4KV8B

Crystal structure of hiv rt in complex with bilr0355bs
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
407
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV Reverse transcriptase P66
publication title N- versus O-alkylation: Utilizing NMR methods to establish reliable primary structure determinations for drug discovery.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 113
structure length 407
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kv8B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B04
1N6QA 2B5JB 3T1AA 4ZPBA 2W9CB 3HHKA 1JLEA 3QIPB 3M8PB 1HNVB 4WXWA 2BRKA 3BGRA 5JXSA 4EYHB 1RYSA 4IFYA 3KK2A 1C1CB 3DLKB 1RT1B 3KLHA 2C28A 5FDLB 2IAJA 5KFJA 4IRKA 3KLGA 3DRPB 5KT3A 2D41A 1S1XB 4J9SA 4PWDB 5J2QA 3LP2B 4M94A 4ZMMA 2E9TA 4ECVA 4Q8EA 3QZ7A 5KG5A 1S6PA 3NBPB 5K14B 1WNEA 1IKVA 2OPRB 2R2UA 5HLFA 3PVXA 1SUQA 2YNIB 1S0NA 4ED0A 2C2EA 1JLFB 4H4OB 3QIDA 4Q44A 4ECUA 1DTTA 1EP4B 4I2PB 1I6JA 4NZ0A 3RB6A 3OL6A 3GILA 5KG0A 5F8HA 1VRUA 4NLDA 2ALZA 4NLPA 3DRSB 4NLOA 4TLRA 1Z4UA 5J2PB 4DL7A 4G3IA 1LW0A 3FFIA 3PR4A 3G6XA 1S1WA 4O4GA 1IKXA 2OPSA 4R5PA 3CJ3A 3QGIA 4Q0BB 4NCGA 1QE1A 3RB0A 2ILZA 1S9GA 2UUWA 1TKZB 4ED2A 1DTQA 3JSMA 1RT2A 4KV8A 1KHVA 4R8UA 3DOKA 5KG6A 3C6UA 3KK1A 2ZD1B 5J2MB 1RA6A 4ZPAA 3ITHB 1C0UB 1C1BB 1K1SA 3MEEB 3CJ5A 1NHUA 4K50A 1JLAB 1S9EA 4IRDA 1N5YB 2YNFA 5HBMB 3H5SA 4K4TA 4XPCA 2AGPA 5EUHA 3I0SA 5KFGA 5L1LA 2XGQA 5F8JA 5KFQA 5F8NA 5KFNA 2WHOA 1HPZA 4KAIA 4FBUA 4KFBA 5KFBA 3T5LA 4IR1A 3MEGA 3HKWA 4WE1A 3V6DB 5C24B 3JYTA 2XC9A 2WONB 4M95A 4ZPCA 4HKQA 2HWHA 3DI6B 3QLHB 3PJWA 1EETB 5HROA 2VG6A 1XR7A 2HWIA 4IH6A 4NYZA 5F8IA 1VRTB 1SV5A 2HNDA 2OPPA 1C0TB 1TL1B 4KKOA 2HMIB 4Y34A 1IM4A 2IJFA 3MTKA 4ZPDA 2QE5A 1TKXB 3DLGA 4IOBA 1BQMB 5KFTA 2BANA 3LANA 4TQRA 2R8KA 3I5BA 3CIZA 3UDLA 1RTHA 1HQEB 1UWBA 2ILYA 4NLXA 4PQUB 5DQGA 4IG3B 2AX1A 2WB4A 2O5DA 3HVTB 3M8QB 1RTIB 3DOLA 4F4YA 3V81A 3KHRA 4HYKA 1SH2A 1JLEB 5KG2A 1RDRA 3Q8QB 4O3RA 4TYAA 4MKAA 3IN5A 4PUOA 4I2QB 1T03A 2WRMA 3BGRB 4J9OA 3T5HA 2D3ZA 3KK2B 3N6NA 3KLHB 3CVKA 3CJ0A 2YNHA 5F8MA 2IAJB 1GX6A 5DQHA 4KHMA 3KLGB 1ZTWA 1W25A 3QZ8A 3V4IB 2IM2A 2WK4A 1LWCA 5DQIA 5KG7A 2V4RA 3BJYA 5J2QB 3N6LA 4J9QA 1N48A 4K4WA 3I5CA 4TYBA 4MFBB 2WTFA 4RNNA 3KJVA 3DRRA 3PW0A 1LWFA 1S6PB 3KLIA 3KLFA 1IKVB 2AU0A 5HLFB 1SUQB 2IC3A 2XWYA 3SFGA 2ZE2A 3OLBA 1NHVA 4KE5A 4YR0A 3MR6A 3ISND 4NLTA 3MFIA 1JLQB 1DTTB 3DLEA 4QWCA 2JEJA 4X2BA 4NRUA 3H5YA 3FQLA 4ZP7A 2W9AA 1S6QA 4YQWA 1HQUA 4MK8A 1HYSA 2C2RA 2CKWA 1YVFA 2D3UA 1S9FA 4K4UA 1VRUB 4B3OB 3C6TA 2ZKUA 4MK9A 3CWJA 2RDJA 2FVQA 2VA2A 2IA6A 1S1UA 5D3GB 4RZRA 3V6KA 5KFOA 1LW0B 3FFIB 1LW2A 1S1WB 4O4GB 2OPSB 4O44A 4R5PB 2JC1A 4JUZA 5KT2A 4K4VA 1MU2A 5EWFA 3H98A 1J5OB 4LSLA 1RT2B 4KV8B 2XGPA 3KMSA 1FKPA 5CYMA 1S1VA 2GIQA 5KT4A 4J9PA 3DOKB 3C6UB 3KK1B 3N6MA 4LQ9A 1REVA 4EBDA 2OH2A 3IRXA 4IG0B 5C42B 3PW5A 1S9EB 4RW8A 4O3OA 3LAKA 2YNFB 2UVUA 3KNAA 3DM2A 5CYQB 4DG1A 3I0SB 1TL3A 5DG9A 2GIRA 2R8GA 3EPIA 4J9KA 3CDUA 4WYWA 1HPZB 2UVWA 2I5JA 4KFBB 5J2NA 4RUCA 3MEGB 3KLVA 2J6SA 4WE1B 3I0RA 3JYTB 1JLCB 3BREA 1BQNA 1TVRA 3OHAA 2C2DA 1RYRA 2V4QA 5EWGA 1RT3A 3HVAA 2QV6A 1RTDA 4O3NA 2UVVA 3MECA 5HROB 4QW8A 5L1IA 3KLEA 2VG6B 2FVCA 4DL4A 4XPEA 3MF5A 3HVWA 4KKOB 1SV5B 4ECRA 3KMQA 4ECXA 2GC8A 3LP0A 4Y2AA 3DLGB 4IQXA 2BANB 4F4ZA 3GIJA 5C5JA 4K4XA 1RTHB 4H54A 2UUTA 3CJ2A 4ECZA 3LAMA 4LSNA 1HMVA 5L1KA 2YNGB 3BQ0A 5KFDA 2UVRA 4JV2A 4ED6A 3DOLB 5I42A 4TQSA 1S4FA 3EZUA 3IG1A 3QYYA 3V81B 4ZVHA 3PZPA 2FLPA 3KK3A 1R0AA 1CSJA 4NLUA 3G6YA 1GX5A 4G1QA 4MH8A 1KLMA 4PUOB 4JV1A 1U09A 1D0EA 2CJQA 3IS9A 4IH7A 1SH3A 3V6HA 2YNHB 2J6UA 2WOMB 5F9LA 4IH5A 1RAJA 2RKIA 4NLWA 4RNMA 1JKHB 3PW4A 3OHBA 5I3UA 4JV0A 3V6JA 1S0OA 4URQU 3KJVB 3DRRB 1LWFB 3KLFB 2W8KA 2JEFA 4K4ZA 2IC3B 2ZE2B 1RT4A 5KT6A 4WZQA 3FQKA 2XCAA 2W8LA 4Q8FA 3NMAA 3DLEB 4RW9A 2FJWA 2R8JA 3PW7A 1S6QB 2AQ4A 1HQUB 1HYSB 3SI8A 2R2RA 3Q8RB 3C6TB 2W9BB 1RT6A 4URGA 3DMJA 1S1UB 3OSNA 2B5JA 5KFIA 2R8HA 4EYIB 1LW2B 4K4SA 2AX0A 3QIPA 3M8PA 5KFHA 2ASLA 2BQ3A 1MU2B 1RT7A 2BQUA 4ZVFA 3QO9A 1S0MA 5KFPA 5F8GA 3DLKA 2VG7A 4LSLB 3MR2A 4DL2A 5CYMB 1DLOA 1S1VB 3M9MB 3GIMA 5KT5A 4ICLA 1REVB 3NAIA 3MEDA 4PWDA 2WCXA 1N6QB 2VG5A 5KFFA 4RW8B 4RU9A 3E51A 3DM2B 4ID5A 3GV8B 1IKYA 1TL3B 5K14A 4NRTA 4ED1A 3RB3A 2YNIA 5EWEA 4IFYB 4J9RA 2AWZA 4F4XA 3GQCA 2I5JB 5T14A 5J2NB 3CO9A 3I0RB 4ZP6A 3OL7A 2W7OA 2FLLA 2ASJA 1TVRB 4ZVGA 3BSAA 2FLNA 3OL9A 3MR5A 2IM1A 1RT3B 4Q43A 2I1RA 2HNYA 2FJVA 1RTDB 3NGDA 3MECB 4IDKA 5F9NA 3KLEB 2HAIA 2V9WA 2YKMA 1NNDA 2OPQA 3GV7B 1S1TA 4QW9A 3DYAA 3I5AA 2VA3A 3LP0B 3VQSA 4NLYA 2F8EX 1RTJA 2BE2A 2JLEA 4MIAA 2FJXA 5KFLA 3MR3A 1LWEA 3BSNA 5KFVA 2D7SA 1TQLA 4RNHA 5J2MA 5KFKA 1ZETA 2IBKA 4LSNB 3ITHA 1HMVB 1C0UA 1FKOA 1HNIA 3BQ1A 5I42B 4Q45A 1IKXB 4TXSA 1R0AB 1JLGA 1QE1B 1RT5A 4G1QB 4NCGB 1KLMB 1S9GB 1XR6A 4IFVA 3UR0A 4YR3A 4ZVEA 1DTQB 2B6AA 3JSMB 5KFYA 3IS9B 3D28A 3KHGA 4FS2A 4R8UB 4ECSA 1RA7A 1S97A 3E01A 4RW7A 3GIIA 4NLSA 2WONA 1S49A 4IRCA 4DEZA 3KHHA 5I3UB 4ED7A 1EETA 3H59A 2AGQA 4YMEA 1FK9A 3IGVA 1RT4B 4RW4A 1IKWA 3D5MA 2XI3A 3Q8PB 4I7FA 4QWAA 4F50A 2E9ZA 4TY8A 2YKNA 5KFCA 4MK7A 2HNZA 4WXOA 5EDWA 3H4DA 4ECQA 4KHRA 4IR9A 1T05A 3H5UA 4O3PA 3UQSA 4U6PA 3RB4A 4F4WA 1SH0A 4YR2A 1RT6B 4YP3A 3DMJB 3M8QA 2FVSA 1RTIA 2HNDB 2OPPB 1QAIA 2FVRA 3CDWA 3SFUA 4ED8A 3TQ1A 4LQ3A 4ZP8A 1OS5A 1JLBA 2RDIA 3PHEA 3GV5B 5KG3A 3H4BA 2DPJA 1RT7B 4I2QA 1TKTA 2XCPA 3QO9B 4O3SA 3KOAA 1TP7A 3OLAA 1UWBB 2VG7B 5HP1A 3BSCA 1DLOB 4EBCA 4ECTA 5L1JA 4NLGA 4ICLB 3V4IA 4H4MA 4QPXA 3MEDB 1JX4A 3TVKA 4KO0A 2VG5B 4WYLA 4ED3A 4MFBA 3IGNA 4TN2A 4RNFA 4ID5B 2IMWP 4URSA 5KFEA 1C2PA 1IKYB 1T03B 4NLVA 3M9NB 3LALA 2R2SA 5C25A 4KBIA 1JLQA 4J9NA 1LWCB 4DL5A 2RF2A 1JIHA 2HNYB 1T3NA 4IDKB 4B3OA 3MFHA 5KT7A 3KLIB 4O3QA 1T94A 3GYNA 2YKMB 5D3GA 5DG8A 2OPQB 4RW6A 1S1TB 5J1EA 3NKYA 3DYAB 3RBEA 4WZMA 2R2TA 1RTJB 4ECWA 5KFUA 2BE2B 3NAHA 3QGHA 1J5OA 1TV6A 3TAMA 4ZHRA 4ZP9A 5KG1A 1JXLA 1LWEB 4FS1A 4GC6A 4EO6A 1N56A 3DDKA 1HARA 4K4YA 3RAQA 3LP1A 4IG0A 5C42A 1FKOB 1HNIB 3CJ4A 2W9CA 4J9MA 2DPIA 4XO0A 4O44B 5CYQA 2XI2A 1HNVA 1JLGB 1RT5B 4Y3CA 4IFVB 5DLGA 3G6VA 1C1CA 3KHLA 1RT1A 2B6AB 3PR5B 2JEGA 5FDLA 1FKPB 2BQRA 2EC0A 4MIBA 2BR0A 1MMLA 3DRPA 3E01B 4RW7B 1JLCA 1S1XA 3IRXB 1XR5A 5KFMA 3LP2A 2C22A 5KFWA 4KSEB 3FDSA 2B43A 1N4LA 4DG1B 3NBPA 2IM3A 5KFZA 3ISNC 2OPRA 4FBTA 4EO8A 1FK9B 3PJXA 4NLRA 3ICLA 3NL0A 4RW4B 1IKWB 1JLFA 4H4OA 2V0NA 5KFAA 3T5JA 4I7FB 1EP4A 4OL8A 4I2PA 1BQNB 3FSIA 4TY8B 2YKNB 2HNZB 4RUAA 4RNOA 5KFXA 1T05B 2JEIA 2YNGA 3DRSA 3UPFA 2AGOA 3T19A 5J2PA 2E9RX 4QWBA 4EBEA 3T5KA 2IJNA 3OSPA 3QGGA 1JLBB 1QAJA 4Q0BA 1TKTB 1TKZA 2IM0A 5DGBA 4EEYA 5DG7A 1S10A 4Y2CA 5HP1B 5KG4A 4DL6A 3BR9A 2ZD1A 2WOMA 5F8LA 2W7PA 5KFSA 3EPGA 1C1BA 4H4MB 3MEEA 1JKHA 1JLAA 5DGAA 4KO0B 4U7CA 1N5YA 3IG1B 5HBMA 4O4RA 3G86A 3KK3B 4WFXA 4NLQA 4DL3A 3PW2A 3BQ2A 3V6DA 5C25B 4QWDA 5C24A 4MKBA 1S48A 4QWEA 2RKIB 2RF2B 4WFYA 3Q8SB 3DI6A 3QLHA 1ZTTA 1QUVA 3CDEA 3RAXA 2ASDA 2BRLA 2J6TA 5KFRA 5DLFA 4J9LA 4TY9A 2ATLA 2W9BA 2JC0A 4KB7A 1VRTA 2HMIA 1C0TA 1TL1A 3OL8A 4GC7A 4RW6B 2R8IA 2FVPA 4IKAA 4WFZA 1TKXA 5J1EB 3FRZA 1BQMA 5L9XA 4RW9B 3H40A 3RBDA 1D1UA 1HQEA 1TV6B 3TAMB 4ZHRB 4PQUA 4R0EA 5JUMA 3GIKA 4ECYA 4IG3A 1KHWA 3M9OB 3H2LA 3BSOA 3HVTA 3LP1B 1K1QA 3H5XA
chains in the Genus database with same CATH superfamily
1AA1B 2B5JB 1DRZA 5HN0A 1FNOA 1QVGR 1WEYA 2HVDA 2MSSA 2XULA 3DLKB 1XMBA 2HHHF 4F67A 2RB7A 2IPOB 3U1LA 4Q8EA 2Z57B 2YNIB 3SQGB 4HVZA 2O01C 3QIDA 4H4OB 4Q44A 4QIVA 2W4CA 1ROFA 3C19A 4DV2F 3FBBA 2Y1IA 3DGVA 2W7AA 4B9LA 4O4GA 2ABYA 2OPSA 3GJTB 5LMUJ 3H42A 3RB0A 3K2YA 5E5NA 1NH7A 5K8PA 1C0UB 1U2FA 4X84A 4XPCA 3M30B 3AJDA 2IDEA 2IFXA 2ALYB 3T5LA 3PKYA 5L39A 3R1LA 3HHDA 4XK8C 2IRYA 5FD1A 2HMIB 4ANCA 3S1TA 3LANA 5K8NA 1G2EA 3NWRA 4D3GA 3UDLA 2ZZMA 3LWLA 1Y3JA 1Y5NB 1HBMB 5A8KB 2DGQA 4EFAC 3KDOA 3QZ8A 1LWCA 5DQIA 1OPIA 2V4RA 2RHSB 4RNNA 1LWFA 1NDLA 2E7VA 3ISND 3UNYA 3H5YA 1FD8A 4CNYA 1VRUB 1H2TZ 2IA6A 1GMUA 3WZ0A 4K4VA 3C46A 1UJ6A 4CM2A 3ENVA 1TL3A 5E41A 5CZVA 4OYBA 3HT3A 2VODA 3SV3A 3R5GA 3BPDA 4CZCA 3W7BA 5EWGA 3VAKA 3MECA 2FVCA 4DL4A 3MF5A 1SV5B 3CD5A 3I96A 3J7AN 4AFFA 1KRPA 3WBZA 1WC4A 5GAGI 1X31C 4LSNA 3BQ0A 5KFDA 2FGCA 2BBEA 4RLEA 3ZZPA 2JSXA 2ROPA 2XMUA 2YQ3A 2WOMB 3C66A 1TUVA 3WQPA 4JI5J 4USJC 3DRRB 2V34A 3FKBA 2IC3B 1KQGB 1RT4A 2K7KA 5BYQA 2VHGA 3BDPA 5A0YA 2DH7A 3ELHA 2B5JA 3DLKA 2VG7A 1FDDA 4OX9J 3EX7B 1KBRA 1ZM9A 2XMTA 4DLEA 2YNIA 2DCLA 4IFYB 1SIWB 3X1LB 2ASJA 4WFNQ 1H2VZ 4A47A 1RT3B 4LFBF 3QT5A 3ZZTA 4I64A 4IQMA 2PSZA 3SCKE 3IBWA 5GAEI 2CPIA 5IM0B 2JLEA 2HQIA 1WTBA 1R8BA 3ZZRA 3O3LA 1C0UA 4ES1A 1OYEA 1GXLA 2W4PA 3MAAB 4UOGA 1WG4A 1MNEA 5LJ3Y 4JV5J 2A2CA 3GIRA 5DETA 2AGQA 2GZOA 3TRGA 3W9HA 4X4SA 4TY8A 5KFCA 1D09B 4IR9A 1D9AA 1U1OA 3CDWA 2FVSA 1HBMA 5A8KA 1OS5A 5KG3A 2DPJA 1H38A 3KOAA 1XNQJ 1Q81T 3JQJA 1CJKA 1QM9A 2FD2A 2UU9F 2IMWP 1CQNA 2XY7A 4GKJJ 3LH2S 4RBTA 3PKMA 2HIQA 2DH8A 1NDPA 1HBNB 4DL5A 5CHCB 2E7WA 1D3WA 2DXDA 3ZXWA 4DF8A 3VGSA 2BE2B 2Y1RI 3L09A 1LWXA 1FKOB 1PKUA 5DLGA 3DRPA 1S1XA 4QYZK 4QYRA 2K3KA 3J80Y 4EO8A 1FX2A 3T1HF 4NWBA 3MDFA 1WHVA 3P4UB 3BB5A 4QWBA 2MQLA 1JLBB 4XDCA 3M8YA 2WOMA 5L8RC 3SCIE 5DS7A 1PCAA 3KK3B 2COLA 4L74A 3PO4A 4DL3A 2V5HG 3FCVA 5B0AA 2RKIB 3QLHA 4MMOA 3CMES 2M9KA 4J9LA 3MOZA 1HNXJ 3UN2A 2JVOA 3R7NB 5HQ8A 5T7LB 1VMBA 2RJZA 1NHKL 2K3IA 4ZOSA 2ZFHA 3N01A 3HHKA 3M8PB 3BGRA 4IFYA 1GAOA 2CPFA 4JI0J 1SI9A 1S6PA 4OYOA 1IKVA 4CH7A 3CC4S 4QPTA 2LCWA 1EP4B 1YRTA 2ALZA 1BUXA 3G6XA 3T9ZA 2ILZA 2ZH9A 3OW2R 2AV5A 1RA6A 2ADCA 1WF1A 2XGQA 2FHKA 3QJJA 1IM6A 2JX2A 2WSFC 4IR1A 3AAWB 1CC8A 2EPIA 2HWIA 4Z2XA 3CE8A 1U6ZA 4PCQA 1OYDA 2YWKA 1VCTA 2L08A 3EICA 3CJRA 4NMLA 3KLGB 4RBUA 1HHSA 3I5CA 4TYBA 2MKHA 1NU4A 3KJVA 5F0WA 3KLFA 1RHMB 2XNQA 1FJGJ 4K7QA 4LIRA 1JLQB 3VF0B 3QWPA 1S9FA 3C6TA 1SVDA 1X4CA 3OJSA 2BJEA 4KV8B 1D8YA 3DOKB 1RISA 4IG0B 4C8ZA 3T41A 4DPOA 1GMWA 2K7JA 2GGPA 3EPIA 1KVIA 4J9KA 2ZBRA 4RUCA 4NXNJ 2ZWOA 2HQ3A 4QW8A 3I6PA 3RZAA 4KPYA 1RLCL 2CWXA 4QR0A 2CZ4A 3MOJB 2VF3A 4U95A 1Q78A 1HMVA 1FJCA 2EW9A 4LF9F 3KK3A 2N4DA 1VQOS 1EIYB 3M2VB 1FWPA 3DLBA 2RKIA 3BV8A 3TA0A 3HFVA 3T3FA 2FC9A 1SB6A 4OHZA 4K2XA 1HQUB 4YB1P 1TK8A 2MQ8A 5KFIA 4EYIB 3FCWA 1R8HA 3M8PA 2BXJA 1MU2B 1RT7A 4DS5A 2CQHA 1VK8A 4DL2A 3L3CA 2DNPA 3IR6B 4ID5A 4UY8T 4W4MA 1HL6A 1VQNS 1YIJS 4OYIA 3OL7A 2FJVA 4ZIWA 3TX8A 4S0MA 2R3VA 5HANA 2EFOA 2F8EX 1JK9B 3DNCA 3EXYA 3IO1A 1MWYA 3QGPA 2YH0A 4OHXA 2MKSA 1HLWA 2NYIA 4FF2A 4BC7A 4G1QB 2MEWA 3ZZOA 3D6FB 3E01A 1F5CA 4X4UA 2CVIA 1AUSL 3H59A 5E3QA 3MAHA 2DNZA 1UVJA 2FQQB 3K5NA 1FK9A 2AKWB 3TANA 3H2VE 4I7FA 1NK4A 2FUG9 4RO0A 2C2KB 3US5A 1QSYA 4QIWD 1KQFB 3RB4A 4YR2A 2JLGA 4H4KA 2HNDB 2OPPB 4ED8A 3WC0A 5L1JA 4KO0A 2QGFB 1N33F 2J0WA 3RW7A 3J7YI 5K8OA 3CD6S 3TEGA 1RWVB 2BE9B 1RBAA 1JLQA 2QLWA 2X1GA 2KM8C 5A2QY 2Q6BA 3TUJC 2QN6B 4LR9A 1Y0HA 2HHVA 4IG0A 2JWNA 1NB2A 4AUKA 3ZTRA 2UUAJ 1C1CA 1WHWA 1TL5A 1FFWB 2HZCA 2B43A 1N4LA 4G65A 2HS4A 2RQ4A 3PJXA 4ZLNA 2BW7A 2MGZA 4A8XA 2HBRB 5K5MA 2AGOA 1UVLA 4M5MA 2GAHC 1S5ZA 3N9UC 2AD9A 1KFDA 5CCLA 1RU1A 2J9DE 1UL3A 3RAXA 2ZNYA 1QUVA 2AT1B 3H2UB 3TA1A 4TY9A 4FYYB 3MCNA 3FRYA 3UDEA 4CLTA 1ZZNA 4ED5A 3H40A 2QFIA 3QT7A 2N3OA 5B0EA 1VBYA 4WXWA 5JXSA 3BGLA 1RT1B 2UP1A 5KFJA 2IAJA 3IA0A 2EXUA 1CJUA 1VOMA 2QSWA 2E9TA 1UJ4A 1RWMB 3NBPB 3NCQA 3P5BP 4TLQA 1DTTA 4I2PB 1GT8A 3RB6A 2KG0A 4I6AA 3KNGA 2KG1A 4C98A 3DN9A 2DK2A 4FP9A 1K1SA 3ZTSA 2J8AA 3H5SA 2AGPA 5EUHA 2D1CA 1HD0A 3E2EA 2KM8B 2GFFA 1REGX 4RR5A 2VQFJ 2OMOA 2XC9A 2WONB 2OELA 4DFKA 4HKQA 1KLNA 1UVMA 3FEXB 2HNDA 2OPPA 1EB0A 4TQRA 5HK4A 2K2PA 5ETNA 4ZIVA 4PPDA 3OVAA 1VS3A 4B3SJ 3V81A 3OVSA 3F41A 3AD9C 2ATCB 3DDNA 3CJSA 3FSYA 4KHMA 5J2QB 4MFBB 4Y0FA 2AU0A 4HLBA 3K5PA 3SFGA 2ZE2A 3ZC4A 2IBOA 3PV8A 2YXLA 3PNIA 2QC3A 4MK8A 1HYSA 5I4MA 2GQCA 3CWJA 3AD8C 4P75A 4RZRA 1LW0B 2DNKA 2KO1A 2WW8A 3KK1B 3J7A1 4FNHA 2ZDPA 4DR7F 1U0HB 3RRHA 4AL5A 2Z2MA 2DEJA 3UNGC 1RYRA 2Z2YB 2CJXB 2ZOGA 1M1GA 2VG6B 3I31A 2YKAA 2FLOA 4KQZA 1I51B 5LSOA 4OYMA 2BANB 4C97A 3DGPB 3HK2A 3J81j 2J0XA 3TOQA 2W24A 3BDEA 4HI1A 3JAMU 1U1LA 2B4PA 1D0EA 2BEFA 1PIEA 3TJAA 4NLWA 1IN0A 4C0HA 2CDQA 1FERA 2MMYA 2DD8S 3GU0A 2XCAA 3DLEB 2DR9A 1S6QB 3HF5A 3SI8A 2CNKB 1LW2B 3JQMA 2ZH2A 4CLWA 2I0XA 5CYMB 3PYFA 1V5VA 3VVTA 2VG5A 4DPUA 3DM2B 3FEYB 4J9RA 2ZH8A 4OI3A 1ZM3A 2L9DA 2XO7A 2B8QA 2PA8D 2FLNA 3BGUA 3BSAA 4KC5A 4IDKA 3KLEB 2LP4A 1RKIA 2YKMA 5KOWA 3QRRA 3QWUA 2HW3A 4WCEQ 2DJWA 1RB0A 4CNZA 2M8HA 3BSNA 5KFKA 1ZETA 4M5JA 2IJRA 4LMZA 4TXSA 4FXWA 4YFUA 3KG0A 1KLMB 1N34J 4DR2F 4FS2A 2R7UA 1SKSA 2WONA 3KUEA 3PDNA 3M6VA 2MQQA 2BJ1A 3TQEA 5B09A 3D6HB 1F9HA 4CLSA 4O3PA 2EFVA 5EN1A 2QSFA 1ZA1B 3FK4A 4ZP8A 4DR3F 4CLYA 4QPXA 2KHDA 1K9MT 4MFBA 3IGNA 1A0OB 2H3EB 5HMWA 1IBKF 3LALA 2CUYA 3LGMA 4OMFG 2WZ1A 2OEKA 2C2MB 3MHYA 1AROP 3NKYA 2CQ1A 1H72C 3MTJA 2KJWA 1KONA 4EO6A 4UUWA 3PX6A 1JLGB 2JEGA 2LU2A 2EC0A 1ZZFA 3ET6B 4RW7B 3UVJA 2OPRA 3Q2SC 1OSCA 3CCUS 3QT8A 3ZTPA 4DZDA 5DO2A 3AA9A 4LF8F 2HURA 3K17A 3LOUA 2LA4A 3VZIA 2DCUB 3W9IA 2PE8A 2J9EA 3EPGA 2YH1A 3Q22A 5D8HB 1FRHA 2BUNA 2VFSA 2X7IA 2MZRA 4J9UE 2YPZA 3IFEA 3CDEA 4NOHA 4CDIA 3R27A 3W2WA 4JI1F 3TAMB 4R0EA 4ECYA 3H2LA 3CJQA 1SQEA 2XYPB 1NJIT 1YGYA 3QIPB 1HHQA 4NX9A 2V8HA 5D4LA 4W90B 4J9SA 3LP2B 2FHJA 3CD0A 4CT8A 1WNEA 3PVXA 1L3TA 4CTAB 4LRDA 2DISA 3M2RB 3D3BJ 3DRSB 5J2PB 3IM8A 3FUYA 1RT2A 2KVQE 4FZVA 2DHSA 3RJMB 5HBMB 4K4TA 3I0SA 3P96A 2NYHA 5F8NA 1G3OA 3HKWA 5KTQA 2G0IA 3W8GA 3BKFA 3PYEA 2B3TB 2IJFA 4A8KA 1KKHA 1RTHA 3QFWA 4IG3B 2FTRA 3F73A 3SQOP 2QA1A 2KKHA 3LA0A 1X8DA 1FRKA 1GX6A 3W63A 2WVBA 4G1IA 3HFKA 2P6TA 3UN3A 2E1RA 3ISZA 3PRVA 2DT9A 2DO0A 4ZN3A 2EBEA 3G71S 4ZP7A 4LSZB 4YQWA 3FGVA 2NLWA 4MK9A 3THVA 2I6WA 3V6KA 1SJ4P 4ID8A 5KT2A 2XMKA 1R27B 4B9TA 4DQSA 2DIVA 2Y1JA 4ELUA 2GIQA 5KT4A 4CYUB 5K20B 1CC7A 2UVUA 3M6WA 2AIRB 4WYWA 1J5EJ 2MXYA 3I0RA 2CQGA 4I6YA 1E6YA 1B7FA 1RTZA 3M2UB 2FY8A 3NWGA 2XZTB 3AQPA 1X9SA 1U26A 3GSIA 4F04B 3ZTQA 4CH1A 1A9NB 5HL7Q 1R0AA 4ELVA 1X4BA 3IS9A 3V6HA 2UXBF 4IH5A 3D7SB 5AE1A 1JKHB 3OQ2A 2ZOMA 4FXVA 4Q8FA 2V68A 2R8JA 3B8HA 5F41A 2W9BB 4K4SA 3QIPA 1I94J 2BQUA 3QO9A 4DR5J 1Y3KA 3M9MB 2VASA 8RUCA 1N6QB 4YUDA 4YHHF 5E3PA 4LVNP 2JOQA 4F4XA 2I5JB 2MLYA 4ZVGA 3NCRA 2R7XA 1NB7A 5E3CA 2GNKA 2V9WA 2XLIA 2YWHA 2OPQA 4I6WA 2DNYA 3SMZA 2VA3A 2ZUGA 4NLYA 2A2DA 3QAEA 4KGZB 2EG1A 3CT9A 1NK7A 1UW4A 4C7QA 1S9GB 4IFVA 1S97A 3KDNA 4ZCIA 5H9EK 1NBEB 5HO4A 2NCKL 2NXUA 3M8SA 2AYBA 3SIPB 2P9EA 1RT6B 4DCPB 3DMJB 3DLJA 3H4BA 1UWBB 2G4BA 3EJMA 2QL5B 2GHWA 4KY3A 2BM0A 4UOHA 4RNFA 2QEXS 4NLVA 3HLUA 2R2SA 2LXUA 1U02A 4A8FA 1VQ6S 3QT6A 3KLIB 3MWBA 1RAAB 2DVIA 2AHOB 3M32A 4ZHRA 5KG1A 2RIJA 3DDKA 1FXRA 4CYUA 4Q2MA 3G8TA 3CCJS 1NK0A 3GCWP 2XYHB 2AJFE 2B6AB 5LMUF 2VL1A 4ILRA 2QRRA 4GRSA 1SL1A 1FFGB 4UQGA 4JI2J 4NL5A 3ICLA 3IRWP 1IKWB 1B7YB 1K0TA 2ZVIA 3B4MA 4NZ7A 4U8YA 4AD6A 1L5UA 3VWSA 5CABA 1TKTB 5LMNJ 5GAHU 5KG4A 3OR2B 2JH3A 3MEEA 1JKHA 4M5DB 1U1RA 3TO8A 4QWDA 4L76A 1BE4A 1A6LA 2IYGA 3CSKA 2W9BA 5EGYA 4KPCA 1VRTA 2VFTA 3GIKA 3EVWA 3HXMA 2IDLA 4Q45A 1N6QA 2IVFB 3VVUA 1TFWA 1S76D 3TR5A 1B0PA 2CYYA 4ECUA 5CD4H 3OPKA 4DSIA 1L3SA 4LBIA 1IUJA 1CULA 4M5NA 1H3DA 1Z4UA 4G3IA 3FFIA 1S9GA 2UUWA 3CDBA 3QRQA 3DDIA 4HACB 4ZCLA 3C6UA 1QJHA 3SSRA 1C1BB 3DOMA 2XYGB 1JXEA 4GVLA 2XTJP 1X4HA 4OI4A 1ZH5A 1P1TA 5IS2A 3MEGA 1C4CA 2HHQA 1CJTA 3H20A 5ETVA 4WFBQ 1KN6A 2OFHX 1TL1B 4JI5F 2XQCA 2HHXA 2IHR1 1UWBA 1UVIA 1GTHA 4LJMA 1WOSA 2L48A 4P2FA 4HL9A 3OXLA 4O3RA 4USUA 2L41A 3W5YA 3G82B 1F60B 4C0BA 2Y9HA 2M7SA 1W25A 2QLXA 2B0GA 4L3KA 4OX9F 3KLIA 1SUQB 3HD1A 3W5ZA 1NHVA 4YR0A 3AA8A 1MMNA 4QWCA 4X2BA 5GMEA 4DV7J 4WBFA 4FXDA 4USKA 4E8UA 2E1MC 4KJIA 4IOCQ 4OZ5A 1RAIB 3L95X 2FHOB 3TI0A 2J7KA 2NZCA 2RE1A 4OLOA 1F9FA 4FF3A 1BHNA 4O3OA 2CAJA 4N77A 4OZ1A 5CXTA 1N32J 1X4EA 1VQ7S 3HVAA 1RTDA 1A7GE 2H1YA 4DHVA 4JV5F 3DU6A 2CPHA 3D0HE 3GCXP 2LKZA 3OR2A 2DITA 4ECZA 2UVRA 2MDAA 1UEKA 4TQSA 3QYYA 3CJTA 1CSJA 2F4VJ 2GMHA 1SH3A 5A6PA 1XNQF 3PW4A 4X4PA 1FDBA 2I9SA 4WZQA 1FRIA 2AJQA 1LOUA 4GKJF 4PWWA 2BJ9A 3A1YG 2LU1A 4P9SA 2GJ2A 4NYOA 2ASLA 3MURP 5KT5A 4KYZA 1X7VA 4ED1A 2Y0SD 3RB3A 5T14A 1OY8A 4PAAA 4CLFA 2QIFA 1Q53A 1R8CA 3K7RA 5JMNA 4RJVA 4RUBA 4MIAA 5D4PA 4CO1A 4C3KA 3VTIA 3HP6A 3HFZB 4BDPA 1Q79A 2JVRA 2V2VA 4IOAQ 4WIQA 3BF4A 4HT7A 1G6BA 2EWHA 3ZZYA 2ROEA 2K06A 5EDWA 3EZOA 3A3NB 1RAEB 3HZEA 2MLXA 1X0PA 2RDIA 3PHEA 4C8MA 3MMAA 1H74A 2IMOA 3BSCA 2FJEB 4ECTA 1NK6A 4ICLB 1FA0A 4DN0A 5RUBA 4KBIA 2BJ8A 2RU9A 4C11B 2RSQA 1JXVA 4O3QA 2DR8A 4JI0F 1O6XA 1B0TA 4DV0J 2V4JA 2XS5A 3MPWA 1HNZJ 3IWXA 1HARA 3QNWB 2Z30B 1HNIB 5CH7B 4J9MA 2DPIA 5D0EA 5HATA 1RT5B 1F9EB 1TL7B 4E0DA 2C22A 1RWUA 3T1YJ 1FEHA 1OWXA 1LNQA 3QMQA 2F4FA 5D0HA 1QTMA 3CF5Q 2FJDB 5L9NA 3N28A 2NXNA 3D2WA 4Z7CA 3EWGA 2XM3A 2XWXA 1S10A 4Y2CA 4ES2A 2YTCA 5DGAA 4OFZA 2QTWA 2LXIA 3J81Y 1SL2A 2C2OB 2HFOA 3PG9A 4FVMA 3MXHP 2RF2B 1J27A 2MQOA 3RAMA 2JC0A 2Y0BB 1NDCA 1BQMA 4P6QA 1TK5A 3RBDA 1FJGF 1HQEA 4PQUA 2MZQA 2ZC3A 2MJUA 2KYXA 1HNVB 3KK2A 3J7ZT 2FIUA 5GADU 1UW9A 3BKTA 4Z37A 1ZA2B 2XB2D 5HAOA 1S0NA 2XLKA 3CTRA 1OQ3A 1I6JA 4JI3J 2X3GA 2ZH6A 5GMDA 4F3QA 2FY1A 5F8HA 4NXNF 1S1WA 4R5PA 2LFVA 1FX4A 1AZSB 1TKZB 1O8BA 1TKDA 3VHQA 3KG1A 1AFJA 1NSAA 1JLAB 2KFYA 3CMAS 2RILA 1UP1A 2HQCA 1X9MA 1NKEA 1Z1ZA 4DS4A 2ZH1A 3JYTA 2B9XA 1JJHA 2J0SD 3I32A 2MHEA 3MTKA 4LT6A 2E1CA 2YX1A 1TKXB 1F1BB 1F3VA 2DXFA 4DX5A 4B9MA 4LF1A 2OAUA 5JVHQ 4XDDA 2XY6A 1Q82T 3K5OA 4HYKA 2OUGA 3Q8QB 1RDRA 4DFPA 4J9OA 3NEKA 2D3ZA 2ZH3A 4CLLA 3CJ0A 5DDPC 4ETZA 1PYSB 2MZSA 1ZBTA 4ZPTR 2LQ8A 1S7HA 1P8GA 1UETA 2B9EA 5D4OA 2CKWA 1WC0A 1VBZA 2ZHBA 1DFDA 2FVQA 1KTVA 3KUGA 2JC1A 4DU8A 2WVFA 2KZZA 2DKOB 1H73A 3LQVA 4LSLA 3OTCA 4LUBA 3N79A 1PBAA 2JDJA 2R8GA 2J6SA 4HR2A 1Q4RA 2CQ2A 3PJ9A 2D3OR 4OYWA 3AODA 4GVBA 1PO6A 1RABB 4DCOB 3AY0A 4F3OA 4Y2AA 2B51A 4K4XA 4L73A 1HWJA 5I42A 3D66A 2FLPA 3KXDA 1BMQB 3N5FA 1AB8A 3ZO7A 4WTYA 5HMXA 3GZ7A 2BYCA 4GKKJ 3OHBA 4MTPA 5SZTA 1R8AA 2MZTA 3D67A 3Q89A 5EX0A 1U49A 4DV1J 1R8PA 1ICEB 2E5LJ 1X60A 1M5HA 2G1DA 1ZAVA 1U1PA 2XSJB 4JP8A 5ETTA 1FJ7A 2FLLA 4JI7F 2GS8A 3MR5A 5B0CA 5A8RB 2UUAF 1XJWB 2GIFA 3Q0AA 2HAIA 3OBIA 2AMCB 3OFGA 1RAGB 4DF4A 3ZTOA 2D7SA 1PJ7A 1TQLA 2MQMA 3Q83A 4DX7A 2XNRA 1IKXB 2VFVA 1QE1B 4YR3A 4OZ3A 2QG9B 2ZBQA 2CXEA 2DIUA 3KHHA 3EE3A 2DYAA 2BKOA 2GHVC 1RK8A 1NJYA 3NP5A 1U1KA 1LQ9A 2YKNA 1H0HB 3UQSA 3VZHA 3NCPA 1NDKA 2J7WA 1FTRA 5HP1A 4PR6A 5C2CA 3LO3A 1PG5B 3A12A 4USHA 1UA0A 1CEZA 3PO5A 1F5BA 1MLAA 4FKXA 3MMBA 2IIHA 1HBOB 4RW6A 1S1TB 2H5JB 2UXCJ 3A8JA 5HSPA 1BWVA 3MPYA 1N56A 3RAQA 3CMQA 1RLDA 4C2MA 1W7WA 5FDLA 1KFSA 4LF8J 1RKJA 3I87A 5F0UA 2V0NA 1S59A 3FSIA 2VOPA 7FDRA 2HNZB 2VQFF 1GNKA 2KRRA 3UPFA 4EGLA 1WC6A 4ANEA 2W4DA 3GYXB 2YWEA 4G1PA 4WP8A 4U7CA 3IG1B 2QL9B 4B3SF 3IMQJ 4B02A 1NMEB 1T9XA 5FJ4A 3QFHA 5BR8J 4OZJA 1RE1B 2ASDA 2BRLA 1C0TA 1FE4A 3GG0A 3HULA 2GJIA 3RG6A 4I67A 2OTLS 4M5LA 3TJ8A 2LVWA 4CP5A 3O6QA 2LYVA 1XK8A 2PMZD 5HLFA 2CPEA 2ZWPA 4ED0A 3JTPA 1JLFB 1IWGA 2KJVA 2G2ZA 1U24A 1IKXA 3QGIA 4Q0BB 1WACA 1QE1A 4IYQA 5H9EJ 3M6XA 2LEAA 4ZPAA 2ZD1B 3K57A 3BN7A 2YNFA 3VAGA 3BR8A 4FBUA 3NNHA 5GAHI 2M2BA 4RX6A 5DRKA 2KT5A 3K89A 2J9DA 4OJ3A 3MAQA 3HZGA 3SCJE 4NLXA 3PIPQ 3E3XA 3DOLA 1K47A 3R6GB 3KHRA 4ZDNA 1UEUA 1WSRA 2V6AA 4DSLA 4P2XA 2WK4A 1LV5A 1YBUA 1PC5A 4DL0C 2GAGC 1W2BR 1RCOB 2RDJA 4B9UA 4O4GB 4FVCA 2OPSB 1N5QA 3KMSA 4EBDA 3M1VA 2HLUA 2EFPA 2NXJA 2V67A 4WWSA 1N34F 2QV6A 2AEMA 2RMLA 5DDOC 2RQKA 4ECRA 5T41A 4X62J 3L7PA 1VI7A 2XO6A 5C5JA 3ONQA 4C3MA 4JV2A 1Q8BA 2XMVA 3IG1A 1IR0A 3TUIC 2ASYA 2CPDA 2PA3A 1M5SA 3MM6A 2AJ1A 1URNA 4AXIA 5B7WA 2GVZB 3HHLA 1LWFB 4TU7A 5DZ6A 1XEZA 2V8VA 3LGHA 4R0JA 3TVYA 2AQ4A 2A10A 4URGA 5K9FA 3THTA 4PXDA 2ADBA 4X66J 3SYZA 3A3PB 1S0MA 4FF4A 1N5TA 2ZEJA 3MR2A 3PY8A 4B9VA 4DFMA 4BBYA 3GV8B 1TL3B 5B0BA 4DPWA 2ZITA 1SQFA 1GK8A 3MECB 2H4WB 4HI2A 3MEKA 4N41A 2Z58B 3M6UA 2Y3YA 1V6HA 5KFLA 3MR3A 4J90A 1LWEA 3UO0A 4LSNB 1S7IA 3A13A 1RBOB 1HKAA 2OHDA 2A6MA 2POKA 1Z2ZA 1SC3B 1RP5A 2HEKA 1RT4B 2RRBA 1OO0B 1HR0J 4MIWA 2L3MA 4MK7A 1RSCA 3HVRA 2KL8A 1WORA 2C3YA 1QAYA 2J9CA 3KWMA 4F4WA 3TQ1A 4NA2A 3GV5B 4JI8J 5DM7Q 5EHHA 1FRXA 2KDOA 2VG7B 4OJGA 1VYAA 4F26A 4WIIA 4ED3A 3MR7A 3JSBA 2LMIA 5A6WA 3M9NB 3VAIA 3P6YC 1OMSA 4HEA9 3GG1A 2KVIA 1YJ9S 4AXJA 2F8HA 4KHPJ 1I3OB 1FWLA 1HI8A 2Q1LA 3NAHA 2MKCA 2BKNA 4OYZA 1JXLA 3PEHA 5JVGQ 3LP1A 5A8WA 2PD1A 2W9CA 5IXUA 3O1LA 2V94A 4KGVB 1VR6A 3UN5A 2VICA 4F02A 1Y11A 4TY8B 1VQYA 4FDFA 3CGIA 5AJ3J 2KZMA 2E5IA 3T5KA 2WVCA 2R7SA 1CJKB 2QMWA 2GVZA 3TNVA 2AF6A 4O4RA 4ZITA 1BXNA 4DN9A 3V6DA 3F0NA 1DURA 2E44A 3Q8SB 3ZNJ1 5DLFA 4KTQA 1FKAF 2FVPA 5IC6B 2UUBJ 3MCMA 3SZ2A 3H25A 2W2OP 2LQ9A 3UFCX 1JLEA 3QJPA 3I9ZA 4DU7A 3KLHA 3K5MA 1OSDA 3DRPB 4LR8A 1S1XB 4N56A 3NOGA 3JSYA 4ECVA 2R2UA 1FDNA 4OI0A 2X3DA 2P5VA 2ZC4A 1VLYA 1VHIA 1FTCA 2N4CA 1J5EF 3K58A 2LXFA 1IBCB 3HKZD 1IXKA 4WP3A 3BO4A 4K50A 5BYRA 3T9NA 1XN9A 4QR1A 3VAMA 4MKYA 4ZPCA 3QLHB 5EX3A 4NYZA 4NASA 4DPXA 4Y34A 3W2VA 3GR0A 4ZPDA 1VBKA 1HWLA 2FYXA 1RWOB 3CC2S 1RTIB 2EKNA 3BGRB 2ZOFA 4UF4A 1D8ZA 2WBRA 5DQHA 2XY5A 2LEBA 1I94F 2DNQA 3VAJA 4DR5F 1FEEA 3LWMA 2ZHAA 1ZPVA 1S6PB 1IKVB 5GADI 2LEPA 5IT9U 4B3OB 4QJVA 1W26A 1S1UA 5KFOA 4D3HA 3UCGA 1VIOA 1XMQJ 3MM9A 3D4JA 1N5VA 1YRUA 2PEHA 2V63A 4PG7A 1REVA 2P9GA 4RW8A 2ZDOA 4JOUA 3PACA 5D15A 2HGMA 3CDUA 4RBVA 2Z56B 2YWWA 1JLCB 1TVRA 4RPFA 5LXYA 3OVBA 3NS5A 3SDEA 4OI2A 3GIJA 3A8EA 2R4FA 2PMHA 5L1KA 3EZUA 4WFAQ 3A4TA 3U1NA 4RUHA 2CJQA 3C14B 4K0KJ 2LA6A 1NJWA 1S0OA 3MM8A 3KJVB 3KLFB 2DNLA 2HK3A 1HNWF 4DCJB 2VB6A 3C6TB 3OR1A 3BN4A 4DV5J 4GO5X 4LRCA 4H4KC 4N8NA 3K5LA 1OY6A 2WCXA 1PILA 2E1PA 4J9VA 2GMJA 5J1NA 4QCLA 3LGNA 2GGPB 3GFYA 3L7OA 1EJ7L 3RRKA 4DDFA 1SJ1A 4J7CA 2B8PA 1WJ9A 3GV7B 2RRNA 3DYAA 1RTJA 2WBMA 4JI2F 2LQBA 1WKLA 1IBLJ 2CQBA 1HMVB 4B9NA 2DGUA 4UZBA 1F2HA 5LT5A 1WF2A 5LMNF 5IQ6A 2X1BA 1TTHB 4KT0C 1NLKL 2B9YA 3CD7A 4F8RA 4KHRA 1T05A 2MKKA 5E0OA 1RTIA 2F63A 2V8GA 2M70A 1RT7B 2HQDA 2F7VA 2CWKA 2HPUA 1TR0A 4WYLA 3P3DA 4ID5B 4URSA 4CLZA 2A1BA 5C25A 3D0IE 3I56S 2RQMA 1JIHA 1IQTA 1Q8LA 4B3OA 1M0SA 1JJ2R 2VBWA 2N3LA 5J1EA 5DDQC 1G1XA 1NSPA 2UV8G 4K4YA 1RACB 3NS6A 1YWXA 3C8YA 1HW9A 1FDAA 1DJ0A 1SPBP 1F5AA 3BEGB 3G6VA 2HVHA 1NPKA 3BGOP 1MMLA 3E01B 1RWNB 1JLCA 5KFMA 1R0CB 3TVZA 4B3MJ 1FK9B 4I56A 4NLRA 2BKPA 4I7FB 2F5GA 3W66A 2KYZA 1NM2A 3H8YA 1RI7A 2ZNZA 1Q8IA 3D1OA 3VGTA 3C14A 2PIIA 5ADZA 4DQRA 2BJ3A 3EGWB 2MSTA 4KO0B 2FJBB 4DSJA 1U47A 2B7CB 1PYOB 1S48A 1UAWA 2V2ZA 1AFIA 4DV3J 1SC1B 2E1AA 5ETSA 2DGOA 4GC7A 4WFZA 2C2ZB 3MGJA 2AP6A 3IBCB 3M9OB 3VR1A 1HWUA 1VJQA 4YY3J 4OYAA 1LEOA 3GJRB 4DV7F 1RYSA 1R7IA 1C1CB 5KT3A 4PG5A 4ZMMA 5HMYA 3EZ5A 3K8WA 3MMCA 2V69A 2MGZB 1N32F 4F36A 2W2PP 2HZAA 4UQTA 4X4VA 3U02A 2Q3PA 3ITHB 2DO4A 5L1LA 3GB0A 3FJ2A 1KOHA 3BYRA 1VK3A 1KEKA 2F4VF 1EETB 5F8IA 4DOZA 4KKOA 4EU0A 1IM4A 1FNXH 3D3CJ 4IOBA 5FLXU 3CIZA 2F9JA 5DQGA 1FRJA 3CUNA 1U45A 1SKWA 3NGTA 2O3DA 3KJNB 1MWQA 4PUOA 1T9WA 4UY85 2G9OA 2YNHA 5F8MA 2IAJB 4FN5A 4N47A 5ETOA 3BJYA 4LF4J 5HMZA 1CJUB 1P9QC 5SUHA 2VJUA 4FYDA 1QUPA 2XWYA 4HT5A 3DCAA 2JEJA 1DTTB 1TU0B 4ZLJA 2BOAA 3D1HA 3JXOA 3BBBA 3EMTA 4KR0B 4J9PA 2XGPA 4ZS6A 1S1VA 3PW5A 2RD5C 3B82A 3LAKA 3R5BA 3IR5B 5DG9A 5BXIA 5BJRA 2G0JA 1NSQA 1R89A 4A8MP 4JI4J 3AJ2A 1X5SA 3NLCA 1KQKA 4YOEA 5A2QU 2GVDA 4BWMA 3V81B 3IC1A 4MH8A 4PPZA 4HDGA 1GXUA 5G0RA 2MZ1A 3OT9A 2QYGA 5I3UA 4JV0A 3V6JA 2JEFA 2W8KA 4RWWA 2ZE2B 2RS2A 3UR3C 3TAQA 1HYSB 2R2RA 1S57A 2LECA 4HHHA 2AX0A 5KFHA 1IBMJ 1VC6A 4JI7J 2M3DA 5F8GA 2A18A 4ERDA 3CJ8A 1RHQB 2CRLA 2DB1A 4UOFA 3FCHA 4DV0F 1UZHA 3NAIA 3MEDA 1GH8A 1HNZF 1H6KX 1IKYA 4NRTA 2AEFA 1VQLS 2AWZA 2H48B 3OUYA 4ZP6A 2HNYA 1X5OA 3NGDA 2NSCA 5H9FK 4DV4J 3PX0A 2RRAA 4BHQA 2Q6CA 2DH9A 1X4FA 2EKYA 3T1YF 1UPMB 4RNHA 1RJJA 2FJAB 3ITHA 3Q8YA 3K8VA 2CPZA 2HG4A 4ILLA 2V2KA 4FF1A 1RA7A 2F8MA 4NA3A 1FD2A 2OGUA 1EETA 4N8OA 3QRPA 3HM9A 2KTQA 4RW4A 4ZJLA 4HTJA 2MKYA 1SBRA 1V3SA 4U6PA 3D68A 4FYWB 2FVRA 1RHRB 4LQ3A 2HFZA 3CJKA 1ZM2A 3QSYB 3HPOA 1XBWA 2VG5B 3VAHA 2D3O1 1Q5VA 2DNNA 5LM7E 4B3RJ 2IYIA 5MAOA 4ZN1A 3OXGA 1XTZA 4IDKB 2YQ1A 3MUTP 2YKMB 2KXNB 3N4WA 2RDDA 3NS7B 3T6JA 2R2TA 3C2PA 3I9V9 2M4MA 4JI3F 1FT8A 4XO0A 4LBPA 1CJVA 3NRBA 3PR5B 1FRLA 2BR0A 3UDCA 3POTA 5KFWA 3FDSA 1APSA 1VJWA 5E33A 1H2UX 4A4JA 4CH0S 1BQNB 1WD6A 4OI1A 4RUAA 5HI7A 3ILIA 2RUGA 3W5XA 1K8AT 4X4RA 4NZ6A 1RAOA 3AFGA 5F8LA 2W7PA 1N5YA 1TAQA 4C8KA 5DJBA 2GX8A 3HSJA 4LFCF 2DGSA 5C24A 1S77D 2V8PA 2R7TA 1N36J 3TYTA 2DNOA 3DI6A 1SJ3P 5KFRA 4B08A 3I4PA 3OL8A 3HJFA 4DUZJ 2X1AA 2ZJQQ 3L4BC 3BSOA 1NAQA 3HVTA 1IWAA 3I4HX 3R2DJ 4U96A 2BZ2A 2PMWA 4WPAA 7AT1B 1YK9A 4N5SA 3UVJB 4CRJA 2OPRB 3GFHA 4CO3A 1U8SA 2IRUA 1P1LA 1C4AA 3MD1A 1RWXB 1H7XA 3X3UA 2UUCF 4NLPA 1H7WA 3FZ2A 3UI3A 2G0CA 2R9LA 5KG6A 2XLJA 1KVJA 3W65A 2NS1B 1S9EA 4IRDA 5IQQA 2NPIA 5KFQA 4V1Ak 2WHOA 3TJ9A 1HPZA 2QT7A 4KFBA 4WE1A 4ALZA 1B70B 3TZYA 2DNGA 3PJWA 2N7YA 5HROA 4K8RA 4GKKF 1UVKA 2HLTA 3DLGA 4UUXA 3W2WB 4RU2A 4DWIA 1FJEB 3C16A 2AYGA 1WTFA 1P9YA 4DV1F 1UMJA 2GQQA 3BM7A 2E5LF 2VC1A 2YWGA 3GP9A 4K4WA 2ZBIA 3MUVP 4ZLPA 1CS4A 2FHJD 1CG2A 3QSIA 4ANDA 1VQ5S 4MYUA 1HWKA 2D3UA 2RH3A 2VA2A 2UXDJ 2AJ2A 2WW4A 4JUZA 4LFAJ 1L3UA 2GHPA 4ZPWR 1RT2B 2HIYA 5M2PA 3N6MA 4UW2A 3OXFA 1FVSA 3LPYA 4A8QA 2JLFA 1RAHB 3I0SB 4TKTA 1VQPS 2Z2LA 2APOA 2MY7A 3VCDA 2EEYA 1YZ7A 5J2NA 1YJRA 2DRBA 1BQNA 1WELA 1U7LA 2VPYB 2R7RA 2A3JA 1F6TA 5AXMA 3LP0A 4IQXA 1RTHB 3WIUA 3CJ2A 2KXFA 3PRDA 2DTJA 1S4FA 3PZPA 1WC1A 1GX5A 2PEBA 4DX8H 4OJ1A 1V9OA 5LSLA 1NJXA 3NG8A 3NMAA 2ROGA 3TA2A 4P73A 4L6V3 2WAQD 3UD3P 1FNMA 3OSNA 1Y9OA 1MROA 5KOXA 3HJVA 2BABA 2XG8A 3IAS9 4C8LA 1DLOA 3PYDA 2UXCF 2RVJA 4LREA 2QLFB 3KUHA 2VFRA 3I0RB 2W7OA 1E6YB 3OL9A 2H65B 3NGSA 2I1RA 3IR7B 1TAUA 2D69A 4A46A 3KJQB 1R0AB 5I3QA 1JQGA 3IS9B 2HFVA 3RR8A 1Y5IB 4NLSA 5F3ZA 3HO1A 4IRCA 1WG5A 2J8SA 4DEZA 2E5GA 2RS8A 4DR6J 2ERRA 1RWWB 4Y2IA 9RUBA 2BJDA 2J76E 2HYIB 2XI3A 4ECQA 3H5UA 4AQYJ 2XZWA 3GSDA 5BR8F 2VC0A 4DX6A 4C8NA 3QO9B 1S6OA 4H4MA 1JX4A 3HX9A 4LR7A 4NEZA 2RQCA 3LF0A 5KFEA 2B4UA 3PM9A 4C3LA 1Q95G 3MFHA 3GYNA 8AT1B 2OPQB 3ETOA 2CNNB 3RBEA 3GTYX 2DGVA 1YHQS 3ZFVA 4U8VA 1TV6A 2HFNA 2MKIA 1K44A 3HMJG 3UCZP 4ZVUB 2GQ2A 2XI2A 1NRKA 2E7XA 1O5JA 4IFVB 3KHLA 4MIBA 4Z7YA 3TZZA 4QU6A 2CQPA 4ZVSB 3CCSS 4KSEB 5M2UA 3NNAA 2IM3A 1ZYQA 3SQGA 2HSEB 3UW1A 4H4OA 1YI2S 4CO0A 3R5AA 2YVSA 2AEJA 4OLPA 4DR1J 2E9RX 4HDHA 2HRYA 4OX7A 1T3OA 2EFQA 2OEJA 2CA9A 3TZWA 1RCXB 4CLKA 4USMA 4EEYA 2QX0A 5DG7A 1KD1T 3JQKA 1YJVA 1K0VA 3KTQA 4QZVB 3M30A 3PHTA 3FC9A 2CFXA 3PIOQ 2YQ0A 3DXBA 1EAYC 2H5EA 4QIEA 5IT9Y 1R0BG 4L75A 5LSRA 4P7VA 1ZTTA 1U0SA 2DBBA 2I8EA 4ED4A 2HMIA 2ZJPQ 4DR4J 1BQXA 2HK2A 3FRZA 3M32B 4LF5J 1YJUA 4ZHRB 1NZ8A 3TX0A 4G6VB 4ZPBA 4F3MA 3FBFA 1WWHA 2C28A 5J1PA 2W25A 1HA1A 1FFSB 2OLWA 2G13A 1R43A 1FE0A 4BWJA 4C8YA 3OL6A 3DC2A 1Q0NA 1VRUA 3MM5B 2RNEA 4WU3A 2V50A 3UCUP 4FPIA 1Q5YA 3NXZA 4X62F 5J2MB 2KU7A 3MEEB 1V3RA 3VAFA 4XAKA 3IAM9 2R7WA 9ATCB 1ZAWA 1DQ9A 4P7TA 3TUPA 2WSCC 2J7UA 2VBXA 3NGUA 4JYAJ 4UOCA 4WKYA 2PDAA 2ZZTA 1VRTB 1SV5A 4DQIA 3AD7C 2LQJA 2V8DA 1VIXA 2P8IA 4KGMA 1M5OC 2WB4A 1XMOJ 4IO9Q 5IWAJ 2NXCA 4USVA 4WTOB 4X66F 4O0IA 2VBYA 2HVIA 3DRRA 1HIYA 2IC3A 4ELTA 3OLBA 4Y2MA 2DR7A 1U1QA 1N54B 1CULB 3G8SA 5D3GB 1QD1A 1VISA 3FFIB 5D77A 1SCJB 2DGXA 3OTOJ 1EKSA 3C6UB 4LQ9A 2VZ9A 3EM1A 2DHHA 3DOMB 1IVZA 1OQ6A 1J2VA 1Y4ZB 3MEGB 2DNRA 3Q86A 1Q8KA 1CJTB 1RT3A 1EHWA 5L1IA 1UEVA 4ZPVR 1S4EA 4P2SA 4ECXA 3TEHB 5IM0A 1H98A 2DEIA 4NCAA 2JHEA 1UJ5A 2H51B 3LAMA 1HR0F 3PCOB 2OSRA 4DI6A 4E98A 1HNWJ 3G6YA 5FIIA 3MAAA 5D6GA 1U09A 2DHXA 2HQFA 5CCMA 4JI8F 4F2SA 3BBCA 5IT4A 1YG0A 3W3SA 2CNOB 2CPXA 2IVMA 1FVQA 3FQKA 3H90A 3EUNA 3OTBA 3PW7A 1SKUB 3I82A 3IXQA 4OZ2A 1HD1A 3PTWA 4KHPF 1F3FA 2BX6A 4OHYA 3E51A 2MPUA 1WKKA 2HHTA 1QAXA 1Y7PA 1HBNA 2X1FA 1RTDB 1T0TV 1TL4A 3MM5A 2C3MA 2P2CB 3DHWC 5KAKA 4PXBA 3JB9k 4KGKA 3I5AA 2JZ5A 2RT3A 2BE2A 5J2MA 1CVJA 4P71A 1FKOA 5HJYA 5AJ3F 4DJBA 4DUYJ 1XERA 4QBUA 2YBVA 3GJSB 4ED7A 1QTNB 1R3NA 3N0VA 2B56A 4K59A 1SC4B 2WVEA 3SXLA 4ZVOB 5HQMA 3VGUA 4YP3A 2VD3A 1KWMA 2VUGA 4C48A 3CCZA 1Q7LB 5LL6d 1JLBA 3ENWA 3TW0A 3AOCA 4EK2A 1BGXT 2UUBF 4NXMJ 2SXLA 5HQLA 1N0VC 1UFKA 4F7VA 4F4AA 3BO2A 2KRBA 1T3NA 3C15B 1YX2A 2AW0A 4B3TJ 5D3GA 4PRFA 5T7LA 2FPHX 1B0VA 4DUTA 1YBAA 4Q2LA 2F40A 3MCOA 4R25A 4O44B 1Q86T 3MD3A 3R7SB 1S12A 2BQRA 1N5SA 4B9SA 4J5OA 4X65J 5FLXY 3R97A 2KT3A 4J91A 1EP4A 3GWCA 4TU9A 3Q24A 3NOCA 1IR2A 2BDPA 1TK0A 1QAJA 4ER8A 2NREA 3BH6B 4CQ1A 3MMAB 2X51A 4QQBA 2ACMA 5KFSA 2RUSA 5AE3A 4X64J 3ETMA 5HVFA 4WK3A 1NUEA 1VHFA 4QWEA 3IP0A 2WB1D 4LF6J 2IY5B 4AYBD 3CULA 1ZOTA 3W61A 3CCES 2KFNA 5F3TA 4IKAA 2V4JB 4C8OA 2IRXA 5L9XA 2CJBA 3EGNA 5C2GA 2ZBCA 1QDUB 4YB7A 3H5XA 2QA2A 1FXLA 3F56A 4PQAA 3T1AA 3WHIA 2QLBB 4EYHB 3L9ZA 3HCXA 3KLGA 1RHKB 5H9FJ 2RU3A 2D41A 1XMQF 5ETPA 4M94A 2CVEA 5K14B 2D9PA 4YEAA 1HI0P 4XIUA 3CCVS 4NZ0A 2Y8YA 2PT0A 4A48A 5KG0A 3OJUA 1WHXA 4NLOA 3H0PA 3Q23A 3RW6A 1WI6A 4KV8A 2LDIA 2VPZB 3DOKA 1NHUA 3KJFB 5KFGA 4KAIA 4DSFA 4M5GA 2MKJA 2VKRA 3GPAA 3RRGA 3MPVA 2Z0GA 4K0KF 3NY0A 3HHNB 4ENOA 3QBCA 3NNCA 1IR1A 1PSDA 2QE5A 1BQMB 5BYSA 4Y6IA 1VGYA 1HQEB 2ILYA 4PQUB 2EI5A 4MAKA 2GA7A 3Q8VA 5KG2A 3KK2B 4DV5F 3FNNA 1K73T 3M2VA 2ZH7A 2OEMA 2QMUB 1ZTWA 3N6LA 1SIZA 1FWKA 4OHWA 3C15A 3CC7S 4EZ9A 3GE9A 1M5VC 1HQUA 3EGVA 1S1WB 4O44A 4R5PB 1MU2A 1J5OB 3QPIA 3BKUA 4ES3A 2CJ9A 4RL1A 2HHWA 1IBLF 2M8DB 4X4NA 4OX6A 3JYTB 1NK9A 1GMVA 4NPOA 1U6BA 3CO0P 2L9NA 2MQPA 4FYVB 3KMQA 2KH9A 2GC8A 2H4YB 1NJZA 3S01A 3DLHA 3W64A 1B4SA 2YNGB 3OTDA 2H54B 2RHQB 4G1QA 2ZBPA 1S72S 2KI2A 1TFYA 1RAJA 1YDLA 5LJ5Y 2CQDA 2CQCA 2EK1A 1KSPA 4P72A 3FBCA 3BYPA 2Y8WA 4YN3B 2CZVC 4OZNA 3W60A 3DU5A 1SL0A 2YWFA 5I3PA 3JS9A 3Q8RB 3IM9A 1NEEA 2UV8A 4YB5A 3PXGa 5GVQA 2BQ3A 2MHNA 2W2QP 4LSLB 4B17A 2HFUA 2CQ0A 1RQ0A 4I0WA 2MLZA 4CWBA 2QA4S 4FPRA 4PZVA 5K14A 5EWEA 4JI6J 3GQCA 2MYFA 2L9WA 1KOOA 2FZKB 1U8WA 2IM1A 2G1HA 1XC9A 4GVBB 4JB8B 2BVZA 1VRQC 1ITPA 2OP5A 3J81U 1OPZA 2D9OA 2GW8A 4B3MF 4DPYA 2QZ8A 3ILLA 3WIVA 4OZLA 5I42B 2OD6A 1XR6A 5F9LA 1DTQB 5KFYA 1T11A 1SJQA 4PG8A 3NGKA 1FESA 4DBQA 2V9KA 2AJ4A 2D74B 5B0FA 1X4GA 4ZVQB 4DV3F 3EDQB 1TP7A 1EX8A 3J7Z5 4DQQA 3TVKA 1RBLA 3B78A 4YY3F 1T9UA 3GFZA 2JL9A 2U2FA 4OV6A 3WX4A 4KGXB 3JAMY 1Q1KA 1AXQA 2HVEA 1Z2LA 1W2IA 2ZJRQ 1J5OA 2EK6A 2DY9A 4N7TA 1T7PA 3R1HA 3OV7A 4Y3CA 4KH1B 1RT1A 1NXIA 4LF7J 3IRXB 4DG1B 3NBPA 1SXLA 1N52B 2VOOA 1S0VA 4I2PA 2YKNB 3A8IA 4C4WA 2JEIA 2YNGA 1YJTA 4EBEA 4LFCJ 2DR6A 3OSPA 3GYGA 1YITS 4DV6J 2B9WA 3SEOA 5HP1B 4DL6A 4FNIA 3JTOA 4MT1A 1FO1A 3PYGA 4CM0A 1P6TA 3AH6A 3M8WA 3P5TL 3MMBB 2VQEJ 4LF4F 4RW6B 2C3PA 2XHWA 1M5PC 2FHMA 2F1FA 2XMAA 1EZZB 4UT4A 1KHWA 1U2CA 3BBFA 1K1QA 1FXDA 5H1SV 5FDLB 2OO4A 4IRKA 4HH1A 2UUCJ 5J2QA 3A8KA 5B0DA 3UDVA 4WJBA 5KG5A 1WI8A 3KYLA 3T6BA 2Y1LB 4CCHA 2LQ5A 3GILA 1HBUB 3GR1A 4TLRA 5THWA 1LW0A 4Y2KA 1DTQA 2F65A 1RWPB 3L7UA 4OHVA 4JI4F 3KK1A 1L3VA 2XZDB 5ETMA 3SBMA 1U0HA 5ETQA 5KFBA 3BH7B 3G96A 1X9WA 3PX4A 5E3RA 2VG6A 4AT1B 5IZHA 1XNRJ 4IH6A 1C0TB 1TUWA 3LUYA 2BANA 3DXSX 1YTYA 2PN6A 3DGPA 1TMJA 4U7UD 1SH2A 2WRMA 2DGWA 3LTOA 1IBMF 5KG7A 3W62A 4Y65A 4DLGA 2J0QD 4LVOP 4ZCMA 5HLFB 3RGIA 1KVKA 1ULRA 4KE5A 3HHLC 3MR6A 4NLTA 1SQGA 2ZM6J 3DLEA 4DQPA 1S6QA 5AXKA 4BCAA 2CQ4A 2XMJA 2HBYB 4ETXA 2I2YA 1HWIA 2HHHJ 1LW2A 5IFMA 2VIHA 5EWFA 3H98A 4I4BA 1NPRA 4DV4F 5CYMA 1NK8A 2M52A 3IRXA 3D6MB 2GV1A 1VC5A 2YNFB 4K5SA 3KNAA 3DM2A 4DG1A 1T9VA 2DY1A 4DV2J 3CIMA 1X5PA 3KLVA 3DHXA 4O3NA 2UVVA 3HT0A 3KLEA 4PABA 4XPEA 3HVWA 4K5RA 2W01A 3GJQB 2PI4A 3OTEA 2UUTA 5DDRC 1V5IB 3TARA 3DOLB 3M4XA 2YX4A 3SV4A 1KLMA 2JNJA 1GFWB 1X4AA 2DGTA 5ETRA 2NPFA 1R6YA 3IWLA 2FJWA 3G9CA 4B3RF 1RU2A 1UA1A 3R7BB 2XMMA 3S6EA 3R5CA 3FMWA 1JMTA 2PI5A 4NEYA 2ZZNA 3FZBA 3GIMA 3M1VB 4A8YA 4L3NA 3U7JA 4O0NA 4OQJA 1URRA 4Q43A 1HBUA 4NI2B 2IA0A 1T9YA 3ILJA 3VQSA 1WOPA 1JJCB 4USIA 4AE5A 3DRXA 2FDNA 3EVMA 1JNRB 1R6VA 3W1YC 2J5AA 1VBXA 4QYZJ 1JLGA 4NCGB 3CNQP 1S79A 3JSMB 3MM6B 4ECSA 3ET6A 4RW7A 2Q43A 3HHLB 4HH0A 3M8ZA 2HS3A 1EKRA 3CEDA 2GO8A 2OTJS 4QWAA 1KR4A 3HHLD 4WXOA 5D78A 6FDRA 1VFJA 2P6SA 4W98A 5IT0A 1N36F 2YKOA 4ZVTB 5AT1B 2DR5A 2OMLA 4O3SA 1T02A 1UFWA 4DUZF 4NLGA 2XEXA 3R6LB 3MCSA 1VQKS 1BY9A 3CXCR 1WC3A 4J37A 3RTVA 1C2PA 1P27B 6FD1A 2M5YA 4J9NA 4QOTA 2HBZB 2CADA 2VFUA 1T94A 1U2RA 3OFEA 4WZMA 2DRDA 3TAMA 1LWEB 2V2QA 1Q16B 2VONA 3C3LA 4F0KA 3ENQA 3ENAA 4LFBJ 2AZ3A 1XR5A 3AB2B 3LP2A 1QVFR 1Y00A 3MPUB 3O44A 1MWZA 2I38A 1ZM4A 4CTAA 3BO3A 4ZKAA 3D0GE 4RNOA 4OIXA 3M2RA 3DRSA 1YLXA 1TELA 5J2PA 2CPJA 5CA5A 3EYZA 4QU7A 4USTA 2MTLA 2WSEC 5E7OB 3BR9A 4AL7A 1UKUA 2U1AA 4EMDA 5HBMA 2XBPA 3NGRA 1B3TA 1VQ9S 1XIQA 4I1TA 3MPDA 1CBKA 4KB7A 3M05A 4ILMA 1F0XA 1UFLA 1AT1B 4M5KA 5JUMA 1SJFA 4P74A 4IG3A 2UU9J 3LP1B 5A8WB 2W9CB 4CI0B 1GTEA 4OI6A 2UXDF 4BC9A 2KFZA 1IQZA 4LFAF 3FVYA 3E8OA 4NI2A 2MJNA 5MLCV 2C2EA 2C42A 4C9DA 3B6BA 1ZPWX 2CPYA 4QIGA 4DL7A 3AQOA 4NCGA 2MB0B 4ED2A 3AOBA 3JSMA 2KT2A 4PG4A 1LFWA 2VKZG 4LRFA 1UWAA 4X4OA 2F9DA 3T1HJ 5ITHA 2K1RB 5G4DA 5KFNA 4F4KA 3V6DB 4A8SA 4M5HA 4ZJOA 3M2UA 2LDYA 4YDXA 3K0JA 8ATCB 4OX8A 4UTGA 3ZNUA 3W8PA 3G4SS 5AXLA 2AX1A 2GO9A 2VH7A 3ZZUA 4F4YA 2QA4G 1XQIA 3R8YA 1SJRA 1JLEB 1JWWA 4MKAA 3IBFB 3T5HA 2CJYB 3DFEA 3KLHB 3P45B 3V4IB 3AJ1A 3D54A 2Q66A 3GONA 2HGLA 4EZ6A 3VQTA 1M5KC 4YB6A 4NRUA 2W9AA 1HW8A 3TP2A 3PFOA 4CO5A 3ZZZA 1BLUA 2CG4A 2GCFA 1FCAA 1OJ4A 3WDOA 4GO7X 2FZGB 2UVWA 2I5JA 3OHAA 3A3OB 1LKZA 2EFNA 1M1KT 4DR6F 3W2VB 4YDDB 3SSQA 3FEZA 6AT1B 2QJ3A 2NZ4A 2VPXB 1QSSA 4KRWA 2XMWA 1VQ8S 1QY7A 1KC8T 4KH0B 5CZXA 4AQYF 2NXEA 4JV1A 2J6UA 2CJKA 2EC2A 2OSQA 3CCMS 2NUHA 1MN9A 1I5OB 2DXEA 4K4ZA 1YJ7A 2NSBA 2W8LA 4IUFA 3N5BA 1HHTP 2YY3A 1WUUA 1RT6A 3DMJA 1S1UB 2KXHA 2HFSA 2BMBA 4CIOA 2QMXA 1TZ0A 1WG1A 3MM9B 1DAXA 1YZ6A 2YKQA 1REVB 1NCLA 3RBXA 2DHGA 5E3AA 4RW8B 4NMXA 4RU9A 4OYPA 3D1QA 2BJ7A 1LXJA 4LRBA 1YBTA 1TVRB 2OKQA 1S99A 5E2QA 5F9NA 5HVHA 3SDEB 2XHCA 2JRSA 1UTAA 3ILOA 1GEHA 2HGNA 4ZA1A 3R9LA 5U47A 5KFVA 1WOOA 3BQ1A 2M88A 3WX8A 3G2XA 4DR1F 1RXOB 3UR0A 2K1RA 2VJVA 2B6AA 1RZMA 3D28A 1MSWD 1FRMA 2BV3A 1S49A 1MMDA 3MM8B 3TZXA 1PAEX 2QLJB 1N0UA 1IKWA 2E9ZA 3FBEA 4LF9J 4NYPA 4TVAB 5LXRA 4F0MA 3OR1B 3SFUA 2CDRB 4M1KA 1TKTA 3I55S 4DR4F 4X4TA 3CDAA 4EBCA 3OFFA 3V4IA 4LF5F 5ETKA 3K59A 1PJ6A 4M5DA 3JSRA 1T03B 1HFEL 1YSJA 2G2YA 1NK5A 5LOQA 2HRUA 2BA9A 5DG8A 4F2RA 3DYAB 1RTJB 4ZP9A 3IWNC 2K8GA 3UD4P 2AYMA 3MMJA 3VV2B 1KDNA 2FC8A 4U7UK 1CPZA 4NCBA 5IV4A 4ZLLA 4NE9C 2VU5A 2IVYA 4Y28C 5KFZA 3O2IA 1TMMA 4ZVPB 3T5JA 3P49B 2HS0A 1KS2A 5KFXA 2CG8A 1T05B 4RWXA 3T19A 1MW7A 4JYAF 3S8SA 1U25A 3RYLA 5B08A 4HACA 1C1BA 5CYJA 4PYAA 1Y5LB 2YX7A 4TU8A 2OD4A 2JFKA 3DRYA 3PRBA 1WHYA 1XMOF 4RKUC 5IWAF 5C25B 1LK7A 1NPPA 3BS9A 4MJKA 3VALA 3AHPA 2NQPA 2JJ4D 1TL1A 2GMLA 3EXCX 1CQMA 5J1EB 1NH8A 2HQGA 1HI1A 1D1UA 1N33J 1WDTA 3MZIA 5CQGA 2WVDA 2PFDA 1HNXF 2BRKA 3G82A 4OJHA 2YKPA 3OTOF 4AL6A 3G87A 2EG2A 4ZVRB 1SUQA 3AXMA 3SCLE 1JJ4A 2G2OA 1RADB 4FKYA 1TUGB 1D9DA 2XSFA 2HHUA 4OV1A 3CJ3A 1KHVA 7FD1A 3BPSP 1RHJB 1RWKB 2KN4A 4O23A 5D0GA 2E66A 1DY3A 2H9ZA 5GAGU 1LXNA 1NZAA 2N7CA 4F25A 2C2NA 3J80U 1DQ8A 2R8KA 3F44A 3I5BA 5CAAA 1L3KA 3TWZA 2O5DA 1KP6A 3M8QB 1PC4A 4P2MA 5IC4B 2C1EB 3IN5A 4LBHA 1T03A 1F2GA 1DHMA 4K2JA 3N6NA 1N48A 1GMWD 2WTFA 3PW0A 1PGZA 3P8BB 3O5TB 4BLGA 3B4DA 3FQLA 3MMCB 3QATA 4TNOA 2HBQB 1YVFA 1EQ0A 2JFDA 2AJ0A 4QR2A 3EVOA 3PFEA 5M2RA 1X0FA 2OH2A 5C42B 5GAEU 2Z2ZA 1VDHA 4V19X 1T8EA 3BREA 2VV5A 4DUYF 1WC5A 4YS2A 2B4OA 2YPYA 4KKOB 4XTTA 3KG4A 1V3ZA 2W2NP 3U1MA 1SC6A 1KTQA 4F4ZA 5CD4A 1G7CB 2HHSA 2XS2A 5L38A 1AYEA 4ZVHA 4NLUA 3Q8UA 1IJEB 4PUOB 4DSEA 4BS2A 4IH7A 2YNHB 3GLJA 5AXNA 4RNMA 1HQ2A 4NXMF 3CW2C 5KT6A 4OZ0A 1G4CA 2CQ3A 5IV3A 1VQSA 1KNZA 4LF2A 4B3TF 4ZVFA 3M7VA 5KFPA 1FI4A 1S1VB 4IO1A 4ICLA 1S6UA 2VDHA 1U1NA 2RAQA 1QLNA 3CO9A 1E6VB 2HZVA 3MUMP 3Q2TC 5C7PA 4C11A 1RUSA 2E29A 5IOLA 3FSXA 1RHUB 4X65F 4DR7J 2O1PA 2IBKA 1FHTA 1HNIA 1U6FA 2GVDB 4EWTA 4ZCKA 3CCQS 5JJBA 2DNHA 1RT5A 5D4NA 4ZVEA 3R3TA 5G0RB 3MI7X 3R5DA 4R8UB 1TL7A 5I3UB 4P10A 2ZKTA 3G6ES 4YMEA 3CB4A 2PO4A 1PJ5A 1T95A 3IGVA 3MM7B 4X64F 4F50A 4KIAA 2EBGA 4WKRA 3H4DA 2NUUG 2MQNA 1Q7YT 1SH0A 3M8QA 4DPTA 4LF6F 2XCPA 1BD6A 3OLAA 1B64A 2MZJA 2E5HA 2ZHOA 1QSLA 3MEDB 2GJFA 2BOPA 2QO3A 4UZCA 4JBCA 4WK1A 2PFFB 1IKYB 4C0OC 4CT9A 3D6TB 3OUYB 2VBZA 2HRTA 2RF2A 4I68A 2HNYB 5KT7A 3HDSA 1EQMA 2Z8QA 5C42A 1RGVA 3CCTA 1NKCA 3CCRS 3RU0A 1HNVA 3GFXA 3FMBA 1VQMS 1FKPB 4PYDA 3EDRB 1NO8A 1PBUA 1PYTA 3BZQA 1DARA 3R2CJ 1BC6A 1FF2A 4RW4B 2R7VA 1OY9A 4V19J 4W92B 4DR2J 1M1HA 2IJNA 4ATNA 1U48A 3V2UC 2CIMA 1AZSA 1RAFB 1TKZA 2IM0A 3DLLQ 1YRXA 4DXLA 3CJKB 2KB2A 2NR0A 3HD2A 1JLAA 1PAUB 2QFJA 4WFXA 4NLQA 4GMKA 2R42A 4MKBA 4WFYA 2PC6A 1YKWA 1VQ4S 2ACYA 2B4VA 4U67Q 4X4QA 4PWUA 4DR3J 2R8IA 1TKXA 4RW9B 2BW2A 3W9JA 3EGZA 2EFGA 1IBKJ 2M0GB 2BM1A 1B99A 1CJVB 2HKEA 1DBDA 3HSZA 5B0GA 2OJ3A 1E6VA 2OFGX 4PWDB 4DFJA 4DMZA 3POTB 3QZ7A 4LIWA 1YJWS 2Z4PA 3R5JB 2F3JA 1JNZB 4EI2A 4NLDA 3PR4A 2DNMA 1VLOA 2MY8A 1WSVA 4R8UA 2CZ9A 4WF9Q 3CJ5A 1N5YB 5F8JA 2FZCB 3CCWA 5D0RA 1EARA 3MM7A 5C24B 4DZ6A 1SKRA 1U1MA 4M95A 2A6OA 2HWHA 3DI6B 5K8MA 1GQEA 1XR7A 2AZ1A 4HHUA 2O67A 4OYXA 4PKDB 5KFTA 1JB0C 4ZJQA 3HVTB 3HHEA 4TYAA 4I2QB 3CVKA 2IM2A 5HJXA 3G8QA 1LFPA 4J9QA 4USWA 1X5TA 4JI1J 2LLZA 3MFIA 4JI6F 1ZS6A 1U4BA 2ZH5A 2C2RA 4K4UA 1R31A 2ZKUA 1UVNA 2C3OA 2H5IB 1WF0A 3O8WA 2QL7B 1FKPA 2XSJA 3D9BA 1BWEA 2HWTA 3WC2A 5HVGA 1S9EB 1ELOA 3HI9A 5CYQB 2GIRA 1HPZB 4KFBB 1MG7A 3BGFA 4WE1B 2EVZA 4M63A 2C2DA 4HTIA 4PEOA 2V4QA 5A8RA 1OIAA 5HROB 3TAPA 3V4MA 4A8OA 4ITSA 1WEZA 3DLGB 3OFHA 2W2MP 3NMRA 4H54A 3C16B 4Y00A 4ED6A 3DKDA 2R7OA 3VGVA 2UZAA 3ZZ0A 4MYTA 4Q5VA 1CLFA 2ZH4A 3CPWR 4URQU 2PGCA 1YQHA 3ADAC 1CS4B 3RBZA 4NA1A 3H7HB 4RW9A 3GMGA 4F0HA 5GMKa 2N82B 4FYXB 2E5JA 3LPEA 1LK5A 3J7YU 4M5IA 4HHJA 1D9FA 2QYCA 2O66A 1ACMB 3QAUA 2W1BA 4PWDA 5KFFA 4P52A 1N88A 1T9TA 5J2NB 3CCLS 3UD5A 3AXKA 4LF7F 1HBOA 2AYEA 2ZUAA 3KKFA 1NNDA 4CLPA 4A8WA 1S1TA 5AE2A 4QW9A 4LRAA 2FGOA 3LP0B 4EUVA 4L72B 2FJXA 1ZAXA 1DZ5A 2HAFA 3KFWX 3LW5C 2FB0A 2VPWB 3SSSA 1WEXA 3KHGA 3AOAA 3GIIA 3QQCD 5DZ7A 3RR7A 4DV6F 3AT1B 3OD2A 3U27A 2BACA 4CO4A 4QIFA 2B7BB 3D5MA 3Q8PB 3V5RA 2OIHA 2HNZA 2HHPA 4PXEA 2VDIA 2XS7A 2DHAA 2HVZA 1KQSR 2CQIA 1NSKL 1QAIA 2VQEF 1WKJA 1DQAA 4N76A 2UXBJ 1MROB 4I2QA 3S7RA 1Y10A 5L46A 4WP9A 1DLOB 5DM6Q 4TN2A 5A76A 4CLUA 3B54A 1IJFB 2Q79A 1LWCB 2KHCA 4Q7AA 4WU2A 4CO2A 1UZDA 1MN7A 1AW0A 1AUDA 4MKVA 1M90T 1GXTA 4ECWA 5KFUA 3QGHA 1UPPA 4YHHJ 4FS1A 4GC6A 2DRAA 3UWTA 4M8LA 1I1GA 5ETLA 3CJ4A 3ULHA 1YJNS 2CJAA 5CYQA 3AB4B 3RUBL 2BE7D 4PXCA 1X4DA 3HSDA 3ISNC 4FBTA 2P9CA 1XWLA 3JTNA 3NL0A 4I69A 5KFAA 1JLFA 3QJLA 4OL8A 4U9RA 2R7QA 1O51A 2OI2A 3PEJA 3TUZC 3UE2A 3THPA 2A0FB 3HSGA 1XNRF 3QGGA 4Q0BA 4C6AA 4PG6A 5DGBA 2ZD1A 4H4MB 2ZVSA 3G86A 1O0PA 3M8RA 3PW2A 3BQ2A 2CNLB 4E2FB 1VC0A 2C3UA 2J6TA 2ATLA 1N8RT 4DSKA 1UCNA 4ZK7M 1TV6B 1NKBA 2ZM6F 5A0YB 1WDDA 2R8HA
chains in the Genus database with same CATH topology
1N6QA 2B5JB 1DRZA 5HN0A 1FNOA 1FXDA 2IVFB 1QVGR 1WEYA 2XULA 2MSSA 1TFWA 4DV7F 1RYSA 1R7IA 5H1SV 1C1CB 3DLKB 1XMBA 2HHHF 5FDLB 2OO4A 4IRKA 4HH1A 5KT3A 3TR5A 1S76D 4F67A 5J2QA 4PG5A 2RB7A 4ZMMA 5B0DA 3U1LA 4Q8EA 4WJBA 1B0PA 5KG5A 1WI8A 2CYYA 5HMYA 3KYLA 3EZ5A 2YNIB 3K8WA 3SQGB 4HVZA 3T6BA 2O01C 3QIDA 4H4OB 4Q44A 4ECUA 5CD4H 3OPKA 4CCHA 4QIVA 2LQ5A 2W4CA 3MMCA 1ROFA 4DV2F 3GILA 2MGZB 1HBUB 1L3SA 4DSIA 1N32F 1IUJA 2Y1IA 3GR1A 2W7AA 4B9LA 4TLRA 1H3DA 1Z4UA 5THWA 4G3IA 1LW0A 3FFIA 4O4GA 2ABYA 2OPSA 4Y2KA 3RB0A 3K2YA 5E5NA 1S9GA 2UUWA 3CDBA 1DTQA 4UQTA 4OHVA 4X4VA 4JI4F 1NH7A 4ZCLA 3C6UA 3KK1A 1QJHA 3U02A 3SSRA 2Q3PA 5K8PA 1L3VA 3ITHB 1C0UB 1C1BB 3DOMA 1U2FA 1JXEA 4X84A 2DO4A 1X4HA 4OI4A 1ZH5A 4XPCA 3M30B 5L1LA 1P1TA 2IFXA 5KFBA 3T5LA 5IS2A 3MEGA 3PKYA 3GB0A 3FJ2A 5L39A 1C4CA 3G96A 3R1LA 2HHQA 3HHDA 1KOHA 4XK8C 1VK3A 3H20A 1KEKA 4WFBQ 2IRYA 2F4VF 1X9WA 1EETB 5E3RA 3PX4A 2VG6A 5IZHA 1KN6A 5FD1A 5F8IA 4DOZA 4IH6A 4KKOA 2HMIB 2OFHX 4EU0A 1C0TB 1TL1B 4JI5F 1IM4A 3LUYA 1FNXH 4IOBA 2BANA 3LANA 3S1TA 5K8NA 3DXSX 1G2EA 2HHXA 2IHR1 2F9JA 3CIZA 4D3GA 3UDLA 5DQGA 1UWBA 1FRJA 1UVIA 2ZZMA 1GTHA 1YTYA 3CUNA 2PN6A 3DGPA 3LWLA 1U45A 1SKWA 4LJMA 1Y3JA 2L48A 2O3DA 1Y5NB 1HBMB 5A8KB 1SH2A 4HL9A 3OXLA 4O3RA 2DGQA 4EFAC 4PUOA 2L41A 2WRMA 2DGWA 4UY85 2G9OA 1F60B 4C0BA 2YNHA 5F8MA 2IAJB 4FN5A 1IBMF 2M7SA 4N47A 1W25A 3QZ8A 5KG7A 3BJYA 5HMZA 1LWCA 5DQIA 1OPIA 2V4RA 1P9QC 2QLXA 5SUHA 2B0GA 4Y65A 4DLGA 2J0QD 4FYDA 4RNNA 4OX9F 4LVOP 1LWFA 4ZCMA 3KLIA 1QUPA 5HLFB 1SUQB 2XWYA 1NHVA 1ULRA 4KE5A 3HHLC 4HT5A 3ISND 4NLTA 4YR0A 3MR6A 3DCAA 3AA8A 1MMNA 1DTTB 3DLEA 4QWCA 2JEJA 4X2BA 3H5YA 4DQPA 1S6QA 5AXKA 1FD8A 4CNYA 4BCAA 1VRUB 1H2TZ 2CQ4A 3D1HA 2XMJA 2IA6A 4FXDA 4E8UA 4ETXA 2I2YA 2E1MC 1HWIA 4KJIA 1LW2A 3WZ0A 4K4VA 5IFMA 4IOCQ 4OZ5A 3C46A 5EWFA 3H98A 3L95X 1UJ6A 4I4BA 4DV4F 4KR0B 2FHOB