA 2OXPA 4EQNA 1XNRL 1Y8NB 4LFAQ 1HZBA 5C4JH 1OXVA 5C4ZA 1RTNA 2N8NA 3M3YH 5IYBG 2XNAC 1I94Q 1BR9A 3SK5A 1SNCA 5EKKA 2SDFA 1N34Q 4L5QA 4HJAA 1LO5D 4A3FG 1U4PA 3HG9A 1SNOA 2O4XA 1EYCA 5ISRA 4JOIC 2NWGA 4NXNL 3CCJA 2A6HD 1SE2A 4KJOA 1K0RA 2B2WA 3DWQA 3KF6B 4X3TA 5D65A 1EIYB 1JMCA 5FO9B 2JA5B 4JCVE 2OQ0A 2CVRA 2BE5C 1SRUA 2PW7A 2C9OA 3ZYYX 3PF4A 3H94A 5I2XA 4B08A 4QCLA 3MC0B 2R7FA 3DUZA 1NE3A 4FXDA 1D5XC 1I4HA 3BVMA 1AEXA 3OOCA 4LF7L 3HGBA 3EIVA 3BYYB 3P7JA 3T56B 4DNRB 4RKBA 2EVBA 4RHRA 3HOVB 2KHIA 3LNNA 2G9HD 3I4MH 3E5SA 1O7YA 1BXTA 2K33A 1DXMA 1QJOA 2UUBQ 4X66Q 3K6OA 4C3HG 1OXUA 1TWAB 5EBDA 1G51A 3FKIG 4L8JA 4G7HC 1FL0A 1JOKA 5IWAL 4UAIA 1L0WA 4YCWA 3GTGB 2F0GA 1EYGA 3UE1A 3CP0A 1YJ9A 2JJQA 2BA0A 4PMBA 3K7AH 1X3QA 1VQDA 2KCTA 2NYZD 1QOHA 3I55A 3HOVG 5I9PA 5C5MA 1HR0Q 1JT8A 4UP8A 2HD3A 4C2MH 1PZJD 1B3AA 1ET6A 3PSIA 3S2HB 4RFBA 3SK4A 4K8JA 2K14A 1K83B 4IZ8A 4B3SQ 2LMCB 4LWCA 3KFUA 2NBFA 3HKZG 2CW0D 2JYOA 4NKLA 1SMYC 2PNRC 3PUWA 4GNXC 2OTLA 3SHLA 2LXKA 2Y0SE 2FXQA 4R1JA 2LFNA 3Q6SA 2A69D 1YNJC 2SOBA 1XPRA 4O1NA 2RDGA 5C0XG 1FNWA 5C5LA 3HOZB 4UP7A 2G9DA 1BNZA 2EIFA 1XXGA 2KHSA 2PMZE 3R8BA 4A3BH 5BR8Q 2FFKB 1BO0A 1PTOH 2WACA 4JV5L 2K1BA 4DAVA 3ND9A 4IQZA 3PF5A 5C0XJ 3RZDB 2B29A 4KN7C 1V43A 3J80i 2EY6A 4L5SA 1GVPA 3HOYH 2ZTDA 1P16A 1X6OA 1XJVA 3D4DA 3PO3G 5IE8A 5M5XB 2ENBA 5J39A 4DGZA 4F88A 3H0GH 1PYBA 5A35A 5IP7H 3HOVH 3SK6A 1O7LA 1JICA 1AP0A 1E1OA 1WCMG 4BBRH 1CFMA 1BOSA 2Z8LA 4X3KA 5CC4A 1I3QH 3K58A 1HNXQ 3PQIA 2NVXB 2A19A 3GDEA 3SEBA 1ASZA 2E76C 3J80L 4DK3C 1W2BA 2PZUA 1V9PA 1IW7C 1N33Q 4BY1G 4ODGA 4TRDA 5K5PA 3MAQA 1II3A 1EOVA 1N34L 1LTAD 2RKSA 4I65A 4JI8L 1IL8A 1HZCA 2A8VA 4POGA 3KLRA 3NBHB 1VF7A 2PZTA 4TQUS 4HSPA 3AFPA 1SYFA 5HGTA 4NXMQ 2VL6A 4GNXB 5DM73 4K14A 1I50H 1L1OA 3CQZH 2DGYA 1AW7A 2X6GA 3D6WA 3CPWA 4BWGB 2TMPA 5F2DA 1CKOA 1YITA 1ICFB 3MFYA 3NWSA 4QY7A 1XNQL 5IT9E 1ENFA 1F2ZA 5FK9C 1VQJA 1AFPA 2K5VA 2F0MA 1SYBA 5JAVA 4Z9CB 4BBSG 2OF1A 2RHQB 3SXHA 1FGUA 2L5TA 5E4XA 1GUTA 1PLFA 1TU2B 2DY8A 1GJXA 3I56A 3F8TA 3TP5A 1I3QB 2KVMA 1DJRD 1HA6A 2BCOA 1HJPA 2GA4B 3FEWX 5ELEA 4CJ2C 1Y1VH 4YIJA 1B44D 1VQHA 1FR3A 4IFDJ 2AUKA 5IODA 3S1MH 3NBIA 1EY7A 3TZDA 2R92B 4IURA 2JA5H 2JA6H 4IUQA 1M8AA 2MUYA 4JI8Q 3VR6A 3I3CA 2E2IH 4Q0FA 1VQIA 1S5CD 2KEDA 4LW1A 3M9BA 1BUVT 1DM0B 5IIFA 3KJPA 1AE2A 1A8VA 1EY8A 5IGGA 1F2LA 1Q8IA 2B2UC 4C3IH 2K5QA 5C0XH 5AJ3Q 4CBVA 4A3JB 4KY6A 1S72A 3FHWA 1E1TA 2DNEA 2WAQG 3TDQA 3OW7A 4R4OA 4PMWA 1STHA 3I4LA 3NQTA 2ASBA 4GNXA 2ALYB 3M4QA 3S17B 2SNMA 3MZ5A 2ZTCA 5FOBB 2J0TD 4M1UB 2F0TA 4H02A 3JAML 1SEBD 2DNCA 4POFA 1TIID 1K8GA 2NVQH 4RAUC 4IPDA 2OQKA 1IKLA 4JC0A 1Q3LA 2XRQD 2R7ZB 4A3JH 1CZGA 1K8MA 3QIAA 4UPAA 3STBD 1F9SA 1Y8PB 3OMCA 4YCVA 4YY3L 1A3UA 3MXGA 1EZ8A 4JK1C 2B2YA 3W1BA 3TP6A 2I5MX 3QJYA 1ILPA 3EFXD 1BVSA 1EIFA 3VYTA 1PZID 2V1CC 1M4VA 2YTYA 1WYDA 4DKAC 1J9OA 2K32A 3ULLA 2WB1E 2IHEA 2OCEA 3T16A 5BN5A 2K28A 4V0BA 3J81c 1QVFA 1VQBA 1JCKB 5CV5A 1K8OA 4A3EG 1XNRQ 1U5KA 2K01A 3VA5A 3H6MA 5FLMH 1M90C 1JR0D 3G4SA 5A2QE 3K81C 1VDZA 3C1FA 1KDAA 3F1ZA 2NUCA 3BVGA 4JVZA 3FMCA 1E22A 2EZVA 3K57A 4DV0L 2R61A 1RIPA 2XWJB 3CMAA 3R93A 4GOPA 2E8GA 3BZCA 1KIXA 3KBGA 4PZ8A 4XYOA 1EWIA 1VQKA 4FF3A 1FGBD 1LTLA 2AKWB 3S16H 4YHHL 1IXRA 3S1RH 3C46A 4RA8A 3ER0A 1CKNB 4KKSA 3MA2B 2KCCA 4NXML 4RKLA 2UXBL 2CKZB 2HCIA 4X65Q 1TWFH 4JW0A 3RN5A 1M1KC 5H1SE 2EYHA 1U4RA 4B3RQ 1B53A 5D3DA 1STGA 1NJIC 1CSQA 4V190 2WB1G 4OIJA 4FP5D 1TY2A 3KDFA 3PUZA 5E1FA 1I4GA 4OWWB 3HOYG 4KN4C 4DK0A 3T1YQ 4A3BG 5I6WA 3HZXA 4DAMA 1AH9A 1I4RA 1XYIA 5J1ZA 2SNSA 1NUCA 4A3IH 1EZ6A 3S1MB 1U4MA 5I9OA 2GVBA 1XMQL 3BDLA 2L11A 4K5WA 1EU4A 2B39A 2XRSD 5LMNQ 5J3BA 4K5VA 1HNWQ 3Q0AA 1PH5A 3FVQA 3W2DA 3X3NA 1E24A 4HJ9A 4TVAB 2E2JH 2K5WA 1PFBA 5D14A 3TN2A 2HQEA 1QZGA 4R4CA 4LF6L 1LUZA 4LF5Q 3M4PA 3S14B 1N32Q 3A7AB 4MTNA 2AQ3B 1VQGA 2NN6G 4DNIA 4GLVB 5IOCA 1MIUA 4MTKA 4A3FH 1S4ZA 3O13A 1C7YA 2Z6KC 1YZ6A 2E75C 2UUBL 1ET9A 1GUNA 1MKHA 2ZT9C 3CCSA 1D5MC 5BR8L 4PQXA 4HIOA 4OIKA 2KOLA 1UE6A 3QR8A 3UDIA 1R9TB 3VA7A 3DWAA 1ZYRD 3KBXA 4UDUC 3DM1A 3MWYW 1HNZL 3NK9A 4HN7A 1OXXK 1V8QA 2PPBC 4XT1B 3F2DA 3J80c 2A1AA 1JOOA 1PRTC 5GAEC 4HCSA 4JPBW 2CHBD 2B63H 5ELOA 1U4LA 4B9WA 1J6QA 2EYOA 4UY8C 1VQFA 1NCVA 4PZ6A 2UXDQ 1I4PA 2JE6I 1GKHA 1H9SB 4K6DA 3T1YL 4IPHA 2MO0A 3B6YA 1C48A 4GKJQ 2R6GA 2PQEA 5M5WB 1PHJA 3EQLC 3I4NB 2LY7A 1WVLA 4BY1H 1DGSA 3RMHA 2PI2E 1RHPA 3GTJB 3FRPB 3Q8DA 1RL2A 3HOXB 1UNSA 1TS3A 2D9UA 5ELCA 1NMFA 4ILWA 1YNNC 3SGIA 2NZ1D 5KRUA 4GZYC 3S2DH 4IUPA 5C4XG 1N8RC 3T1HL 1STBA 3BG3A 4NMZA 1Q8KA 3DMUA 1SNDA 5EKLA 4ZAIA 1IYVA 4HJ7A 1AN8A 3OIQA 3A0JA 3K5NA 5M5YH 1VQNA 2B2TC 2A6EC 4RMFA 5M5YB 4JI7L 5ELNA 4RCOA 2CH4W 2QCPX 3U4VA 2CFMA 2K52A 4LF7Q 1PA6A 3K5LA 3OMGA 2ID0A 2VQEQ 4EGVA 3I4MG 1G6ZA 2EYJA 2R93H 3I8ZA 5I4DA 4GKJL 1L0YB 5IWAQ 2YTXA 1MI2A 4QMGA 3U9OA 4YHHQ 4DR6L 1B3QA 1B9NA 1YBYA 2JA6B 2KHJA 4IUNA 1DCZA 4EQPA 2R92H 4HJ5A 1G91A 1Y69U 2YU9B 1H9SA 1X55A 4NB3A 4JBKA 3G48A 5IYDH 2L4NA 1Y1VB 4XIGS 1I6VC 4RGTA 1QZHA 1V1PA 5FLXE 1CQFA 3AQQA 4JI2L 3E3XA 4DU9A 3CAMA 1Z9FA 5CV6A 2UXCL 4K5XA 4R8NA 2CWPA 1IYJB 1X3GA 5M3FB 2Q2UA 5D3IB 5EGTA 4GLXA 3M4OB 2UXBQ 4DV2Q 1SAPA 4BA1I 4HMJA 5FLMG 2EYPA 4ME3A 1TWGB 1WCMH 4KLKA 3S1QB 1JOQA 2Z4IA 3E9IA 3LX0A 2XTIA 1EQRA 5EJWA 3GTOH 1QE6A 3I2ZA 3OIPA 1QCBD 1EWHA 1FJGL 3J81L 3VYRA 1Q12A 4DAYA 2WP8J 4PNYA 1PYWD 2HHHQ 2I5LX 2HCCA 4B3TL 3S16B 1VQMA 2F0HA 1BCPC 2WAQE 3W5OA 3HOUG 1N32L 2R93G 3NELA 1IBLQ 4IFDI 4F8MA 5EPJA 3GV6A 1SFOH 1VCIA 4P72A 4NDXA 3GTLB 2VUMH 4FVMA 2EJMA 2VB3X 2IT1A 5LMNL 1CKNA 4DV1L 4IUVA 1S40A 1WI5A 1SNQA 5EKIA 5C4HA 1VMPA 1GUWA 1YVCA 2EQSA 4L63B 4RHSA 3GV3A 2JA8G 1KL9A 3E0EA 1STYA 1BBUA 2PI2A 2WAQB 1NR2A 4H7BA 4BXXG 2HDMA 1NR4A 2JN4A 4HCEA 2I07B 3NTHA 4A3IG 2UUAL 3UDGA 4J8QA 3HRZC 2UU9Q 1KHIA 2QILA 4DXGA 1TS5A 1EUJA 3HOYB 1YI2A 1CT1D 1TY0A 1PZKD 5KGUA 4DV4L 1KLGD 2WB1B 5LL6X 2WINB 2VQFQ 4HIDA 3PUYA 2V4DA 1XPUA 3BYTB 3IFDA 4X64Q 4CDCC 3GTQH 4JI5Q 5NUCA 3DWPA 2F0EA 1S5BD 2Q8TA 1N33L 1R4PB 4KTAA 1PTOB 1RJTA 4J15A 3NTKA 4A75A 2BA1A 3TSSA 3J81i 2A68D 4OO1G 2P5ZX 2MNAA 2Y0SB 1X54A 2EYFA 3GD7A 1GOZA 1SJED 3DLLA 4R4QA 4DR5L 1N9WA 1YJWA 1TS2A 4C1NK 2RQXA 1SFOB 3PV0A 3HOWH 1N36Q 1HFGA 1GHKA 2NZHA 3QO2A 3P75A 4QUCA 3BDCA 5IY0A 5AFWA 1FNUA 1TWCH 2JA8H 2VZAA 1MJEA 3K7AB 4CDFC 3D8GA 4A3EB 2D5DA 4DV1Q 5KEEA 3EVQA 2RBMA 1D1IA 3DXJC 4F7XA 2M00A 1QNUA 1EY5A 4HMIA 1GUOA 3PGZA 1VQ6A 4B9XA 1PRTF 4DUYL 5GQOA 4OL7A 3ULJA 4X62Q 1Q1EA 2IY5B 1CM9A 2G5DA 4BXXH 4DV0Q 1KRTA 4LF4L 3TS2A 5GAHC 1TWGH 1WCMB 3U58A 1QUQB 3H0GB 1HZAA 2H4OA 3E0JA 4N8X1 3RLFA 5FO8B 5IGCA 5EBCA 4E6IA 1QILA 4DF7A 4LF9L 5JEAJ 2VY3A 1LTGD 3KF8B 1D6EC 2C5CA 4ZK9B 4FXKC 4A93B 1S5ED 4EVOA 1F77A 2F0VA 3L3OC 4OELB 2L0CA 2RF4A 4GKKL 5C3EG 1HZ9A 3R2TA 1ENAA 4IPCA 1PXUA 5LMUQ 1B7YB 4PG3A 1V1PB 1I50B 1ML0D 1FJGQ 3T4AC 2OTJA 4DA2A 3MXNA 4DR3Q 1EOTA 1PH6A 4WRDA 4A3JG 3C1EA 3IKJA 4XYQA 4Y7NB 3MFGA 1EQQA 1PH4A 4FNFA 2I0QA 1LT6D 3QG1A 4EQ5A 3NENA 1PH9A 1XMQQ 1WTPA 3IL8A 2N3SA 3OHXC 4LFBQ 3CW2C 3DM3A 2E2HH 2EOTA 2KQ3A 3CKIB 3T51B 3TP8A 1HH2P 1WOCA 1VQ4A 4J1MA 5M3MH 2K5DA 3PCOB 2MPMA 4M8AA 1U9RA 2X69A 2QKIC 1PFMA 3I72A 1VQLA 4B3TQ 4DR2Q 2R92G 4A3MH 4QQBX 3D4WA 3M4OH 4KHZA 2HHHL 2NTTA 1MSHA 2E2DC 3QOLA 2F0UA 5JPNC 1EFID 2AWNA 2QF7A 1XNQQ 4DV5L 5GADC 1KTKA 3S2DB 1B9MA 5M5XH 1TS4A 3GTGH 3HEJA 3GTMB 3PUVA 3GP7A 5JVG3 1BQQT 1RCVD 3EN2A 5KNDA 3K0YA 4G4KA 2F03A 4JI0L 2UXDL 1X65A 1SXTA 3WOFA 1MD2D 5ELDA 1SYGA 3CC4A 1TWFB 3I4NH 4B3MQ 4H13C 1GD7A 2F52A 4C3HB 4EQOA 3RN2A 4OWTB 2PQAA 2AQ2B 3GTMH 3S1RB 2B2VC 5CGKA 2UUAQ 1YHBA 2N49A 2PZWA 3A5UA 2VNUD 3NTIA 1A0IA 2K5NA 4B3RL 2ICIA 4C3IG 4QL5A 3HOZH 4KD4A 4LUVA 5C6AA 5HURA 3S1NB 5JJKA 4OWXB 4A3DH 3LGJA 4OXPA 1EY6A 1STNA 2IPKD 2NN6I 1IKMA 1MHWC 1YNXA 3M7GA 2ATWA 3KUPA 3VYUA 3TREA 5M3MG 2M2LA 1EY9A 4DUZL 3D3RA 1OO9B 4K8IA 2JA5G 2XVSA 4P2CB 2E2HB 4LUOA 5JEAH 3U50C 1D1KA 1K3BC 4JI6L 2F0DA 2MJ8A 4PZ7A 3I4OA 3SE0A 4BA2I 1Z6HA 2KA7A 4DN4M 4EX5A 4Y7NH 3OTOL 2DUDA 2E2JB 3VR2A 4A3FB 4AIMA 1PH3A 4N8FA 1RKNA 2JEBI 1ZKOA 1IBML 3ICEA 1W6JA 1S5FD 1WTVA 4KV6A 3H09A 2CWAA 3FDTA 2EDGA 4NW2A 3TMEA 3J80E 1U0LA 3P1HA 4APVA 3PIOA 3CXCA 1ICWA 1KDBA 4XDXA 1O7IA 2UXCQ 1VS0A 1PVOA 1XMOQ 2K03A 4BY7H 2HIXA 3HS0C 3BS1A 1A62A 4C56C 3NPPA 1LACA 2ZJQA 4HIMA 3HFZB 3WOEA 4FF4A 3GTKB 4HJ8A 5KNCA 1NSNS 2K50A 4OO1H 2UUCL 4QGUA 4AH6A 5CORA 4XQQA 3S17H 5M3MB 1XTDA 2EXDA 4I7ZC 4L6TB 5K36H 2XN9C 3HKZB 4OO1I 4RGOS 4K0KL 3OWEB 1ONLA 3D4RA 4ZUIA 2IWHA 1E2ZA 1UWVA 2A6HC 4ALPA 4C3IB 1VMCA 1W6KA 1EIGA 2RHSB 4H44C 3NXWA 2F0NA 4C3JB 4IUUA 4LNQA 3NBHA 4NPSA 1HR0L 3CCUA 2EJGC 2BE5D 3HOWG 3E9HA 2KUMA 3NHHA 2RSNA 2O2LD 4YWLA 4X66L 4O42A 3S1QH 1CZWA 2GN5A 3I73A 3R2IA 2JP1A 3N52A 1H95A 5GAGC 3K5MA 1EEID 4A4IA 1UAPA 4FXGC 1WTXA 1SMYD 2WFWA 3GTPH 1LM0A 2K4KA 4ZLTF 3HOWB 1WTWA 3A5ZB 1X3PA 4DK1A 2OWOA 4ZCKA 1TR5A 3BU2A 2NVXH 4DV4Q 4BY7B 1E3PA 1QB5D 2LSSA 3G7LA 5C4XH 3S9WA 2F3IA 4X6AH 2Z1CA 1G8ZD 2BH8A 1T5EA 1CSPA 3A8KE 1HTPA 2EPBA 1D8LA 1E0BA 2MO1A 3PO2H 1LTTD 4A3KH 2B2VA 3E6ZX 4DV7Q 3K7UC 1Q82C 1Q86C 4QUFA 4LFBL 2ZM6Q 1EY4A 3NSWA 1TKWB 2D0PA 2NVTH 1LTSD 2RDFA 3KF6A 1IBKQ 4GN4B 4GKKQ 4IN3A 1HTLD 1SE4A 2UUCQ 4GS3A 4IJHA 3ONAB 4IALA 1ESRA 3WWVA 1ASYA 2HDLA 3IAYA 2B63B 2R3ZA 1D5ZC 3NP8A 3HOUH 2R7ZH 4CDEC 1G2SA 1S3OA 1L2FA 1UE7A 1PH2A 1IYUA 3CCMA 2Z9HA 2IW3A 1IL2A 2DJFC 3MXUA 4DV5Q 1NMGA 1YHAA 2LS01 4CJ1B 2RSOA 1ZYRC 4LF9Q 2A69C 4LAAA 1UE5A 4C2MB 3GTLH 4BBRB 2NTSA 4ZQ3A 4JI3L 5FJ8H 3CF5A 2F0KA 3A55A 5J22A 4JI6Q 2JQOA 4ME5A 1PRTD 2A73B 1RDPD 2PQAB 1C4QA 1CTMA 1ILQA 4DV7L 1IHZA 4JBWA 4XXEA 1HNZQ 5JJZA 1WTHA 1VQ5A 3S2HH 3U9SA 3S14H 2IX0A 2NVYH 3TBIB 4A3KB 1PTOD 1SYCA 3JC66 2RDHA 3GTOB 4ABNA 1L0XB 2F0FA 2SEBD 5T1GA 4DV2L 1X3EA 3BZKA 1XPOA 4DR1Q 2AQ1B 4LF8Q 4JI3Q 1KC8C 2B2YC 3PIO3 1SROA 5C44B 2Z6BA 3GTKH 1HUNA 5CMDA 3A56A 2WV6D 1X32A 2R7DA 3CRLC 1C8CA 3QOJA 5TSSA 5DAUA 5I2YA 3PIPA 1K8AC 2EYMA 2QGQA 4DAYB 1TVXA 2K6AA 4JYAL 3V96A 4GLAC 4L5TA 2EY1A 4KD3A 4ULLA 1JJCB 3LWEA 1J5EL 2AHOB 4JI1L 2UU9L 1O7ZA 2QW7A 1SJHD 3M85A 4DR3L 2Q8IB 4LK1C 5LMNW 3PO3H 2Y0SG 5FJ8G 2Z6KA 4WJWA 3OWFA 4C1NI 1HQMC 2F4VL 1SE3A 4GN5A 1YHQA 3CCQA 1Q90A 4FF1A 3P20A 2WKDA 1SLJA 4A76A 5JJIA 2ZXRA 1WTQA 3UI2A 2VB2X 3R3OA 5G3LF 4A3EH 2AUJD 3T13A 1NBWA 3X3MA 3TEHB 3CD6A 1DOKA 3RNUA 2F0SA 4X3SA 3M7NA 4IFDG 1EEFD 1Z7TA 2K7VA 3G6JB 3L2PA 3RR5A 4OX9Q 4R9WA 1KAAA 1PMRA 5HY6A 2WIIB 5HGQA 5I6YA 3M3YB 2XSCA 2N78A 4MHEA 1KAWA 4RGMA 4A3IB 1I94L 1V1OA 3AYHB 1HUMA 3OYYA 2KCMA 3H3VH 2FJ2A 3TP7A 4N9TA 3KK7A 4FYDA 5CBEE 2JA7H 3MEHA 1JWUD 4A3GG 5DM63 4P75A 1A3TA 3BZDB 1BKBA 1CQVA 1ESFA 3S15H 4S3SA 3GTJH 3QB3A 4MN3A 4GN3B 1WFQA 4KMUC 5C3EB 2F4VQ 3FPUB 1PH1A 2M9VA 2F4IA 1Y1WB 1LTRD 3BVZA 4P73A 4A93G 3A8JE 1LT5D 1UEAB 2LKVA 1YEZA 1WJJA 1E7ZA 3SK8A 1K28A 1CK1A 3NWTA 2PYKA 4X62L 2R93B 1I6HH 3D6CA 3H0GG 5IGEA 1G6PA 3ERSX 2YTVA 3K8AA 1Y8OB 2FHTA 4DK6C 2NZOA 5IYBH 2L15A 1R9TH 3FKIH 3NEMA 1LT4D 2F3WA 2D62A 2K05A 4OHJA 1GUGA 3GTPB 2ZM6L 3KLWA 3JAMi 1SYDA 3A7LA 3CRKC 4RCNA 5EPKA 3VYSA 4A3MG 1DONA 1UEBA 3K80C 3CCVA 1FVIA 1SDFA 3VDYA 4TSSA 5GROA 4DV6L 1KLUD 1LABA 1VQOA 1BF4A 3N6RA 1PDQA 3STBC 1OTCA 1LTID 2O5JC 4LUZA 4A3GH 3W3AA 4NP5A 4QF4A 4QB4A 2RA4A 4Q5VA 5CV9A 5EQ0A 4JI4L 2B3GA 3S24A 1IBLL 3CCLA 3HKSA 1B4OA 1UE1A 3MTSA 1VQ8A 3ERQA 2FMCA 2CCZA 2JK8A 4U68A 4DR7Q 2TSSA 2QEJC 2F0QA 2L55A 4YWKA 4ZYSA 5JVH3 2FMMA 1K0SA 1E2WA 3I4MB 4CJ0B 4OONA 3NUCA 4HIKA 1VQCA 4CGYB 2A68C 2NVQB 1KXLA 4X65L 2F3VA 1LT3D 3MXNB 3CC7A 4ZUJA 5IT9L 2EE1A 3VR4A 2F0PA 5COYA 3URYA 5AJ3L 3U4ZA 2RCFA 3I90A 4LMQD 2BH2A 1EFWA 3MHBA 1JE4A 5BN4A 1F9RA 3Q23A 1C9OA 3CQZB 4JI2Q 1TWHB 3KOJA 5FLXL 2A74C 1EY0A 4DR5Q 1T9HA 5IGBA 1VF5C 2YV5A 1ZEQX 4X3UA 1BBWA 3PO2G 3I91A 4DR6Q 1CUKA 4LJZC 1C0AA 1TWCB 2CW0C 2JA8B 3H15A 2JA7G 3TZUA 1LLRD 4A3LG 1TWAH 1LYLA 4KHVA 3I4NG 2F0JA 3AMUA 2E5LQ 2L1BA 1KDCA 2VS1A 4AYBB 4I7AA 1YNJD 3HP3A 2BOSA 3J81E 1Q81C 1EWCA 3RZOH 4LF6Q 4DR4Q 2IHFA 4KY7A 1RD9D 1G291 2ZXPA 1JJGA 4LFAL 1HNXL 4WJ3M 1E2VA 1DOMA 1PFNA 4F87A 1I6HB 3J7YW 3HOUB 2EJFC 3S1NH 4TKOB 1DYQA 2BDOA 1FYCA 3KLSA 1A15A 2N55A 5JPMC 3BJUA 4J6HA 4R4TA 1PTOF 1K3RA 3JAME 2Z4HA 1YJNA 5CV7A 3D0FA 4CKEA 1B70B 3K5OA 1PRTB 3ZJYC 4BBSH 2KJXA 1L1OC 1PYSB 2J7ZA 4PV1C 5ELBA 1SE8A 1F9PA 4UHVA 4DUYQ 2KCNA 1HXYD 1IBKL 2HT1A 5M3FG 1XTCD 3L7ZC 1IBMQ 3C3LA 2B2WC 4QIWB 2F0WA 3LWUA 1HPCA 1SYEA 1DZ1A 1XWEA 4CHTB 5CV8A 2AMCB 1AZQA 2CH4A 5L37A 1Y1VG 2ZJPA 2RCNA 1EYAA 1KQSA 4AYBG 1UUPA 1MBYA 1Q7YC 3SDZA 4IFDH 4H0LC 4P74A 1IW7D 1W3SA 2Z0SA 1QG7A 1JJ2A 3EJIA 2OT2A 2JA6G 5FKAC 2A6ED 1VQ7A 4XT3B 2K75A 4A3DB 2XWBB 2VUMB 2QEXA 2XGTA 4A3CG 1SR3A 3MXPA 2N88A 5M9OA 1OXTA 4YCUA 1P8LA 5T1IA 4OGQC 1QNKA 5C3EH 5CV4A 1QVGA 3MEFA 5A2QL 2MGSA 3VR5A 2JEAI 4P71A 2ZTEA 5E3FA 3UE0A 4QJFA 2EYLA 3L9AX 4JI5L 4A93H 1JB7A 1H9RA 2I5HA 4LFCL 3W1GA 3PUXA 3RZDH 4IOAA 1HHVA 4HR7B 2YYZA 4LF8L 2VQEL 5C4XB 3RUZA 1K73C 1VQPA 1HR0W 1YNND 3TS0A 1I4XA 3UDXA 4DPGA 1AZPA 3EBEA 2EY5A 1DD2A 3J81j 1TQOA 4FDBA 3HOXG 4AYBE 4FF2A 4DV6Q 2VUMG 4HEDA 4A3DG 3EROA 3PIP3 2Q2IA 4KHPL 1NNXA 1J5EQ 2ZXOA 1RODA 5ELFA 5CR3A 3AEVA 3TQYA 3G71A 4DV3L 2NVYB 3UDFA 4LF4Q 4HAEA 1CHPD 2QDLA 1D2BA 5DLQE 1BCPF 1S5DD 2B2UA 2PCFB 3ND8A 4IUTA 1JB3A 3CCEA 4L5RC 4U673 3RLNA 2HIVA 1CA5A 2VW9A 2I46A 3CHBD 2MFIA 2D2CC 3ITPA 3KF8A 4JYAQ 2MQHA 2HQLA 3I70A 1VQEA 3DEPA 1JQYD 2L12A 4XQJA 5IYCG 3KLSX 4KJNA 1TXYA 2B2TA 1CA6A 1V1QA 5IGFA 2IL8A 3DEOA 1GHJA 3FPPA 5KIXA 3EA6A 3OSOA 4MNOA 4A3CH 2IX3A 4OX9L 1B50A 1HCZA 2PO4A 2ICEC 3Q22A 2E74C 1NTGA 3F2CA 4KKTA 2R7ZG 4YWMA 3K59A 1L1OB 4DUZQ 4CKBA 1O78A 1Y14B 1H9JA 3RD4A 5IGDA 3JAMc 1Y1WH 3J7A5 5C44H 2NVTB 1QWYA 2JSOA 2KBNA 4N9PA 3V2TA 5C3WA 2RVLA 3AU7A 1WTOA 5M5WH 1STAA 5IYDG 4IPGA 1KNAA 2JA7B 1JWSD 3PO2B 4A3GB 1F2MA 2MHVA 3CMEA 1BCPD 3KYHC 2O5IC 4XQNA 4GOPC 5IP7G 1AE3A 2FINB 1KD1C 1EYDA 1A63A 3F2BA 2JA9A 2EY2A 4WFN3 2Q8RE 2KEEA 1N36L 4A3BB 2A5HA 4FO2A 3T1HQ 1TWHH 2J4XA 1LV9A 4JI0Q 3WDNA 4RG1A 3CPFA 1JC7A 5C3XA 3QWNA 2H1EA 3J7AV 4IOCA 4JG2A 4X64L 3A8IE 1K83H 1H9KA 5IT9c 1ENCA 2IX1A 4Y52H 3MVVA 3GQBA 1ZXTA 5KNBA 2Q2TA 1LTBD 5K36G 1TT2A 1WD1A 1WTRA 4DR2L 3L0OA 1CKMA 3K0XA 1GO3E 1SMXA 2ES2A 4BBSB 4JI4Q 4UP9A 1KRSA 1D7QA 1SNPA 4KKUA 4AQYL 3C2PA 4WORA 3H91A 4NXNQ 3T53B 3D31A 1BCPB 2B8FA 1RTOA 3Q24A 4HSVA 3RLOA 4DR1L 2PW5A 1HFNA 5CYUA 3J7ZC 1FNVA 4IO9A 2XIWA 1RF2D 1VQ9A 4JI1Q 3H3VI 5E4WC 2NB0A 5M3FH 4B3ML 4G7OC 1NY4A 5LL6S 1NAPA 2K5HA 3FP9A 1GXDC 5LMUL 4A3MB 1X9NA 5EAYA 4CKCA 4A3LH 1EU3A 3OW2A 3I7FA 2YU9H 4HTHA 1YIJA 4DNTB 3GO5A 4G57A 5IYCH 1OXSC 1JE5A 4A3KG 2JXMB 1WD0A 1EIHA 3V05A 2F0LA 4YY3Q 3H3VC 1EQVA 1SN8A 4OEMB 4DXFA 5BN3A 4ZRZA 5G3LD 4AQYQ 1GM5A 2E5LL 4C3JH 5KYIA 5KYLA 3SVMA 4MZ9A 3IRBA 3NQIA 3PO3B 4BBRG 4K2LA 2D0OA 4KY5A 1Y1WG 3KDFB 2E2IB 1PTOC 4KI0A 5C0XI 1IZ6A 4QIWE 2WKCA 4O2DA 2PNHA 1QUQA 5DNFA 2EXZA 2CQOA 4JBMA 1J8IA 1K9MC 4CDDC 3OPOA 3PMFA 1A2UA 1PH7A 1A3VA 5C4JB 4B3SL 2B63G 4DR4L 1KNEA 3HOXH 3HOZG 4R4IA 5CBAE 1HRJA 1A6XA 2LXJA 1MSGA
chains in the Genus database with same CATH topology
1Z47A 5DEHA 1MGSA 4ZKBB 2DN8A 1I4QA 1Q1BA 1HA5A 4RGNA 3GTQB 1DOLA 2L9HA 2PMZB 4MIUA 5JEAG 2F0OA 2MP1A 2OEOA 4PMCA 2IJ0A 3CU7A 2HUGA 1HQRD 2F1MA 1O80A 4DFAA 3DHQA 1B1ZA 2B8GA 1SNMA 2AWOA 5LHY1 3F2UA 3FKIB 5EPLA 4DAPA 2DY7A 1EQTA 2CQAA 1F9QA 1B2TA 1G2TA 2VXWA 2BDNA 4BS9A 1EL0A 4RH6A 4ID6A 3VR3A 1T5XD 1H9MA 5FO7B 4RWSC 2K04A 4K6LA 4ZKCB 4C3JG 2QDBA 3SR1A 4KK7A 1JORA 4R8IA 2X6LA 1SSOA 4G7ZC 2NN6H 5JOBA 3A54A 2F0IA 4BY1B 4K2KA 3AB9A 1BDOA 1CI3M 3S15B 1GUSA 1CHQD 1JWMD 1SBBB 1A2TA 1BBXC 3M4YA 3J7AF 1FD7D 1R4QB 4XTCS 3RZOB 3IFTA 1STEA 1F2YA 1KABA 1XX8A 3NE5B 3BDOA 2KECA 2OXPA 4EQNA 1Y8NB 1OXVA 5C4ZA 1RTNA 2XNAC 1BR9A 3SK5A 1SNCA 5EKKA 2SDFA 1LO5D 1U4PA 3HG9A 1SNOA 2O4XA 1EYCA 5ISRA 2NWGA 2A6HD 1SE2A 4KJOA 2B2WA 3DWQA 4X3TA 5D65A 5FO9B 2JA5B 2CVRA 2BE5C 3ZYYX 2PW7A 2C9OA 3H94A 5I2XA 4B08A 4QCLA 3MC0B 3DUZA 4FXDA 1D5XC 1I4HA 3BVMA 1AEXA 3OOCA 3HGBA 3BYYB 3P7JA 3T56B 4DNRB 4RKBA 2EVBA 4RHRA 3HOVB 3LNNA 2G9HD 3E5SA 1O7YA 1BXTA 2K33A 1DXMA 1QJOA 3K6OA 4C3HG 1OXUA 1TWAB 5EBDA 4L8JA 4G7HC 1JOKA 4UAIA 3GTGB 2F0GA 2BA0A 4PMBA 1X3QA 2NYZD 1QOHA 5I9PA 5C5MA 1PZJD 1B3AA 1ET6A 3S2HB 4RFBA 3SK4A 4K8JA 1K83B 4IZ8A 2LMCB 2NBFA 2CW0D 2JYOA 4NKLA 1SMYC 2PNRC 3PUWA 3SHLA 2LFNA 3Q6SA 2A69D 1YNJC 2SOBA 4O1NA 2RDGA 5C0XG 1FNWA 3HOZB 5C5LA 2G9DA 1BNZA 1XXGA 2KHSA 3R8BA 2FFKB 1BO0A 1PTOH 2WACA 2K1BA 4DAVA 3ND9A 4IQZA 5C0XJ 3RZDB 4KN7C 1V43A 2EY6A 3D4DA 5M5XB 2ENBA 5J39A 4DGZA 4F88A 5A35A 3SK6A 1O7LA 1JICA 1AP0A 1CFMA 1BOSA 2Z8LA 4X3KA 5CC4A 3K58A 2NVXB 3SEBA 2E76C 3J80L 2PZUA 1IW7C 4ODGA 4TRDA 5K5PA 3MAQA 1II3A 1LTAD 2RKSA 4I65A 1IL8A 3KLRA 1VF7A 2PZTA 4TQUS 4HSPA 1SYFA 5HGTA 5DM73 4K14A 1AW7A 2X6GA 3D6WA 4BWGB 2TMPA 5F2DA 3MFYA 3NWSA 5IT9E 1ENFA 1F2ZA 5FK9C 1AFPA 2F0MA 1SYBA 5JAVA 4Z9CB 2OF1A 3SXHA 2L5TA 5E4XA 1GUTA 1PLFA 1TU2B 2DY8A 1GJXA 3TP5A 1I3QB 2KVMA 1DJRD 1HA6A 2BCOA 2GA4B 3FEWX 5ELEA 4CJ2C 4YIJA 1B44D 1FR3A 4IFDJ 2AUKA 5IODA 3NBIA 1EY7A 3TZDA 2R92B 4IURA 4IUQA 1M8AA 2MUYA 3VR6A 3I3CA 4Q0FA 1S5CD 2KEDA 1BUVT 1DM0B 5IIFA 1EY8A 5IGGA 1F2LA 1Q8IA 2B2UC 2K5QA 5C0XH 4CBVA 4A3JB 4KY6A 2DNEA 3TDQA 3OW7A 4PMWA 1STHA 3I4LA 3NQTA 3S17B 2SNMA 3MZ5A 5FOBB 2J0TD 4M1UB 2F0TA 3JAML 1SEBD 2DNCA 1TIID 4RAUC 1IKLA 1Q3LA 2XRQD 2R7ZB 1CZGA 1K8MA 3QIAA 1F9SA 1Y8PB 3OMCA 1A3UA 3MXGA 1EZ8A 4JK1C 2B2YA 3TP6A 3QJYA 1ILPA 3EFXD 3VYTA 1PZID 1M4VA 1J9OA 2K32A 3T16A 5BN5A 2K28A 4V0BA 1JCKB 5CV5A 1K8OA 2K01A 3VA5A 3H6MA 1JR0D 5A2QE 1VDZA 3C1FA 1KDAA 2NUCA 3BVGA 3FMCA 2EZVA 3K57A 2R61A 2XWJB 3R93A 3KBGA 4XYOA 4FF3A 1FGBD 3C46A 4RA8A 4KKSA 3MA2B 2KCCA 4RKLA 2HCIA 2EYHA 1U4RA 1B53A 5D3DA 1STGA 4V190 4OIJA 4FP5D 1TY2A 3PUZA 5E1FA 1I4GA 4KN4C 4DK0A 5I6WA 3HZXA 1I4RA 1XYIA 5J1ZA 2SNSA 1NUCA 1EZ6A 3S1MB 1U4MA 5I9OA 3BDLA 2L11A 4K5WA 1EU4A 2B39A 2XRSD 4K5VA 3Q0AA 3FVQA 3W2DA 3X3NA 2K5WA 1PFBA 5D14A 3TN2A 2HQEA 3S14B 3A7AB 2AQ3B 2NN6G 5IOCA 1S4ZA 3O13A 2E75C 1ET9A 1GUNA 2ZT9C 1D5MC 4PQXA 4OIKA 2KOLA 1R9TB 3VA7A 3DWAA 1ZYRD 3KBXA 4UDUC 3DM1A 3MWYW 3NK9A 4HN7A 1OXXK 1V8QA 2PPBC 4XT1B 1JOOA 1PRTC 4HCSA 2CHBD 1U4LA 4B9WA 2EYOA 1NCVA 1I4PA 2JE6I 1H9SB 4K6DA 1C48A 2R6GA 2PQEA 5M5WB 3EQLC 3I4NB 2LY7A 1WVLA 3RMHA 1RHPA 3GTJB 3FRPB 3HOXB 1UNSA 1TS3A 2D9UA 5ELCA 4GZYC 4ILWA 1YNNC 5KRUA 2NZ1D 4IUPA 1STBA 3BG3A 4NMZA 3DMUA 1SNDA 5EKLA 4ZAIA 1IYVA 1AN8A 3OIQA 3K5NA 2B2TC 2A6EC 5M5YB 4RCOA 2QCPX 3K5LA 3OMGA 2ID0A 4EGVA 1G6ZA 2EYJA 3I8ZA 5I4DA 1L0YB 1MI2A 4QMGA 3U9OA 1B9NA 2JA6B 4IUNA 1DCZA 4EQPA 1G91A 1Y69U 2YU9B 1H9SA 2L4NA 1Y1VB 4XIGS 1I6VC 4RGTA 1V1PA 5FLXE 1CQFA 4DU9A 5CV6A 4K5XA 4R8NA 5M3FB 5D3IB 5EGTA 3M4OB 1SAPA 4BA1I 4HMJA 2EYPA 1TWGB 1JOQA 3S1QB 2Z4IA 3LX0A 5EJWA 1QE6A 3OIPA 1QCBD 1EWHA 3J81L 4DAYA 3VYRA 1Q12A 2WP8J 4PNYA 1PYWD 2HCCA 3S16B 2F0HA 1BCPC 4IFDI 4F8MA 5EPJA 3GV6A 1VCIA 4NDXA 3GTLB 4FVMA 2EJMA 2VB3X 2IT1A 4IUVA 1SNQA 5EKIA 5C4HA 1VMPA 1GUWA 4L63B 4RHSA 3GV3A 1STYA 2WAQB 1NR2A 4H7BA 2HDMA 1NR4A 4HCEA 2I07B 3NTHA 4J8QA 3HRZC 2QILA 4DXGA 1TS5A 3HOYB 1CT1D 1TY0A 1PZKD 5KGUA 1KLGD 2WB1B 5LL6X 2WINB 3PUYA 2V4DA 3BYTB 3IFDA 5NUCA 3DWPA 2F0EA 1S5BD 2Q8TA 1R4PB 4KTAA 1RJTA 1PTOB 3NTKA 2BA1A 3TSSA 2A68D 4OO1G 2Y0SB 2EYFA 3GD7A 1GOZA 1SJED 1TS2A 4C1NK 2RQXA 1SFOB 3PV0A 1HFGA 1GHKA 3QO2A 3P75A 4QUCA 3BDCA 5AFWA 1FNUA 3K7AB 3D8GA 4A3EB 2D5DA 5KEEA 3EVQA 2RBMA 1D1IA 3DXJC 4F7XA 2M00A 1QNUA 1EY5A 4HMIA 1GUOA 4B9XA 1PRTF 4OL7A 1Q1EA 1CM9A 1WCMB 3H0GB 2H4OA 3E0JA 3RLFA 5FO8B 5IGCA 5EBCA 4E6IA 1QILA 4DF7A 5JEAJ 1LTGD 1D6EC 2C5CA 4ZK9B 4FXKC 4A93B 1S5ED 4EVOA 1F77A 2F0VA 3L3OC 2L0CA 3R2TA 1ENAA 1PXUA 1V1PB 1I50B 1ML0D 3T4AC 4DA2A 3MXNA 1EOTA 4WRDA 3C1EA 3IKJA 4XYQA 4Y7NB 3MFGA 4FNFA 1LT6D 3QG1A 1WTPA 3IL8A 3OHXC 2EOTA 2KQ3A 3CKIB 3T51B 3TP8A 4J1MA 2K5DA 4M8AA 2MPMA 1U9RA 2X69A 2QKIC 1PFMA 3I72A 3D4WA 4KHZA 2NTTA 1MSHA 2E2DC 3QOLA 2F0UA 5JPNC 1EFID 2AWNA 2QF7A 1KTKA 3S2DB 1B9MA 1TS4A 3HEJA 3GTMB 3PUVA 3GP7A 5JVG3 1BQQT 1RCVD 5KNDA 3K0YA 4G4KA 2F03A 3WOFA 1SXTA 1MD2D 5ELDA 1SYGA 1TWFB 4H13C 4C3HB 4EQOA 2AQ2B 3S1RB 2B2VC 5CGKA 2PZWA 2VNUD 3NTIA 2ICIA 4C3IG 4KD4A 5C6AA 5HURA 3S1NB 1EY6A 1STNA 2IPKD 2NN6I 1IKMA 3M7GA 3KUPA 3VYUA 2M2LA 1EY9A 3D3RA 1OO9B 4K8IA 2XVSA 4P2CB 2E2HB 5JEAH 1D1KA 2F0DA 2MJ8A 3SE0A 4BA2I 1Z6HA 2KA7A 4DN4M 2E2JB 3VR2A 4A3FB 1RKNA 2JEBI 1ZKOA 1W6JA 1S5FD 1WTVA 4KV6A 3H09A 3FDTA 2EDGA 4NW2A 3TMEA 3J80E 3P1HA 1ICWA 1KDBA 4XDXA 2K03A 3HS0C 3BS1A 4C56C 3NPPA 1LACA 3WOEA 4FF4A 3GTKB 5KNCA 1NSNS 4OO1H 5CORA 4XQQA 5M3MB 4I7ZC 4L6TB 5K36H 2XN9C 3HKZB 4OO1I 4RGOS 3OWEB 1ONLA 3D4RA 4ZUIA 2IWHA 1E2ZA 2A6HC 4C3IB 1VMCA 1W6KA 1EIGA 4H44C 3NXWA 2F0NA 4C3JB 4IUUA 3NBHA 2EJGC 2BE5D 2KUMA 3NHHA 2RSNA 2O2LD 4O42A 1CZWA 3I73A 3R2IA 2JP1A 3N52A 3K5MA 1EEID 1UAPA 4FXGC 1WTXA 1SMYD 4ZLTF 3HOWB 1WTWA 1X3PA 4DK1A 1TR5A 4BY7B 1QB5D 3G7LA 3S9WA 2Z1CA 1G8ZD 1T5EA 3A8KE 1HTPA 2EPBA 1E0BA 1LTTD 2B2VA 3E6ZX 4QUFA 1EY4A 3NSWA 1TKWB 1LTSD 2RDFA 4IN3A 1HTLD 1SE4A 3ONAB 4IALA 1ESRA 2HDLA 3IAYA 2B63B 2R3ZA 1D5ZC 3NP8A 1G2SA 1IYUA 2IW3A 3MXUA 2LS01 4CJ1B 2RSOA 1ZYRC 2A69C 4LAAA 4C2MB 4BBRB 2NTSA 4ZQ3A 2F0KA 3A55A 5J22A 4ME5A 1PRTD 2A73B 1RDPD 1C4QA 1CTMA 1ILQA 1IHZA 4JBWA 4XXEA 5JJZA 3U9SA 2IX0A 3TBIB 4A3KB 1PTOD 1SYCA 2RDHA 3GTOB 4ABNA 1L0XB 2F0FA 2SEBD 5T1GA 2AQ1B 2B2YC 3PIO3 5C44B 1HUNA 5CMDA 3A56A 2WV6D 1X32A 3CRLC 1C8CA 3QOJA 5TSSA 5DAUA 5I2YA 2EYMA 1TVXA 2K6AA 3V96A 2EY1A 4KD3A 4ULLA 3LWEA 1O7ZA 1SJHD 3M85A 2Q8IB 4LK1C 4WJWA 3OWFA 4C1NI 1HQMC 1SE3A 1Q90A 4FF1A 3P20A 2WKDA 2ZXRA 1WTQA 3UI2A 2VB2X 3R3OA 5G3LF 2AUJD 3T13A 3X3MA 1DOKA 2F0SA 4X3SA 3M7NA 4IFDG 1EEFD 1Z7TA 2K7VA 3G6JB 4R9WA 1KAAA 1PMRA 2WIIB 5I6YA 3M3YB 2XSCA 4MHEA 4RGMA 4A3IB 1V1OA 1HUMA 2FJ2A 3TP7A 4N9TA 3KK7A 4FYDA 5CBEE 3MEHA 1JWUD 5DM63 1A3TA 3BZDB 1CQVA 1ESFA 4S3SA 3QB3A 4MN3A 4KMUC 5C3EB 3FPUB 2M9VA 2F4IA 1Y1WB 1LTRD 3BVZA 3A8JE 1LT5D 1UEAB 2LKVA 3SK8A 1CK1A 3NWTA 2PYKA 2R93B 3D6CA 5IGEA 1Y8OB 2FHTA 1LT4D 2F3WA 2D62A 2K05A 4OHJA 1GUGA 3GTPB 1SYDA 3A7LA 3CRKC 4RCNA 5EPKA 3VYSA 1DONA 1SDFA 4TSSA 1KLUD 1LABA 1BF4A 3N6RA 1PDQA 1LTID 2O5JC 3W3AA 4NP5A 4QF4A 4QB4A 2RA4A 4Q5VA 5CV9A 5EQ0A 1B4OA 3MTSA 3ERQA 2FMCA 4U68A 2TSSA 2QEJC 2F0QA 2L55A 4ZYSA 5JVH3 2FMMA 1E2WA 3I4MB 4CJ0B 3NUCA 4CGYB 2A68C 2NVQB 2F3VA 1LT3D 4ZUJA 5IT9L 2EE1A 3VR4A 2F0PA 5COYA 3URYA 3I90A 4LMQD 3MHBA 1JE4A 5BN4A 1F9RA 3Q23A 3CQZB 1TWHB 5FLXL 2A74C 1EY0A 5IGBA 1VF5C 1ZEQX 4X3UA 3I91A 4LJZC 1TWCB 2CW0C 2JA8B 3TZUA 1LLRD 4KHVA 2F0JA 3AMUA 2L1BA 1KDCA 4AYBB 1YNJD 3HP3A 2BOSA 3J81E 1EWCA 4KY7A 1RD9D 1G291 2ZXPA 1E2VA 1DOMA 1PFNA 4F87A 1I6HB 3J7YW 3HOUB 2EJFC 4TKOB 1DYQA 2BDOA 1FYCA 3KLSA 1A15A 2N55A 5JPMC 4J6HA 1PTOF 3JAME 2Z4HA 5CV7A 4CKEA 3K5OA 1PRTB 2KJXA 2J7ZA 4PV1C 5ELBA 1F9PA 2KCNA 1HXYD 1XTCD 3L7ZC 3C3LA 2B2WC 4QIWB 2F0WA 3LWUA 1HPCA 1SYEA 1DZ1A 1XWEA 4CHTB 5CV8A 1AZQA 1EYAA 1UUPA 1MBYA 3SDZA 4IFDH 4H0LC 1IW7D 1QG7A 3EJIA 2OT2A 5FKAC 2A6ED 4XT3B 4A3DB 2XWBB 2VUMB 3MXPA 2N88A 5M9OA 1OXTA 5T1IA 4OGQC 1QNKA 5CV4A 5A2QL 2MGSA 3VR5A 2JEAI 5E3FA 2EYLA 3L9AX 1H9RA 3PUXA 1HHVA 4HR7B 2YYZA 5C4XB 3RUZA 1YNND 1I4XA 1AZPA 2EY5A 1DD2A 1TQOA 4FF2A 4HEDA 3EROA 3PIP3 2ZXOA 1RODA 5ELFA 5CR3A 2NVYB 4HAEA 1CHPD 1D2BA 1BCPF 1S5DD 2B2UA 2PCFB 3ND8A 4IUTA 1JB3A 4U673 1CA5A 2I46A 3CHBD 2D2CC 3ITPA 3KF8A 3I70A 3DEPA 1JQYD 2L12A 4XQJA 3KLSX 4KJNA 1CA6A 2B2TA 5IGFA 2IL8A 3DEOA 1GHJA 3FPPA 5KIXA 3EA6A 3OSOA 2IX3A 1B50A 1HCZA 2PO4A 2ICEC 3Q22A 2E74C 4KKTA 3K59A 4CKBA 1O78A 3RD4A 1H9JA 5IGDA 2NVTB 1QWYA 2JSOA 4N9PA 3V2TA 5C3WA 2RVLA 3AU7A 1WTOA 1STAA 1KNAA 2JA7B 1JWSD 3PO2B 4A3GB 1F2MA 2MHVA 2O5IC 1BCPD 4XQNA 2FINB 1EYDA 2EY2A 4WFN3 2Q8RE 2KEEA 4A3BB 2A5HA 4FO2A 2J4XA 1LV9A 3WDNA 1JC7A 5C3XA 3QWNA 2H1EA 3J7AV 2IX1A 3A8IE 1H9KA 1ENCA 3MVVA 3GQBA 1ZXTA 5KNBA 1LTBD 5K36G 1TT2A 1WD1A 1WTRA 4BBSB 1SNPA 4KKUA 3C2PA 4WORA 3H91A 3T53B 3D31A 1BCPB 2B8FA 1RTOA 3Q24A 4HSVA 2PW5A 1HFNA 5CYUA 1FNVA 2XIWA 1RF2D 5E4WC 2NB0A 4G7OC 5LL6S 1NAPA 1GXDC 4A3MB 4CKCA 1EU3A 4HTHA 4DNTB 3GO5A 4G57A 1OXSC 2JXMB 1WD0A 1EIHA 3V05A 2F0LA 3H3VC 1EQVA 4DXFA 5BN3A 4ZRZA 5G3LD 5KYIA 5KYLA 3SVMA 3NQIA 3PO3B 4K2LA 4KY5A 2E2IB 1PTOC 4KI0A 5C0XI 2WKCA 5DNFA 2EXZA 1J8IA 3OPOA 3PMFA 1A2UA 1A3VA 5C4JB 1KNEA 5CBAE 1HRJA 1A6XA 1MSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV5 A;  3OWF A;  3TP5 A;  5DEH A;  1TT2 A;  3VA5 A;  4KV6 A;  2RDF A;  3H6M A;  2KQ3 A;  3SK5 A;  4NP5 A;  1SNC A;  5CV7 A;  4YIJ A;  5EKK A;  2SOB A;  4QF4 A;  4QB4 A;  5CV6 A;  3TME A;  3TP8 A;  3NK9 A;  4K5X A;  4R8N A;  5CV9 A;  4J1M A;  3P1H A;  5IOD A;  4IAL A;  5C5L A;  3C1F A;  1KDB A;  1EY7 A;  1KDA A;  3R3O A;  1JOO A;  1U9R A;  2EYF A;  2NUC A;  5EGT A;  3NP8 A;  3ERQ A;  3T13 A;  2KHS A;  5ISR A;  1SNP A;  1SNO A;  1EYC A;  2O4X A;  4MIU A;  3ITP A;  3D4W A;  2F0O A;  2WAC A;  2EYP A;  4HMJ A;  4WOR A;  2F0S A;  4B9W A;  4KJO A;  2EYO A;  2OEO A;  4PMC A;  1JOQ A;  3QOL A;  2F0W A;  2F0U A;  2F0Q A;  3P75 A;  2PW5 A;  3LX0 A;  1SYE A;  3BDC A;  1KAA A;  2EY6 A;  5IIF A;  4KJN A;  5CV8 A;  4DFA A;  5I6Y A;  3D8G A;  1NSN S;  5IGF A;  1EY8 A;  4K6D A;  5IGG A;  3NUC A;  5KIX A;  1EYA A;  3EVQ A;  2RBM A;  2PW7 A;  3DHQ A;  3OSO A;  3HEJ A;  4LAA A;  3D4D A;  4PNY A;  5K5P A;  4F7X A;  2PQE A;  4ZQ3 A;  2M00 A;  4J6H A;  5IGB A;  1SNM A;  2ENB A;  2F0K A;  2F3V A;  4KY6 A;  4RKL A;  3TP7 A;  1EY5 A;  4HMI A;  4N9T A;  2F0H A;  3EJI A;  4ZUJ A;  4DGZ A;  4ME5 A;  5J39 A;  2F0P A;  1AEX A;  4B9X A;  2EYH A;  3MEH A;  1SYG A;  4ZUI A;  4DU9 A;  1A3T A;  1IHZ A;  1STG A;  1STH A;  3NQT A;  3SK6 A;  4F8M A;  4EQO A;  3MHB A;  4RKB A;  3MXP A;  4HTH A;  4ID6 A;  4NDX A;  4S3S A;  3QB3 A;  5M9O A;  2SNM A;  5IGD A;  5E1F A;  4G57 A;  3MZ5 A;  5CGK A;  4OL7 A;  5KRU A;  3NXW A;  2F0T A;  2F0N A;  4N9P A;  5CC4 A;  1SYC A;  2PZW A;  3E5S A;  3V2T A;  2QDB A;  5CV4 A;  3SR1 A;  5I6W A;  1SNQ A;  3HZX A;  5C3W A;  1EY0 A;  1JOR A;  1STB A;  2F0F A;  2LKV A;  5C4H A;  5J1Z A;  2SNS A;  1NUC A;  1STA A;  4NMZ A;  5JOB A;  1EZ6 A;  3NHH A;  3DMU A;  2PZU A;  4KD4 A;  3SK8 A;  1SND A;  5EKL A;  5C6A A;  5HUR A;  5I9O A;  2F0L A;  2F0I A;  3BDL A;  1EQV A;  4K5W A;  5E3F A;  5IGC A;  1STY A;  2PYK A;  4K2K A;  4K5V A;  4ODG A;  1F2M A;  4TRD A;  1EY6 A;  2EYL A;  1II3 A;  4DF7 A;  4E6I A;  1STN A;  3D6C A;  5IGE A;  2RKS A;  4I65 A;  4H7B A;  5J22 A;  5KYI A;  4KHV A;  5KYL A;  1JOK A;  2F0J A;  1EYD A;  2F0G A;  1A2T A;  4K2L A;  2EY2 A;  3QOJ A;  4KY5 A;  5DAU A;  1TR5 A;  1KDC A;  1EY9 A;  3OMG A;  2PZT A;  3OMC A;  3RUZ A;  4EVO A;  1A3U A;  4K8I A;  2F0V A;  5KEE A;  4PMB A;  1EZ8 A;  1SYF A;  2HQE A;  5HGT A;  2EYJ A;  3TP6 A;  1ENA A;  2EYM A;  4K14 A;  3S9W A;  2EY5 A;  5I9P A;  5C5M A;  5KGU A;  1TQO A;  2F3W A;  2EY1 A;  4KD3 A;  4KY7 A;  2F0D A;  4QMG A;  5F2D A;  3SK4 A;  5IOC A;  3U9O A;  2EXZ A;  4K8J A;  1SYD A;  3ERO A;  5C3X A;  1F2Z A;  4IZ8 A;  1F2Y A;  1KAB A;  4IUN A;  2F0M A;  4EQP A;  4WRD A;  1SYB A;  5JAV A;  3PMF A;  1A2U A;  3C1E A;  1A3V A;  5NUC A;  1ENC A;  4NKL A;  3T16 A;  2F0E A;  2OF1 A;  3SXH A;  3MVV A;  2OXP A;  4EQN A;  5CR3 A;  4KTA A;  3SHL A;  1RKN A;  1EY4 A;  5C4Z A; 
#chains in the Genus database with same CATH topology
 1Z47 A;  4GOP B;  5DEH A;  1MGS A;  4ZKB B;  2DN8 A;  1I4Q A;  1Q1B A;  4WJ4 A;  1HA5 A;  3OTO Q;  2ZJR A;  1X56 A;  4RGN A;  3CC2 A;  3GTQ B;  1DOL A;  2L9H A;  2PMZ B;  4MIU A;  5JEA G;  2F0O A;  4LF5 L;  5IP9 H;  1VQA A;  2MP1 A;  2OEO A;  4PMC A;  1PV4 A;  2IJ0 A;  5JJL A;  1Q46 A;  3CU7 A;  2HUG A;  1HQR D;  1PFS A;  4JOI A;  2F1M A;  1O80 A;  1MJC A;  4DFA A;  3CCR A;  4JI7 Q;  4BY7 G;  2DJG C;  3DHQ A;  1B1Z A;  1HNW L;  1X3F A;  2B8G A;  3G6E A;  1SNM A;  2VQF L;  2AWO A;  5LHY 1;  3F2U A;  5FLX c;  3FKI B;  4DR7 L;  5EPL A;  3AFQ A;  4DAP A;  2DY7 A;  1EQT A;  2CQA A;  1F9Q A;  1B2T A;  3HKZ E;  1G2T A;  2VXW A;  2BDN A;  4BS9 A;  1EL0 A;  4JBJ A;  4RH6 A;  4ID6 A;  3VR3 A;  1T5X D;  1H9M A;  5FO7 B;  4RWS C;  2K04 A;  4K6L A;  4ZKC B;  4C3J G;  2QDB A;  3SR1 A;  4KK7 A;  1JOR A;  4R8I A;  4K0K Q;  2X6L A;  1SSO A;  4G7Z C;  3A74 A;  1QVC A;  2NN6 H;  5JOB A;  1I5F A;  3A54 A;  2F0I A;  5C44 G;  4BY1 B;  4JV5 Q;  4K2K A;  3AB9 A;  1BDO A;  1CI3 M;  1XMO L;  1GUS A;  3S15 B;  1CHQ D;  4IJL A;  1JWM D;  2QA4 A;  1SBB B;  1A2T A;  5E7N A;  3TRZ A;  4C3H H;  1BBX C;  3M4Y A;  3J7A F;  1FD7 D;  3KJO A;  1R4Q B;  1B8A A;  2Q2H A;  5IP9 G;  4LFC Q;  4DV3 Q;  4O0A A;  4XTC S;  3RZO B;  3IFT A;  3ULP A;  1PH8 A;  2C35 B;  1STE A;  2KEN A;  1F2Y A;  1KAB A;  1XX8 A;  3NE5 B;  3BDO A;  2GVA A;  2KEC A;  4KHP Q;  2H5X A;  2OXP A;  4EQN A;  1XNR L;  1Y8N B;  4LFA Q;  1HZB A;  5C4J H;  1OXV A;  5C4Z A;  1RTN A;  2N8N A;  3M3Y H;  5IYB G;  2XNA C;  1I94 Q;  1BR9 A;  3SK5 A;  1SNC A;  5EKK A;  2SDF A;  1N34 Q;  4L5Q A;  4HJA A;  1LO5 D;  4A3F G;  1U4P A;  3HG9 A;  1SNO A;  2O4X A;  1EYC A;  5ISR A;  4JOI C;  2NWG A;  4NXN L;  3CCJ A;  2A6H D;  1SE2 A;  4KJO A;  1K0R A;  2B2W A;  3DWQ A;  3KF6 B;  4X3T A;  5D65 A;  1EIY B;  1JMC A;  5FO9 B;  2JA5 B;  4JCV E;  2OQ0 A;  2CVR A;  2BE5 C;  1SRU A;  2PW7 A;  2C9O A;  3ZYY X;  3PF4 A;  3H94 A;  5I2X A;  4B08 A;  4QCL A;  3MC0 B;  2R7F A;  3DUZ A;  1NE3 A;  4FXD A;  1D5X C;  1I4H A;  3BVM A;  1AEX A;  3OOC A;  4LF7 L;  3HGB A;  3EIV A;  3BYY B;  3P7J A;  3T56 B;  4DNR B;  4RKB A;  2EVB A;  4RHR A;  3HOV B;  2KHI A;  3LNN A;  2G9H D;  3I4M H;  3E5S A;  1O7Y A;  1BXT A;  2K33 A;  1DXM A;  1QJO A;  2UUB Q;  4X66 Q;  3K6O A;  4C3H G;  1OXU A;  1TWA B;  5EBD A;  1G51 A;  3FKI G;  4L8J A;  4G7H C;  1FL0 A;  1JOK A;  5IWA L;  4UAI A;  1L0W A;  4YCW A;  3GTG B;  2F0G A;  1EYG A;  3UE1 A;  3CP0 A;  1YJ9 A;  2JJQ A;  2BA0 A;  4PMB A;  3K7A H;  1X3Q A;  1VQD A;  2KCT A;  2NYZ D;  1QOH A;  3I55 A;  3HOV G;  5I9P A;  5C5M A;  1HR0 Q;  1JT8 A;  4UP8 A;  2HD3 A;  4C2M H;  1PZJ D;  1B3A A;  1ET6 A;  3PSI A;  3S2H B;  4RFB A;  3SK4 A;  4K8J A;  2K14 A;  1K83 B;  4IZ8 A;  4B3S Q;  2LMC B;  4LWC A;  3KFU A;  2NBF A;  3HKZ G;  2CW0 D;  2JYO A;  4NKL A;  1SMY C;  2PNR C;  3PUW A;  4GNX C;  2OTL A;  3SHL A;  2LXK A;  2Y0S E;  2FXQ A;  4R1J A;  2LFN A;  3Q6S A;  2A69 D;  1YNJ C;  2SOB A;  1XPR A;  4O1N A;  2RDG A;  5C0X G;  1FNW A;  5C5L A;  3HOZ B;  4UP7 A;  2G9D A;  1BNZ A;  2EIF A;  1XXG A;  2KHS A;  2PMZ E;  3R8B A;  4A3B H;  5BR8 Q;  2FFK B;  1BO0 A;  1PTO H;  2WAC A;  4JV5 L;  2K1B A;  4DAV A;  3ND9 A;  4IQZ A;  3PF5 A;  5C0X J;  3RZD B;  2B29 A;  4KN7 C;  1V43 A;  3J80 i;  2EY6 A;  4L5S A;  1GVP A;  3HOY H;  2ZTD A;  1P16 A;  1X6O A;  1XJV A;  3D4D A;  3PO3 G;  5IE8 A;  5M5X B;  2ENB A;  5J39 A;  4DGZ A;  4F88 A;  3H0G H;  1PYB A;  5A35 A;  5IP7 H;  3HOV H;  3SK6 A;  1O7L A;  1JIC A;  1AP0 A;  1E1O A;  1WCM G;  4BBR H;  1CFM A;  1BOS A;  2Z8L A;  4X3K A;  5CC4 A;  1I3Q H;  3K58 A;  1HNX Q;  3PQI A;  2NVX B;  2A19 A;  3GDE A;  3SEB A;  1ASZ A;  2E76 C;  3J80 L;  4DK3 C;  1W2B A;  2PZU A;  1V9P A;  1IW7 C;  1N33 Q;  4BY1 G;  4ODG A;  4TRD A;  5K5P A;  3MAQ A;  1II3 A;  1EOV A;  1N34 L;  1LTA D;  2RKS A;  4I65 A;  4JI8 L;  1IL8 A;  1HZC A;  2A8V A;  4POG A;  3KLR A;  3NBH B;  1VF7 A;  2PZT A;  4TQU S;  4HSP A;  3AFP A;  1SYF A;  5HGT A;  4NXM Q;  2VL6 A;  4GNX B;  5DM7 3;  4K14 A;  1I50 H;  1L1O A;  3CQZ H;  2DGY A;  1AW7 A;  2X6G A;  3D6W A;  3CPW A;  4BWG B;  2TMP A;  5F2D A;  1CKO A;  1YIT A;  1ICF B;  3MFY A;  3NWS A;  4QY7 A;  1XNQ L;  5IT9 E;  1ENF A;  1F2Z A;  5FK9 C;  1VQJ A;  1AFP A;  2K5V A;  2F0M A;  1SYB A;  5JAV A;  4Z9C B;  4BBS G;  2OF1 A;  2RHQ B;  3SXH A;  1FGU A;  2L5T A;  5E4X A;  1GUT A;  1PLF A;  1TU2 B;  2DY8 A;  1GJX A;  3I56 A;  3F8T A;  3TP5 A;  1I3Q B;  2KVM A;  1DJR D;  1HA6 A;  2BCO A;  1HJP A;  2GA4 B;  3FEW X;  5ELE A;  4CJ2 C;  1Y1V H;  4YIJ A;  1B44 D;  1VQH A;  1FR3 A;  4IFD J;  2AUK A;  5IOD A;  3S1M H;  3NBI A;  1EY7 A;  3TZD A;  2R92 B;  4IUR A;  2JA5 H;  2JA6 H;  4IUQ A;  1M8A A;  2MUY A;  4JI8 Q;  3VR6 A;  3I3C A;  2E2I H;  4Q0F A;  1VQI A;  1S5C D;  2KED A;  4LW1 A;  3M9B A;  1BUV T;  1DM0 B;  5IIF A;  3KJP A;  1AE2 A;  1A8V A;  1EY8 A;  5IGG A;  1F2L A;  1Q8I A;  2B2U C;  4C3I H;  2K5Q A;  5C0X H;  5AJ3 Q;  4CBV A;  4A3J B;  4KY6 A;  1S72 A;  3FHW A;  1E1T A;  2DNE A;  2WAQ G;  3TDQ A;  3OW7 A;  4R4O A;  4PMW A;  1STH A;  3I4L A;  3NQT A;  2ASB A;  4GNX A;  2ALY B;  3M4Q A;  3S17 B;  2SNM A;  3MZ5 A;  2ZTC A;  5FOB B;  2J0T D;  4M1U B;  2F0T A;  4H02 A;  3JAM L;  1SEB D;  2DNC A;  4POF A;  1TII D;  1K8G A;  2NVQ H;  4RAU C;  4IPD A;  2OQK A;  1IKL A;  4JC0 A;  1Q3L A;  2XRQ D;  2R7Z B;  4A3J H;  1CZG A;  1K8M A;  3QIA A;  4UPA A;  3STB D;  1F9S A;  1Y8P B;  3OMC A;  4YCV A;  4YY3 L;  1A3U A;  3MXG A;  1EZ8 A;  4JK1 C;  2B2Y A;  3W1B A;  3TP6 A;  2I5M X;  3QJY A;  1ILP A;  3EFX D;  1BVS A;  1EIF A;  3VYT A;  1PZI D;  2V1C C;  1M4V A;  2YTY A;  1WYD A;  4DKA C;  1J9O A;  2K32 A;  3ULL A;  2WB1 E;  2IHE A;  2OCE A;  3T16 A;  5BN5 A;  2K28 A;  4V0B A;  3J81 c;  1QVF A;  1VQB A;  1JCK B;  5CV5 A;  1K8O A;  4A3E G;  1XNR Q;  1U5K A;  2K01 A;  3VA5 A;  3H6M A;  5FLM H;  1M90 C;  1JR0 D;  3G4S A;  5A2Q E;  3K81 C;  1VDZ A;  3C1F A;  1KDA A;  3F1Z A;  2NUC A;  3BVG A;  4JVZ A;  3FMC A;  1E22 A;  2EZV A;  3K57 A;  4DV0 L;  2R61 A;  1RIP A;  2XWJ B;  3CMA A;  3R93 A;  4GOP A;  2E8G A;  3BZC A;  1KIX A;  3KBG A;  4PZ8 A;  4XYO A;  1EWI A;  1VQK A;  4FF3 A;  1FGB D;  1LTL A;  2AKW B;  3S16 H;  4YHH L;  1IXR A;  3S1R H;  3C46 A;  4RA8 A;  3ER0 A;  1CKN B;  4KKS A;  3MA2 B;  2KCC A;  4NXM L;  4RKL A;  2UXB L;  2CKZ B;  2HCI A;  4X65 Q;  1TWF H;  4JW0 A;  3RN5 A;  1M1K C;  5H1S E;  2EYH A;  1U4R A;  4B3R Q;  1B53 A;  5D3D A;  1STG A;  1NJI C;  1CSQ A;  4V19 0;  2WB1 G;  4OIJ A;  4FP5 D;  1TY2 A;  3KDF A;  3PUZ A;  5E1F A;  1I4G A;  4OWW B;  3HOY G;  4KN4 C;  4DK0 A;  3T1Y Q;  4A3B G;  5I6W A;  3HZX A;  4DAM A;  1AH9 A;  1I4R A;  1XYI A;  5J1Z A;  2SNS A;  1NUC A;  4A3I H;  1EZ6 A;  3S1M B;  1U4M A;  5I9O A;  2GVB A;  1XMQ L;  3BDL A;  2L11 A;  4K5W A;  1EU4 A;  2B39 A;  2XRS D;  5LMN Q;  5J3B A;  4K5V A;  1HNW Q;  3Q0A A;  1PH5 A;  3FVQ A;  3W2D A;  3X3N A;  1E24 A;  4HJ9 A;  4TVA B;  2E2J H;  2K5W A;  1PFB A;  5D14 A;  3TN2 A;  2HQE A;  1QZG A;  4R4C A;  4LF6 L;  1LUZ A;  4LF5 Q;  3M4P A;  3S14 B;  1N32 Q;  3A7A B;  4MTN A;  2AQ3 B;  1VQG A;  2NN6 G;  4DNI A;  4GLV B;  5IOC A;  1MIU A;  4MTK A;  4A3F H;  1S4Z A;  3O13 A;  1C7Y A;  2Z6K C;  1YZ6 A;  2E75 C;  2UUB L;  1ET9 A;  1GUN A;  1MKH A;  2ZT9 C;  3CCS A;  1D5M C;  5BR8 L;  4PQX A;  4HIO A;  4OIK A;  2KOL A;  1UE6 A;  3QR8 A;  3UDI A;  1R9T B;  3VA7 A;  3DWA A;  1ZYR D;  3KBX A;  4UDU C;  3DM1 A;  3MWY W;  1HNZ L;  3NK9 A;  4HN7 A;  1OXX K;  1V8Q A;  2PPB C;  4XT1 B;  3F2D A;  3J80 c;  2A1A A;  1JOO A;  1PRT C;  5GAE C;  4HCS A;  4JPB W;  2CHB D;  2B63 H;  5ELO A;  1U4L A;  4B9W A;  1J6Q A;  2EYO A;  4UY8 C;  1VQF A;  1NCV A;  4PZ6 A;  2UXD Q;  1I4P A;  2JE6 I;  1GKH A;  1H9S B;  4K6D A;  3T1Y L;  4IPH A;  2MO0 A;  3B6Y A;  1C48 A;  4GKJ Q;  2R6G A;  2PQE A;  5M5W B;  1PHJ A;  3EQL C;  3I4N B;  2LY7 A;  1WVL A;  4BY1 H;  1DGS A;  3RMH A;  2PI2 E;  1RHP A;  3GTJ B;  3FRP B;  3Q8D A;  1RL2 A;  3HOX B;  1UNS A;  1TS3 A;  2D9U A;  5ELC A;  1NMF A;  4ILW A;  1YNN C;  3SGI A;  2NZ1 D;  5KRU A;  4GZY C;  3S2D H;  4IUP A;  5C4X G;  1N8R C;  3T1H L;  1STB A;  3BG3 A;  4NMZ A;  1Q8K A;  3DMU A;  1SND A;  5EKL A;  4ZAI A;  1IYV A;  4HJ7 A;  1AN8 A;  3OIQ A;  3A0J A;  3K5N A;  5M5Y H;  1VQN A;  2B2T C;  2A6E C;  4RMF A;  5M5Y B;  4JI7 L;  5ELN A;  4RCO A;  2CH4 W;  2QCP X;  3U4V A;  2CFM A;  2K52 A;  4LF7 Q;  1PA6 A;  3K5L A;  3OMG A;  2ID0 A;  2VQE Q;  4EGV A;  3I4M G;  1G6Z A;  2EYJ A;  2R93 H;  3I8Z A;  5I4D A;  4GKJ L;  1L0Y B;  5IWA Q;  2YTX A;  1MI2 A;  4QMG A;  3U9O A;  4YHH Q;  4DR6 L;  1B3Q A;  1B9N A;  1YBY A;  2JA6 B;  2KHJ A;  4IUN A;  1DCZ A;  4EQP A;  2R92 H;  4HJ5 A;  1G91 A;  1Y69 U;  2YU9 B;  1H9S A;  1X55 A;  4NB3 A;  4JBK A;  3G48 A;  5IYD H;  2L4N A;  1Y1V B;  4XIG S;  1I6V C;  4RGT A;  1QZH A;  1V1P A;  5FLX E;  1CQF A;  3AQQ A;  4JI2 L;  3E3X A;  4DU9 A;  3CAM A;  1Z9F A;  5CV6 A;  2UXC L;  4K5X A;  4R8N A;  2CWP A;  1IYJ B;  1X3G A;  5M3F B;  2Q2U A;  5D3I B;  5EGT A;  4GLX A;  3M4O B;  2UXB Q;  4DV2 Q;  1SAP A;  4BA1 I;  4HMJ A;  5FLM G;  2EYP A;  4ME3 A;  1TWG B;  1WCM H;  4KLK A;  3S1Q B;  1JOQ A;  2Z4I A;  3E9I A;  3LX0 A;  2XTI A;  1EQR A;  5EJW A;  3GTO H;  1QE6 A;  3I2Z A;  3OIP A;  1QCB D;  1EWH A;  1FJG L;  3J81 L;  3VYR A;  1Q12 A;  4DAY A;  2WP8 J;  4PNY A;  1PYW D;  2HHH Q;  2I5L X;  2HCC A;  4B3T L;  3S16 B;  1VQM A;  2F0H A;  1BCP C;  2WAQ E;  3W5O A;  3HOU G;  1N32 L;  2R93 G;  3NEL A;  1IBL Q;  4IFD I;  4F8M A;  5EPJ A;  3GV6 A;  1SFO H;  1VCI A;  4P72 A;  4NDX A;  3GTL B;  2VUM H;  4FVM A;  2EJM A;  2VB3 X;  2IT1 A;  5LMN L;  1CKN A;  4DV1 L;  4IUV A;  1S40 A;  1WI5 A;  1SNQ A;  5EKI A;  5C4H A;  1VMP A;  1GUW A;  1YVC A;  2EQS A;  4L63 B;  4RHS A;  3GV3 A;  2JA8 G;  1KL9 A;  3E0E A;  1STY A;  1BBU A;  2PI2 A;  2WAQ B;  1NR2 A;  4H7B A;  4BXX G;  2HDM A;  1NR4 A;  2JN4 A;  4HCE A;  2I07 B;  3NTH A;  4A3I G;  2UUA L;  3UDG A;  4J8Q A;  3HRZ C;  2UU9 Q;  1KHI A;  2QIL A;  4DXG A;  1TS5 A;  1EUJ A;  3HOY B;  1YI2 A;  1CT1 D;  1TY0 A;  1PZK D;  5KGU A;  4DV4 L;  1KLG D;  2WB1 B;  5LL6 X;  2WIN B;  2VQF Q;  4HID A;  3PUY A;  2V4D A;  1XPU A;  3BYT B;  3IFD A;  4X64 Q;  4CDC C;  3GTQ H;  4JI5 Q;  5NUC A;  3DWP A;  2F0E A;  1S5B D;  2Q8T A;  1N33 L;  1R4P B;  4KTA A;  1PTO B;  1RJT A;  4J15 A;  3NTK A;  4A75 A;  2BA1 A;  3TSS A;  3J81 i;  2A68 D;  4OO1 G;  2P5Z X;  2MNA A;  2Y0S B;  1X54 A;  2EYF A;  3GD7 A;  1GOZ A;  1SJE D;  3DLL A;  4R4Q A;  4DR5 L;  1N9W A;  1YJW A;  1TS2 A;  4C1N K;  2RQX A;  1SFO B;  3PV0 A;  3HOW H;  1N36 Q;  1HFG A;  1GHK A;  2NZH A;  3QO2 A;  3P75 A;  4QUC A;  3BDC A;  5IY0 A;  5AFW A;  1FNU A;  1TWC H;  2JA8 H;  2VZA A;  1MJE A;  3K7A B;  4CDF C;  3D8G A;  4A3E B;  2D5D A;  4DV1 Q;  5KEE A;  3EVQ A;  2RBM A;  1D1I A;  3DXJ C;  4F7X A;  2M00 A;  1QNU A;  1EY5 A;  4HMI A;  1GUO A;  3PGZ A;  1VQ6 A;  4B9X A;  1PRT F;  4DUY L;  5GQO A;  4OL7 A;  3ULJ A;  4X62 Q;  1Q1E A;  2IY5 B;  1CM9 A;  2G5D A;  4BXX H;  4DV0 Q;  1KRT A;  4LF4 L;  3TS2 A;  5GAH C;  1TWG H;  1WCM B;  3U58 A;  1QUQ B;  3H0G B;  1HZA A;  2H4O A;  3E0J A;  4N8X 1;  3RLF A;  5FO8 B;  5IGC A;  5EBC A;  4E6I A;  1QIL A;  4DF7 A;  4LF9 L;  5JEA J;  2VY3 A;  1LTG D;  3KF8 B;  1D6E C;  2C5C A;  4ZK9 B;  4FXK C;  4A93 B;  1S5E D;  4EVO A;  1F77 A;  2F0V A;  3L3O C;  4OEL B;  2L0C A;  2RF4 A;  4GKK L;  5C3E G;  1HZ9 A;  3R2T A;  1ENA A;  4IPC A;  1PXU A;  5LMU Q;  1B7Y B;  4PG3 A;  1V1P B;  1I50 B;  1ML0 D;  1FJG Q;  3T4A C;  2OTJ A;  4DA2 A;  3MXN A;  4DR3 Q;  1EOT A;  1PH6 A;  4WRD A;  4A3J G;  3C1E A;  3IKJ A;  4XYQ A;  4Y7N B;  3MFG A;  1EQQ A;  1PH4 A;  4FNF A;  2I0Q A;  1LT6 D;  3QG1 A;  4EQ5 A;  3NEN A;  1PH9 A;  1XMQ Q;  1WTP A;  3IL8 A;  2N3S A;  3OHX C;  4LFB Q;  3CW2 C;  3DM3 A;  2E2H H;  2EOT A;  2KQ3 A;  3CKI B;  3T51 B;  3TP8 A;  1HH2 P;  1WOC A;  1VQ4 A;  4J1M A;  5M3M H;  2K5D A;  3PCO B;  2MPM A;  4M8A A;  1U9R A;  2X69 A;  2QKI C;  1PFM A;  3I72 A;  1VQL A;  4B3T Q;  4DR2 Q;  2R92 G;  4A3M H;  4QQB X;  3D4W A;  3M4O H;  4KHZ A;  2HHH L;  2NTT A;  1MSH A;  2E2D C;  3QOL A;  2F0U A;  5JPN C;  1EFI D;  2AWN A;  2QF7 A;  1XNQ Q;  4DV5 L;  5GAD C;  1KTK A;  3S2D B;  1B9M A;  5M5X H;  1TS4 A;  3GTG H;  3HEJ A;  3GTM B;  3PUV A;  3GP7 A;  5JVG 3;  1BQQ T;  1RCV D;  3EN2 A;  5KND A;  3K0Y A;  4G4K A;  2F03 A;  4JI0 L;  2UXD L;  1X65 A;  1SXT A;  3WOF A;  1MD2 D;  5ELD A;  1SYG A;  3CC4 A;  1TWF B;  3I4N H;  4B3M Q;  4H13 C;  1GD7 A;  2F52 A;  4C3H B;  4EQO A;  3RN2 A;  4OWT B;  2PQA A;  2AQ2 B;  3GTM H;  3S1R B;  2B2V C;  5CGK A;  2UUA Q;  1YHB A;  2N49 A;  2PZW A;  3A5U A;  2VNU D;  3NTI A;  1A0I A;  2K5N A;  4B3R L;  2ICI A;  4C3I G;  4QL5 A;  3HOZ H;  4KD4 A;  4LUV A;  5C6A A;  5HUR A;  3S1N B;  5JJK A;  4OWX B;  4A3D H;  3LGJ A;  4OXP A;  1EY6 A;  1STN A;  2IPK D;  2NN6 I;  1IKM A;  1MHW C;  1YNX A;  3M7G A;  2ATW A;  3KUP A;  3VYU A;  3TRE A;  5M3M G;  2M2L A;  1EY9 A;  4DUZ L;  3D3R A;  1OO9 B;  4K8I A;  2JA5 G;  2XVS A;  4P2C B;  2E2H B;  4LUO A;  5JEA H;  3U50 C;  1D1K A;  1K3B C;  4JI6 L;  2F0D A;  2MJ8 A;  4PZ7 A;  3I4O A;  3SE0 A;  4BA2 I;  1Z6H A;  2KA7 A;  4DN4 M;  4EX5 A;  4Y7N H;  3OTO L;  2DUD A;  2E2J B;  3VR2 A;  4A3F B;  4AIM A;  1PH3 A;  4N8F A;  1RKN A;  2JEB I;  1ZKO A;  1IBM L;  3ICE A;  1W6J A;  1S5F D;  1WTV A;  4KV6 A;  3H09 A;  2CWA A;  3FDT A;  2EDG A;  4NW2 A;  3TME A;  3J80 E;  1U0L A;  3P1H A;  4APV A;  3PIO A;  3CXC A;  1ICW A;  1KDB A;  4XDX A;  1O7I A;  2UXC Q;  1VS0 A;  1PVO A;  1XMO Q;  2K03 A;  4BY7 H;  2HIX A;  3HS0 C;  3BS1 A;  1A62 A;  4C56 C;  3NPP A;  1LAC A;  2ZJQ A;  4HIM A;  3HFZ B;  3WOE A;  4FF4 A;  3GTK B;  4HJ8 A;  5KNC A;  1NSN S;  2K50 A;  4OO1 H;  2UUC L;  4QGU A;  4AH6 A;  5COR A;  4XQQ A;  3S17 H;  5M3M B;  1XTD A;  2EXD A;  4I7Z C;  4L6T B;  5K36 H;  2XN9 C;  3HKZ B;  4OO1 I;  4RGO S;  4K0K L;  3OWE B;  1ONL A;  3D4R A;  4ZUI A;  2IWH A;  1E2Z A;  1UWV A;  2A6H C;  4ALP A;  4C3I B;  1VMC A;  1W6K A;  1EIG A;  2RHS B;  4H44 C;  3NXW A;  2F0N A;  4C3J B;  4IUU A;  4LNQ A;  3NBH A;  4NPS A;  1HR0 L;  3CCU A;  2EJG C;  2BE5 D;  3HOW G;  3E9H A;  2KUM A;  3NHH A;  2RSN A;  2O2L D;  4YWL A;  4X66 L;  4O42 A;  3S1Q H;  1CZW A;  2GN5 A;  3I73 A;  3R2I A;  2JP1 A;  3N52 A;  1H95 A;  5GAG C;  3K5M A;  1EEI D;  4A4I A;  1UAP A;  4FXG C;  1WTX A;  1SMY D;  2WFW A;  3GTP H;  1LM0 A;  2K4K A;  4ZLT F;  3HOW B;  1WTW A;  3A5Z B;  1X3P A;  4DK1 A;  2OWO A;  4ZCK A;  1TR5 A;  3BU2 A;  2NVX H;  4DV4 Q;  4BY7 B;  1E3P A;  1QB5 D;  2LSS A;  3G7L A;  5C4X H;  3S9W A;  2F3I A;  4X6A H;  2Z1C A;  1G8Z D;  2BH8 A;  1T5E A;  1CSP A;  3A8K E;  1HTP A;  2EPB A;  1D8L A;  1E0B A;  2MO1 A;  3PO2 H;  1LTT D;  4A3K H;  2B2V A;  3E6Z X;  4DV7 Q;  3K7U C;  1Q82 C;  1Q86 C;  4QUF A;  4LFB L;  2ZM6 Q;  1EY4 A;  3NSW A;  1TKW B;  2D0P A;  2NVT H;  1LTS D;  2RDF A;  3KF6 A;  1IBK Q;  4GN4 B;  4GKK Q;  4IN3 A;  1HTL D;  1SE4 A;  2UUC Q;  4GS3 A;  4IJH A;  3ONA B;  4IAL A;  1ESR A;  3WWV A;  1ASY A;  2HDL A;  3IAY A;  2B63 B;  2R3Z A;  1D5Z C;  3NP8 A;  3HOU H;  2R7Z H;  4CDE C;  1G2S A;  1S3O A;  1L2F A;  1UE7 A;  1PH2 A;  1IYU A;  3CCM A;  2Z9H A;  2IW3 A;  1IL2 A;  2DJF C;  3MXU A;  4DV5 Q;  1NMG A;  1YHA A;  2LS0 1;  4CJ1 B;  2RSO A;  1ZYR C;  4LF9 Q;  2A69 C;  4LAA A;  1UE5 A;  4C2M B;  3GTL H;  4BBR B;  2NTS A;  4ZQ3 A;  4JI3 L;  5FJ8 H;  3CF5 A;  2F0K A;  3A55 A;  5J22 A;  4JI6 Q;  2JQO A;  4ME5 A;  1PRT D;  2A73 B;  1RDP D;  2PQA B;  1C4Q A;  1CTM A;  1ILQ A;  4DV7 L;  1IHZ A;  4JBW A;  4XXE A;  1HNZ Q;  5JJZ A;  1WTH A;  1VQ5 A;  3S2H H;  3U9S A;  3S14 H;  2IX0 A;  2NVY H;  3TBI B;  4A3K B;  1PTO D;  1SYC A;  3JC6 6;  2RDH A;  3GTO B;  4ABN A;  1L0X B;  2F0F A;  2SEB D;  5T1G A;  4DV2 L;  1X3E A;  3BZK A;  1XPO A;  4DR1 Q;  2AQ1 B;  4LF8 Q;  4JI3 Q;  1KC8 C;  2B2Y C;  3PIO 3;  1SRO A;  5C44 B;  2Z6B A;  3GTK H;  1HUN A;  5CMD A;  3A56 A;  2WV6 D;  1X32 A;  2R7D A;  3CRL C;  1C8C A;  3QOJ A;  5TSS A;  5DAU A;  5I2Y A;  3PIP A;  1K8A C;  2EYM A;  2QGQ A;  4DAY B;  1TVX A;  2K6A A;  4JYA L;  3V96 A;  4GLA C;  4L5T A;  2EY1 A;  4KD3 A;  4ULL A;  1JJC B;  3LWE A;  1J5E L;  2AHO B;  4JI1 L;  2UU9 L;  1O7Z A;  2QW7 A;  1SJH D;  3M85 A;  4DR3 L;  2Q8I B;  4LK1 C;  5LMN W;  3PO3 H;  2Y0S G;  5FJ8 G;  2Z6K A;  4WJW A;  3OWF A;  4C1N I;  1HQM C;  2F4V L;  1SE3 A;  4GN5 A;  1YHQ A;  3CCQ A;  1Q90 A;  4FF1 A;  3P20 A;  2WKD A;  1SLJ A;  4A76 A;  5JJI A;  2ZXR A;  1WTQ A;  3UI2 A;  2VB2 X;  3R3O A;  5G3L F;  4A3E H;  2AUJ D;  3T13 A;  1NBW A;  3X3M A;  3TEH B;  3CD6 A;  1DOK A;  3RNU A;  2F0S A;  4X3S A;  3M7N A;  4IFD G;  1EEF D;  1Z7T A;  2K7V A;  3G6J B;  3L2P A;  3RR5 A;  4OX9 Q;  4R9W A;  1KAA A;  1PMR A;  5HY6 A;  2WII B;  5HGQ A;  5I6Y A;  3M3Y B;  2XSC A;  2N78 A;  4MHE A;  1KAW A;  4RGM A;  4A3I B;  1I94 L;  1V1O A;  3AYH B;  1HUM A;  3OYY A;  2KCM A;  3H3V H;  2FJ2 A;  3TP7 A;  4N9T A;  3KK7 A;  4FYD A;  5CBE E;  2JA7 H;  3MEH A;  1JWU D;  4A3G G;  5DM6 3;  4P75 A;  1A3T A;  3BZD B;  1BKB A;  1CQV A;  1ESF A;  3S15 H;  4S3S A;  3GTJ H;  3QB3 A;  4MN3 A;  4GN3 B;  1WFQ A;  4KMU C;  5C3E B;  2F4V Q;  3FPU B;  1PH1 A;  2M9V A;  2F4I A;  1Y1W B;  1LTR D;  3BVZ A;  4P73 A;  4A93 G;  3A8J E;  1LT5 D;  1UEA B;  2LKV A;  1YEZ A;  1WJJ A;  1E7Z A;  3SK8 A;  1K28 A;  1CK1 A;  3NWT A;  2PYK A;  4X62 L;  2R93 B;  1I6H H;  3D6C A;  3H0G G;  5IGE A;  1G6P A;  3ERS X;  2YTV A;  3K8A A;  1Y8O B;  2FHT A;  4DK6 C;  2NZO A;  5IYB H;  2L15 A;  1R9T H;  3FKI H;  3NEM A;  1LT4 D;  2F3W A;  2D62 A;  2K05 A;  4OHJ A;  1GUG A;  3GTP B;  2ZM6 L;  3KLW A;  3JAM i;  1SYD A;  3A7L A;  3CRK C;  4RCN A;  5EPK A;  3VYS A;  4A3M G;  1DON A;  1UEB A;  3K80 C;  3CCV A;  1FVI A;  1SDF A;  3VDY A;  4TSS A;  5GRO A;  4DV6 L;  1KLU D;  1LAB A;  1VQO A;  1BF4 A;  3N6R A;  1PDQ A;  3STB C;  1OTC A;  1LTI D;  2O5J C;  4LUZ A;  4A3G H;  3W3A A;  4NP5 A;  4QF4 A;  4QB4 A;  2RA4 A;  4Q5V A;  5CV9 A;  5EQ0 A;  4JI4 L;  2B3G A;  3S24 A;  1IBL L;  3CCL A;  3HKS A;  1B4O A;  1UE1 A;  3MTS A;  1VQ8 A;  3ERQ A;  2FMC A;  2CCZ A;  2JK8 A;  4U68 A;  4DR7 Q;  2TSS A;  2QEJ C;  2F0Q A;  2L55 A;  4YWK A;  4ZYS A;  5JVH 3;  2FMM A;  1K0S A;  1E2W A;  3I4M B;  4CJ0 B;  4OON A;  3NUC A;  4HIK A;  1VQC A;  4CGY B;  2A68 C;  2NVQ B;  1KXL A;  4X65 L;  2F3V A;  1LT3 D;  3MXN B;  3CC7 A;  4ZUJ A;  5IT9 L;  2EE1 A;  3VR4 A;  2F0P A;  5COY A;  3URY A;  5AJ3 L;  3U4Z A;  2RCF A;  3I90 A;  4LMQ D;  2BH2 A;  1EFW A;  3MHB A;  1JE4 A;  5BN4 A;  1F9R A;  3Q23 A;  1C9O A;  3CQZ B;  4JI2 Q;  1TWH B;  3KOJ A;  5FLX L;  2A74 C;  1EY0 A;  4DR5 Q;  1T9H A;  5IGB A;  1VF5 C;  2YV5 A;  1ZEQ X;  4X3U A;  1BBW A;  3PO2 G;  3I91 A;  4DR6 Q;  1CUK A;  4LJZ C;  1C0A A;  1TWC B;  2CW0 C;  2JA8 B;  3H15 A;  2JA7 G;  3TZU A;  1LLR D;  4A3L G;  1TWA H;  1LYL A;  4KHV A;  3I4N G;  2F0J A;  3AMU A;  2E5L Q;  2L1B A;  1KDC A;  2VS1 A;  4AYB B;  4I7A A;  1YNJ D;  3HP3 A;  2BOS A;  3J81 E;  1Q81 C;  1EWC A;  3RZO H;  4LF6 Q;  4DR4 Q;  2IHF A;  4KY7 A;  1RD9 D;  1G29 1;  2ZXP A;  1JJG A;  4LFA L;  1HNX L;  4WJ3 M;  1E2V A;  1DOM A;  1PFN A;  4F87 A;  1I6H B;  3J7Y W;  3HOU B;  2EJF C;  3S1N H;  4TKO B;  1DYQ A;  2BDO A;  1FYC A;  3KLS A;  1A15 A;  2N55 A;  5JPM C;  3BJU A;  4J6H A;  4R4T A;  1PTO F;  1K3R A;  3JAM E;  2Z4H A;  1YJN A;  5CV7 A;  3D0F A;  4CKE A;  1B70 B;  3K5O A;  1PRT B;  3ZJY C;  4BBS H;  2KJX A;  1L1O C;  1PYS B;  2J7Z A;  4PV1 C;  5ELB A;  1SE8 A;  1F9P A;  4UHV A;  4DUY Q;  2KCN A;  1HXY D;  1IBK L;  2HT1 A;  5M3F G;  1XTC D;  3L7Z C;  1IBM Q;  3C3L A;  2B2W C;  4QIW B;  2F0W A;  3LWU A;  1HPC A;  1SYE A;  1DZ1 A;  1XWE A;  4CHT B;  5CV8 A;  2AMC B;  1AZQ A;  2CH4 A;  5L37 A;  1Y1V G;  2ZJP A;  2RCN A;  1EYA A;  1KQS A;  4AYB G;  1UUP A;  1MBY A;  1Q7Y C;  3SDZ A;  4IFD H;  4H0L C;  4P74 A;  1IW7 D;  1W3S A;  2Z0S A;  1QG7 A;  1JJ2 A;  3EJI A;  2OT2 A;  2JA6 G;  5FKA C;  2A6E D;  1VQ7 A;  4XT3 B;  2K75 A;  4A3D B;  2XWB B;  2VUM B;  2QEX A;  2XGT A;  4A3C G;  1SR3 A;  3MXP A;  2N88 A;  5M9O A;  1OXT A;  4YCU A;  1P8L A;  5T1I A;  4OGQ C;  1QNK A;  5C3E H;  5CV4 A;  1QVG A;  3MEF A;  5A2Q L;  2MGS A;  3VR5 A;  2JEA I;  4P71 A;  2ZTE A;  5E3F A;  3UE0 A;  4QJF A;  2EYL A;  3L9A X;  4JI5 L;  4A93 H;  1JB7 A;  1H9R A;  2I5H A;  4LFC L;  3W1G A;  3PUX A;  3RZD H;  4IOA A;  1HHV A;  4HR7 B;  2YYZ A;  4LF8 L;  2VQE L;  5C4X B;  3RUZ A;  1K73 C;  1VQP A;  1HR0 W;  1YNN D;  3TS0 A;  1I4X A;  3UDX A;  4DPG A;  1AZP A;  3EBE A;  2EY5 A;  1DD2 A;  3J81 j;  1TQO A;  4FDB A;  3HOX G;  4AYB E;  4FF2 A;  4DV6 Q;  2VUM G;  4HED A;  4A3D G;  3ERO A;  3PIP 3;  2Q2I A;  4KHP L;  1NNX A;  1J5E Q;  2ZXO A;  1ROD A;  5ELF A;  5CR3 A;  3AEV A;  3TQY A;  3G71 A;  4DV3 L;  2NVY B;  3UDF A;  4LF4 Q;  4HAE A;  1CHP D;  2QDL A;  1D2B A;  5DLQ E;  1BCP F;  1S5D D;  2B2U A;  2PCF B;  3ND8 A;  4IUT A;  1JB3 A;  3CCE A;  4L5R C;  4U67 3;  3RLN A;  2HIV A;  1CA5 A;  2VW9 A;  2I46 A;  3CHB D;  2MFI A;  2D2C C;  3ITP A;  3KF8 A;  4JYA Q;  2MQH A;  2HQL A;  3I70 A;  1VQE A;  3DEP A;  1JQY D;  2L12 A;  4XQJ A;  5IYC G;  3KLS X;  4KJN A;  1TXY A;  2B2T A;  1CA6 A;  1V1Q A;  5IGF A;  2IL8 A;  3DEO A;  1GHJ A;  3FPP A;  5KIX A;  3EA6 A;  3OSO A;  4MNO A;  4A3C H;  2IX3 A;  4OX9 L;  1B50 A;  1HCZ A;  2PO4 A;  2ICE C;  3Q22 A;  2E74 C;  1NTG A;  3F2C A;  4KKT A;  2R7Z G;  4YWM A;  3K59 A;  1L1O B;  4DUZ Q;  4CKB A;  1O78 A;  1Y14 B;  1H9J A;  3RD4 A;  5IGD A;  3JAM c;  1Y1W H;  3J7A 5;  5C44 H;  2NVT B;  1QWY A;  2JSO A;  2KBN A;  4N9P A;  3V2T A;  5C3W A;  2RVL A;  3AU7 A;  1WTO A;  5M5W H;  1STA A;  5IYD G;  4IPG A;  1KNA A;  2JA7 B;  1JWS D;  3PO2 B;  4A3G B;  1F2M A;  2MHV A;  3CME A;  1BCP D;  3KYH C;  2O5I C;  4XQN A;  4GOP C;  5IP7 G;  1AE3 A;  2FIN B;  1KD1 C;  1EYD A;  1A63 A;  3F2B A;  2JA9 A;  2EY2 A;  4WFN 3;  2Q8R E;  2KEE A;  1N36 L;  4A3B B;  2A5H A;  4FO2 A;  3T1H Q;  1TWH H;  2J4X A;  1LV9 A;  4JI0 Q;  3WDN A;  4RG1 A;  3CPF A;  1JC7 A;  5C3X A;  3QWN A;  2H1E A;  3J7A V;  4IOC A;  4JG2 A;  4X64 L;  3A8I E;  1K83 H;  1H9K A;  5IT9 c;  1ENC A;  2IX1 A;  4Y52 H;  3MVV A;  3GQB A;  1ZXT A;  5KNB A;  2Q2T A;  1LTB D;  5K36 G;  1TT2 A;  1WD1 A;  1WTR A;  4DR2 L;  3L0O A;  1CKM A;  3K0X A;  1GO3 E;  1SMX A;  2ES2 A;  4BBS B;  4JI4 Q;  4UP9 A;  1KRS A;  1D7Q A;  1SNP A;  4KKU A;  4AQY L;  3C2P A;  4WOR A;  3H91 A;  4NXN Q;  3T53 B;  3D31 A;  1BCP B;  2B8F A;  1RTO A;  3Q24 A;  4HSV A;  3RLO A;  4DR1 L;  2PW5 A;  1HFN A;  5CYU A;  3J7Z C;  1FNV A;  4IO9 A;  2XIW A;  1RF2 D;  1VQ9 A;  4JI1 Q;  3H3V I;  5E4W C;  2NB0 A;  5M3F H;  4B3M L;  4G7O C;  1NY4 A;  5LL6 S;  1NAP A;  2K5H A;  3FP9 A;  1GXD C;  5LMU L;  4A3M B;  1X9N A;  5EAY A;  4CKC A;  4A3L H;  1EU3 A;  3OW2 A;  3I7F A;  2YU9 H;  4HTH A;  1YIJ A;  4DNT B;  3GO5 A;  4G57 A;  5IYC H;  1OXS C;  1JE5 A;  4A3K G;  2JXM B;  1WD0 A;  1EIH A;  3V05 A;  2F0L A;  4YY3 Q;  3H3V C;  1EQV A;  1SN8 A;  4OEM B;  4DXF A;  5BN3 A;  4ZRZ A;  5G3L D;  4AQY Q;  1GM5 A;  2E5L L;  4C3J H;  5KYI A;  5KYL A;  3SVM A;  4MZ9 A;  3IRB A;  3NQI A;  3PO3 B;  4BBR G;  4K2L A;  2D0O A;  4KY5 A;  1Y1W G;  3KDF B;  2E2I B;  1PTO C;  4KI0 A;  5C0X I;  1IZ6 A;  4QIW E;  2WKC A;  4O2D A;  2PNH A;  1QUQ A;  5DNF A;  2EXZ A;  2CQO A;  4JBM A;  1J8I A;  1K9M C;  4CDD C;  3OPO A;  3PMF A;  1A2U A;  1PH7 A;  1A3V A;  5C4J B;  4B3S L;  2B63 G;  4DR4 L;  1KNE A;  3HOX H;  3HOZ G;  4R4I A;  5CBA E;  1HRJ A;  1A6X A;  2LXJ A;  1MSG A; 
#chains in the Genus database with same CATH homology
 1Z47 A;  5DEH A;  1MGS A;  4ZKB B;  2DN8 A;  1I4Q A;  1Q1B A;  1HA5 A;  4RGN A;  3GTQ B;  1DOL A;  2L9H A;  2PMZ B;  4MIU A;  5JEA G;  2F0O A;  2MP1 A;  2OEO A;  4PMC A;  2IJ0 A;  3CU7 A;  2HUG A;  1HQR D;  2F1M A;  1O80 A;  4DFA A;  3DHQ A;  1B1Z A;  2B8G A;  1SNM A;  2AWO A;  5LHY 1;  3F2U A;  3FKI B;  5EPL A;  4DAP A;  2DY7 A;  1EQT A;  2CQA A;  1F9Q A;  1B2T A;  1G2T A;  2VXW A;  2BDN A;  4BS9 A;  1EL0 A;  4RH6 A;  4ID6 A;  3VR3 A;  1T5X D;  1H9M A;  5FO7 B;  4RWS C;  2K04 A;  4K6L A;  4ZKC B;  4C3J G;  2QDB A;  3SR1 A;  4KK7 A;  1JOR A;  4R8I A;  2X6L A;  1SSO A;  4G7Z C;  2NN6 H;  5JOB A;  3A54 A;  2F0I A;  4BY1 B;  4K2K A;  3AB9 A;  1BDO A;  1CI3 M;  3S15 B;  1GUS A;  1CHQ D;  1JWM D;  1SBB B;  1A2T A;  1BBX C;  3M4Y A;  3J7A F;  1FD7 D;  1R4Q B;  4XTC S;  3RZO B;  3IFT A;  1STE A;  1F2Y A;  1KAB A;  1XX8 A;  3NE5 B;  3BDO A;  2KEC A;  2OXP A;  4EQN A;  1Y8N B;  1OXV A;  5C4Z A;  1RTN A;  2XNA C;  1BR9 A;  3SK5 A;  1SNC A;  5EKK A;  2SDF A;  1LO5 D;  1U4P A;  3HG9 A;  1SNO A;  2O4X A;  1EYC A;  5ISR A;  2NWG A;  2A6H D;  1SE2 A;  4KJO A;  2B2W A;  3DWQ A;  4X3T A;  5D65 A;  5FO9 B;  2JA5 B;  2CVR A;  2BE5 C;  3ZYY X;  2PW7 A;  2C9O A;  3H94 A;  5I2X A;  4B08 A;  4QCL A;  3MC0 B;  3DUZ A;  4FXD A;  1D5X C;  1I4H A;  3BVM A;  1AEX A;  3OOC A;  3HGB A;  3BYY B;  3P7J A;  3T56 B;  4DNR B;  4RKB A;  2EVB A;  4RHR A;  3HOV B;  3LNN A;  2G9H D;  3E5S A;  1O7Y A;  1BXT A;  2K33 A;  1DXM A;  1QJO A;  3K6O A;  4C3H G;  1OXU A;  1TWA B;  5EBD A;  4L8J A;  4G7H C;  1JOK A;  4UAI A;  3GTG B;  2F0G A;  2BA0 A;  4PMB A;  1X3Q A;  2NYZ D;  1QOH A;  5I9P A;  5C5M A;  1PZJ D;  1B3A A;  1ET6 A;  3S2H B;  4RFB A;  3SK4 A;  4K8J A;  1K83 B;  4IZ8 A;  2LMC B;  2NBF A;  2CW0 D;  2JYO A;  4NKL A;  1SMY C;  2PNR C;  3PUW A;  3SHL A;  2LFN A;  3Q6S A;  2A69 D;  1YNJ C;  2SOB A;  4O1N A;  2RDG A;  5C0X G;  1FNW A;  3HOZ B;  5C5L A;  2G9D A;  1BNZ A;  1XXG A;  2KHS A;  3R8B A;  2FFK B;  1BO0 A;  1PTO H;  2WAC A;  2K1B A;  4DAV A;  3ND9 A;  4IQZ A;  5C0X J;  3RZD B;  4KN7 C;  1V43 A;  2EY6 A;  3D4D A;  5M5X B;  2ENB A;  5J39 A;  4DGZ A;  4F88 A;  5A35 A;  3SK6 A;  1O7L A;  1JIC A;  1AP0 A;  1CFM A;  1BOS A;  2Z8L A;  4X3K A;  5CC4 A;  3K58 A;  2NVX B;  3SEB A;  2E76 C;  3J80 L;  2PZU A;  1IW7 C;  4ODG A;  4TRD A;  5K5P A;  3MAQ A;  1II3 A;  1LTA D;  2RKS A;  4I65 A;  1IL8 A;  3KLR A;  1VF7 A;  2PZT A;  4TQU S;  4HSP A;  1SYF A;  5HGT A;  5DM7 3;  4K14 A;  1AW7 A;  2X6G A;  3D6W A;  4BWG B;  2TMP A;  5F2D A;  3MFY A;  3NWS A;  5IT9 E;  1ENF A;  1F2Z A;  5FK9 C;  1AFP A;  2F0M A;  1SYB A;  5JAV A;  4Z9C B;  2OF1 A;  3SXH A;  2L5T A;  5E4X A;  1GUT A;  1PLF A;  1TU2 B;  2DY8 A;  1GJX A;  3TP5 A;  1I3Q B;  2KVM A;  1DJR D;  1HA6 A;  2BCO A;  2GA4 B;  3FEW X;  5ELE A;  4CJ2 C;  4YIJ A;  1B44 D;  1FR3 A;  4IFD J;  2AUK A;  5IOD A;  3NBI A;  1EY7 A;  3TZD A;  2R92 B;  4IUR A;  4IUQ A;  1M8A A;  2MUY A;  3VR6 A;  3I3C A;  4Q0F A;  1S5C D;  2KED A;  1BUV T;  1DM0 B;  5IIF A;  1EY8 A;  5IGG A;  1F2L A;  1Q8I A;  2B2U C;  2K5Q A;  5C0X H;  4CBV A;  4A3J B;  4KY6 A;  2DNE A;  3TDQ A;  3OW7 A;  4PMW A;  1STH A;  3I4L A;  3NQT A;  3S17 B;  2SNM A;  3MZ5 A;  5FOB B;  2J0T D;  4M1U B;  2F0T A;  3JAM L;  1SEB D;  2DNC A;  1TII D;  4RAU C;  1IKL A;  1Q3L A;  2XRQ D;  2R7Z B;  1CZG A;  1K8M A;  3QIA A;  1F9S A;  1Y8P B;  3OMC A;  1A3U A;  3MXG A;  1EZ8 A;  4JK1 C;  2B2Y A;  3TP6 A;  3QJY A;  1ILP A;  3EFX D;  3VYT A;  1PZI D;  1M4V A;  1J9O A;  2K32 A;  3T16 A;  5BN5 A;  2K28 A;  4V0B A;  1JCK B;  5CV5 A;  1K8O A;  2K01 A;  3VA5 A;  3H6M A;  1JR0 D;  5A2Q E;  1VDZ A;  3C1F A;  1KDA A;  2NUC A;  3BVG A;  3FMC A;  2EZV A;  3K57 A;  2R61 A;  2XWJ B;  3R93 A;  3KBG A;  4XYO A;  4FF3 A;  1FGB D;  3C46 A;  4RA8 A;  4KKS A;  3MA2 B;  2KCC A;  4RKL A;  2HCI A;  2EYH A;  1U4R A;  1B53 A;  5D3D A;  1STG A;  4V19 0;  4OIJ A;  4FP5 D;  1TY2 A;  3PUZ A;  5E1F A;  1I4G A;  4KN4 C;  4DK0 A;  5I6W A;  3HZX A;  1I4R A;  1XYI A;  5J1Z A;  2SNS A;  1NUC A;  1EZ6 A;  3S1M B;  1U4M A;  5I9O A;  3BDL A;  2L11 A;  4K5W A;  1EU4 A;  2B39 A;  2XRS D;  4K5V A;  3Q0A A;  3FVQ A;  3W2D A;  3X3N A;  2K5W A;  1PFB A;  5D14 A;  3TN2 A;  2HQE A;  3S14 B;  3A7A B;  2AQ3 B;  2NN6 G;  5IOC A;  1S4Z A;  3O13 A;  2E75 C;  1ET9 A;  1GUN A;  2ZT9 C;  1D5M C;  4PQX A;  4OIK A;  2KOL A;  1R9T B;  3VA7 A;  3DWA A;  1ZYR D;  3KBX A;  4UDU C;  3DM1 A;  3MWY W;  3NK9 A;  4HN7 A;  1OXX K;  1V8Q A;  2PPB C;  4XT1 B;  1JOO A;  1PRT C;  4HCS A;  2CHB D;  1U4L A;  4B9W A;  2EYO A;  1NCV A;  1I4P A;  2JE6 I;  1H9S B;  4K6D A;  1C48 A;  2R6G A;  2PQE A;  5M5W B;  3EQL C;  3I4N B;  2LY7 A;  1WVL A;  3RMH A;  1RHP A;  3GTJ B;  3FRP B;  3HOX B;  1UNS A;  1TS3 A;  2D9U A;  5ELC A;  4GZY C;  4ILW A;  1YNN C;  5KRU A;  2NZ1 D;  4IUP A;  1STB A;  3BG3 A;  4NMZ A;  3DMU A;  1SND A;  5EKL A;  4ZAI A;  1IYV A;  1AN8 A;  3OIQ A;  3K5N A;  2B2T C;  2A6E C;  5M5Y B;  4RCO A;  2QCP X;  3K5L A;  3OMG A;  2ID0 A;  4EGV A;  1G6Z A;  2EYJ A;  3I8Z A;  5I4D A;  1L0Y B;  1MI2 A;  4QMG A;  3U9O A;  1B9N A;  2JA6 B;  4IUN A;  1DCZ A;  4EQP A;  1G91 A;  1Y69 U;  2YU9 B;  1H9S A;  2L4N A;  1Y1V B;  4XIG S;  1I6V C;  4RGT A;  1V1P A;  5FLX E;  1CQF A;  4DU9 A;  5CV6 A;  4K5X A;  4R8N A;  5M3F B;  5D3I B;  5EGT A;  3M4O B;  1SAP A;  4BA1 I;  4HMJ A;  2EYP A;  1TWG B;  1JOQ A;  3S1Q B;  2Z4I A;  3LX0 A;  5EJW A;  1QE6 A;  3OIP A;  1QCB D;  1EWH A;  3J81 L;  4DAY A;  3VYR A;  1Q12 A;  2WP8 J;  4PNY A;  1PYW D;  2HCC A;  3S16 B;  2F0H A;  1BCP C;  4IFD I;  4F8M A;  5EPJ A;  3GV6 A;  1VCI A;  4NDX A;  3GTL B;  4FVM A;  2EJM A;  2VB3 X;  2IT1 A;  4IUV A;  1SNQ A;  5EKI A;  5C4H A;  1VMP A;  1GUW A;  4L63 B;  4RHS A;  3GV3 A;  1STY A;  2WAQ B;  1NR2 A;  4H7B A;  2HDM A;  1NR4 A;  4HCE A;  2I07 B;  3NTH A;  4J8Q A;  3HRZ C;  2QIL A;  4DXG A;  1TS5 A;  3HOY B;  1CT1 D;  1TY0 A;  1PZK D;  5KGU A;  1KLG D;  2WB1 B;  5LL6 X;  2WIN B;  3PUY A;  2V4D A;  3BYT B;  3IFD A;  5NUC A;  3DWP A;  2F0E A;  1S5B D;  2Q8T A;  1R4P B;  4KTA A;  1RJT A;  1PTO B;  3NTK A;  2BA1 A;  3TSS A;  2A68 D;  4OO1 G;  2Y0S B;  2EYF A;  3GD7 A;  1GOZ A;  1SJE D;  1TS2 A;  4C1N K;  2RQX A;  1SFO B;  3PV0 A;  1HFG A;  1GHK A;  3QO2 A;  3P75 A;  4QUC A;  3BDC A;  5AFW A;  1FNU A;  3K7A B;  3D8G A;  4A3E B;  2D5D A;  5KEE A;  3EVQ A;  2RBM A;  1D1I A;  3DXJ C;  4F7X A;  2M00 A;  1QNU A;  1EY5 A;  4HMI A;  1GUO A;  4B9X A;  1PRT F;  4OL7 A;  1Q1E A;  1CM9 A;  1WCM B;  3H0G B;  2H4O A;  3E0J A;  3RLF A;  5FO8 B;  5IGC A;  5EBC A;  4E6I A;  1QIL A;  4DF7 A;  5JEA J;  1LTG D;  1D6E C;  2C5C A;  4ZK9 B;  4FXK C;  4A93 B;  1S5E D;  4EVO A;  1F77 A;  2F0V A;  3L3O C;  2L0C A;  3R2T A;  1ENA A;  1PXU A;  1V1P B;  1I50 B;  1ML0 D;  3T4A C;  4DA2 A;  3MXN A;  1EOT A;  4WRD A;  3C1E A;  3IKJ A;  4XYQ A;  4Y7N B;  3MFG A;  4FNF A;  1LT6 D;  3QG1 A;  1WTP A;  3IL8 A;  3OHX C;  2EOT A;  2KQ3 A;  3CKI B;  3T51 B;  3TP8 A;  4J1M A;  2K5D A;  4M8A A;  2MPM A;  1U9R A;  2X69 A;  2QKI C;  1PFM A;  3I72 A;  3D4W A;  4KHZ A;  2NTT A;  1MSH A;  2E2D C;  3QOL A;  2F0U A;  5JPN C;  1EFI D;  2AWN A;  2QF7 A;  1KTK A;  3S2D B;  1B9M A;  1TS4 A;  3HEJ A;  3GTM B;  3PUV A;  3GP7 A;  5JVG 3;  1BQQ T;  1RCV D;  5KND A;  3K0Y A;  4G4K A;  2F03 A;  3WOF A;  1SXT A;  1MD2 D;  5ELD A;  1SYG A;  1TWF B;  4H13 C;  4C3H B;  4EQO A;  2AQ2 B;  3S1R B;  2B2V C;  5CGK A;  2PZW A;  2VNU D;  3NTI A;  2ICI A;  4C3I G;  4KD4 A;  5C6A A;  5HUR A;  3S1N B;  1EY6 A;  1STN A;  2IPK D;  2NN6 I;  1IKM A;  3M7G A;  3KUP A;  3VYU A;  2M2L A;  1EY9 A;  3D3R A;  1OO9 B;  4K8I A;  2XVS A;  4P2C B;  2E2H B;  5JEA H;  1D1K A;  2F0D A;  2MJ8 A;  3SE0 A;  4BA2 I;  1Z6H A;  2KA7 A;  4DN4 M;  2E2J B;  3VR2 A;  4A3F B;  1RKN A;  2JEB I;  1ZKO A;  1W6J A;  1S5F D;  1WTV A;  4KV6 A;  3H09 A;  3FDT A;  2EDG A;  4NW2 A;  3TME A;  3J80 E;  3P1H A;  1ICW A;  1KDB A;  4XDX A;  2K03 A;  3HS0 C;  3BS1 A;  4C56 C;  3NPP A;  1LAC A;  3WOE A;  4FF4 A;  3GTK B;  5KNC A;  1NSN S;  4OO1 H;  5COR A;  4XQQ A;  5M3M B;  4I7Z C;  4L6T B;  5K36 H;  2XN9 C;  3HKZ B;  4OO1 I;  4RGO S;  3OWE B;  1ONL A;  3D4R A;  4ZUI A;  2IWH A;  1E2Z A;  2A6H C;  4C3I B;  1VMC A;  1W6K A;  1EIG A;  4H44 C;  3NXW A;  2F0N A;  4C3J B;  4IUU A;  3NBH A;  2EJG C;  2BE5 D;  2KUM A;  3NHH A;  2RSN A;  2O2L D;  4O42 A;  1CZW A;  3I73 A;  3R2I A;  2JP1 A;  3N52 A;  3K5M A;  1EEI D;  1UAP A;  4FXG C;  1WTX A;  1SMY D;  4ZLT F;  3HOW B;  1WTW A;  1X3P A;  4DK1 A;  1TR5 A;  4BY7 B;  1QB5 D;  3G7L A;  3S9W A;  2Z1C A;  1G8Z D;  1T5E A;  3A8K E;  1HTP A;  2EPB A;  1E0B A;  1LTT D;  2B2V A;  3E6Z X;  4QUF A;  1EY4 A;  3NSW A;  1TKW B;  1LTS D;  2RDF A;  4IN3 A;  1HTL D;  1SE4 A;  3ONA B;  4IAL A;  1ESR A;  2HDL A;  3IAY A;  2B63 B;  2R3Z A;  1D5Z C;  3NP8 A;  1G2S A;  1IYU A;  2IW3 A;  3MXU A;  2LS0 1;  4CJ1 B;  2RSO A;  1ZYR C;  2A69 C;  4LAA A;  4C2M B;  4BBR B;  2NTS A;  4ZQ3 A;  2F0K A;  3A55 A;  5J22 A;  4ME5 A;  1PRT D;  2A73 B;  1RDP D;  1C4Q A;  1CTM A;  1ILQ A;  1IHZ A;  4JBW A;  4XXE A;  5JJZ A;  3U9S A;  2IX0 A;  3TBI B;  4A3K B;  1PTO D;  1SYC A;  2RDH A;  3GTO B;  4ABN A;  1L0X B;  2F0F A;  2SEB D;  5T1G A;  2AQ1 B;  2B2Y C;  3PIO 3;  5C44 B;  1HUN A;  5CMD A;  3A56 A;  2WV6 D;  1X32 A;  3CRL C;  1C8C A;  3QOJ A;  5TSS A;  5DAU A;  5I2Y A;  2EYM A;  1TVX A;  2K6A A;  3V96 A;  2EY1 A;  4KD3 A;  4ULL A;  3LWE A;  1O7Z A;  1SJH D;  3M85 A;  2Q8I B;  4LK1 C;  4WJW A;  3OWF A;  4C1N I;  1HQM C;  1SE3 A;  1Q90 A;  4FF1 A;  3P20 A;  2WKD A;  2ZXR A;  1WTQ A;  3UI2 A;  2VB2 X;  3R3O A;  5G3L F;  2AUJ D;  3T13 A;  3X3M A;  1DOK A;  2F0S A;  4X3S A;  3M7N A;  4IFD G;  1EEF D;  1Z7T A;  2K7V A;  3G6J B;  4R9W A;  1KAA A;  1PMR A;  2WII B;  5I6Y A;  3M3Y B;  2XSC A;  4MHE A;  4RGM A;  4A3I B;  1V1O A;  1HUM A;  2FJ2 A;  3TP7 A;  4N9T A;  3KK7 A;  4FYD A;  5CBE E;  3MEH A;  1JWU D;  5DM6 3;  1A3T A;  3BZD B;  1CQV A;  1ESF A;  4S3S A;  3QB3 A;  4MN3 A;  4KMU C;  5C3E B;  3FPU B;  2M9V A;  2F4I A;  1Y1W B;  1LTR D;  3BVZ A;  3A8J E;  1LT5 D;  1UEA B;  2LKV A;  3SK8 A;  1CK1 A;  3NWT A;  2PYK A;  2R93 B;  3D6C A;  5IGE A;  1Y8O B;  2FHT A;  1LT4 D;  2F3W A;  2D62 A;  2K05 A;  4OHJ A;  1GUG A;  3GTP B;  1SYD A;  3A7L A;  3CRK C;  4RCN A;  5EPK A;  3VYS A;  1DON A;  1SDF A;  4TSS A;  1KLU D;  1LAB A;  1BF4 A;  3N6R A;  1PDQ A;  1LTI D;  2O5J C;  3W3A A;  4NP5 A;  4QF4 A;  4QB4 A;  2RA4 A;  4Q5V A;  5CV9 A;  5EQ0 A;  1B4O A;  3MTS A;  3ERQ A;  2FMC A;  4U68 A;  2TSS A;  2QEJ C;  2F0Q A;  2L55 A;  4ZYS A;  5JVH 3;  2FMM A;  1E2W A;  3I4M B;  4CJ0 B;  3NUC A;  4CGY B;  2A68 C;  2NVQ B;  2F3V A;  1LT3 D;  4ZUJ A;  5IT9 L;  2EE1 A;  3VR4 A;  2F0P A;  5COY A;  3URY A;  3I90 A;  4LMQ D;  3MHB A;  1JE4 A;  5BN4 A;  1F9R A;  3Q23 A;  3CQZ B;  1TWH B;  5FLX L;  2A74 C;  1EY0 A;  5IGB A;  1VF5 C;  1ZEQ X;  4X3U A;  3I91 A;  4LJZ C;  1TWC B;  2CW0 C;  2JA8 B;  3TZU A;  1LLR D;  4KHV A;  2F0J A;  3AMU A;  2L1B A;  1KDC A;  4AYB B;  1YNJ D;  3HP3 A;  2BOS A;  3J81 E;  1EWC A;  4KY7 A;  1RD9 D;  1G29 1;  2ZXP A;  1E2V A;  1DOM A;  1PFN A;  4F87 A;  1I6H B;  3J7Y W;  3HOU B;  2EJF C;  4TKO B;  1DYQ A;  2BDO A;  1FYC A;  3KLS A;  1A15 A;  2N55 A;  5JPM C;  4J6H A;  1PTO F;  3JAM E;  2Z4H A;  5CV7 A;  4CKE A;  3K5O A;  1PRT B;  2KJX A;  2J7Z A;  4PV1 C;  5ELB A;  1F9P A;  2KCN A;  1HXY D;  1XTC D;  3L7Z C;  3C3L A;  2B2W C;  4QIW B;  2F0W A;  3LWU A;  1HPC A;  1SYE A;  1DZ1 A;  1XWE A;  4CHT B;  5CV8 A;  1AZQ A;  1EYA A;  1UUP A;  1MBY A;  3SDZ A;  4IFD H;  4H0L C;  1IW7 D;  1QG7 A;  3EJI A;  2OT2 A;  5FKA C;  2A6E D;  4XT3 B;  4A3D B;  2XWB B;  2VUM B;  3MXP A;  2N88 A;  5M9O A;  1OXT A;  5T1I A;  4OGQ C;  1QNK A;  5CV4 A;  5A2Q L;  2MGS A;  3VR5 A;  2JEA I;  5E3F A;  2EYL A;  3L9A X;  1H9R A;  3PUX A;  1HHV A;  4HR7 B;  2YYZ A;  5C4X B;  3RUZ A;  1YNN D;  1I4X A;  1AZP A;  2EY5 A;  1DD2 A;  1TQO A;  4FF2 A;  4HED A;  3ERO A;  3PIP 3;  2ZXO A;  1ROD A;  5ELF A;  5CR3 A;  2NVY B;  4HAE A;  1CHP D;  1D2B A;  1BCP F;  1S5D D;  2B2U A;  2PCF B;  3ND8 A;  4IUT A;  1JB3 A;  4U67 3;  1CA5 A;  2I46 A;  3CHB D;  2D2C C;  3ITP A;  3KF8 A;  3I70 A;  3DEP A;  1JQY D;  2L12 A;  4XQJ A;  3KLS X;  4KJN A;  1CA6 A;  2B2T A;  5IGF A;  2IL8 A;  3DEO A;  1GHJ A;  3FPP A;  5KIX A;  3EA6 A;  3OSO A;  2IX3 A;  1B50 A;  1HCZ A;  2PO4 A;  2ICE C;  3Q22 A;  2E74 C;  4KKT A;  3K59 A;  4CKB A;  1O78 A;  3RD4 A;  1H9J A;  5IGD A;  2NVT B;  1QWY A;  2JSO A;  4N9P A;  3V2T A;  5C3W A;  2RVL A;  3AU7 A;  1WTO A;  1STA A;  1KNA A;  2JA7 B;  1JWS D;  3PO2 B;  4A3G B;  1F2M A;  2MHV A;  2O5I C;  1BCP D;  4XQN A;  2FIN B;  1EYD A;  2EY2 A;  4WFN 3;  2Q8R E;  2KEE A;  4A3B B;  2A5H A;  4FO2 A;  2J4X A;  1LV9 A;  3WDN A;  1JC7 A;  5C3X A;  3QWN A;  2H1E A;  3J7A V;  2IX1 A;  3A8I E;  1H9K A;  1ENC A;  3MVV A;  3GQB A;  1ZXT A;  5KNB A;  1LTB D;  5K36 G;  1TT2 A;  1WD1 A;  1WTR A;  4BBS B;  1SNP A;  4KKU A;  3C2P A;  4WOR A;  3H91 A;  3T53 B;  3D31 A;  1BCP B;  2B8F A;  1RTO A;  3Q24 A;  4HSV A;  2PW5 A;  1HFN A;  5CYU A;  1FNV A;  2XIW A;  1RF2 D;  5E4W C;  2NB0 A;  4G7O C;  5LL6 S;  1NAP A;  1GXD C;  4A3M B;  4CKC A;  1EU3 A;  4HTH A;  4DNT B;  3GO5 A;  4G57 A;  1OXS C;  2JXM B;  1WD0 A;  1EIH A;  3V05 A;  2F0L A;  3H3V C;  1EQV A;  4DXF A;  5BN3 A;  4ZRZ A;  5G3L D;  5KYI A;  5KYL A;  3SVM A;  3NQI A;  3PO3 B;  4K2L A;  4KY5 A;  2E2I B;  1PTO C;  4KI0 A;  5C0X I;  2WKC A;  5DNF A;  2EXZ A;  1J8I A;  3OPO A;  3PMF A;  1A2U A;  1A3V A;  5C4J B;  1KNE A;  5CBA E;  1HRJ A;  1A6X A;  1MSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...