4KV8B

Crystal structure of hiv rt in complex with bilr0355bs
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
407
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N- versus O-alkylation: Utilizing NMR methods to establish reliable primary structure determinations for drug discovery.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV Reverse transcriptase P66
total genus 113
structure length 407
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kv8B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B04
2OPRB 3PHEA 4IH5A 1KLMB 1TL3A 4J9PA 1RYRA 4ZPAA 3RAXA 4DL6A 3UR0A 2I5JA 4DL2A 3LAKA 1ZTTA 1C1CA 1S9GB 4B3OA 4LSLA 2BANA 4I2PA 3BGRA 3QZ8A 4I2QA 1HQEA 4I7FA 4EYHB 5I3UB 3NMAA 2UVVA 3LP2A 1FK9B 3OSPA 4RW6B 5KFLA 5HBMA 3OHAA 1HMVB 3BSCA 5JUMA 2W7OA 4IR1A 4ED1A 2IC3B 4ED0A 4TLRA 4WFYA 2IA6A 2JEFA 2ASLA 4WXWA 2D3UA 4GC7A 2ATLA 1N48A 3OL6A 2W9BA 3MR2A 5KFWA 4X2BA 1EP4A 2UVRA 4H4OA 1JIHA 3QYYA 5FDLA 1RT7A 1RTDA 1N6QB 5KT5A 5HBMB 5F9LA 2JEIA 4MK8A 3DRRA 1TL3B 1QE1B 3MECA 3V81A 2BRKA 3GYNA 2JC1A 5KFFA 2XCAA 3FQLA 3FFIB 4ECTA 2YNIB 4RW7A 1JKHA 5KFOA 3FDSA 1C1CB 1S9GA 3KHLA 3BSAA 5KT2A 5F8GA 1D1UA 3H5XA 4EBCA 4ED7A 5D3GB 4O4GB 1JLFA 1S1UA 5HLFB 3ITHA 2YKNA 1RDRA 1LWEA 2FVPA 2VG6A 3LP1A 2JEGA 3M8PA 3CJ4A 4WFZA 5JXSA 2ZD1B 4ZVEA 1IKXA 2F8EX 4KFBB 1HYSB 4K4WA 2IAJA 4QWDA 2AU0A 1S49A 4Q44A 1JLGA 3BJYA 3DOKA 3KMSA 3OSNA 5CYMB 1TVRB 4O4GA 3DOLB 4H4MB 5C5JA 1JLQA 2HWIA 2OPSB 3DLGA 4IDKA 4O3QA 1T94A 3MFHA 4RNHA 1MMLA 1TP7A 1S1XA 4NLUA 4EO8A 3V6HA 2E9RX 3HVTA 3DRRB 3H40A 4K4UA 2RDIA 3KK3A 1N6QA 3D5MA 1JLAA 3DLKB 4QW8A 4PWDA 3DMJA 4ED8A 3KHHA 4RW4B 2RKIA 3LP0A 3CO9A 2HNZA 3MTKA 2XI3A 1RT4A 5DLGA 2YNGA 2HMIA 1S10A 4XPEA 4EBEA 3DOKB 3RB4A 2XI2A 3I5CA 3G6YA 1N4LA 2R8IA 3PJXA 4WXOA 2RDJA 3TVKA 1S1XB 1RT1B 1HQUA 2WB4A 3M9MB 5DQHA 4Q0BB 3G6VA 2UVWA 2XCPA 1TV6A 3IS9B 4PQUB 4ECUA 2VG6B 2WOMB 2VA3A 3Q8RB 1S1WA 3HVAA 2ILZA 4NLOA 5F8LA 4ZMMA 1RT6B 2WONA 1TL1B 5J1EB 1YVFA 3MEGB 4JUZA 5KT3A 4F50A 3QZ7A 4J9NA 3H5YA 5DGAA 4QWBA 2BANB 1LW0A 4NCGB 4FS1A 3EPGA 1RTIA 3T5KA 1IKVB 3KLHB 1QAIA 2OPRA 5EWFA 3M8PB 5DQGA 2BE2B 2E9ZA 3KLIB 3TAMB 2DPIA 4RNNA 2FJVA 2R8JA 4IH7A 1TKXA 5L1KA 1T3NA 4TY9A 4MK9A 4ID5B 2IM0A 4NLDA 3QO9A 3KLGB 4ZHRA 2CJQA 1RTHA 4KV8A 3IGNA 2ASJA 4IG3B 2C2RA 3I5BA 2J6SA 4IRDA 5CYQB 4Y2CA 4ED2A 4O44A 3PR4A 4IFYB 4KHMA 3KK2A 3MR6A 1SH2A 1VRUA 3GV8B 1R0AA 5KFZA 4YP3A 4M94A 4LSLB 1FK9A 4ZVFA 4ZP8A 3DI6A 5KG3A 3RBEA 2BQUA 1HNVB 3MEEB 4MK7A 4O3NA 4R8UA 4I2QB 1NHUA 3PZPA 4IG3A 4K50A 2IM2A 2GC8A 2BE2A 1KLMA 3KJVB 4KAIA 3PW4A 1HMVA 3GIJA 2I5JB 2FLLA 1REVB 2VG7B 3UQSA 1C0UB 2R2RA 3G86A 4FS2A 4ZPDA 2OPQA 4J9QA 3RBDA 3MEGA 2W9CA 3KLEB 2AX1A 3H2LA 5KG4A 1RT7B 3NBPA 1XR6A 1ZTWA 2BRLA 1S1TB 4H4MA 1D0EA 4NLQA 3E51A 4ICLA 3DRSB 5KFTA 1MU2B 2UVUA 4WZMA 4J9RA 4QPXA 4HYKA 1RT3A 2R8KA 3T5LA 4KKOA 3MEDA 4MFBA 4URGA 4IFVA 4QW9A 5J2PA 4DG1B 3PW2A 5F8NA 3CJ5A 2IM1A 4ZVHA 4G1QA 2YNGB 2HMIB 3RB6A 1BQMA 1VRUB 1LWCB 2ZE2B 2HNYA 3IRXB 4ECXA 4YR2A 1S0MA 4KB7A 3H98A 3N6MA 2YKNB 3NAIA 4ECVA 3D28A 2C28A 1S0NA 5J2QA 3I0RB 4RNFA 1HARA 1HQUB 4NLYA 3T5JA 3PW0A 2BQ3A 2OH2A 1IM4A 4KHRA 1C0UA 3MF5A 3RAQA 1DTTA 1UWBA 4RW9B 1K1QA 4KBIA 4EO6A 5KFEA 4O3PA 3KLVA 3DMJB 2RF2B 1LW2B 1JLEB 4J9LA 4Q8FA 3N6NA 4RW8B 3HVTB 4MKAA 1TVRA 2D3ZA 2XGPA 1K1SA 1OS5A 5K14A 4O44B 2AWZA 3KHRA 2JEJA 3KK3B 4ED6A 1TKZB 2FVQA 5KG7A 1BQNB 2YNFA 4ZP7A 1S1TA 3KLFB 1RT3B 1HYSA 3KLHA 4NYZA 4F4YA 3QGIA 5KFIA 1MU2A 4K4SA 5EUHA 1RA7A 3T1AA 2R2UA 1S97A 4I2PB 3H59A 4GC6A 2DPJA 4NLRA 1RA6A 1C0TB 2FJXA 4MFBB 1JLBA 4RW6A 1W25A 4Q43A 2HNDB 1GX5A 5D3GA 3TQ1A 2BQRA 2AQ4A 4I7FB 5C24B 2QE5A 3DRSA 4NLSA 2VG5A 1SUQA 1DTQA 4DL4A 2V9WA 5KFRA 2C22A 2AGQA 1RT2A 1DTTB 1N5YA 2EC0A 5HROA 3UDLA 5KFYA 5DG8A 3MR5A 1S6QA 4WFXA 1JKHB 1SV5B 4NLTA 5KT4A 4F4ZA 3PJWA 1RTHB 3MR3A 2I1RA 2ASDA 4NLGA 1JLBB 3OLAA 4F4XA 3HVWA 2W8KA 1VRTB 3CVKA 4ZP9A 3DI6B 4ECZA 3V6DB 3MECB 3FRZA 5KFAA 2AGPA 2B6AB 3KK1A 4FBTA 4KKOB 4QWAA 3OL9A 1IKWB 1RT5B 4YQWA 2FVRA 3RB0A 2J6UA 4IQXA 4KFBA 3DRPB 4O3OA 5KFBA 4ID5A 3T5HA 2FLPA 4G3IA 4J9SA 4IR9A 2FJWA 3RB3A 4WZQA 2HNZB 5DG7A 2J6TA 5I42A 2R8GA 3QIPA 4LSNA 1FKOB 1S6PB 1J5OB 3KLEA 1S1UB 2W9AA 2C2EA 4IFYA 2VG5B 3V6DA 1IKXB 1RAJA 1FKPA 1RT2B 3ISND 3KLIA 1N5YB 4TQRA 2CKWA 1REVA 2VG7A 2WHOA 4WYLA 1DTQB 2GIQA 4PWDB 5HP1A 3I0SB 1JLGB 1QAJA 1SV5A 4R0EA 3PVXA 1C2PA 4K4XA 2IAJB 1DLOA 1S1VB 1S6QB 4NLXA 3PR5B 1RT6A 2XC9A 5F9NA 3V6KA 4Q8EA 4H54A 3MFIA 3DOLA 1T05B 2BR0A 1BQNA 3CJ2A 2OPPB 3C6TB 3BQ2A 4ED3A 3KOAA 5KG2A 4IKAA 3I5AA 5L1IA 4EYIB 1RT5A 5KFHA 1LWFA 4XPCA 3CWJA 4URSA 3SFUA 1S1WB 5KFPA 3M9NB 4WE1A 3OLBA 4RZRA 2YNHB 3BSOA 1JX4A 5F8IA 3JSMA 1T03B 1N56A 1NNDA 2FVCA 5L1LA 3IG1A 3QO9B 3KLGA 4IH6A 1JLEA 4RU9A 3BSNA 1TV6B 3BGRB 3IS9A 4PQUA 3QLHA 4ZPBA 4RUCA 1RTDB 1RT1A 3CJ0A 3GIKA 5HROB 3M8QA 2YKMA 2IMWP 3EPIA 2R2SA 2O5DA 3FFIA 4M95A 2WCXA 3Q8PB 2RF2A 2C2DA 1C1BA 1IKYB 2IBKA 2IM3A 3JYTB 4IFVB 5L9XA 2HNYB 3IRXA 1TKXB 4RW9A 4YR3A 2WTFA 3BQ0A 3NL0A 4TY8B 3KNAA 1S4FA 1T03A 4Y3CA 5J2NA 1LWCA 3I0RA 2B43A 4DL5A 2WK4A 3DDKA 2UUWA 5F8JA 1IKVA 3UPFA 3T19A 4YR0A 4TYAA 2ZD1A 2WOMA 5KG1A 1QUVA 3BREA 5KFQA 3SI8A 5J2MA 5KFUA 1TKTB 4LQ3A 4TYBA 4O4RA 1LWFB 3HKWA 1S9EB 1JLFB 5HLFA 3CIZA 3QIDA 1LWEB 5J2NB 2OPPA 2YNFB 3C6TA 5KFNA 3KHGA 5L1JA 3IGVA 4NLPA 4RNMA 3OL7A 3FSIA 4J9MA 4K4YA 2E9TA 2YKMB 3CDEA 4MIBA 1JLCB 5KFCA 1JLAB 3DLKA 5KFJA 2V4RA 1HNIA 2AGOA 5DQIA 2ZKUA 2GIRA 5KFDA 3EZUA 4TY8A 1RTJB 3E01B 4PUOB 1EP4B 1EETB 4OL8A 2ALZA 4MH8A 1R0AB 1JLQB 3GQCA 3JYTA 3H5SA 2W8LA 4DEZA 3KJVA 1HPZA 3CDWA 1J5OA 3Q8QB 2ILYA 3KK1B 4IG0A 3M8QB 2XWYA 1KHWA 4WE1B 4LQ9A 2B6AA 2YNHA 4J9OA 4K4TA 4B3OB 4DG1A 4Y2AA 3NBPB 3M9OB 1WNEA 1XR5A 2R8HA 3GIMA 1KHVA 4IRKA 1S48A 5DGBA 4YMEA 1RTIB 2D7SA 4ECSA 1T05A 3PW7A 2JLEA 4IRCA 4KE5A 3LP2B 3DM2B 1S0OA 1JXLA 3Q8SB 1XR7A 3I0SA 1C1BB 5F8MA 1QE1A 3V81B 4U6PA 4RNOA 1TL1A 2B5JA 1JLCA 5J1EA 4EEYA 1FKOA 3QGHA 4HKQA 3ICLA 2OPSA 3DLGB 3PW5A 4JV1A 1TQLA 1LW0B 4NCGA 3GV5B 4RUAA 3DLEB 1RYSA 3SFGA 1S6PA 4R5PA 4ZVGA 3GIIA 4EBDA 1IKWA 3LALA 2IJFA 2UUTA 2W7PA 4ECRA 5FDLB 4KO0B 5KG6A 4TQSA 1CSJA 1GX6A 5EWEA 1TKTA 4NRTA 2WRMA 2HAIA 4K4VA 2VA2A 2WONB 4URQU 3QIPB 4LSNB 2JC0A 3V4IB 5I3UA 4ECYA 3ITHB 3LANA 5C25A 5KFVA 1LW2A 3C6UB 1TKZA 4K4ZA 4NLWA 1U09A 4ZHRB 2AX0A 1VRTA 4QWCA 4IG0B 5DLFA 1Z4UA 4JV2A 3DYAB 3NKYA 3GV7B 3BR9A 3TAMA 3QGGA 1NHVA 1EETA 2RKIB 3LP0B 3N6LA 5KT6A 5CYMA 2QV6A 1C0TA 3KMQA 4IDKB 3QLHB 2HWHA 5DG9A 5EWGA 3C6UA 2FLNA 2HNDA 3H5UA 5KFSA 3H4DA 4QWEA 5C24A 3DM2A 4R5PB 3KLFA 4JV0A 3LAMA 2V0NA 4F4WA 3VQSA 2IJNA 3DRPA 4KO0A 4ZP6A 1S9EA 1SH3A 2W9CB 3NGDA 4WYWA 5KG0A 4O3RA 2R2TA 3DLEA 3HHKA 4DL7A 4ECWA 4Q0BA 4Q45A 5KFXA 4Y34A 5C42B 4H4OB 3OL8A 4TN2A 3OHBA 2XGQA 4NLVA 2D41A 1HNIB 1RT4B 1IKYA 1UWBB 1SH0A 3IN5A 5HP1B 2OPQB 4RW4A 5I42B 3DYAA 5KFMA 4XO0A 4TXSA 4O3SA 1HNVA 3MEEA 4KSEB 5C25B 4R8UB 2W9BB 4ECQA 1ZETA 5KFKA 3CDUA 3JSMB 4IOBA 4U7CA 3BQ1A 1BQMB 2ZE2A 4MIAA 3IG1B 4NRUA 4J9KA 3FQKA 5KFGA 5F8HA 5C42A 4FBUA 1HPZB 4RW7B 5CYQA 2FVSA 5J2MB 5J2QB 3LP1B 5EDWA 3MEDB 3H4BA 2IC3A 3V6JA 5T14A 1RTJA 3E01A 4PUOA 5J2PB 3V4IA 3KK2B 2V4QA 4G1QB 2B5JB 1DLOB 1S1VA 3ISNC 3NAHA 3GILA 5KT7A 3CJ3A 1HQEB 4MKBA 4ZPCA 5KG5A 5K14B 1S9FA 4ICLB 3G6XA 1I6JA 4DL3A 4NZ0A 4RW8A 4KV8B 1SUQB 1FKPB 2YNIA
chains in the Genus database with same CATH superfamily
2HK3A 3PHEA 3R97A 4NXNJ 4X4UA 4TVAB 4ZPAA 4OX9J 2HWTA 1NB7A 2POKA 3UR0A 2DGVA 3I31A 4X65J 1ZTTA 2HQGA 3KJQB 4B3OA 2B7CB 2WBMA 3QZ8A 4DV1J 1KR4A 1JNRB 2L08A 4I7FA 2DB1A 4YB5A 4BDPA 3NMAA 2UVVA 1KTQA 1FK9B 2C3YA 1CQMA 4RW6B 4HT5A 3OHAA 1XMBA 2Z30B 3PYEA 4LFCF 1G6BA 2V4JA 3BSCA 1UFKA 2W7OA 4FNIA 4LREA 2IC3B 2FDNA 3OFHA 4DPWA 5E41A 4ED1A 3T1HF 4TLRA 3KDNA 3K58A 4FNHA 1SQFA 3BSNA 2JEFA 4CCHA 4L74A 4WXWA 1GQEA 1P1LA 1EARA 4F3MA 4JP8A 3VAJA 2XYPB 3A8EA 4PG8A 2H5EA 1EP4A 4DCJB 2QZ8A 1JIHA 2AZ1A 3SV4A 1RTDA 1N6QB 3EICA 4ETZA 3DRRA 1TL3B 3V81A 1HI8A 1NRKA 2EG2A 2FLOA 2JC1A 2KJWA 2Z58B 3FQLA 3GYNA 2H5IB 4DL0C 4E98A 4CH7A 5KFFA 5HL7Q 4DR3J 1OY6A 3FDSA 5EGYA 2U2FA 1VLYA 2XHWA 3QWUA 1D1UA 2BW7A 3OUYA 4O4GB 1WC4A 4KYZA 3ITHA 1PBUA 1RAEB 1S79A 1YRXA 2OO4A 3JQJA 2MKSA 1X5OA 1VQKS 4RLEA 2LEAA 4RL1A 3SEOA 5CD4A 1MROB 2ZD1B 4ZVEA 1IKXA 2DKOB 4PXEA 2V8DA 4KFBB 3TJAA 4CIOA 1GH8A 2HHHF 1XK8A 2BEFA 2CZ9A 1UVKA 5ETNA 3NRBA 2CVIA 2AF6A 4YHHJ 3DOKA 2HAFA 3AD7C 3OSNA 3TUPA 3MI7X 2BM0A 3FGVA 5C5JA 4H4MB 2E5GA 1FT8A 4ZN3A 3DLGA 1NHKL 4FS1A 1F9FA 2YX7A 3J7A1 1FJGF 1QM9A 3CJQA 1O5JA 4DV0J 3TZZA 4A8KA 3DLKB 4QW8A 2IA0A 2KTQA 1RWUA 3KWMA 4R0JA 3CO9A 2XI3A 4EFAC 2HMIA 4MTPA 4F0MA 3HSDA 4XPEA 1RE1B 2HBQB 1T3OA 1A6LA 3FEYB 4DV2J 5HK4A 2XI2A 3MMJA 1ZM9A 3RW6A 3R7BB 1J27A 3TVKA 4EGLA 1RT1B 1VJWA 2C3UA 2QIFA 5DQHA 4UZBA 3PRDA 2L41A 4RUHA 3CDBA 3TARA 1U1KA 1TV6A 4PQUB 1FCAA 2UVWA 4OZ1A 1UPMB 1U6BA 1P1TA 1FE0A 2VG6B 2BV3A 3VZIA 3SQGA 2YTCA 2ILZA 4ZMMA 1RT6B 4OX6A 2WONA 1CJUB 2QN6B 3NWGA 3ZNJ1 4K5RA 3MEGB 2Y9HA 1E6YA 3R6GB 2LP4A 2VPZB 5THWA 1T9XA 3TVZA 5H9FJ 2CPZA 4UUXA 1XMOF 1H38A 1P9YA 2AYMA 4CI0B 4C8ZA 3VHQA 3M8PB 2P6SA 4HACB 3IMQJ 2MKKA 5DDQC 1RWOB 3IBWA 5A76A 1NKBA 5ETKA 1RWKB 2ABYA 1H73A 3K8VA 2FJVA 3SDEB 1CPZA 4IH7A 5HN0A 1TKXA 2EKNA 4HLBA 1GTEA 4OYZA 4MK9A 1WG4A 4NI2A 2MZTA 1OO0B 2D9PA 4ZHRA 4HH1A 4KV8A 5I3PA 5CA5A 4CO0A 3I5BA 4IRDA 4Y2CA 1J2VA 1FTRA 3WC2A 4O44A 3M8ZA 2YWEA 5DZ6A 2ZH5A 1S12A 3SSQA 2X1BA 2RU3A 3LF0A 1G3OA 3K57A 3KK2A 1NEEA 2MSTA 2AJFE 5BYQA 1VQNS 3WBZA 1VRUA 1PJ7A 1SQEA 3PM9A 2H51B 4J37A 3GV8B 4QU7A 1M5OC 1R0AA 2RQKA 1TTHB 2OI2A 4LSLB 3OTOF 4RR5A 5GADI 2XLJA 3DI6A 3EM1A 1ZM4A 1HNVB 2BJ7A 2QMXA 4R8UA 2B9WA 5GMKa 2MKIA 2IM2A 4DU8A 2Q1LA 1KLMA 4DJBA 3H20A 1HMVA 4X4VA 1TL4A 1ZPWX 2ROGA 2XO7A 1C0UB 4WKRA 4ZPDA 4M5KA 4J9QA 4QIEA 4LF7J 1RAOA 4DX5A 2F4VF 2N3OA 3CCRS 3KLEB 1KTVA 1I94J 4P10A 2X51A 3JTPA 1RT7B 4RBUA 4B08A 4N8NA 2UUAF 3QJPA 4H4MA 1NSKL 2JWNA 2OFGX 1N36F 4X4NA 3DRSB 5KFTA 3HHNB 1JJHA 4CT8A 2KXHA 1CJVB 4OZ0A 4PXBA 4CH0S 3MMBB 1Y00A 3D4JA 3MEKA 3M7VA 3POTA 1YJTA 4OLPA 3A8KA 3C19A 5F8NA 3K7RA 5A0YB 2AYEA 2X7IA 2BACA 4ZVHA 1H0HB 2HBRB 4G1QA 4MT1A 2HMIB 3BM7A 3ZC4A 1BQMA 1VRUB 1LWCB 3DGPA 3IRXB 5IXUA 4ECXA 1UVMA 3S01A 4CM2A 1YWXA 1D9DA 3H98A 2RQMA 2HGLA 3D28A 2MJUA 2RMLA 2DEIA 4PEOA 2H4WB 3I0RB 2ZKTA 2BJEA 2IVYA 1BHNA 5HJXA 4RNFA 5DM6Q 2BQ3A 3O3LA 3DLJA 2MQ8A 3DOMB 1F9HA 1K1QA 2HW3A 3EVMA 2RF2B 2MZQA 1RAHB 5F0WA 3DFEA 3UO0A 3VQTA 5F3TA 3L7UA 3JAMU 2G1DA 2VUGA 3HVTB 3HFKA 1TVRA 4MKAA 3B4DA 4JYAJ 2DISA 1FXLA 4O44B 3EE3A 4DDFA 3W9HA 2GV1A 2HIQA 1BQNB 1S0VA 2YNFA 1RWNB 3QAUA 1MNEA 4I6YA 4NE9C 2EKYA 4K0KJ 5MAOA 1RBOB 3D6HB 1AXQA 1RXOB 1VISA 2J0WA 3TX8A 4C3MA 4Z37A 3PYFA 3UN5A 1RUSA 2R7TA 4NLRA 1N54B 1C0TB 2FJXA 1HWJA 2LXIA 4C8LA 4Q43A 4RW6A 1UA1A 4PXCA 2HNDB 1KFDA 3FBEA 4G1PA 5LSLA 5IC6B 4X4RA 4CNYA 1PBAA 3ZZUA 1EKRA 2DGQA 4V19X 4JYAF 1I51B 1QTNB 1SUQA 1P9QC 1N34F 1LV5A 2E1PA 3CJSA 2LA6A 4P7VA 2EC0A 1IUJA 2DY1A 1MN7A 1YBUA 2FGOA 4WFXA 5KFYA 5LMNF 4DR7F 1U1NA 4WFAQ 1HD1A 3N79A 4M1KA 5KT4A 3HP6A 4F4ZA 2XS7A 2I1RA 2CPJA 3HHEA 1T9TA 5ETRA 4F4XA 2AEFA 2MSSA 1VQ4S 4LT6A 2UXDJ 1FRJA 3V6DB 3SIPB 2AMCB 1EAYC 1VQPS 1LFWA 2V4JB 2RJZA 3BR8A 4KGKA 4ZVUB 1FE4A 2Q43A 3N5BA 3POTB 2IVFB 4ZCMA 1FDAA 2ZH1A 1RT5B 4F25A 2FVRA 2N3LA 3D0GE 2QGFB 4P7TA 4O3OA 3RB0A 2V34A 1Q1KA 4IQXA 2EFQA 2DT9A 2QC3A 2EWHA 4G3IA 3NGSA 2J9DA 2HNZB 2QLBB 4ZVSB 5DG7A 4QIWD 2R8GA 4DV4J 2OELA 4N56A 2OTJS 1S6PB 5RUBA 3KLEA 1U2CA 3GG0A 3PKMA 1RADB 2VG5B 2YH1A 1U1QA 4KGXB 3T41A 1IKXB 1JJ2R 2J0XA 2VDHA 4ETXA 1U45A 2UXDF 4LFAF 4H4KC 1TAUA 3KLIA 1MSWD 3M4XA 3D0IE 1V3RA 1WOPA 1V3ZA 2GIQA 5HP1A 1Y5LB 1LWXA 3I0SB 1QAJA 3B8HA 4GRSA 1SV5A 4LVNP 4ER8A 1HNZF 1Q81T 3MOJB 2FHOB 1LQ9A 2VBXA 4F0HA 2XC9A 4H54A 2AJ4A 1YLXA 4P2MA 4N8OA 4DUYJ 2K1RB 2OPPB 3O5TB 3E2EA 2C3MA 3KXDA 3R5JB 3I5AA 4OYBA 1VQOS 4B9LA 3G87A 5L1IA 4JI0J 2IMOA 4UOGA 2OMOA 4P9SA 2NS1B 4C0HA 3W9IA 5KFPA 1S1WB 3DU6A 2FYXA 1R7IA 2NPIA 2RB7A 5DS7A 4B3MJ 4U8YA 3K2YA 4OI2A 3TP2A 3CCMS 3NNAA 1DQ8A 2C42A 2F4FA 1R6VA 1TKDA 2FVCA 3TA0A 3X3UA 2HS4A 3KLGA 2Q6BA 2Z8QA 3W9JA 4OI3A 5K8PA 1TV6B 3BGRB 4PQUA 1ROFA 3JQKA 4ZPBA 3U1NA 3W5YA 1NJWA 5IOLA 4IOCQ 1F2GA 3R5DA 2B51A 5LM7E 4DF4A 3W5ZA 3EPIA 1HNWF 2HHHJ 3KHRA 1CG2A 3Q8PB 2ZBCA 2C2DA 1C1BA 2PD1A 3HI9A 2IBKA 4YR3A 3PZPA 2J7WA 4MMOA 5AT1B 4RW9A 3BO4A 2C1EB 2P5VA 4B3MF 3NL0A 1S4FA 1D09B 1LWCA 1D8ZA 1ELOA 2O66A 3DGPB 4YY3J 3O1LA 3NGTA 2LXUA 4DL5A 1FKAF 3FRYA 2UUWA 3NOCA 3PRVA 2H1YA 1CULB 5HVHA 4JI8F 3UPFA 3T19A 4TYAA 5KG1A 2JLGA 5DDOC 3SI8A 1HNWJ 3KG1A 3A3PB 4OHVA 3G8TA 3MAAB 1GXTA 2VQEJ 4ZCIA 1AB8A 3BGFA 1S9EB 2CPEA 1JLFB 3CIZA 3OBIA 2Y1LB 2KVQE 3QIDA 4C0BA 4ITSA 2DPJA 2DGWA 3KHGA 5KFNA 1U8SA 5L1JA 4K4YA 2QL7B 4QBUA 3FSIA 1V6HA 2A2DA 2CZ4A 2LVWA 3CE8A 2MY7A 1DARA 4DQRA 3KUEA 3LQVA 5KFCA 1Q7YT 2K8GA 5L38A 2ZBIA 3T1HJ 3T9ZA 2BJ8A 1R8PA 2VV5A 4HHHA 4R25A 3EZUA 2R9LA 2E5LF 3E01B 4PUOB 2G0IA 2H3EB 4USHA 3NXZA 1WTBA 1Q16B 1B64A 2KXFA 3KJVA 5LSOA 4F02A 1HPZA 1JXVA 5GAHI 1J5OA 3Q8QB 3MAQA 3M8QB 2LU1A 4GO5X 1KHWA 4FKYA 2EEYA 1Q4RA 3GFHA 1CJVA 4OI4A 4QIVA 4EUVA 4AQYF 4LFBF 3OFGA 4DV3J 1VJQA 1RWXB 2FC8A 4K4TA 4DG1A 1YZ7A 2V8VA 1AFJA 3IM8A 1O8BA 1RU2A 4UOFA 4A47A 4OZ5A 2FY8A 1Q8KA 4RBVA 1TMMA 2DGXA 1VC6A 2M8DB 3CUNA 1S48A 4QJVA 4YMEA 1M1HA 4ECSA 2VKRA 3GYXB 5HATA 3PW7A 4JI4F 2QEXS 3DM2B 2RILA 2RQ4A 3VAHA 5E2QA 1XR7A 3I0SA 1C1BB 3FBCA 1U1RA 3WQPA 3V81B 2UUCF 4XTTA 1VYAA 4U6PA 1TL1A 2ZHOA 4EEYA 4I56A 3QGHA 4HKQA 1HWIA 5EX3A 1O0PA 2DHHA 2XMAA 2OPSA 2KO1A 1TQLA 1FFSB 2WB1D 3B82A 1U49A 4UY85 3J80U 2D3OR 2HIYA 5IQQA 4P2SA 1S6PA 1BWVA 3MUTP 3GIIA 2NZ4A 4EBDA 1IKWA 1DURA 3AA8A 1X4EA 4JB8B 4P52A 1SKUB 5A2QU 2HQ3A 4EU0A 2W7PA 3SCJE 1NJYA 5F8JA 5GAGU 2P6TA 2ZJQQ 3IAM9 2UUCJ 2C2NA 4JI7J 4ZDNA 1FRIA 4MYTA 2Q79A 3NY0A 4DR1J 3V4IB 4CLLA 5I3UA 2R7WA 3KUHA 5KFVA 3M2UB 4X4OA 1LW2A 1TKZA 1PO6A 4K4ZA 2ZOFA 3RBXA 1SJQA 1NPRA 1OIAA 1U09A 2CYYA 2JL9A 4C48A 5ADZA 4QWCA 4IG0B 2M7SA 1SL1A 4N77A 2R42A 5T41A 4B17A 2BJ1A 3DYAB 1F6TA 1V5IB 3B6BA 4Y00A 3U7JA 4AD6A 4ZVRB 3LH2S 3TEHB 1F9EB 2LA4A 1DHMA 5DO2A 5JMNA 2AHOB 4GVBA 4PZVA 4Z2XA 2QV6A 3QLHB 5DG9A 4DR5J 1SKWA 3IXQA 5KFSA 2KT5A 3EXYA 2M4MA 3EVWA 3FMBA 3N5FA 2AJQA 4ELVA 2OLWA 2FB0A 3J80Y 4UZCA 1U1MA 1NK5A 5LSRA 1OMSA 2U1AA 4LF4J 4ZP6A 1VBKA 1RWVB 3H2UB 3SSSA 2HVIA 4CWBA 5KG0A 1IBLF 3M30A 3GU0A 1XQIA 3DLEA 3BYPA 3CCTA 4X64F 1F5BA 3T6BA 4USVA 2FHJA 4Q0BA 2C2MB 2CJYB 1RU1A 3HFVA 1OY8A 3NGRA 4USWA 4KRWA 1NMEB 1XN9A 1AA1B 1VIOA 3K5PA 1IKYA 1FXDA 1UWBB 1SH0A 2M0GB 5HP1B 3AJ2A 3TZXA 3R1LA 4RW4A 1TMJA 2VODA 4KR0B 3C3LA 2KXNB 3HO1A 4LMZA 2Z56B 3FK4A 1FD2A 5ETVA 1HNVA 4R8UB 5BR8F 2MQOA 4P2FA 1U47A 1ZETA 1IBMF 3JSMB 3LPYA 3MWBA 4M5DA 1OWXA 8AT1B 5HQMA 2ZE2A 1UKUA 2P8IA 1HWLA 3BH6B 5B09A 3HM9A 5KFGA 3BQ1A 1EQ0A 2Y1JA 2DR9A 4OYWA 1T7PA 2HFVA 2VA2A 4FBUA 3ELHA 2EFVA 1WDDA 1T8EA 5J2QB 4OV6A 3VAMA 2IC3A 5B0DA 5T14A 1FHTA 2UU9J 3V4IA 1S4EA 2ACYA 4Y6IA 3THVA 4FF4A 1AZSA 2DEJA 1YJNS 2K1RA 3GILA 3M6VA 3CJ3A 4F04B 2DH7A 4DL3A 2CA9A 1FKPB 3OT9A 1PILA 3CD0A 1KKHA 2C2RA 5BXIA 3W7BA 3IBFB 3D9BA 2HQDA 3NCQA 3JSRA 1NSAA 1WF2A 2B4OA 1D9AA 4IH5A 5D4OA 1TL3A 5G0RA 5HANA 1RLDA 4EK2A 3GCWP 5DJBA 3RAXA 2M88A 3PYDA 4DL2A 2V8HA 3P3DA 2MHNA 1ZAWA 1C1CA 1S9GB 1UFLA 2B3TB 1N0UA 2DNKA 3GONA 5JJBA 2VOPA 4I2PA 5H9FK 2PMHA 1KQKA 4YHHF 3NEKA 5LOQA 1N5SA 4B3RF 2F65A 3N9UC 3LP2A 3OSPA 2HG4A 5HBMA 2VD3A 3O44A 2GGPA 1BY9A 3AJ1A 3TAPA 1S72S 1N32J 3MPVA 5IV4A 3QWPA 1AROP 2CPYA 4WFYA 3G71S 1UEUA 3I9V9 4TLQA 4JI3J 1WWHA 1R3NA 1T02A 3W8PA 1TZ0A 2W9BA 1EQMA 1R8BA 4CZCA 4AYBD 1DQ9A 1SXLA 2IRUA 4YB1P 5FDLA 1RT7A 4RWXA 4JV5F 1GK8A 4UW2A 4A8FA 5F9LA 2HHSA 3CCZA 4NWBA 2KG0A 3CCJS 3OJSA 3MECA 1X4CA 3D3BJ 3NS6A 2COLA 2F63A 2XY5A 3ZZ0A 2WVDA 1VQYA 2W2PP 3ILJA 1FNOA 2DCUB 4IOAQ 2CJXB 2W2QP 3KHLA 5KT2A 5AJ3F 5JVHQ 3QSIA 3MM6A 4EBCA 4ZVQB 3D7SB 3CGIA 3GLJA 5A6WA 2CQ3A 2O01C 3MDFA 4QZVB 3T6JA 1RDRA 4HTJA 5FJ4A 1LWEA 2RHSB 3AOBA 5CABA 4XIUA 4ZIVA 2E5JA 1M5VC 2VHGA 1FX2A 2HZCA 5JXSA 7FD1A 1U1LA 2JEGA 2F8EX 2B9EA 3A1YG 2J0SD 4KHPJ 4O23A 4USIA 4QYZK 3TAQA 3NGUA 5D15A 2HK2A 2QO3A 4KIAA 3HSGA 4OMFG 3BGUA 3MM6B 5D0EA 4DV5J 4DR3F 4GKJF 3EVOA 3TANA 3C15A 5K9FA 3GIKA 1JLQA 3MFHA 1T94A 3PACA 4K2XA 4EO8A 1S1XA 1QSLA 2CZVC 2E9RX 3HVTA 4LR8A 5HAOA 3DRRB 2E5HA 1UJ5A 4UOCA 1XIQA 3RR7A 2DGUA 4C6AA 1TK5A 1Y5IB 4ED8A 4PWDA 5B0BA 3SSRA 3NGKA 2RKIA 1CJTB 1RAIB 1TK8A 2L9DA 1LFPA 1RT4A 1JB0C 3CD5A 1S10A 3R5CA 1GTHA 4HI2A 5JVGQ 4ZVOB 1RISA 1BWEA 4NMLA 4QR2A 4NYPA 4RX6A 5L39A 4ILRA 4C8NA 5IT9Y 1WF1A 2WAQD 3EYZA 1JK9B 3C66A 3PJXA 2RDJA 2G0JA 5I3QA 3OVAA 3QJLA 1KBRA 3G6VA 2BZ2A 3AFGA 3IS9B 1XEZA 5A8RB 3PG9A 4B9UA 2QA2A 3HVAA 3R2DJ 3VGSA 1HWUA 3EWGA 1VBXA 2VPXB 2NUHA 1VBZA 2VZ9A 4USUA 2PFFB 5J1EB 2BKOA 1YVFA 2XTJP 4AXJA 5E5NA 4RPFA 4JBCA 4U67Q 1OPZA 2DO0A 2ZJPQ 2MLYA 1MLAA 4QWBA 5DGAA 2JJ4D 4NCGB 1UAWA 1X5SA 2GMLA 2H4YB 3H8YA 3G6ES 2M8HA 5J1NA 2EC2A 2VBYA 3RRKA 3EPGA 1QAIA 2RVJA 3FBFA 2BE2B 1FVSA 3F56A 3D3CJ 3MM7B 4IYQA 4L76A 5G4DA 3SQOP 4DBQA 1IBCB 2VONA 3DU5A 1VBYA 1AFIA 3E3XA 3QBCA 4F4AA 3TAMB 4M5NA 4Y2IA 4RNNA 3MTJA 1DBDA 2IRXA 5L1KA 1ACMB 1X0FA 2XS2A 4NYOA 2IM0A 5E3QA 3QO9A 3ENAA 3SCKE 3NP5A 5CQGA 2GHVC 4B3SF 3V5RA 3IGNA 2ASJA 2UUBJ 4IG3B 3IRWP 4ED2A 3G2XA 2W01A 1RHJB 3DNCA 3PR4A 2VF3A 2GIFA 3TUJC 2GFFA 1UW9A 2ZZNA 2QSFA 5HQLA 1MW7A 1WSRA 3GG1A 3MR6A 1OPIA 2PEBA 4DR5F 1PYSB 4Z7YA 1Q53A 2XNRA 5C2CA 3FSYA 2H48B 1FK9A 3RBEA 2BQUA 3K5OA 1CC8A 4IRKA 3MEEB 3HKZD 4MK7A 5CZVA 4O3NA 2HZVA 1R8CA 4IG3A 1CQNA 6FDRA 3MPWA 3RRGA 4B3SJ 3HHDA 1AUDA 4KAIA 2FTRA 4J5OA 3PW4A 2ZH6A 2GGPB 2LDYA 1F2HA 3TVYA 3GIJA 1TELA 2LLZA 1WSVA 1REVB 2VG7B 2O67A 2R2RA 2W7AA 3G86A 4YEAA 3SDEA 3AQPA 3UQSA 2OPQA 2C2ZB 2CDRB 2F8HA 5D77A 2FHJD 3H7HB 2CJ9A 2CNLB 2G2YA 3CC4S 2CUYA 4ZPVR 5E3RA 4EZ6A 2Y0SD 3CC2S 1XR6A 3OXFA 7FDRA 2JZ5A 3P96A 1PG5B 2BVZA 3CXCR 1S1TB 1D0EA 1WEZA 1BQXA 1DZ5A 1WD6A 1SQGA 3MD3A 4ICLA 4FN5A 4WP3A 1IBLJ 1MU2B 4X62F 3GSDA 2E1AA 1LOUA 3C14A 1N34J 1F5CA 1RT3A 2HQFA 4L3KA 2M9KA 2RS8A 2HZAA 3AOAA 1YHQS 4MFBA 1HBMA 4URGA 4QW9A 5J2PA 4FPIA 4WP8A 3RB6A 3GJQB 3HHLA 3HT0A 2GJFA 3LA0A 3M2VB 1S0MA 1FTCA 4KB7A 3UW1A 2E1CA 4F36A 3N6MA 2YKNB 3MCSA 3Q0AA 4ECVA 4KTQA 3J7AN 1F3FA 1WG5A 5J2QA 1YDLA 2CWXA 4DSEA 2DK2A 4ZCKA 1HARA 1HQUB 4JI2F 3T5JA 3PW0A 3DRYA 2KM8C 1IM4A 3RAQA 1C0UA 4K59A 1SJ4P 2J8SA 2XG8A 1S76D 4RW9B 1AYEA 2QL5B 1Q5VA 2VFTA 4KH1B 2F3JA 3EGVA 4DSKA 3KJFB 2B7BB 2HVHA 1LW2B 1VGYA 3N6NA 3AHPA 2B8QA 3FC9A 2XGPA 3C15B 2BM1A 2D3ZA 4A8SA 4OI0A 1OS5A 1K1SA 5K14A 1FRLA 3JSBA 4WFBQ 2MZ1A 3KK3B 1FDBA 1NDPA 2B0GA 2NXUA 2FVQA 1Y0HA 3P8BB 3W65A 3EX7B 2ZHAA 5K20B 4F4YA 3KLHA 1R0CB 3QGIA 4ZLJA 5KFIA 1MU2A 2GAGC 5EUHA 1RA7A 1A9NB 3T1AA 2R2UA 3F73A 1R27B 4I2PB 4WCEQ 1HA1A 1S97A 5F3ZA 3BKTA 4P71A 4EZ9A 2QTWA 3A4TA 1XERA 3D66A 1JLBA 4D3HA 2CPHA 1H7WA 4CO1A 1U24A 4I7FB 1FVQA 3DRSA 3HDSA 2VG5A 4NLSA 1DTQA 2BX6A 4CLZA 2D69A 5KFRA 2UUBF 4CO5A 1RT2A 1DTTB 3W5XA 2DR6A 4F3OA 4NXMJ 3ENWA 5DG8A 3K8WA 2W4DA 2KRRA 1ZOTA 2FC9A 2VASA 3WZ0A 4CTAB 4CYUA 1WI6A 4ZOSA 1SV5B 4NLTA 1IBKF 2R7UA 2DCLA 2MB0B 4K0KF 2ZUGA 2EG1A 3MR3A 3OD2A 2ASDA 4NLGA 2P9EA 1JLBB 3OLAA 3CCVS 1KOHA 2A0FB 4LR9A 1VRTB 4ZS6A 3KYLA 4Y65A 5GAGI 3FRZA 5B0EA 2ZOMA 5E3AA 3BPDA 4DV0F 1NK0A 4C9DA 3DKDA 3NCRA 4KKOB 4QWAA 1IKWB 3ZNUA 4YQWA 3LUYA 3MCNA 2J0QD 2PMWA 2J6UA 1XNRJ 2Y1RI 1KS2A 3Q83A 2NYHA 3MGJA 4NI2B 3T5HA 2FLPA 1L3UA 2B4VA 2DNGA 4IR9A 3RB3A 4ZVTB 5HMXA 2R4FA 4DR7J 3CEDA 2W2OP 4DF8A 2IJRA 3LWLA 3CPWR 1S1UB 4PG4A 2B4UA 1Q5YA 4HACA 3Q2TC 1NO8A 1QJHA 2BA9A 3B78A 3E8OA 3QFWA 1SC4B 4DOZA 1RAJA 3D6TB 1N5YB 2WVCA 2UZAA 2CKWA 3CJ8A 4WYLA 1Y9OA 3UN3A 4WTYA 1N33J 4PWDB 1KP6A 2MKJA 2JHEA 1U1OA 4DQPA 1B70B 5AXMA 4K4XA 2IAJB 1DLOA 1S1VB 3V6KA 3PR5B 1RT6A 4PCQA 1SIWB 2VPWB 3MHYA 2HS3A 3MFIA 2GO9A 2CG4A 3CJKB 1UTAA 2OGUA 1SPBP 3KOAA 3ONQA 2EVZA 2V68A 5L9NA 2OMLA 4ZIWA 2CIMA 2R7RA 4EYIB 1RT5A 1QSSA 2VL1A 2WBRA 5KFHA 4KGMA 3CWJA 3SFUA 3K0JA 4ED4A 1GEHA 2DNYA 3PY8A 2DGOA 4Q7AA 1P6TA 1ZM3A 2YNHB 2YKQA 3MM8A 4CLFA 3G8SA 2OIHA 3PYGA 2XZDB 4PR6A 3JSMA 2EFOA 2XMMA 1XBWA 4PKDB 5DZ7A 1KQGB 2IRYA 1K0VA 4IH6A 1JLEA 3BBBA 1IBMJ 1D8YA 4P75A 2V8PA 3SV3A 2EBEA 3BN4A 1RT1A 2HBYB 2UV8A 4QOTA 2NREA 5HROB 3M8QA 1FRHA 4FXVA 2VU5A 2R2SA 3A3OB 1SKRA 2OJ3A 2WCXA 4CTAA 4E0DA 4WJBA 2W4CA 3I55S 1SJ3P 1IKYB 4X66F 3JYTB 5GADU 3BQ0A 2HNYB 3GCXP 1WOOA 3KDOA 3OQ2A 1IR1A 4DSLA 5SZTA 1FO1A 1GMUA 3O8WA 1HKAA 4DFJA 1T03A 3RAMA 3GJTB 1RBAA 5AE1A 1UEVA 3I0RA 3VGUA 4A4JA 5BJRA 1LK5A 3MM7A 2B43A 3OFFA 3HD2A 1VS3A 3DDKA 1H7XA 3BGOP 3OFEA 4ATNA 4ENOA 2V63A 1BD6A 3W66A 1M90T 1VI7A 3VTIA 1Q79A 2EW9A 3H90A 4K5SA 1LEOA 4G1IA 2E5IA 1EIYB 4JI6J 1DRZA 5KTQA 4TYBA 4O4RA 4TU7A 2FJEB 1VQ6S 1EX8A 2Y1IA 2LCWA 2LQBA 2BUNA 4WIIA 2BDPA 3M1VB 1LWEB 4WF9Q 2E66A 3RW7A 3C6TA 4WZMA 4DN9A 3H2VE 2FHKA 3IGVA 4RNMA 1Q8BA 2GMJA 1FDDA 3M2RB 1NZAA 4PYAA 4J9MA 2AZ3A 1NJZA 3CDEA 3Q8RB 2NUUG 2AJ1A 1FEEA 1JLAB 1Q8LA 2W25A 3OR2B 5KFJA 3JXOA 3D1QA 3I87A 2V4RA 5G0RB 4F4KA 2ZKUA 2PA3A 1RTJB 4OL8A 3M6WA 4MH8A 2FQQB 2RHQB 2HVDA 3JYTA 4NPOA 1IWAA 3H5SA 1QAXA 3DHWC 3M2UA 3MUMP 4KGVB 3MXHP 5E3CA 2GW8A 2NXNA 3N01A 4NX9A 4RUBA 5AE3A 4LF9J 4QR0A 2IY5B 4HI1A 1UFWA 4YN3B 2A10A 3UCGA 4WE1B 1VQ5S 2DD8S 2RT3A 1J5EF 1BMQB 1UW4A 3A8JA 1OYEA 2XWXA 4I4BA 2GHWA 4L6V3 4B3OB 6AT1B 2L9WA 3JB9k 4Y2AA 3NBPB 5AJ3J 1RBLA 4DX6A 2ZBRA 2R8HA 3HSZA 1WHYA 4KPYA 2PC6A 3ZO7A 3IO1A 4H4KA 5DGBA 2F1FA 1T05A 3Q89A 2GJ2A 2C3OA 4KE5A 1K73T 3BO3A 2CFXA 3FCVA 5F8MA 2D74B 2FD2A 4CO4A 1QE1A 1RB0A 5J1EA 1L5UA 1JLCA 5FD1A 4EI2A 5DDRC 2QJ3A 3CSKA 2G4BA 3VGVA 3CW2C 2ZH9A 1DY3A 3KUGA 2MHEA 5B0CA 1LW0B 4WIQA 4OJHA 5M2UA 3DLEB 1TFYA 4R5PA 2VICA 3Q22A 3VVUA 4DSIA 1KVIA 1Q82T 1RJJA 4OX9F 1R8HA 2KZZA 3PFOA 3LALA 4DLEA 1U0HB 1QDUB 5FDLB 4KO0B 2GS8A 4TQSA 4LF8J 1GX6A 2H54B 1WORA 1O6XA 1T9WA 1PGZA 2FJDB 3Q8YA 4K4VA 2WONB 2VH7A 3DXBA 3L7OA 1NK9A 4FDFA 2Q3PA 2N82B 1FD8A 1SCJB 4ECYA 3HT3A 4BLGA 3LANA 2GMHA 4X84A 4LFCJ 1WC3A 1WG1A 3BF4A 2P9CA 4LUBA 3HHLC 4PABA 5BYRA 3R7NB 4CRJA 5B7WA 5DRKA 3U27A 2DR8A 2AX0A 4ES1A 1Z4UA 1YQHA 4YDDB 1YJ7A 2RRBA 4A8XA 1WF0A 3K5LA 5E7OB 1TK0A 2MQMA 4IO1A 2EXUA 2Z2ZA 4OIXA 3GV7B 1Q86T 1NHVA 2DNZA 1ZPVA 2Z2MA 3BKFA 3TYTA 2RKIB 3N6LA 3J7YI 4HEA9 3MM8B 5CYMA 3SZ2A 4JI6F 1C0TA 3W62A 3UVJA 4IDKB 3UDCA 3C6UA 4BWMA 3UI3A 5EX0A 2XEXA 4FP9A 2DO4A 2VB6A 5C24A 1KRPA 1URNA 3MCMA 5L8RC 1RQ0A 2ZM6F 4R5PB 4ELUA 3LAMA 1VRQC 2BABA 2I0XA 4ZK7M 5E0OA 1NZ8A 3BPSP 3QATA 2IJNA 2RH3A 3ADAC 2GVZB 1OQ3A 3NG8A 4M5GA 4DFPA 1Q0NA 2CQCA 3VAGA 2W9CB 5D78A 2ZH8A 3BBCA 4JI1J 1N36J 2HPUA 3PEJA 1VQ7S 4O3RA 1XMQF 4RWWA 4C2MA 4KGZB 2FGCA 4DL7A 3BB5A 2CQDA 3IR7B 3UDEA 4Y34A 5C42B 4OJ1A 3PO4A 2KT3A 2XS5A 1RT4B 1DJ0A 1M5HA 3GFYA 3S1TA 2WW4A 3IN5A 3QSYB 5HJYA 2JX2A 4DR6F 1SB6A 3BBFA 2EPIA 3A12A 4XO0A 4C4WA 4O0NA 1FJGJ 2ZNZA 1RCOB 2MZSA 2BE7D 4ECQA 5GMEA 2OHDA 3CDUA 1WUUA 1SC6A 2KB2A 2YPYA 4IOBA 3G8QA 1XNQF 5F8HA 2G1HA 1O51A 1UL3A 4IO9Q 4M8LA 2EK1A 5HMZA 4MIWA 5FLXU 3HXMA 4ZPWR 3PX0A 5EDWA 3MEDB 3H4BA 5DETA 1N8RT 1A7GE 4WBFA 3TUZC 2DXFA 2V4QA 1UJ4A 4G1QB 1X4HA 4ES2A 1N33F 2C2KB 5D0RA 1HQEB 2XB2D 2XULA 4ZPCA 3CMES 4NZ0A 4G65A 2AV5A 2PGCA 1H74A 1K8AT 4OZNA 3C14B 1SUQB 4TU8A 3IM9A 5CCLA 1NSQA 1R8AA 1X8DA 1FWLA 4CNZA 1RYRA 1I5OB 4DS5A 2ZNYA 2I8EA 4LRDA 2I5JA 4FF3A 4I67A 2OFHX 1XMOJ 4LSLA 2DIVA 5D4PA 1KQFB 4JV5J 2DHAA 4ZITA 4I64A 4I2QA 1HQEA 3P5BP 3I32A 5A8WA 3CD7A 5KFLA 5E33A 2HHVA 6FD1A 3BO2A 1HMVB 1RTZA 2CPDA 1FWKA 5HO4A 2G13A 1NK8A 1BGXT 3ENQA 5K8MA 1WC1A 2AEMA 1KD1T 2NXEA 4C0OC 3K17A 2GO8A 2FUG9 4OYXA 2D3UA 4GC7A 2YVSA 2ATLA 1TL5A 1FFGB 2QA1A 2Z2LA 2VKZG 3OL6A 2Q66A 2RIJA 3IFEA 3MR2A 2G2OA 4DR4J 1K0TA 2NR0A 1PC4A 4DV1F 2YKAA 1XWLA 4H4OA 4ZA1A 5A8WB 2UVRA 2XMVA 5KT5A 2HLUA 3DLHA 2JEIA 4GO7X 3I96A 4LRCA 4MK8A 5KAKA 2XYHB 2PI5A 3LW5C 3HVRA 1YZ6A 3DLBA 2AKWB 2CQ4A 2K3KA 5B0AA 2XCAA 2L3MA 3K89A 4ZLPA 4ECTA 4GKJJ 2QLXA 3ZZOA 3BZQA 1C1CB 1S9GA 3AD9C 3OVBA 3BSAA 3H5XA 3RYLA 3TOQA 5F8GA 1F3VA 1X7VA 4ZJOA 3VZHA 4ED7A 2ERRA 3QRRA 1SJRA 4PPZA 5D3GB 1UZDA 1VFJA 5KOXA 2AJ2A 1JLFA 1S1UA 1Q95G 3L95X 4PXDA 1VK3A 3MMCA 3PX6A 1RKJA 1AT1B 2FVPA 1T0TV 2HFZA 2MKHA 4LIRA 1FNXH 3UNGC 3BDPA 2VG6A 2HHTA 2XZTB 2VJVA 2QLFB 3CJ4A 4WFZA 5A8KB 3THTA 2YWHA 4PWUA 1TFWA 1EB0A 4WPAA 4C8YA 4K4WA 4JOUA 4F3QA 3EGZA 1NK4A 2IAJA 3TWZA 4QWDA 1HHQA 2AU0A 2UUAJ 4Q44A 4DZDA 3TA1A 1JLGA 1B0VA 4DV6J 4I69A 1T11A 2CNNB 2UXBF 5CYMB 1TVRB 2VFRA 4O4GA 3DOLB 3FNNA 1U6ZA 4O3QA 4B02A 2OPSB 4IDKA 3VAIA 4DLGA 1JMTA 3AXMA 3VF0B 1MMLA 4NLUA 3NS5A 5K8NA 3V6HA 1MN9A 1XC9A 3QJJA 2PSZA 1N88A 5IM0A 3OR1A 2N7CA 2HVZA 4K4UA 1UPPA 2LQ5A 3KK3A 5T7LA 3TRGA 1N6QA 1QY7A 1JLAA 5SUHA 1XNQJ 1ZH5A 3DMJA 2VBZA 1SBRA 3BKUA 4AFFA 5CYJA 1Y4ZB 4FXDA 2A1BA 2IYIA 1FERA 4JI0F 4FVCA 1Q8IA 2ZVSA 1X31C 2YNGA 1F0XA 2YQ1A 2FZKB 4E8UA 3ILLA 2RNEA 3DOKB 2V2ZA 5U47A 2VJUA 4EBEA 2V6AA 3ISZA 3JQMA 4CLYA 1HD0A 2HRUA 1GXUA 1YK9A 3RG6A 1KWMA 1V5VA 3AT1B 2KHDA 1X4AA 3O2IA 4P6QA 2CG8A 3LTOA 5IV3A 2M70A 3HCXA 3MMAA 2LMIA 4KPCA 2WOMB 1MG7A 2ALYB 2OUGA 1S1WA 5GVQA 4C3KA 4USKA 5CD4H 3I82A 2JOQA 3BV8A 2OAUA 5A8KA 2ACMA 2DITA 1K9MT 4N41A 2B9YA 1TL1B 1GMVA 4NZ6A 5KT3A 4F50A 2AT1B 3QZ7A 2XMUA 4DQIA 2PE8A 3I56S 5HVGA 3PNIA 2RD5C 1WEXA 4LF6J 1A0OB 3T5KA 1IKVB 2CQ1A 1APSA 3Q24A 2KYXA 2MQNA 2MKYA 2BMBA 2E9ZA 3RZAA 5L46A 2DPIA 1DFDA 4LF8F 1CJUA 1H2VZ 1T3NA 2WVEA 1PIEA 2G0CA 4ID5B 2PFDA 4DZ6A 4F26A 3ZZRA 2XM3A 3EXCX 4ILLA 3CMAS 2CJQA 3H42A 3OTEA 3TJ9A 1JJCB 3CCUS 4OHWA 2J6SA 3SBMA 5CYQB 2KI2A 2MPUA 3EJMA 2W4PA 4AXIA 5LMNJ 4IFYB 1RK8A 1WJ9A 4DU7A 3CD6S 4KHMA 3QT7A 2HEKA 3V2UC 3L3CA 3AOCA 3OXGA 3PCOB 2H9ZA 3MPDA 1SH2A 4DI6A 3K5MA 4A8WA 5ETMA 1N52B 4B9SA 1KONA 4YP3A 4M94A 4W92B 5KG3A 1RWMB 4ZP8A 1NDCA 2KFYA 2ZM6J 1IVZA 2JLFA 4I2QB 1U8WA 2AEJA 4ES3A 2QSWA 3NCPA 4K50A 2AIRB 2GC8A 2BE2A 2K3IA 3KJVB 2IBOA 1UVLA 4NZ7A 3EZ5A 3AH6A 3MD1A 5HMWA 4Y2MA 3PKYA 2FLLA 4JI1F 2KN4A 4CQ1A 2F9JA 2YWKA 2XSJA 4TKTA 3RBDA 2N7YA 3DC2A 4JI4J 3FJ2A 1ITPA 1TL7A 1SJ1A 3H2LA 2WVFA 1P8GA 1I1GA 3OTDA 4XDCA 1U25A 4RU2A 1Q78A 2BRLA 2OD4A 4KH0B 2JVOA 2FIUA 4NCBA 4NLQA 2HHPA 4LJMA 2PEHA 2DRBA 4J9RA 4QPXA 4HYKA 1W7WA 3SQGB 4GVLA 3RRHA 1KVJA 2R8KA 3T5LA 2E7WA 4QYZJ 3MEDA 3CF5Q 2J8AA 2MDAA 1S6UA 3N0VA 5MLCV 4EMDA 2W2NP 2PI4A 4DG1B 4WU3A 3CJ5A 2XZWA 1HBNB 2EFPA 1R6YA 2YNGB 3ULHA 1YI2S 4P2XA 3CCWA 2HNYA 3HPOA 1BXNA 4YR2A 2AD9A 4UF4A 2ZDPA 2FY1A 1OJ4A 2C28A 4FYYB 2GQQA 2HSEB 3JS9A 1S0NA 2I6WA 3BN7A 1F1BB 3W3SA 4NLYA 2OH2A 4B9NA 3ZFVA 2LECA 2HQIA 3L09A 3MF5A 1DTTA 2MMYA 4LVOP 2CAJA 1M5PC 4B9VA 1KNZA 2V67A 3MURP 1X4DA 3M8YA 3ZTQA 2DTJA 2GAHC 2VBWA 3W2VA 2WSFC 3I4HX 1RI7A 3NOGA 1LNQA 4LF1A 5ETOA 1NJXA 4IUFA 2RE1A 3MPUB 2KT2A 3BS9A 2DIUA 1E6YB 2AWZA 3ETOA 3FKBA 3WX8A 4C98A 3UFCX 3OV7A 3RTVA 1TKZB 2RU9A 5D4LA 1DQAA 4A48A 4ZP7A 3RGIA 1RT3B 1HYSA 3GP9A 2CDQA 3PDNA 4DV7F 2ROEA 2CJKA 4ERDA 4K4SA 3GJRB 3A8IA 2GJIA 2M3DA 3H59A 3MMBA 4GC6A 3MAAA 1RA6A 1RZMA 2CJAA 2CPFA 2DNHA 4ID8A 1CEZA 2AJ0A 4UY8T 2F9DA 1G7CB 2HFUA 2DRDA 2ZWOA 3Q2SC 4OX7A 2QT7A 5C24B 2MTLA 4OQJA 1NH8A 3GR0A 5B0FA 3VALA 3WIVA 1NKCA 2Z4PA 2V9WA 1Y11A 2J7KA 3HJVA 2AGQA 1N5YA 5GMDA 1CJTA 1HR0F 1K47A 2N4CA 4L72B 2C2OB 2KYZA 5LJ5Y 1WKJA 5H1SV 2MZRA 2QA4G 3P49B 3WC0A 3DLLQ 3M8SA 1K44A 1BC6A 1EJ7L 4I6AA 2A6MA 3ZTSA 3HVWA 4W90B 3PHTA 4ECZA 3DI6B 3RJMB 1YX2A 1WHXA 2JH3A 5K8OA 2B6AB 2CXEA 3KK1A 3ILIA 1LK7A 3W1YC 2V2VA 4FBTA 3BEGB 1NU4A 3KFWX 2E5LJ 4KFBA 3DRPB 1RWWB 4U7UD 2HGNA 4J9SA 2ZWPA 2X1AA 1BE4A 2FJWA 1FA0A 3FEXB 2XQCA 1NK7A 1NK6A 2ATCB 1UVNA 4WZQA 4PG5A 4LSNA 1HLWA 1T9YA 1FKOB 1CBKA 4DUYF 4OJGA 2BKNA 1J5OB 1TL7B 4B9TA 3PTWA 2DH9A 2QYCA 4MAKA 5IWAF 1FJ7A 3G82A 3V6DA 3LOUA 4DQSA 4UQGA 2Y0BB 4M5IA 4TQRA 1RT2B 3D68A 3DOMA 2BYCA 3CO0P 2HGMA 2WHOA 2ZVIA 4QPTA 4RBTA 1HI1A 1Y3JA 4ANDA 1RAFB 2K06A 2UXBJ 1JLGB 1CS4B 3HX9A 4R0EA 1UEKA 1C2PA 3QT5A 3FUYA 3P6YC 2HFSA 4NLXA 1M1KT 2DNRA 2LQ9A 4N47A 1B7FA 1CC7A 3IP0A 1AUSL 1XMQJ 1F5AA 2CJBA 1HL6A 4LBPA 1BQNA 3AJDA 3C6TB 3BQ2A 4J9VA 5KG2A 4IKAA 4LIWA 3EDRB 1QVGR 2R7QA 2ZHBA 1CJKA 3LWMA 4A8YA 5I4MA 4XPCA 1YJUA 1IR0A 1IM6A 4URSA 1RHUB 3C16A 4DFMA 2DHGA 3OLBA 1H6KX 1QUPA 2P9GA 4G6VB 3BSOA 5F8IA 1RHMB 2YKPA 4DX7A 4PWWA 4YDXA 1N56A 2AW0A 3Q8VA 5L1LA 3T3FA 1GT8A 3QO9B 3VCDA 2ADCA 4RU9A 4HTIA 4RUCA 4DUZJ 2ZH4A 4U96A 3CJ0A 1MMNA 3MM9B 1KQSR 4B3TF 3VGTA 3TJ8A 4JI3F 1RAAB 1VIXA 2O5DA 3FFIA 3OVSA 3OR2A 1HHTP 2RF2A 1X4GA 2M5YA 3PJ9A 3W64A 2IM3A 2AGPA 3AXKA 1VMBA 2CADA 1JQGA 1TKXB 2LYVA 3M30B 3M8WA 2PO4A 3MPYA 4K8RA 4HHUA 2R7XA 2YKOA 2ZBQA 4LFAJ 1IR2A 2MXYA 5J2NA 3VWSA 1NB2A 5ETTA 2HRTA 3J81U 2WK4A 2HHWA 3UCUP 4OYIA 2UV8G 1KDNA 3J81j 4LBHA 2WOMA 3KKFA 4YFUA 4ED5A 3BREA 2ZZMA 4A8OA 5J2MA 2CRLA 1TKTB 4HVZA 5KFUA 1YJWS 4F0KA 1EZZB 5B08A 2Y3YA 2F5GA 2MLXA 4M5DB 5J2NB 1FX4A 1VQSA 2H65B 2V8GA 3TI0A 2NLWA 2X3DA 3BGLA 1X4FA 4WWSA 3H0PA 4ZJLA 2YKMB 5GAEI 1CULA 3THPA 1CLFA 3KJNB 5DDPC 2RQCA 3QPIA 3TO8A 2AGOA 1JWWA 2HHXA 1AZSB 2RUSA 5KFDA 2GIRA 2F40A 2XSFA 1U0SA 4X64J 3UN2A 4TY8A 2ALZA 1R43A 1EP4B 5AXKA 2ASYA 3IR6B 4FZVA 4OX8A 2Z57B 3CC7S 4OYMA 3CDWA 2KJVA 3LGNA 3OTBA 4L73A 2XMWA 2ILYA 3KK1B 3CCQS 4BC7A 4JI2J 1NDLA 4LF7F 5BYSA 4D3GA 1G2EA 1Z2LA 1UVIA 2HKEA 1S5ZA 1FJCA 1U26A 4LQ9A 2BXJA 2EI5A 2VC0A 2ZBPA 3M32B 2L48A 4QYRA 4X66J 4J9OA 4BWJA 2YY3A 4YB6A 5HQ8A 2MJNA 1VQ9S 5A0YA 2JEJA 4QQBA 3R3TA 3KG4A 3M6UA 3RU0A 3S6EA 3MMCB 4KT0C 3VR1A 3GIMA 3T1YJ 1LXJA 5ETSA 2IHR1 4HH0A 3SCIE 2MGZA 2NQPA 1AW0A 3CDAA 5CHCB 1VQMS 2LEPA 1RTIB 2D7SA 4IRCA 1I94F 3O6QA 2VFUA 3R7SB 1S0OA 1JXLA 9ATCB 1LXNA 4WTOB 3G4SS 3OJUA 3TQEA 1KLNA 1HBOA 2KHCA 3GMGA 3TZYA 2B5JA 2UXCF 2W24A 2EBGA 4ZLLA 1NCLA 2ZC3A 1M5KC 2CQIA 3MR7A 1J5EJ 3DLGB 4WK3A 4C8KA 1FRKA 4DV6F 4JV1A 2GX8A 2VC1A 4CLKA 1PJ6A 1URRA 4RUAA 3EUNA 3GV5B 1RYSA 2E1MC 2HFNA 2KU7A 1FFWB 1I3OB 2APOA 4ZVGA 2QFJA 4FYDA 2MQPA 1B3TA 2UUTA 1ULRA 2IJFA 1CSJA 1TKTA 3GJSB 2WRMA 2LU2A 4NRTA 2JNJA 2HAIA 2LFVA 3KNGA 1SL0A 3PO5A 3CTRA 1ZA1B 1GMWD 2QLWA 4A8QA 4B3RJ 3QIPB 2JC0A 3ZZYA 4CO2A 5C7PA 2JSXA 3R2CJ 1Y3KA 1HWKA 2EK6A 5C25A 5FLXY 4WKYA 1FDNA 4NLWA 2W1BA 1NPPA 3CIMA 1VRTA 5CZXA 3M6XA 4BCAA 3MOZA 3DDNA 3OR1B 2CQ2A 3NKYA 3R5BA 3BR9A 3TAMA 3F0NA 3P45B 1IQZA 2ROPA 2VDIA 2VQFF 3OW2R 1UP1A 2D3O1 4Y28C 1E6VA 4OHZA 2ZH7A 1UJ6A 2JVRA 2WSEC 4ZCLA 3DHXA 4I6WA 4LRAA 4CH1A 1VCTA 1HR0J 4ALZA 1WC5A 4OFZA 5D4NA 3I4PA 2BOPA 3ZTPA 4QWEA 4J9UE 2V94A 1WHVA 3ETMA 3FCWA 5E3PA 1KEKA 1GXLA 2MKCA 4GMKA 4E2FB 1ZZNA 1WHWA 3IBCB 4F4WA 1TUWA 3DRPA 1X4BA 4FPRA 2MY8A 5C2GA 3PIPQ 3HF5A 1S9EA 5BR8J 3US5A 4TU9A 3NGDA 1SC1B 5H9EJ 3L4BC 1OYDA 2DGSA 3HHKA 1RSCA 1RKIA 1F60B 1YBAA 2NXJA 4ECWA 1OQ6A 5ETLA 2NZCA 3ZZPA 1MWZA 4Q45A 5J1PA 3N28A 4TN2A 4CO3A 3PIOQ 1RGVA 1OY9A 3GSIA 4C11B 1HBOB 2D41A 4NLVA 1NBEB 4RKUC 3OHBA 3UWTA 3FVYA 2OSQA 2OEKA 2QLJB 3A13A 3FSXA 2OPQB 3RUBL 3R8YA 1QAYA 1VC0A 3DYAA 5KFMA 2BE9B 3L7PA 4TXSA 1U48A 4N7TA 4DV3F 1NDKA 5M2PA 3W2WB 2VIHA 1YRTA 2QG9B 4U7CA 1L3KA 3D54A 1N5TA 3IG1B 4L3NA 4NMXA 1X9SA 3FQKA 4IQMA 4PG7A 4PQAA 2OP5A 5LXYA 4X65F 1IWGA 2R7VA 4WU2A 5CYQA 5LMUJ 4Z7CA 2J5AA 3LP1B 2PMZD 3ET6B 1Y5NB 1RTJA 3C16B 5J2PB 2ZC4A 2ZH3A 4BS2A 3KK2B 2GCFA 1X9WA 3CCLS 5D0HA 3BDEA 2B5JB 1DLOB 1S1VA 3ISNC 3IR5B 4MYUA 2XY7A 1U02A 5KT7A 1FEHA 5KG5A 2XYGB 4MKBA 1S9FA 3DGVA 3CNQP 3PV8A 1HNXJ 2DR7A 4RW8A 3GR1A 4KV8B 8ATCB 3Q23A 4RW7B 2YNIA 1Z1ZA 1S99A 2OPRB 2H5JB 2GA7A 3A3NB 3HULA 3WDOA 1KLMB 3I9ZA 4ZKAA 4J9PA 1WC6A 1EKSA 4AT1B 2E44A 1CS4A 3GFZA 1TR0A 2CPXA 2LDIA 4K2JA 3R6LB 1D3WA 3LAKA 4OYAA 1H2UX 3SCLE 3TW0A 5IZHA 3AAWB 1UA0A 3MM5B 2BANA 1YSJA 2B8PA 3BGRA 4DPXA 2WSCC 2KL8A 3EGNA 3WHIA 1VOMA 3SMZA 2Q6CA 5I3UB 1PYOB 4EYHB 1FXRA 5ITHA 2B56A 3CULA 3VAFA 1UMJA 2J76E 4LRFA 4ANCA 5JUMA 1QTMA 3I6PA 4IR1A 4ED0A 1HNZJ 2G2ZA 2J9EA 4U9RA 2IA6A 2OEMA 3UE2A 2ADBA 2LXFA 2CQHA 2VFVA 3PRBA 2J9DE 4WP9A 4CP5A 4YUDA 2ASLA 1N48A 3T9NA 3ET6A 1IJEB 1GAOA 2ZDOA 5KFWA 3ENVA 4X2BA 3W8GA 4FYXB 4DV2F 1MWQA 3QYYA 4P73A 2XBPA 1RACB 2CQPA 5HBMB 3QRPA 5LT5A 3DDIA 1GFWB 1PAEX 3R5GA 2BRKA 1QE1B 2CVEA 4TNOA 5HSPA 5IM0B 3FFIB 5AXLA 2YNIB 4RW7A 2E29A 3CJTA 3VVTA 1JKHA 1U6FA 5AE2A 5KFOA 2DXEA 3CMQA 4DQQA 1U4BA 4L75A 4OJ3A 4CLTA 4WFNQ 1FESA 2BW2A 1VLOA 1R31A 3SXLA 5HLFB 4NA2A 2YKNA 4LF5F 4DUZF 1PKUA 3Q86A 2HQCA 2XO6A 2A6OA 1G1XA 3LP1A 4C7QA 3M8PA 4LF6F 1W26A 2DNMA 4C97A 1ZM2A 1ICEB 1HYSB 1X9MA 1EHWA 4Q2LA 1S49A 4LRBA 3BJYA 2KZMA 3KMSA 3IC1A 3DXSX 2B4PA 4A8MP 2VOOA 2HWIA 2NSCA 4X62J 1WC0A 1TP7A 1NPKA 2DHXA 4RNHA 1W2BR 3H40A 4NCAA 4M5HA 2RDIA 4FF1A 3D5MA 2P2CB 2IPOB 5CH7B 5IT0A 2KRBA 4KQZA 3U1MA 4RW4B 3KHHA 4KHPF 3LP0A 2LQ8A 5HMYA 2HNZA 2PA8D 2CPIA 3MTKA 4BHQA 4CLWA 5DLGA 3MUVP 2V2KA 4CLSA 4AQYJ 1D9FA 5KOWA 2FHMA 4QR1A 2KH9A 2XHCA 3RB4A 3GWCA 1YBTA 2BKPA 3BYRA 1N4LA 3I5CA 3OTOJ 3G6YA 2IFXA 2R8IA 2QA4S 4WXOA 1PJ5A 1S6OA 1S1XB 2WB4A 1HQUA 2A3JA 4FXWA 5IWAJ 1FNMA 4Q0BB 1T95A 3M9MB 1YJRA 1MROA 3BH7B 2XCPA 4F2SA 3WX4A 4NA1A 3W60A 3X1LB 4ECUA 1ZAVA 4I68A 4K7QA 2DH8A 2DBBA 3J7YU 2VA3A 3GIRA 3CT9A 4NLOA 5F8LA 1OSDA 1FRMA 2ZJRQ 1H2TZ 2MLZA 4JUZA 1HFEL 4UT4A 1QSYA 2DNQA 4JI5J 1XJWB 3H5YA 4J9NA 2RDDA 2BANB 1LW0A 3S8SA 1SC3B 2ZEJA 1RTIA 4A46A 2JFDA 4C8OA 3KLHB 2OPRA 2FZCB 5EWFA 1M0SA 3G82B 4M5LA 5DQGA 4LFBJ 3KLIB 1PC5A 2BBEA 3WIUA 3FZ2A 2K7KA 2FJBB 4XDDA 2UU9F 1N32F 2BOAA 2GNKA 4NASA 4Q5VA 2R8JA 2DR5A 3VV2B 5GAHU 5IT9U 3DCAA 4TY9A 5CAAA 3ZXWA 4NLDA 3KLGB 1SVDA 4OZ3A 1S7IA 3IWLA 1RTHA 2Z2YB 4N76A 2WW8A 4M63A 1N0VC 1YGYA 2NYIA 1WEYA 1Z2ZA 3IAS9 2MEWA 4PYDA 3J7Z5 4NEZA 3AD8C 1VHIA 4DCOB 1IBKJ 1L3VA 3HHLD 3HJFA 4LF2A 2QFIA 5GAEU 1REGX 3HK2A 1U2FA 1WI8A 1NUEA 1V9OA 4NA3A 1YKWA 3HHLB 3M2VA 3N4WA 5LL6d 2KG1A 1GNKA 4PRFA 4W4MA 5KFZA 1NSPA 1X5TA 4F7VA 1FWPA 4ZVFA 3OTCA 2D1CA 1NHUA 2YH0A 2RUGA 3NLCA 1U2RA 1RAGB 4LF5J 4KJIA 1XNRF 2SXLA 2V9KA 1X5PA 3D6MB 2L9NA 3PFEA 3V4MA 4JI8J 1NJIT 2I5JB 2PDAA 1S57A 2HBZB 2DVIA 4FS2A 4FYWB 3RBZA 3NS7B 2OSRA 3J7ZT 3MEGA 1R0BG 2VQEF 2W9CA 5B0GA 2AX1A 5KG4A 4CDIA 1KC8T 3GE9A 4DFKA 3NBPA 1KOOA 3CJRA 1ZTWA 4OI1A 4QU6A 2FPHX 4GKKF 2IDLA 3GTYX 3E51A 3IA0A 3TA2A 2ZH2A 3NMRA 4NXNF 2UVUA 2CNOB 4HT7A 2HRYA 3VAKA 5D6GA 3L9ZA 1UZHA 4KKOA 3AB2B 4IFVA 3PW2A 1H3DA 2OKQA 3GB0A 2IM1A 1YG0A 2X3GA 2ZE2B 1H72C 4X4TA 2ZITA 5HVFA 2Y8WA 3EZOA 3HZEA 4Q2MA 4HR2A 3NAIA 1JNZB 1HQ2A 3NWRA 2KVIA 1TU0B 4ZPTR 5EHHA 2V50A 4DV7J 3EDQB 4DSFA 2QMWA 2HVEA 4KHRA 2DXDA 1YJ9S 1UWBA 2C3PA 4DPOA 2WVBA 1PAUB 2KDOA 4FVMA 2PIIA 4KBIA 2DY9A 3EMTA 3DMJB 4O3PA 4EO6A 2GQ2A 5KFEA 3KLVA 5LMUF 1KFSA 3C8YA 1VQ8S 3M1VA 2RSQA 1JLEB 4J9LA 4Q8FA 4RW8B 4CM0A 1UVJA 2QX0A 1B99A 1GMWA 1H98A 2XMTA 1MWYA 4ED6A 5KG7A 3TZWA 2I9SA 2LKZA 4OV1A 4UTGA 3W63A 3K5NA 1S1TA 3KLFB 4NYZA 2YX4A 1SL2A 2DNPA 4ANEA 1WDTA 3AODA 1VDHA 3M05A 2ZOGA 1E6VB 3HSJA 4MFBB 1HBMB 2FJAB 4AL7A 2YQ0A 4DMZA 3C2PA 1W25A 1WKLA 2Z0GA 1GX5A 5D3GA 3TQ1A 2BQRA 2AQ4A 1ZA2B 3QAEA 2QE5A 5FIIA 3MMAB 1N5QA 4NOHA 4DL4A 4XAKA 1VHFA 2C22A 3QFHA 5AXNA 3MAHA 3W61A 5HROA 3UDLA 3UD3P 3PXGa 1NLKL 1S6QA 3MR5A 2OTLS 2W9BB 1JKHB 4DV4F 2V69A 2HS0A 3QMQA 2E7XA 4YS2A 7AT1B 3W2VB 1VQLS 4F2RA 1RWPB 3PJWA 1X60A 3FMWA 1ZAXA 3HD1A 1LKZA 1V3SA 4J90A 4KY3A 4DR1F 1YTYA 2CNKB 4KC5A 5F0UA 3ZTRA 4Y0FA 2W8KA 1MMDA 3CVKA 4DPUA 4ZP9A 2XLIA 3LGMA 3MECB 1B0TA 5KFAA 3GPAA 2X1FA 1HW8A 2GHPA 3M32A 1IQTA 4O0IA 3OL9A 1UCNA 2JRSA 4DUTA 1TAQA 1TUGB 2W2MP 2F8MA 2I38A 5KFBA 3HLUA 4ID5A 4DXLA 3KTQA 4OHXA 4F67A 1WOSA 2J6TA 5I42A 2RRAA 3QIPA 1FF2A 4OYPA 4QIGA 2W9AA 2C2EA 4IFYA 4YY3F 2G9OA 3CB4A 1RP5A 1B4SA 2E1RA 4ZN1A 1SJFA 1FKPA 3ISND 3LGHA 1M1GA 4YOEA 1T9UA 3M2RA 1REVA 2VG7A 1DTQB 3ZZZA 2OEJA 1R89A 3PVXA 5CXTA 3JTOA 2XNQA 4DL6A 1S6QB 4C8MA 4Q8EA 5F9NA 2XSJB 4M5MA 4U8VA 1U1PA 3DOLA 4B3TJ 1T05B 2BR0A 3CJ2A 4HDGA 3K59A 4ED3A 2O1PA 3GYGA 2WZ1A 1HBUB 4DPTA 1B0PA 1Y7PA 1NH7A 2HLTA 1PSDA 4QCLA 4V19J 1HW9A 3U02A 1LWFA 1IXKA 3M9NB 2BJ3A 1BUXA 4WE1A 1U7LA 4RZRA 2V2QA 2CQBA 2EFNA 3D1HA 3JAMY 1JX4A 2HHUA 2LQJA 1SIZA 2J7UA 1T03B 2DNLA 1NNDA 2YXLA 3IG1A 1S59A 3IS9A 3AY0A 3QLHA 3IWXA 1RTDB 3D0HE 3D6FB 3AQOA 3HMJG 3P4UB 2YBVA 3CCSS 1WACA 2YKMA 1FI4A 2R7OA 4RJVA 2IMWP 1WTFA 4NL5A 1S77D 2XMKA 4M95A 4QIFA 4C11A 4JI5F 3TEGA 4AL5A 1YITS 3G9CA 3LPEA 4ZVPB 3GFXA 4IFVB 5L9XA 3IRXA 2WTFA 3RR8A 3ZTOA 3PEHA 4S0MA 2HHQA 4TY8B 3KNAA 3FZBA 2AP6A 3MZIA 4UUWA 1JXEA 4Y3CA 2VPYB 4X4SA 1NAQA 1SI9A 2MGZB 3J81Y 4BBYA 4DCPB 3R1HA 1RCXB 1IKVA 3UR3C 1UETA 4YR0A 4DHVA 2ZD1A 3JSYA 5A8RA 1QUVA 3SYZA 5KFQA 5A6PA 1YRUA 2M52A 2DHSA 2R7SA 4LQ3A 2N4DA 2ZFHA 3HFZB 1M5SA 3KG0A 1LWFB 3UD4P 3TX0A 3HKWA 3CCES 5IFMA 5HLFA 1P27B 2CQ0A 2NPFA 2GZOA 4DWIA 2QRRA 2CWKA 3OUYB 5LJ3Y 1CVJA 1QVFR 2OPPA 2YNFB 2YQ3A 4FYVB 3TR5A 2QMUB 4NLPA 3OL7A 2KM8B 2E9TA 5LXRA 1ZBTA 4MIBA 1KVKA 1N5VA 2VFSA 4OI6A 8RUCA 2LEBA 1JLCB 2RS2A 3DLKA 2HURA 4MJKA 4DR4F 3UD5A 1HNIA 5DQIA 2DNNA 1YIJS 4ILMA 1KSPA 4JI7F 1XTZA 1HHSA 1EETB 5IQ6A 1R0AB 1JLQB 2IDEA 3GQCA 1HBNA 2W8LA 4DEZA 1IJFB 2JFKA 4C3LA 3D67A 5D8HB 4LBIA 3QNWB 5D0GA 4DR6J 4IG0A 2XWYA 3MM9A 4AUKA 2B9XA 4DN0A 4WK1A 4EWTA 1L3TA 2B6AA 2YNHA 1S7HA 1WKKA 4U95A 2MZJA 2Y8YA 4AE5A 4X4QA 1C4AA 3M9OB 1WNEA 2HYIB 3IWNC 2V5HG 4GKKJ 1RHKB 1RHRB 1VK8A 1XR5A 2I2YA 4DX8H 3R5AA 3QRQA 3MM5A 1KHVA 4F8RA 3FBBA 2KFNA 3CJKA 1B7YB 2JLEA 4FKXA 3LP2B 4FF2A 3Q8SB 4USMA 1QD1A 2JDJA 1G4CA 2RAQA 4RNOA 4J91A 2NSBA 2HFOA 3FEZA 3Q8UA 2YPZA 3S7RA 1FKOA 3UVJB 3H25A 4OHYA 1KN6A 3HZGA 3ICLA 2CQGA 1BLUA 1ZZFA 4GVBB 4ZJQA 4DV5F 4NCGA 3PW5A 1TUVA 3UCZP 2XLKA 3SFGA 5IC4B 4HHJA 5IS2A 3C46A 4ZLNA 3T1YF 2NXCA 2QL9B 4ECRA 2AYBA 1WELA 3LO3A 4PG6A 2GVZA 4OYOA 5KG6A 1ZYQA 5EWEA 3ZZTA 3OXLA 1NM2A 3D2WA 3M8RA 2XMJA 3MCOA 1NXIA 4HDHA 4MKVA 4DR2F 4X4PA 2QYGA 2GVDB 4URQU 2XY6A 2A2CA 4LSNB 4CLPA 2YWFA 3ITHB 1HI0P 2UXCJ 2FZGB 3C6UB 3NNHA 3W2WA 3PX4A 2MQLA 3NNCA 2GQCA 3AB4B 4ZHRB 2IYGA 5DLFA 1NKEA 2E7VA 5ETQA 2DJWA 4CLUA 2KFZA 4HL9A 4JV2A 3EGWB 1L3SA 4DSJA 2ZZTA 5EN1A 1W2IA 5IT4A 1PYTA 1VC5A 3QGGA 2YX1A 4CYUB 1EETA 1YJVA 2GVDA 3LP0B 1PCAA 4I1TA 5KT6A 4DR2J 4PAAA 1JJ4A 3KMQA 2BJDA 5ETPA 5EWGA 2HWHA 2IIHA 1QLNA 4NEYA 2FLNA 2HNDA 3H5UA 2YWWA 3ILOA 5K5MA 4N5SA 3H4DA 2IVMA 1CJKB 4I0WA 4DS4A 5F41A 4Y2KA 2RRNA 2ZUAA 2NCKL 3DM2A 1HIYA 3KLFA 3QT6A 4UQTA 4USTA 2V0NA 4JV0A 3G96A 5H9EK 2AYGA 2F4VJ 1IN0A 2YWGA 4OZ2A 3VQSA 3QQCD 4KO0A 2X1GA 1C4CA 2DYAA 1SH3A 4WYWA 1SKSA 1Y10A 2R2TA 3GZ7A 3B54A 4M5JA 2MQQA 4CT9A 4UOHA 2VQFJ 3OPKA 1VR6A 2OD6A 1RABB 5KFXA 5DM7Q 4H4OB 1DAXA 3FCHA 3OL8A 4P72A 4ELTA 3AA9A 2XGQA 4U7UK 5T7LB 1HNIB 4OLOA 4LF9F 3F44A 4BC9A 2UP1A 2F7VA 2R3VA 5I42B 4YB7A 1FRXA 5A2QY 1HNXF 4O3SA 2MYFA 3MEEA 2PN6A 4KSEB 5C25B 1Q7LB 4USJC 3UDVA 2J9CA 4RO0A 4PPDA 5HI7A 3QT8A 5CCMA 5KFKA 4LF4F 1RLCL 2K7JA 4XK8C 3DRXA 1BQMB 3B4MA 1U0HA 4MIAA 1ZS6A 2M2BA 2BJ9A 2KKHA 3DN9A 4NRUA 4OZLA 5C42A 4J9KA 1HPZB 1HBUA 4MKYA 1T9VA 3QGPA 3TNVA 2FVSA 9RUBA 5J2MB 4AL6A 2D9OA 4NXMF 4B9MA 4OZJA 4V1Ak 4P74A 3V6JA 3E01A 4PUOA 3U1LA 4DPYA 3D1OA 2DGTA 3F41A 3JTNA 2PT0A 2A18A 3NAHA 2DNOA 2K2PA 3R27A 3P5TL 4LSZB 2EFGA 3R9LA 3TUIC 1UWAA 1RHQB 4J7CA 5K14B 4W98A 2DRAA 4ICLB 4LR7A 1I6JA 3G6XA 1X0PA 2O3DA 3UNYA 1RTHB 1FJEB 1OSCA 5M2RA
chains in the Genus database with same CATH topology
3PHEA 4X4UA 4ZPAA 2HWTA 1NB7A 2POKA 3UR0A 2DGVA 3I31A 1ZTTA 4B3OA 2B7CB 2WBMA 3QZ8A 1KR4A 1JNRB 2L08A 4I7FA 2DB1A 4YB5A 4BDPA 3NMAA 2UVVA 1KTQA 1FK9B 2C3YA 1CQMA 4RW6B 4HT5A 3OHAA 1XMBA 4LFCF 1G6BA 2V4JA 3BSCA 2W7OA 4FNIA 4ED1A 2IC3B 2FDNA 3OFHA 5E41A 3T1HF 4TLRA 3K58A 4FNHA 4CCHA 2JEFA 4WXWA 1GQEA 1P1LA 4F3MA 3VAJA 4PG8A 3A8EA 2H5EA 1EP4A 2QZ8A 1JIHA 3SV4A 1RTDA 1N6QB 4ETZA 3DRRA 1TL3B 3V81A 1HI8A 1NRKA 2FLOA 2EG2A 2JC1A 2KJWA 3GYNA 3FQLA 4DL0C 5KFFA 4YOEA 4E98A 4CH7A 5HL7Q 3FDSA 5EGYA 2U2FA 1VLYA 2XHWA 3QWUA 1D1UA 3OUYA 4O4GB 3ITHA 1S79A 1YRXA 2OO4A 2MKSA 1X5OA 1VQKS 4RLEA 2LEAA 3SEOA 1MROB 2ZD1B 4ZVEA 1IKXA 4PXEA 2V8DA 4KFBB 4CIOA 2HHHF 1XK8A 1UVKA 3NRBA 2CVIA 2AF6A 3DOKA 3OSNA 3MI7X 2BM0A 3FGVA 5C5JA 4H4MB 2E5GA 1FT8A 3DLGA 4FS1A 1F9FA 2YX7A 3J7A1 1FJGF 1QM9A 1O5JA 3DLKB 4QW8A 2IA0A 2KTQA 1RWUA 3KWMA 4R0JA 3CO9A 2XI3A 4EFAC 2HMIA 4MTPA 4XPEA 1T3OA 1A6LA 3FEYB 2XI2A 3MMJA 1ZM9A 3RW6A 3TVKA 4EGLA 1RT1B 1VJWA 2C3UA 2QIFA 5DQHA 2L41A 3PRDA 3TARA 4RUHA 3CDBA 1U1KA 2UVWA 1TV6A 4PQUB 1FCAA 1U6BA 4OZ1A 1P1TA 1FE0A 2VG6B 2BV3A 3VZIA 3SQGA 2YTCA 2ILZA 4ZMMA 1RT6B 4OX6A 2WONA 3NWGA 4K5RA 3MEGB 1E6YA 2VPZB 5H9FJ 5THWA 3TVZA 2CPZA 4UUXA 1XMOF 2AYMA 4CI0B 4C8ZA 3M8PB 2P6SA 2MKKA 5DDQC 3IBWA 1NKBA 2ABYA 3K8VA 3SDEB 2FJVA 4IH7A 5HN0A 1TKXA 4HLBA 1GTEA 4MK9A 1WG4A 2MZTA 1OO0B 2D9PA 4ZHRA 4HH1A 4KV8A 5I3PA 5CA5A 4CO0A 3I5BA 4IRDA 4Y2CA 1J2VA 1FTRA 3WC2A 4O44A 2YWEA 2ZH5A 3SSQA 2X1BA 2RU3A 3LF0A 1G3OA 3K57A 3KK2A 1NEEA 2MSTA 2AJFE 5BYQA 1VQNS 3WBZA 1VRUA 1SQEA 3PM9A 4QU7A 4J37A 3GV8B 1M5OC 1R0AA 2RQKA 3OTOF 4LSLB 2XLJA 3DI6A 1ZM4A 1HNVB 2QMXA 4R8UA 2B9WA 5GMKa 2MKIA 2IM2A 2Q1LA 1KLMA 4DJBA 3H20A 1HMVA 4X4VA 1TL4A 1ZPWX 2ROGA 2XO7A 1C0UB 4WKRA 4ZPDA 4J9QA 4QIEA 2F4VF 2N3OA 3CCRS 3KLEB 1KTVA 4B08A 2X51A 3JTPA 1RT7B 4RBUA 4N8NA 2UUAF 3QJPA 4H4MA 2JWNA 2OFGX 1N36F