4KV8B

Crystal structure of hiv rt in complex with bilr0355bs
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
407
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV Reverse transcriptase P66
publication title N- versus O-alkylation: Utilizing NMR methods to establish reliable primary structure determinations for drug discovery.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 113
structure length 407
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kv8B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kv8B04
5KFJA 2XCAA 3G6YA 5F8MA 2YNHA 2W7OA 5HBMB 4TY8B 1RTIB 3ISNC 4WFZA 4PQUA 1YVFA 5F8IA 3V6KA 4LQ3A 2YKNB 3UPFA 2WTFA 1N5YB 1GX5A 5KT2A 1N56A 4NLQA 4ED0A 3PW2A 4IR1A 3BR9A 3QO9A 3FDSA 4KV8A 3QYYA 4KSEB 2RKIB 3KLHB 3QIDA 4ZVFA 3PR4A 4ECVA 1HYSA 5KFRA 3V81A 5KFGA 3HVWA 2HMIB 3KLVA 3KK3A 4DL4A 3PVXA 3VQSA 2OPRA 4JV1A 1JX4A 1IKXB 1S9GA 3KMSA 3DMJA 4R5PB 4LSLB 1QAIA 2FVPA 1RAJA 1RT1B 5KT4A 4ECYA 4MK7A 2AWZA 3KLGB 1JKHA 4IG3A 3MR6A 2AGPA 3MEEB 5KFHA 4JV0A 4K4ZA 3MFIA 4ICLB 2YKMA 1EETA 1SUQA 3OLAA 2AGOA 5KT6A 3E51A 4QWBA 3I0SB 1HQEB 3IS9A 3LP2A 5L1JA 4K4TA 3MECA 1D0EA 3RB6A 3FFIA 4NLWA 2R8HA 1FKOA 5J1EA 3N6NA 2IM3A 4MK8A 3E01A 5KG2A 4RNNA 2W9CB 5KFWA 1JIHA 3LP1B 4ECRA 2XGQA 3BQ0A 2HAIA 4ZPBA 2ZE2A 2B6AA 4NLRA 5KFBA 3PR5B 2JEIA 4DG1B 4G3IA 1HMVA 3D5MA 2VG7B 4DEZA 1JLQB 4TQRA 4Q8FA 2R2RA 2D7SA 4J9NA 2HNDB 5C42A 3M8QB 2BRKA 2XI3A 2XC9A 2AGQA 3PW7A 5KFQA 2GC8A 4NLGA 2FVQA 3MEGA 1QE1B 1DTTB 3NBPA 3DDKA 5EWEA 1TKTA 3BSCA 5KFTA 2WHOA 3OSPA 3RAQA 1BQMA 2ASDA 3KK2A 2V4RA 2R8IA 5KFUA 5EWGA 5KFZA 3BREA 3UR0A 1IKYA 1HNVB 1MU2A 4O4GA 5K14A 2BQ3A 2VG6A 1T05B 1BQNB 2XGPA 4WXWA 4ECWA 3CDUA 2IA6A 3LALA 3M8PB 4RW9A 1J5OA 4RW8B 4RNOA 2BQRA 4RW7B 5HROA 1LW0A 2XI2A 3OL8A 5FDLB 3KJVA 3OL9A 3KK1B 5C5JA 2WOMA 4QPXA 4IR9A 4O3RA 2WONB 2UVWA 4H4OA 1SH2A 1C0TA 1KLMA 3PJWA 1S9EA 5CYMA 1QAJA 4Y3CA 5DGBA 5J2PB 1KHVA 4YR3A 1TKZA 1XR7A 3RB0A 4RUAA 1S1WA 4YR2A 5J2MB 2IM2A 1RTIA 1JLGB 1VRTA 4TY8A 4F4ZA 2YKNA 3PZPA 3T19A 1C1BB 3GIIA 2C2DA 5KFXA 3ICLA 4NLUA 3QZ8A 4IFYB 3DLEB 3QIPB 5EUHA 1SH0A 3LANA 4NYZA 3M9NB 4K4YA 3KLHA 1N48A 3H5UA 1S0NA 2VA2A 3D28A 4URQU 4NLSA 1RYSA 2HMIA 2IM1A 3T5HA 3KLIB 3CDWA 1LW2B 4I7FA 4IDKB 2J6UA 2OPQB 3CO9A 1HNIA 1IKXA 2V0NA 4IG0A 5F8LA 1U09A 4DL6A 3ISND 4GC6A 5KG7A 4R5PA 4LSLA 3JYTA 1JLCB 4QWCA 5L1KA 2QE5A 3KLGA 2AU0A 3Q8PB 4RZRA 1LWCB 4I2PA 1S1TB 1SH3A 5L1IA 1S10A 4NCGB 5F8GA 4ICLA 2IBKA 4ZVEA 1EP4B 2AQ4A 3OL6A 1RA7A 1LWFB 1FKPA 2OPSB 1HQEA 2HNYB 3I0SA 2FLNA 1DLOB 3NL0A 4TQSA 5KFIA 5KG3A 2I5JB 1S0MA 1KHWA 4PWDB 3DLGB 3OL7A 1NNDA 2HNZB 3HKWA 3LP1A 4MH8A 4J9LA 4WZQA 3KHLA 1TL1B 2D3UA 4DG1A 1T3NA 4TYAA 3Q8RB 1NHUA 2VG7A 1R0AB 1HQUA 4ID5B 3H5YA 4QWEA 1CSJA 4IFVB 1RT3A 4ZP6A 4TXSA 5I3UB 1TL3A 3DYAB 3DRRB 2RDJA 4B3OA 3BSNA 5J2NA 4TN2A 4JV2A 3H40A 5J2QB 3H4BA 2OPPB 5KFOA 1RTJB 4RU9A 1HNVA 3MEDB 1T05A 2JEGA 3H98A 4MFBA 5KFKA 4RW8A 4DL7A 3KLFB 4RW7A 2W7PA 3LAKA 2ZD1B 4IH7A 5KFLA 2IC3B 4WE1A 4F4XA 4ECXA 4K4SA 4KO0A 5C25B 4F4YA 2BE2A 3BSAA 3KK1A 1RT2B 1JLEB 4G1QB 2WONA 2R2UA 1RTDA 4YMEA 4Q0BB 3IG1B 3DLKA 2W9BA 4NLDA 4TLRA 5DG8A 1SV5A 2BANB 2WK4A 3I0RB 5J2PA 1DTQA 5KFSA 1QUVA 5DQIA 1RTHA 2YNIB 3DOKA 3NGDA 5J2MA 3C6TA 2D3ZA 4ECTA 4KFBB 4NLPA 1IKVA 2CKWA 2VG5B 1TKXA 5DQHA 2W9AA 1C1BA 1HPZB 1S1XB 1UWBB 5HP1B 2D41A 2F8EX 4FS1A 4KKOB 5L9XA 3HHKA 3QIPA 2UUWA 4ED2A 4IRKA 4Q45A 2IMWP 3JSMB 2JLEA 1REVA 2YNGB 2JC1A 5KFYA 3GV8B 5CYQB 1OS5A 3V6DB 3HVAA 4YP3A 5KG5A 4KE5A 3HVTB 2J6SA 4NRTA 2YNFA 3KLIA 5KT3A 1LW2A 1K1SA 4R0EA 1RT6B 4Y2AA 5DQGA 1C1CB 3CJ5A 4J9OA 4GC7A 1JLAA 3KLEB 3PHEA 1S6QB 3CWJA 3DM2A 1S6PB 4RW6B 4J9QA 1JLFA 3GQCA 2E9RX 1TQLA 4EO6A 2R2TA 5KFFA 1RT4B 3QGGA 5F9NA 5HLFB 4ECQA 2XCPA 2R8GA 3V4IB 1LWFA 4ED7A 2B5JA 2OPSA 3G86A 3SI8A 4LSNB 5KFEA 2V9WA 1HARA 4O44A 3H59A 2YNHB 4TY9A 4ZP7A 4ZVGA 2BQUA 1JLBB 2I5JA 4PQUB 4PUOB 4NRUA 3DLGA 3BSOA 4IQXA 5I42A 4J9SA 2HNZA 4O3NA 4FS2A 2FLPA 4ZP9A 1TL1A 3GYNA 2IM0A 4IOBA 2CJQA 2FVRA 5HBMA 3QO9B 2IAJB 3TQ1A 4ECUA 4KV8B 5C24B 4QW9A 1TP7A 3V81B 1N5YA 4QW8A 3I5BA 3DYAA 3OHBA 1XR6A 2OH2A 3DRRA 3BGRB 1ZTWA 4WXOA 3NMAA 4RUCA 3CDEA 1IM4A 2RDIA 3EPIA 3CJ2A 4MK9A 4NLOA 3DMJB 2RKIA 5F8JA 1I6JA 4K4UA 3MEDA 3KHHA 3IRXB 3QGHA 2R2SA 1JKHB 2DPIA 2ZD1A 4J9PA 2IC3A 2ILYA 4RNMA 2AX0A 3I5AA 5JXSA 3PW4A 4EBEA 2FVCA 2R8KA 1RT2A 1EETB 3GIJA 4G1QA 5JUMA 1RT1A 4ZHRB 4R8UB 4FBUA 1T03B 5KT7A 4QWAA 1LWEB 3LP2B 4Q0BA 3IG1A 3IS9B 3G6XA 3V6JA 3MECB 3CJ4A 3DI6B 3FFIB 3M9OB 4NLXA 3MEEA 5J1EB 3OHAA 3C6UB 2W8KA 3E01B 4M95A 3T5LA 3TVKA 3FQLA 2VA3A 2GIQA 4RW4B 4MIAA 2ZE2B 1HPZA 1UWBA 5HP1A 2JEFA 5D3GB 4M94A 5C42B 1NHVA 4J9KA 3JSMA 5KFCA 2FLLA 2YNGA 2W9CA 1N4LA 3MEGB 5CYQA 4EYIB 4O3SA 3V6DA 4K4WA 3RBDA 3QLHB 1TVRB 3HVTA 1JLQA 3KK2B 2ATLA 2HNDA 2HWHA 3M8QA 5KG6A 3NKYA 5K14B 1RT7B 1C1CA 2VG6B 1QE1A 1DTTA 3OSNA 2R8JA 3GV7B 4RW9B 1J5OB 4EO8A 4ECZA 4EBDA 5HROB 4RW6A 2I1RA 5F8NA 1RT5B 4MIBA 3MF5A 3G6VA 4QWDA 4KB7A 3BQ2A 1RT4A 4ZPCA 2HWIA 4WFYA 1BQNA 4KAIA 4WFXA 3H5XA 3MR5A 3UQSA 3M8PA 1T94A 4H4OB 1KLMB 3SFGA 2JC0A 2EC0A 1S49A 4XPEA 3UDLA 2ASJA 2UVRA 5FDLA 1TKZB 2RF2B 3DOLB 4ECSA 1S1WB 3NAIA 1RYRA 1JLBA 3MR2A 1VRTB 3Q8SB 4PUOA 4NLYA 4IRDA 3QZ7A 4K4VA 1VRUB 1FK9B 3DRSB 3IN5A 3KMQA 1S97A 3MR3A 4OL8A 3MFHA 3DRPB 2BR0A 3KOAA 2IAJA 4O3QA 1JLGA 1S48A 3RBEA 4ZMMA 3LP0B 4ZP8A 5C24A 4NLVA 4H4MB 3CJ0A 3T5KA 2E9TA 5DLFA 2O5DA 4I7FB 3BGRA 4IFYA 3DLEA 4I2QB 3IGVA 5EWFA 2XWYA 1HNIB 3FQKA 4KHRA 4O4RA 4IG0B 5KG0A 3EZUA 2QV6A 3LAMA 1S1UB 3JYTB 4Y2CA 1JXLA 3NAHA 4U7CA 3IRXA 1N6QB 1D1UA 1W25A 1TV6B 4IDKA 4FBTA 2UUTA 2OPQA 4I2PB 2ZKUA 3FRZA 1S1VB 1S9FA 3TAMB 3OLBA 2WCXA 5F9LA 2WRMA 2ASLA 3GILA 4ZHRA 3ITHB 1JLCA 4R8UA 1T03A 5KT5A 1FKPB 1C0UB 1LWEA 3GV5B 3KHRA 2UVVA 1IKWB 3DI6A 3IGNA 4YQWA 1LWCA 1S1TA 3C6UA 3GIKA 2BRLA 4NCGA 4RNHA 1EP4A 4RW4A 2W8LA 5DGAA 1GX6A 2J6TA 2HNYA 5KFVA 2DPJA 4Y34A 1DLOA 2FJVA 5D3GA 4RNFA 1S4FA 3V6HA 3RB3A 1HQUB 5KFNA 4PWDA 3PJXA 1ZTTA 2AX1A 1RT3B 4URSA 3H2LA 4EEYA 2E9ZA 5KFDA 3M9MB 3H4DA 5DLGA 1TL3B 3QLHA 1TVRA 4IH6A 4B3OB 5J2NB 4XO0A 1R0AA 2ILZA 4ID5A 4TYBA 4U6PA 1RT7A 4IFVA 5F8HA 1HYSB 3T5JA 4O3PA 4MFBB 5I3UA 4DL2A 2FJWA 3CIZA 3KK3B 4ED8A 4HYKA 4DL3A 1RT5A 4XPCA 2OPRB 4IKAA 4WE1B 4LQ9A 5J2QA 4ZPDA 2OPPA 4KO0B 1S9GB 5KG1A 1RA6A 3FSIA 2BE2B 4DL5A 3KNAA 1RTJA 1Z4UA 3I5CA 1MMLA 5KG4A 2FJXA 1RTDB 4O3OA 3QGIA 3DLKB 3KLFA 2W9BB 4IG3B 2IJNA 4IRCA 1SV5B 4Q8EA 2UVUA 1DTQB 4ZPAA 3EPGA 2RF2A 5C25A 1RTHB 3DOLA 3DOKB 2YKMB 3C6TB 1JLEA 4K50A 4ED3A 1SUQB 4MKAA 1IKVB 4EYHB 1TKXB 3RB4A 5L1LA 1VRUA 1FK9A 2C22A 3DRSA 2BANA 4ZVHA 3PW0A 1FKOB 3I0RA 4WYLA 4Q43A 3BJYA 4NLTA 2JEJA 3DRPA 2YNIA 1REVB 3CVKA 4F50A 2GIRA 2V4QA 4MKBA 3N6MA 4KFBA 4YR0A 4KBIA 2C2RA 2VG5A 3LP0A 2B6AB 4WZMA 2FVSA 4H4MA 5EDWA 1ZETA 1S1XA 1HMVB 3CJ3A 4KKOA 2YNFB 1WNEA 4J9MA 4I2QA 3PW5A 1S0OA 2C2EA 4URGA 4NZ0A 3NBPB 4HKQA 4WYWA 1JLAB 4KHMA 1TKTB 1K1QA 1S1UA 1RDRA 3N6LA 3SFUA 4ED6A 3DM2B 4H54A 1N6QA 3RAXA 1C2PA 3T1AA 1BQMB 1JLFB 4X2BA 1TV6A 3GIMA 2WB4A 5DG9A 5DG7A 1RT6A 1IKYB 1MU2B 4O4GB 1S1VA 2IJFA 3TAMA 4ED1A 2C28A 4IH5A 4K4XA 3BQ1A 3KLEA 1S6QA 3ITHA 4J9RA 3KHGA 1XR5A 1C0UA 1S6PA 2B5JB 1LW0B 3H5SA 1IKWA 4F4WA 3Q8QB 3KJVB 4O44B 5KFMA 5KFPA 2WOMB 5HLFA 5I42B 5T14A 5KFAA 3MTKA 3V4IA 4JUZA 4Q44A 1C0TB 4EBCA 2ALZA 1S9EB 5CYMB 2B43A 4LSNA
chains in the Genus database with same CATH superfamily
2O66A 4NI2B 1FWPA 6FDRA 5KOXA 3BO3A 4B9NA 2ZBPA 3DFEA 2AWZA 3RU0A 1U7LA 4ES2A 4BWMA 5HO4A 4EGLA 4F2RA 3JTPA 1FFWB 1R8CA 2G1HA 3OTOF 2YWGA 5J1EA 3R9LA 4B3MF 2Q6CA 1VBKA 2B6AA 2CPHA 1KP6A 4NL5A 4TQRA 1M5OC 2XI3A 2L3MA 3IBWA 4YY3J 3BSCA 3KK2A 4USIA 5EWGA 3C8YA 2EG1A 4ECWA 4C8ZA 4LF8J 1AXQA 2H65B 2HIQA 3OL8A 5FDLB 4DCPB 2R7SA 5J2PB 1KHVA 5M2RA 3RB0A 3R7SB 2G4BA 1VRTA 3HSGA 3A13A 1RU2A 3VCDA 3GIIA 2C2DA 2GMHA 4LFBF 1URRA 2PMHA 5D0HA 5T7LB 2ZKTA 3KLHA 2V94A 4AT1B 4KGMA 1TELA 2IRYA 5IZHA 1LW2B 1IBMJ 1WWHA 1DFDA 1JLCB 4USTA 1GXTA 3KLGA 5BYRA 5L1IA 5B7WA 4L73A 3A4TA 1FKPA 3CMES 3I0SA 1I94F 2FLNA 4CM0A 1PG5B 2EXUA 2MPUA 2HNZB 1HLWA 2VJUA 3ZZOA 1U1KA 1P9QC 3MHYA 3VV2B 3J80Y 4GO7X 1HR0J 1IUJA 3HVRA 2HBRB 3HP6A 1A0OB 5KFLA 1SIWB 3BKUA 4G1QB 1RBAA 1KOOA 5JVHQ 4CLLA 3TAPA 4BDPA 2JWNA 5DQIA 3NGDA 4DUYJ 3MMCB 3MM7B 1TKXA 2DO4A 1JJ2R 3JSYA 2JC1A 3GB0A 3C16A 3HVTB 2VQFJ 5LSRA 2AYMA 4B02A 2E9RX 1LFWA 4F4AA 4HT7A 1TUVA 5HJYA 5KFEA 3S01A 2C42A 2W4PA 4NX9A 4J9VA 4X65J 3K17A 4PUOB 3DLGA 4Q5VA 1REGX 3FC9A 4EK2A 1VQKS 1VBXA 4QW9A 1UPMB 1ZAWA 3JQMA 1SXLA 3F0NA 4LRCA 1GEHA 3IRXB 1U45A 4DV0F 3KNGA 1UW4A 4LF5J 1EETB 4WWSA 4ZHRB 1KD1T 4NZ7A 2CNOB 3FFIB 4LRFA 1SI9A 3T5LA 3UVJA 3FSYA 1U8SA 1HPZA 1S72S 2DGSA 2GO9A 4A8WA 2QGFB 1JLQA 5JJBA 1RBOB 3ADAC 4ETZA 2MQQA 4EFAC 3O5TB 2HWIA 4WFXA 5IFMA 3UQSA 3CCSS 4A8XA 3SFGA 4XPEA 2ZHBA 4ECSA 1RYRA 1RWKB 1U1NA 3DRSB 2Q1LA 3GJRB 3JSBA 4ZJQA 4DPUA 3LP0B 2F40A 3IGVA 1XIQA 1N5VA 2BE7D 2NS1B 3OQ2A 4M5KA 3MOZA 3PRVA 3MAAB 2VBYA 4CNYA 3K59A 5L38A 2VOOA 3DCAA 2RU3A 5KOWA 1LWEA 4QU6A 3AHPA 2YQ3A 4WTYA 3ILJA 4Y34A 2W2OP 1RT3B 4OJ3A 1Y4ZB 1TVRA 3BKTA 3CCUS 1NZAA 1MROA 4TYBA 2YKOA 3GTYX 3T1HF 1URNA 3J7YU 4ED8A 3IWXA 4XPCA 4IKAA 3M7VA 1WOOA 4N47A 4E2FB 1N36J 1RAOA 3QGIA 4DLEA 4LFCF 1DTQB 4DDFA 2J8AA 1H0HB 4MKAA 3TUIC 3PW0A 1F6TA 4ZVTB 2H5JB 2B6AB 2UUAJ 2BKNA 3GG1A 3BM7A 2DCLA 1S1UA 3CCQS 2DNQA 2MKIA 1U1QA 4CYUA 2KI2A 4UOCA 1XR5A 2VQEF 3Q8QB 2ZEJA 4CQ1A 4USMA 1FXRA 4JUZA 2HHTA 3G6YA 4CO0A 1WOSA 2W7OA 2A2DA 3V6KA 1N5YB 3HCXA 2CQ2A 2YX4A 2FZCB 3VR1A 1NSKL 3S1TA 4LBIA 3KLHB 1B4SA 2W7AA 1P9YA 4JV1A 2WW8A 1HBNA 2VFSA 1VISA 3AA9A 3KLGB 4PCQA 4L76A 4YDDB 4DV2F 3R2CJ 2YKMA 1SUQA 1IQTA 3I0SB 5GMEA 1KNZA 3MM5A 5KG2A 3QAEA 3O44A 2E5HA 2PA3A 1R6VA 3D66A 2W9CB 4CO4A 3D5MA 2LQ5A 3R5JB 2BRKA 2MKJA 3OJUA 5GAGI 5AXNA 2ZH5A 3UR0A 2GHWA 5C5JA 4IR9A 1UW9A 4JV5J 4XDCA 1S9EA 4AFFA 4YR2A 2FC9A 3C16B 1ZZFA 4JYAF 3TZYA 3CDWA 1C4AA 3OFGA 3QWPA 5F8GA 2CVEA 1SC3B 1EZZB 1RA7A 2IYGA 1HWLA 1RAGB 1Q5VA 4TQSA 1KHWA 3PY8A 3DLGB 1JQGA 2A0FB 2JVRA 1YI2S 5BYQA 4OZJA 4H4KC 3OVBA 1OY9A 2BJEA 1SIZA 2OKQA 3AXKA 5J2QB 2CZ9A 4NXNF 2P9EA 3UI3A 4JI3F 3CD6S 2HFSA 1X4BA 2VIHA 3DLHA 3DOKA 4C0OC 1QSSA 2ZHOA 2V2VA 1HPZB 5DZ6A 2Y8WA 1L3VA 4IRKA 4Q45A 2Y9HA 3KUGA 2RS2A 2YNFA 5K20B 3NS7B 2POKA 5ETMA 1WC6A 2W4CA 4ZJLA 4USHA 2LYVA 2V67A 2MQNA 2UUBJ 4ED7A 3G86A 4J91A 2BQUA 1XNQJ 4F67A 2XSJA 4NRUA 1NPPA 4WTOB 2CJQA 1NLKL 4ZVRB 5A8WA 3HHDA 2RUSA 2HFNA 1XJWB 3DRRA 3T9ZA 2LDIA 3GJTB 1UWAA 2ZBQA 1M5HA 1L3SA 5CQGA 1Q8IA 3V5RA 2GNKA 2MEWA 1RT2A 2PE8A 2IBOA 5KT7A 1LWEB 1VIXA 2RVJA 3D1OA 3W9IA 3MGJA 2VA3A 3FQLA 3MMBA 4C8OA 3RW7A 4E8UA 1LK5A 5A0YA 5K8NA 1UWBA 2XY6A 1OPIA 1NHVA 2FLLA 2E1PA 2OO4A 1TVRB 3K7RA 4PWUA 1MROB 1QE1A 1MMNA 1KQKA 4N5SA 3PX6A 1KONA 4GKJF 3O2IA 4P75A 1WF2A 5K8OA 2K7KA 2W2QP 2PD1A 2AP6A 2YXLA 3MUVP 1S97A 3MFHA 2C3OA 2L08A 3VAKA 2QRRA 3JS9A 4M5NA 3T5KA 2NSBA 4W98A 3DLEA 3FCHA 3MWBA 2PC6A 1S1UB 3JYTB 4Y2CA 4LBHA 1VQ9S 4I2PB 2AYBA 2I8EA 4CYUB 2WCXA 2WRMA 4ED2A 1D9DA 2VPXB 1PAEX 2BRLA 3HXMA 2NZCA 2W8LA 2J7KA 3I31A 4JI0J 1M5VC 2G2OA 2H4WB 4EUVA 1S4FA 2ZUGA 1FX4A 3ZZUA 2FIUA 3J7ZT 4URSA 2QFJA 2DNYA 4QPTA 3TUJC 3J80U 2HFOA 4USUA 1HBNB 3TZWA 1APSA 2YKMB 1KVJA 1SUQB 2GQQA 1FK9A 1AA1B 2LVWA 3MM5B 5LXRA 4MKBA 4KFBA 1TK0A 3D3CJ 2MZQA 4M5MA 2DHXA 2IHR1 1KVIA 1IJEB 3OTOJ 3ITHA 2J9CA 4P73A 4DR2J 4B3MJ 4LF9F 3KWMA 4RBVA 4Q44A 1S9EB 4OHYA 2V9KA 2VDHA 3BO4A 5IT9U 1AT1B 2XWXA 3FMWA 4GO5X 1N34J 2CQIA 2VB6A 2ZOGA 1VI7A 3EXCX 2NPFA 1Y9OA 1NAQA 5GAGU 4MK7A 1R3NA 3VAGA 5HMXA 3CEDA 2DH7A 4LFBJ 5L1JA 4CWBA 4F04B 3BEGB 3E01A 1YTYA 1PC5A 4DSIA 1H38A 1JJ4A 4RR5A 4M8LA 1X60A 1FJGJ 1BQMA 4WIQA 2DXDA 1HWKA 1CULA 4C8MA 1I94J 2HVZA 3ILIA 2N7CA 3NGKA 1K9MT 2O1PA 4DQPA 1H7WA 3PJWA 5IXUA 3F56A 1XR7A 4CO5A 5LMNF 1JLGB 3EGZA 1X0PA 4OI4A 3W63A 2LA6A 1PJ5A 4DQQA 2HRTA 2PEBA 4IDKB 3K0JA 5CABA 3DGPB 1WHXA 2HHQA 3W60A 1HNWF 5FIIA 4LSLA 2JRSA 2W25A 3DC2A 1RHKB 4ILRA 3DNCA 3GYXB 3UD4P 3FBEA 3WIUA 2NCKL 4I56A 1NXIA 2XSJB 2MQMA 3RYLA 4DG1A 1K73T 3BDPA 2B3TB 5CAAA 4IO1A 3DRRB 2RDJA 4NA3A 4Y2IA 4LF2A 1YG0A 2AZ3A 1RT2B 4HACB 2XYHB 2OD4A 2MJUA 1HNZJ 3AA8A 1RWMB 3MMBB 1IKVA 4OV1A 2EW9A 3HO1A 1UWBB 4KKOB 2F4VJ 2NXCA 3CD0A 3ZZYA 1UA1A 3C66A 4DV0J 2M52A 2HQDA 3FKBA 4GRSA 5DQGA 3PTWA 1U2FA 3CWJA 3QRQA 2WVDA 2KZMA 2EFOA 1TK8A 3UR3C 3SIPB 1H2UX 3H25A 1FNOA 4PEOA 2FJDB 3OR2B 2MKCA 1ZAXA 3DYAA 4C8LA 2OH2A 1I6JA 3PDNA 1U1RA 3PRDA 2XQCA 2HGMA 2R8KA 1FD2A 2KH9A 4FBUA 3U1LA 2MZSA 2W2PP 4GKKF 3P5TL 1X5PA 3ZZTA 2A2CA 2BW7A 4PYDA 5DDPC 2HNDA 3QSIA 3M8QA 1L3KA 2GJFA 1PYOB 1DTTA 2HQ3A 4RW9B 4YOEA 4QWDA 1NJYA 3H20A 2KU7A 2VPZB 1WC4A 3N79A 4NMLA 4F3OA 1FK9B 1Q1KA 3T1HJ 5BYSA 2KN4A 1S48A 1AFIA 2EFPA 4CH0S 2RQCA 5B0CA 3CNQP 2MTLA 3BO2A 4LFCJ 2Z30B 4N7TA 2XEXA 1JNZB 1FX2A 4USVA 1IBKF 3ITHB 5LSLA 1MWZA 4YQWA 4A8QA 3C6UA 2M4MA 4OZ1A 4NYPA 2XHWA 5DDQC 3LA0A 4PXCA 2XS5A 1ZTTA 5DRKA 3M9MB 1RLCL 1OIAA 5J2NB 2CQBA 3SCIE 1R0AA 2V8HA 3ZZPA 4L75A 2B9YA 4ATNA 1U1OA 1JB0C 4ZLNA 6FD1A 2ZJPQ 4KO0B 4N41A 4F2SA 1NEEA 2BOAA 4R25A 2I38A 4Q8EA 4ZPAA 4U95A 3UFCX 2RQMA 3J7AN 1O51A 1T9YA 3CJ3A 1WNEA 3QT5A 2OEJA 4I2QA 3KDOA 3RRGA 6AT1B 1RDRA 4ED6A 3B54A 1BQMB 4DV2J 3BN4A 2DD8S 1RT6A 4EI2A 4M5LA 4ED1A 2VFRA 1S6QA 2B5JB 4F4WA 2UZAA 3G6ES 5H9FK 1RKJA 1B0TA 2RHSB 3OHAA 5KFJA 2XCAA 5D15A 2M0GB 3R5AA 1RE1B 3QYYA 3WDOA 2KVIA 3FEXB 4LSLB 1TMJA 5E5NA 1Y5NB 3POTB 4A8OA 2ERRA 1T9VA 4USWA 2AGOA 3MECA 3RB6A 3VGSA 2ADBA 4NLWA 1FERA 2K8GA 4JYAJ 2B7CB 2HAIA 4ZPBA 3I4HX 4DG1B 3I96A 1LK7A 1WSVA 5HN0A 2R2RA 1M1HA 5CCLA 9ATCB 2GMJA 2AW0A 3OSPA 3FCWA 3JAMU 1NK8A 1YJ7A 3BREA 3K5NA 4ZIWA 3WQPA 3PX0A 2U2FA 4DR1F 3E3XA 4CLFA 2O3DA 4X4OA 4OX7A 2NXEA 4NXNJ 4AUKA 2ZM6J 2P6SA 4LREA 1FRKA 4KT0C 1ZAVA 2VV5A 4OJGA 1IKXA 2CJXB 3BZQA 1LWCB 4NCGB 3W5YA 4RBTA 3T1YJ 4C97A 1WHVA 4FKYA 1IN0A 1K44A 2E1CA 2FTRA 1CQNA 2DNNA 1LXJA 1P27B 4O23A 2V2ZA 1GXLA 2D3UA 1DQ8A 4HDGA 3LPEA 2YKAA 4X4PA 3TQEA 3DYAB 2L48A 2Z2LA 4B3OA 4A8YA 2KM8C 1LEOA 3I56S 1RWXB 2JEGA 3A3OB 3CE8A 4X62J 3E2EA 1X5OA 3GIRA 2XO6A 1F3VA 3M05A 4TLRA 3VWSA 1SL2A 1UJ6A 1OSDA 2LXUA 4ECTA 1T7PA 4LF6F 4C8NA 8AT1B 1RHUB 3RJMB 4CO3A 2IMWP 1IVZA 1K1SA 1CVJA 3DM2A 3BH7B 2BW2A 2HFVA 3M1VA 2F3JA 2XCPA 3LWLA 3SEOA 2QA1A 1H2VZ 3W64A 3Q2TC 1FFSB 4NOHA 3GCXP 2V4JB 3GYNA 4WCEQ 2K3IA 2QO3A 1B7FA 4DPXA 2WSEC 4P74A 1KN6A 4UZCA 4ZS6A 1OO0B 1NKCA 1IM4A 4L74A 2RDIA 1BLUA 2DEIA 3KHHA 1N0UA 4FYWB 3TYTA 4F26A 4DSKA 1HBUA 1VQSA 3GIJA 5JUMA 3VZHA 4WKYA 4NLXA 2DGOA 4KH0B 3C6UB 3F44A 1ULRA 7FD1A 5HJXA 3UD5A 4N76A 1DARA 2Q6BA 2BJ8A 3S6EA 5IV3A 3US5A 1UEVA 1FRMA 2HWHA 4PG8A 3R1LA 1WI6A 3NKYA 1GXUA 1J5OB 1J27A 5HROB 1KOHA 3DDIA 1GMWD 4A47A 5E2QA 3BGFA 1T94A 2ASJA 2HRUA 1FTCA 2FZKB 2OTLS 1QVGR 1GH8A 2A18A 2MJNA 2ZWPA 1OY6A 1YHQS 2FGOA 2IAJA 2VBWA 2QLBB 1WJ9A 1IBCB 2OMOA 2OJ3A 4I2QB 1AZSA 1FJCA 4UW2A 4MT1A 2OPQA 1S4EA 2ASLA 3GILA 2XHCA 3FCVA 3N0VA 1S1TA 3GIKA 4QYRA 5A6PA 5GADU 5A8KA 4OX9F 5D3GA 5D4OA 3VVTA 1FDNA 1M1KT 5DLGA 1TL3B 3QLHA 3Q8UA 1FRLA 2IY5B 3CCZA 5F8HA 1EHWA 4C0HA 4U9RA 1RT5A 3W2WB 2N82B 2BE2B 2COLA 4ERDA 1T9UA 2UU9F 3M30A 2W4DA 2CJAA 4DWIA 1R27B 4DV7J 1LQ9A 1FESA 1XC9A 2JEJA 2DHAA 4FVMA 4CM2A 4CLTA 2GHPA 3N4WA 3KG1A 3H5YA 4PYAA 4LF7F 1QAXA 2FUG9 1IJFB 2XLJA 5CZVA 3QATA 3EGWB 1C0UA 1IKWA 2CPYA 4DX7A 1T0TV 1DURA 1SPBP 4P72A 1RAFB 2MY8A 1FEEA 1M5KC 3O8WA 3BR9A 2Y1LB 1MSWD 3W66A 2L9WA 1ZH5A 2HFZA 3KLVA 3PVXA 2OPRA 1IKXB 1Z2LA 3AQOA 3CCMS 5KT4A 5LMNJ 2NXJA 2G13A 4RX6A 1MN9A 2CPFA 2HAFA 4WFBQ 3E51A 4K4TA 4JI2J 1P1LA 3PKMA 1NDPA 2HKEA 1HBOA 3BQ0A 3WZ0A 4FPRA 2HK2A 4DF8A 1D8ZA 3FZ2A 2CA9A 1HNWJ 1CPZA 3OXGA 5C42A 3PW7A 3MEGA 3NBPA 1HHQA 1VHIA 4ETXA 2ZH4A 2ASDA 2V4RA 2WB1D 3P49B 1ICEB 5K14A 4FNIA 1UL3A 3FZBA 4V19X 4PR6A 1FFGB 4ZVQB 2DKOB 5ETVA 3PHTA 1MG7A 2Z56B 1UETA 4Y28C 5J1NA 1AB8A 4ENOA 5DO2A 2LQJA 5LXYA 3C15A 1RWUA 2ZH8A 3LANA 3KUHA 3G8QA 2MMYA 4NEZA 3R97A 3DRYA 2HHHF 5KG7A 4DR6F 4DX5A 4A48A 2HLUA 3SMZA 2KB2A 4B3SF 1UVMA 1WTBA 4W4MA 3NL0A 3R5CA 2FHJD 3UWTA 3SSSA 1TZ0A 2NUUG 1SJQA 4WZQA 2HS3A 3KHLA 4OYBA 1NHUA 1HQUA 2NXNA 2ZBIA 3NS6A 5E41A 4A8KA 4LRAA 4ER8A 4RU9A 4MFBA 2OEMA 4DPTA 3LAKA 4ECXA 1HBUB 3W5XA 2CDQA 2GJ2A 2RHQB 1QUVA 2YNIB 5J2MA 5DQHA 3ZFVA 3TR5A 2JLEA 1OS5A 1YJVA 4KE5A 4KHPF 5LJ5Y 4DXLA 3MD3A 2HVIA 1JLFA 3D67A 3DU5A 4RL1A 5A2QY 4DR4F 3X3UA 2Z2MA 2IYIA 3OXFA 3KFWX 1CJVB 3AB4B 3HLUA 2J0XA 2CQ3A 4ZP9A 3T6BA 2IAJB 4KV8B 1I5OB 4ZPTR 2E29A 1AZSB 4YS2A 2NQPA 5F8JA 2E5JA 2CQHA 1YWXA 2QL5B 3D1HA 3IG1A 3IS9B 2QJ3A 2W8KA 2GIQA 3GFXA 5D3GB 5IC4B 4IO9Q 3V6DA 3QLHB 1IBKJ 4DU8A 3M8WA 4HLBA 2DNLA 3OTDA 1M5PC 4DR7F 1VC6A 5AJ3F 1RT5B 1HWUA 2KVQE 2XS2A 2I9SA 4OI6A 4KAIA 2Y0BB 2OIHA 1S49A 3M30B 2VHGA 3HJVA 2GZOA 3MR2A 3X1LB 2JHEA 2GW8A 1WEXA 4DL0C 3H0PA 5C24A 2YX7A 1EKSA 5DLFA 3UCGA 4C9DA 1F5AA 1HNIB 5BJRA 2DIVA 3EZUA 2QV6A 3M2VB 3OLBA 1FDDA 5KT5A 1C0UB 3GV5B 1IKWB 3WIVA 3A3PB 3ILOA 1VQ7S 1S7IA 2MHNA 2Z0GA 5E3QA 2X1GA 1NJXA 1DQ9A 1QJHA 4X4QA 1S79A 5F3TA 4RPFA 3BF4A 4UY85 2OPRB 1CS4B 2BX6A 2YBVA 2B9EA 5LJ3Y 3G4SS 1SV5B 2LQBA 2UVUA 3EPGA 1JLEA 3ZC4A 3BR8A 1VRUA 4Y0FA 3TEGA 3VZIA 1HKAA 4NLTA 4NA1A 1HBOB 3M2UB 1SQGA 3PEJA 1ZETA 3PM9A 3ENQA 4A8MP 3CIMA 3DKDA 4PQAA 3NBPB 2BMBA 2C3YA 4CH1A 3N6LA 2ACYA 5LOQA 1FRJA 5DG9A 2VODA 2FDNA 1DQAA 2V2QA 4CLYA 1KDNA 2AT1B 4J9RA 3ZXWA 1NUEA 4O44B 4GVBB 4XAKA 1BXNA 3K58A 4KH1B 2NYHA 5HBMB 1FCAA 1YVFA 3KTQA 3DLJA 3R6GB 5HVFA 2VKRA 4TU9A 4DR1J 1V3ZA 1TK5A 3N5FA 3A3NB 1KQSR 4Q7AA 1RT1B 2E5LJ 5A6WA 2ZH9A 2WVEA 3K5PA 3TA2A 1HNXJ 2CNLB 3EE3A 3ENWA 3ET6A 2MY7A 4LRDA 2GC8A 1CBKA 3P5BP 4A8SA 2ZDOA 4Z37A 3T41A 2VG6A 3LPYA 3T6JA 2KG0A 1LW0A 2XI2A 1RHMB 3OL9A 4P52A 2WOMA 3D3BJ 2UVWA 2BBEA 1SH2A 2B4VA 3E8OA 4DN9A 5J2MB 4B9UA 2PA8D 4OI3A 1YJRA 3PZPA 1V5IB 3DOMB 1SH0A 3AFGA 1YJWS 2GVZA 1FEHA 5J1PA 2HHPA 3OUYB 3D0IE 4AL6A 1UJ5A 3ZNUA 4X66F 4EWTA 4RUHA 4LF6J 2VC1A 3Q8VA 4ICLA 3MZIA 3M8YA 2DJWA 4PWDB 3OL7A 3OXLA 2UXCJ 4X65F 4ZPWR 2LEPA 4ID5B 2DR7A 2JFKA 2VOPA 3CJTA 2DVIA 1FE0A 2KXHA 2OPPB 2J9DA 3JTOA 5THWA 2N7YA 3JB9k 5KFKA 1WACA 1Y5LB 1WD6A 1M5SA 1FJEB 3IG1B 1N8RT 1NH8A 1J5EJ 4NLPA 2VG5B 1EX8A 4U8VA 2UUWA 4QIVA 3V6DB 2BVZA 3LWMA 2XTJP 4X4UA 3CJ5A 1NB2A 3FJ2A 1Y0HA 2OPSA 3SI8A 4TY9A 2ZJQQ 1JNRB 5GAEI 4IOBA 1F2GA 2PN6A 2FVRA 5C24B 1VHFA 2KRRA 2KL8A 2C3UA 1XR6A 2KHDA 4Y00A 2G2ZA 2RKIA 2DRAA 2OD6A 1B0VA 4K2XA 1DHMA 1U26A 1BUXA 1H6KX 3B8HA 4XK8C 1EQ0A 2OFHX 2CWKA 3R7NB 5L46A 3ZO7A 1IBLF 2I0XA 4ZN3A 2KFZA 4YB6A 1RHRB 1VK8A 2PMZD 1C1CA 2X1FA 3GV7B 2DK2A 1WORA 4OX9J 4KGKA 4NCAA 2EC0A 4IQMA 2UVRA 1S1WB 4R0JA 3JXOA 3EYZA 3SSRA 4K4VA 1VRUB 4OL8A 1X5SA 3T9NA 2C2ZB 2J8SA 4PXDA 1YJNS 4ZMMA 4JI4F 4ZP8A 2UU9J 3MCSA 4IG0B 2K1RA 2OSQA 1W25A 4FBTA 2K3KA 4B17A 3ETMA 2LLZA 4R8UA 1NSAA 3QRRA 3MUTP 2HSEB 5H9FJ 2YWFA 5MAOA 1G2EA 3NGSA 1MLAA 1RCOB 2GJIA 1KWMA 3MMJA 2V8GA 1J2VA 4M1KA 5L9NA 3QBCA 2E1AA 1NO8A 4F3QA 2HW3A 1RTDB 3RRKA 4IOCQ 3DLKB 5D6GA 2W9BB 3MI7X 5C25A 1RTHB 1Q8LA 1GMUA 3C6TB 1NBEB 2Q43A 1HA1A 4ZVHA 1XK8A 1SL1A 1SKUB 5EDWA 3OTCA 4J9MA 1S0OA 4TU7A 4I4BA 1YKWA 4URGA 1N52B 4DR5J 1R8HA 4H54A 4HI1A 4X2BA 1RWPB 3MUMP 1C4CA 2OLWA 5HATA 3LW5C 2KFNA 2W24A 1H98A 1S6PA 1AYEA 1LW0B 2H1YA 4WIIA 2MQLA 4DU7A 2WOMB 5HLFA 1WC0A 4IUFA 2GFFA 3CB4A 4JV5F 1TFYA 2QLFB 2KM8B 3F41A 1S77D 1VYAA 2G0IA 1X9MA 3QO9A 1XMBA 3PR4A 4WF9Q 3EXYA 2HQCA 1PO6A 2V50A 4K59A 3NS5A 1QAIA 2QMXA 1VOMA 3D0GE 4HHHA 4D3GA 3D6HB 4IG3A 2BXJA 4ICLB 5K8MA 3P3DA 3U02A 2MYFA 3RTVA 4FKXA 2R8HA 2P5VA 4RNNA 4ECRA 2HHHJ 4DEZA 3GG0A 2HHWA 2ZVSA 4WBFA 2Q66A 3DN9A 3QT8A 5C7PA 2WHOA 3M32B 4KR0B 4B3SJ 1NDLA 2QA2A 2J76E 5HAOA 3GMGA 1G6BA 2DGXA 5GMDA 1WHWA 1SJ4P 3HFVA 3LGNA 2XLKA 1KLMA 1R0BG 1U2CA 4Y6IA 3HX9A 3QZ8A 1VQ4S 2F65A 4C11B 3VTIA 1Y00A 4C48A 4OZ3A 3G87A 3M6VA 2YPYA 3MEKA 1WG1A 4I7FA 2V6AA 5BR8J 1U09A 2XS7A 2WVFA 2H54B 2LXIA 4BHQA 2OPSB 1DLOB 2UUBF 3M6WA 4KHPJ 3WC0A 1MWQA 1XNQF 2VU5A 3KDNA 5ETPA 4TYAA 1GK8A 4M5DA 2PEHA 4TXSA 5I3UB 1SQFA 3H4BA 3ZZ0A 1U6BA 2DNRA 2V34A 3ZTPA 3H98A 4RW8A 2DY9A 3D6TB 4F4XA 1VMBA 3CCTA 3UO0A 1R8AA 2WK4A 1Q8KA 4EU0A 4HTIA 3TZZA 2DGUA 3VAJA 2D3ZA 3AJ2A 3QIPA 3UN5A 1REVA 1FJ7A 5GAEU 3NOGA 5CD4A 3R7BB 5KT3A 3MM9A 4Y2AA 1C1CB 4JI5F 1GAOA 1U1LA 3IWLA 5HQ8A 2IVFB 5CCMA 1K8AT 2R7QA 4LF4J 5E0OA 3V4IB 4DZ6A 4LSNB 3M6XA 1U0HB 2HGNA 4PQUB 2VC0A 1WG4A 1N33F 1CQMA 1TL1A 5IM0A 2FB0A 3TQ1A 4X64F 3RR8A 7AT1B 3G8TA 2K1RB 3R5GA 4MK9A 5DS7A 5I3PA 3MMAA 4QOTA 4R8UB 4CT9A 3L3CA 3RGIA 2Q3PA 1Z1ZA 3TVKA 2ZE2B 3J7YI 4DZDA 1AUSL 1Y5IB 5KFCA 3DXBA 1UVIA 2MKKA 1LXNA 1YDLA 2I1RA 4MIBA 1HFEL 1BQNA 3M8PA 2ZWOA 4PPDA 3NLCA 1E6VB 2BJ3A 1HBMA 5EX3A 1QSYA 3KOAA 5H9EK 2EBEA 2EEYA 3VGUA 4USKA 4Z7YA 3L9ZA 3ELHA 4TLQA 2XO7A 4B9SA 4CLSA 5FLXU 3OFFA 4DR2F 2XYPB 1EP4A 2OGUA 3CCWA 4RW4A 3QT6A 4ZVPB 1WC1A 4A8FA 1K47A 2LKZA 2ZNYA 4EEYA 5KFDA 2FY8A 2QA4S 1M1GA 2KG1A 1S6OA 4N8NA 2LQ9A 2V8VA 3PYEA 2CJKA 4DL3A 4HYKA 4NE9C 4WE1B 1N34F 1RTJA 3TP2A 2CJBA 3KLFA 4IG3B 2IJNA 1TL4A 2CAJA 4ELUA 5L8RC 2QA4G 1KQGB 4EYHB 2LP4A 3Q83A 2BANA 3I0RA 4CTAA 1YBUA 4OI0A 2V4QA 4P10A 3N6MA 4WZMA 4H4MA 1S1XA 5F41A 4QBUA 2AJFE 2J9EA 5LMUF 4NZ0A 1PYSB 9RUBA 4HKQA 1JLAB 1X4FA 2NZ4A 1Q7YT 1FJGF 4JOUA 4K4XA 3KLEA 4OJ1A 5AXMA 4DQRA 2ZITA 2AEFA 1RAHB 5F8MA 1G3OA 2YNHA 2HVDA 4OLPA 3ISNC 4P2MA 2XMVA 2M2BA 1GX5A 3C46A 4OYOA 2KXNB 2XMKA 2Z8QA 4OV6A 2CPEA 3V81A 3HSDA 4G6VB 3TOQA 3DMJA 1KKHA 1O0PA 3EGVA 4ZK7M 1HD1A 3PO4A 1JKHA 3MEEB 3U1NA 5K8PA 2RIJA 5M2UA 5KT6A 3LP2A 1TR0A 4Q2MA 1TTHB 3C14A 5ETNA 2VF3A 1N54B 2YWWA 5KFBA 3AD7C 1FRHA 4M5DB 5KFQA 4P2FA 4X66J 4PZVA 2M88A 3Q0AA 3FUYA 3LO3A 1MU2A 4O4GA 8ATCB 2BQRA 4RW8B 4RNOA 2B8PA 3R6LB 2HWTA 4H4OA 5CYMA 5U47A 2PI4A 5AE2A 5IT9Y 1HNZF 2IM2A 4P9SA 2ZH6A 5D4LA 2LU1A 3QIPB 4IFYB 4ZCLA 2F4VF 1H7XA 3H5UA 3DHWC 2IM1A 1M0SA 1GTEA 3MM9B 3TRGA 4DFJA 4QWCA 3CUNA 5L1KA 2AU0A 1WF0A 4DFKA 4RZRA 2CZ4A 2HNYB 3J7Z5 1YSJA 4J9LA 2LMIA 3RZAA 1TL1B 1T3NA 5IM0B 2G9OA 1OQ3A 3KJQB 4DV4F 4ZP6A 3EZOA 4QU7A 2FPHX 5F0WA 1EAYC 1FWLA 4YFUA 2HPUA 5HSPA 1TUWA 2CPDA 3EX7B 1VQ5S 3MMAB 3R1HA 3W1YC 1CJUA 1NCLA 3OD2A 1PYTA 5CD4H 2W9AA 2GAGC 2WSFC 5L9XA 4RJVA 1R43A 3HHKA 3RRHA 3NGRA 1T8EA 4P7VA 2Y3YA 3IFEA 4R0EA 3QJLA 3GONA 3FRYA 2CPIA 4RWWA 3AD8C 2QSWA 2EI5A 2IDLA 4N56A 1S6UA 3CXCR 4DX8H 1IBLJ 3PKYA 5K5MA 2V9WA 2AEJA 2B51A 3BSOA 1Q4RA 1HBMB 1PBAA 3PYFA 4QJVA 2CADA 1ZTWA 3NMAA 3QMQA 3MEDA 1R31A 3HDSA 4LR7A 1L5UA 2AX0A 4CO1A 2R7WA 4C98A 1UPPA 4HI2A 4B08A 4JI4J 5J1EB 2DNZA 4M95A 4RW4B 1SL0A 3PIPQ 4YB1P 2DR9A 2KTQA 4Z2XA 2GVDA 3KK2B 3GE9A 2AJ2A 2HGLA 4RW6A 1TL7A 3Q8YA 3D4JA 3NNCA 1KFSA 3CDBA 4I6YA 4X4RA 3MR5A 4CLZA 4OHZA 2F9JA 4Z7CA 4K2JA 2YTCA 1VRTB 4IRDA 4DR3F 4NZ6A 3HHEA 1QTMA 2VL1A 1NK5A 4CTAB 1IWAA 2MSTA 2EFNA 4H4MB 2AZ1A 3OR1A 3AXMA 3S7RA 5AXKA 5GAHU 3HK2A 3NGTA 1UA0A 3IR6B 3M6UA 1NZ8A 3O6QA 1D1UA 2MGZA 2ZH3A 2KT5A 3R27A 5F9LA 3A8IA 2RILA 4B9MA 3PFEA 1FKPB 3OVSA 3DI6A 5BXIA 3SSQA 2HQGA 2J0QD 3DHXA 4JBCA 2CQ1A 3HFZB 4DUZJ 3LF0A 2CRLA 2RSQA 4F7VA 2OP5A 2R3VA 4IFVA 2PO4A 3T5JA 5D77A 1KLNA 1X4DA 1HD0A 2Y1JA 2V8DA 1MMLA 4O3OA 4CP5A 3Q24A 2HS4A 4JI1F 1TKXB 3GYGA 4HH0A 4WYLA 4F50A 2AYGA 3PW5A 3SCLE 1HWIA 4HR2A 1C2PA 2VPWB 3T1AA 4OHXA 4DV1J 4WFNQ 2WVCA 1MU2B 4O4GB 3BQ1A 4K0KF 4P2SA 3K5MA 5I4MA 5D0EA 4ZCKA 3VAMA 1EQMA 1Q79A 1W26A 4AE5A 5E33A 5CYMB 2LFVA 4LQ3A 3UPFA 4I1TA 3PW2A 3ZZRA 2F4FA 2ZM6F 2QFIA 2AKWB 3MPUB 3VQSA 2XB2D 1FXDA 2GX8A 1XWLA 2AGPA 2QIFA 3ISZA 5IT0A 2LECA 1R89A 5B09A 1YK9A 3UVJB 1W7WA 1GNKA 3T1YF 3LGMA 3Q2SC 5KFWA 2DITA 1U25A 5G0RA 8RUCA 2JEIA 3PR5B 1G7CB 3U1MA 1JLQB 4J9NA 1UVNA 1FHTA 5DM6Q 1N88A 1QAYA 3RAQA 1JXVA 3HHLA 2XGPA 3TX0A 3EDQB 3QNWB 2U1AA 4NYOA 4X62F 2MLZA 4GMKA 2Y1IA 4YR3A 1TKZA 3PACA 2FQQB 2E5IA 1KS2A 3FBBA 1WC3A 1CEZA 3PXGa 2J6UA 1RADB 3ONQA 4DL6A 3ISND 1Q95G 3Q8PB 5HMZA 4PG4A 3KJFB 2FJAB 3FK4A 2BJ7A 3NG8A 1NNDA 3HKWA 2QLWA 4JI5J 3JAMY 5C2CA 2JLFA 2QC3A 2KT3A 4HHJA 1SJ1A 2RQKA 1OQ6A 3BGOP 3MEDB 1T05A 5DJBA 1N5QA 2W7PA 2F8MA 1P8GA 3PJ9A 4F4YA 1N33J 3KK1A 2CXEA 1F1BB 3WX4A 2OI2A 4X64J 1FF2A 1SVDA 1WF1A 2GVDB 3IO1A 5IT4A 2H5EA 5D4PA 4UQGA 4J9OA 4M63A 3JQJA 4ZVOB 4RW6B 3GQCA 3UDVA 3CJQA 3QGGA 5HQMA 4DSEA 4OIXA 3LUYA 4OLOA 3GZ7A 3H59A 4OX6A 3SXLA 2FYXA 5I42A 5ITHA 2HZVA 2IM0A 4NI2A 4ECUA 3GJQB 3OR1B 3AJ1A 3TA1A 3CDEA 2MKYA 4I64A 4OYZA 1H73A 2MGZB 3P6YC 3QGHA 4FZVA 2DPIA 3DGVA 4EBEA 3GSDA 3VHQA 3DI6B 1BMQB 2BOPA 3G71S 4MIAA 4DOZA 2BE9B 3HSZA 2VICA 1WI8A 1NSPA 2LCWA 4Y65A 3I4PA 2CPZA 1FWKA 2NYIA 1W2IA 2RS8A 2MSSA 2B4UA 5F8NA 2CG4A 1WEYA 3H5XA 2GCFA 5FDLA 3HMJG 1RUSA 1JLBA 1BQXA 1X4AA 3IA0A 4UY8T 4ANCA 4CLUA 3UDCA 4PABA 4DV7F 4PKDB 2BR0A 5AXLA 3PNIA 1RWNB 4NLVA 3AOBA 1TKDA 1FRXA 1WG5A 5EWFA 1FO1A 5T7LA 2HIYA 2LA4A 2EWHA 3H7HB 3NCPA 2QT7A 4WP9A 1JLCA 3CW2C 2MZ1A 1X4GA 3BBBA 4HDHA 2AEMA 3HJFA 1GX6A 5LMUJ 4QQBA 4N77A 2DH8A 5KFNA 2W1BA 4Y2KA 5E3RA 1NM2A 3D68A 1Q0NA 5CHCB 4QIFA 1RT7A 2ZZNA 3LH2S 4O3PA 1BWEA 1F3FA 1Q5YA 1MW7A 4OZNA 1X4CA 2ZBRA 5F3ZA 1RA6A 3I5CA 4FXWA 2XMJA 1ZZNA 2RF2A 3DOKB 3AAWB 4DMZA 3MTJA 3CCES 4DS4A 1IR0A 4BC9A 3BJYA 3PCOB 4JI2F 3CVKA 5G0RB 4YR0A 2BJ9A 3MM7A 3VAFA 1UMJA 2V69A 2YNFB 4Y2MA 1DZ5A 4OYMA 1V3RA 3RW6A 1YGYA 1TV6A 3TA0A 5EHHA 1S1VA 4P71A 4PWWA 3EDRB 2DHGA 1UKUA 1ZPVA 5T14A 1N32F 4EBCA 2MLXA 3PIOQ 2YQ0A 5A8WB 3BYPA 2E1RA 2WTFA 1N56A 3V2UC 4KSEB 5ADZA 3QIDA 5KFGA 4LRBA 3KMSA 2FVPA 3UN3A 2GMLA 3PRBA 4K4ZA 2HBQB 1EETA 2XNRA 5A0YB 2A6MA 1D0EA 3FFIA 1OWXA 1WKKA 4F36A 3AQPA 1Y7PA 2XC9A 4KTQA 3DXSX 3K2YA 1DAXA 1UFWA 2QMUB 4DF4A 4NLGA 1QE1B 3MOJB 1GTHA 4KGVB 1T05B 4JI7F 3ENAA 5DDRC 1IR1A 2VUGA 3KJVA 3KK1B 4AD6A 2ZDPA 4BLGA 2IMOA 4DV4J 1VJQA 1QAJA 2IFXA 4UUXA 2KHCA 3DLEB 1KQFB 4D3HA 3HULA 2R7VA 4ANEA 2HMIA 3G96A 4NXMF 2B4OA 2MKHA 1XMQJ 2HK3A 3MAAA 1RXOB 4ZVEA 3VALA 5LT5A 3CJRA 2EFGA 2VONA 1HQEA 4OYWA 1IXKA 1S0MA 1BHNA 4LR9A 4JI6F 5CH7B 3W2VA 1HHTP 3S8SA 2R7UA 1RT3A 3FMBA 1X31C 2IJRA 2Y1RI 3BSNA 3GFYA 3H40A 1DY3A 3PX4A 1TMMA 3FSXA 2RH3A 2R7RA 2IRUA 2G0JA 3NEKA 4LJMA 2X7IA 3BSAA 4F8RA 2Q79A 1BC6A 2JOQA 3L7OA 1ZPWX 5IWAJ 2AJ0A 1DTQA 3ETOA 3G9CA 5E3PA 3EMTA 3VAIA 4KFBB 4B9VA 2F8EX 2HHUA 4MKVA 4FYXB 4U7UD 3SBMA 5KG5A 2J6SA 3KLIA 1R8PA 2CJYB 1NH7A 4RU2A 1BE4A 3VVUA 3R2DJ 2UP1A 2CQDA 3CTRA 1AW0A 4HH1A 4F0KA 3HSJA 2CQGA 1SQEA 4DSFA 4ZP7A 1JLBB 2I5JA 1U0SA 4J9SA 1BY9A 1F5BA 5H9EJ 1N5YA 4QW8A 3I5BA 3OHBA 1H2TZ 4LVNP 3QFHA 5GADI 1YJ9S 5IOLA 4DR3J 5JXSA 2LDYA 3G6XA 2QZ8A 3EGNA 1JJCB 1WDTA 3E01B 1PGZA 1VBZA 2MQPA 2J7UA 2W9CA 1N4LA 1Y3KA 2V2KA 4EYIB 4CZCA 1CULB 4RWXA 5KG6A 3PO5A 1RT7B 4C4WA 2R8JA 3W5ZA 4EBDA 2XYGB 3LQVA 3K5OA 2O01C 2KFYA 2RF2B 1ITPA 3NAIA 2KYXA 2MXYA 3W9JA 4P6QA 1VCTA 2M8HA 1VQLS 2D9OA 2DT9A 4ITSA 2XWYA 4KGZB 4KHRA 3W8PA 3CO0P 1XTZA 4JI1J 1TV6B 3FEZA 1S1VB 1UFLA 5D0GA 1FD8A 1S9FA 3AODA 2AJ4A 1VQOS 4G1IA 4F25A 4CT8A 3GFZA 2GQ2A 4DV3F 1WSRA 3IBCB 4O0NA 2JDJA 4KPCA 3HF5A 2A1BA 1WOPA 3TJAA 1TL5A 4XO0A 4K0KJ 1UFKA 2BZ2A 5J2QA 4ZPDA 3UW1A 4PG7A 2A3JA 3P4UB 4KY3A 3OBIA 1SJFA 2E5LF 4ZITA 1Q86T 4ED3A 1IKVB 1F9HA 2C22A 3SZ2A 2GGPA 3BH6B 3DRPA 4S0MA 1HNXF 3K89A 4KBIA 1PSDA 2FVSA 4FVCA 1Q78A 4AQYF 3TUPA 4AL7A 4WYWA 2WB4A 1ZOTA 2KJWA 3L4BC 3KJVB 1WTFA 1EARA 1WC5A 4LUBA 1YJTA 1ROFA 2Z4PA 3GFHA 5JMNA 5F8IA 4BCAA 3L7PA 1UEKA 4IR1A 1T9WA 4P7TA 4ECVA 5KFRA 2BV3A 2FGCA 3HVWA 4YB7A 2HMIB 1VK3A 5IQ6A 1JX4A 3CC7S 5HMYA 4CO2A 2XG8A 3QFWA 2XNQA 2UXBJ 1KSPA 4RO0A 1HQEB 3RBXA 3NWGA 4FF1A 2QG9B 2L41A 3A8KA 4E0DA 1RGVA 1O5JA 3EVMA 2M9KA 3UDEA 4F4KA 4I6AA 2UXCF 2PMWA 3W2VB 2HNDB 1JXEA 3M8QB 3NWRA 1DTTB 5D8HB 2OHDA 1A6LA 4YUDA 5KFUA 2BQ3A 1YBAA 2O67A 4QCLA 2JJ4D 2DRDA 3R5DA 1B64A 2CQCA 3H8YA 4FYVB 3I55S 2RT3A 1C0TA 1XQIA 2YWKA 2E7WA 5H1SV 3K57A 3NCQA 3FBFA 4FXDA 3OV7A 1J5EF 1A9NB 1AFJA 3B4DA 1FVQA 4WFAQ 1S0NA 2HLTA 3HHNB 1OYDA 3KLIB 2RQ4A 3Q22A 3CO9A 4USJC 2V0NA 5HVHA 4GC6A 3OVAA 4R5PA 3JYTA 1YZ7A 3KUEA 4I2PA 2IBKA 4I69A 4HEA9 2I5JB 5A76A 1IM6A 3JTNA 1FKAF 2KT2A 5B0DA 2RDDA 3F73A 4WK3A 2EFVA 1R0AB 4NMXA 4UF4A 4X84A 2A10A 2BUNA 2JNJA 4JV2A 2CNKB 5IV4A 1KTVA 4LFAF 4LSZB 2R2UA 2CZVC 1RCXB 5AT1B 2F5GA 1T02A 3L7UA 2QLXA 2RU9A 4FS1A 5EGYA 3UNYA 3AOAA 2J9DE 3KG4A 2CG8A 4ZA1A 4YP3A 4JP8A 2ZH2A 1NHKL 4AL5A 3G8SA 2GIFA 1RT6B 3UNGC 4GC7A 4FYYB 1S6QB 4J9QA 4UOHA 2GAHC 4EO6A 2R8GA 4HTJA 3BYRA 1XNRJ 3TZXA 4O3NA 4CRJA 2E5GA 4PG6A 2D3O1 1ZBTA 4OX8A 1R0CB 2N4DA 2GHVC 2WW4A 1TUGB 2OMLA 4GVLA 1U24A 2ZD1A 2FVCA 5C2GA 4Q0BA 1CJKA 3MECB 3NP5A 1L3TA 4CLWA 3NOCA 2EC2A 3QAUA 1KRPA 3G2XA 4ANDA 5CYQA 4O3SA 2WVBA 3GR0A 1DJ0A 2HHVA 3QGPA 3VQTA 2NPIA 2PI5A 2AJ1A 4TU8A 2YWEA 1VC0A 1PJ6A 3KYLA 5HK4A 4UUWA 3VGVA 3IN5A 2QYCA 3LTOA 2GGPB 3DRPB 4L6V3 4O3QA 1JLGA 2C1EB 1UCNA 5CZXA 3BGRA 5KG0A 2OAUA 3NGUA 4A46A 3MXHP 4IDKA 4MTPA 4W90B 4DR5F 1PAUB 2OFGX 3DGPA 4MMOA 3OJSA 4ALZA 3VGTA 4DV6F 2IVYA 4P2XA 4OHVA 2RJZA 2YKQA 4YN3B 4DUTA 1I1GA 2OEKA 3GU0A 2EKYA 5DGAA 4LF1A 3EVWA 1NKBA 3ZTOA 2ZZTA 3I82A 1S7HA 3TVYA 5DETA 4IH6A 4B3OB 4U6PA 1VDHA 1UVJA 1O8BA 5KG1A 1N32J 2DGWA 3FSIA 5D4NA 1Z4UA 2FJXA 3I87A 2B4PA 2VFUA 1VLOA 1RWWB 4HACA 3MAQA 3RB4A 1SKWA 3I6PA 5IC6B 1YRXA 1QTNB 2BM1A 2XMMA 1U48A 4KKOA 1SCJB 2C2EA 3DM2B 2LEAA 3M1VB 1VR6A 3IM9A 1RBLA 3FVYA 4LT6A 3KXDA 4CI0B 5E7OB 3JSRA 2HVHA 1X0FA 1C0TB 1AROP 3ULHA 4DPOA 4UQTA 4NLQA 1PKUA 4JI7J 3FDSA 3NCRA 3OR2A 1FDAA 3AJDA 3B6BA 2XZWA 5HVGA 4R5PB 1RAJA 4ES1A 5BR8F 4U67Q 5KFHA 2PFDA 3HD2A 1KBRA 2HBYB 2H9ZA 2R9LA 2W2MP 1FKOA 2IM3A 4MK8A 3N9UC 4NXMJ 4DQIA 3LGHA 4JI8J 4OZ0A 4JB8B 3AB2B 1EKRA 3H90A 4BC7A 2R8IA 1KC8T 1F9FA 5AE1A 1IKYA 2IA6A 4RW9A 2HHXA 2N4CA 4NWBA 3IXQA 4JI6J 5DGBA 3FGVA 2VJVA 3MPVA 4NA2A 4TY8A 1RTIA 3G82A 1F0XA 4F4ZA 2EFQA 4M5JA 4E98A 4WP3A 2DO0A 1D9FA 1SB6A 2VA2A 4UZBA 3BS9A 3D28A 3T5HA 2ZH1A 2OPQB 2DR6A 2QE5A 1NRKA 1S1TB 1SH3A 3DRXA 1MMDA 3UCUP 1B0PA 4LF4F 5A8KB 1RZMA 1MWYA 5KFIA 4DX6A 2RMLA 2JSXA 4QR1A 1QLNA 3IP0A 3Q8RB 1Y10A 2JL9A 1U6ZA 4TNOA 4MKYA 1L3UA 5J2NA 1RACB 3GPAA 2DXFA 1FVSA 4ZLLA 1KVKA 5B0FA 2ZC3A 4U7UK 1VQ8S 2ZD1B 4KO0A 2P8IA 2WAQD 5FD1A 3P8BB 2WONA 2VPYB 4Q0BB 1CJKB 4KJIA 5DG8A 5IS2A 2CVIA 4MYUA 2D41A 2R42A 3B82A 4ED4A 1O6XA 2JLGA 5KFYA 5CYQB 1U2RA 3HVAA 1S57A 4C2MA 1PJ7A 4ZDNA 3N5BA 1G4CA 1F60B 3PHEA 3NY0A 1WELA 2P2CB 3L09A 4M5GA 2FJBB 2CUYA 1XN9A 2B5JA 1XEZA 1Q81T 3R8YA 3CCRS 4YB5A 3IMQJ 2K7JA 4QYZK 1UTAA 2V8PA 1NK0A 3BGRB 3PYDA 4WXOA 3UCZP 2NXUA 4K4UA 3I9ZA 1HHSA 1ZM9A 3D2WA 1B70B 3I5AA 5HQLA 3PW4A 4J5OA 4MIWA 4QIWD 3POTA 3CJ4A 3M9OB 2D1CA 1PCAA 1T3OA 1K0VA 2JEFA 5ETKA 5C42B 1CLFA 1FRIA 3IR7B 3MEGB 1VLYA 3RBDA 2W01A 2MDAA 2XMTA 4I68A 5K14B 3Q89A 1RAAB 2DXEA 2FHMA 1JMTA 5ETTA 3WHIA 4DV3J 3M8ZA 2QTWA 2V63A 3ILLA 4NLYA 3QZ7A 1RSCA 2XY5A 3C15B 1T11A 4U8YA 3MPYA 3BKFA 2BA9A 1R6YA 2WZ1A 5A8RA 3KJNB 3FQKA 2HG4A 4YHHF 4I67A 4FP9A 1Y3JA 1JXLA 1VGYA 4OYAA 4QIGA 1PIEA 3T3FA 1VC5A 1T03A 2UVVA 4FXVA 1LWCA 3ENVA 1NJWA 3SV3A 4NCGA 2F7VA 4RKUC 4AQYJ 2AD9A 1PC4A 3SQOP 3UE2A 3V6HA 4C3LA 5G4DA 4KRWA 1HQUB 3D7SB 1RAEB 4DFMA 2VH7A 1V6HA 3CSKA 1TU0B 4WK1A 1HWJA 4MFBB 1KR4A 2L9DA 4LQ9A 4DL5A 3AT1B 2C2KB 3N01A 5KG4A 1QY7A 1XBWA 3FNNA 5L1LA 3P45B 1FKOB 3R3TA 2ZC4A 3W9HA 3OPKA 2C2RA 3MDFA 3SQGA 2HZCA 4O0IA 4KC5A 4DV5F 3RAXA 1N6QA 1JLFB 4LVOP 3D54A 1IKYB 1WHYA 2V5HG 4MAKA 5FLXY 3TAMA 2C28A 1VQNS 3DDNA 5KFMA 2UV8G 2DHHA 5KFPA 1NKEA 1GT8A 1YRTA 2DBBA 2AMCB 4TY8B 1RTIB 3G82B 4FN5A 2V4JA 2ATCB 5D0RA 2FHKA 4ZVFA 3SCJE 3KK3A 4HHUA 1S9GA 1UEUA 4NASA 2UXDF 4DS5A 4JV0A 4B3RF 1VQPS 4DN0A 5AE3A 1G1XA 4ELVA 3NMRA 2DNMA 2FJEB 2XMWA 2HQFA 3RG6A 1MNEA 3SCKE 2FHOB 2VQEJ 1J5OA 2V68A 5HROA 1NK4A 1ELOA 1VQMS 1RB0A 2WONB 4Y3CA 1ZS6A 2KKHA 1BD6A 2P9GA 2AJQA 2F63A 2XY7A 2R4FA 3ICLA 3W61A 4K5SA 2XMUA 4LFAJ 4C0BA 1UJ4A 1YBTA 3V4MA 1RWVB 2VKZG 1SC4B 1RQ0A 4C8YA 1RAIB 5ETLA 2HQIA 4C3MA 2IA0A 3LP1A 4FF2A 2H3EB 2CDRB 1PILA 1TL3A 2G1DA 1H72C 1YJUA 1HNVA 2C2MB 3W2WA 2BE2A 3GJSB 1JLEB 2J7WA 3O3LA 2ALYB 1VBYA 2WBRA 1T95A 4ZVUB 3GV8B 3A8JA 3CCVS 1R7IA 2AV5A 1FXLA 2MQ8A 4ZPVR 4IYQA 4K5RA 5KFFA 5F9NA 2DGQA 4ECQA 2K06A 1LWFA 2EG2A 3IWNC 3HKZD 1HARA 1WKLA 4H4KA 2FLPA 3IAM9 5LM7E 4ZKAA 2ASYA 3TEHB 4OHWA 5A8RB 3H42A 4JI3J 4X4NA 2MZJA 4EMDA 4CLKA 2YQ1A 2LEBA 1ZM2A 3BBCA 2IC3A 2ILYA 1D8YA 1NK9A 2QYGA 1T03B 4QWAA 4BS2A 2JX2A 1U47A 3ET6B 5ETRA 4M94A 4PXEA 3I32A 4OQJA 4CH7A 4QIEA 2KXFA 2XBPA 1EIYB 3M8SA 4K4WA 2G2YA 3CD7A 3CT9A 4DUZF 4DV6J 2R7XA 2VG6B 3W62A 1IWGA 1RK8A 3MF5A 3G6VA 1RT4A 4ZPCA 2ABYA 3H2UB 2PIIA 4DFPA 2JC0A 4BBYA 3QJJA 3GCWP 2QLJB 2VZ9A 1UP1A 1WUUA 4DHVA 2GVZB 3GWCA 5KTQA 1DRZA 1Q82T 2O5DA 3SQGB 4B3TF 1NDCA 2CJ9A 4ZVSB 4FYDA 4U7CA 1N6QB 1ZM3A 4DV1F 3TAMB 3HFKA 2VASA 3B78A 2F9DA 3CC2S 2EK6A 1P1TA 3TNVA 4NCBA 1SJRA 3KKFA 2IRXA 1NMEB 1ACMB 2KO1A 3EUNA 1OYEA 2GS8A 2ILZA 3CULA 5HANA 3CIZA 3KK3B 4GKJJ 3MCNA 2VBZA 3C3LA 1S9GB 1D9AA 1OSCA 2OTJS 1H3DA 4W92B 4IRCA 3M8RA 3VF0B 4UOGA 4I6WA 2CYYA 4K50A 2IIHA 1HL6A 2YNIA 2GIRA 4ZIVA 1KTQA 4ED5A 3RAMA 2K2PA 2DNGA 1X8DA 2ZFHA 4ZOSA 4PRFA 1K1QA 3SFUA 2CQPA 2ZOMA 3DLBA 2D74B 4XIUA 3GIMA 3GLJA 2DY1A 3HHLC 3O1LA 1RP5A 2Y8YA 2CPJA 4G1PA 2DCUB 1XMOF 1SJ3P 1CJVA 1VFJA 4WFZA 3PEHA 2MKSA 5KT2A 3HM9A 1QVFR 4ED0A 2JFDA 2MQOA 3NNAA 1ZA2B 4KV8A 2RKIB 4YEAA 1TFWA 1OY8A 4IOAQ 4DJBA 1VJWA 3IS9A 5E3AA 2MZTA 2VD3A 3LP1B 2XGQA 1NJIT 2DTJA 1HMVA 1CJTA 1W2BR 2GA7A 2M5YA 1NPKA 2XLIA 1HNVB 1E6YA 2NSCA 1LWXA 3LALA 4LF9J 1GFWB 4QR2A 5LSOA 2RB7A 1KEKA 1B3TA 3HZEA 2BEFA 2VDIA 2DGVA 4OI1A 2YKNA 4DCOB 4V19J 4NLUA 1H74A 4NYZA 3M9NB 1YRUA 1GMVA 1WDDA 2P6TA 1HNIA 1U6FA 1S76D 3MM8A 2HYIB 1NSQA 1VRQC 3IBFB 3M2VA 2A6OA 2DNKA 2QSFA 1LWFB 1V3SA 1QDUB 2M7SA 4J37A 2FLOA 4WP8A 1M90T 3CMAS 4QWEA 1CSJA 3I9V9 2DHSA 1YLXA 5KFOA 1YQHA 4FPIA 4J90A 4AXJA 4DL7A 5FJ4A 2Z58B 4CCHA 4RW7A 3QT7A 2IC3B 4K4SA 1CS4A 5C25B 4C7QA 3CC4S 2LQ8A 1SV5A 1SC6A 2EK1A 2APOA 1U02A 3J81Y 2CKWA 4TVAB 1C1BA 2IDEA 2R7OA 2OSRA 1JJHA 2X1BA 3M2UA 1HQ2A 1BGXT 2DR5A 4FF3A 1CC8A 1QD1A 2AIRB 1TAUA 3W3SA 1S6PB 2R2TA 1RT4B 4CNZA 5HLFB 2I2YA 5F0UA 3PG9A 2DR8A 2XM3A 3P96A 4O44A 2VFTA 5GAHI 4GVBA 4KQZA 1X7VA 4IQXA 4F0HA 3HI9A 3JQKA 2X51A 3OT9A 2C2NA 5HBMA 3QO9B 1TP7A 4RUCA 3UD3P 3AOCA 1FI4A 1GQEA 4N8OA 3QJPA 2UUCF 3EM1A 4J9PA 4DCJB 2YPZA 2E7XA 4RUBA 3U7JA 1RT1A 4YDXA 2C2OB 1GMWA 2JZ5A 2RNEA 2YY3A 4YHHJ 4J9KA 2YNGA 1MN7A 2BKPA 2LXFA 1PBUA 2YWHA 2KJVA 4KPYA 4ECZA 3MAHA 3BQ2A 2BM0A 4WFYA 5ETQA 1KLMB 5T41A 5K9FA 1Y11A 2CIMA 4X4VA 3IR5B 5B0AA 3KMQA 3PYGA 3AY0A 3BPSP 1UAWA 4ILMA 3CJ0A 1HI0P 2ZUAA 4B9TA 4I7FB 3DOMA 4KGXB 3HZGA 4O4RA 4OYXA 3LAMA 4ELTA 3NAHA 4AYBD 2AYEA 5B0GA 2H48B 3OUYA 1HW9A 4GKKJ 5DZ7A 3L95X 3ZNJ1 4RNHA 1B7YB 1VIOA 2DPJA 2I6WA 4DV5J 4PWDA 2CFXA 3GSIA 2HURA 2E9ZA 3A1YG 1VQ6S 4CDIA 2WSCC 2Y0SD 1S0VA 4ID5A 1ZM4A 1HW8A 4X4SA 3BBFA 4DL2A 1NPRA 2ZHAA 3OTEA 2OPPA 1N5TA 2CQ0A 2DIUA 2X3DA 3GP9A 3NXZA 3DOLA 4TKTA 2DH9A 3EJMA 2NLWA 3OFHA 4WU2A 3MPWA 4Q43A 1IR2A 1XERA 1REVB 3BGLA 3RBZA 1U4BA 2VG5A 1HMVB 1CJTB 2UXDJ 2PFFB 2RD5C 4KHMA 3K8VA 4B3RJ 5DG7A 1E6YB 1LOUA 1I51B 2DEJA 1CC7A 5KFAA 3J81j 2B43A 1RU1A 3WX8A 2YKNB 1N5SA 1WKJA 4XTTA 4ZCIA 3HT0A 2D69A 5KAKA 1HYSA 3BPDA 4DL4A 4DSJA 1DBDA 4ECYA 3MM8B 3B4MA 3TJ8A 4BWJA 4AXIA 1XMQF 2FD2A 3BGUA 4WPAA 3N6NA 3THVA 3D6FB 4OZLA 4ZLPA 1YIJS 1JIHA 1X5TA 4OFZA 4Q8FA 2Z57B 2AGQA 2XSFA 4WKRA 2FVQA 5EWEA 1TKTA 5KFTA 1NK6A 1JWWA 5KFZA 3TANA 5CA5A 1BQNB 1RABB 3CDUA 3M8PB 4RW7B 2ZZMA 4LR8A 2Z2ZA 3C19A 3HPOA 2CPXA 2HZAA 2GO8A 4QPXA 2PDAA 4RBUA 2NREA 3AH6A 4LMZA 5IWAF 1S1WA 4RUAA 4U96A 3T19A 1C1BB 3HHLD 5EUHA 5EN1A 2RRBA 4KYZA 2FHJA 4K4YA 1RYSA 2DISA 4K7QA 4QZVB 1S12A 2EVZA 4IG0A 3CDAA 4C8KA 2F8HA 4YY3F 4LBPA 4OMFG 3C2PA 4DI6A 1EP4B 1X4HA 3MCOA 2KDOA 1V9OA 5MLCV 4LF8F 4Q2LA 2SXLA 4DPWA 4MH8A 3QSYB 2ADCA 2F1FA 2VG7A 3CMQA 4QYZJ 2UV8A 1SBRA 2H51B 3TI0A 3TVZA 3M2RA 2RRAA 2FZGB 4CLPA 3SDEA 3TX8A 3VAHA 4TN2A 1YITS 2ZBCA 1RTJB 3KLFB 1NJZA 4IH7A 2L9NA 2DRBA 1IBMF 1NB7A 1RTDA 4YMEA 5CXTA 3DLKA 2W9BA 4NLDA 2BANB 3I0RB 5KFSA 1RTHA 3C6TA 2HS0A 1S1XB 3U27A 3QWUA 1AUDA 2DNPA 2YNGB 2B9WA 3N28A 3BB5A 4NRTA 2D3OR 3CF5Q 3CGIA 3KLEB 1ZA1B 3MR7A 1YZ6A 3D9BA 3GR1A 2EPIA 1TQLA 5IQQA 2ZJRQ 4L3KA 1S5ZA 2DGTA 4KIAA 4L3NA 1UVKA 4XDDA 1HR0F 1U1PA 2M70A 2C3MA 2YNHB 2E66A 1X9SA 4UOFA 4HVZA 2XMAA 3D6MB 2M3DA 3V81B 4DUYF 4FF4A 3CJ2A 4NLOA 3DMJB 2MHEA 1S99A 2AF6A 3H2VE 2R2SA 1JKHB 2C3PA 3FEYB 4DQSA 2VQFF 2GQCA 3LP2B 1VQYA 4DLGA 1P6TA 3C14B 2RUGA 2NUHA 4B3TJ 5HP1A 4B9LA 3DLLQ 3JSMA 2BACA 4PXBA 2JVOA 3Q86A 3HD1A 2M8DB 5E3CA 2ATLA 2YVSA 3M32A 1X4EA 1NK7A 1F5CA 4F02A 1JK9B 2OUGA 4H4OB 2ZOFA 3RUBL 3DOLB 3TO8A 5B08A 4I0WA 4LF5F 2FC8A 7FDRA 3CD5A 1RKIA 3MR3A 3QQCD 5HI7A 2ZVIA 3LOUA 2N3LA 3TWZA 4C11A 1UZHA 1RJJA 3SV4A 1SKRA 1T9TA 2J0WA 4ZCMA 3EICA 3EVOA 2HRYA 3IGNA 2WBMA 4WJBA 2J6TA 5KFVA 1DLOA 2FJVA 2AX1A 3H2LA 3H4DA 2E44A 3CJ8A 2W2NP 3QRPA 1HYSB 3MCMA 2ROPA 5I3UA 2IPOB 2XULA 2VFVA 1XMOJ 1CJUB 3ZTRA 3HT3A 4J9UE 4FNHA 5JVGQ 2UXBF 1KFDA 2H5IB 3J81U 1N0VC 3TJ9A 1X9WA 3K8WA 3ZTSA 1U1MA 2XZDB 1NU4A 2G0CA 1QM9A 1TKTB 5SUHA 1FA0A 1ZYQA 2IJFA 1EB0A 4IH5A 4ILLA 2QMWA 3NNHA 4PAAA 3H5SA 5HL7Q 3CJSA 2B8QA 1QSLA 3MTKA 3V4IA 3CPWR 4LSNA 1U0HA 1N36F 4PQUA 3MM6A 3AD9C 4M5IA 5I3QA 3W8GA 2ROEA 3WBZA 2YX1A 5RUBA 2PGCA 4CIOA 3RR7A 3TUZC 3D0HE 2QN6B 4OZ5A 5EX0A 2UUAF 2BJ1A 4DSLA 3QPIA 2J0SD 3MR6A 2B0GA 2QL7B 3MFIA 3A12A 4J7CA 4MYTA 3OLAA 4QWBA 1I3OB 3FBCA 3M4XA 5M2PA 2ZH7A 3EWGA 1T9XA 2ZE2A 4NLRA 2DB1A 5D78A 4G3IA 3MD1A 2VG7B 4V1Ak 2D7SA 4LF7J 3M2RB 1BWVA 1LNQA 2X3GA 3J7A1 1LKZA 3DDKA 3SDEB 1Q53A 3CJKA 1RHQB 1TL7B 3BDEA 3EZ5A 4RLEA 3KG0A 2KRBA 4WXWA 1CG2A 4O3RA 2CNNB 2KZZA 1RTZA 2CQ4A 1E6VA 5KFXA 1U49A 2PT0A 5B0BA 2N3OA 4NPOA 2HBZB 4DPYA 3TAQA 4UT4A 2HVEA 2E7VA 1N48A 4URQU 2D9PA 4NLSA 2BJDA 2J5AA 1WEZA 3D1QA 5F8LA 2YKPA 2EBGA 2R7TA 1B99A 3Q23A 2DYAA 2E1MC 2AQ4A 3OL6A 1OPZA 5KG3A 4EZ6A 3CCLS 2RE1A 5A2QU 1XNRF 2ZNZA 3PFOA 1A7GE 4QR0A 5LL6d 4IFVB 3UN2A 4ZJOA 2H4YB 4ES3A 1SKSA 2AHOB 4ZN1A 4LIWA 4WE1A 3THPA 2RAQA 2ROGA 2QX0A 3NRBA 4OJHA 5J2PA 1QUPA 4PG5A 1R8BA 1U8WA 2FY1A 4A4JA 5HP1B 1IQZA 4M5HA 3JSMB 2B56A 2GV1A 2OELA 4K8RA 2UUCJ 1FNXH 2IVMA 2CWXA 1LW2A 4DR6J 1RHJB 1JLAA 2HHSA 2P9CA 1K0TA 4EZ9A 3OW2R 2BYCA 3W7BA 3ZTQA 1Q7LB 1RI7A 4ZLJA 3OFEA 4ZVGA 1SC1B 2HNZA 4L72B 4FS2A 1OJ4A 1HI1A 1VS3A 2XZTB 1FTRA 4DBQA 2KYZA 1UZDA 4C6AA 2LU2A 1RLDA 3EPIA 3WC2A 1FNMA 2MZRA 4RNMA 4G1QA 3CCJS 1LV5A 3V6JA 3IC1A 3DU6A 3MEEA 1TAQA 2EKNA 3BV8A 5DDOC 3TW0A 3MMCA 3BN7A 3K5LA 4LIRA 3MPDA 3W65A 4WU3A 3HVTA 3HHLB 1EJ7L 3A8EA 3OSNA 2VBXA 4EO8A 1YX2A 2YH1A 4DR4J 4HT5A 2PSZA 4KB7A 4G65A 4C3KA 4NEYA 2X1AA 2MB0B 1V5VA 4OI2A 3UDLA 3PV8A 2MLYA 1TKZB 2JH3A 2DNOA 4ID8A 3Q8SB 4PUOA 4MJKA 5ETOA 5L39A 3IAS9 4F3MA 2DNHA 3TARA 3RBEA 3OTBA 5HMWA 4OYIA 2E9TA 4IFYA 5GMKa 1FE4A 2HEKA 3IRXA 2QEXS 5B0EA 2UUTA 5ETSA 2ZKUA 3FRZA 1D09B 4UTGA 3SYZA 4ZHRA 3KHRA 2ACMA 1D3WA 2HNYA 4RNFA 1NDKA 3RB3A 4HL9A 1Q16B 2HFUA 1RISA 4X4TA 3PJXA 1HIYA 3MM6B 4FDFA 2Z2YB 4OZ2A 4DR7J 5AJ3J 2YH0A 1LFPA 2FJWA 1S10A 3KNAA 2B7BB 2BKOA 2BDPA 3IM8A 3THTA 3MURP 5GVQA 2RRNA 4OYPA 1UVLA 1RWOB 1S59A 3R5BA 1FDBA 2NR0A 3DRSA 3ZZZA 5DM7Q 5CYJA 2B9XA 1F2HA 3LP0A 2BABA 1FT8A 1Z2ZA 4F0MA 1F9EB 5SZTA 4JI0F 1OMSA 3CJKB 3IRWP 1HI8A 4JI8F 3KHGA 4PPZA 5I42B 1Q8BA 2QL9B 2ALZA
chains in the Genus database with same CATH topology
2O66A 4TY8B 1RTIB 4LQ3A 4FN5A 2V4JA 3UPFA 2MY8A 1FEEA 4I1TA 3PW2A 1M5KC 3O8WA 6FDRA 2FHKA 3BR9A 3ZZRA 5KOXA 1MSWD 4ZVFA 3BO3A 2L9WA 2ZM6F 1ZH5A 2HFZA 3SCJE 3KLVA 3KK3A 4B9NA 3PVXA 3VQSA 2OPRA 1IKXB 1S9GA 1Z2LA 3AQOA 3CCMS 3DFEA 1UEUA 2XB2D 1FXDA 5KT4A 2UXDF 2AWZA 3RU0A 1U7LA 2GX8A 1XWLA 4DS5A 2G13A 4RX6A 2AGPA 4ES2A 4BWMA 2QIFA 3ISZA 5HO4A 2CPFA 4JV0A 4B3RF 5IT0A 2LECA 4EGLA 4WFBQ 1R89A 5B09A 1VQPS 4F2RA 4DN0A 5AE3A 3E51A 4K4TA 1P1LA 3JTPA 1G1XA 1GNKA 3T1YF 3PKMA 1R8CA 3OTOF 2YWGA 5J1EA 4ELVA 3LGMA 3Q2SC 5KFWA 4B3MF 2DITA 1U25A 2Q6CA 1HBOA 5G0RA 3BQ0A 2JEIA 3WZ0A 2B6AA 3PR5B 1G7CB 4FPRA 2CPHA 3U1MA 4DF8A 2DNMA 1D8ZA 1JLQB 3FZ2A 4NL5A 4TQRA 1M5OC 2FJEB 3OXGA 4J9NA 1CPZA 5C42A 2XI3A 1UVNA 2L3MA 3IBWA 3PW7A 1FHTA 2XMWA 3MEGA 3NBPA 5DM6Q 1N88A 3BSCA 1QAYA 4ETXA 3RAQA 2ZH4A 2ASDA 3KK2A 2V4RA 3HHLA 2WB1D 1MNEA 4USIA 3SCKE 2FHOB 5EWGA 3P49B 5K14A 4FNIA 1UL3A 3C8YA 3FZBA 2XGPA 4V19X 2EG1A 4ECWA 4C8ZA 4PR6A 1J5OA 5HROA 1AXQA 1NK4A 2HIQA 3OL8A 5FDLB 1ELOA 1VQMS 2WONB 2U1AA 4NYOA 4X62F 1UETA 4Y3CA 4GMKA 2Y1IA 4Y28C 2R7SA 5J2PB 2KKHA 1BD6A 1KHVA 1TKZA 2P9GA 5J1NA 5M2RA 3PACA 4YR3A 3RB0A 2G4BA 2AJQA 2E5IA 1VRTA 1KS2A 5DO2A 2XY7A 3VCDA 3GIIA 2C2DA 2LQJA 2GMHA 2R4FA 3ICLA 5LXYA 1CEZA 4LFBF 1RWUA 1URRA 2PMHA 2XMUA 4K5SA 2ZH8A 3LANA 4C0BA 5T7LB 2ZKTA 1UJ4A 3G8QA 3KLHA 2V94A 2MMYA 4KGMA 3PXGa 2IRYA 5IZHA 3DRYA 1LW2B 2HHHF 2J6UA 3ONQA 1WWHA 4DL6A 3ISND 3V4MA 5KG7A 1DFDA 4DR6F 1JLCB 1GXTA 2VKZG 4A48A 3KLGA 3Q8PB 2HLUA 3SMZA 5BYRA 2KB2A 5L1IA 4B3SF 1UVMA 1RQ0A 5B7WA 5HMZA 4PG4A 1WTBA 4C8YA 1FKPA 3CMES 3I0SA 1I94F 2FLNA 2FJAB 3NL0A 3R5CA 2FHJD 3UWTA 3SSSA 1TZ0A 2MPUA 2HQIA 1NNDA 2HNZB 2IA0A 2NUUG 3LP1A 1SJQA 3HKWA 3NG8A 4C3MA 4WZQA 2HS3A 3KHLA 4FF2A 1NHUA 2QLWA 3JAMY 1HQUA 2JLFA 2ZBIA 1PILA 3NS6A 3ZZOA 1TL3A 2KT3A 1U1KA 5E41A 4HHJA 1SJ1A 2RQKA 2G1DA 1P9QC 4A8KA 1OQ6A