4KVCH

2h2 fab fragment of immature dengue virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
220
Chain Sequence
b'DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARWGNYPHYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCDGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig heavy chain V region MOPC 21, Igh protein
publication title Obstruction of Dengue Virus Maturation by Fab Fragments of the 2H2 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcH01
4RGOL 5DFTA 2VLME 3C8KA 5C3TA 4WO4D 5F7EL 4TUKL 5D7LE 3I6KA 2IPKB 2MMXA 3QCVL 5FUOH 1TZIB 2PYEA 2X1WL 4QF1B 2Y4SA 4YHOL 3ULUL 1TQBB 1F3RB 4DVRL 3I9GL 4HZLB 4G8EB 1AHWC 3UTOA 2J12B 4WFHE 3AS3A 1EAPA 4KMTH 3JWOC 4U6XA 1FVEA 4YNYA 5EZOH 2EDYA 1PEWA 1RZJL 4NT6B 3U7YL 4PTTA 4X5XA 4O02H 1IEAB 3TN0A 2Y1VA 5A3IC 1CICD 5DEFB 1MWAA 4X7SH 1HH9A 1REIA 1JWMB 5L7XL 2IH1A 1T03H 5I19H 1KGCD 5JW4N 4MYWB 5DC9B 1UYWH 2GJ6B 5F1NB 1M6OA 5DQ9A 3T0EB 1U8HA 3QWOA 1K8DB 1KEGL 5HHQB 5KSAA 3U0TA 1CLOH 2EDNA 1I85A 5TPWH 1WZ1H 1JNLH 1RVFH 5CINL 1NANI 1YJDL 1AE6H 3OBAA 2CGRL 2P49B 4OLUH 3MV8E 5FO7B 5DVOA 3SGDH 3O8XC 1P6AB 1SY6H 2FGWH 4U1SA 3FB8A 4YZFF 3MACH 1A7NL 1UH3A 2AXHA 4TPRL 5IMLA 2Z93B 4IBLT 1VGKB 3OJ2C 1I7TA 3O3EB 4K8RH 3LEVL 1RZ7H 3D2UA 1I9JH 2A6KB 4U1LA 2MFNA 3E8UL 4GMSH 4G80A 5IEKA 4LSUL 4PJFA 5E6IB 2K7PA 3QDGB 2HKFH 1AXSA 4XC3H 3LKNA 1UJ3B 1TTGA 1XFPA 3QNZA 3K80A 3DXAA 2X4RA 3VI3F 1J1PH 5CJXA 3WFCH 3TM6A 1WWWX 4PV9A 1TCMA 4PY7A 3EYUL 3UO1H 1F4XL 3HMWL 1CE1H 2A0LD 3BQUC 5C7XH 3S3SA 1N2RA 4PJIB 4PGBB 4KTYA 4U1IB 1Q9KB 2RCSL 5BRZB 4M93C 5CWSA 3TIDA 2CR6A 5LGHH 2HTLC 4XXDB 4YQXL 4LRIC 5F3HB 3SKMA 5L2KB 5IV2B 1EMTH 1QFWM 3AXLA 3BRGC 1T5WB 4OLXL 5JHDD 4KZDH 2F54E 3RWGA 3KJ6H 3C8KB 4AIZB 5TQ0L 3TGXA 5F1IA 3ZT7A 1C8PA 3V5KA 4LRNL 5CLTA 3I6KB 4JM2D 1RUAL 3B83A 1S7VA 3JV4A 2HWZH 5GS2D 1JGVL 2PYEB 1HXMA 4N8PA 4OV5A 3QDAA 1UQSA 2J88L 4OQTA 5M94B 3SE3A 1EAPB 5CLWA 3EAKA 2CKBA 2YWZA 4PB9L 5E4EB 1R3IH 4U6XB 4YNYB 1GH7A 5JIKA 2CD0A 1U93A 1JVKA 4HUWA 4LCCA 4LCYA 3L6FA 4AEHL 4PTTB 4X5XB 5AAMA 5T33H 3TN0B 2OMNA 5KZCD 4IOSD 3U36A 1MWAB 1HH9B 5D2LA 3N85H 3M07A 4OCNC 2IH1B 4PRIA 5D5MF 3BAEL 1NGPH 3PDOA 5FV1L 1BP3B 4QOKD 3PXHA 4M43H 1M6OB 5DQ9B 1SMAA 2ZG3A 3QWOB 4LVEA 4RFNC 2YK1H 1OM3L 2Z91A 3ZDZF 2GQHA 1JHTA 1JN6A 5FGBC 3BGAA 4PTUA 3U0TB 5KSAB 3F58L 4MXQD 2DQUH 3TWCH 3RTQB 4P23C 3QHFH 3INUL 1A6TA 4HAGA 3SDXF 2DTMH 3E2HB 4GRWE 4LVHC 4U1SB 3FB8B 3VFOA 4XVSH 2DM7A 5IMLB 3DX7A 1CFNA 5F44A 5AYUL 5HPOA 12E8H 4JRYA 1I7TB 5JW4R 4U1HB 1I8MA 3D2UB 4U1LB 5FYJL 1C7SA 4ODUA 4G80B 2F8XC 4PJFB 1KEML 3FO2A 1AXSB 2FRGP 1NCDH 3T1FB 4AH2B 2G9HA 3LKNB 3T0XA 4YHMH 1IGYA 3QCTL 3DETD 4JZOB 3G6JF 2VXVL 3QNZB 2X4RB 4WCYH 4IIQC 1DQML 1ZS8A 1MCLA 4WTZA 1KYOK 4LLMA 3BJLA 1N8ZA 4PV9B 5JR1L 4BUHA 3RVXC 3TO4C 4PY7B 4F37K 4I13B 1E4XH 2XRAH 1N2RB 3P2TA 2JB5L 1UCBL 5CWSB 5DRXA 3TIDB 3D85D 4B5EA 5I1EL 2GJJA 4LGSB 2H2SC 3SKMB 5LGJB 5DMIL 4IRSA 5GJSL 2QQQA 2WK2A 3KPRA 1M1SA 3AXLB 1A22B 1V7NL 3HRPA 1J9CT 5EOQH 3TO2A 5F97E 3RWGB 1CLYH 5HYEA 3BPLB 5HI3D 4KKBC 5F1IB 3V5KB 3MSPA 4ONFH 1S7VB 1ORSA 1NFDE 3JV4B 2HN7A 1HXMB 4WVRA 3QUZD 1FIGL 1HWHB 4OV5B 3QEGL 5TQ2L 3GKWH 4XAWL 3PXJA 2E8ZA 4PJXE 2CKBB 3H9HA 2VDOH 1IZJA 4KK5D 4WEUD 4YFLI 1U93B 5E24E 4LCCB 4HUWB 4LCYB 5JOPD 1TCRA 3L6FB 1MIEL 4LHUG 1VSCA 1L6XA 4M3JA 3U36B 4U1GC 5D2LB 5D2NE 5DO2C 5B4MD 3WD5H 1P2CB 1TFHA 4PRIB 3VMNA 5IWLC 5IQ7H 1DFBL 3IFNH 4L8DA 2XN9E 1G84A 3RWCA 1D5IH 2NX5E 3ARZA 1FRGL 4K3EL 5J8OA 4YHNB 1K9TA 5ELIA 2Z91B 2Y06H 3GIVA 2NY6B 4DN4H 4XBGA 1JHTB 1JN6B 4WHYH 1QSFD 1CVRA 5DVKA 1D7FA 4MDIA 1A6TB 1JZ3A 4GW5A 2I9TA 4FQLH 3G6AA 3DX7B 1Q0XL 1CFNB 4UIMA 5TE6H 1I8MB 4KQ4H 1ZOXA 1MWAH 3DX9A 1CICC 1N6QH 3FO2B 4LMQE 4U1JA 2DTSA 2G9HB 4OFPA 1AGFA 1IGYB 3QBTB 3QO0A 2ZPKL 1ZS8B 4I2XA 2L7UA 3SKNA 4M6MH 4LLMB 4Z76A 1FE8H 4WV1C 3VGBA 5GRJH 2P5WD 5KOMC 5D96B 2DBLH 4KK9D 2K1MA 5E2VL 3MLSH 2Z92A 4CDHA 4G43B 4OZHF 1DUYA 1PZ5A 2AK4E 4K3JL 4IRSB 1J0YA 3L5WA 3KPRB 2ZSVA 1L7TL 4NOBA 2KQNA 1FCCA 3OG4B 3TO2B 1F8TH 2YZ8A 4GBXA 4Z7NF 1QTYT 3L3JB 4OJFL 1C16A 1MCCA 1KC5L 3KYOA 1ORSB 2DQIL 4H1LG 2HN7B 4GFTB 3EOBB 1RUMH 1A6UH 3DURB 2MNUA 3MLUH 4JGUA 4C4KO 1QACA 4OCSL 4NQEA 5EDXA 3Q5YA 4JZJA 4JFZH 3MNWA 3VG0L 3MCG1 2DWEA 4YC2C 4LLDA 3ZDXE 4YBLB 5E2WH 2XQBH 3K74B 1TCRB 3RU8H 2EDWA 3HPJB 1ZLUH 1I8IA 5D7SH 4N0UA 2R29L 5F96L 4PY8J 2NYYD 3O2WL 4WUUA 1JFQH 5K59E 1NGQL 2R2BA 3IRPX 4L8DB 1U58A 2UZIH 4QCIA 3EOYG 2CH8A 4JM2C 4PLNC 4WW2A 3VFGL 3BHBA 2AXGA 3LDBC 4QT5A 4M7ZC 4OQTH 3C5JA 4K3HA 5C6TL 3QA3A 4MDIB 2DIJA 1JWSA 3ZTJG 4GW5B 5EORH 1OAQH 4F2MA 1ERNA 1YDPB 2I9TB 4GO6B 3G6AB 4HV8A 5IBTH 3ZSSA 3QQ4A 4UIMB 3TV3L 4R2GB 3DX9B 1UM5H 2EICA 4P46A 4U1JB 2DIBA 1WBZA 3NA4A 1YEHH 3FFDB 5FHAL 1AGFB 5C09E 4I5BA 3QO0B 1KJMA 4QXUL 5CEZD 2QQNL 4I2XB 5F6IC 4LVOC 5F1KC 2DYPD 3JBG7 3OB0H 3SKNB 4Z76B 2F9BT 6FABL 4HD9A 2ZUXA 3FMGH 3SDAD 3FQWA 4NQDE 2DLGA 2J6EA 5FGSA 4DGIL 2AJYH 4QRTA 4YHZL 2Z92B 3QPXH 4JKWA 1TPXB 2AQ3A 2X4UA 1AD0A 1V7MH 2OL3H 1DUYB 3FO1A 1PZ5B 2XZAH 3BE1L 2JJSC 3RWHA 5D6CA 5LXGH 4J3WA 1WVZA 4FFWC 3L5WB 2ZUQB 5FAAA 5C0RL 5EPMB 1AGEA 2BHYA 2ZSVB 3WO4C 4MS8D 5DVMA 3DGGA 4AENA 4M5ZH 3CFBA 5HI5C 4GBXB 2J8HA 3AREC 4M7JL 5C0BD 3DI2B 3NVQA 3O2VH 1C16B 5TE4L 2YEZA 3KLDA 4N90D 3KYOB 1ZHKA 3GSOA 1FYTA 3DETC 1LWRA 2OP4H 2IBZY 2DJUA 1G9MH 4AEIH 5FGRA 2D0HA 4NQEB 5C0AA 4JFDE 2Y7QA 4JZJB 3MNWB 5F7YC 1U91B 5JQ6L 1VGEL 4S1RL 4HBCH 2DWEB 4LLDB 3O6FC 3EYVA 5IFHH 1FO0L 3SDYL 4NRZB 3CAFA 1BZ9A 4TOYL 5IHLB 1I8IB 3CC5A 1XIWC 4N0UB 4JHZA 3TH2T 3IDXL 1XT5A 3BO8A 2OK0H 4RWYL 1MVFA 4WUUB 4NM4H 3QNXB 2R2BB 2R1YA 1U58B 5IT2L 4K55A 5J3HD 1NKRA 4PJ7F 5EA0L 1B2WH 4QCIB 1VEOA 2HKHH 4ZAKA 4N8CL 4NN6C 4WW2B 1TJGH 4UTBH 3QEQE 5BZDA 1TTFA 3BHBB 4JQVA 2AXGB 2GUOB 4QT5B 2XV6B 5AUMA 5LQBL 3QA3B 3LRGA 4ODVL 3RZCD 1JWSB 2O5YL 5SWSB 4F2MB 4IMLA 2MWCA 3ARQA 4JJHA 1MFDH 4HV8B 3DJ9A 4B53A 3QQ4B 4JFFD 5D1ZD 3VRIA 1XR8A 1EUTA 1CZ8H 1U8OB 3S35L 4O5LL 5JHLH 1P7HL 5TDOA 4XPBH 1I3GL 4P46B 1WBZB 4KI1A 4PG2A 4Y19A 2PW1A 5IGXH 2WAHA 1ZHNA 4GG6A 4I5BB 4H20L 1KJMB 4YHYB 1I8LC 2X70B 4LPYA 4KDVA 2AS5M 3L7EA 3HI6L 3RKPA 1TVDA 4H26A 5FHBL 3SE4C 3MYJA 4IS6A 4FFVC 4GRLD 5EOTA 4QRPD 3N0PB 1H0DB 3WLBA 1J0KA 4QRTB 1SEQL 3SBWA 2X4UB 4P2QB 3LKRA 3CFIC 1AD0B 5FDYA 3FO1B 4H25A 4KK6C 4F58L 5ID1B 3RWHB 4U6HA 5I1HL 4QHKJ 2IAMD 3D3VB 4L1DA 1YEKL 3RNKA 1A4KA 1MJ8H 2XZQL 3WDIA 1AGEB 2X5PA 1G7HA 3DGGB 4AENB 3QUXD 3CFBB 1A1NB 2A83A 5F3BA 1NUNB 3WIIH 3P77A 2YEZB 4EI5A 2R0WH 1ZHKB 2UWEF 5IM7A 3GSOB 1N6UA 1FYTB 1X5YA 3LEYL 4QHMA 3UDWA 2F8VA 3RY5A 5C0AB 2Y7QB 3NCYS 5IW6A 4I3SH 2NNAA 5IROC 1L4IA 1QRNA 2FO4A 1J1XL 3I2CL 4XP5H 4XC1L 2OS7A 4UUJA 3V52L 5HJ3B 3LRSA 4JG0L 4OLYL 4K9EC 3EYVB 3H9SE 4KDTC 1LO3L 3M8OH 2XXMB 4NBYB 4HULB 4L9DA 2OZ4A 1GOFA 2WLYA 3CC5B 4OD3H 3EFFA 4JFPA 5GRUL 5EN2A 3FFCA 5IJKC 4LLUA 1SM3H 2KZWA 4BZYA 3N06B 1RV6X 5C0ND 4W4OA 2R1YB 1RZFL 2ED8A 3NFSL 5F7LB 3ULUF 5MHSE 4ZAKB 4EN3C 1R3HA 2W65A 5BZDB 3DMMA 3HMXL 5AUMB 3HNTL 4ORZC 5D5MA 1IFHL 5E08H 3HAEA 4ONHA 3S3PA 2OTPA 3WS6C 5F7KC 3VA6A 4IMLB 5GGTL 2R8SH 3I84A 3UEZA 4XPTL 2CIKA 1AXTL 3ARGB 3THML 3R8BB 1YEJL 3D6GA 4XNXH 1BAFL 5F71A 4WNQB 3VRIB 4P2OA 1XR8B 4YWGL 2VN4A 4DKEH 1ND0A 2WQRA 5TDOB 5CCKH 1F3JA 4JG1H 2C4FT 2XPGA 3NFPA 2A6DA 2PW1B 1A9EA 4RGNC 4ZNEA 3R0NA 1ZHNB 5F7HA 4GG6B 4PRHA 5E7FA 4PJGE 2VO5A 4I4WA 4TTDC 1JPSH 2W60B 4KI5C 1S9KC 2X05A 3QFJE 2AJUL 1ZANL 4OFIA 4H26B 4X6DA 3CVHA 3MYJB 4CU7A 4IS6B 4GXUN 5EOTB 4YAQB 5C07E 1KV3A 3MJ6A 3WLBB 1ZEAL 1CBVL 1T22A 3EIFA 4LU5L 5JLZB 4ODWA 1EXUA 4H25B 4U6HB 5T3ZL 2QKIA 1BJ8A 3RNKB 1YN6A 1G7HB 2FIKB 4PJCF 4G3YL 3KS0H 5C0CA 1YQVL 3C8HA 4MXVF 2A83B 5F3BB 4DGYH 1NAKL 1NDMA 3P77B 3RHWF 4DOHE 5IM7B 2QSVA 1XF3A 1CXEA 3S5LA 4UINH 1NCUA 4QHMB 4UU9A 5IK3A 5FKPA 5IW6B 2J6EH 2NNAB 3SDAC 3HE7D 5T1KD 1QRNB 2FO4B 4HEME 4JHAH 2NY1C 2C3VA 4UUJB 2VZUA 4LNRA 1QBML 3LRSB 1J1OH 3I50H 4XHQA 3U48A 5JMRA 3ULVH 1OGAA 3IU4L 1MCWW 2VXQL 2NY0B 2CUMA 1UM6L 3BPNB 4I9WD 4Z77A 1A6WL 1BEYH 3P0GB 4U2YA 1FV1A 1QLFB 3EFFB 4JFPB 1PG7W 5EN2B 3FFCB 4LLUB 5H37H 5MERA 3O4OB 4LASL 1ZKAA 1TENA 2DQFA 3W9DA 2H6PB 4HJJH 1IGFH 4BM7A 4ALAH 4U1MA 4FQJH 4IOFC 2W65B 4HIXL 1H8SA 1OAKH 5HD8C 1A7QL 5D5MB 1W72A 3HE6D 4F15C 4YDVA 3FN0H 3HAEB 4ONHB 3VD5A 3H2WA 1H3VA 4F7MB 3AB0C 1T80A 2EDRA 4N5ED 5J1SC 2CIKB 2CXGA 3VFVA 4X9GA 4NQSA 5K9OA 4OCRL 2C3XA 4M00A 3MGAA 4P2OB 3L5JA 3QRFM 2IANA 4NDMA 1ND0B 4XMLL 3IF1B 1KGCE 1F3JB 4P4RA 2XPGB 3NFPB 2A6DB 4EDXA 3BZDA 3PV7A 1WBYA 3WXVH 4PRHB 1CN4A 3TEUA 4I4WB 5ICYB 5K9QG 5CUSH 2WP3T 4QWWC 1EZVY 2YKLH 4J3XA 2YN5A 4ZSOE 3MPCA 3PIQA 4X6DB 4S2SA 3CVHB 3BN9D 1OQXA 4KUCF 3V6FA 1NEZG 1EBAA 4JJ5A 3MRFA 4FQHB 4OZGA 4U0RC 4UNTA 1T22B 1WIOA 3F7RA 5DJ2A 4KZEH 1MLCA 5BV7B 3G6JB 4CNIB 4ODWB 4PREA 5CAYB 1EXUB 2F74A 4NRXA 3QDMD 2QKIB 2E6QA 3CIQA 1OWRM 1AH1A 4R7DA 3HUJF 1AQKH 4TSAL 1J7VR 5C0CB 2ITCA 1BGXL 2BNQA 2D7OA 1NDMB 2W9EH 3KXFA 4ZUUA 1P4BH 5F9AC 7FABH 1HSAA 1EDQA 4AEEA 1XF3B 3C5ZC 3S5LB 4LCWD 4PJ8A 4UU9B 1N64H 4XPGL 4LIQH 2BXZA 3PL6C 5JXAL 2AK1H 5IK3B 5C0EA 2ARWA 5FKPB 1A0QL 1JHLL 3L3GA 5ITFA 4NUGH 5EULV 2C3VB 3WSQH 1ES0A 3ILQD 4Q6IC 3MUGB 1QHPA 2BSRA 5JW3L 4Q0XH 5GHWL 1OGAB 3VFSA 2IAMC 1X7QA 2C3HA 3EYSL 4Z77B 1FV1B 4XCFL 3VXPA 3QHZH 5MERB 3LD8C 3MRLA 4QO1A 2DQFB 3W9DB 4NZJA 4OGXH 1UWEH 4LGRB 4TSBL 5J0BA 2JCCF 3DSNA 1BX2A 3DGCR 3LS5H 5EC1A 5KANG 4YHLL 2XWJA 5EUOE 4Y5XC 1W72B 4QXGH 2PCPB 5I8CA 4YDVB 4QXWA 1T21A 2FDBP 3I3EA 3KPSA 2FCBA 1AGDA 3CX2A 5FCUH 1FORL 2QSQA 1W0WA 3VFVB 1S7RB 1EGJL 4NQSB 4UT9H 5K9OB 1CL7I 1B88A 3QCUH 1OSPL 3RX7A 4X9HA 4E41D 2IANB 4NDMB 5CZKA 3LQAH 4JPVH 2D2OA 4P4RB 4QOKE 5C0NC 4EDXB 4Y4HB 1WBYB 1CDIA 3JWOL 4Z7VE 2YRLA 4UILL 1H9VA 2OLDA 2HP4A 4H8WH 2GY7B 1A1MA 3ORJA 4XPAH 3PIQB 2PYFA 3S97C 4S2SB 3V6FB 3KYKH 4JJ5B 3MRFB 4OZGB 4PJBE 2E27H 1KYOJ 3ZHDA 3HAEH 1RIHL 5FV2A 2BVEA 4BQ6A 5DJ2B 1RK0A 2VDRL 1MLCB 2BVOA 4LPUA 4PREB 5IB3A 4NRXB 1NKOA 2G5RA 2GKIA 3D9AL 3ZKNC 4R7DB 3E6HA 4OGAD 2IGFL 3BESR 3VXRA 5JXEA 3AS1A 2ITCB 2BNQB 4FQXC 4PB0L 1TJHH 3UPRA 1FG2A 4HUUA 3KXFB 4ZUUB 3FO0L 4EBQH 5E99L 1HSAB 3B2UC 5DI8A 3SEPA 3G9AB 4PJ8B 1HSBA 4J2XA 3CVHH 4IRJD 5L6YL 3KS0J 1UEYA 3UTPD 3MJ9L 4YFEA 3VWKD 5C0EB 4YIQA 3N1PC 3GNML 3W2DH 1CK0H 1MCBA 4GSDH 3WFBL 3L3GB 5ITFB 3OPZH 3AY4C 4HBQA 2ED7A 3MOAH 3PHOA 3TT1H 1X5ZA 5BV7H 4Z7WF 1ES0B 2NW3A 4V1DA 4K94H 2BSRB 4QGYA 1LK2A 3VFSB 5F8RC 1X7QB 2YPKA 5J12B 3NIGE 1KELL 1UEMA 5JZ7C 2A74A 3VXPB 5KSVA 5SV3A 3QNYA 1MI5A 4JDTL 2VZ1A 5DZOA 3A6CH 3P11H 5JDSA 4FG6D 1MAJA 1RULL 2FX7L 4M8QA 1BX2B 2H41A 5D1QD 3UTTD 2B1AL 2E7BA 3QUYA 5EC1B 3MREB 2AJSL 4P9ML 1DBAH 5CIPH 3TBSA 4R4BA 2FX9L 2I24N 5I8CB 1LO2L 1EERB 1T21B 3WKMH 1UB6B 4PJ7A 1AGBA 4AYFA 1T6VN 3KPSB 2FLRT 2JIXD 1AGDB 2NY4D 4RDQF 1XCTA 4P3CL 3SO3B 1JYWA 2E7LC 1W0WB 1DVFC 1ZMYA 2VE6A 4DZBA 4D0CA 5J1TC 3SJVA 2KL6A 2AI0H 2VXTH 1OL0A 3ZE0E 3P0YH 3T04D 2KZ1B 3LKQA 5DD1L 5MEND 1D5BA 1A1MB 3OV6A 1OTTD 1CFVL 1A47A 3QRGH 2PYFB 3SQBA 1QSFE 3O3BA 3RVVC 2ZCHH 4EDWL 3VFTA 3FZUC 2EZ0D 1W72H 5E4IA 1KJ2H 4QRUA 1GZPA 2VDLL 3HE6C 3NPSC 2IPUK 3RX8A 2BVOB 5IB3B 3SKJH 3HC3L 2IFFH 2O61A 4LHJB 3DI3B 2ADJA 4J1UA 1A6VH 3Q5TA 3E6HB 3RVWD 1GGIH 2A9MH 5F9JA 1NUGA 2B2XL 3VXRB 3JXAA 1VEMA 4MQSB 1L7IL 1FYHB 3QIWA 1MCFA 4UBDC 1QYGL 4WFGD 2BC4A 1FG2B 4C56A 3UPRB 1RZKC 1B4RA 2QADC 4HUUB 5L0QB 5F72S 1N5YH 1H3PH 2Q6WB 3SY0A 2R0ZH 4M1GL 2Z4QB 5DI8B 2ZCKH 2K7QA 1MCJA 1KSRA 1G7QB 1HSBB 1EO5A 3OF6A 5EWIL 3S34H 1URLA 3IDYC 2P5WE 4K3DH 4YIQB 1X5LA 3BZ4A 2V7NA 4JFQA 3EJZD 1NC4A 1XF5A 5EU3A 4KC3B 4XBEL 4HLJA 2CUIA 3RAJH 4JFYA 1KCVL 2AAVA 3PHOB 4W70A 4IDJH 2DD8L 3UTQA 2NW3B 4LHQB 4V1DB 2V9TA 1YPZA 1F4HA 4M8VA 2EYSA 2BJML 3V5HB 1LK2B 1OW0A 4MAYA 1QLEH 5C9KA 5BS0D 2LAGB 5ESAA 5J06A 4KQ3L 2PF6A 1F90L 2A74B 1MJUL 5KSBE 2X7LA 3S88L 5KSVB 1Q94B 3QNYB 4PJEA 2H2PC 1PQZA 3E6FA 2YXFA 1F58H 1KACB 2VXUH 1IC4H 4M8QB 5I8KL 4OLVL 3QUYB 1VA9A 5DJ8A 5DRWA 3T0ED 1WWAX 3QXDA 2F53A 1BECA 5CJOL 3TBSB 1T2QH 3C60B 2LTQC 4NQUA 4R4BB 5CZXD 5ERWA 3LZFH 2CMRL 4PJ7B 2Z8VC 4FQIH 1UWGH 4PGZA 5GSVA 4JQIL 3OKMA 4RX4D 2DQGH 5DMYA 1AR2A 2DMBA 1XCTB 4NO3A 3SGKA 5DWUL 4XP4L 1WEJH 2VE6B 4DZBB 4Z0XA 1NCAH 4IMKC 2YD7A 4D0CB 4G9FA 4KAQL 1BQLL 4RGNE 2GIYA 3C87A 3SJVB 4KI5E 3ESVF 3LKQB 2CDGA 4M7LL 1G0DA 2IF7A 3E3QC 1QSVA 4ZDHA 1D5BB 1DN0A 3LV3A 3UC0H 2HVKA 3H3PL 4HKJA 3V0VA 3PABA 4F57L 3O3BB 3BDYH 4Q9QH 3U9UA 3VFTB 3D1MC 5JPMA 1N5AA 4YXLL 4ZS6C 4DTGH 3MLZL 1PFCA 2BVYA 4QRUB 2VLRD 2P45B 3DTXA 5BVPL 2Y36H 4HIEA 1DQDL 4Y4FA 3NGBC 5C0DB 3FHAA 2HYMA 1U42A 4NCC2 2ADJB 2P8PA 4J1UB 4O2CA 5F9JB 2OR8A 3VI4E 3V8OA 5TE7H 3FAWA 3QIWB 2HRPH 2BC4B 4C56B 3N9GL 4CN4A 3IAQA 4XMPH 5CEZE 1JGUL 4Y16D 1CXHA 4C54A 4DZ8A 3X3GH 3SY0B 3QDJD 5FDWB 2V5TA 3UTSE 2R4RH 4XGZA 1X9QA 3VWJD 1I7ZA 1R5VA 1NFKA 1AO7A 5TH2A 4OF6A 3BZ4B 3EOTH 2V7NB 4MNQA 4JFQB 1NC4B 1XF5B 3PGDA 4ODSH 4HQQL 5EU3B 3X3FH 4JFYB 4P4KC 2UWEB 2WUBH 2VLKD 3UTQB 4CRPA 4M1CD 1AI1L 3OAZH 5SX4H 4X99A 1YPZB 1JF1A 2EYSB 2OX5A 4BK5A 3CZJA 3EYOA 4WFFD 2O5XH 1P84J 1KIPA 2Z31B 5A43C 4OCLC 4NZRH 1BQHB 3ARYA 3MXWL 4PJEB 2YRPA 1QEWA 1Z0MA 3CH1A 4N90E 1PQZB 1GGBH 4UNVA 3E6FB 3GGWA 2JE8A 1RHFA 1UH4A 4Y4KA 5L2JA 4EVNA 1GVIA 2UVFA 4KGJA 2DQHL 5DRWB 1V3LA 3QXDB 2F53B 4HLZH 3U30B 4N0RA 2ZCLL 3EO9H 3GM0A 4OF7A 5GSVB 4JDVA 5KVGL 4LK4A 1MFEH 3GO1L 2ERJB 2X1OA 3DX6B 3MRHA 4NO3B 4TNWF 3C2AH 3LMJH 1ZT4A 3ARDA 4Z0XB 1G1CA 4G9FB 1NBVL 2EE3A 2V5MA 5D4QA 5HHVH 2EDLA 4K8RC 3QZWG 4RQQA 4NZTH 2EEDA 3TBWA 2CDGB 5KN5A 5ANMA 2FH6A 1GC1H 2VDPH 4ZDHB 3LV3B 4XPFH 4KK8D 2AEIT 2HVKB 4HKJB 3C09B 5DD6A 3DXAD 3ZYOA 5IESH 3PABB 1INDL 4I18C 3U9UB 5JPMB 1N5AB 1TETL 1Z0NA 4IEFB 2N4IA 1FH5L 1OCWL 4FZ8L 2VDQL 2ADIA 3DTXB 4ZFZA 4HIEB 1MEXL 1SEBA 4HWBL 4Y4FB 3RL2A 4HS6A 1NFDF 1YMHA 3U7AA 2P8PB 1IGMH 4JFFE 5JDJA 4O2CB 5J56B 3BMWA 1L9NA 4OUUA 2IBGA 1I7UA 3BYTA 3LN4A 2IG2H 3C6SA 1T83A 2WZPD 4CKVX 4LEXL 1DQLH 4PJXF 5CP3A 1AKJA 1YZZA 3F7QA 2DKMA 3QIUC 4S1SH 5ACZA 3MV9D 3WCYA 3RKDC 1MQKH 2EDKA 4HWNA 4FQ2H 4XGZB 3X12A 4PJCB 4HXAL 3CSGA 4F7TB 1DLFL 1RZ8B 1I7ZB 1R5VB 1AO7B 1PLGL 1UKSA 5TH2B 1OTTC 4QRPE 2GK0A 4WHCA 4MNQB 1OY3B 1WITA 1AJ7H 4KDWA 1WT5A 2I5YL 4N0YH 1J0JA 5CILL 1DBMH 2E9IA 4X99B 4ZD3H 1JF1B 4FHBD 1SJEA 3FQUA 3EYOB 5FGCB 3IFLH 4G6KL 2QHLA 2CIIA 5EZJA 4I1NB 5EZIH 1KIPB 1WAAE 5JUEL 4OCMC 5HHXL 1BFTA 1QR4A 4V2BA 5J89A 3OGCA 1QEWB 3CH1B 3T0DA 3L95A 1OGTA 3HNSL 4PRID 3GGWB 4PJ5D 4R4FL 2P7TA 3KAAA 3O0RH 4Y4KB 2YPLA 2VQTA 5L2JB 4EVNB 1O5DT 4POZD 2V5SA 5FYKH 1GGCH 1VPOL 4PLKD 2UV3A 2WWKT 4DGVH 4PJ9D 1TQBC 2X1QA 4ZODA 4TRPH 2YD3A 4JDVB 4LNVA 4WJ5A 4CMMA 5HGBA 3Q1SL 3VG9B 3NACL 2G60H 3SOBH 3U4BH 5B3JE 1FLRH 1S9XA 3IFPA 1ZT4B 4I8DA 1RJZA 3ARDB 3F5WA 3N50A 1IVLA 1J18A 3O4LA 4JRYD 4KHTL 3PJSA 4NM8H 2Y6SD 1X44A 4UB0H 1MIML 4RQQB 3DHJA 3TBWB 5E2TH 5KN5B 3SGEI 4FTVA 1Q9WA 4RGOH 1J8HD 5ANMB 4AG4L 3GSUB 3ZMRA 5D71H 5DD6B 3KLAA 5TF0A 2HJLB 2YOCA 4WU7A 3T0EC 1T66C 3LPFA 3WDHA 4MWFA 3ULUH 5CZXC 4C55A 2ADIB 4ZFZB 4DVRH 1SEBB 4LAQH 3RL2B 4HS6B 4NWUH 1YMHB 3EUUA 4JGJA 3CDGA 4NFDA 4UTAH 3QO1A 4OUUB 4Z78A 1I7UB 3PQYA 3LN4B 3IJYA 4X83A 4M1DH 5E00A 3C6SB 5EBLA 2BY0A 1RZJH 4E42A 3DRQB 1AKJB 4JAMA 4NUJA 3DRTA 3GSNL 3TBYA 1ZHLA 1CTOA 3PDGA 5ACZB 3ZDXF 1OP5K 5E6IC 1DBBL 1TVBA 4PPTA 3N1MC 2P5EA 5FM5M 1P7QA 5MI0C 5F7MC 2YD5A 1CDGA 4P59H 4Q2ZA 4G5ZL 4PRPE 5I30H 2GK0B 4FA8A 5GS1A 4L4VA 2E5EA 3TH3T 4XP6L 1KEGH 5K59F 2CKNA 2FEDD 5J9PA 1T2XA 1MCDA 15C8L 1YJDH 5DLML 1SJEB 3ILPA 3FQUB 2ORBH 3GRWA 1IEBB 2CIIB 3NFNA 5EZJB 5T1DL 4JRXA 5TJWK 1OTUD 2IBBA 2Q76A 4UQ3A 3UYRL 4UDTA 3OGCB 1X5JA 3L95B 5GGQL 5GZND 1OGTB 3CK0L 2YD9A 4PJHE 2R15A 3LEVH 5D9SB 1JJUA 3E8UH 2P7TB 2N7AA 2YPLB 1K3ZA 3C5SA 4LSUH 4NIKB 1A2YA 2BK8A 3BZEA 3HZVA 2EXYD 4NKMA 4R90L 3ARBA 3BP4A 4JFEA 4LLVA 1YQ2A 5JA9A 5HGBB 4WJ5B 4CMMB 4OLZL 1F4XH 3P4NA 5EOCH 2MHAA 1U3HD 4M1CC 2Y72A 2RCSH 2D7QA 1S9XB 3IFPB 1RJZB 1HXYA 3KYMA 4NJ9H 4OGYH 3F5WB 5CP7A 4YQXH 3BT2L 3O4LB 1DBKL 4X6BA 1HINH 3PJSB 1YMME 2YSSA 3TN0C 2C3WA 2BVTA 4LP4A 3ZKQD 5DD0L 4OLXH 4FTVB 1Q9WB 3SGJA 3VH8G 4K9EL 5IB1A 5TQ0H 3KLAB 5DHYA 5E2UL 3ZKXB 4KKCC 1RUAH 4WU7B 5FYJD 3ES6A 1X5IA 3B2VL 5GJTL 1JGVH 4MWFB 4NN5B 5KSAC 1I85C 1I3RA 3BD5A 2J88H 2N7BA 4WFEE 4QY8A 1IC5H 4LPXA 1E6JL 4EQ3A 4HX1A 5KVEH 3CDGB 1EO7A 3E2HC 4PB9H 1KFAL 3BPCA 3QO1B 4R8WH 3PQYB 3IJYB 3BWAA 5E00B 1OTSD 3PWPA 4E42B 3TFKC 3NN8B 5CSGA 4GH7B 4JAMB 4NUJB 3DRTB 1RUPL 1ZHLB 3W11C 3BGFB 4I0PD 8CGTA 4LOUD 3PWVB 3HZYA 1TVBB 4IRZL 4CW1A 4P5TB 1Q72L 3BAEH 2P5EB 1P7QB 4RMTA 4Q2ZB 4TNVF 4KK8C 5CJXC 3GBLA 3V6OA 5GS1B 2CQVA 1OM3H 5CBAB 2GK2A 5J9PB 5F9OL 3F58H 3QDME 1J0IA 1JRHL 1D5XA 3INUH 3ILPB 4OIAA 3NFNB 4JRXB 4UQ3B 1CE6A 3CVIH 3RGVA 4UDTB 4HKBA 3UMTA 3D87B 1RK1A 5AYUH 5CP3H 1BFVH 3SO5A 5CS7A 1FVCB 1QFUL 2WIIA 4ZXBA 2PTUA 4LCWE 3BPLC 3C5SB 5LAXB 1X5KA 1A2YB 1A3LL 3BZEB 1MY7A 3HZVB 3OWEA 4JO1L 3QCTH 2VXVH 1QFPA 4NKMB 1IAII 1DQMH 3MA9L 3VXSD 5F89A 5FK9A 2EYTB 3ARBB 2ADFL 5DUML 3BP4B 4JFEB 4LLVB 4J6RL 1XGYL 3SE3C 3P4NB 4HUVA 1A02N 2MHAB 4CADA 5DFVD 5J6HA 3QB7C 3I6LE 4MQTB 2W0KA 4AM0A 2JB5H 1UCBH 1HXYB 3KYMB 4LLQA 5I1EH 1I9IH 2X10A 5CP7B 1V05A 4LCCC 4Z8FL 3K4ZA 1IARB 1MFNA 1MY5A 4WW1A 5I1CL 2CLZA 1MELA 5DMIH 3R1GH 5GJSH 3BD4A 4APQA 1FZKA 2YSSB 2BP3A 1IAOA 1J87A 4HIJA 1UWXH 5T1LB 1V7NH 4LF3A 3V95A 5DHVH 4ZFFA 1LDPL 1XR9B 4EOWH 1FIEA 3QP3A 5DHYB 3ET9F 4LLYA 3ES6B 3ECBA 3SQOH 4PLKC 5DURD 5HVWA 2NY6C 3DUSA 1FIGH 4YGVA 1I3RB 4KXZI 4A6YL 2APFA 3WFDL 3QEGH 5TQ2H 4QY8B 5HGHA 3LN5A 4HX1B 1OQOA 2DQDL 3T2NH 3W9EA 1JK8A 3V4UH 3OMZA 3ZE2E 4OFKA 3HFML 4XMKL 1KN2H 4E41E 3RL1A 3NZHL 4ZTOL 3BWAB 1JF5A 3PWPB 1LD9A 1FNAA 4RAUA 3TA3A 5L9DL 1MIEH 2A77L 2Y6SC 4HPYH 3ZL4H 1WIUA 2VR4A 3BKJH 4HG4K 3HZYB 1NC2D 3QSKB 4CW1B 3X17A 1FYTD 1ZLSL 4R6UA 2ATPA 4ODTL 1CLCA 1FRGH 4K3EH 1Y6MR 5FKAA 1G9MC 1RIVH 1X5XA 4UIKL 4OFDA 4P5MA 3D5OF 5D96C 1D5XB 5HSFA 3DUUA 3RUGF 3L3DB 5ETUA 3VFRA 2VIRB 3RGVB 2LAAA 4HKBB 4IRSC 1PY9A 4UV7H 1RK1B 1Q0XH 5FIEA 4QRRA 1CFTA 1CQKA 2WIIB 4ZXBB 4FXKA 4OI8A 1K3IA 5LCVL 2DI7A 3E1F1 4RSVA 4JO2H 2ZPKH 1OP3K 2AABH 2IH3A 1FNHA 4ZO6A 5FK9B 3ZE1F 3S98A 1J0HA 4JY5L 1YY8B 5A2LH 4HUVB 2A9NL 4PJGF 4CADB 3GHEH 4E9LA 5J6HB 1SBBA 4POUB 5E2VH 4AM0B 6CGTA 1SYVA 3TJEL 3EGSA 2X4OA 4LLQB 4WHDA 4JANA 1ZT7A 4YBLC 4JVWA 2HAZA 3FN9A 1BZQK 1MCSA 4WW1B 1KXQE 2CLZB 4YH6A 4APQB 3AMKA 5M7QA 5MEPA 4LFHG 2H32A 1L7TH 4YDKH 1IAOB 2VAAA 4HIJB 5EOCJ 4ZFFB 4LF3B 3W5NA 4Y19D 1QQDA 3JTSA 4ELME 2YRZA 2D7TL 2V6HA 4K07A 2NZIA 3OKEA 3VDAA 4OJFH 2FB4H 1CGSL 1JHKL 1JV5B 4BZ1H 1JPGA 4LLYB 2DQIH 3ECBB 1ACYL 4DUWA 3O2DL 3N1GC 3VFMA 3DUSB 3FAXA 5K93A 5J57B 4LCUA 5I0DA 5I2IA 4OCSH 3T08A 3UPAA 5ESQA 1UT9A 4WFHD 5HGHB 1Z3GL 3LN5B 3W9EB 1JK8B 2OXHA 3VG0H 5K33A 2BHUA 5HYQB 3RL1B 5LWYH 4ELKA 1LD9B 4RAUB 2DF3A 3TA3B 4JZNA 1FDLL 4MX7A 3SCMA 4GAGL 3MLRL 4MJIE 1NBYA 4R2GC 1NFDA 4DAGL 1KNOA 3LCYA 2EDXA 3IETA 5F96H 4YFDB 3TZVD 5KW9L 4EI5D 1OAXH 3O2WH 1NGQH 3G5YB 1KCUL 2DQCL 5FKAB 3BIAX 1KUMA 1TMCB 2O93L 4U0QB 3VFGH 4B41A 2VZ3A 1U92A 1A9BA 5C0IA 4P5MB 2WMPA 3ZYJA 1PYWA 1IC1A 3CSBA 3MLXH 5F93C 5C6TH 3SDDA 3MV8D 5EO9A 3DUUB 3IDGA 1TPXC 2NZ9D 3P0VL 2J5LB 4GLRH 2ESVA 3VFRB 4UAOC 1MJ7H 1UFUA 2LV4A 3WFEH 5D2NA 4AJ0A 1BD2A 2ZUQC 4WFGE 3OR6A 4PUBH 4TUJB 4LQFH 4QRRB 2NX5A 1CFTB 1VCAA 4GBXC 3S35X 3QIBA 3MGTA 4FXKB 1KB5L 1G6RA 4HWEL 3GZKA 3A67H 5I15H 4QXUH 3DMMD 1N59A 5ILTL 2QQNH 2IH3B 4JHWH 35C8L 1RURL 4GRWB 1IT9L 1BOYA 4YDLB 4JZJC 4M9PA 3U4AA 4M5YL 1EVTC 1SYVB 3BDXA 3EGSB 2X4OB 5HVFB 4JANB 1DQQA 3BE1H 4GAJH 4BH8A 1ZWIA 5C0RH 1WUNT 5MEPB 3Q0HA 2DLHA 1CDHA 2VAAB 3RDTD 1DLHA 1QQDB 2GJ6E 5IFAH 4M3KB 4MHHI 5DTFA 5HYSA 3T0EE 3OKEB 3VXUD 1INEL 4M7JH 1PX4A 5CEYA 4OZFG 1JPGB 1OPGL 5LG1A 4WW2C 5DFWH 3VFMB 2QLVB 4HC1A 3ZTJH 4HFUL 4LCUB 5I2IB 2AXJA 4KRPD 4FQCL 5ESQB 3B5GA 2R4SH 4UT7H 1IE5A 2DN7A 3C6LD 3FO9A 4QEGA 5EIIA 4NGHL 3EJJX 3ROLA 2CLRA 5FM4A 5JQ6H 5DFVC 5EU6A 1VGEH 2LU3A 4S1RH 5EU7E 1N3NA 4PR5A 2EKSA 2XTJD 4YXKL 1E4JA 2PN5A 1NBZA 3PHSA 2H8PA 1FO0H 1QHOA 5DDHA 2Y5EA 4ELKB 1OP5H 5EC2A 1YEDA 3HG1A 4JZNB 4DQOL 4MX7B 4TOYH 3SCMB 2Y07L 5HY9A 2E6PA 2LVCA 1NBYB 1NFDB 4X6CE 3IDXH 3IETB 4EZMA 3TYFA 4P46C 4RWYH 2WM0A 4JR9H 5IT2H 5EA0H 4OB5L 2X09A 5SWQA 2VLRE 5DUBB 4ZTPL 4L4TA 2FBJL 4HXBL 4F7PA 1I9RL 1U92B 1A9BB 5C0IB 5BRZE 2DRUA 4JM2F 5LQBH 1PYWB 5CMAA 1JNNL 3SDDB 4ODVH 5EO9B 3IDGB 5I66A 2ESVB 5I1GL 2NXZB 1FG9C 2UZXB 2ARJA 2HH0L 2B7DT 4GXVL 5EUOF 4XP9H 5D2NB 1BD2B 5IG7A 3OR6B 1JZ4A 1X5AA 4XCNA 4KJWD 1OHQA 3DROA 2NX5B 3UJTL 4AL8H 4ZG1A 3QDJE 3QIBB 3MGTB 1P5VA 4JM4H 2PYEE 4PJAA 1MSPA 4Z95H 2RAMA 2V5YA 4W81A 3U83A 1N59B 3I75A 5T3XD 3RPIA 3QPQC 3NCBB 4K7PY 5FHBH 2FR4A 3S4SG 4K7PH 2VITA 3BKYL 4NC1E 4XNUL 1RZKL 1EO8L 4K23H 4KGLA 4WFFE 5CBEA 3TVMD 4OM0L 3WIHL 4Y5YA 5I1HH 4BH8B 1YEKH 1NCWL 1ZWIB 4PJBF 3LPGA 3NA9L 3U82B 1FP5A 3LEXA 3GBML 25C8H 5C09A 1DLHB 5F7FA 5DTFB 4BK4A 5HYSB 2NLJA 4OCXL 3K0WA 4ZAKC 1CD1A 4KJYA 4NQDA 1RD6A 1KBGH 2HRLA 4YK4B 4ERSL 3RQ3A 4JQVC 3LEYH 4GRWH 4JO3H 3NCJL 3FO9B 5TFSL 4MA8L 3ROLB 3DVGA 1J1XH 2CLRB 3I2CH 4BSJA 3JSSA 1N3NB 4PR5B 4XTRD 4JG0H 4OLYH 2EKSB 5C71A 1F2QA 1NBZB 2H8PB 2QQKH 5DDHB 4HK3N 1KJ3L 3T4AA 4DKFL 5EC2B 1VFUA 3HG1B 5ACMA 5C0FA 3WLWC 5DS8B 5HY9B 4PJFE 2AJVH 4WI7A 2YC1A 1HHJA 3TYFB 5T3ZD 3KXFD 1ZLWK 4PG2C 3DXAE 1RZFH 5H2BA 3MBEA 3NFSH 3NIGF 2GI7A 5SWQB 1UM4H 3C9NA 4GAYA 4I0CC 5DVLA 4QHNB 3WJJA 4F7PB 3B9DA 4FN0A 4K2UL 3HMXH 2AXFA 4RMSA 3U4EA 3EZJB 1EAJA 5CMAB 4D94A 3T3ME 1BQSA 5I66B 3SBWC 2ARJB 1ONQB 2VZTA 5GGTH 1ZVSA 4D9QE 4KUZL 3LPWA 4XPTH 1QFWL 1KPUA 4G7VH 4KY1L 5IG7B 2NTFA 4XCNB 4ZS7H 1VESA 3WL9A 3DROB 3WUZA 4JKMA 3BH8A 4AIOA 5ESVA 4YWGH 2DAVA 2XQYK 1V3KA 3QEQA 4J7RA 5CD3A 3O9WD 3ZSTA 3AMLA 4PJAB 4EI5C 1CT8A 3MRCA 1MHEA 1RFDH 2APTA 3I75B 3LIZH 3RPIB 3V7MA 3UDWC 5CHNA 3DO3A 2FR4B 1LK3L 2VITB 3F12A 5HPMA 3DV6A 3ZE0F 5B39A 5CBEB 1JMXA 5HYIA 4UMGA 1ZEAH 4RZCA 1NMAL 4LU5H 2NZ9C 4I77L 3RWDA 4Y5YB 2AK4D 1HQRA 5F7WC 2PTTA 3BPNC 2EO9A 2P46B 4WRLA 5E9DD 4PRIE 3LEXB 4PJ5E 5C09B 1E4WH 1ED3A 1IQDA 4NQCA 4G3YH 1YQVH 3LQAC 3QI9A 3O4OC 4W4OC 2NLJB 4KMTL 4R97B 2VSCA 3KYAA 2X89A 2PO6A 1UKTA 5FYKU 1CD1B 4KJYB 1UH2A 4H8WC 4NQDB 1S7WA 5EZOL 4JDZA 4MA7L 3RVTD 3K2UH 3DMMC 2D4FA 2DLEA 4Q9BA 1BIHA 4TVSa 3DVGB 4KJQC 1T03L 5I19L 4JRYE 1QBMH 3EZ8A 5DEGA 3VXRD 3R0MA 3T4AB 4S0SD 1YEGL 2PXYA 5C0FB 3SGDI 2ADGB 4CU8A 2P43B 2HFEA 1X6LA 4FXGA 1XF4A 3MO1A 4P2OC 1F6AA 1X4ZA 5TPWL 2YC1B 1HHJB 3TPUA 4OI9A 4OLUL 4LASH 4FXLA 2ZJSL 3MBEB 2FGWL 4O2FA 3C9NB 4GAYB 1HEZA 3MACL 4JB9H 4HJ0D 1S7QA 5KSBF 4NO0D 4HIXH 4LARL 3LRHA 2R0LL 5DD3L 1RU9L 3U4EB 1RZ7L 4P9HC 1A7QH 3H9SA 1UADC 3Q6GL 4L29A 3VW3H 5C2UB 5BV7C 3F6LA 5SX5K 4EEEA 4WI8A 4K94C 1GHFH 1ZVSB 3Q3GA 1KPUB 4G6FD 2NTFB 3WFCL 2BSED 5D72L 5JIPA 1MI5D 1IM9A 4OCRH 1NCBH 3UO1L 5ESVB 1CE1L 4QRQA 3QEQB 1OP3H 5CD3B 3LB6D 1CT8B 3NMEA 3MRCB 1MHEB 3OKNA 4KROB 5LGHL 1DEEA 1DSFL 1FFQA 2GYSA 5TGBA 5CHNB 1EMTL 3F12B 4AMKL 4KI5F 3DV6B 1UXSB 1XH3A 5B39B 3FQNA 5L8LB 2ZUUA 4HS8H 4RZCB 4YPJA 3V9FA 1F42A 1LO4L 3GJEA 2FH8A 1HQRB 2PTTB 4HCRA 5FUZL 2YXMA 1CDJA 4PY8I 1LP9A 1IQDB 1ED3B 4NQCB 4TSAH 2OMBA 5D70H 2VISB 1NH6A 2AQ1A 3QI9B 1BGXH 3EYQC 4S1QH 2PKDA 4Y2DA 2I27N 2PO6B 4X8XA 2AQ2A 3VI4F 2UY7A 1S7WB 4JDZB 1AIFA 3SE9L 1PZUB 3KPTA 2BNRA 4JKPH 4WWKA 1CI5A 2GTWA 4ZPVB 3DYPA 4XPGH 4H0GA 5T33L 2WIMA 3MA7A 1A0QH 1JHLH 3Q6FA 4P0DA 5F7UA 3H3KA 3N85L 5KBNC 4LBEA 5I1DA 4R4ND 3MGOA 4FZEL 2PTVA 1JI1A 1U95A 5DEGB 4M43L 3IDJA 5I8OL 1GRWA 1L9MA 4NZUL 2PXYB 3B3IA 2DLTA 2HFEB 4FXGB 3V0WH 1XF4B 3MO1B 5HVGB 3QR2A 1PG7L 2V2XB 4YR6A 4XCFH 3TWCL 4NRYA 5HGDB 3BIBX 2EH7L 3TPUB 4YE4L 5CEXA 3C08L 3VXTA 5FYJE 3MUY1 5IVXF 4TSBH 5LJYH 3OF6D 1S7QB 4JN1H 3OKLA 5HDLA 2P48B 1NC4D 1F3DH 1HIMH 3TBVA 3LHPH 1MCPL 3MRQA 3H9SB 4L29B 3BWUC 4MAYD 1HWGB 1VKXB 3VGGA 4YHML 3Q3GB 1E4XI 4RMRA 4XTRC 3S36X 4CVWA 2AJXH 4WO4A 4EIZC 4N1EA 2O26U 5HYFA 3KPPA 4KWUA 3WMSA 2CRYA 1E4XL 4QRQB 3L3IA 4BH7A 1H5BA 2E7CA 3JWOH 3OKNB 3Q5OA 1FAKT 1DEEB 3OSKA 3BQUD 3FKUS 2VJXA 2EECA 5TGBB 4PJ8C 43CAA 1YYLH 4U4BA 4L8SA 5IFJA 2HTLD 3FRUA 5DMKA 5EOQL 2AEQH 3FQNB 5CKGA 5GRVL 2D0FA 3L3KA 2VDRH 3GJEB 2MOVA 2NY2B 2QTEA 4ONFL 2FHCA 4BSVA 5I6XB 2Y23A 3D9AH 1YNKL 1LP9B 4LL9A 3V2AR 4IIQB 2V17L 3NAAL 4UZGA 3WNPA 2IGFH 2D31A 4XNYH 4PJGB 1N26A 1PKQE 2W1NA 5J1AA 5H35A 4PB0H 4PGEA 4ZSOA 1NLDL 4Y2DB 1CD0A 5GRZA 1MAMH 3FO0H 1RJLA 1CU4L 5C07B 2VDOL 3IVKA 2ICWA 1AIFB 4WWKB 4D3CL 2R1WA 2GTWB 4JPWL 1H8OA 5L6YH 3QULA 1ZA6A 3MA7B 3WFBH 2DM2A 3Q6FB 1MFAL 3MJGX 4LBEB 4QTHA 3MGOB 3F7VA 5E8DH 1U95B 3SO3C 2NXYB 4NJAL 2X44D 2RFXA 2QV2A 5I73B 1CF8H 5KVFH 3B3IB 2Y06L 5EH1A 4HUKB 1KELH 3VMPA 4YR6B 4YPGA 3MRPA 1N0XH 1KPVA 4JDTH 5CEXB 1XF2A 3P4LA 4GS7B 3VXTB 5C86A 1RULH 2FX7H 1NLBH 4QF1A 2L4OA 3Q2CA 3U7WL 2CPCA 4HG4J 3A6OA 1WAAF 3NCMA 4FQLL 3WDJA 1MRFL 2V9RA 1WIPA 3OKLB 2B1AH 4P23D 4MNQD 4O2EA 2AJSH 5TE6L 1B0GA 1MCIA 3MRQB 3TBVB 4KQ4L 1C5CL 2FX9H 1MWAL 1LO2H 3ZLQC 4O51A 4QHKI 2BRRH 4HWZA 5HHMB 5D6DA 2YMXH 5JHDA 3SE8L 4P3CH 3S36H 5GGSB 4WO4B 3KPNA 5E95B 4M6ML 5JXEC 2NR6D 3KPPB 1NSNH 5GRJL 3TCLB 5JO5A 2L0DA 3L5XH 1FYTE 1YC7A 3L3IB 4BH7B 5L0QC 1G0YR 5AAWA 1LEGA 4X7CC 5B3JF 4LSDA 2XYCA 5DD1H 3RVXD 3TO4D 1K8DA 2EDOA 3OJDA 1DZBA 3QFJD 43CAB 5KTEH 2XICA 3QQ9C 3O81A 3LH2H 4L8SB 1LDSA 4KJPC 5IFJB 5DMKB 2GTZA 2K9UA 2VDLH 5ISZA 2PW2A 1CICB 1H8NA 1NMCB 2ZG1A 4BSVB 5J6GA 3HC3H 1V3JA 2ZUSA 3K2MC 1DCLA 3WKNA 1RUML 3AU1A 5H8DA 2B1HL 1A6UL 4BKLA 1EH9A 4Z7VA 2D31B 4YBQC 4KKBD 4RRPA 2OYPA 5J1AB 4Y88A 2C3GA 2AGJL 5H35B 4PGEB 4ZSOB 5IBUB 1QYGH 1UJ3A 4DUVA 2OM5A 1RJLB 1MCHA 3P73A 1GC1C 3IVKB 2ICWB 1U2CA 4M1GH 3QUYC 2XQBL 4MVBD 2GAZA 2R1WB 2W38A 2C1PA 4OLEA 1HOCA 3RU8L 3CMGA 5D7IA 3QULB 4R26H 2AEWA 4PGBA 1FBIL 3B9AA 2EDTA 4XBEH 4QTHB 2V9QA 1JFQL 3K8LA 3F7VB 2DD8H 2UZIL 5L2KA 3B5HA 5L8JB 4J4PA 1CLZL 2RFXB 4HCRH 4HIIA 2VH5H 3MLPA 5DO2D 3HNVH 5LKNA 1YEEL 4Y19E 1YYML 3MJ7A 4KQ3H 4YPGB 4XBPA 3D0VA 1F90H 3VRJA 1MJUH 4AIZA 3MRPB 3S88H 1SMOA 1KPVB 1MCOL 4WTZG 1HYSC 3W5MA 1KENH 2CKBL 1XF2B 2FD6L 1FC1A 5LBSL 3IAPA 3GB7A 1EIBA 4XWOC 4PBWD 4O2EB 3WHXA 5CJOH 1B0GB 2WBKA 2EIDA 4PJHF 3CSYA 2O5ZH 1RJCA 4O51B 1N0LA 5I18L 2CMRH 1CIDA 4HWZB 4U6TA 1CDBA 4JQIH 5JHDB 1YEHL 2QL1A 4R4NC 2EE9A 1GIGL 1BF8A 2CJUH 3KPNB 5DWUH 4XP4H 1UB5A 4WI4A 1KCSL 4P2RD 4MA3A 3CUPA 3LDBB 3MV11 3QIWC 1BQLH 5JO5B 3QUZA 3KVQA 2QSCH 3VMOA 2Z35A 5IVOA 1LEGB 5EUOB 1K6QL 5FO8A 1IGCH 4OLWL 3NOIA 5I1KL 1MFCH 3FTGA 3OJDB 3G6DL 4S11A 1U3JA 3UJJL 1WJ3A 4LDOB 5FOJA 4CVZA 3H3PH 3RTQA 1QRNE 3JWDH 4F57H 4X4XA 4X80H 4M5ZL 3O3UN 4UQ2A 4YXLH 1U9KA 3MXVH 3MLZH 2GTZB 3DBXA 4XCYB 4HS3B 4ONGH 2Q1EA 5MEQA 1RZGA 2PW2B 5BVPH 5KZCB 5ISZB 2H1PL 1DQDH 1JZ6A 2YD8A 5J6GB 2X42A 1CR9L 1S3KL 2ZWLT 3EO0A 1OW0C 4MAYC 3FFCE 4LDEB 1TQCB 5I75C 4M6NH 4U1HA 3O4LD 3AU1B 5F6HJ 4QOKB 4BKLB 4LVOB 3CDYA 4Z7VB 4AEIL 3WNOA 4MAUL 2PR4H 4YHPB 3KJ4B 4OGZA 5DD5H 4MA1B 4AH2A 3VCLB 5FYLD 3T1FA 3PP4H 2MPAL 4FTVD 1QSFA 4JZOA 3N9GH 4RBPK 3P73B 3FB7A 1SJHA 1MPAL 2AV1A 1O7SA 2GAZB 2C1PB 1HOCB 2PETA 5D7IB 3QWQB 3U30C 2WINB 3WO4B 5MEOA 4TYUA 3WS3A 3MRJA 4HQQH 2J8UA 4TULH 1HKLL 5LGJA 3I3DA 2ERJC 2WBJA 5GZOC 1AI1H 1BWWA 5HBBA 4CAGA 3SGKC 1S7XA 4HIIB 2ZUYA 1MF2L 5I71C 2F15A 4MQXC 3MJ7B 4ZNEE 4XBPB 3D0VB 3L1OH 1RZJC 1UZ6E 3VRJB 4PRHE 3VXUE 1FGNL 3MXWH 1R3LA 1K5NA 2JELH 2LU7A 2P5WA 1IKFH 3RIFF 3GB7B 1QBAA 4NYLB 3GSVA 3C09C 2DQHH 3WHXB 4L4VD 5SX5H 3GI9H 5KS9A 4U6VL 2LFGA 3CSYB 1ORQA 3QXUA 1CZ8L 3GDBA 3RP1A 5JHLL 3NIFE 4N8VA 1KULA 4Y4FC 3TBTA 2XTJE 5KVGH 3VD9A 3T2OA 3GO1H 4PYGA 4EJ1C 4CVXB 4L3CA 4P57B 2B39A 5KSBA 4JRXD 4BQ8A 2XACC 3EW3B 1UB5B 1P2CA 4MA3B 3CUPB 1XMWA 1YNLH 2F19L 3QUZB 1FFOA 5GS0D 4XVUC 2IFGA 1A6ZA 1JBJA 2Z35B 1N6VA 4YHNA 5FO8B 3V4PH 5CGYD 2YN3A 2Q8AL 3FTGB 2ITDA 4X5WA 1VDGA 2Q86B 4CVZB 3KR3L 4X4XB 1INDH 1CS6A 1BJ1J 1X6NA 3REWA 4UQ2B 5JQHC 2ICEA 1FH5H 1KG0A 3DBXB 3G04A 4W6YB 2OL3A 4IJ3B 5MEQB 2VDQH 1RZGB 4FFWD 4LAJH 2X9YA 2R0WL 1WICA 2B20A 4BFGA 3DO7A 3EO0B 4U3CA 3BZFA 5HI5D 1NUDA 3ARED 5GS2H 4K71B 5I76A 2NR6C 3NCEB 3G08A 4HKXB 5M95B 4LEXH 1QSFB 3OKDA 3ZE2F 4WWID 4L3EA 1NGWA 2DMCA 5T3XE 3FB7B 1SJHB 4Y4KC 1KJVA 1F4YH 4RFOH 2AV1B 4QNPE 3NTCH 1DLFH 4C4KT 5MEOB 5EB9A 3WS3B 1SM3L 3MRJB 3O6FD 2COQA 4G43A 2J8UB 3ARUA 3MRIA 3VG9C 2ED9A 2WBJB 2VTFA 4LPVA 3BGMA 3TNNA 3LSOB 1XIWD 4WDIA 4OI7A 1S7XB 3VXMA 3WNNA 1AC0A 3ARDC 4G6KH 3K1KC 1I1AA 2R1XB 1FFNA 4Y2OA 3U0PA 5IW1A 3L3JA 2DYPA 4N0CC 5JUEH 5E08L 5HHXH 5DVNA 1R3LB 1K5NB 2DICA 5JOFA 4GKSA 4WENB 2P5WB 3EOBA 4OD1L 5I1JH 2QSTA 4R4FH 2R8SL 3DURA 4F3FA 3GSVB 4OZGE 3RWJA 1MH5A 5EZLA 4MVBC 4WIQA 4GKZA 3LS4L 1BMGA 5B8CA 5KS9B 5BW7A 1UCTA 3GHBH 1ORQB 2DQEL 4NKIL 5E5MA 2ZNWA 3H42H 4N8VB 1F4WL 3TPKA 3TBTB 4RAVA 2MQCA 2VABA 1YC8A 3S37L 4L3CB 3HPJA 5C0BA 3ZHKA 1AFVL 5KSBB 5H37G 2BNQE 3CGTA 1WC7A 2ZP0T 5K9JH 1B3JA 1UACH 1T83C 5T3ZE 1OAZL 3KXFE 4KHTH 4Z7UE 2FLBT 4XVJH 1C5BH 1FL3A 1FFOB 3H9ZA 1A6ZB 1MIMH 1S7SA 4G6JL 3DYMA 2ITDB 4FFVD 4AG4H 4X5WB 3OG6B 4F80A 2BVPA 3LKOB 2VC2L 3D25A 4OZIA 2VSDA 4S0TD 3IS0X 2MCPL 4DKAA 1JZ2A 4GQ9H 3REWB 2YPVH 2FX8L 4LSQH 1WT5C 4KK6D 2ICEB 4ELMF 1KG0B 4DJMA 2CK0H 3G04B 1A7OL 2OL3B 1YDPA 5DJCA 2X1XR 5MP6L 3DO7B 3DVNA 3ZKMC 1BVLA 4HKZA 1EHAA 3BZFB 4KHXH 4UINL 1A14L 4G9DA 5I76B 1QUNA 2F8OA 4FRWA 3CMOH 3G08B 3KHQA 2J6EL 3FFDA 3GMNA 3V7AG 3UBXA 2EXWD 3OKDB 3GSNH 4L3EB 1NGWB 1FGVH 4MB3A 1T1WA 1B90A 1DQJA 2BX5A 1NBQA 3RZCA 1KJVB 3I50L 5F9DC 3A0OA 3M45A 4FABH 4OF8A 4EIGB 2AJ3A 4NC2B 3CFCH 2WNGA 1BEYL 3KPSE 3OXSA 4G5ZH 3IXTA 4JKKA 5TF1L 4JFFA 4U2ZA 4XP6H 5D1ZA 2P8LA 3MRIB 3NPZB 1IGFL 3BGMB 3TNNB 5C92A 2PNDA 3ARSA 4FMKA 1JCKA 1YUHB 4OCWL 15C8H 4WDIB 4DW2L 5DLMH 3IKCB 5EPMA 5E9DE 3VXMB 2Q87A 1K2DA 1I1AB 2KPNA 1OAKL 1BFSA 5T1DH 4ZUVA 1FFNB 3TA3D 3U0PB 3M1BA 3UYRH 5A40E 5IW1B 5E6ZA 2DYPB 4EN3D 1MCKA 3QQ3B 1D5MA 5GGQH 5JOFB 4GKSB 4GRLA 3D18A 1HYRC 1OP9A 2EC8A 2XA8L 2HFTA 2QEJA 2VDKL 4F3FB 2XZZA 2QJDA 5ICZA 3RWJB 1MH5B 3ZKXC 5B38A 5EZLB 4GKZB 5B8CB 4YDJB 4E0RA 1T0PB 1U91A 4NN5C 5E8OA 5E5MB 4FFYL 4R90H 3QUXA 5C8JA 4G8GD 2VB5A 2EH8H 4HT1H 4RAVB 2VABB 4OLZH 2Q3AA 1MHCA 1D6VL 3VXRE 3WXVL 2ICWJ 1AC6A 4NRZA 1SBSL 5C0BB 4N9OB 2VZSA 2PUQT 1WC7B 2GT9A 4KVNH 1F4AA 3BT2H 4RGND 1DBKH 5ALBL 4QRRD 3QNXA 4JFOA 3UJIL 1FL3B 2ZNXA 3HRZA 4TTDD 1S7SB 4KI5D 3BGFC 4KZEL 2DQJL 1TDQA 5DR5H 3EDEA 5ALCH 3AB0B 2BVPB 2GUOA 3D25B 3FN3A 4OZIB 4Y5VA 5B22A 5E2UH 4N0FA 4NC0B 2HLFC 5GS1C 1GGTA 3DECA 3I6GA 5GXBB 4V1DE 5GJTH 3NCYP 3ARFA 3FJTA 1X5HA 5SWSA 5DJCB 4LSSL 4M62L 4CU6A 1E6JH 3CLFH 3DVNB 3OR7B 1BVLB 4HKZB 1I1RA 1KFAH 1MI5E 4BUGA 3RIFK 1EFXD 1U8OA 4G9DB 1FZMA 4D9LL 2XWTB 1RUKL 4NN7B 2R56H 4NUGL 1G6VK 5HGGS 3GMNB 3UBXB 5GS0C 2VLJA 2YA1A 2X70A 1RUPH 4GJTB 4XXCA 5DJ0A 1FFRA 3WSQL 1PDKA 1OSZA 1T1WB 2I60L 1DQJB 3IDMA 3RZCB 3UTSD 4XX1G 2G75A 4IRZH 5CGYC 4ZO7A 2AJ3B 3CXHK 1Q72H 3HAEG 3OXSB 1H0DA 2NY1D 3IXTB 4X6CF 3VXQA 3ARBC 3QHZL 4DN3H 4JFFB 2AW2A 1U8LA 2P8LB 4P2QA 5D1ZB 1GPOL 5ID1A 1MRCL 1T7YA 2NY7L 3D3VA 1JRHH 4JPKH 5EIQA 4OGXL 3T0BA 3QYCA 2GFBA 4XVTL 1K2DB 1A1NA 3KNBA 3RI5F 1CXKA 4ZUVB 1G1YA 3M1BB 5DXWA 3SCMD 3WFZA 3MRKB 3MLYL 1V8HA 1X5FA 1KIQA 2X40A 1D5MB 1K85A 4GRLB 3D18B 4IOFD 1OAUL 4LP5A 3SGJC 4LSTL 3K7UA 5HD8D 4L3AA 5FCUL 4UT6L 4ZUSB 5J13B 3D48R 1HHHA 5ICZB 4XCCL 2OZ4L 5B38B 4OAWA 2IAMB 3QG7L 3BH9A 4JO1H 5HDQH 4E0RB 3BFOA 5E8OB 3MA9H 2FECI 3QUXB 4BZ2L 3LQAL 4JPVL 5C8JB 2ADFH 5DUMH 5HJ3A 4EKXA 1MHCB 1P4IH 4HZAA 5J7CC 1I1YB 4EI6A 5IKCA 3OGOE 1DBJL 2YD2A 1FPTL 1BD2D 2GT9B 4C56E 5CEZH 3FRPA 4KKAC 4Z8FH 1ZVYA 3FHQA 4JFOB 3KYKL 3RBSA 1U41A 4JQXA 1ZGLM 3HRZB 4OKDA 5IHBA 3S5LG 1OVZA 4QWWD 4KKNA 1XCQA 4NCDA 1MVUB 3HE7A 3IFOA 5D1XA 5T1KA 1LDPH 3TJHC 5TDNA 4Y5VB 1E27A 3K81A 4N0FB 3RPKA 3V6OC 3I6GB 5GPRA 3ZT5A 5CJQH 3LVEA 3ARFB 1YPZE 1TJHL 2OCFD 4P2YA 5BO1H 3RA7H 4A6YH 3DARA 3ARGA 2XY2A 1J5OL 4EBQL 2BFVH 2APXA 2NY3B 1GSMA 3P4OA 3GUTA 1C7TA 4MD4A 4WNQA 2RQ8A 3RGVC 3PWJA 3HFMH 1FZMB 4RBPH 3NZHH 4ZTOH 1CDCA 3KPOA 4GSDL 5C08D 3W2DL 3D39D 4P9HL 5L9DH 3T0WA 5K9KA 3MOAL 3C5ZD 2VLJB 4D8PA 2ENSA 5DJ0B 2W60A 1OSZB 4ZXBC 1T0NB 2F53E 3IDMB 4U7KA 4XNMA 4K94L 3PL6D 4EUPA 2G75B 3DSFL 4YAQA 4PJFF 4KTEL 3ARXA 2UVEA 4NHCL 4I48A 3VXQB 2R69H 3U0WH 2IPTH 5JLZA 1U8LB 4M03A 4UIKH 3P11L 2J8OA 5EU6D 4FQ1L 3BEWA 4G9FE 2FIKA 2GFBB 3REVB 3WJLA 4HUMB 3KNBB 3JVGA 3HG1D 5SWZA 3S3JA 3GM8A 4APQC 5E2JA 1QNZL 4GW4A 1Q1JH 1L0XA 3T3MF 2D03H 1KIQB 3WKML 4NKDA 3KLHC 3MV01 2EXWC 4M6OL 3I02A 3RRQA 2WUCL 1MCEA 1HHHB 1TXKA 2ZSWA 2CLVA 2OR9L 4I3GA 4XWGL 3HC4L 1MLBA 4OAWB 4L4TD 3QDMA 2H3NA 3BH9B 2KBGA 3QEUA 2AI0L 3MODL 4JY5H 2ARJQ 2H26A 2A9NH 2C7UA 4EI6B 2ZOLA 5IKCB 2KUTA 5A1AA 5HVHB 1QLFA 4D0BA 3TJEH 3CFJA 5ECJE 5T3XL 2ZCHL 4P5KA 1IC7L 3T8XA 4HH8A 3TA3C 1W72L 4MNGA 1JYXA 2H6PA 3T2QA 5DF0A 4LFHD 1PGRB 5AG8A 5HDBE 1XCQB 4H0HB 3RUGE 1KCRH 3HE7B 3IFOB 5D1XB 5T1KB 2IFFL 4MNQE 1S78C 5TDNB 1FNEB 1A6VL 1CGSH 4H88L 3SDCA 1E27B 1JHKH 2EDQA 2V2WA 3NIDF 1UC6A 1BQUA 5IEHA 1T1YA 4MZ3A 3O2DH 1A6AA 5I9QC 4F7MA 5FGCE 5FFLA 3ZKND 1T1ZA 4ZUTA 4MJ2A 1LEKA 1K8IA 1N5YL 1Z3GH 2J5LC 4KMLB 3P4OB 3GUTB 4MD4B 2ZCKL 4FQXD 3PWJB 3OJVC 3SDXA 3IF1A 1UENA 4K3DL 3ZE1E 3MOQA 1U3YA 5KJRH 3KPOB 3MBXL 1FAIH 3B2UD 1R3KA 1FDLH 3RAJL 5K9KB 2BVUA 2X2YA 4GAGH 1D9KA 3CLEL 3BXNA 4D8PB 3VRLE 5ICYA 2HT3C 1B9ZA 4CMHB 4DAGH 4XNMB 4EUPB 4QRSA 3JV5A 4OT1L 1NMBL 1RUQH 1QLEL 4PRPD 4W6WB 4FQHA 4J12A 2DQCH 4I48B 1KTKE 4NSKA 3G6JA 4CNIA 2BOCB 4RFEA 4YBHA 1ZTXH 3D69A 4YDLC 4E41A 5DA0B 3HR6A 1BF2A 2OSLA 2VXUL 5AWNL 3BEWB 5JZ7D 5E1AB 5AZ2L 2A1WH 5SWZB 3R4DA 4R9HA 3BSZL 4MDJA 3CCHA 5CSZB 4GW4B 5ANME 3LZFL 4X6EB 4FP8L 5C70A 3WYRA 1FZOB 4NKDB 4NBZB 3I02B 4KRMB 2X4TA 3PGFL 4AK1A 4HFWB 2ZSWB 5CIPA 2CLVB 2VQ1A 1MLBB 2EIZA 1WEJL 1U8NA 3EHBD 3QDMB 2H3NB 3UP1A 5I74B 2FEEI 3MUGA 3GBNH 4M48L 1IT9H 1A3RL 3QEUB 1DVFD 2H26B 4M5YH 5HHOD 2C7UB 2ZOLB 4MZ2A 1G9NH 1XGPA 3SKOA 3UC0L 3OAZK 5J4MA 4D0BB 3CFJB 3FQXB 3FT3A 4Q9QL 2G2RB 2YD1A 4P5KB 3T8XB 1YMMD 4MNGB 3SCMC 4IRJA 3NBNA 4F9PA 4HLZG 1O0VA 4UOW1 4E5XA 5KVMC 3RVVD 3FZUD 4KROD 1INEH 3GK8H 5EU5A 3B8SA 3SDCB 2V2WB 2RBLA 4OZ4A 2MKWA 1LVEA 1YEIL 2PCPA 3ETBF 1OPGH 3X11A 1KJ2A 5IEHB 1T1YB 3RI5K 5TE7L 1A6AB 2HRPL 4WFED 3FL7A 4N5UA 3EDDA 1T1ZB 4ZUTB 3AAZA 3SDDC 4XMPL 2VDML 1LEKB 3RWIA 1K8IB 1I3UA 1TLKA 1HK6A 1S7RA 4TVPD 2NXZC 2R4RL 4G6AD 3TESA 4P2RE 1AR1C 4UBDD 5D2NC 1HILB 3SDXB 5JW4M 4YXKH 5D1QA 2QADD 3UTTA 5SX4I 1YA5A 3MV7D 4Y4HA 2YPLE 1M7IA 1R3KB 1E6OL 1CGVA 3U2SA 2Y07H 3QI9D 1D9KB 1QBLH 2WUBL 1ZA3A 2DDQL 3BXNB 2PO6D 3QIBC 1S7TA 4QRSB 2Q7NA 5IHUH 4M7KH 1OAYL 3VDCA 4Q58C 4ISVA 4C58B 3A6BH 1AY1L 1PSKH 4NSKB 4OSUH 4ZTPH 2FBJH 4RFEB 2B4CH 1GGBL 3D69B 4E41B 1DN2A 2NQCA 4PRDA 5BJTA 4TQEH 1R24A 2AVGA 2OSLB 1JNNH 3O4LE 4L5FL 2JJVA 3BRDA 4Y1AD 3PDDA 2HH0H 2WWMD 5MENA 2H2PD 3DLQR 4MDJB 5FYLE 3CCHB 4OZHA 4FTVE 4ODHL 3EO9L 3DHMA 4X4YA 4OTXH 1MFEL 4EUPH 2X4TB 5IBLC 3PG2A 5CIPB 4NZDA 2VQ1B 1SJXA 1FNGA 2EIZB 1U8NB 3L7FA 2X6MA 3CD4A 4YK4C 5IB2A 1WCBA 1GJIA 1E28A 3BKYH 5CJ8A 3F62A 1IGJA 4WY7L 3I6LD 1RMFH 1EHLL 1GC1L 5HHNA 2VXSL 1XGPB 3SPVA 3SKOB 4OM0H 4XPFL 3FT3B 3V4VL 3MRNA 3WIHH 5IESL 4OFYD 1QFOA 5KG9A 5JPNB 1Z9OA 1KIUA 1IM9D 5BMFH 4IRJB 1BBJA 2HMIC 3VWKB 4JCMA 2P5EE 5CJBA 5JW5A 4ESKA 4E5XB 3MREA 3K8MA 3IJHA 3QWRA 4ZS6D 4L4VE 1EFQA 5EU5B 5T5NG 4OZ4B 4OCXH 3HTLX 3X11B 1KJ2B 3CU7A 5F1OB 1UB6A 3QHTC 4ERSH 4KVCL 5E8NA 5BS0A 1HNFA 1DQLL 5BVJA 2LU4A 5ADOH 3AAZB 4YFLF 4JRXE 5E1HB 3NCJH 3RWIB 1BQHG 1MQKL 3CZFA 2VYRE 4MA8H 5EBMA 4UOW0 1KIRA 5D1QB 3UTTB 1OB1A 2VLLA 4DKFH 1KJ3H 3EDJA 1UKQA 1AJ7L 1M7IB 3U2SB 1CL7L 1ZA3B 2RHEA 1S7TB 1F02I 2WV3A 2NY4B 4JFEE 5EZIL 2BNRD 2XI9A 4P4KD 4MXWL 4ISVB 1I4FA 4LCIL 3KDMB 4K2UH 5BJTB 4PRDB 1OT1A 1R24B 1R0AL 1T89A 2N1KA 2YA0A 1NAML 2VQUA 3U1SL 5EUKA 5CGTA 5DZLA 5MENB 4Y5YC 2MQ0A 3NCCB 5DRNA 5J11B 4KUZH 1QFWH 1JMZA 4KY1H 4OZHB 3ZHLA 3MZTA 4X4YB 3DUHA 2Q6WA 2YD4A 2Z4QA 2NY5C 1TJIH 1G7QA 4R97C 3U4BL 3O6LL 1JGLL 2HTKC 1FNGB 1BIIA 4YXHL 3L7FB 2BSTA 2CXKA 5IB2B 4X7EC 1WCBB 4RCAA 4NFBA 4UB0L 1DUZA 1E28B 1LK3H 1U6AH 3X14A 1WFUA 3V5HA 3AS2A 1IGJB 3F8UB 5EO1A 2AV7A 1W8OA 5HHNB 2KDGA 3PWPE 3SPVB 2B0SH 5D71L 1NMAH 1EA9C 3B4NA 4Y16A 3MRNB 4I77H 3QDJA 4K8RD 2E6JA 1Q94A 5KG9B 1SVZA 3VWJA 4Z7OE 3RIAF 3BKML 1BBJB 2E9BA 2QQLL 3RY6A 1RIUH 1MREL 5JW5B 5KVDL 4LAQL 5ID0A 2YZ1A 4NWUL 3IJHB 1EHXA 3V6OE 3MJ8A 2VLKA 4M9OA 3VD4A 4UTAL 3MBEC 2DI8A 3C60A 5IJVA 1OLLA 1U3ZA 2RR3A 4M1DL 3EHBC 4MA7H 1A5FH 4RNRB 3WJJC 2OJEA 5E8NB 3ARVA 1DTUA 5BS0B 5DJAA 1KXTB 5BVJB 3DV4A 1TZGH 4MB4A 3RHWK 4NNPL 4HF5L 3EDFA 3CZFB 5EBMB 1RAMA 4P59L 4UV4L 1KIRB 5I30L 3GI8H 3QIUD 1OB1B 2VLLB 4K7FA 2OQJA 4XPHH 3MRDA 1YEGH 3RKDD 3QAZB 4C59B 4MJID 1U0QA 1PG7X 2IPUG 1CFBA 3I3BA 4MMXC 2QHRL 5IOPA 3RZWA 3GJFK 4S1DC 2ORBL 2ZJSH 3T4YB 4PP1C 4KROC 4F8TA 3FB5A 5H94A 4GG6F 5D93B 3IDIA 1I4FB 4Y0GA 2D3VA 4LARH 5C0DA 2R0LH 5DD3H 5FA4A 1RU9H 4V2CB 4CN1A 1KN4L 5L88H 1ULVA 3Q6GH 3W0WA 2C5DC 3MYZA 1NGYA 1NGXA 1F45A 5EUKB 4G6ML 4G6AC 4X6CB 1H3WM 5DRNB 1VFOA 5MI0B 3H7LA 3GSQB 1S5IL 3WXWL 1RJYA 5D72H 1H3TA 1N7ML 1LO0L 2C26A 5FDWA 3QI9C 2VLRB 5EOCL 1D5ZA 5F1SA 2W9LA 2PO6C 2XKUA 5GIRB 1BIIB 4NJ9L 4OGYL 2BSTB 3EJYC 1DSFH 1HINL 2UWEA 1EUUA 5DMGC 1DUZB 5AZEL 3X14B 4AMKH 1GAFH 3O6ML 5EO1B 2AV7B 2JJTA 4ZFOL 5DSCA 4H5SA 2Z31A 3MV9A 4Y16B 1BQHA 1LO4H 3QEHA 2JK5A 3QDJB 2WWMC 1H3GA 2DQTH 3VWJB 2PXYC 5FUZH 3DVFA 3ELAT 4J3UA 4NQXA 4G8IA 5INDA 2OTUA 3MQIA 2GJ6D 1IC5L 2M1KA 2W0FA 5ID0B 3HHRB 4HEPG 3MLWL 1T66D 3MJ8B 2VLKB 5KVEL 1YY9C 5IJVB 4R8WL 1M4KA 4G7YH 1FVEB 1M05A 4Q6YA 4G8GE 3SE9H 2OJEB 1OD9A 1WLHA 1QO3A 3ZZ1A 5DJAB 1QP1A 3DV4B 5LGKA 3DX6A 5ISZD 2J4WL 2HFGL 32C2A 3WUWA 4PJ5A 4JGMA 4QRRE 4FZEH 4WEBL 5I8OH 1NCCL 4K7FB 3UZEA 1QVOA 2OQJB 3VDBA 4NZUH 1KPRA 1U8HB 3MRDB 1QSEA 4ENEC 5E6ID 3QDGD 1PG7H 4PJ9A 1CXLA 5IOPB 2EH7H 4HPOL 1CFQA 1G0XA 3DWTA 1UWXK 2OJZL 2W91A 4YE4H 3C08H 1PEZA 4D9RE 2HFFA 3BKCL 1CYGA 3CVIL 3FB5B 4C57C 5H94B 1UZ6F 1JGEA 3CXHJ 4GT7A 3IDIB 4RAHA 1T7ZA 5BRZD 1DDHA 5GQBA 1BFVL 5FA4B 1MCPH 4X6DF 1VFBA 2GJZA 4XP1H 5L2KD 3W0WB 2EYRA 5IEKB 1NGYB 1II4E 4QTIL 1JYNA 4J4PD 1XGRA 1NGXB 2NY2C 5I6XC 1J8HA 4O58H 2BCKA 1CGXA 3KPMA 3CX5K 3DXAB 1RJYB 3LY6A 1UVQA 3TYGH 5HYJA 1ZXQA 2V5RA 3NIFF 1Z6JT 4PJCA 5DMJB 2XG4A 4F7TA 1D5ZB 1RZ8A 4Y2DC 2PYED 3JV6A 5E5RB 2OXGA 5CKAA 2CRZA 2Y9RT 1I9IL 2DM3A 2D7PA 1FNLA 4WWKC 2P42B 3R1GL 3RNQA 2UY6A 1LE5A 2W92A 4OIIL 4H0IA 1MFBL 5DSCB 2FJHA 4H5SB 4EOWL 2CDFA 5IVXE 3MV9B 3QEHB 2JK5B 2NXYC 3TN0D 5GS3A 5I73C 5LVEA 1CDUA 1PY4A 3CXDL 1A7PH 3SQOL 4X8JA 1EHNA 1YNKH 4NQXB 5INDB 4G8IB 3TIEA 3NAAH 2OTUB 2V17H 2D0GA 3GJFA 1UQSB 1Y6NR 2W0FB 4KKCD 4GMTL 4FQPA 4HSQA 5GISL 4GS7C 1NLDH 1VFMA 3L9RA 3T2NL 3V4UL 1Z9SA 1G7JA 5KSAD 3TLRA 1KN2L 1CU4H 1M05B 4JN2A 3EKCA 3RTQD 3F7YA 3OAUL 1K4DA 1QO3B 4D3CH 2EDHA 2VN7A 3JWDC 4JPWH 5EFIA 2R9HC 2VKXA 2ESVE 4KPHL 4HPYL 3ZL4L 5FYLL 1ADQL 2VUOA 3VGAC 3BKJL 1KF9B 1MFAH 1BD2E 1DR9A 2H45A 32C2B 4QNPF 3WUWB 3TFKD 4PJ5B 4AY0A 3PDOB 3GIZH 3D2UD 3T3PE 1I8KA 4URTB 3W11D 4WO4C 4NJAH 1QVOB 1I1FA 1KPRB 5FEBA 3QJFA 1QSEB 1RIVL 1HZHL 1RZIA 3G5XA 1H3UA 4PTUB 4PJ9B 3GSRA 2AKRA 3GSUA 1CFQB 4J3VA 2HJLA 1NPUA 1H5BC 5F7DA 4OM1L 2HFFB 1U3HA 3U7WH 3VFOB 2XZCL 1JGEB 1MRFH 4PLOB 4UV7L 1DDHB 4JRYB 4L8SC 4IOIA 1LMKA 1MCWM 3RIAK 1VFBB 4F8QA 1C5CH 2GJZB 4ODUB 2WBJD 2EYRB 1S9WA 4QHUA 2F5BH 1NMCC 1XGRB 4OZGF 5IMKA 4RDQG 1J8HB 5C08E 4D9QD 4JO2L 3SE8H 2BCKB 3D39E 3KPMB 3DRQA 5HYJB 1UVQB 3TT3H 2AABL 1C08A 3MFFA 1N8ZB 1EK3A 2BRQA 1QKZL 3CFDA 4WUKH 3HUJA 3KGRA 1SJVA 3GHEL 4PRNA 3PGCA 3LQZA 4JVPA 1IGIH 3GRWL 3JV6B 3LAFA 5DRXB 4DVBA 3ABZA 4ONOA 4O4YL 5DQJA 4Y7MA 4Z7UF 3ZO0A 3RNQB 2D4DA 4YDKL 5EU6E 5GGVL 5GS0L 5DT1H 1LE5B 1IEBA 1Q0YH 5DUPH 2FJHB 3QUKA 2CDFB 4I0PA 1L0YA 1FL5A 1D3CA 3HG1E 2FB4L 2D9CA 1LILA 4BZ1L 3S6CA 2FYYA 5A2IH 2B5IB 4X8JB 4RMVA 3H7BA 4ZFGH 4FFZH 2B1HH 3TIEB 2XKSA 3GJFB 5D9SA 4K3GA 5DHVA 3DNKA 2IBZX 2AGJH 2A0LC 3L9RB 4L4TE 2NY6D 1G7JB 3H9HB 3NABH 4JN2B 5LWYL 3F7YB 3OQ3B 1K4DB 3QDHA 5EFIB 4MD0A 2JCCA 2XG5A 4WGVB 4MJ4A 3GSXA 3LKSA 4HIHA 1FBIH 2ID5A 5D6DC 1JF6A 1OAXL 3RWCB 1PKQA 1I8KB 2GHWB 2DMKA 4Z5RA 1CLZH 2BXYA 1I1FB 3QJFB 4YUEL 2BNUA 1RZIB 4GLRI 4FNLL 1NL0L 3GIVB 4PJAE 1YEEH 3G5XB 1YYMH 4XBGB 3GSRB 2AKRB 3IJSA 3VXSA 3MLXL 4LSPL 4L3ED 1WQVT 5F7EH 4TUKH 1MCOH 5INCA 2CKBH 5F7DB 4GG8A 4YDIL 1MJ7L 2FD6H 1S7UA 3QCVH 5LBSH 1U3HB 4QHLA 4YHOH 5FM5O 3WFEL 4F7EA 3I9GH 3UCRA 3WFHA 4PUBL 3BPOB 4LQFL 2OBGA 4IOIB 1I3VA 2ZUTA 1C1EL 3ZDYE 5I18H 4IRSD 1J10A 1S9WB 4QHUB 3K8KA 2IQ9L 5IMKB 3KPRD 3UZQA 3VXMD 1BBDL 1GIGH 1Y0LA 3O6KL 1MCQA 1I1AD 3NN8A 3A67L 1TQCC 3U7YH 5I15L 4R0LA 3MFFB 1C08B 4JREB 4JHWL 1KCSH 2HT4D 3PWVA 2R0KL 5L7XH 3CFDB 3KJ4C 3HI5L 2VL5A 4MA1C 4P5TA 3HUJB 4GXUM 3B9VA 4PRNB 4MXQC 3PGCB 1UJ3C 3LQZB 4AZ8A 3E0GA 2VL4A 1K6QH 4DVBB 4OLWH 4UAOB 1GGUA 5I1KH 1S9VA 5DQJB 3G6DH 4GAJL 5CBAA 3UJJH 4EXKA 4NOFA 5CINH 5DC0A 2IQAA 1BHGA 2CGRH 5DJZA 4LHUA 1HKFA 5IFAL 3QUKB 4I0PB 2UUDK 1XGTA 1FL5B 1QD0A 1NANH 2H1PH 1A7NH 4TPRH 4J4PC 1NC2A 2FYYB 1BJMA 3UYPA 1CR9H 4Z7WA 1S3KH 3H7BB 1EJOL 1R6VA 4JPIA 2CK2A 5DHVB 1FVCA