4KV8B

Crystal structure of hiv rt in complex with bilr0355bs
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
407
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N- versus O-alkylation: Utilizing NMR methods to establish reliable primary structure determinations for drug discovery.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV Reverse transcriptase P66
total genus 113
structure length 407
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kv8B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B04
5EWEA 4O4RA 3CJ5A 3MEEA 4ZP9A 4ZVFA 4RW7B 1N6QA 4OL8A 1IKWB 1S1VA 3CO9A 4ED6A 1SUQB 1S6QB 1FK9B 5F8MA 3CIZA 3DLKA 1S9FA 3JSMA 1S1XA 1T03A 1LWCB 2AQ4A 1RT7B 3JYTA 2UUWA 1FK9A 3H98A 3N6LA 1OS5A 4I2PB 4Q8EA 4NLUA 4K4TA 1DTTB 1S1TA 4B3OB 4G1QA 4O4GB 4NLSA 4Q45A 1VRTA 2B5JB 3CDEA 3NBPB 4R5PB 4Q44A 4ECWA 3RBEA 3LANA 1JLAA 2HNYB 1RTHA 3V81B 3UDLA 1TKTA 2IJNA 4ZVEA 2ASDA 3DRRB 2UVWA 3QIDA 4ZP8A 4KO0B 5L1KA 1JLGB 5C24A 4XPEA 3DYAA 3BQ1A 3BQ0A 2W9CB 3SI8A 3I5CA 1RT6B 3C6UA 5J2PB 1CSJA 5I42B 2OPQB 2J6UA 2B6AA 3CJ2A 4LSNB 4NLYA 4RNNA 3G6YA 4EYIB 3DOLB 4ICLB 2RKIB 3NAIA 2OPPB 1S1VB 4H54A 2R8GA 3T5LA 2FLPA 2R8HA 4LQ3A 1GX5A 4EO6A 1WNEA 1RT4A 4MIBA 4NLVA 1LWFA 4IKAA 5F8IA 2WONB 3KMQA 4WE1A 2AGOA 5EDWA 1TV6A 1UWBA 5KFUA 5C25B 3BGRA 3Q8SB 4EBDA 2V0NA 2BQRA 1T05A 2FLNA 1DTTA 1S1TB 4B3OA 1LWEA 5KFCA 3DOKA 2BE2A 1JX4A 1S6PB 1SH2A 5F8LA 2XGPA 1IKVA 3V6HA 4O44B 2FJWA 4RW9B 1S0NA 4TN2A 2WHOA 2QE5A 2AGPA 4K4UA 4EO8A 5JUMA 1HMVB 2YKNA 4IDKA 3MFHA 2JC0A 3I5AA 4TQSA 2W8KA 4ED7A 3PZPA 3I5BA 5L1IA 1TVRB 5KFLA 2FLLA 1S1UB 3DM2B 3KK3A 1BQNA 4DL5A 4KHRA 1C0TA 4PQUA 3QGGA 2W7OA 3DOLA 4ZPBA 5L1JA 3OHBA 3ICLA 4WYLA 3I0RB 1C0UB 3IS9A 4RU9A 3GIJA 1DTQA 4IFVA 4J9NA 3QIPA 5I3UA 5DG9A 2DPJA 2FJXA 3KHGA 1BQMA 2VG5B 3RB6A 2B6AB 3GV5B 4O3PA 5C25A 1TKZA 3MR3A 4ZVHA 3Q8PB 3GIKA 3PJWA 3OSPA 5F8GA 4MFBB 3DOKB 2W9BA 3NMAA 1TP7A 3G86A 5JXSA 3BSNA 3H4DA 5CYMB 4RUAA 4J9KA 2J6SA 3ISNC 3HVAA 3M8PA 1T94A 3MEGA 3NGDA 3MECA 4F4YA 5KFOA 4KE5A 3NBPA 3H5UA 3CJ3A 1TVRA 4NLQA 4NRUA 3KLGB 1IKVB 4TYAA 4O3QA 5KFHA 5DG8A 4MH8A 2GC8A 2IC3B 3IG1A 2IM0A 2YNFB 4NLXA 1RT1B 2BANA 1S6QA 1EP4B 4KSEB 1RA6A 3KLEA 4TY9A 3RB3A 2V9WA 3H5XA 4FS2A 3NKYA 5KFPA 4RW7A 3QIPB 3C6TB 1RTIA 5J2MB 5I3UB 4JV0A 2C22A 4JV2A 1TL1B 3UQSA 1D1UA 2ZD1A 2HWIA 5L1LA 4F4WA 3DLKB 4HYKA 3PR4A 5KFWA 3QO9A 4O3OA 5KFAA 3FFIA 2OPRA 2XC9A 5KFQA 2ZD1B 2E9TA 3BQ2A 4J9SA 1EETA 3V6JA 4TLRA 4H4MB 1C1CB 5C42B 1J5OB 2AX1A 4R8UA 3PW7A 4WZMA 3BR9A 3GIIA 1TL3B 5DG7A 2FVCA 3KLVA 2ILYA 5EUHA 4IH7A 1RT5B 1MMLA 1RT5A 3DLGA 4ZHRA 2FVSA 1S48A 2IM1A 4QWEA 1S6PA 3M9OB 2R8IA 4EBCA 1R0AA 1XR6A 5KFVA 3DRRA 2ZKUA 1JKHA 5KG1A 4MK8A 5EWFA 5HBMB 4NLTA 4EEYA 4H4OA 3D5MA 5F8JA 4ZVGA 3MEEB 2ASJA 4NLPA 3MEDA 2D3ZA 1QAIA 2OH2A 3DRPA 2FVQA 4ICLA 1S97A 4IR1A 1T03B 1TKXB 2YNGA 1K1QA 1RTJA 4ECYA 3OHAA 4IG0A 4ZPDA 2AU0A 2R2RA 4K4ZA 4I2PA 2QV6A 1SV5B 3TVKA 2UVRA 5KFBA 5EWGA 3DLEA 1N5YA 2IMWP 2JEFA 2UVVA 2ATLA 3ITHB 3JSMB 2IAJA 3RBDA 3OSNA 1MU2B 4H4MA 5C42A 5HP1B 1NHVA 4NYZA 4R8UB 2XCAA 3RAXA 2AX0A 3OL8A 1RTHB 3H5SA 3MFIA 3OLBA 2YNHB 3H5YA 4O4GA 4Q0BB 3MR2A 4NCGB 2E9RX 4EYHB 1Z4UA 4DG1B 1S49A 5J2QA 1LW0A 1LW0B 2HMIB 3Q8QB 3FSIA 3DYAB 3N6MA 1DTQB 4IFVB 2WRMA 3D28A 4G3IA 2IM3A 4Y3CA 2IC3A 4NLDA 4RNMA 5J2NB 2HMIA 5D3GA 4QWCA 1SUQA 3DMJA 1S9EB 2AGQA 3E01B 1NNDA 3MEDB 3KK2A 3H59A 4RW4B 2OPPA 4RW6A 3T19A 5KG7A 4DL4A 1S9EA 3KLHB 4Y2CA 1DLOB 3GIMA 2W9BB 3DRSA 5DGAA 4IRKA 3TQ1A 3SFGA 2IAJB 5C5JA 2IBKA 3IGNA 4YMEA 2HWHA 4NZ0A 4O44A 2UVUA 1LWEB 3QZ8A 1JLAB 2HNYA 1RA7A 5KFTA 2BQ3A 4WFXA 1JLBA 3OL6A 1JLBB 3V81A 1NHUA 4TXSA 2J6TA 4LSNA 3C6TA 3EPGA 5DQGA 2RKIA 1RT6A 3C6UB 5D3GB 2JEGA 4J9QA 3HHKA 1HYSB 4O3SA 4IG3B 4ED1A 1RYRA 5KT2A 4F4ZA 1D0EA 1BQMB 3LAMA 1YVFA 5F8NA 4DL2A 2I1RA 3M9MB 1S1XB 5KFEA 1T05B 3ISND 1JLEA 1HNVA 3IRXB 4J9OA 2XCPA 2ZE2A 3I0SA 4NLWA 3I0SB 4ECQA 1JLQB 4PUOB 4K4VA 4Q43A 2E9ZA 4WZQA 1RT2A 4Y34A 1ZTTA 1HNIA 4EBEA 1S0OA 3Q8RB 1REVB 4RZRA 5HBMA 2YKMB 4IOBA 4ECTA 4URSA 4IDKB 1ZETA 5FDLB 3PVXA 3SFUA 1QE1A 4HKQA 3IG1B 3H4BA 4ECXA 3KLFB 3KLFA 3IGVA 3NAHA 5F9NA 4RW9A 4J9MA 4K50A 5FDLA 3CJ4A 4NLRA 5J2QB 1I6JA 2DPIA 1C0UA 5KT4A 5C24B 4KFBB 2FJVA 2WCXA 2R2UA 3PW5A 2GIQA 1IKWA 4QWBA 3GV7B 3LP2B 3CWJA 3CJ0A 5KFKA 2W8LA 4Q8FA 2WOMB 3E01A 1KLMA 3FFIB 3LP0A 5HP1A 3LP2A 3GILA 2C2RA 2JEJA 4ED3A 1GX6A 2VG7A 3DI6B 2XI3A 5KFMA 3H40A 3HVWA 2R8KA 1HPZA 4TY8A 3DRSB 4QPXA 1FKOA 3KMSA 3PJXA 5KFDA 4ECVA 5KG6A 4YR2A 1RT2B 1RTDB 3CDWA 1LW2B 1TKTB 1T3NA 4URGA 1S1WB 5HLFB 1TQLA 3V6DB 3QGHA 4JUZA 4RNFA 1HQUB 3M8PB 3DMJB 4F50A 3QZ7A 4H4OB 1S10A 4MIAA 4KV8B 5J1EB 1S1UA 2YNFA 3DM2A 3KK3B 4WYWA 1JLCB 2RDJA 1SV5A 4IQXA 5KFYA 5KT7A 4J9PA 3HVTA 2V4RA 1RT7A 5DLFA 3FQLA 5KFSA 5KG0A 5KFIA 3DI6A 1HYSA 2WK4A 4DL6A 4ECZA 1RT3A 2WONA 4IH6A 4ECSA 3OL9A 2HNZA 4IFYA 2GIRA 5HROB 4YQWA 4KKOB 2V4QA 1EETB 3BGRB 2XI2A 5KFGA 3GYNA 1JXLA 2OPRB 4WFYA 4KB7A 2HNZB 4MFBA 3ITHA 2ZE2B 1SH3A 2FVRA 3EPIA 1R0AB 4TYBA 5KFFA 3PW0A 3V6DA 4WXWA 3KHRA 3KK1B 1S9GA 1S0MA 3TAMB 4ZHRB 2YNIB 5KFNA 3LAKA 4DG1A 3KNAA 1QE1B 4ID5A 5J2PA 4Q0BA 2I5JA 2F8EX 3PHEA 4PQUB 2W9CA 4PWDA 2B43A 2CJQA 5CYQA 4FS1A 3PW2A 2HNDB 1TKXA 2YNGB 3QYYA 4IH5A 4ZP6A 3IS9B 2XWYA 4O3NA 4IR9A 4ED0A 1HQEA 2JLEA 1HQEB 2OPSB 2OPSA 2ASLA 5J2NA 1RAJA 4JV1A 3CVKA 1N5YB 4K4XA 3KOAA 2VG6A 3QLHB 3KJVB 1QUVA 3MR6A 2RF2A 4K4YA 1RT3B 1LWCA 4X2BA 2BE2B 3UPFA 3DLEB 3HKWA 1FKPA 5KFJA 1FKPB 4K4SA 1K1SA 1N56A 2RF2B 4ECRA 1C1CA 1REVA 3MR5A 1C2PA 4R5PA 5KFRA 4QWDA 3GQCA 3CDUA 4LSLB 3V4IA 2B5JA 4NLOA 3BSAA 5DQIA 4Y2AA 5KG2A 4KFBA 1JLFA 2FVPA 2ALZA 5CYQB 3BJYA 4I2QA 3UR0A 2IA6A 1JKHB 2W7PA 3KLEB 4RUCA 2I5JB 1HMVA 2YKNB 2VA2A 4XO0A 1JIHA 2HAIA 3LP1A 5KG4A 3LP1B 3M8QB 4KO0A 2VA3A 2OPQA 5I42A 3PR5B 4DL7A 3KHHA 3LP0B 1N6QB 4GC7A 1DLOA 1RTJB 4GC6A 3T1AA 4KAIA 4PUOA 5F8HA 5DLGA 3QLHA 5T14A 4RNOA 4RW4A 4FBTA 3IRXA 1HNIB 1ZTWA 1JLQA 2C28A 1S1WA 5HLFA 1MU2A 4WXOA 3DLGB 1HNVB 1JLEB 3JYTB 4ED8A 1XR7A 5F9LA 1XR5A 2BRKA 1KHVA 3BSCA 2D41A 3MF5A 4YP3A 5L9XA 2WTFA 5KT6A 3TAMA 3KLGA 1RT1A 2BANB 5KG3A 2YKMA 1JLCA 1N4LA 1JLFB 4KV8A 3BREA 4LSLA 3V4IB 1BQNB 4U7CA 2CKWA 5KFZA 3BSOA 2BR0A 1QAJA 4MK9A 3NL0A 3V6KA 1RYSA 2W9AA 1TL1A 2WB4A 2HNDA 3KHLA 4ED2A 4FBUA 3PW4A 3QO9B 3KK2B 4IG3A 5DQHA 3M9NB 2IJFA 4LQ9A 2VG5A 1HPZB 2BRLA 4R0EA 4TY8B 5KT5A 3OLAA 2C2DA 4KHMA 1TKZB 4DL3A 4TQRA 3RB0A 3KK1A 4I7FB 1IKXA 4I7FA 3E51A 2R2TA 1TL3A 2VG7B 2RDIA 4WE1B 2YNIA 3LALA 3VQSA 4J9RA 5KG5A 4RNHA 1W25A 1J5OA 1LWFB 1C1BB 1S9GB 4URQU 3QGIA 5CYMA 3G6XA 4J9LA 3MTKA 3KLIA 3KLIB 1TV6B 1UWBB 3MECB 4O3RA 3FRZA 4PWDB 3DDKA 1C1BA 4KBIA 2XGQA 4QW8A 4M94A 1RTDA 1HQUA 4ZP7A 4IRDA 4MK7A 1N48A 4ZMMA 2BQUA 2AWZA 1RTIB 5J2MA 2O5DA 3HVTB 4RW8B 4IG0B 4MKBA 4ZPCA 1EP4A 3N6NA 5K14B 1KHWA 5K14A 1U09A 2ILZA 5J1EA 4RW8A 3DRPB 3FDSA 3KLHA 1C0TB 1IM4A 2VG6B 3KJVA 2D7SA 2WOMA 1RT4B 1SH0A 4QW9A 4QWAA 3GV8B 4WFZA 1IKYA 4M95A 3I0RA 4XPCA 1RDRA 2R8JA 5HROA 4IRCA 4IFYB 5DGBA 1VRTB 2R2SA 4YR3A 3OL7A 1KLMB 1IKYB 3T5KA 1IKXB 3EZUA 1S4FA 4KKOA 4NLGA 1LW2A 5KFXA 4YR0A 1VRUB 5KT3A 2IM2A 4G1QB 3FQKA 2JEIA 4ID5B 3H2LA 3G6VA 4ECUA 2D3UA 4NCGA 4F4XA 4ZPAA 1FKOB 3RAQA 1VRUA 4U6PA 2C2EA 4MKAA 2YNHA 4I2QB 3M8QA 2UUTA 1JLGA 4NRTA 3T5JA 3RB4A 2EC0A 3MEGB 4DEZA 2JC1A 4K4WA 3T5HA 1HARA 3IN5A 4RW6B
chains in the Genus database with same CATH superfamily
1RADB 4B3MF 1NK0A 2EEYA 4ZP9A 1YX2A 3QT6A 1BXNA 4ZVFA 3WIVA 2AEFA 1N6QA 4P52A 4C8OA 4OL8A 1Y9OA 1IKWB 2CQDA 2ZBRA 3W62A 4ED6A 2DRBA 4PZVA 1VCTA 2G2ZA 4DZDA 1VQ7S 3M2UB 1QSSA 4OHYA 1S1XA 3BDEA 5GAEI 2AQ4A 3IBFB 2K2PA 1UJ6A 2UUWA 4NMXA 2CJXB 3H98A 4B3TJ 2Y3YA 4Q8EA 1U0HB 3DRYA 1S1TA 2XS2A 5FLXY 4G1QA 1K8AT 3ET6B 4O4GB 2OO4A 2MTLA 1VRTA 2B5JB 3QSIA 4NLSA 3NBPB 2ATCB 4M5NA 5K8PA 2WSFC 3LANA 5GADI 1FX4A 1JLAA 4BBYA 1R7IA 3RBEA 3V81B 2FB0A 2VPXB 2M52A 1TAQA 3I82A 4AD6A 2WZ1A 4ZVEA 1PBAA 3POTA 4KO0B 3QIDA 1NMEB 1JLGB 1WHVA 4MYUA 4BS2A 3D1QA 4RWXA 2EI5A 1VIOA 3NS7B 5HJYA 1FNMA 3I5CA 1EZZB 4C7QA 2XLJA 5J2PB 5FIIA 1Q8BA 1XBWA 1KLNA 2B9XA 3B78A 4EYIB 4KGVB 1UVJA 2GW8A 2DGQA 3P5BP 2CZ9A 3NAIA 4M8LA 3K57A 1H72C 1TL5A 3S01A 5IT4A 4LF5F 2FLPA 2DIVA 2R8HA 4C8KA 4DV1F 4EO6A 5DM7Q 4IKAA 3FJ2A 3THPA 2QEXS 4B9TA 4DSIA 5EDWA 3DLLQ 2MKSA 3MUMP 3BGRA 2W2QP 2ZC3A 1DTTA 4B3OA 5LMUJ 4CO1A 2IDEA 4DQSA 2XSJB 3V6HA 4WF9Q 3CB4A 4RW9B 2EWHA 1I94J 4TN2A 2CQ1A 4K4UA 4PG8A 1WI6A 4DU8A 2W8KA 3MFHA 1HMVB 2YKNA 2BJ3A 2G9OA 2JOQA 3CD0A 4DCJB 2N82B 4ED7A 1YITS 2FLLA 4HTIA 1S1UB 2DGSA 1J5EJ 4UUXA 1Y00A 4W92B 2ALYB 4OZNA 2FHKA 1RHQB 1AFJA 2AZ3A 1IQTA 1WI8A 1UVMA 1F9HA 2RRBA 1ZZNA 2RRNA 2LQJA 3S7RA 3ICLA 4WYLA 1QDUB 2F9DA 1XN9A 2MSTA 4J9NA 3C8YA 4DL0C 2FJXA 4G65A 1BQMA 4RU2A 3RB6A 4O3PA 1IBCB 3FGVA 1OQ3A 5C25A 1TKZA 1YHQS 3MR3A 4HHHA 4Z37A 2OFGX 1QSLA 2A2DA 2BJ7A 5F8GA 3DOKB 1S79A 3GG1A 5GAGU 1TP7A 2R7SA 2EKYA 3BSNA 3SBMA 1YKWA 4J9KA 3RBZA 2P9CA 4GKKJ 2HBRB 3DLJA 3QATA 4M5MA 4X4OA 1E6VA 1Q53A 3OUYA 1SC1B 4C98A 4OHXA 2HRYA 2E7WA 5A8RB 4KE5A 2GGPB 2PE8A 1TVRA 1RHRB 2DGXA 3H5UA 1M1GA 4LF7F 3KLGB 1AYEA 2DGTA 4OJ1A 3OXFA 1R8PA 2AIRB 4NASA 5EX0A 4N47A 2X51A 2R9LA 1X5OA 2UXDJ 4P9SA 2MQMA 4KSEB 2JJ4D 4FS2A 1V5IB 3OTDA 4RW7A 5I3UB 3C6TB 5KFPA 4JV2A 3BBBA 4QIWD 4U9RA 2E44A 1TL1B 2EBEA 3WX8A 1WHYA 1WKJA 4ALZA 3K2YA 3W2VA 5B08A 4HYKA 2QC3A 3PR4A 1A0OB 2BKNA 4O3OA 5KFAA 5GADU 4U96A 4JI0F 4LF2A 5K20B 2E9TA 5AXKA 4LBIA 3BQ2A 4J9SA 1EETA 3V6JA 5ETSA 4H4MB 3Q2TC 3MMCA 1UVLA 3GIIA 2HQGA 4M5KA 4OYMA 1X31C 4M5DB 2ILYA 5EUHA 4PG6A 4F26A 4QWEA 1MG7A 2DGOA 4CLSA 4ZN3A 1S48A 2IM1A 3T41A 2WBRA 1S6PA 3UDCA 2XMWA 2RHQB 5LXRA 3WHIA 4DV3J 1KEKA 1R0AA 1XR6A 2W2MP 2WSEC 5A8RA 4YDXA 1TK8A 3DOMA 2AJ1A 2YWWA 2ZKUA 2R4FA 5KG1A 1X7VA 3WDOA 1MN9A 4D3GA 1QD1A 5L46A 4EEYA 2D3ZA 1RTZA 1N5TA 2QT7A 4I67A 2OH2A 2AEJA 2VBYA 5A2QY 2FC9A 4KGZB 6FD1A 2AYEA 5I3QA 2GMLA 1KWMA 3N79A 4G1PA 4DZ6A 4IR1A 1BD6A 5THWA 5C2GA 3QAUA 1V3SA 2NUUG 3PRBA 3IXQA 1T02A 3R1LA 1SV5B 3M32B 4DS5A 2GQCA 2KRBA 1RKJA 5H9FK 3GJQB 1JNZB 2ZITA 1X0FA 2M88A 2B4UA 3GSIA 3IC1A 3M2UA 4PXCA 2JEFA 3ETOA 1VJWA 3R7SB 3P49B 1MU2B 1FRLA 1AXQA 2YKQA 5HP1B 3ILLA 4NYZA 2XCAA 2NSBA 3E3XA 3VAJA 3W2WA 2DJWA 3HX9A 3KUHA 4G6VB 2DNHA 3JQMA 3U1NA 4OYIA 3QT5A 2ZVSA 4O4GA 2A10A 2MY7A 5ETTA 3MR2A 1RLDA 3HVRA 5MLCV 2ZZNA 2OLWA 4PYDA 2IMOA 1RHJB 4X4PA 3Q8QB 2GNKA 3FSIA 1SBRA 3F44A 3DYAB 1FFGB 2SXLA 2V4JB 1DTQB 3N6MA 4O0NA 4G3IA 3PRDA 2IM3A 4OHZA 2IC3A 2DHXA 1Y3KA 2QG9B 5B0AA 3FBBA 1NHKL 4K59A 1VI7A 2GZOA 1Q78A 4DPXA 2MZ1A 2QL7B 1TL4A 3J7YI 1HD1A 1U02A 2G13A 3DLHA 3MEDB 2UXBJ 4AFFA 5KG7A 3GCXP 1HA1A 3ILOA 2HKEA 4FN5A 2N4CA 3TQEA 4IUFA 3IMQJ 4ELVA 3ENAA 1QTNB 3TZYA 3GIMA 2V6AA 3TOQA 4IRKA 4ZLLA 3SQGB 1DBDA 1KQFB 2MQPA 1U2RA 3AD9C 3MM5A 1YK9A 3CMQA 2FC8A 4Y2MA 3PYEA 2HWHA 1KP6A 2E29A 2E7XA 2IRXA 4JI2F 2W1BA 3KKFA 1NJXA 2HNYA 2YXLA 2HFSA 3QWUA 4QU7A 4WK1A 1WHXA 3CCRS 3BGUA 4J9VA 1HD0A 3UD5A 2J0WA 1FEEA 3PFEA 1IWAA 4B9MA 2G2OA 1JLBA 1Q0NA 3F0NA 4MKYA 4DV3F 1X9MA 4TXSA 1OY6A 4L72B 1SKSA 4QCLA 2HIYA 1YJUA 4YS2A 7AT1B 4E98A 5L39A 4FZVA 4ZJQA 4HDGA 3MM7A 5F3TA 3MD1A 3TA0A 1U4BA 1N33J 2CADA 3M2VA 2BE7D 4F4ZA 2FHJD 1YVFA 3LAMA 3EZ5A 1FERA 4XK8C 2HK3A 2KU7A 2ZZTA 4DSLA 1U1KA 2FZKB 3BYPA 2VOOA 3QJJA 1O5JA 2VF3A 4RKUC 3TYTA 5CD4H 2QA4G 3GR0A 1PJ7A 4J9OA 2RAQA 4NLWA 1EB0A 2C3PA 2CQHA 4PUOB 2M9KA 3NCRA 3UVJA 2JRSA 4LT6A 5GMKa 2F40A 1ZBTA 4O0IA 2HHTA 1FRHA 2MQLA 1HNIA 3R6GB 1S0OA 1ITPA 4CLLA 4X4TA 4N5SA 3CXCR 4IOBA 2CUYA 1OPIA 5B0EA 1YJ7A 2HQCA 3PDNA 1FDBA 1QSYA 4X65F 4B3SF 4OLOA 2W7AA 1S7IA 4P73A 4DLGA 4ILMA 2OHDA 5F9NA 2HRTA 1RAOA 4J9MA 5FDLA 2QN6B 2YKPA 1BLUA 3M6WA 1UPPA 3R6LB 3RUBL 2KXNB 1EQ0A 1XMQJ 2KN4A 1K47A 5HL7Q 4F02A 2HFZA 1V5VA 3C15A 3EVWA 1T0TV 3BKUA 1V6HA 1P9YA 3G96A 4H4KA 3CC2S 4QWBA 1KVJA 2NZ4A 3KJQB 4OX7A 5AXMA 3VVTA 4ANEA 5HQ8A 1S12A 5KFKA 2CJKA 2V2KA 2MPUA 3G82B 3E01A 3MUTP 3AOCA 2QMUB 2VBWA 4PXBA 2NSCA 5A76A 3LW5C 1XNRJ 5CYJA 4LUBA 4MYTA 2MMYA 1R8HA 4C9DA 3HVWA 4QPTA 1X4GA 1TKDA 1HPZA 4QPXA 3KMSA 4L3NA 2VODA 3TW0A 5IFMA 1RT2B 3M30B 1ZYQA 5EN1A 3LGNA 3BO4A 2E1CA 2WW8A 1M1KT 2RQ4A 3KJFB 3FEXB 2VQFJ 4IO1A 5HLFB 1GMVA 5CXTA 3V6DB 3FZ2A 2V2QA 4ZN1A 5KOWA 1Q1KA 1SKWA 2YQ1A 1SL1A 1CJVB 3DMJB 1XJWB 3BN7A 4H4OB 1GXTA 3D6MB 1S10A 2FJEB 1X5TA 3TJAA 3MPYA 5J1EB 1ZAWA 3FSXA 1S1UA 2YNFA 3PNIA 2EG1A 1U1RA 4FYXB 2AD9A 1SV5A 4OYBA 3JQJA 5KFYA 4ZITA 1H73A 2F8HA 5KT7A 3FQLA 1Y5IB 2EK1A 3IA0A 4ZCKA 5KG0A 5B0DA 3J7Z5 3Q8YA 3M8RA 2VQFF 1HYSA 4FVCA 1U2FA 4ECZA 3CGIA 2EC2A 3GJSB 1YRXA 2VFVA 4F67A 2QZ8A 1YBUA 3BGRB 1LEOA 2K3IA 3OFEA 3GYNA 4OX9F 1FRMA 2B4VA 1IWGA 3VTIA 1JXLA 2H4YB 4DPUA 2HNZB 1D9AA 1NRKA 4DJBA 1R0AB 4M5GA 4YB1P 5KFFA 5IXUA 1JJCB 1GXLA 4HT5A 2OIHA 4DFKA 4YB5A 3T1YJ 3IR7B 4F3MA 3S8SA 1Q8LA 4YOEA 2JLGA 1FA0A 1QE1B 3QQCD 4ZVUB 2LEPA 2YKAA 2BE9B 4USKA 1OY8A 4B17A 4UUWA 3O3LA 4WU3A 4UTGA 5SUHA 4FS1A 2HNDB 1TKXA 1NLKL 3QYYA 4IH5A 4O3NA 3TZXA 4IR9A 3VV2B 4CCHA 4C4WA 1IUJA 1FF2A 4C8MA 1HBNB 4CYUA 1NK9A 2VKRA 1HQEB 2OPSA 4DWIA 2XQCA 4DQPA 4H4KC 3CVKA 3KOAA 3CJSA 1WD6A 4C0OC 4K2JA 3KJVB 3QLHB 1WELA 3KG1A 1QUVA 3IR5B 3S6EA 2RF2A 2ACYA 3C2PA 3J81j 2LA6A 1FKPA 5KFJA 1FKPB 4OX8A 5F0UA 2GJ2A 4C0HA 2ZDOA 1U0HA 3L3CA 3ILJA 4ECRA 1MLAA 3K5OA 2KFYA 2CQPA 1REVA 3MR5A 2I9SA 4CTAB 2QRRA 1WF1A 5D0GA 1FTRA 2I6WA 1AW0A 3OFFA 2O67A 3Q8VA 2NXUA 2WVBA 1F3FA 2OMOA 1HL6A 1NPPA 3AT1B 3HJVA 2VBXA 4LBPA 4DR4J 1UW4A 2FVPA 2Z2LA 4AE5A 5B09A 1F5BA 3R7NB 3CW2C 3VZHA 4WFBQ 4RUCA 4XO0A 3TVZA 2HAIA 4DUYF 2XO7A 2MKYA 1FXDA 1NKCA 4DFJA 3A8JA 4Y65A 2BABA 2N7CA 4DL7A 3LP0B 2HAFA 4I68A 4GC6A 3GCWP 1JJ4A 2VJVA 2MXYA 5ITHA 3MWBA 3T1AA 1JXVA 3QLHA 2GFFA 2RS2A 1UJ5A 4UF4A 5EX3A 2KFNA 5HSPA 1S1WA 2XMTA 4JI6F 3SXLA 1MU2A 1K0TA 1JLEB 4ED4A 2VICA 1YSJA 2KFZA 4RX6A 5F9LA 1XR5A 1ZH5A 4CTAA 1KHVA 2KM8C 2OI2A 4C3LA 5LOQA 4P7TA 1FXLA 2PC6A 2KG1A 3A13A 3KLGA 2BANB 2CVIA 4OI6A 3SCIE 1NDCA 2CDQA 1VQKS 3FC9A 3OBIA 1NO8A 1JLFB 3HSGA 3BREA 4ZS6A 4GKJF 2RE1A 2GAGC 1YTYA 1KVKA 2COLA 2FHOB 3M05A 3M6UA 3Q89A 4Y2IA 5BYRA 4U7CA 3BSOA 4OI0A 2RT3A 4JOUA 3SCKE 4LVNP 4U7UK 4YDDB 2PEBA 3FEYB 4I0WA 2RILA 5ETKA 1R6YA 2NYIA 3FBFA 4FNIA 3PW4A 4L76A 4DS4A 2QJ3A 3ZNUA 1QVGR 1VQNS 2X1AA 4IG3A 3M9NB 4C3MA 1N54B 1HPZB 5CQGA 4LBHA 2V63A 2YQ3A 3PHTA 1TKZB 1VQ6S 4X66F 1QAYA 3CCVS 5E7OB 4DX5A 4TQRA 2OTJS 1IKXA 5HK4A 1FESA 2F9JA 2IPOB 3VQSA 4DQIA 2DNRA 2M7SA 2YVSA 1FD8A 5KG5A 4URQU 1WG5A 3A8IA 5AE3A 3MTKA 3T6BA 1NDLA 2KH9A 3HM9A 2YPYA 5BR8F 3RW7A 1MROA 4DF8A 4QW8A 4DR5J 2DR6A 1RACB 3QNWB 4IRDA 2RQKA 4MK7A 5DDRC 4FYDA 1SXLA 3ZTOA 4DR2F 5ETRA 2BQUA 5L38A 2O5DA 2YY3A 2BW2A 4XIUA 4RW8B 2IHR1 1HWIA 2HQ3A 4PKDB 2FZCB 3R5DA 4KRWA 1KHWA 3J7AN 2OAUA 4Z7YA 2FGOA 4B9LA 3C16A 1NEEA 1W7WA 3N4WA 2D7SA 2VG6B 4WIIA 1SH0A 1RT4B 2AYMA 4ZCMA 3GV8B 1IKYA 4M95A 3I0RA 4XPCA 3PJ9A 5HROA 1S99A 2ZH9A 1VRTB 1S7HA 4PXDA 4Q2MA 4YR3A 4DV0F 5H9EJ 1DQ9A 1KLMB 4EZ6A 1XTZA 2ZVIA 5IOLA 3I4HX 3SDEA 4A8KA 3T5KA 1IKXB 1F5AA 2NPIA 1S4FA 3UD3P 4K5SA 3B54A 1RABB 5KFXA 4DUZF 4DF4A 1FJCA 2XMKA 1DY3A 1V3ZA 3G6VA 3H2LA 2HQFA 2D3UA 4IYQA 2BACA 2W24A 3RAQA 1VRUA 3NLCA 4U6PA 1TFYA 4MKAA 3R1HA 2EBGA 5MAOA 4I2QB 3H20A 1P9QC 4X66J 1DAXA 5CHCB 4DV0J 3NCQA 2GVDA 5ETVA 3KDOA 2BMBA 1Y4ZB 4OHWA 2ADCA 1HARA 1UJ4A 4JI3F 3D1OA 3GONA 2C2NA 2C1EB 1IXKA 3HULA 2UUCJ 5IC4B 1FDDA 3MUVP 3US5A 4C8YA 1RAGB 3CO9A 2XMVA 5F8MA 5IQQA 3CIZA 3DLKA 3G8SA 3BBFA 3JS9A 3Q8UA 3HT3A 2C2KB 1RT7B 3GYGA 3JYTA 2KYXA 1FK9A 5A8WA 1MMNA 3AODA 1SQEA 2XSJA 2ZOGA 5CABA 1J5EF 4NWBA 1T9TA 2HURA 4GRSA 4W98A 2WSCC 2M70A 1HNXJ 4RBVA 4F4WA 4C3KA 2KI2A 4CM0A 2J5AA 2QMXA 3CDEA 3GU0A 1P8GA 4ECWA 1TK0A 2HVIA 1NU4A 3L7OA 5K8NA 3PM9A 2FYXA 5A6WA 4ER8A 2KVQE 3DRRB 1FVQA 3RJMB 1I51B 4MAKA 4M5JA 2AP6A 3DYAA 2E5HA 2CJAA 3D0GE 4PWWA 2PMZD 3SI8A 1VQ4S 1RT6B 1WHWA 2HEKA 1CSJA 4G1IA 3ZFVA 5K5MA 4UQGA 1Q81T 3PEHA 2J6UA 1EJ7L 2C2MB 4LSNB 3MM7B 4TKTA 2QX0A 4RNNA 4HVZA 4LVOP 2RRAA 4YFUA 1WACA 3MCMA 3NOGA 5SZTA 2PMHA 5E5NA 3T5LA 2HBZB 2M3DA 3L9ZA 1LWFA 3AA9A 4IO9Q 2CQ2A 4YB6A 4WE1A 3HPOA 2XLKA 2DY9A 2HQIA 2OD6A 4ZLPA 4DV4J 4LF6F 2V0NA 4LJMA 1Q82T 1S1TB 5JJBA 1X4FA 5KFCA 3G87A 3TAQA 2BE2A 4CM2A 2CPIA 2HS3A 5F8LA 1QTMA 4ILRA 3EXCX 1U6BA 1TFWA 4WKYA 5A2QU 1F1BB 3GJRB 1FFSB 3HK2A 4EO8A 2I0XA 4KH0B 2R7TA 2JC0A 3I5AA 2RQMA 4NZ7A 3HHLC 3PZPA 3I5BA 5KFLA 5AE1A 3KK3A 4DL5A 1GAOA 3DU6A 1NPRA 2VFSA 3I32A 2RU9A 1PGZA 2X7IA 4DV2F 3DOLA 1A6LA 3W5ZA 1OO0B 1X60A 3IRWP 2ERRA 2J8AA 1C0UB 1KFSA 3OT9A 4U95A 1TELA 4ZLJA 4YHHF 2VB6A 2LXUA 4KPCA 2DPJA 1IJFB 2UUAJ 2VG5B 3CF5Q 3GMGA 3GV5B 1N48A 1D8YA 1SJ3P 1HNZF 4UOFA 3GTYX 1HBMA 2G0JA 3GIKA 3CTRA 1HHTP 1NPKA 1FCAA 2R7WA 3OVSA 2CPZA 2GMJA 3JSYA 2EK6A 5IT9Y 2W9BA 2VPWB 3G86A 3VWSA 2A6MA 3MR7A 3UVJB 4UZBA 5CYMB 4O23A 2YX7A 4I6WA 2HVZA 4UZCA 4F0KA 1VOMA 1T8EA 3JB9k 3O1LA 2EXUA 4LF5J 1UVNA 5T41A 5KFOA 3NBPA 2ZH2A 3CJ3A 2Y9HA 3CEDA 1J27A 4NRUA 1IKVB 1M0SA 4TYAA 2OKQA 4C97A 1R31A 2GC8A 4DFPA 2ROEA 3OFGA 5C2CA 5D0EA 1HI8A 2XMAA 3ZZOA 2YNFB 5D0HA 1NSPA 1EP4B 1RA6A 4S0MA 3KLEA 4ZJLA 3RB3A 3MOJB 2WVEA 1FJ7A 3QIPB 2BV3A 1RTIA 5J2MB 3QRQA 4F25A 3DU5A 2ZD1A 1FWKA 3VZIA 4J37A 2Q43A 1E6YA 2H48B 5E41A 3QO9A 2WBMA 1FFWB 4CO2A 1L3SA 3TWZA 5KFQA 1WOPA 3W9HA 1CQMA 1S4EA 4CLKA 2UU9J 2CQBA 1KKHA 2FJDB 3C14B 1QLNA 1FO1A 5C42B 4QOTA 1J5OB 2HGMA 2AX1A 1RISA 4DV5F 1AUDA 1URRA 3CC4S 1Q5YA 4DXLA 2BXJA 4YB7A 2FVCA 3EVOA 2QTWA 1MMLA 1RT5A 4ZHRA 2CA9A 2Q6CA 1YJ9S 3NGSA 2J0XA 5ETLA 5HQMA 2MQQA 5KFVA 3IAM9 3PCOB 4KR0B 3K59A 4ZJOA 4HH1A 1PIEA 2QSWA 5F8JA 2UUBF 3D5MA 2YX1A 2MLYA 3MEDA 2RHSB 3GFXA 4NLPA 4QR1A 3K58A 1SJ4P 2V68A 4XDCA 1UPMB 2QL5B 4HI1A 3DRPA 5ETQA 5CA5A 3BF4A 2FVQA 5LMNJ 4ICLA 1DZ5A 4CNZA 3D4JA 4KQZA 1T03B 2YNGA 3OR2A 4USWA 1NDPA 3HHDA 2Y1JA 1B7YB 2MZQA 3RW6A 1S57A 4P7VA 2AU0A 4JYAF 2HHSA 4K4ZA 1GMWD 2DNYA 2GMHA 3M32A 4CQ1A 3I9V9 3P96A 4LRFA 3HSJA 2B7CB 3W65A 4N8NA 4ZLNA 2FLOA 1NH8A 3IP0A 1KD1T 2UVRA 2ATLA 1KQKA 3UN3A 3GE9A 3IAS9 2FTRA 2IYIA 3HXMA 4H4MA 1R8BA 3KUEA 4DX6A 5BYQA 3RAXA 3R5GA 4X62F 3PO4A 3BBCA 2CPEA 3MFIA 3OLBA 3BB5A 1K9MT 4FF2A 4HR2A 1ZM9A 1BY9A 3KNGA 4LIRA 4R0JA 3ZTQA 4CLTA 2CQGA 4P2XA 3RRKA 4DPTA 4EYHB 4DV7F 4DG1B 4ATNA 1S49A 5J2QA 1NK6A 1LW0B 2HMIB 5DO2A 2O3DA 1HQ2A 3OR1B 4PQAA 2GJFA 1JMTA 1PC4A 4IFVB 1YJRA 2CZ4A 2WRMA 1M5SA 4M5LA 2UUAF 4FF1A 2ZWPA 4I69A 2HVDA 1LOUA 4QWCA 2KHCA 2XM3A 4BCAA 2DNKA 1FWLA 1YWXA 4LFCF 3KK2A 4NA3A 3H59A 4JV5F 5DDPC 5A6PA 2OPPA 1CULA 2O66A 2KXHA 1NM2A 1S9EA 3FBCA 2CQCA 2G2YA 1UTAA 5E3PA 2MEWA 1FKAF 1DLOB 1TR0A 2E5IA 3A8EA 1FWPA 4ZPTR 3SFGA 5C5JA 2B56A 3Q0AA 4NXMJ 3BM7A 3LTOA 3NGTA 4ZVOB 3VVUA 4UY8T 2DEIA 2AHOB 1B7FA 4QU6A 4UQTA 2HFOA 1OJ4A 3N9UC 3BPSP 2ADBA 3MM6A 1B99A 1HNZJ 4Q7AA 2CNNB 5KFTA 2BQ3A 2ZBPA 2H5EA 3V81A 3NNAA 3W1YC 2NXCA 4LSNA 3HD2A 2A0FB 2BOPA 3C6TA 1XK8A 3TO8A 4NEYA 4U8YA 2V8GA 3C6UB 5DQGA 1FHTA 2JEGA 3FBEA 4N56A 5DRKA 2OSQA 4ED1A 4KIAA 3HMJG 3UE2A 1RYRA 5D8HB 5L9NA 1X4BA 1WEXA 2N3OA 4X4QA 5F8NA 2Y1LB 4R25A 1A7GE 5KFEA 2KT2A 3ISND 1N8RT 1S76D 1HNVA 1B0PA 2J7WA 3MAQA 2ZE2A 4ECQA 1KQSR 1JLQB 2PSZA 2YPZA 4DI6A 1VS3A 3AAWB 3C3LA 5EGYA 1Q8IA 2GQ2A 5HBMA 1YGYA 4URSA 3J81Y 1G7CB 3VF0B 2LXIA 5HN0A 3SFUA 3H4BA 3SMZA 3IG1B 2GV1A 2LMIA 2J9DE 3GYXB 3IBWA 4KGKA 2DIUA 4ECXA 1N34F 4I6AA 4RW9A 3A8KA 3MPDA 1BGXT 2VC0A 3CJ4A 2LECA 2HHHJ 3MZIA 3MCSA 3R5AA 4NYPA 2MGZB 1GXUA 2BW7A 2N3LA 1TU0B 2ZBQA 3TEGA 3UWTA 4EWTA 4DV5J 3VGUA 3QJPA 1S5ZA 3RRGA 2D1CA 2WCXA 3SV3A 1BUXA 4LF1A 3SCLE 1SKRA 1SJFA 3M8WA 4M1KA 2FJAB 2VC1A 3TARA 3WC2A 1KS2A 4ZVPB 4ZVTB 1CVJA 3CD6S 3OVAA 3CJ0A 1IBLJ 4Q8FA 3G82A 2D74B 3FFIB 1VGYA 3HSDA 1BQXA 3GILA 3MM9B 2MY8A 3T9ZA 4LF9F 2XI3A 2DRDA 4QIVA 5KFMA 1SJ1A 2V8DA 2APOA 3U1LA 3J80U 3W5XA 3DRSB 1TTHB 1WWHA 2MLZA 5KFDA 4ECVA 5KG6A 2LP4A 4YR2A 3MM5B 3L95X 1R89A 3EGNA 1L3UA 1FT8A 1D9FA 3OFHA 1SC3B 3CDWA 3ZTSA 1LW2B 3W3SA 1TKTB 1NDKA 2H51B 1S1WB 1TQLA 3UN5A 4URGA 1R6VA 4NEZA 3WIUA 3GFHA 4JUZA 4FNHA 3M8PB 4Z2XA 4F50A 1S72S 3QZ7A 3D6HB 1HBNA 2QLJB 4WIQA 2LU1A 3HHLB 3DOMB 2P8IA 1ZAVA 1RWXB 3P4UB 3KK3B 2CYYA 2EFOA 4NXNJ 1BWEA 4WYWA 5JVHQ 3L4BC 1B70B 1Q79A 1RGVA 3VAMA 2G4BA 1Q95G 1YZ7A 5G4DA 1X9SA 4DR1J 2I38A 5HO4A 1FE4A 1AZSA 3DLBA 4KYZA 4DL6A 4C0BA 1RQ0A 2HIQA 1TL7A 3OL9A 2HNZA 1MWZA 2GIRA 4Q5VA 5HROB 3ZC4A 4YQWA 2QLXA 1LFPA 2X3GA 2XI2A 2MLXA 5KFGA 3W60A 4TU7A 1NKBA 3GJTB 1GNKA 2M2BA 2QSFA 2ZFHA 3EPIA 2BM1A 2HZCA 1T9VA 1VBKA 2G0CA 3DC2A 4TYBA 4WXWA 4PXEA 3VALA 2DK2A 1HNWJ 3BEGB 3OR1A 3EE3A 2JDJA 1WTFA 4JP8A 1Y7PA 3TI0A 2DH7A 3LAKA 1S77D 3OXLA 1RE1B 2XHCA 1RUSA 2ZZMA 4ID5A 3K5LA 3PXGa 2I5JA 3CCUS 2F8EX 3TJ9A 3PHEA 4PQUB 3ETMA 4DOZA 1VQ9S 1MROB 2IDLA 3KFWX 4NI2B 4WK3A 3PW2A 1GK8A 3N28A 4ZP6A 1KDNA 2XWYA 1WF2A 1J2VA 3FNNA 2ZJQQ 2FHJA 1WC1A 1HQEA 2OPSB 1X4EA 3CO0P 3ADAC 4OIXA 3LPYA 2MKKA 3OTOJ 5ETOA 3PIPQ 3RRHA 2ASLA 4K4XA 1ZA1B 1NUEA 2UXDF 1KN6A 1VC5A 3MR6A 1H74A 4X2BA 2CPDA 1CJUB 2RQCA 3PX0A 3DLEB 2DVIA 4JV5J 2K8GA 1VLOA 4OI2A 2HW3A 2B51A 2AJ2A 3IWXA 2LEAA 1KVIA 3FK4A 3GG0A 1KOOA 2K06A 3M7VA 4DR4F 2XS5A 1GEHA 2BOAA 3DCAA 4CO0A 5HMZA 5GAHI 3PKYA 4CO5A 3UI3A 3G71S 2BVZA 3TA1A 1HBOB 5AJ3F 2VQEJ 4LREA 4A8WA 3BSAA 2IIHA 2HFNA 2ZBCA 4KFBA 5KG2A 5FJ4A 2ZWOA 3NGKA 2RVJA 5CYQB 1CQNA 5E2QA 3UNGC 4ZK7M 3BJYA 4WFAQ 4AQYF 2XYHB 4F2SA 4NYOA 3KLEB 2C2ZB 2I5JB 2RUGA 4YN3B 2HZAA 3WX4A 2R3VA 2MHEA 3LP1B 3KDNA 5HI7A 1DURA 2OPQA 2V5HG 4N77A 5ETNA 5ADZA 5DM6Q 1JJHA 4WCEQ 4KC5A 4OZ2A 1KBRA 3CJKB 4L74A 2OEMA 1NK7A 1N6QB 3HFZB 3VAKA 2Y0BB 1RTJB 5CCMA 2MKJA 3SQOP 3JQKA 3ZZZA 3SCJE 4FBTA 3IRXA 2ZH6A 1RWKB 2HFUA 1E6VB 3NCPA 2C28A 2HK2A 2VPYB 3ZNJ1 4QYZJ 2UUBJ 4BWJA 1U1LA 3CPWR 1X4DA 2BRKA 3BSCA 3TX0A 1B4SA 2D41A 5L9XA 1RWWB 2ACMA 4P10A 1RT1A 2DHAA 5KG3A 5KT6A 1JLCA 1B3TA 3SYZA 5KFNA 4LFBF 4B3TF 2NQPA 2H1YA 4KV8A 4QQBA 1IBKJ 2XO6A 5HATA 3H8YA 1ZOTA 1PYSB 3V4IB 1EQMA 2E5LJ 2BR0A 2CKWA 4OFZA 1RKIA 3V6KA 2W9AA 1TL1A 3Q86A 2HNDA 3VR1A 3FMWA 1WOOA 3TR5A 8ATCB 4FBUA 2L48A 2HQDA 1K73T 3KK2B 4DPYA 4P2MA 1UFWA 4WP3A 1VC6A 2VG5A 2EFGA 1PAUB 4FKYA 2V8VA 4R0EA 1FDNA 2ZBIA 4KHMA 1FE0A 3OLAA 1F6TA 2DGVA 4DL3A 3ONQA 3H90A 4DR6J 3DHWC 4I7FA 3CDAA 3DN9A 2R2TA 4YEAA 2RDIA 5JVGQ 5D0RA 2YNIA 4J9RA 3PO5A 1IN0A 1H2TZ 4ES2A 1LWFB 1C1BB 1S9GB 3HO1A 4K50A 2CNKB 5IQ6A 1FJEB 4J9LA 1U8SA 2C3YA 1NJZA 4F8RA 2UV8G 4JI8F 2J76E 1PO6A 4KTQA 4RJVA 3ZZUA 3TUJC 3FRZA 3Q83A 4PWDB 2RDDA 2XGQA 3X3UA 3B4MA 3THVA 3BN4A 3M1VA 1HQUA 3KJNB 3QBCA 2VUGA 3QRRA 1NZAA 4K2XA 2Q79A 1WSRA 2RU3A 3RR7A 2JZ5A 2Q6BA 2Z56B 3R5BA 1UW9A 1P1LA 3FEZA 4A8QA 4LRAA 2YWGA 2DGWA 2WAQD 3C16B 4IG0B 4MKBA 4PABA 1EP4A 2HS4A 4ZPCA 5B0GA 1WUUA 4CH1A 2M8DB 3N6NA 5K14A 2BDPA 4WKRA 2IFXA 5J1EA 5A8KB 2KDOA 1D3WA 8AT1B 1X9WA 5GAHU 1IM4A 4WP8A 2A1BA 3VGTA 2WOMA 4QWAA 3KTQA 4NXMF 4WFZA 1DQAA 1RDRA 4ZVQB 3PV8A 2R8JA 3MAAA 4DR7J 1IBKF 1OWXA 2HHUA 4OI1A 1FXRA 2E5LF 1T95A 2Z4PA 4F7VA 2P6SA 1AA1B 1HR0F 5T7LA 1M1HA 1LW2A 3AQPA 3TNVA 4YR0A 1VRUB 2R7RA 2AMCB 5D6GA 5GMDA 3H42A 3OTEA 4G1QB 4UOHA 3OTOF 3G9CA 4ID5B 3T3FA 2XYGB 1FKOB 2VH7A 2ZEJA 4ZPAA 4PPZA 7FDRA 2V8HA 2YNHA 2GCFA 3TX8A 3M8QA 4NRTA 3T5JA 5IS2A 4DV6J 3K0JA 1RAFB 4DEZA 4WU2A 3EGWB 5IWAF 1SB6A 3CJ8A 2LQ8A 3M4XA 1VHFA 2D69A 5M2UA 2GX8A 4O4RA 3CJ5A 1HKAA 1O8BA 3JSRA 1ICEB 2R7QA 4NI2A 5B0FA 1LKZA 1S1VA 1XMBA 1TL7B 5ETPA 1SUQB 1PG5B 1FK9B 1WEZA 3IO1A 5A8WB 2ZH7A 4I56A 3JSMA 2M0GB 1H7XA 3QT7A 5CCLA 2XLIA 1F3VA 2K1RB 1T03A 3D9BA 1LWCB 1VFJA 4LSZB 1RBAA 1NSAA 3D66A 1OS5A 3H0PA 4I2PB 1CJKB 5IV4A 3P45B 4NLUA 2L9DA 2LA4A 3CD7A 2ZM6J 2CPYA 3LQVA 3MAHA 4DR3F 2JL9A 1YJWS 3EGVA 2XYPB 2JVRA 5LSLA 4R5PB 4Q44A 1IR2A 2HNYB 1F0XA 4ANDA 1RTHA 2UV8A 4AL7A 1H6KX 2XULA 1KTVA 3FVYA 4DV4F 1TKTA 2IJNA 2PIIA 2OFHX 5JMNA 4X62J 2XNQA 2Z57B 2UVWA 4UY85 1OYEA 3L7UA 3TP2A 2I8EA 4FYWB 5H1SV 2PI5A 4QR2A 3BQ0A 2FD2A 4OI4A 2W9CB 2KZZA 2Z2YB 3K5PA 2XY5A 2DNGA 1WC4A 3BH7B 4FYVB 1U26A 3CJ2A 3M8YA 4NLYA 2KRRA 3G6YA 3K5NA 3DOLB 2QGFB 2ASYA 3AA8A 3AD7C 2RKIB 2RSQA 2R8GA 1S1VB 1UMJA 3MCOA 1D9DA 4PEOA 4PYAA 4LQ3A 5CAAA 4RWWA 4X64F 1RT4A 4MIBA 4NLVA 1RHUB 1C4CA 5F8IA 3VHQA 2KO1A 3CCZA 3M8SA 5D77A 1U1PA 1DRZA 3KMQA 2AGOA 2DTJA 3F56A 1TV6A 1UWBA 2ZH8A 5C25B 4EBDA 2FLNA 2BQRA 2PA3A 1T05A 1RWPB 2A3JA 1LWEA 3DOKA 2PD1A 1RHMB 1S6PB 2L9WA 2HHVA 1IKVA 2H54B 1UEUA 3H7HB 1SL0A 4CLUA 4NXNF 1S0NA 1RWUA 2B9EA 2QE5A 3C66A 4OJHA 1LQ9A 2OELA 2RNEA 5JUMA 4IDKA 2E9ZA 4TQSA 4ZPVR 2PI4A 4IOAQ 4F4AA 1TVRB 1T11A 3H2UB 3DM2B 5L1IA 1NKEA 3K8WA 4QJVA 3I96A 3W9IA 3RGIA 1BHNA 4KHRA 1KR4A 1C0TA 3W9JA 4PQUA 2E5JA 2W7OA 2AJQA 2IVYA 4LR8A 5DJBA 3OHBA 1M5HA 3U7JA 3IS9A 1M90T 4USVA 5BR8J 1DTQA 4JI8J 2DHGA 2RIJA 5I3UA 2M8HA 3MMAA 4N7TA 5DG9A 1WOSA 2FDNA 3KHGA 1QUPA 2V50A 2B6AB 2CWKA 4I4BA 2FZGB 4CO4A 5GAGI 4ZVHA 4TVAB 3QT8A 3PJWA 3QGPA 3OSPA 1JK9B 1WC5A 1U25A 4PCQA 3O6QA 4ZVSB 1S0VA 3NMAA 2F63A 2Z0GA 1U2CA 5JXSA 3I31A 5J1PA 3H4DA 1U1MA 2XNRA 2C3OA 3ISNC 3D2WA 3HVAA 1R3NA 1VQ5S 1T94A 3BO2A 2W4PA 3MEGA 4DCPB 1HBUB 3MECA 3HSZA 4ERDA 3GB0A 1N5QA 4NLQA 2LQ5A 1Q8KA 2AKWB 1Z2ZA 5ETMA 3SV4A 5KFHA 2M4MA 1H2UX 1ZPWX 4MH8A 5DG8A 1CBKA 2CQIA 3GP9A 3MMBB 4DQRA 1N32F 2GO9A 3IG1A 1C4AA 2IM0A 4YY3F 1FRXA 2BANA 3CCWA 1S6QA 3PRVA 1P27B 2W2PP 3POTB 4MT1A 4ZOSA 3RTVA 2FY1A 2V9WA 3NKYA 2F4VF 3KYLA 4JV0A 3H5XA 1HWLA 4JI7J 2BJ9A 3LUYA 2WVCA 1D1UA 4FKXA 2MKIA 2L9NA 3DLKB 2V8PA 3RG6A 3TEHB 3A1YG 5IC6B 4HHUA 1ZA2B 3C14A 3M6XA 4X4UA 3HF5A 2OPRA 2QYGA 3ET6A 3UW1A 3AQOA 1L5UA 1CS4A 1Y10A 4R8UA 3ULHA 1HBMB 1DFDA 3PW7A 4XDDA 3BR9A 1RP5A 2E66A 2X1BA 1TL3B 4HACB 5E3RA 2A6OA 3CNQP 2W2OP 4L3KA 3EX7B 3KLVA 4PR6A 4CLWA 4IH7A 1RT5B 3MMCB 2KZMA 4EBCA 3QRPA 2DY1A 3JAMY 4C11B 1HBUA 3D6FB 2B9YA 4OX6A 2K3KA 4MK8A 3IM8A 4NLTA 1XNRF 4ZVGA 2ASJA 2ZOFA 4V19X 3OPKA 1Q86T 3LGMA 4C8NA 3R5CA 1YBAA 4LFAJ 5GVQA 3CCTA 3ELHA 1IBMJ 1UFKA 2C2OB 4DUTA 1QVFR 1S97A 3KUGA 3R8YA 4ECYA 5CZVA 1RTJA 1NB7A 3OHAA 4HDHA 4ZPDA 2XHWA 4B08A 1R43A 2R2RA 3VGSA 4I2PA 3TVKA 3W63A 1HNXF 2AJFE 2RB7A 3DRXA 2MZRA 3W8PA 3CUNA 1R8CA 1QAXA 1APSA 5KFBA 1EHWA 1LFWA 5EWGA 1N5YA 3G6ES 2IMWP 3T1HJ 2UVVA 3ITHB 3JSMB 2JFKA 2QO3A 3TZZA 2Z8QA 2EKNA 1VQLS 2XBPA 5C42A 2IA0A 3FUYA 4QYRA 2AX0A 2WW4A 1RTHB 2MKCA 4ZKAA 1VBYA 3H5SA 1VQYA 3ENWA 3DHXA 4LR7A 2UXBF 1NSQA 4DSJA 4LRDA 3SSSA 4DX7A 1MWYA 3NNHA 2QFJA 4DSEA 2E9RX 1Z4UA 4WWSA 1LW0A 3U1MA 4RBUA 3PYFA 4NA2A 2OEJA 2XG8A 2XZDB 2Z2MA 2YWFA 2ZHOA 4E2FB 1N5SA 1OSDA 3R7BB 4Y3CA 3UCZP 2OD4A 5J2NB 3E2EA 2DYAA 5D3GA 1SUQA 3GFYA 3DMJA 1S9EB 1HFEL 1UKUA 3BGFA 1VQMS 3E01B 1PILA 2V2ZA 3PEJA 3L09A 2AGQA 1FI4A 2ZDPA 3QFHA 3BO3A 4RW4B 1YI2S 4RW6A 3T19A 1UP1A 3GWCA 3PFOA 2Y1IA 4KHPF 3NRBA 3CCES 5LT5A 1U0SA 3OW2R 2W9BB 5DGAA 4I64A 1RB0A 2ZC4A 1L3VA 1ELOA 2PFDA 1FX2A 3JTOA 2CNLB 2VFRA 3IGNA 2GVZB 3B6BA 3UCGA 3RBXA 3QWPA 4CT8A 5HMXA 4O44A 4HHJA 3EMTA 4B3RF 2DITA 1K0VA 4OMFG 4RL1A 3QZ8A 1JLAB 2F4VJ 2L08A 1Q7LB 4USMA 2OTLS 2CZVC 1RA7A 2GHVC 1X4CA 1RK8A 1U6FA 3BGLA 2CDRB 3QAEA 4ES1A 3OL6A 4DHVA 1KRPA 2V9KA 1FVSA 1PYTA 1Y5NB 2DNZA 2LCWA 3MCNA 3N5FA 4E8UA 2ZH5A 2LEBA 3FCHA 1X8DA 1D09B 2GJIA 4IOCQ 1H38A 3G4SS 3M6VA 2KB2A 5D3GB 3GLJA 4WTOB 4J9QA 1U7LA 4O3SA 2HWTA 1VMBA 4KGXB 4IG3B 1HR0J 2CRLA 2HS0A 2AJ0A 2XSFA 2M5YA 4FF4A 1YIJS 1PKUA 4NE9C 2Y8YA 2W4DA 2XWXA 1RWVB 3IN5A 2VJUA 4DL2A 1VQPS 5DDOC 1U1NA 3AJ2A 3ZZPA 5CD4A 1RJJA 2BEFA 3IRXB 1NB2A 2XCPA 2B0GA 3I0SA 2DR8A 3I0SB 4B9UA 3LO3A 2FQQB 5BYSA 2CQ4A 1ZTTA 3EZOA 1WKLA 4Y34A 4L6V3 2HVHA 3Q8RB 1REVB 4ITSA 4BLGA 2YKMB 4RZRA 2YX4A 4A8MP 3X1LB 1NK4A 4OLPA 1VK3A 1ZETA 5FDLB 1X4AA 2DXFA 2KXFA 2L41A 3DGVA 4EFAC 3PVXA 1NJIT 2I2YA 4N76A 4RBTA 2DNMA 4LF6J 5DETA 2ROGA 1O0PA 1PAEX 4AYBD 1XIQA 4OZ1A 4A8SA 5J2QB 1I6JA 2IBOA 2XY6A 1C0UA 2EFQA 5C24B 1TMMA 4KFBB 2FJVA 1AT1B 2GIQA 3I9ZA 1GMWA 4WBFA 3GV7B 4LMZA 3K8VA 2DBBA 2W8LA 1WKKA 2WOMB 3CD5A 2V94A 5LJ5Y 1KLMA 2MDAA 2Y1RI 2B8QA 1M5KC 3LP0A 4U8VA 1NSKL 3LWMA 3LP2A 2C2RA 1M5VC 2JEJA 4QIGA 1N0UA 3GIRA 3LF0A 2VG7A 1I3OB 1AZSB 3DXBA 1SC4B 2ZOMA 3NWGA 4QBUA 5GMEA 2KJVA 2MQ8A 1FEHA 1VBXA 2QA2A 3UNYA 4HEA9 4M5DA 1GMUA 4KH1B 1OYDA 2BA9A 1XNQF 1RTDB 1U48A 4GVBB 3TVYA 2JX2A 2BKOA 2HGNA 1GQEA 1XC9A 3OTBA 4RNFA 3NG8A 2J9DA 4OYWA 1REGX 5KTQA 3CSKA 5LXYA 2CXEA 2Q66A 3N0VA 3AH6A 5G0RA 2DGUA 2DCUB 3DM2A 3HFKA 2DRAA 2GHWA 1OSCA 2N7YA 3NP5A 4F3QA 2DXEA 3PYDA 3K5MA 4IQXA 1Y0HA 2V4RA 2DNPA 3AB4B 1RT7A 3AFGA 5DLFA 2PT0A 2DR5A 4JI2J 3UR3C 2PFFB 5KFIA 3DI6A 3LPEA 5HMYA 4ZPWR 1GFWB 1RT3A 2WONA 3MTJA 4ECSA 4IFYA 1KOHA 3MAAB 4KKOB 1R0BG 1XERA 4X4NA 4N41A 1WEYA 4DBQA 1WORA 2B3TB 3M2RB 2BBEA 4MFBA 1RCOB 3ITHA 1SH3A 4LFCJ 3NGUA 4C11A 1YRUA 1H2VZ 3V6DA 1UCNA 1HI1A 2VFTA 3KHRA 3TAMB 2EFPA 1NJYA 5C7PA 4D3HA 3D67A 2JH3A 2NXEA 3HD1A 1URNA 3EGZA 3J7A1 3ZTPA 5J2PA 1VR6A 2HPUA 4F36A 4HT7A 1M5PC 1IR0A 2YTCA 2W9CA 4PWDA 1RSCA 2B43A 5E3QA 5M2RA 5B7WA 3VAIA 2YNGB 3K17A 3OR2B 3IS9B 2Z30B 3A3OB 3SSRA 6FDRA 2J0QD 5DDQC 2XMMA 4ED0A 3O8WA 2WB1D 1V3RA 3LGHA 3C15B 4PWUA 1JB0C 8RUCA 2UXCF 1RAJA 4CRJA 4ETZA 2QLBB 4JV1A 1N5YB 1IJEB 1TZ0A 3ENQA 3UFCX 3CJKA 2VG6A 4Q2LA 2HBYB 1RLCL 2JVOA 1Q7YT 3HJFA 4P2FA 2IRYA 4KJIA 2BE2B 3UPFA 2NREA 2LQ9A 4BHQA 3HI9A 3J7YU 4JI3J 4AL5A 3LH2S 1M5OC 2RF2B 4DV7J 4PRFA 1ZM2A 4LRBA 2UUCF 2VDIA 1T9UA 2GIFA 1LK5A 3HZEA 4FXWA 4CLPA 1IR1A 2DCLA 3FSYA 4F0HA 2PGCA 5KFRA 4JB8B 1HBOA 1OMSA 2CPJA 3GSDA 3CDUA 3V4IA 4NLOA 4NX9A 4OYXA 4ZCIA 4DR3J 2X1FA 3MM6B 2HHXA 1TUWA 2ALZA 4I2QA 4LR9A 3W8GA 2IA6A 1BWVA 3OJSA 3MPVA 1ZZFA 3HCXA 1FRKA 1VRQC 4DR5F 3LP1A 1N5VA 1YQHA 3M8QB 5KG4A 2KG0A 2HBQB 1VDHA 4TU9A 4PPDA 3PR5B 1FTCA 4LFBJ 3I87A 4I1TA 4RUHA 5D4PA 1T3OA 3KHHA 3N5BA 5LM7E 3M2VB 4U7UD 2WVFA 3MEKA 1DLOA 1N52B 4OYAA 4GC7A 4L75A 4I6YA 5IM0A 4JI4J 1SQFA 2G1DA 2MQOA 1CS4B 1Q5VA 4FDFA 4RNOA 1OQ6A 2P9EA 3D68A 1ZTWA 2QFIA 4KPYA 1S6UA 1JLQA 5E3CA 2AYGA 1KQGB 3IWLA 4WXOA 1IM6A 3DLGB 2BJ1A 3TRGA 1HNVB 3JYTB 2CPFA 1NXIA 1QM9A 1XR7A 2IYGA 2ZUAA 4ED8A 3QSYB 4A46A 4JI7F 4OYZA 2KVIA 2CG8A 3MF5A 1MWQA 3UD4P 2WTFA 2J9EA 1WG4A 2VDHA 1G4CA 2YKMA 2KJWA 4Y2KA 1TUVA 4DUZJ 4NMLA 1GTEA 2E1MC 2O01C 4BWMA 4DCOB 4X64J 3PKMA 4F4KA 5A0YA 4CZCA 4LSLA 2NLWA 3KG4A 4OX9J 3MPUB 5E33A 2NCKL 3AJDA 1E6YB 3PG9A 4MTPA 3NL0A 1RYSA 1O6XA 3NEKA 4USUA 2QLWA 4Y6IA 4ED2A 3CCSS 2JLFA 3JAMU 2DO4A 3OVBA 4MKVA 1VQSA 4EZ9A 3QO9B 3AXMA 3J80Y 4QIEA 5AJ3J 5DQHA 1YRTA 4HTJA 3HHLD 2D9OA 5F41A 2BRLA 2C2DA 5IT9U 3FMBA 2VONA 2PA8D 3MMAB 4B02A 3KK1A 4I7FB 4NOHA 4RLEA 3RB0A 3BZQA 4Z7CA 1TL3A 2VG7B 3EJMA 2OSRA 4DSKA 1W25A 5CYMA 3BGOP 1MNEA 2CJ9A 3G6XA 3PX6A 3KLIA 3KLIB 4WP9A 4O3RA 2HLTA 2XMUA 1U47A 3CULA 1AB8A 2AZ1A 1AFIA 3NY0A 4GKKF 1W2IA 3G8QA 3QPIA 2E1AA 2KT3A 5LJ3Y 3T1HF 1L3TA 3HVTB 3DNCA 2IJRA 1LNQA 1O51A 2DNLA 3I55S 4FVMA 3MXHP 5K14B 1U09A 1LXNA 3ILIA 3MDFA 4J5OA 3B82A 3FDSA 1CJTB 3KJVA 3ENVA 3C19A 4A8OA 4P74A 4OJGA 5IWAJ 2LDYA 4V1Ak 3SDEB 4DV2J 4IRCA 2J0SD 3OD2A 4DV6F 4TLQA 3IWNC 1W2BR 3Q2SC 2R2SA 3OL7A 3NS5A 1MSWD 4C8ZA 1IKYB 1WF0A 2JWNA 4DFMA 1JWWA 2E1PA 3EZUA 4KKOA 1WJ9A 3LA0A 5D78A 3W7BA 1AUSL 2DNQA 3CJQA 5KT3A 3PY8A 2IM2A 3NS6A 3EICA 4A8FA 2UXCJ 1NCLA 2J8SA 4ECUA 4M5IA 4P71A 2BM0A 3D0IE 4PAAA 2DD8S 1WTBA 2UUTA 1JLGA 3RB4A 2XZTB 2CPXA 2JHEA 2K7JA 4YUDA 4K4WA 3VCDA 1G2EA 1CULB 2A2CA 1CJVA 5EWEA 1DARA 1HLWA 2R7UA 3MEEA 2P2CB 4NA1A 3BKTA 4CIOA 3EYZA 4RW7B 2KHDA 5EHHA 1NK5A 4NCAA 1HW8A 4HI2A 1S6QB 1S9FA 1KSPA 3W2VB 2ZM6F 3CDBA 2K1RA 4ELTA 5D4LA 1GH8A 3N6LA 1WSVA 3DDNA 2BYCA 3EDRB 3G8TA 2EVZA 4K4TA 3D3BJ 1TUGB 1DTTB 4B3OB 1RI7A 4OV6A 4WTYA 2AW0A 2G1HA 1UAWA 2J9CA 2W2NP 2ZHAA 4AT1B 5DZ6A 5BXIA 5D15A 3ZXWA 4Q45A 4MJKA 2CWXA 2RS8A 4A48A 4DR1F 2V34A 4PG7A 1D8ZA 2ZKTA 2E7VA 1OPZA 2H3EB 4OYPA 5AXLA 3UDVA 5IZHA 3F73A 1HWJA 3UDLA 4B3MJ 1W26A 2PN6A 2ASDA 4ZP8A 5L1KA 5C24A 1KFDA 4XPEA 2V4JA 3CJRA 3O44A 4FPRA 3BQ1A 2HZVA 2F65A 2B9WA 3U27A 3C6UA 1A9NB 2CQ3A 2ZH3A 2POKA 5I42B 2OPQB 4USIA 2B6AA 3MI7X 1WDDA 1VK8A 3SEOA 2X3DA 3P5TL 2RJZA 5LSOA 4ICLB 2EPIA 2H5JB 2LLZA 3TUPA 1UFLA 2OPPB 4H54A 2MZSA 4DX8H 4CDIA 1BMQB 1GX5A 2VKZG 3AOAA 1WNEA 4W4MA 4OI3A 2WONB 4WFNQ 4KGMA 1G6BA 1S6OA 2RH3A 3I56S 5IM0B 3AXKA 5KFUA 4EI2A 2VA3A 3Q8SB 4C48A 3HZGA 1HW9A 1JX4A 2MB0B 1U1OA 2YKOA 2F3JA 5AT1B 1SH2A 4UW2A 2XGPA 2UP1A 4O44B 2FJWA 3W64A 5BJRA 1JNRB 2ZUGA 2GGPA 3IBCB 2ZH1A 2BKPA 2WHOA 2AGPA 4RPFA 1B0VA 3BH6B 2IBKA 2OEKA 4KHPJ 2BZ2A 1WC3A 1BQNA 5DS7A 2VIHA 1YBTA 4J91A 5U47A 3QGGA 3UN2A 4ZPBA 3WBZA 5L1JA 4X65J 4B3SJ 2XS7A 2KT5A 3I0RB 2ABYA 3AJ1A 1SVDA 4RU9A 1F9FA 4IFVA 3GIJA 4EMDA 3GR1A 3QIPA 3G2XA 2UZAA 4QIFA 4K5RA 1EX8A 2PMWA 3GZ7A 2XMJA 2CJBA 4HACA 4DPWA 2GQQA 2HYIB 1V9OA 4DMZA 1UWAA 3Q8PB 4DR2J 1CEZA 3TJ8A 1EKRA 4MFBB 2AJ4A 3IFEA 2FJBB 1F9EB 3PYGA 2XB2D 3KG0A 2QMWA 3EXYA 3D6TB 3CMAS 4RUAA 5HVGA 2DHSA 2J6SA 2HGLA 4QYZK 2FPHX 3SIPB 3M8PA 3P6YC 4CNYA 3J7ZT 3NGDA 2R42A 2MZJA 3BDPA 1RBLA 1RAEB 2HVEA 1RHKB 4UT4A 4F4YA 4TU8A 1F60B 1U24A 1DJ0A 2OP5A 2K7KA 2ZNZA 2P5VA 4O3QA 2ZH4A 3CT9A 3R3TA 2IC3B 3HFVA 1PSDA 2LKZA 4NLXA 1XMOJ 1RT1B 2B8PA 1QJHA 1VIXA 3ZZYA 4TY9A 1N36F 1SCJB 1OIAA 1ROFA 4JI0J 2C22A 5J1NA 1PYOB 3MURP 4FF3A 1UZDA 1MW7A 1I1GA 3UQSA 2HWIA 3BS9A 4CH0S 2PO4A 5L1LA 2EG2A 2KL8A 3VQTA 4Y28C 3NOCA 4HL9A 4XTTA 5KFWA 3CCQS 3R5JB 2HHWA 2LVWA 4CWBA 1CG2A 4W90B 2GS8A 3FFIA 2ZNYA 4OV1A 2ZD1B 2XC9A 1HHSA 2MYFA 4OZ0A 2DT9A 1CJTA 1VLYA 2W25A 2HHHF 4TLRA 2VOPA 1C1CB 4C2MA 1EKSA 1P6TA 5GAEU 4WZMA 2NXJA 2B7BB 1PJ6A 3K89A 1MMDA 5DG7A 4LF7J 1LXJA 1VHIA 1KNZA 2FVSA 3HKZD 3DLGA 4GO7X 1CC7A 3M9OB 1ULRA 2YQ0A 1IQZA 3HT0A 5T7LB 2R8IA 1U1QA 4KY3A 3IM9A 3MMJA 2G0IA 1HWKA 2C3UA 5CZXA 1IBMF 3DRRA 1EIYB 1R27B 3A3PB 4LFAF 1JKHA 2V67A 1JQGA 1RXOB 5HBMB 2NUHA 5EWFA 4H4OA 4GO5X 4EU0A 3MEEB 2GVDB 1RWOB 4TNOA 1SC6A 1UVIA 1QAIA 4NCBA 2D3O1 2VV5A 4WPAA 4EK2A 3EUNA 3A3NB 1TKXB 1K1QA 3BKFA 3JTNA 1NAQA 4ANCA 2JSXA 4IG0A 1WC0A 1DHMA 4CLFA 2YH1A 1TAUA 2FIUA 3AB2B 2QV6A 3TZWA 4LRCA 2BX6A 4M5HA 1RU2A 1L3KA 3UO0A 4PG5A 3H2VE 1N32J 3DLEA 1YJNS 2PEHA 4Y0FA 1G3OA 2DR7A 2IAJA 1YG0A 4CT9A 1KTQA 1SQGA 4YY3J 3OSNA 3RBDA 3FCVA 3O5TB 4R8UB 1NHVA 3LOUA 4ES3A 3OL8A 4K7QA 4P72A 3WC0A 1CC8A 2XY7A 2YNHB 1SI9A 1FNXH 3H5YA 2H5IB 2O1PA 3QFWA 2P6TA 4Q0BB 4NCGB 2R7OA 3THTA 3FKBA 4LF9J 2VFUA 1H7WA 5E0OA 4J90A 1YJTA 3MOZA 4ZVRB 2F4FA 3D28A 3NWRA 1FDAA 4NLDA 4RNMA 2HMIA 4P75A 4ZDNA 4DV1J 1T7PA 2XEXA 4FXVA 5CH7B 4CI0B 4CYUB 2B4OA 1R8AA 1NNDA 3HP6A 2VBZA 4OZ5A 1XMOF 1JJ2R 3B4DA 4DL4A 4CLZA 3KLHB 1Z1ZA 1U8WA 3EM1A 4J9UE 2H65B 4DUYJ 4Y2CA 3W61A 1ZM3A 4RR5A 2BJ8A 3HLUA 1FRJA 4DSFA 2RD5C 2GVZA 2CJYB 3DRSA 1AROP 4USJC 2QLFB 4ZIWA 3TQ1A 1U45A 2IAJB 3V4MA 1U49A 2BJEA 1FNOA 4F0MA 3TA2A 5LMNF 4YMEA 5B0CA 2Y0SD 4NZ0A 4J7CA 3CCJS 1SIWB 2KM8B 2UVUA 1RZMA 4C8LA 2VL1A 2CIMA 3D0HE 5HQLA 4DN9A 1LWEB 3M2RA 3OXGA 4YHHJ 2LFVA 3CCLS 2R7XA 1SKUB 2X1GA 3W5YA 5HMWA 4N8OA 1WDTA 4WFXA 1JLBB 1RAHB 3CE8A 3JSBA 3JXOA 1NHUA 5A0YB 2H9ZA 3T9NA 3TAPA 2J6TA 1ACMB 3EPGA 2HHPA 2QIFA 1DQ8A 1JXEA 2MGZA 1BC6A 2RKIA 1RT6A 1UL3A 3B8HA 3BPDA 1Y11A 5B0BA 3HHKA 1H0HB 5HVHA 1HYSB 4X4SA 2QL9B 3NNCA 2DKOB 3CIMA 1D0EA 1BQMB 1NZ8A 3AY0A 5KT2A 1OY9A 1HIYA 1SJRA 2I1RA 3D7SB 2F8MA 4QZVB 1S1XB 3M9MB 4LF4J 1T05B 5HVFA 4AQYJ 1JLEA 1R0CB 2LU2A 5KAKA 4OHVA 2A18A 5I3PA 4A8XA 4K4VA 4Q43A 2AEMA 4WZQA 1RT2A 2VZ9A 3M30A 2VPZB 4EBEA 4ECTA 1RWNB 5KOXA 1CPZA 4IDKB 1QE1A 4HKQA 3NMRA 1IVZA 4FPIA 4MMOA 3S1TA 3KLFB 1SPBP 3KLFA 3OTCA 3R2CJ 3IGVA 3NAHA 4U67Q 4HLBA 2GHPA 4AUKA 4C6AA 5AXNA 3RZAA 1X5SA 2GO8A 2MSSA 4NLRA 5K8MA 1HHQA 2C42A 1VQ8S 2DPIA 1RBOB 2YH0A 5KT4A 1ZAXA 1CLFA 4ILLA 1XEZA 2R2UA 4EUVA 3PW5A 3JTPA 1IKWA 2OUGA 5IV3A 1F5CA 2CG4A 3LP2B 2HG4A 4BC9A 2VHGA 4B9SA 2MKHA 3CWJA 4OZLA 1BE4A 2AF6A 4ETXA 3DFEA 5I4MA 1YLXA 1SL2A 5LSRA 1H3DA 3BR8A 5AE2A 5HP1A 5FLXU 2Y8WA 1LK7A 2E5GA 4ED3A 1GX6A 5K8OA 3DI6B 1NJWA 2DR9A 4F3OA 3H40A 1VBZA 1F2GA 4ENOA 2R8KA 5D4NA 4USTA 1UZHA 2CAJA 4TY8A 2IVMA 1FKOA 1KC8T 3PJXA 3VGVA 2F1FA 2MQNA 2CFXA 3QJLA 2V2VA 1N33F 4JYAJ 2MJNA 1XMQF 2AYBA 1T3NA 2DNOA 4BC7A 3AOBA 2MHNA 3QGHA 1UA1A 4RO0A 1B64A 2U2FA 2KYZA 4ELUA 1HQUB 3ISZA 4USHA 3R97A 4OZ3A 3P3DA 4B9NA 3F41A 3LWLA 4MIAA 2HFVA 5DZ7A 4KV8B 1PCAA 4CLYA 9RUBA 3OV7A 2LQBA 3R27A 1JLCB 2EFNA 1T9YA 3MMBA 2HRUA 2RDJA 4J9PA 3HVTA 3CC7S 1B0TA 1UEVA 1WG1A 3I6PA 3OQ2A 2Q1LA 3A4TA 4MIWA 5KFSA 5L8RC 3J81U 1U6ZA 1F2HA 3VAFA 3VAGA 2N4DA 2WK4A 9ATCB 3AD8C 4IH6A 4V19J 3OJUA 1H98A 3BYRA 1LV5A 2P9GA 2V4QA 1EETB 1UVKA 1VISA 4OZJA 3TUIC 4F04B 1YDLA 4IQMA 3Q22A 1X5PA 2OPRB 1T9XA 4KB7A 4WFYA 1HI0P 3CJTA 2FY8A 2W4CA 5F0WA 3PIOQ 1N34J 2ZE2B 2DISA 2FVRA 2FUG9 3PW0A 3R2DJ 4K0KJ 2JFDA 3KK1B 1S9GA 1S0MA 3NGRA 4ZHRB 4Y00A 1QY7A 1NK8A 3D54A 2YNIB 2CNOB 2MJUA 3PTWA 2JNJA 4L73A 4XAKA 4DG1A 3KWMA 5E3AA 3KNAA 1N88A 4ID8A 4DR7F 4Q0BA 4LF4F 4DR6F 5H9FJ 3D3CJ 3DXSX 2CJQA 5CYQA 1T9WA 2CQ0A 4A47A 3DKDA 2EFVA 4M63A 2DNNA 2BUNA 5IT0A 1XWLA 4E0DA 1XNQJ 2JLEA 4ED5A 3ZTRA 4K0KF 5J2NA 2GA7A 3W66A 1FRIA 3TUZC 1VQOS 5LL6d 1WC6A 3ZZ0A 3I4PA 2BJDA 3P8BB 4X4RA 1Y5LB 2H4WB 4P6QA 4K4YA 1RT3B 1LWCA 5A8KA 1PBUA 3HKWA 3DGPB 4K4SA 3DGPA 2KKHA 4GKJJ 1K1SA 2IY5B 5HANA 4CH7A 1N56A 4JI5J 1C1CA 4RUBA 4EGLA 1FD2A 2IRUA 3W2WB 1UA0A 2W01A 1C2PA 5HAOA 3V2UC 4R5PA 4QWDA 3M1VB 1TK5A 3GQCA 1IBLF 1ZS6A 1ZPVA 4LSLB 2QA4S 2B5JA 3GFZA 3K7RA 5DQIA 4Y2AA 1NBEB 3MD3A 1JLFA 3FCWA 2HHQA 3L7PA 4OYOA 3UR0A 1SIZA 2J7KA 2NPFA 1JKHB 2W7PA 4DU7A 3AHPA 1HMVA 2YKNB 2VA2A 1JIHA 3H25A 4ZCLA 1Z2LA 1I5OB 4KO0A 2DEJA 5I42A 1MN7A 2YWHA 2ZHBA 2DO0A 3CMES 2NR0A 2NYHA 2DHHA 7FD1A 4UOCA 2ZJRQ 3GPAA 1FJGF 2V69A 4PG4A 3ZO7A 4HH0A 3D1HA 3Q23A 1EARA 2R7VA 1PC5A 4KAIA 4PUOA 5F8HA 5DLGA 5T14A 4NZ6A 1RAIB 4RW4A 4GMKA 1HNIB 1XQIA 1HWUA 3ZZRA 3DDIA 5HLFA 5K9FA 2FHMA 2NXNA 1UEKA 2DH8A 2F5GA 4GVBA 2KTQA 2L3MA 3SZ2A 2D3OR 4YP3A 2HSEB 3E8OA 2NZCA 4JI1J 3TAMA 4DPOA 4GVLA 3RR8A 4JI4F 1N4LA 1RCXB 3HHLA 2AT1B 2Z58B 1S59A 2Q3PA 3HHNB 1N0VC 1LWXA 4OQJA 2CPHA 3EVMA 1BQNB 1VJQA 5KFZA 3V5RA 2YWEA 3TANA 1QAJA 4MK9A 2C3MA 3MHYA 4LF8J 2WB4A 4FYYB 3KHLA 4B3RJ 2U1AA 2DB1A 2OMLA 3MPWA 5HJXA 3BV8A 4BDPA 3SSQA 2E1RA 2QA1A 2AV5A 2VQEF 3HDSA 4AL6A 4JI6J 2OJ3A 2IJFA 3UDEA 4LQ9A 2OGUA 3Q24A 1N36J 4TY8B 1CJKA 3MM8B 3FZBA 3MM8A 3NXZA 2HLUA 5KT5A 3IR6B 3UCUP 2VD3A 3E51A 1K44A 2B4PA 3WZ0A 4WE1B 3RYLA 3LALA 3OUYB 3SQGA 2DXDA 3EWGA 4RNHA 4DN0A 1J5OA 5H9EK 4LF8F 1P1TA 3QGIA 3ZZTA 2VASA 3CCMS 4WJBA 4X4VA 4UOGA 4CO3A 1TV6B 1UWBB 3MECB 1ZM4A 2WVDA 3DDKA 4KBIA 1C1BA 4AXJA 4NL5A 4FXDA 2MZTA 4M94A 1RTDA 1RAAB 2J7UA 1RWMB 2LDIA 2XTJP 4ZP7A 4DLEA 4K8RA 4X84A 1X4HA 4LIWA 4ZMMA 3T6JA 5RUBA 1PJ5A 4JBCA 2AWZA 1RTIB 5J2MA 2EW9A 3O2IA 3PACA 3RU0A 3VAHA 1I94F 4P2SA 1YZ6A 1VYAA 4DDFA 4ZA1A 2ILZA 3QMQA 4A8YA 2LYVA 2PDAA 3HHEA 4KT0C 1CJUA 2D9PA 4RW8A 3DRPB 5G0RB 4CP5A 3KLHA 1HNWF 3T1YF 1C0TB 2YWKA 2YBVA 4QW9A 6AT1B 4B9VA 2NS1B 2CVEA 3MM9A 4IFYB 1GTHA 2IVFB 5DGBA 3PX4A 3A12A 3RAMA 1FJGJ 2RMLA 2GAHC 3KXDA 4OJ3A 4NPOA 4QR0A 4AXIA 1KONA 3FRYA 4JI1F 5D4OA 5FD1A 4NLGA 2DH9A 3MGJA 4DQQA 3N01A 1RU1A 2UU9F 1UETA 3EDQB 3FQKA 2JEIA 1NH7A 4NCGA 4F4XA 2ROPA 2FGCA 2QYCA 2VU5A 1EAYC 2XZWA 3WQPA 1X0PA 5LMUF 2C2EA 5F3ZA 1YJVA 1TMJA 1Q4RA 4A4JA 3C46A 2EC0A 1GT8A 1G1XA 3M8ZA 5M2PA 3MEGB 2F7VA 2JC1A 2Z2ZA 2LXFA 2ZJPQ 1Q16B 2RUSA 1Y3JA 3U02A 1SJQA 3T5HA 4ZIVA 4F2RA 4JI5F 3R9LA 4FP9A 4RW6B 1VC0A
chains in the Genus database with same CATH topology
4B3MF 1NK0A 4ZP9A 4ZVFA 1N6QA 4OL8A 1Y9OA 1IKWB 2CQDA 4ED6A 2DRBA 1QSSA 1VQ7S 4OHYA 3M2UB 1S1XA 3BDEA 5GAEI 2AQ4A 2HHVA 2K2PA 1UJ6A 2UUWA 3H98A 4Q8EA 3DRYA 1S1TA 2XS2A 5FLXY 4G1QA 1K8AT 4O4GB 2OO4A 4NLSA 1VRTA 2B5JB 3NBPB 5GADI 5K8PA 3RBEA 2WSFC 3LANA 1BWEA 1JLAA 4BBYA 1R7IA 3V81B 2FB0A 2VPXB 2M52A 1TAQA 3I82A 4ZVEA 3POTA 3QIDA 4KO0B 4MYUA 1WHVA 1JLGB 4BS2A 3D1QA 4RWXA 2EI5A 1VIOA 1FNMA 3I5CA 4C7QA 2XLJA 5J2PB 5FIIA 1Q8BA 1XBWA 1KLNA 2B9XA 3B78A 4EYIB 1UVJA 2GW8A 2DGQA 4LF5F 3NAIA 4M8LA 3K57A 1TL5A 5IT4A 3S01A 2FLPA 2DIVA 2R8HA 4C8KA 4DV1F 4EO6A 5DM7Q 4IKAA 3FJ2A 3THPA 2QEXS 4B9TA 4DSIA 5EDWA 3DLLQ 2MKSA 3MUMP 3BGRA 2ZC3A 1DTTA 4B3OA 4CO1A 4DQSA 2XSJB 3V6HA 4WF9Q 3CB4A 4RW9B 2EWHA 4TN2A 2CQ1A 4K4UA 4PG8A 1WI6A 3Q0AA 2W8KA 3MFHA 1HMVB 2YKNA 2G9OA 2N82B 2JOQA 3CD0A 4ED7A 1YITS 2FLLA 4HTIA 1S1UB 2DGSA 4W92B 4UUXA 1Y00A 4OZNA 2FHKA 1AFJA 1IQTA 1WI8A 1UVMA 2RRBA 2RRNA 2LQJA 3S7RA 3ICLA 4WYLA 2F9DA 1XN9A 2MSTA 4J9NA 3C8YA 4DL0C 2FJXA 4RU2A 1BQMA 3RB6A 4O3PA 3FGVA 1OQ3A 5C25A 1TKZA 1YHQS 3MR3A 4Z37A 2OFGX 1QSLA 2A2DA 5F8GA 3DOKB 1S79A 3GG1A 5GAGU 1TP7A 2EKYA 3BSNA 4J9KA 2P9CA 3DLJA 4X4OA 1E6VA 1Q53A 3OUYA 4C98A 4OHXA 2HRYA 2E7WA 5A8RB 4KE5A 2GGPB 2PE8A 1TVRA 2DGXA 3H5UA 4LF7F 3KLGB 2DGTA 4OJ1A 3OXFA 1R8PA 5EX0A 4N47A 2X51A 2R9LA 1X5OA 2MQMA 4KSEB 2JJ4D 4FS2A 3OTDA 5KFPA 4RW7A 5I3UB 3C6TB 4JV2A 4QIWD 4U9RA 2E44A 1TL1B 2EBEA 4ALZA 1WHYA 5B08A 3K2YA 3W2VA 4HYKA 3PR4A 4O3OA 5KFAA 5GADU 4JI0F 2E9TA 5AXKA 3BQ2A 4J9SA 1EETA 3V6JA 4H4MB 3Q2TC 3MMCA 1UVLA 3GIIA 4M5DB 2ILYA 5EUHA 4PG6A 4F26A 4QWEA 2DGOA 1S48A 2IM1A 3UDCA 2WBRA 1S6PA 2XMWA 5LXRA 1KEKA 1R0AA 1XR6A 5A8RA 2WSEC 4YDXA 1TK8A 3DOMA 2AJ1A 2ZKUA 3WDOA 2R4FA 5KG1A 1X7VA 4D3GA 4EEYA 2D3ZA 1N5TA 2QT7A 4I67A 2OH2A 2VBYA 5A2QY 2FC9A 6FD1A 2AYEA 5I3QA 2GMLA 3N79A 4G1PA 4IR1A 1BD6A 5THWA 3QAUA 1V3SA 2NUUG 3PRBA