4KVCH

2h2 fab fragment of immature dengue virus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
220
Chain Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARWGNYPHYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCDGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig heavy chain V region MOPC 21, Igh protein
publication title Obstruction of Dengue Virus Maturation by Fab Fragments of the 2H2 Antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kvcH01
3MRQB 1R0AL 3O3DB 5DO2D 5C09A 5KSVA 4J3SA 2XKNA 2JKXA 5DJ8B 2P49B 4WEMB 5FYKE 4YAQA 3K1KC 1P9MA 3UO1L 1E4KC 1L7TL 1F6AB 1CZ8L 2WMPA 2K7PA 1KYOK 1INQB 4J3UA 1G7JB 4ZUWB 4AL8H 4DCQA 3P4MA 1N6QH 2DTSA 1RZJC 1INEL 2J6EH 4HXBL 4JN2B 4P46B 1PZUB 2V5MA 2VISB 5FEBA 2PN5A 5IG7A 5GSVB 1R5VA 3M1BA 2LAGB 4CVWA 4XT1C 3FB5A 3MXWL 1H15A 3RWCA 3E2HC 1W0WA 3V7AE 2EIBA 4MD5A 3W11C 4L8DA 5I71C 5IR1B 4OF3A 3BT2H 4L3EA 1N7MH 3PWPD 3B9KD 1UADC 1U92B 5HI3C 4X7FC 1MUJB 3D87B 1X5LA 1MFAH 5J1TC 4PLJC 3VFOB 1Z9MA 1Q9KB 5JIPA 3SBWA 3MJ8B 3WSQH 5IBUB 1J11A 5GSRB 3HNVH 5CP3H 4MS8D 3UEZA 1FFNB 3DIFA 1K4CA 3QI9B 3BGFB 5EH1A 2FB4H 4UBDC 1CBVH 4PTUB 3MQIA 4JO4L 1JZ6A 4WV1A 1KCVL 3FFCD 1EEYA 4HMEA 1KEML 4TVPE 1KG0A 3OPZH 1WBYB 3MLVL 2VERN 2V7HB 1LMKA 3H42H 4MXVF 3FQRB 2AEPL 2VLKE 4XAKE 2CMRH 1NC4A 3BXNB 5KBNC 4PV9A 3ZSSA 5FHAH 2GFBB 5ALBL 2IEPA 1CL7I 3TVMD 3BIBX 3ZHDA 5J6HA 4FG6C 1F5WA 4GXVH 1WIUA 2F53E 4K7PY 3GDBA 4GG8A 4P0DA 4H25A 5HYQA 2CRYA 3N1MC 2A6KA 5IIEB 4CVUA 1A4KA 2XZAH 1DQLL 5FYLE 3QXTA 1UACH 1LK2A 4UV4H 1CGSL 2AJXH 4O5LH 3OGCB 4ZQKA 3MLPA 5DRXB 5C9JA 3TWCL 4OKVA 5IFHL 1FNFA 1KN4L 1TJHL 3SGEH 4R7DA 5DJYA 1MCPL 3Q1SH 1CE6A 3MLTB 1A2YB 3MRBB 4QRTA 5J11B 2NTSP 3PWLB 1FGNH 3FO9B 5DT1H 3QIUD 2N4IA 1KJ2A 1T20A 4ZXBD 1PKQB 1U58B 3BP7A 2UWEF 4Y4FA 3QUKB 1FH5L 4L8BB 2ORBH 3F7QA 5F70A 3X3GH 1I7ZA 1RVFL 4XTRC 4I3SH 3ULVL 1J1OH 2OQJB 4TNWK 4P23B 3QUZB 4NQCB 3RUGB 3VWJD 1IAIH 3CX5K 3FRUA 1OSPL 1JK8B 3IFOB 4JGMA 5SV4A 3QIBB 5I8OH 4Y5YA 3SE3A 3QCTH 3L3OB 1C12A 3MLYL 1UH2A 3WJLA 2XA8H 3AROA 2AI0H 4F37K 4PBWD 4X80H 3DHJA 5KANG 2DQUL 5MEQA 1NGXB 2WINB 4F8TA 3VDCA 5D7IB 1RZGB 4MZ2A 4F9LA 4FXKA 5CEZE 3K7UA 3EYVB 2Q87A 1CXKA 4Y16A 1QSFA 5ESAB 3UJTH 3LIZH 3BP4A 3IRZA 1INDH 1W72L 1NSNH 4RNRB 1CDJA 5D5MF 4PRID 4NO2B 5D1QB 1P4IL 1RHHA 1J0YA 5LGHL 3NPSC 3GBLA 3AY4A 5DJXA 4MDJB 4QOKA 4YQXL 1MCWW 5I76B 3VXNB 4JG1H 1VHPA 2JE8A 2CDGA 4RGNC 4JY6B 2VAAA 5EC2A 1NLBL 3TYFA 5SWZD 5KTEH 3ZMRA 2DLFH 1AO7D 3BI9X 4MVBC 1Z5LB 3FZUD 4RCAA 5H37G 3EFDH 4WUUD 1D5IH 4YHMH 3RWFB 3MUJA 3PJSB 1SYSA 4HGKC 4A6YL 5JPNB 4MNQB 3BH9A 4PJEB 3P0YL 4ZAKC 4JO1H 2EDOA 4PPTA 5F7WC 1VGKB 2JJUA 2NW2A 3HI5L 3DUHA 1VFUA 5CJQL 1OAXL 3HUJB 1OTSC 2H8PB 3OBAA 1RZ8B 1YECL 1JPST 1KENH 2QQLL 1A9BA 4QHUA 4G7YH 2Y36L 3IS0X 4J7RA 3SDDD 3W9EB 1CDHA 4KK6C 1A7QH 1MJ7L 4P2OC 3UDWA 2X9YA 2HJLB 4CN1A 1YC8A 4LEOB 4N0UA 5DRWA 1IEHA 2XTJC 3WUWB 4MCYB 3QQ4A 2P48B 2VO5A 1OAUL 2AQ2A 2V2TA 1HINL 4WHYH 3C9NA 3VXRD 1MFDH 1TJIH 5DD1L 2ENYA 3C5ZA 3UTSB 4CDGC 4OGZA 5KW9L 4IDJL 1DQMH 3ET9F 1K8DB 1WWCA 4LLVA 4K94C 5DK0A 5KVEH 2IAMD 5L2JA 4MMXC 1KNOA 1NGWA 3D85B 3KHQA 5TDNB 2WAHA 5ISZA 1DQJA 3IFNH 4ENED 5DYOB 2AJVH 4GS7C 2R2BA 4OZHA 4RISL 4E42B 4MJ6A 5CMAB 1YA5A 3Q6GL 2XWBA 4UT7H 3O4LA 1NEZB 1YJDH 2PTVA 3WXWH 3CDCA 1JGLH 2Y06L 4U6HA 3ZDXE 2VXQL 4X0KB 4L9LC 4QRSA 3E6FA 4JZOB 5FM4A 4ELKA 4OBSA 3T8XA 2VZOA 3MLXL 1G6RH 1L9NA 3O4OC 1UWXK 3SKMB 2R4RH 5IVXB 1FFQA 4PY8I 2IBZX 5BQ7A 1I7TA 3EO1B 3BEWB 4LDOB 4O2CB 1QSEA 3ARGA 1H5BB 1HWHB 1XIWD 3VXPA 1OCWH 4M8VA 4KDTA 1DUYB 3C5SB 3QEUA 4HUWA 3DHMA 5EBWB 3SDXA 4HIXL 1LO2L 4P2RD 4MNHB 1C5DB 5ANMA 5CD3A 2DQEH 1KJVB 3QULB 1MY7A 4QTHA 1JPFA 4GBXA 3WMSA 5T33L 4W4OC 4YHPB 5M94B 4FQ1H 5CIPH 2OJZL 1NAMH 4J2XA 3HB3D 4YGAB 1BBJA 2BK8A 5I8KL 3EDJA 3MBXL 3REVA 5LBSL 1A5FH 2X40A 5F6HJ 5HYSB 2QSCL 4H20L 4WUKH 4S2SA 1KPRA 3BOVA 4WWKA 1NBYA 4M03A 4M7KH 4FABL 1JV5B 2Z91B 4EVNB 2Z9TA 4O2EB 3GMOA 1YPZA 5E1AA 5F1NA 2LV4A 3MJ9L 3LKRB 3H0TA 2HFEA 3BVNB 3PNWA 4CKVX 4MAYA 4Y5XB 2AABH 3PWNA 1Q38A 4P5TA 4PJ5A 3SDYL 3S96A 4OGYL 2B1AL 4L4VE 4GOSA 2P5ED 2H32H 1X5IA 3IETB 2AQ1A 3WHE1 3AM8C 3CFIC 4KXZH 4Y5VC 2IH1B 3UZEA 1HDMB 1TQCC 4XP9L 2GQHA 5C7XH 2DMCA 2VDKH 3STZB 1JN6B 1BVLA 3RX7A 5IEHA 2XG4A 1ACYH 4KMTL 4O9HH 3WCYA 3QCUL 5HI5C 2DQFA 1LE9A 2R0ZL 4KROD 2VDNH 4U3XA 2AXFB 4X99A 1YEFH 1T1ZA 3LKQA 4G9DA 5ENWA 4NKDA 1CE1L 5DS8B 3HC0A 4UIMA 2AK4D 5LAXA 3CXDH 3PP3K 1XGUA 1ZLWK 4D0BB 3I6KB 1U8NB 2X9WA 4QRPB 4IJ3B 3SO5A 3QSKB 3RPIB 4F37F 3B2UC 1ZSDA 3DUSB 4YHZL 4Q2ZA 3O3UN 3SGJC 1CR9H 1QLFB 2BRRL 2QQQA 3JTSA 3WE6B 4NWTL 5IMOB 2HT3D 1WBZB 5TF0A 3AU1B 3TNNA 1KYOJ 5L2KD 3U6RA 5JQHC 1FO0B 3TLRA 2X1XR 4JDZB 5IQ9B 2FNBA 1PD6A 2VDQL 1LO3H 1FNSH 2VXVL 4M43H 1DLHB 3L3JA 5I0DA 1HQRA 3MLRL 1SJEA 1F00I 2P8LA 3MOAL 4KVNL 2FBJL 1I9JL 1S7QA 3KPRD 5T1KD 4HWZB 4ZO7A 5F9WB 5IHLB 1T5XB 3G6DL 5I1HL 4NDMA 1A64A 2WUBL 2RGSA 1I8KB 3CFJA 3FAXA 3CDGB 3DBXB 2NR6C 4XWGL 1CXHA 3V0VA 2APFA 4PG9A 5C0CB 3V0WH 3ULSB 2B20A 3SJVD 2FRGP 3CSBA 4NRZA 2NXYD 3ZTNL 1OM3H 3SQOH 4I4WB 2IQAB 3I6LD 5DHYB 5D2LF 1N6UA 3T4YB 3QEHA 1MCNA 4WI9A 3UTPE 3RGVC 5JHDD 2YZ8A 3QG7L 1RIHH 3EYOB 5TPWH 5DD5L 5C0BE 5I17B 4PJCB 1IL1A 1NFDA 3B43A 1OGTA 2WW8A 1QR1A 1SBBA 2VDPH 1ND0B 1UJTA 3GKWL 1MCCA 2YC1B 4XNYL 1NCCH 4KTDL 4AJ0A 4HV8B 4OZIB 1AGEB 1MF2H 4WU7B 1LEGB 5CSZB 3VXSE 5FYKD 3JVGC 4Z95L 1T4KA 4NUJA 3PHQA 5J1AB 6FABL 1HZHH 1VACB 5D6DA 4U1JB 4LNRA 5FGBC 1T2QL 3B5TA 3DV6B 4ZOAA 3FJTA 1EO5A 2XIDA 4JM2C 4UT6H 4E41B 5GGSA 1BECA 3MFGB 4IOIB 4CJ0A 1KTDB 3VFUA 5HGBB 1LEIA 5EOQL 2ZUXA 4M1GH 2EICA 2P5WE 4MB4A 5JXED 4JQVC 2A74A 5E2WH 1CLZH 4ZYKA 2R8SH 4LKXA 3L95A 1CFBA 4XP6L 1KIRB 4ELMF 2PO6A 1EJOL 3RZCA 1FZMA 1S7WA 3LKNA 4LU5L 1HHHA 3NVQA 1Q72H 3F12A 3GKZA 4TQEH 4R6UA 5E5RB 4LSVH 3NIDE 3LS4L 4OCSH 4WFHE 1AD9B 4PJXB 3J7HA 5J6GB 3LQAH 1Q9LB 2RFXA 1OP3H 2NZ9C 3IDMA 4NZTH 3TJHC 4AM0B 2I60H 2LE9A 3TCLB 5C0IA 1FNGB 4JKWA 4XBGA 5ICZB 2ESVB 5DZLA 3UBXA 1ORQA 3O3AA 3O8XD 4H8WH 1UQSA 4PS4L 4XXCC 3I2CL 3PDOA 5T3XL 3EOYG 4FQCH 1LDPH 4ODUA 4GRLB 4LSUL 4ODVL 1DQTA 4YHKH 3ALPA 2CQVA 3U79A 3N85L 1CFSA 4ZOEA 1BQHA 1SY6L 2J1KA 2X70B 1C08B 3P73B 1M71B 2W0PA 3UROR 4LF3B 1G84A 4TVPD 5TH2A 4XPHH 1JUFA 2FZ3A 2EDXA 5BZDB 1MFCH 4P46C 1XR9A 1CG9B 2JK5B 3X14B 1TPXB 3BZ4A 3N0PB 3E8UH 4LCYA 4HPYL 4X5WA 2VLKD 4NRXA 3L7FA 2AV7A 1WFOA 4OCRH 2V6HA 4H1LH 1GGTA 4LQFL 1AXTL 5DMYA 3ARFB 2EIEA 4NC1E 4Q7DA 3SDAD 2F53D 4OIIL 5DHVH 5T3ZH 3MACH 5F3HB 2XACC 1JZ4A 4ODXA 1OLZA 1QBLL 1ZTXL 2YRZA 3KYKL 4IHOB 3WKNA 5A43C 3GJFH 4JPIB 4XBPA 3NH7H 2QR0B 4BFIB 4HBCH 3OB8A 3BP6A 1CTOA 5IT2L 3B6SA 2OTWA 3QI9C 4GLRI 2ILLA 3BGFC 4RDQF 5CJ5A 3FT2B 1CIUA 1NMBL 1RURH 5DUMH 3P4OB 4IRJB 4W4OA 5DR5H 1BOGB 3QCVL 5BVPL 4HIJB 3SGEI 3ZE2E 4C56B 4J12A 4H0GA 3V52H 1M1SA 4ZD3H 3OX8A 1XGPB 2E9IA 5IBTH 2MCPL 1ZVSA 3O45A 5AG8A 4HMCA 3DXAA 4QHKJ 3UTTD 3V6ZB 1C5BH 2D0FA 1FL3A 5CSBA 4MA7L 2BNQA 3FQTA 4F33A 3S9DB 5IFAL 5D1ZA 3DWTA 4G6JL 1E4XL 5HHNA 5MERA 4NUGH 3WIHH 4R90L 5I2IA 1UH4A 5FK9B 4EBQH 4JPVL 1NFIA 2ITCB 3I02A 3WD5L 1HHKB 1ZXQA 2AJSH 2XICA 4G42A 3UYPA 3KYMA 1U8IA 1U8OB 1LO5A 4DGIH 3NA4A 2J8OA 3ARUA 3OKEA 4NBZB 4FTVA 1HCVA 5IEKB 2VWEC 1C8PA 3KLSA 5J11C 4HK0A 4F7EA 4WW2F 4W6XB 4PRBB 3BDXA 3OJVC 4WJ5A 3RY6C 3RWGA 1V7NH 4H26B 5ILTL 2E9WA 3W2DL 4XPGL 2X89D 4P23C 1G7HB 3QUZC 4NQUA 1QA9A 4KVCH 3EIFA 4U3CA 3PWUA 4LSPL 4YBLB 1CVSC 1J8HE 3A67H 3TN0B 4U6VL 1VERA 3QIBC 3VG0H 2Z8VC 5C6TL 4X7TB 3MC0A 4S1QH 1JGEB 3GMQB 1U36A 2VLLB 2FL5B 3CSYA 4I9WD 3T2QA 5I1GL 1N8ZA 5I6XB 3OXSA 4JFPB 3SGJA 1UB6B 5DURB 4Z8FL 3WS6A 4AH2B 3FCTA 3MRGA 2A2QT 4R8WH 4PJ8B 5D71L 3MRCA 4YBHA 4MCZA 4OAWB 1YQVH 3FAWA 4LLQB 3QNXB 4LASH 1DL7L 4GRWB 4DKEL 1JMXA 1N5YH 4RMRA 3MCKA 1FG2B 1T83C 4DZ8B 5HPMA 2HG5B 5HDQH 3G6JF 1UJ3A 2HH0L 1KN2H 5D1QC 1BGXL 1CD9B 3EYUL 4NHUA 3ARDA 3VA2C 2W9DL 1DANT 5D7LA 5DJZA 3SCMD 3KPPA 4K3JH 2BSRA 4OFDA 2P42B 1MEXH 2PTTA 4ZODA 3F7PC 1GCFA 3ROLB 5BCAA 1UWEL 5SX4I 1A14H 3QPXH 4MDIA 4M4PA 3CU1A 3BN9D 4NZUH 1B3JA 1JIBA 3T77A 4LSQL 4NN7C 2KQNA 5DK2A 1MCJA 5TE4L 5DJ0B 4K8RD 2DTML 1IGML 4RMQA 1DFBL 3ARQA 5CFHA 1IEAB 1FV1B 1ZHKA 4PP1C 3EYFB 4LSTH 4BZ2H 3U0PA 3U1SH 5JUEL 3HNTL 2DS4A 1XZ0A 3TT1H 2CLRA 3TYGH 4B50A 1KCSL 1U3HA 2HJFB 4WI5A 1GC1L 3ZDXF 1OAZH 3GI8L 3RTQD 1HNFA 1O7VA 2EDLA 4PJAB 1OAQH 4PRPB 4AZ8A 5K9OB 4GSDL 1IKFL 2XT1B 2OP4L 3EJYC 3LD8B 4XCNA 1B4RA 2VNCA 4JDTL 1I9IL 3H2WA 2X4RB 4BFBD 1ZMYA 4O02L 3DX8A 1B6UA 3U9PL 1G9NH 4JRXA 1EFXD 1FFOA 2LAAA 4MNGA 1SMOA 4R4BB 4Q74A 1U8LA 4JPKL 2OK0L 4WIQA 3WKMH 7FABH 4NSKB 3S37H 2P45B 4JEGB 2DWEB 1T3FA 5I15L 1YEHL 5FO7A 3MYZA 4FQXD 2DMBA 4KAQL 5AG9A 1C1EH 5GPRA 2X4UB 3SGDI 2DICA 4R4NC 3UPCA 4OLWL 1DQDH 4JQVA 4CNIA 4F2MA 1BVZA 2J8UE 5A2JH 4OCYL 2OS7A 2FYYA 5CHNA 1YQ2A 5IFJB 5K9QI 1JZ3A 4XCCH 2RBLA 2DLIA 5HYJE 1U2HA 5KSBE 2V2WB 1CCZA 2VLRB 4G8IA 4F8QA 4CL7A 1ZV5A 2C5DC 3LH2H 1HEZA 4FZ8H 4EQ3A 2EH7L 2AEQL 4QLRA 1P6AB 2EZ0C 2NY2B 4WO4B 3VRJA 4MD4A 1SVCP 4PJFE 2GJ6A 43CAB 4P3DA 1NEZG 1H5BC 2YXFA 4R2GD 3MV9D 3KJ6L 3KWWA 4PRHD 1F6AA 2D2OA 4HKJB 2I9TB 4FZEL 1EHLL 1RFDH 4L4VD 2VIRB 3AFLA 4MSWB 3P77B 3AS0A 3BZDA 1WAAA 4AEHL 3BPCA 5AEAA 4LVNB 3U7WH 1SEBA 3WDHA 3KR3L 3KPQA 4JN2A 5CBEA 3OKDB 3FQUB 2IADA 4P46A 2ZPKH 4XRCB 3O2DL 4HCRL 1JYVA 3HC3H 4NFDA 1Q0XL 4WTXA 2EDHA 3QQ9D 4PJGA 2X1WL 4PJDB 2ADIA 2ZKHL 5GSVA 3RRQA 1O0VA 4G6FD 2F74A 3G5XB 4XNMB 5LXGH 5EO0B 2DL2A 2ADJB 3VXTB 5EUKB 2Z93B 3G6AA 2OL3H 5T3ZE 2VDOL 1VPOL 2HWZH 1Q9KA 3GRWA 3BUYB 1S9VB 1AJ7L 4Z5RA 1R3JA 1KPVB 3IU4H 5GSRA 3RNKB 1T2JA 5KSAA 5T1MA 5F7NC 2C7UA 4UOW0 5TE6L 1UEYA 4HS3B 1WLHA 1ZAGA 5JZ7C 5HYSG 2HVKB 4NP4H 1C7SA 2R56L 3BSZH 4LEXL 4Y5XC 1NBZA 4PTUA 1UZ6E 3CJJA 1YEEH 4PR5A 4WWID 3HS0B 4PJ5D 3BQUD 3CLEL 4HIHA 4GMTH 5E8NA 1MH5A 5HVWA 1XGRA 5I9QB 1SJHB 2R2CA 4KJPD 2W60A 4GUPB 4M93B 2X7LB 1N4XL 2A77L 5FUOH 2B4CH 1NC2D 2J12B 2WBKA 1JNHA 1YUHA 2BOCB 5KS9E 2B0SL 3S36X 3O41A 4YWGL 4AEEA 1VDGA 4KK9D 5IIEA 4NQSA 4AEIH 1ZVYA 5BV7L 1MLBB 4FN0A 3U2SA 1L7TH 2HMID 1CZ8H 1YMMA 4BH8A 4IJ3C 4G80A 4FQLH 3HG1B 5FDWA 1Z9LA 4HH9B 4ORGB 1OP5K 4KFZC 4M7ZB 1INEH 4NCC2 3QBTB 3L3DA 1A2YA 3BWAB 4XZUB 3UTPD 1EMTH 4DVBB 5JIHA 4QRRE 1LE5A 4ZSOA 1PKQA 1U58A 1XGQA 5T5NF 5C0BD 4UUJB 4U1LB 4L8BA 3EDDA 1H3XA 4OFKA 4Y0GA 4AQOA 3MXWH 1KB9K 1D5BB 2HVJA 4IRZH 1IFHL 2OQJA 4DJMA 4UZGA 4NQCA 2L7JA 2FJGA 4ODWA 5BJTB 4KKCC 1CDBA 3DOSA 3RL2B 4PRAA 3GI9L 1SYVA 4G8GB 2ZSVA 3JV6A 2YKLL 1A8JH 3IFOA 1RPQA 2EH8L 4JFOB 3FOLA 4LCIH 3VXSD 1U9KA 1P69B 4YHLL 3C60C 3OJDA 5FKPB 5F9WC 1AKJB 2J7LA 1T7XA 2Y4SA 5FOJA 1WCBB 1FC2D 1FP5A 5HVFB 1HXYA 1WFTA 5D7IA 1CD0A 1NMCB 4Q9RH 2P5WD 3RJQB 1KCVH 5HGDB 4ISVA 1CICA 2KKQA 1KEMH 2CKBB 5D96B 5FGSA 1KB5H 1QFUL 4M1CD 4JFDE 4XMKL 3RAJH 1S7SB 5ESAA 1EEZA 4OLYL 1WT5C 3NIDF 4L29A 4X5XB 1GL4B 3GSNH 1I3RB 1TFHA 2X9XA 1GOGA 1DVFD 5ALBH 2V7NA 3VXNA 3BGMB 4LPVA 1D9KB 3GSQB 4X6BA 1X5HA 1A3RL 2ICEA 3TZVD 1TZHA 5GJSL 2XFXB 1N2RA 1MCDA 1UG9A 2AJYH 2M8XA 2VL5B 1EBPA 1Z5LA 4QYOA 3QQNA 5D72L 4G9FB 1CGSH 4QCIB 1C7TA 4GW1A 1IGYB 3RWFA 4LBEB 3EYQC 2YSSB 1A6AA 2BNRB 1AXSB 2PYEE 4LGSB 4B7IA 1D5XB 5FGRA 1U8HB 2P46B 1V3MA 3MYJB 3TPUB 4LCUA 4LHUA 2EYRB 5TQ2H 1EXUB 5I1IH 5HHME 1FH5H 1TLKA 4R4FL 2BNUB 4JQIL 1JTOA 1AY1L 1JHTB 1MWAB 5DGQA 3KLHD 5EDXA 3X3FL 1A3LL 4P59L 3V5KB 3RZCD 4ETYA 3WUWA 1G7QA 4MCYA 1B0GB 2KZWA 4U49A 1XR8B 2PW2B 4TPRH 2EEAA 1GAFH 2YPLA 2OZ4L 4K7PX 4YE4L 3TA3B 2RHEA 4Z0BH 5C0AB 3VXOA 3MLYH 2B2XH 4UDTB 1I3UA 4WW1A 2JCCE 1RZJH 3QHTC 4Q6IB 1KSRA 1G7IB 3O6LL 2FJHB 3D85A 4GRLC 5TDNA 1KIQA 3MOQA 5DYOA 3VFNB 1FO0L 4KUCD 3NCJL 4Y4KA 4S1DC 4KUCF 4EDXA 4E42A 3NTCL 1V7MH 2FIKB 3ZE2F 1GGCL 4WTZA 3GGWB 1JZ5A 4YIQB 1W72H 4JHWH 4FNLH 5F96H 1TPXC 4ETQA 3C09B 4NBYB 4F9PC 4KK8C 1EUUA 1AR2A 2ENSA 5J1SC 5LGHH 4D8PA 3LKOA 2FX9H 2D9QB 4YQXH 5D2NE 1BAFL 3ARFC 1D5ZA 3WFCL 5IVXA 2WUCH 4M8QB 4RFOH 2FO4B 3EO1A 3BEWA 2GI7A 4LCWB 2DBLL 4G6MH 5DQDL 4Z9KB 5CBAB 1H5BA 2DM4A 2D4DA 3NA9H 3QDMB 4X6CE 3QJFB 1D3CA 3F65A 5F71A 4N0FA 4XCEA 1E0OB 4A6YH 1EO8L 3P0YH 1CFQA 5GRVK 4MNHA 5D1XB 4YHOL 3SDCD 3DNKA 4R7NB 4HAGA 5JNYA 2EDKA 1PG7L 3HI5H 2YA1A 4PV8A 5CJQH 1AIFB 4IRJC 1HE7A 5ESQB 2BRQA 1YECH 2FH8A 5IMMA 1MHCA 2YD2A 2QQLH 3V6FA 2VR5A 4RAVB 1BWWA 1MJ7H 4AEFA 2CDEA 3CFCH 3HMXA 1I7RA 5MP6H 3TJEL 4PIRF 3SKJL 1OAUH 3OKMA 4JGUA 1HINH 3HHRB 1J8HD 2ZCLL 5JO5A 2ZUVA 4ERSL 5HYFA 1T21A 5KW9H 4APQB 4DTGL 4IDJH 1T66D 5EOTA 3RA7L 2OTUA 5IROC 1VB9A 4U1KB 4WY7L 3RFZC 4Y1AA 4KI5E 1F90H 2DQCH 3NCEB 2Z31D 3B3IB 1P53A 4HSQA 4F7CB 1GVIA 4PJBE 3L6FA 4ESKA 1WEJH 3BYTA 1Y6NR 3OXRB 5CKGA 5F7EL 3Q6GH 4N8CL 1CD1B 4YZFF 4YGVA 4TRPL 3T0VA 3GSVB 4ODHH 1DLFL 2Y06H 1F42A 3H9YA 5IJKC 3KYOA 2D03L 4Z7WA 2P7TB 4NQEB 3GSRB 3AAZA 3NN8A 4JDVB 5EU5B 5HI4C 5E00B 2Z92A 3RNQA 4GKNA 3JV0A 4YBLC 3TN0C 3MV01 3V6BR 4LLUA 4ZUVA 3B9KB 1RUPL 2VQTA 3MRDA 2E6JA 3I6KA 1U8NA 2P1YA 1XGTB 4HIXH 4QRPA 1CL7L 1LO2H 5I6XC 1CXEA 3QRGL 4YDVB 3SY0B 3C6LA 1HI6B 3QQ3A 4JZNA 3PHOA 1BQLL 3NIGE 2UUDK 4NO5B 4PJ8C 5KSUA 12E8H 5H37H 2PXYD 5BMFL 1A4JA 3PXJA 4JHAH 1OAKL 5GXBB 4I5BB 2R9HD 4KDVA 5I8KH 3U4BL 5CWSB 3MBXH 4LCCA 3FFCB 3RIAF 2GTZA 4P4KB 4I18B 4ZS7L 5EU3B 1L6XA 1RUMH 5EN2B 1F45A 2QSCH 3V7AG 5F7UA 4H20H 4U6YB 3SE4A 3IGAB 4NM8L 35C8L 3IDJB 1DDHA 2D0GA 4IIQA 4M7LL 2V9QA 4FABH 3Q6FA 1NEUA 1JGVH 2HLAA 4HWZA 2NNAB 4RRPA 2GKIA 2G2RA 4HX1A 4PBVC 1JZ7A 3WFDL 1CDGA 4G7VL 3MJ9H 1IAOA 3P40A 3GUTB 3DYMA 3QPQC 5EBMA 3J8F7 3GMNA 3CDGA 3SDYH 2O93L 1FVEA 4ZNEA 2VYRE 2EC8A 3MRIB 5JDSA 3NZHL 4G6AC 3WJJA 5C0CA 3ULSA 1TVBB 1E4WL 3DSFL 2J8UF 2DAVA 2BVYA 4M3KB 1BQUA 1RHFA 4MD0A 1LD9B 3QFDB 5E24E 1WT5A 2FDBP 2FR4B 3VWKB 5I1CL 4PY7B 4KMTH 3A6OA 3U7AA 3ZKQD 3VW3H 5KSBF 3QCUH 4ZFOB 2DF3A 4ONOA 5DFWH 2R0ZH 4OF7A 3PF2A 3C2AL 5ESVB 4DVRL 2Q3ZA 2UWEB 3ROOB 2NY4D 2N1KA 3LD8C 1NGYA 3FB6A 1AGEA 1RJLB 3MZTA 2YN5A 3HE7A 4PJFF 1PBYA 4WU7A 1D6EB 2YPKA 1HH6B 4WHCA 4NT6B 3VWJB 3MV7E 2SEBB 4JANB 4Z7UA 4F7TB 5ISZE 1K5NA 3TNMA 3DV6A 4UT9L 3ZDZE 3NMEA 4J4PA 4YHZH 3DI3B 3UMTA 4E41A 2BRRH 4NWTH 3FN0H 4HUVA 1DBBL 1LWRA 4NKIH 3LAFA 3O4LE 2Q8AL 2FIRT 5F7DB 5FYKL 3B5HA 3ZLQC 4NKQB 1TTUA 5D6CA 4Z77A 3BD3A 5LGKA 1JHLL 3TV3L 4V1DA 1CK0L 1WBXB 1HHIB 5IVZB 5C3TA 1J88A 3L3HA 3MLRH 3V4UL 4P2QB 2DQTH 1AD9A 5GGVY 5T3ZD 4PJXA 1PLGL 4KVNH 5J6GA 1Q9LA 1I9JH 5D5MB 4KY1H 1HHJB 3MO1B 3TCLA 2FGZA 2NY2C 3G6DH 5I1HH 5ICZA 4WO4C 3EFFB 3L5XL 5JA9A 4OQTA 4X7SH 3SDXE 5SWQB 3GHEL 5HD8D 3W39B 2GJ6D 4N0CD 4XWGH 4MB5A 3UTZA 4EEEA 2QV2A 1QFWI 1XCQB 1FN4B 3RPKA 4KKLD 3O6KH 1RIVL 3TC9A 1NDMA 5DEFB 1C08A 4WUUB 1RAMA 4LVNC 3L7EB 3ZTNH 4LF3A 3Q48A 4X4YA 5BZDA 4MAUL 1VA9A 1ZHNB 1KCRL 1DP0A 3BKCL 5D7JB 3GIZH 1R3HA 2YMXH 3KPTA 5JOPE 3C5JB 4GAYA 4F9PA 3CFBB 3A6BL 3DVNB 4Y8AA 5DDHA 4JM4L 3NPZB 5IBLD 1A9EB 2OX5A 3OZ9L 2D7QA 2PNDA 3GKWH 3P9LA 1JNNL 1QFPA 3Q3GB 5GGQL 3LRGA 5KS9F 4MJ5A 4KTDH 4POZD 4XNYH 4HUUB 5TGBB 1Y18B 4Z7VB 5F3HA 5BRZE 4TVPL 1R24A 4KKBD 4Z95H 2Y6SC 5DSCB 1LP9E 5E9DA 1NANH 2EIZA 2NY7L 3D0VA 5MEOB 2QR0A 3M07A 4XPBL 3S6CA 5KSAD 3ZHKA 5F6IB 4OFYA 2WBJD 3HKFA 1A6TB 4EUPA 3K4DA 5IB4B 4H88H 5EOQH 3QXUA 3P4OA 2IANE 2GUOA 2LVEA 4CDHA 4QRRD 3S34L 1QKZH 5FYLL 1MQ8A 1EJOH 1J05A 3LKPA 4JRYD 2F19H 4HHAA 5I9QC 3W9DB 1IM9D 3MBEA 5HGHB 2CR6A 1XGPA 5I8EB 4C59B 2CLVA 4M93C 3TBVA 4BK5A 1PFCA 2XZQL 3GIVB 2ED9A 4JCLA 3WO4B 3QDJA 3GMLA 3E6HA 3TFKC 3V6ZA 5BXFA 1DJSA 4GAGL 2ITDA 2YN3A 2XV6B 3DX6B 1ZLUH 3O81A 4HUXB 3U0TB 3DYPA 4AG4L 1BIHA 4JJ5B 2WSKA 2AV1A 1MI5A 4HJJL 4X6DF 5I1JL 3EJJX 5FK9A 1E6OH 4U4BA 4LSUH 1ORSA 4HFWB 4CMHC 1ZANL 4XGZB 4EJ1C 1X6NA 1HHKA 3N85H 1SY6H 3AB0B 1TZIB 3WHXA 1U8OA 5F1KC 4M7ZC 3ZYIA 4JFDD 1VGEH 2V17H 2VSDA 2UY6A 4TTDC 4F57H 4L8SB 4P2RB 1T7VA 4PRBA 4LLMA 4XMPL 4HPYH 4X7CC 1FFRA 2EC9T 5C2BL 3FRPG 4PJHE 3I9GL 4LQFH 4G3YH 1BD2E 1X5KA 5CEZL 1FNEB 4G43B 3V6OA 4YDIL 1G7HA 4F7MB 3TH2T 5D7KE 5HYIA 4EXPX 1QBLH 2Q3AA 5EBLB 1T1XB 1ZTXH 2X4QB 3O11A 3ARXA 4KU1A 4LOUD 4X7TA 2JJWA 1W0YT 4NC2B 1M7IB 1Q94B 2FL5A 5I18L 1G7LA 2PYED 1JPGA 2VDML 3BGAA 1FBIL 5IB3B 5KN5B 2DQJL 4JFPA 4DN4L 2CUIA 1UB6A 3RI5K 1T89C 5GZNC 1NMCC 3CCHB 4YPJA 4PJ8A 3G5ZB 3KS0J 3QCVH 4OCNC 3QFJB 5BVPH 5HHMD 2C1PA 3QXVA 2R69L 3HPLB 5FM5M 5D96C 5EUOB 2VQUA 3FB7B 1FG2A 2IFFL 3KPMA 2HG5A 1UCBH 1LO0L 3VFVB 4FFWD 2XA3A 3HAEB 4IDLA 1QSVA 3V4PL 3F5WA 1MCEA 3LZFL 4RGNE 1I8IB 5JTWA 3SE8H 5JOEA 3FQWA 3GBNL 4MJIB 3T0EB 2QLVB 1S7RA 1D9KC 4QHNB 4MA7H 3VRLE 3FTGB 5ID0B 3ROLA 3GSXA 1GIGL 1BLNB 2JCCF 1EFQA 1JWMB 4JPVH 4KUZL 4MWFA 5FGCB 4OGXH 5C0FA 3GMMA 3WD5H 3O6FA 5B4MD 1I3GH 2VXTL 4Z7NE 2HP4A 3H8NA 3HA0A 2X42A 5SWSB 3MRJA 1T04B 1K8IA 2HTLD 1MCBA 5IHZA 1NUDA 1SJXA 3V5HA 3EZJB 3EYSH 1RZ7H 2YD5A 5GRUH 3H9HB 2XTJE 1LILA 5B38B 4ALAL 2D31B 3KPSA 1RJCA 1QACA 5DMGD 3VFRB 5AAWA 4FS0A 4LVEA 1DN0A 1UEMA 1OD9A 4PJAA 3W2DH 1BZ7A 4PRPA 5K9OA 4JFEA 3L5WA 3W81A 3PGCA 1FYTE 2E7CA 5FV1L 2H1PL 3WFEH 2BJML 5E7FA 2X4RA 5BS0D 4U6VH 1O5DT 5C6TH 1PKOA 2PW1A 4BKLB 5CJ8A 4R4BA 4X6FB 1OGAB 4M6OH 4DZBB 3D3VE 4X6CF 3TA3C 2AKRB 4NSKA 2H9GB 5I1GH 4D0CB 1MCWM 4O51B 5FUZL 4B5EA 5T1KB 2GIYA 3C6SA 1S5IL 3WFHA 4Z8FH 5JW4Q 2CDFA 3KXFA 5H8DA 4Q6IC 5E5MB 1NMAH 1EUTA 5EU6B 2X4UA 5H2BA 2E7LA 3ELAT 5D71H 1FL6B 1X5YA 1TXKA 2P43B 1DL7H 3UZVB 4PGBB 1R3LA 3EZ8A 4IS6B 4NQDB 3PIQB 4NO0D 2YXMA 3PV7A 2NXYB 3C09C 5AWNH 3QEQB 1JWSA 4QY8B 3NGBB 4E0RB 1OQOA 3QISA 3QUXD 5JHDB 2J6EL 3KDMB 3RVXD 1EERB 2XQBH 2EIDA 3VRIA 3I6GB 3P11L 1WICA 2QKIA 1QLRA 1NCTA 1IGCH 4KI5D 4KI5F 2JIXD 4TN9A 1S9WA 5C07B 1IAMA 5TE4H 1IGMH 2OI9B 1S7XB 1S7VB 3BT2L 1KT2A 1N7ML 4I48B 2I9TA 4MSWA 2VIRA 3FO0L 4K3GA 4PJBF 3BW9B 3S3SA 5DJDA 1WITA 4NNYA 1MFAL 5D1XC 2CKBL 4LDLB 4BQBA 1IKNA 5DD3H 3H7BA 3HNTH 3FQUA 5KG9B 2QTEA 1PX4A 5T5FH 5CGTA 3HNVL 3I75A 4WHTB 1KCSH 1GC1H 1J86A 4OZFA 4LLWB 3GI8H 1XEDA 4ONGH 5EU4B 5CEXB 4GG6E 5T5NG 1MHHA 4HH8A 2DQHH 1IKFH 4Q97A 2FB4L 2XNAA 3G5XA 3OG6B 5JOFB 1CBVL 4ELMB 2OP4H 5ADOL 5DXWA 4QHMB 4JDTH 4MQXD 5EUKA 5HHXL 1I8LC 4POUB 3P0VH 2FO1A 3MUY1 5C08E 3IJYA 4JPKH 2NX5B 4APQC 3DGGA 1U95B 3H42L 5L6YL 3RNKA 1YEDA 1YY9C 3I3DA 4L5FH 2CMRL 4HS3A 3LV3B 5DO2C 3QAZB 5FHAL 5DRZA 2V9TA 4OSUL 4OLWH 1J9CT 2DM2A 5C09B 3NIGF 4PGDA 5KSVB 2XKNB 2GT9A 5FM5O 1I1RA 4JFXA 1UGNA 3TBTA 2YEZA 4HF5H 3VMNA 2XZAL 2MSPA 4U1MA 4B0MM 4YAQB 4HUMB 1UACL 2QADD 4UV4L 3F6IA 5E99H 3SN6N 1Y0LA 2AK1H 4O5LL 5BZWB 4LRIC 5E03A 3PWJB 5FUCC 4GUPA 3F7VB 4DCQB 5FM8A 3OR6A 3AUVA 3C87A 1WWWX 5EZLA 4DK6A 3K8MA 4DGVH 2EH7H 2YZ1A 2AEQH 3Q1SL 2XN9A 2NY5C 1ACZA 5DT1L 3TBWA 4XVTL 1RMFL 5IG7B 3A6CL 3IXTA 1R5VB 2ORBL 3X3GL 3FHQA 1H15B 3RWCB 3QWOA 2OSLB 1W0WB 1YNTA 3B9KC 4MD5B 5CGMA 4L8DB 2DBJA 4I3SL 1J1OL 2J4WL 3KLDA 4L3EB 5EB9A 3M45A 2ICWA 5CZKA 3HG1A 2B7DT 4AEHH 4PLNC 3DMMA 3D39A 3KR3H 3RI5F 43C9A 5I8OL 3V4VH 3C6LD 2Z35A 3BWAA 4HCRH 2E8ZA 3QCTL 4XZUA 4DVBA 3DIFB 4PJ7A 1Q0XH 2AI0L 4X80L 1K4CB 1ODAA 3PL6A 5KVDH 1NLDH 3ZO0A 2IPKA 4P4KC 3TO4A 4I18C 5E70A 4P3CL 1L4IA 3CDFA 4WV1B 5KJRL 5BJTA 4KZDL 1EEYB 1VPOH 5MENE 1A1MA 1AJ7H 3MV7D 3UJTL 3LIZL 3UBXI 5FKPA 2VLJA 3K8LA 1QNZH 1B2WL 3X11A 2LU7A 5EOCH 4EIZC 1IC1A 4RAUA 3UTTB 4LGPB 3ZDZF 4PV9B 3MREA 4FXGB 3T1FA 5EC1A 2R56H 4LEXH 1CYGA 2F5BL 3BE1H 5J6HB 3QR2A 2CKNA 4GG8B 2VLME 5HGDA 2A6KB 5J3HD 1IC7H 1RUAL 4EI5D 5KTEL 2DLFL 3QDGA 1LK2B 1S7SA 5K9QG 1ZT7B 3SO3B 5GS1A 3R0NA 4L4TE 3VWKC 5C9JB 4OKVB 3TGXA 1N4XH 2A77H 2VR4A 2NY6D 4JO1L 2A6JB 5FA3A 4R7DB 1E28B 5DJYB 3N1GC 3NFNA 1F58L 2B0SH 5FXCH 1CE6B 1NGZA 3HRPA 4QRTB 5J9PB 1I85C 1KJ2B 5JA8B 1T20B 5TF1L 4BM7A 5C2UB 5EIIA 1WFUA 5L8LB 3BP7B 4Y4FB 1KENL 2IH3A 2VL5A 3VWJC 5FFLA 3RVWC 3MODL 5C0ND 2YSSA 3I84A 2OXHA 1HN1A 3ARTA 3QIWC 5A3IC 5BW7A 5F88A 3BN3B 4Y5YB 4Y2DA 4R96A 1DQML 3F58L 2EYRA 3PQYD 1J1XH 4OM1L 4OZGA 5HI3D 3WL9A 3L3IB 2BNUA 4PLJD 1IFHH 1JHTA 1MWAA 4RQQA 3T65B 4RX4A 4X4ZA 4TTGA 3V5KA 4CU6A 5F9DC 2NY5L 2AQ3A 32C2A 3GI9H 5I74B 5BRZD 4Y16B 3G6JB 2FHCA 2EE6A 2PW2A 1V3JA 4YHLH 2JLLA 1QSFB 4X4XA 4BELD 1ADQA 1NPUA 3BP4B 1LP9F 1RK0B 5C6PB 3WXWL 1F11A 1RHHB 4Q0XL 4UDTA 1UM5L 1B0WA 2NY0B 5A16A 5FF6A 1WZ1L 3IF1B 3MLUH 5AZ2L 5DJCA 3HZKA 1G7IA 4QOKB 2YPVH 2CDGB 2IAND 2VAAB 3VFNA 3QXWA 1CVRA 1KEGL 1G7PA 1V8HA 2FIKA 3OKOB 3NZ8A 4XC3H 1OCWL 2BHYA 4IMKC 2VL4A 5D7JC 4XX1G 1SYSB 1T03L 4FG6D 1CGUA 4NNPL 5IW1A 1A02N 4IRSA 2NW2B 4FQHA 2EDEA 2IGFH 1KV3A 4F15B 3OAZH 2A0LD 4JJHA 5HXMA 4LVHB 3RTQB 1A3RH 3O6MH 5GJSH 1NAML 1A9BB 4QHUB 4CVXB 2ZUQB 3GSOA 3QJFA 4N0UB 5DRWB 1A5FL 1FJ1B 3QQ4B 5HVHB 4WUKL 1J1PH 2V2TB 3CVHA 5GJTL 4XCFH 3C9NB 5F6IC 4M7KL 3EHBC 2JELL 2UZXB 3C5ZB 1I1AA 3O9WA 3PG2A 2RAMA 4XTRD 3BPNB 5DQJA 5ESQA 4FQXB 4I0PA 4JAMB 4LLVB 4R4FH 4YXHH 4PJHF 4ZFOL 5L2JB 4RAVA 1KNOB 1NGWB 3X3FH 1Q1JH 2YUZA 1BD2D 2AABL 4BQ6A 2QQKH 1QHPA 1G1YA 2J2ZA 2R2BB 4OZHB 4UQ2A 5D7KD 1JGUH 3G08A 4MJ6B 1NCUA 4C54A 4KWUA 4PLKC 4U1HB 3WO4C 1ZLUK 2OZ4H 3MNZA 4YE4H 4TUKH 5EBGA 5C7XL 5F44A 2VDKL 2VZ3A 4NQVA 4U6HB 4LFHG 1ACYL 1MY5A 2EDBA 4I1NB 3E6FB 4QRSB 1YEIL 1JYNA 4ELKB 3S35L 25C8H 3TH3T 3T8XB 4FQJL 4XPFL 1T5WA 3O2DA 4OV5B 2VWEE 1S9YA 4F7CA 1FO0H 3NCJH 5J56B 2GSIB 1QSEB 3MV9B 3AB0C 4HC1H 4M1DH 4OD3L 3OXRA 4PRHB 4OLUH 3VXPB 5KVMC 1N59B 4RIRB 3QEUB 4HUWB 4L4VB 3B8SA 2MWCA 4L8SC 3H9SA 5IB5A 5J8OA 4ZOCA 4QKXB 2BY2A 1PW3A 4NQCE 3RUGE 4RMUA 4RGND 4XP1L 5CD3B 2ZUTA 2VDLH 2P7TA 3GSRA 1BBDL 2YD3A 3T0DA 1ZGLP 1JPFB 4GBXB 4MVBD 3MRHB 1BAFH 4OUUA 3WFCH 3HB3C 4L8CB 3O2VH 1RUKH 2DBLH 3VRLF 1FSKB 4R97B 1BBJB 3AVEA 1FLTX 4H0IA 4ZAKD 3TEUA 4N5EC 3PWPA 1BVKA 3REVB 2KBGA 1LO3L 3WN5A 1FNSL 5D7IE 2IMNA 4M43L 4TULH 4JFHE 4S2SB 4WWKB 1A1OA 4Z7NF 5ABDE 4YDVA 2W91A 1NBYB 3BFOA 2EO1A 3REWA 1H8SA 4ORZC 2DLTA 3GMOB 4KK6D 4P2OD 1YPZB 5DFVC 5E1AB 5F1NB 2EYSA 4YDLB 2XTJD 1V3KA 3CSPA 4Y19D 4W6WB 2KDGA 3H0TB 5CWSA 2O5ZL 4TSCL 2Q7YB 5I66A 3DYOA 4MAYB 3PWNB 4P5TB 4PJ5B 3OF6D 3S96B 4HKZA 5EU3A 1FYTD 3V0WL 3TJEH 2FX8H 3SKJH 4H1LG 2Y9RT 3IGAA 2P24A 3IDJA 2I24N 1OM3L 5DGRA 4ERSH 3DO7A 2PR4H 3SQOL 5HHPA 3T0EC 3D3VD 4JZJA 1MLCA 3RA7H 3QO0A 1BVLB 4UQ3B 3CLFH 5IEHB 4EQ2A 2CJUL 3PGDA 4MNQE 3GUTA 4PJEE 2DQFB 3TVMA 1LE9B 2NXZB 2R0WL 3QJHB 3O3EA 3H7LA 2E8YA 3EDEA 3BZEA 5IB1B 1NCCL 4OKDA 1T1ZB 3OJMB 4HS6A 5F9JB 3HUJE 4HBQA 4M61B 3LKQB 4G9DB 3QUML 2BVPB 5ENWB 5F7EH 1I7UA 4NKDB 4N8CH 5FA4A 2Y72A 1XGUB 1LNUA 2DLGA 2WQ8A 3QFDA 1DLFH 4LVOB 2ZG2A 1ZSDB 2D03H 4Q2ZB 5DJAA 2XY1A 3JTSB 1NDGA 1NGQL 3QIUA 3KPSD 4ZXBA 3TNNB 2UWEA 4M1GL 3UTSE 5IVOA 1BJ1H 5ADPL 4OCMC 2G75A 1RJLA 4DOHE 1D6EA 4D94A 4C57C 3VWJA 3N50A 5JW3L 1ZWIA 1RUPH 4JANA 1F4AA 1Q72L 2P8PB 5B38G 4RWHA 4TQEL 4LSVL 2YD4A 1CL7H 1MHEB 1H3UA 1HQRB 2G9HA 2E7MA 1MOEA 2OCFD 2P8LB 3S4SG 4K3HA 3LQAL 1S7QB 4NZTL 3P4LA 3DRQB 1JMZA 4MLSA 4NDMB 3OB0H 3OV6A 1OAKH 3U36A 1JNJA 1DCLA 4LMQI 4H8WL 1JWUA 4GH7B 2ZG3A 4OF0A 4CRPA 3PWVB 3CC5A 4GG6F 3IJSB 2P8MB 3FQNB 3V0VB 1WBXA 1HHIA 4PG9B 1FGVH 4YHKL 1ZLVK 2NXYC 5IVXE 4CVZB 2E6PA 3QDHA 3NGBC 4U1NA 4U31A 4NRZB 4XPHL 1SM3H 5D5MA 2IWGA 3BKMH 4ZG1A 3MO1A 5C08D 4PRIA 3BRFA 1BIIA 1VKXA 3QEHB 1KXTB 2Q20A 1AP2A 1DVFB 2WWKO 1IL1B 1NFDB 1PYWB 1OGTB 1QR1B 2BFVH 4OCRL 3ZL4L 1KJ3H 1ZGLM 3VI3E 3TZVB 3VXMD 2OI9C 5SWZA 4KV5E 4JPWH 5T3ZL 1AO7A 3DPBA 1J0JA 4WUUA 4UTBL 3BUTA 3L7EA 5HI5D 4IMKA 1T4KB 2ATKB 4I3GA 2RR3A 3PHQB 3V79C 5EORL 4YDJA 2UVFA 4N9GB 1EEQA 3C5JA 3CFBA 4NWUH 3DVNA 4XXDA 1P5VA 3C2AH 3VFUB 1LEIB 4DVRH 1RZKC 1S7UA 5DUML 3OHXA 1TVDA 2XZZA 2ZG1A 2RB8A 2A74B 2HKFL 1EGJL 4OFVA 4HUUA 3ULUC 3SDDA 3L95B 1EX0A 1Y18A 1A6UL 4X4MA 2PO6B 1Q9WB 3B2UD 3RZCB 1FZMB 1S7WB 1G6RB 3SGKA 2A83B 5DSCA 1A7NL 3F12B 1EVTC 3V52L 3K46A 4UT9H 3VXRA 1NCBH 2MCG1 1GZQA 5MEOA 1EVUA 5SX5H 2D7PA 5GZOD 4PG2C 2RFXB 3QAZC 4NGHL 5IMLA 5C0IB 1M05B 1U3ZA 3UXFA 1F13A 5C9KA 1GGUA 2IAMA 1ZHBA 3UBXB 1ORQB 3DETC 3O3AB 2H2SC 2O5YL 2I25N 4PJIF 1UQSB 3INUL 5I1DB 3PDOB 3GEWB 1P9MC 4ODUB 1QRND 4EBQL 1MJUH 1CK0H 3BISA 1PSKL 4I2XA 3FO1A 3FT4B 1CFSB 5I8EA 2ZZUT 3F6LA 2AJSL 2AEWA 4LL9A 4P9HC 2AJUH 3RDTD 3GIVA 1JUFB 2FZ3B 4IMLA 1QO3B 1GZPA 3LS5L 5JW4N 1XR9B 4KI1A 1JPTL 1YYMH 2NR6D 1AH1A 2EXYC 4LCYB 4NZDA 3DX6A 4QRPE 3KPLA 1U6AH 4NRXB 5HDBE 3L7FB 2AV7B 1V7NL 4FFZH 4FRWA 4G5ZL 3U9UB 3R0MA 1WF5A 4QGYA 3T0BA 1RIVH 1XIWA 2VLMD 2XI9A 4LPXA 5EIVA 4KVCL 3CH1B 4ODXB 2YUXA 1P4LB 4GRWH 3A67L 4P3WA 3D9AL 5I1LA 3BKCH 3DMMD 1J0HA 1VEOA 4P2RA 4KZEL 3ZT7A 4XBPB 3SDCB 1PQZA 3K4ZA 4JY5H 3CZJA 3BP6B 3QXDB 4L4TD 2E6QA 4QHLB 5D93C 2WWKT 3IDGB 4PRNB 2X4PA 2Z0BA 4PJ7F 5EZJB 4MX7A 4QXGH 3PL6D 3QWQB 5DVNA 4GAJL 4WV1C 3MR9A 5J4MA 2BVTA 4JM2D 1N5YL 2BZDA 4JM2F 2X4QA 5CP7B 3ZE0F 4QXWA 3HMWL 1N5AA 5HDQL 3VH8A 4ZNEE 2GW5A 3OX8B 1J8HB 4FQQB 4JQXA 5GGTH 5C0CE 4RMWA 2W65A 4XPBH 3BKJL 3O45B 5JDJA 4BA8A 1HOCA 2L7UA 4K3JL 5E56A 3D69A 1FL3B 1ZT4A 3RBSA 1MEXL 3G5ZA 4F33B 3S34H 5D1ZB 4FFYH 3HPLA 4KRPB 5HHNB 5MERB 3QPXL 1H3TA 4PJCE 5I2IB 3ZKNC 4OCXH 3FB7A 2P5EA 2NZ9D 3BAEH 3I02B 1ZLSH 3P9MA 3SO3C 3ULUL 3L1OL 4AIZB 2X6MA 4G42B 4PB0L 3RJDA 1I8IA 1U8IB 4OZIE 2GSGA 4OCWH 5DD6B 2EEDA 1CLYL 4H5SA 4FTVB 2YHGA 4HK0B 5E8PA 4LPUA 3TT1L 4F7EB 4M7JL 4HUNB 2X4TA 3TYGL 5E8DH 4YDKH 5ID0A 4WJ5B 1OAZL 1DBMH 4Y4FC 1LEKA 3RWGB 1BLNA 2P44B 1RSFA 1JFQL 1OAQL 4Z78B 1I1FA 4Q9CA 1ZANH 2GJJA 2Q1EA 3LVEA 2D4FA 5C0GA 3UAJC 2AK4A 1VFBB 2HAZA 3MRNA 2K9UA 1LGVA 4Y5YC 3WKML 2H6PB 4XMPH 2O5XL 3CSYB 3WJLC 1N8ZB 1U42A 2CIIA 1EPFA 2QHRH 3OXSB 4POYA 1ZS8A 2N7BA 4XI5C 4XP5H 2XXCB 4PJXE 5L2KA 1BJ8A 3TBSA 3FCTB 3MRGB 1IM3B 3MRCB 4LHQB 4MCZB 1P7QD 4LAQL 4YNYB 2ESVE 1OW0A 2R1YA 5I74C 4Y16C 5BO1H 2EKSB 2OJEB 3IAQA 3MCKB 4BKLA 4X6EA 3DARA 5B39A 5HPMB 3QI9D 1SEQH 4OLXH 5E4IA 4RBPK 1GGBH 1UJ3B 4D0CA 4NHUB 3KPRA 4O51A 2DQJH 3ARDB 5T1KA 2DKSA 1F4XL 2NY0C 1UENA 2P47B 1YN7A 1KACB 5D7LB 3K1DA 3ZDYE 4FZ8L 3LY6A 3KPPB 3RWDA 1AGBA 4MXQD 4L3CB 2R69H 4ODBD 4K8RC 5EIQA 3W0WD 2GITA 3FL7A 4PYHA 1AGDA 2IJ0C 2IFFH 3PIQA 4LLDB 1LO0H 1A7BA 4WCYH 3SJVA 1FRGH 1L7IH 2MPAH 4HWBH 5CD5C 5KZCB 1OVZA 3MFFB 4NKOB 1ZHKB 3U7WL 5D2LA 1Z9SA 3LSOB 4E0RA 5JHDA 1GJIA 4F15C 1XZ0B 2XTLA 3GHBH 1W0VA 4ZOBA 4LVHC 3RTQC 2ZJSH 1U3HB 1Y6KR 5EZOH 3AS3A 5T1LD 3KJ4B 2VJXA 3VE0B 2ZUQC 3RWHB 5LXGL 1AXIB 3G5YB 4NJ9H 1Z3GH 2ADFH 5HVHC 3BW9A 1P84K 3DX8B 2VZVA 1LDSA 2HWZL 4JRXB 1AHWB 4MNGB 1FFOB 4WGVB 4XHJD 4FOMA 4HPOH 4ODSL 2FECI 1U8LB 4C56E 5E0QA 3C5ZC 4GQPH 1EEUA 3ZYZA 5KG9A 3O2WL 3IU4L 5EG6C 3BPNC 5DMIH 5DTFB 4FQXC 1T3FB 4KQ4H 1QFWL 3RUGF 2DJSA 3ZT6A 5JXEA 5CEXA 3VD3A 5IWLA 5L9DL 3BSZL 3QIBD 5JOFA 4CNIB 4ELMA 1QFWM 3R8BB 2H1PH 4QHMA 3HNSH 4KHXH 5IK3A 5K9KA 2BC4A 2W38A 2FYYB 4JFFD 3D18B 5CHNB 3IDNA 5F7KC 1MVUA 1B4JH 4EXKA 5DHVB 1U95A 1C16A 4OZ4A 3HLAA 4QT5A 4JFHD 1S5IH 5FUOL 3MGAA 1HEZB 1YEGH 3OWEA 5EFIA 1FL5A 3O8XA 1FG9C 4ZNCD 2ARWA 5CEYA 4D9QE 1BZQK 3VRJB 1A7RL 4MD4B 2GJ6B 3ARGC 2H26B 4P3DB 4Y88A 2OLDA 4AEIL 1DEEB 5D1QD 3OJ2C 5D70H 1S5HA 4KDTC 1M6OA 3KWWB 4IOFD 4WI3A 1UXWA 4XBEH 3RX5A 5BZWA 1CDUA 2C3GA 3PWJA 4FQLL 2A38A 3H9SD 3MV8D 3BPCB 3F7VA 4X9HA 3BO8A 3G9AB 1N3NA 1SEBB 3KAAA 3Q5TA 1CFTA 1OL0A 5HDOA 3KPQB 1TTGA 4CBPA 5CBEB 1AI1H 4GBXC 1U41A 2IADB 2BVUA 3GSUA 1GYAA 1RJZA 2VLKA 4X9FA 1DUZA 3QQ9C 3P11H 1EMTL 1ZHLA 1I8MB 1SHMA 4QXUL 1BWMA 2VQ1A 1FSKC 1PJ9A 4PREA 4R97C 5KS9B 4MNQD 1W8OA 1X9QA 2ADIB 4PJGB 1TTFA 4PJEF 3EO9H 3SDAA 2F53A 2OSLA 4PP1D 4RMTA 2F74B 4IRZL 4JLRA 1H3VA 4ZO6A 3TCXA 5IESL 3ECBB 3FO0H 1EA9C 2W1NA 3G6AB 1QP1A 3HUJF 4WWKC 2CKBH 4GRWE 3QZWA 4LCIL 4Z5RB 1R3JB 2VRAA 4QWWC 4N5UA 4W68A 3TPKA 2Y1VA 5KSAB 5T1MB 4YDLC 2C7UB 1DANU 2W0FA 3DVIA 3EJYD 3VFTA 3D2UD 3PE9A 3IDIA 4MAYC 1NBZB 4P5TC 4QRRB 5ADOH 4Q9RL 4PR5B 3UTSD 5HHXH 2DIJA 4JRYB 4FFVC 4IM8A 4HIHB 2IPTL 5E8NB 1MH5B 1KB5L 2FX7L 1GSMA 3CIQA 2WP3T 1XGRB 4NHCL 3RAJL 1X44A 5L6YH 1WZLA 1CI5A 4LK4A 2W60B 1KIPA 2BY3A 4FMKA 2Y5TA 5C86A 3UTTA 3GSNL 3UPRB 3ALXA 5CAYB 2OR8A 1JNHB 1YUHB 2NXZC 4FXGA 4JFZH 4OSUH 3O41B 2O26U 4X6DB 1D5MA 1JZ8A 1K6QH 4F80A 4NQSB 2VITA 2AJYL 4JR9L 2HMIC 1TVHB 2ZCKH 3U2SB 1MCLA 1MWAH 1YN6B 4GLRH 4M62H 1ZT7A 4PRPE 4LGRB 1YMMB 2HT2C 4BH8B 3MLZL 4G80B 4LVOC 4OB5H 2EZ0D 5FDWB 4EI6A 2NCMA 1IJ9A 3VU2A 4ONFL 4OIAA 2A6JA 4WW2A 3CFDB 1E28A 1UZ8A 3MA9H 1TITA 5DMKA 3L3DB 3S5LB 3MRFB 1IZKA 5J9PA 4Y89A 3U4EA 1V5JA 5TQ2L 5I1IL 4WFGD 4OF6A 4XVTH 1RMFH 4P4RB 5M95B 4ZSOB 1LE5B 2DDQH 3IVKB 1XGQB 2A9ML 3A6CH 2UV3A 2X89A 5ID1A 3QWRD 3LEVL 2HVJB 5J06A 2J4WH 3VI3F 2FJGB 4JY4A 4ODWB 1AC0A 4KV5F 3NCMA 4PRAB 2QQNH 3MOBH 4BZYA 1SYVB 3MRKA 2ZSVB 3JV6B 3D5OF 2F54D 4XNUH 5E7BA 1AD0A 3FOLB 3NCCB 4TPRL 5ALCH 1GAFL 1ZEAH 3OJDB 2FATL 4UILL 1S78D 3LQMA 4Z0BL 3F7YA 2B2XL 3U30B 2VLRE 3WV0A 1RZJL 4X9IA 3L3IA 1HXYB 2MTPA 1A0QH 4DKAA 3T65A 4P3CH 1X6LA 5D8JL 1P5UA 5JPMA 5KJRH 4ISVB 4KZDH 1CICB 5B3NA 4PBXA 1V7ML 3G6JA 1UKQA 4FXLA 4GW5A 3LKSB 4G6KL 4OTXL 3VJ6B 5JZ7D 3FB8A 4F3FA 1FAKT 1EEZB 4JHWL 1RK0A 5L0QC 4L29B 1B2WH 4FNLL 5F96L 5I30H 3ZE1E 1DVFC 3SCMA 2FX9L 3IF1A 4O58H 2V7NB 3BIKA 2F5BH 3TZVC 2WUCL 4X6BB 3UTOA 2ICEB 4RFOL 1RUAH 1TZHB 1N2RB 1Y6MR 4G6ML 2FGWH 3OKOA 4NQXB 2WM0A 4QYOB 1T7ZA 5C70A 4PJDE 3NA9L 4GW1B 3JWDC 4KKAC 4Z0XA 4MA3A 5D6DC 1A6AB 2CXGA 2FSEA 2ADGA 2FEDD 4HULB 2XPGB 3FRPA 1F58H 1YJDC 4LCUB 2D9CA 2CXKA 4LHUB 3RTQA 5TF1H 1D7FA 2DYPA 3FMGH 1H0DB 3OKKA 4QO1A 3KLHC 2PO6C 4CVXA 3RZCC 4LLAA 1XF5A 1A6PA 3MODH 2ARJA 3CK0H 3E3QC 3RWIB 3P30H 5BS0B 3CFCL 2ED8A 3VXQA 1FJ1A 1G7QB 5MP6L 4BSVA 1Q8MA 3QUYA 4ZPTA 4JG0L 1EFXA 1RK1A 3IRPX 4Y4HD 1WTLA 1EZVX 2YPLB 5SX4H 4CU8A 1WVZA 1QPXA 1KCUH 2HLFD 3U46A 4WFEE 3F58H 4YHNA 5M7QA 3VXOB 1KLFA 2D3VA 4FQXA 4OM1H 5DRNA 3HZVA 4JAMA 5DJ6A 4UV7H 2YWZA 2Q86A 4JREB 4WW1B 3I50L 4XCYA 3C8KA 1F90L 2DQCL 1IBGL 1UXSA 5I16A 1HIML 1KIQB 2NY5H 3C60D 4Y4KB 4EDXB 1G9MC 1WEJL 3MXVH 4NO0B 4JE4B 3TIDB 4U1HA 3UBXG 3GNML 3N1PC 4YHIA 5IUSA 1MAMH 4ODHL 3FN9A 4ETQB 2YD7A 1VEPA 3EAKA 4Q0XH 3CMGA 1UM5H 4D8PB 3LKOB 4P57B 1WZ1H 5AZ2H 2E5EA 3KYNA 2NY3D 1MRCL 1BQHG 5CP3A 4FQIL 1D5ZB 3RVVC 2WWMC 4OV5A 3FHAA 3W5MA 3EUUA 4KQ3H 4D9RE 1WGOA 2GSIA 3MV9A 2JIXB 3NAAH 1KEGH 1CGXA 1A6ZA 4PRHA 4ZO9A 1N59A 4PJCF 4RIRA 3BHBB 4U7KA 4L4VA 2WLZA 4N0FB 4XCEB 5HHOE 3SDCC 3SGDH 1T03H 3X13A 1CFQB 4NNPH 4OZIF 4G8GE 5JNYB 2GTWA 2OXGA 1QEWA 4ZFFA 4PV8B 3LPWA 3MRHA 4L8CA 12E8L 2IBZY 3L9RA 5J12B 3EYQD 5E2UH 4MYWB 5IMMB 1MHCB 5CUSH 2VN7A 4JHAL 3V6FB 1YZZA 2KQMA 3D6GA 1MJJA 1N0XL 2VXSL 2CDEB 3MJ6A 3OAYK 1I7RB 2WQRA 1QBML 1RUML 1TCRB 2BCKA 3OKMB 5CILL 5GJTH 1ETZA 3DRTA 4N8VA 4OBRA 5JO5B 4D9LL 1T66C 1WJ3A 2ZWLT 1T21B 1JGVL 2JELH 1HSBA 1X4ZA 4UU9A 5EOTB 2OTUB 4NBXB 5A2LH 1P84J 1HXMA 3ZKXB 1F4YH 3GB7A 5D1ZC 5DC4B 2RIKA 4KRPC 4Y1AB 4G8EB 1FZOA 1B88A 1WWAX 2Q7YA 2EDTA 1VFAB 3P0GB 1CGWA 3LPGA 3BQUA 2ZSWB 4DQOH 3QDAA 3L6FB 2ESVD 2W07A 2R1XA 4KTEL 5HVGB 2NYYC 3QH3A 4KK5D 3VXUD 5J89A 3JTTA 3MJGX 4YGVB 1MIML 1UH3A 4IBLT 5CJXA 1JNLH 1A47A 4G9FE 1NC2A 4GRLD 4UQ3A 2WNGA 1FC1A 2BNRE 2XWTA 3KYOB 1YEIH 4Z7WB 3S35H 5HBBA 3VW3L 3STLA 4S1DD 1L0QA 4FQJH 4XPFH 3AAZB 3QJHA 1F4WH 3NN8B 2J88H 3ZDYF 3VI4E 1G0DA 4CN6A 5IB1A 2Z92B 3RNQB 4GKNB 4K07A 5F9JA 5TQ0H 4J1UA 4JCMA 4QGTA 4M61A 5CZVL 1VADA 3KLAB 3QNZB 4OD3H 2BVPA 4KK8D 4K94L 1XGYL 4URTB 4KRLB 3RVUD 4LLUB 4ZUVB 4LSSH 1BFSA 3MRDB 4NNXA 4OQ1A 4M5ZL 3BPLB 3ARFD 2E7HA 3U83A 1G9ML 2R0LL 1FDLL 4XP1H 2VC2L 3C6LB 4XNZB 1BBDH 3WS6C 3FN0L 3QQ3B 1C5CL 2FHFA 4JZNB 3PHOB 4NKIL 3DECA 5KSUB 5C0BA 2R9HC 4TSBH 5FOBA 5C0AE 1A4JB 4WRLA 1X3DA 4EN3A 4HUKB 1FYHB 2JB6B 4LCCB 2GTZB 4JHBA 2DKMA 2P8PA 1NCAH 5TDPA 1JF1A 1UJ3C 4IRJD 5DA4A 1MHEA 2C3XA 3UTQA 3VXSA 5BOZG 2I26N 2DQTL 3ARDC 4IIQB 1DDHB 4LSDA 3Q0HA 2KPNA 3Q6FB 1TENA 1IGTB 2HLAB 4KY1L 4C56D 2CRMA 1T0MB 3DRQA 1NJ9A 1U8JB 2G2RB 4HX1B 4R0LA 5LCVL 3HFML 4X7SL 1IAOB 4M9PA 2E27H 5EBMB 2P5WA 2O5ZH 4TSCH 3VA6A 3PWVA 3GMNB 3IJSA 1FVEB 2B1HL 2C3VB 1RIUL 2OR7A 2P8MA 3FQNA 5JDSB 4S1SL 3L3GA 4EI5B 4L1HA 3DX9A 3O6KL 2CO7B 4CVZA 5GS0C 1HQ4A 4LCWE 2ID5A 4DUWA 5ACLA 5GGSY 4MD0B 2NLJB 3QDME 1S3KH 2NY6B 2X2YA 4HQQH 2ZOLA 3GIZL 2YMXL 2CJUH 1U3HC 1DVFA 3ES6A 3KJ4C 5ICXB 1PYWA 3VFGL 2R0WH 2AEIT 5A2KH 3WIFA 3TZVA 1EV2E 4D9QD 1NGYB 2Y7QA 3FB6B 5FO8B 5CCKL 4LSRL 3QUMH 4BUHA 1WSST 3HE7B 2YPKB 1B0RA 1AHWC 2ATKA 1OARH 4Z7UB 2I07A 1RJYB 5I19L 1K5NB 3TNMB 4N9GA 1HH9B 3S88L 4OFPA 4TNVK 3JWOC 3RQ3A 4HUVB 1NGQH 5FO9A 3PQYB 4PJ9D 1W72B 3TN0D 4H88L 2EDJA 5DHXB 1R5WB 5ADPH 4U0RB 2JJSC 3TIEA 1QKZL 2JJTC 1X4YA 2XZCH 1MSPA 5D6CB 1Q9WA 4Z77B 4XP4H 5JW3H 1EAJA 1G6RA 2A83A 2F19L 5DURD 4V1DB 1R3IL 2AVGA 3L3HB 3MA7A 1LP9B 5LWYH 4BUGA 1ES0B 4PUBL 4UNUA 4OI7A 1NGPH 1A7PL 4GRWF 2G60L 3UZQA 4A6YB 4BH7A 2O61B 3QO1A 1M05A 5HD8C 3OG4B 1NH6A 3HI1A 5FUCE 1OHQA 1E27B 4N0CC 3OAUH 2HJKA 5I1DA 4UDUA 2BSSB 4MQ7B 4NQEE 1E6OL 2X05A 3UTZB 3NFSH 5D9SA 5CIPA 5F89A 2R29L 3FT4A 1NDMB 3UCRA 4JB9L 3KPOA 3LRHA 4KGLA 5JQ6L 5L8KB 1QO3A 5ITFB 4X4YB 3QPQD 4X9BA 1VGEL 2V17L 5EO1A 4F57L 1NUGA 1R3HB 4GAYB 2YD9A 4G8FA 4XAKD 5DDHB 4YFLI 3VFWA 1RULH 4L1DA 4OI9A 4F7PA 3ZL4H 1HCFX 3P9LB 2HT4C 5JXAL 3U9UA 3UJIL 4G3YL 4S1RL 4MJ5B 1E6JL 4DGYL 2VE6A 1R24B 3CH1A 4UTBH 8FABB 1P4LA 2EDFA 3RWEA 1UCTA 5FYLD 2R0KH 2G5BA 4ODTH 5E9DB 2EIZB 5L7XL 3D0VB 5EORH 3FFCE 1BREA 3HAEH 4OD1H 4YBQC 3SDCA 5KSAC 2H32A 3QXDA 2ERJB 4QHLA 5J57B 3IDGA 4PRNA 4EUPB 2VMFA 3IB4A 5EZJA 4U05A 5DC0A 2NY1B 2DIAA 5LQBH 4KDWA 5E6YA 2GUOB 2HKFH 1EGJH 4PJHB 1MREH 1A6UH 5IBUG 3I85A 1J05B 3LKPB 4LPTA 1A7NH 2CUHA 5CP7A 4HHAB 1UCBL 3MBEB 4FQQA 1J8HA 2VTFA 2CLVB 3TBVB 2MKWA 2AAVA 1SMAA 3SE8L 3QDJB 2BP3A 4UMGA 2CGRL 1I1YA 3T0XA 3GMLB 4NGHH 1VCAA 5GGRY 3E6HB 5DJ2A 4M6NH 3EGSA 5BXFB 4P5MA 5F7YC 1FZKA 2ITDB 5E2TL 2O5YH 4ZTPL 2Z31A 3INUH 2AV1B 3JWNC 1H8OA 1MI5B 3ALWA 4HK3J 1ORSB 2MFNA 4OGXL 1PSKH 2VDRL 2UWEE 5CEZD 3OTTA 4N90E 1I3GL 2W9LA 1KTLA 3D25A 1IILE 3NPSB 4WO4D 3V9FA 4LQ1A 4AIZA 3WHXB 5DD6A 3LS5H 1I1CA 3T4AA 4JO3L 1ED3A 1AQKH 1JPTH 1KGCE 1RZ7L 3EYSL 4U0QB 5GRUL 5GRJL 4LLMB 2EE3A 1WIPA 3VGFA 1UB5A 5HGAA 4G5ZH 5E08L 4Z78A 3M8OL 3ARWA 3WFEL 4TUJB 2XKSA 1NCNA 4WFFE 1VFBA 4LOUC 3WIIH 4YPGB 1MRFL 5DMJB 4ZDHA 3O11B 3D9AH 1YMHB 4PJDF 1IC4L 4M6OL 5GRVL 4KZEH 2H6PA 4XAWH 3HR5A 1G7LB 1JPGB 3K2MC 4WENB 5IOPA 4P2QE 3U30C 4ZUTA 4K7FA 5HSFA 1DBAH 2PYFA 1NMAL 3ARED 2PXYA 3ARVA 4Y19B 3G5VA 1IM3A 4GAJH 1CICC 2QEJA 2C1PB 5HHVH 4YNYA 2AXGB 1U8QA 2WANA 4HK3N 4XX1E 2EKSA 2OJEA 1FYTB 3HMWH 3KPMB 4RGMB 4CGTA 3K2UL 3M17A 5DEGA 5EZIL 2HKHH 2VKXA 1JZ2A 3F5WB 3PABA 5IP4A 3AXLB 3BKJH 4RFEB 5CZXD 5AWNL 4PY8J 2AGJL 1VEMA 3FQWB 4NN5B 5IW3A 4XVUD 4EKXA 1R3KB 1PG7W 3JUZA 1S7RB 3PHSA 2XQBL 4WFED 1FAIL 5J13B 2AP2A 3GSXB 4L3CA 1TNNA 2BERA 5IKCA 1KIUA 2GY5A 1IGCL 2QBWA 2V2XB 4HGWA 3CUPA 1FFPA 5B4MC 4MWFB 5C0FB 1RZKH 4LLDA 3GMMB 4QRUB 1BOYA 2F58L 2J8UA 3IU3A 2P4AB 2YOCA 1HILB 3JV4B 3O6FB 1ITCA 2HTLC 2E9JA 3HZYA 3BESR 5F8QC 3ULUH 4TNVF 3L1OH 3MRJB 1K8IB 3MFFA 4PB0H 4NKOA 4Z7VE 1PVHA 5ERWA 5IHZB 3LSOA 3O4OB 3ILQC 5DD3L 1CLYH 3V5HB 2R2HA 5T5FL 5KSBA 4M7JH 2Z8RA 5DMGC 3KPSB 5FB8A 1T6VN 3H3PH 5IJVB 5F21B 1DN0B 2OMBA 3VE0A 1J8KA 3IAGC 1JFQH 4ONGL 2DYPD 1BZ7B 4HXAH 4JFEB 5GHWL 3AMLA 2DQHL 3L5WB 3PGCB 4WNQB 4PJFA 3RWHA 4TTDD 4HAFA 2G5RA 3G5YA 2AW2A 4Z6AT 4D9RD 5ETUA 4LHUG 3QUYD 1AHWA 2PW1B 3P0VL 1X5AA 3LEXA 4AT6A 1NFKA 5F1OB 2O5XH 4HLZG 3SKOA 5HHOD 5I1KH 5DTFA 2PKDA 4P9HH 3BKYL 3C6SB 4L5FL 3CFKB 5HDLA 4JREC 3WFHB 2CDFB 3KXFB 4G8GD 3WUWG 2QHLA 2E7BA 5H2BB 4UOW1 2L0DA 4LAQH 1KLUA 3K80A 4Y4KC 4XVJH 2JJSA 5DVMA 1AKJD 2JJTA 4HF5L 3D18A 1JRHH 1R3LB 4PRDA 3MJ7A 2ATPA 5E99L 1CQYA 5DHVA 1NQBA 2AK1L 5GZND 2FCBA 5C0RH 2EDQA 7CGTA 1JWSB 1DTUA 3DX7B 2EDYA 1F4XH 4ZUSA 4M5YL 4DGVL 3DTXA 1IC5L 3GJFA 2EC9U 3VRIB 3GMPA 3JXAA 4P9ML 3BH8A 2QKIB 4WTZG 1QLRB 2H26A 3VXMB 1DEEA 4W4NA 3LMJH 2GCYB 1S9WB 2NTFA 1QYGL 3S36L 3NABL 1BZ9B 3KVQA 3GK8H 1KT2B 1D9KD 1EK3A 5DJDB 4NNYB 4HLJA 5E8OA 3IKKA 3H7BB 5A2FA 1URLA 3V4VL 3MNVA 1NBVH 4YFLF 5FYJH 4G9FD 3I75B 2OR9H 1I8MA 4AENB 4YH6A 4OZFB 5DFTA 1IGFH 5KS9A 2Z4QA 3BP5B 5KVDL 1NLDL 5K9JH 2APVA 5F3BB 1MHHB 4WEUD 3NCFB 2XNAB 3VI4F 5C0EA 2X4SA 1EH9A 3ECBA 3PP3H 1ZLWH 5KVGL 3QFJE 3WIHA 5ACMA 2LU3A 3FQXB 5F9OH 1TZGH 4ODSH 5EUOE 1K4DA 3IJYB 3O2WH 3DGGB 2HFGH 2PCPA 2HN7A 1YEDB 2ZOKB 4ZO8A 1V3LA 1QNZL 5FHBL 1DR9A 2WBJA 1R6VA 1QFWH 5EOCL 4MJ2A 3ZKXC 1BJMA 5DEZA 4KJQC 3MRMA 5DRZB 5L9DH 3MGOA 4MJIE 4PJIB 4QRRA 3BE1L 3T0EE 2XRAH 4PGDB 1KJ2H 3TA3D 2GT9B 4JRYA 1IC7L 4JFXB 5C0AD 1QRNB 2YEZB 3TBTB 5F6HI 2IG2L 1JPSL 2A73B 4U1MB 5AYUH 1IM9A 4K3DL 3WLWC 2F8OA 1Y0LB 4LARL 5FGCE 3RDTB 5IMKB 2W0KA 2DLHA 1EIBA 1XFPA 3OR6B 3PGFH 5EZLB 5SWSE 3UPRA 2KL6A 5E6IA 1M4KA 4CMMA 2XN9B 1G7MA 1U93B 1UA6H 1MNUH 1A7RH 3MGTB 4X6DA 3TBWB 3IXTB 2CLZA 1TVHA 1S8DB 3QWOB 1YNTB 4XMLH 1YN6A 2DQDL 4HT1L 2ICWB 3FONA 3BPLC 4DUVA 1ONQB 5JW5A 4JFDA 4J6RH 3DMMB 3D39B 4IOSD 3C6LC 4LCWD 3BD5A 43C9B 4XNZC 4BZ1L 3CFDA 5DUBA 3BZFA 4EOWH 2FLBT 3CGTA 3S5LA 3MRFA 2EEBA 3QDMD 2Z35B 1KLGA 1HKLL 1OGAE 3TBYA 1IAKA 4K9EC 2JB5L 1M7DA 4PJ7B 1J1XL 4QXUH 4P4RA 3S37X 3IVKA 2NZIA 3MNWA 3PL6B 3O3BA 4A2LA 1CXIA 3C08H 2IPKB 5D1XD 5GIRA 4DAGL 4LCCC 3TO4B 1RU9H 4EN3D 3LN9A 5IESH 4FHBD 5EU6E 3C8DA 3SE4C 5INDA 1A1MB 1CLOH 4IIQC 2UZYB 4K8RH 5IV2B 4C55A 3ARBD 4NQDE 2PYEA 4KJYA 2VLJB 3S3JA 3GBMH 3X11B 1DBKH 3MRLA 2B5IB 1FE8H 4RAUB 3QEQE 3MREB 2A1WL 3MLUL 4K7PL 5EC1B 3T1FB 1N26A 2R4SH 1CD8A 2YPVL 5JHDE 4MHHI 3WJJC 4EI5C 1FCGA 4APQD 4HWUA 4DW2H 1R5IA 1T2XA 1YY9D 2IPUG 2IPTH 5DD0H 3OMZA 2FX7H 1CU4L 3QDGB 3ULVC 4LIQL 1QLEH 3LKSA 4RRPG 4NHCH 4HFUL 4XC3L 5K33A 3VJ6A 5FYKU 5CS7A 3RIAK 5C07E 2NY6C 2W0LA 5ITBL 2LTQB 5GS1B 3HMXL 3P9WB 2IALA 4WFHD 3HR6A 4R3SA 1XF3A 5FA3B 5E95B 5LVEA 1MVFA 2PUQT 3NFNB 1NGZB 1FCCA 2IGFL 2JCCA 3O6ML 5EIIB 3HE7C 4JR9H 1FNLA 2IH3B 1T7WA 2WIMA 4NQXA 5C0NC 2XQYK 1CT8B 4NQED 4N0YL 1M7XA 3MLZH 5ECJE 4QRQA 4ELME 4J4PC 4ONFH 3ULUE 4Q9QH 1J1PL 3AC0A 1RV6X 4XCFL 1OPGH 4GT7A 2XPGA 4KKNA 5F88B 4Y2DB 4R96B 1XF4A 1G0XA 1XMWA 1IEBA 2WIIA 2NX5E 5DVLA 4U0RC 4YO0B 4OZGB 2A9MH 1H0DA 4D3CL 5D2NA 3LEVH 5EO9A 4YXHL 3WL9B 1P7QB 4RQQB 3QG6A 1Q1JL 1OP3K 3RWIA 2QQKL 5BS0A 3P3YA 5TDOA 32C2B 5C09E 2E9BA 1JGUL 9CGTA 3WXVH 2IQ9H 4X6CA 4X4XB 1CFNA 2FATH 4UILH 1RD6A 4TUKL 1F11B 4P4KD 2PETA 1NBQA 5A16B 1WFNA 25C8L 5FF6B 5DJCB 3HZKB 5INCB 5D8JH 2FECL 3W0WB 1FVCA 4K9EL 3B9DA 2CD0A 1CDCA 4HC1L 1G7PB 4NO0A 4M1DL 4BYHA 3TIDA 4OLUL 3NZ8B 4G6KH 4OTXH 2HFFA 2YD1A 1MJ8H 5LGJA 1MCKA 2UVEA 4Z18A 2OL3A 3QUXA 4L3EE 1Q0YL 4PGJA 3GMRA 5IW1B 4JO2H 4IRSB 4P57A 5DC9B 2A0LC 2WV3A 5DI8B 3VFPA 2VDLL 4FQHB 1OTUC 4XB7A 1MHPH 2YA2A 5T1LB 5C3LD 5K59E 3O2VL 5SV3A 1RUKL 2JIXA 4A2MA 4GKZA 1OTTC 3DURB 3GJFK 3VWKD 3MLSH 3L5HA 3PXHA 5KAQG 3GSOB 3IDXL 3BHBA 4PJBA 1SBSL 3B9AA 4N90D 3LHPH 1KJMA 2HYMA 4TULL 2ERJC 3EO0B 2BY0A 3CVHB 2OTPA 4JKKA 5FYJU 4L4JA 2C4FT 1I1AB 3O9WB 2NY1C 3FT3A 1KGCD 3CH8A 5DQJB 3RVWD 4GRMA 5FYJE 3VCLB 2H2PD 4I0PB 2VABA 3QIWD 3RVTC 4NOBA 4UINH 3UTTE 3O0RL 5A3ID 3ZYOA 3MV11 4RGOH 2DI8A 2Z8WC 3MBEC 4JFFB 4M00A 3ARYA 4UQ2B 1TCRA 4JG0H 2FX8L 3G08B 4EUPG 1CLCA 4XNXH 1BP3B 4WFFD 1U8PA 5B8CB 3MNZB 5ACZA 3ZKMD 2PR4L 3SOBL 5B3JE 4NQVB 3CLFL 4M6ML 1IT9H 4P2QD 3I50H 4G8EA 3ZZ1A 1IBGH 1KTKE 1X5GA 3OSKA 1T5WB 1T1WA 2J3SA 3WNPA 1HIMH 1VFAA 4U1IA 3T3ME 2Q76A 2ZSWA 1S9YB 4UB0L 1A21A 4BSJA 5C0DA 4HZLA 3WNMA 3B9EA 3OGOE 4OGAD 1FVDA 3BDYL 2VB5A 3BIAX 3GNMH 5F72S 3H9SB 3MV8B 5IB5B 1GOHA 4QHKI 2APBA 4YUEH 5C71A 3F8UB 4NN7B 1MRCH 4W6YB 4FQIH 4OUUB 5T1DL 3V6OC 4I9WE 1QHOA 2ZP0T 4LPCA 5D7JD 4BSWA 4OQTL 3KLAA 3QNZA 2DKUA 1FIEA 3PWPB 1BVKB 3THML 3WN5B 3B83A 2D7OA 4RWYL 4U3HA 1A1OB 1KB5A 1N64L 3N06B 3RX8A 4Z7VF 3G6JE 3REWB 2Z8SA 1YY8A 1QSFE 3DJ9A 1ITBB 2LABA 3CDYA 2EYSB 3D2UB 2I27N 3GSNA 3ZSTA 3FOMA 4MQTB 1N0XH 3HI6L 2V5SA 3Q2CA 5I66B 2VXSH 2JB6A 3AS1A 4RGMC 4HKZB 2OBGA 4QOKE 3EHBD 4ZS6C 1QBMH 1FGVL 1ZA3A 5B22A 4DOHB 1YDPA 4NYLA 3ESUF 5BV7B 5CILH 3MV7A 2P24B 4D9LH 4NN5C 3DO7B 1SM3L 5HHPB 4LFHD 1IGTA 3BKML 5CJOH 1MCQA 3U4AA 3JWDH 4JZJB 1MLCB 4C58B 1T0MA 3QO0B 1U8JA 3R1GL 1VFOA 5J13C 3PGDB 1MIEL 4ZPVB 3TVMB 2BFVL 3O3EB 1KJ3L 4PLKD 2C3VA 3BZEB 3ARPA 3N9GH 3O6FC 4HS6B 4EI5A 4JPWL 1A6VH 2GJZB 4KTEH 1I7UB 5FA4B 4OUOA 5GGUA 1MIMH 4NJAL 1LNUB 4IEFB 5MEPA 3H9ZA 2NLJA 3HE6D 4N0UE 5HYJD 4NOFA 4LRNH 1JRHI 5DJAB 4NWUL 3VDBA 5ICXA 3QNYB 1AQDB 1NDGB 1E4KA 3QIUB 1W8NA 1N0LA 4ZXBB 4GW4A 4FMFA 4J3VA 5CZVH 5FO8A 2G75B 5CGYC 1QZ1A 4K94H 1XGYH 4P2CG 2VUOA 1ZWIB 5EPMB 1RJYA 1T80A 2F54B 4M5ZH 3MZGB 1GHFL 1N6VA 1HH9A 2G9HB 1NCBL 3TP4A 3ILPB 1G9MH 2R0LH 1FDLH 2A9NL 4OZHE 2VC2H 3B9VA 3ISWA 4MQSB 2EXWC 1C5CH 4OM0H 3PQYA 1P7KA 1W72A 1WZMA 3HC4H 4N5ED 2E7LC 3EJZD 3LEYH 2CH8A 1R5WA 3QRFM 1DZBA 3U36B 3FO2A 5IF0A 3FN3A 1JWUB 3CNKA 3PP4L 1CIDA 1CGYA 3CC5B 1QQDB 1MJUL 3JV5A 3RKPA 5BRZA 2EDRA 3T04D 5DFVD 1KXQE 4U1NB 1LP9A 1QSEE 3MV9E 3QFJD 2AJUL 1ES0A 3QXAA 4PRHE 4WGWB 5DWUL 1MELA 4C83B 4PRIB 5EUOF 1BIIB 1VKXB 4A6YA 4O2FA 5LCVH 2O61A 5JIKA 1YYML 3HFMH 4JKMA 1AP2B 4OLVL 2X1PA 4XPAH 1FZJB 1U91A 1E27A 3EOAA 1U6AL 4PGCB 4FFZL 5ANME 5ELIA 2IANA 5FCUH 2BSSA 2B1HH 4MQ7A 1OWRM 1RIUH 4S1SH 4MJID 1MCSA 3MCLL 1UZ6F 5SWZB 3T0ED 1CGVA 1AO7B 1DQQA 3RWJB 5JW4M 3S8WA 3A0OA 4Q6YA 3ZT5A 1IKNC 4S10A 3RU8L 4TNWF 4CN4A 5ITFA 5I8CB 4NRYA 4YDJB 1BFOA 4N68A 4PGZA 4XWOD 4QEGA 4JY5L 4XXDB 3VFGH 1HSAA 3CPLA 5SWSD 2DMKA 3DROB 4KGJA 4L3AA 1S7UB 4CW1A 3OHXB 3MCG1