4KVFA

The crystal structure of a rhamnose abc transporter, periplasmic rhamnose-binding protein from kribbella flavida dsm 17836
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
314
structure length
314
Chain Sequence
b'AADPNAPLKEGLKIAYLPKQLNNPYTDVEVGGGKVAVGEIKGEYKLVGPNDASASSQVSYINTLIQQQQDVIVVAANDPNAVCPSLNQARKADIKVVTFDSDAAKTCRDAFINQATTQGIGESLVKMAKELAGGSGEIAVLSATPNATNQNSWIEVMKTELAKPENAKLKLVKIAYGNDDDQKSFTEAQGLLQSYPNLKVIVSPTTVGIAAASRYVSASSYKGKVAITGLGLPNQMRQYVKDGTVKKFALWNPADIGYLAAYAGAALKSGQITGAQGEKFKAGKLGEYTVGAAGEIVLGPPTEFTAANIDQFNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rhamnose ABC transporter, periplasmic rhamnose-binding prote
molecule tags Transport protein
source organism Kribbella flavida
publication title The crystal structure of a rhamnose ABC transporter, periplasmic rhamnose-binding protein from Kribbella flavida DSM 17836
rcsb
total genus 108
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kvfA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kvfA01
2Q5CA 2WY2D 1E2BA 1S8NA 4NCAA 5EWLB 3OLXA 3SG0A 4B09A 4Y9TA 2MYPA 3FFTA 4NICA 2L18A 3BILA 3O2JA 5IBQA 4H3HB 4MS1B 4MRMB 5EWJA 3QLVA 3ILYA 4W5OA 3LUAA 2JVJA 1U2PA 3BREA 3EQZA 3FDFA 1JF8A 2PAFA 2FSPA 2P4UA 2PUCA 1TJYA 2IOYA 3GV0A 2PUAA 4PE5B 1D2AA 3HDGA 5KC8A 2MYUA 4N76A 1NATA 4DN6A 3KTOA 3EQ2A 3EDCA 4EGSA 2YHBA 4DQDA 2NUBA 3QELB 5JS2A 5KQPA 4KREA 9ABPA 4IILA 3F73A 5DKFA 1M5TA 2WRZA 3JPWA 1J56A 2A9RA 2RJOA 1EAYA 3CNBA 3QLVC 5IUNC 3N53A 2HQRA 1VRVA 4F8JA 5IEBA 5HKOA 2WJAA 3H1FA 3RVMA 1U0SY 3KSMA 1SXGA 1PEAA 3IP9A 2FEPA 4LE0A 3NNSA 1M5UA 3MA0A 4ETIA 3P9YA 1BA2A 2FW0A 4O1IA 2HSGA 2WMYA 2PUGA 2FQYA 3GA5A 4JA2A 1NY5A 5TQ2A 2H0AA 5E3JA 2MYTA 3RVJA 1YMUA 1ZGZA 4RS3A 3TD9A 3SY8A 5F64A 4QYWA 1ABEA 5TPWB 3M9XA 4HNQA 4Q6WA 4UHKA 4YR7A 5TQ0B 1D1PA 2FLWA 4OTZA 5IULC 3OLVA 3LUHA 2QR3A 4RV5A 3HUUA 3DZDA 2QXYA 3JY6A 2FKAA 1W9HA 4HNSA 4RK4A 3JVDA 3JPYA 1MAVA 1ZAYA 2FLKA 1MIHA 4LE2A 4F12A 1RZRD 1CYEA 5BQ3A 4EYQA 1W25A 1OXBB 2FMKA 3OQOA 4RY9A 4MQFB 1FFWA 4Q6BA 4WXEA 4KNYA 4NV3A 4MR7B 3Q7SA 7ABPA 1JDPA 1NXWA 1KRWA 2M1ZA 5IEJA 3HCWA 1EWKA 2LIVA 5C5EA 3S99A 8ABPA 3H5LA 5JNWA 3H1GA 3ROFA 2FMIA 4RWEA 4WT7A 4W5NA 2JRLA 3HV2A 1M2FA 5PNTA 5FBKA 3K9CA 3KKEA 4N0QA 5TQJA 1SXIA 2PUEA 1DZ3A 2FVYA 3H5WA 3O74A 4MS4A 3NBMA 2PUDA 5KQGA 3QX8A 4MPTA 4W5TA 4DADA 3HDVA 3LKBA 1MB0A 1YK0A 1TMYA 5CNKA 2M98A 3M6MD 5FWXA 3RVKA 3DGFC 2PL9A 3IP5A 4NCBA 2IPMA 3C3MA 2VUHB 4TLLB 3LUGA 4ZYLA 1JBEA 1T34A 5FWYB 2H3HA 3ILHA 4EVSA 2LP4Y 4YRZA 2N9UA 1JH9A 3OO1A 2FN9A 3CKMA 3IPCA 1ZH2A 2F8SA 1DRJA 3HK2A 1GCAA 3LFTA 3H5VA 1VKRA 4EUKA 3H5TA 4MR9A 2HQOA 2QZJA 4N03A 5I4CA 4ZPJA 2B4AA 2IPAB 4HYEA 4RDCA 4MR7A 5IUKC 2XDYA 1ABFA 3CG0A 4Q7EA 2MSWA 2GX6A 3LUCA 1QQBA 4KVFA 1VPWA 4LX8A 4MR8B 3LUFA 1CHNA 1JYEA 3NHMA 1UDRA 3OM0A 2DRIA 5JNUA 1B00A 1D5WA 3IP6A 1URPA 2FQWA 3L6UA 3RVNA 4NQRA 3SAJA 3C97A 2FEKA 4D6XA 1BDHA 4Z9BA 4CBVA 5JNSA 1LK0A 3IP7A 3OLWA 4LE1A 4WUTA 3SQNA 1ISSA 1HEYA 1AB5A 4KK3A 2FTKE 3I09A 4G97A 5HQJA 3RVOA 4EYGA 2LPMA 4YV7A 2E4ZA 1L5YA 2QVCA 5JS1A 3OLZA 4Z4HA 3GL9A 1SD5A 4H60A 5IX8A 1YVUA 3N6VA 4WXMA 5CNJA 3JS5A 1NXPA 1JL3A 1EWTA 1YMVA 1TLFA 2VK2A 3Q7TA 3MM4A 3LUJA 3Q7RA 1E6KA 2JK1A 3KLOA 4MQEB 1NXSA 2IKSA 1OXKB 4O5AA 4WWHA 2JB9A 1A2OA 3O2QB 4G0MA 1QO0D 1A04A 4OATA 5EWJB 3QEMA 1K68A 3H1EA 4MLCA 5CNMA 2E4YA 5KQLA 1NXXA 4RXMA 3LOPA 4L85A 3LTEA 4P98A 2VYCA 2E4VA 2FXIA 2NT4A 3BBLA 3F7NA 5DLEA 4EVRA 4MRMA 4ZJPA 2F8TA 1RXEA 3I42A 1DG9A 1PHRA 4Z4EA 3VNAA 1JFSA 1Z2DA 1QNLA 1XHEA 3QELA 2WWVD 1KRXA 2JBAB 3G85A 5TPZD 4RK6A 2FQXA 2YHAA 2L2QA 3CRNA 1F51E 4N0PA 4UHJA 1P6UA 4Z0NA 3A3KA 3NHZA 1Z26A 3DGEC 5B3JC 1XWWA 3UK0A 3Q41A 5EWMB 4RY0A 4KV7A 4LZLA 4JB2A 5FBHA 1PEYA 2GWRA 5ABPA 2LBPA 1FSPA 1ZITA 4JAVC 4RU1A 5T3YA 3UUGA 2NT3A 3OO0A 3RVPA 2PUFA 3HEBA 3H6GA 1DBWA 1Z2EA 2IDMA 3CFYA 1RNLA 4KK4A 1PNTA 4MS1A 1DCKA 3CHYA 4W5QA 4RKRA 3MMNA 2NZVG 5TE9A 3HUTA 1R8JA 1RPJA 3QX9A 3K4HA 3ROTA 1ZESA 1C4WA 4F11A 1JLKA 2HPHA 2CHFA 4ETNA 2IPNA 4D6YA 4EVQA 4MLDA 3CG4A 1QPZA 4XXHA 3RVQA 1F4VA 1XHFA 1Z25A 3OM1A 3KYJB 5TQ2B 3TMYA 1JFVA 1P6QA 5FWYA 2FMFA 4MS4B 2ZAYA 1U2QA 4ETMA 4G0QA 2R47A 3I5AA 2CD7A 3HVRA 1I3CA 2PKXA 1APBA 3T8YA 1JYFA 3MIZA 4RKQA 3URMA 1PUXA 2FN8A 1VLZA 3Q15C 4RY8A 4EY3A 3HS3A 5IC5A 5JNTA 1CEYA 4KZKA 1LBHA 1FQWA 1PNRA 1EWVA 4LRQA 3C6QA 3N75A 4RK0A 4YP9A 1JFTA 1NXOA 2R48A 3OQNA 1DC7A 1ZH4A 2GI4A 4MR9B 4Z4FA 4PYRA 4JOQA 2X7XA 5KWSA 1WETA 4Z99A 3TX6A 2PUBA 3I45A 3OMXA 3VNBA 1NTRA 4IMJB 3Q9SA 2RJNA 1ZDMA 2WB4A 3L49A 1DP4A 4MS3B 4RK1A 1A0OA 1LJLA 4GPAA 1JHZA 2B1JA 1FFSA 3GYBA 4E7OA 3C3WA 3CTPA 3CLKA 3NNNA 3OLYA 3EGCA 5CNIA 4OLAA 2E4XA 2BGGA 3EODA 4KFCA 4PEVA 5TQ0A 3TO5A 3O1IC 1LJUA 1U04A 2E4WA 3KLNA 3N0WA 2MSKA 4GNRA 4OLBA 1ZVVA 2RGYA 2HQBA 2R4QA 1EHCA 3KS9A 4RSMA 5EWMA 2GBPA 4G0XA 3JTEA 1YIOA 5BRJA 4Z4CA 1BVHA 3KJXA 3CZCA 5CHYA 5GOTA 3N8IA 3SNKA 2TMYA 3KHTA 3E61A 1QKKA 1ZGGA 1KGSA 1Y1LA 4IGAA 3GBVA 4MQFA 3A10A 5DTEA 1M2EA 4JP1A 1KMIY 2OENG 1DBPA 4JB0A 6CHYA 4YO7A 3UKJA 5GQSA 3EJWA 4KMRA 3O2SB 3QLUC 3FFXA 4RZSA 1TVMA 1ISRA 1DJMA 4KQCA 3QLTA 3HM9A 4RXUA 4KPYA 3QK7A 3BRQA 1SRRA 1SXHA 2A9OA 1L5ZA 2MSLA 5JNRA 2GKGA 2LUOA 4QYMA 3CS3A 1BDIA 4PZ0A 2IYNA 1QP7A 1RZRA 4Z4IA 1JX6A 2QV0A 3IPAA 3MF4A 4MQEA 5TPZA 1Z15A 3DLHA 4JASB 3H75A 2V0NA 4ML3A 1K66A 2PLNA 1GUBA 4G0OA 2OQRA 1Z16A 4PICA 1C0EA 2QSJA 4QICA 3B2NA 3IDOA 4KQ9A 1P8AA 3EAFA 3OQMA 2VUIB 1YS7A 2AYXA 2JVKA 3MYYA 3O75A 3N0RA 1QP4A 6ABPA 2PL1A 4LDZA 5KQMA 4EYOA 3FFWA 2NZUG 1BAPA 4KRFA 2I6FA 4N47A 4Z4GA 5DCLA 1FFGA 4LDAA 1P2FA 2R25B 3O1HB 5T7BA 3DBIA 1QQAA 5FWXB 1GLGA 3GBPA 4OG2A 4XARA 3HJFA 4XLTA 1YTUA 1E6MA 4YGXB 1YK1A 3FMVA 3RVSA 5KI6A 4ZMRA 4RXTA 5DGCA 1USIA 1IIBA 3F6CA 4WZZA 1Z13A 2E4UA 3A0RB 2FEWB 1JDNA 5KC9A 1USKA 4W5RA 4YCSA 1DCMA 3N0XA 3T95A 1GCGA 1QO0A 4G86A 1Z18A 2JCGA 1E6LA 1ZY2A 2HJ9A 5EWLA 1TM2A 4S05A 2A9PA 4F3TA 2ID7A 2QU7A 2P9HA 4L4UA 1QMPA 1LBIA 3H5OA 3LMKA 4RK7A 1QP0A 4D74A 1JWLA 3G1WA 2ZWMA 2QW1A 4YS6A 1EFAA 4N41A 2IPLA 3CZ5A 3D02A 5B3JA 4OBBA 3T38A 5JNVA 2FMHA 4MAAA 3D8UA 3O1JC 5TPWA 5ED4A 5BR1A 4S04A 3H6HA 4F06A 3RVRA 5C5CA 4RK5A 3TB6A 3SM9A 3W9SA 3DLBA 4TMYA 3NNDA 3GT7A 3JVIA 3LKVA 3GRCA 3GWGA 4FE4A 3HXMA 4TLMB 3HO1A 1H9CA 4XFKA 3RH0A 4Z9AA 4G0PA 2QVGA 2JBAA 3HSYA 4O1HA 4M88A 3CU5A 4FE7A 4YWHA 3QLUA 4HNRA 5HM6A 3T6KA 4ZMSA 2W42A 1U8TA 4IMIB 3BRSA 5D2CA 2L19A 4G0ZA 4TN5A 3RQIA 3LUDA 4FB4A 3KG2A 3RVLA 1MVOA 3M9WA 2RDMA 1D1QA 3KYIB 1USGA 1MB3A 2JVIA 4G0YA 4MGEA 2L17A 3HZHA 4E7PA 1NXTA 3QEMB 4EYKA 4MYRA 1DCFA 1D4ZA 1YS6A 1NXVA 4IRXA 1DRKA 3FGZA 1GUDA 4IF4A 4QPJC 2A9QA 4XAQA 4XASA 4MR8A 2AYZA 4MS3A 2J48A 3E3MA 3F6PA 3KCNA 3O21A 1ZN2A 3MQ4A 1BDJA 2KYRA 1DC8A 1Z12A 3LUKA 4H3KB 2CHEA 2ID9A 2WJWA 1ZHHA 1DBQA 1RXIA 2MYNA 3EULA 3R0JA 3H5IA 2PJUA 5HSGA 3QEKA 1AB6A 2PMCA 3C3KA 4YLEA 5BRAA 5IUJC 3OMWA 2PE5A 3A0UA 4P1ZA 2CWDA 1Z17A 2O20A
chains in the Genus database with same CATH superfamily
2SKCA 3N2EA 2FRXA 3EDRA 1GNTA 3LXXA 1S8NA 2C57A 3L40A 1WVMA 2PANA 4YJFA 4M1ZA 3OT4A 3VO8A 1XLTC 4JT8A 4JP8A 5ES4B 4ID3A 4MYSA 4BLVA 4RV9A 2FGKA 3BILA 4DQXA 2OCAA 1JDBB 1M6VA 2Q7XA 2ZBFA 3O8DA 4PC6A 4PQFA 5EAIA 3ILYA 3TL6A 2Z2XA 2F3UA 4W5OA 5ALKA 5JC1A 4BN5A 1D4OA 3T3IA 4B3XA 3N8DA 4CMKA 5L7TA 1I0LA 3KQYA 3TVTA 3C74A 4RL6A 3UUWA 2AW3A 3C5VA 3QTLA 4ZC8A 4Z6KA 3OFND 2WJIA 4BQEA 3GARA 3COZA 3L8DA 4Q01A 2QUZA 1ZU4A 4OUKX 5EIXA 4QAQA 1EE1A 4YI5A 2P67A 3P0IA 3MRXA 3VH3A 2YN2A 3P7MA 4E31A 2OM2A 4D4JA 3LCJA 3NEYA 4FWBA 1PEKE 4FFOA 3RSQA 5DEIA 1CX9B 4NMMA 4HFJA 1RPNA 3MJCA 4G9EA 5FTMA 3WBBA 1UFOA 2QTWB 4G81A 3OBIA 2X19A 2RJOA 1YL6A 4I6EA 4RVNA 1GVNB 3OTWA 2V7EA 4QOJA 2JIDA 2WJAA 3P9ZA 5H9VA 4C7MA 3NKVA 2XUOA 4FSXA 1XEFA 3F46A 3TZQA 1WV1A 5I9SA 2JEOA 3IAS1 3K73O 4IXTA 4MQ4A 5L40A 3ER9A 5J4VA 2D7DA 1M2VB 2RHDA 2Q2NA 4QGSA 4FOSA 1E9VA 3DEZA 4JA2A 2NXEA 2ZR9A 5A04A 1W5SA 2ZBQA 4PPNA 1E2NA 4K6KA 3SY8A 1JB9A 2PSHA 4QYWA 5HNKA 1OWNA 2OV3A 1YCDA 3R2JA 4O02B 3WGLA 5B55A 1IUKA 3H11B 1G9SA 1I2ZA 1PGOA 1N6IA 3RK1A 3N2NA 3HWX1 3PGVA 1X19A 4MUNA 2DWPA 1VMAA 2H1FA 4C7OA 1VG1A 4CM4B 3JY6A 1LLDA 2MHCA 2JD2A 4RIHA 4PQEA 4EHLA 3JVDA 4P93A 5THXA 2N0SA 1TA9A 3PUYA 1T5IA 2PPVA 3BDAA 1ZAYA 2OHGA 3KKLA 3KOYA 4M0UA 2JK0A 4JUDX 1OLUB 3Q5DA 1UJ5A 5IVPA 1TW2A 1W25A 2ZI9A 3GYGA 3V1KA 3THWB 1Z37A 3PXDA 1E2DA 3QPUA 2RGXA 4GF5A 5J2TB 1EM8B 3WFIA 2YFQA 1ADBA 1B8UA 3FGNA 4BNMA 3J7AC 4F60A 4PLHA 2J4FA 3IULA 3OFVA 3QU2A 2PUJA 2PH3A 4O4IA 2YMPA 1P1CA 5ESWA 2C9OA 5KX5A 1SQ6A 2G1PA 3IRUA 4LRTB 4QOSA 4QWWA 3ROFA 3ZC3A 1XA0A 5G53C 4EJ0A 4XLLA 2Q99A 3TYXA 4F92B 5MN4A 4PLFA 4X97A 2OYRA 4PC7A 2JJ1D 2FYTA 2YYYA 1DJQA 3KVOA 2OVFA 3K6JA 3RYIB 1HYGA 3ZXIA 2QN9A 1VJRA 2CVOA 2AWOA 3K5IA 5IASA 4Z9FA 3HWRA 3W90A 2ZJYA 2CLDX 1UM9A 1N6HA 3U7GA 2I2XB 2JIOA 3EGIA 4XIGS 2Q6VA 3GLTA 3PUVA 2VWHA 4FNMA 1E98A 2H07A 1IM8A 1B74A 2KJQA 3AP1A 2WFMA 3EG5A 1MB9A 3C3CA 4KGVA 1J25A 1OI7A 2LRHA 4MJLA 4WERA 4MVJF 4DQVA 2HK9A 3ZCUA 4ZPXA 1Z7GA 1LW7A 2VHQA 2Q5OA 3AFOA 1IJKA 2Q27A 2DF8A 2Y6UA 4JA0A 3SHQA 2HUPA 1BE1A 1X70A 3M33A 3RS9A 1GILA 2OE2A 5BT8A 3RGGA 2WJ3A 3LLCA 2Q1TA 4R2KA 4G1BA 5DM2A 3MGCA 4PF1A 3OX4A 1BEZA 1C30B 1SMKA 1YIAA 3MT9A 4QATA 2AWNA 3O4IA 2QZJA 2IPAB 4HYEA 4RDCA 3LNTA 3UW1A 2JZNA 2QB5A 5TT1A 1J99A 5HKAA 3FTEA 4D98A 1B42A 4CJXA 3LZCA 1JVBA 2W8BA 3JQ7B 4CLOB 5IKMA 2P3QA 3NX4A 1P33A 3KKZA 5BUQA 3ND8A 1FFHA 3M6WA 1DEAA 1SELA 3ZDAA 2JIRA 1W5FA 3AESB 1U2DA 2V6IA 3U80A 1H8ED 3AI1A 1M6EX 2C83A 2TRSB 3O38A 4WZ6A 4WN9B 4FW9A 2DB3A 2R1TB 2UAGA 2SICE 2P2NA 4KI0A 5FTJA 1S9DA 1SXJD 3Q3GE 1DAPA 3HWSA 2B1QA 3RVOA 1J2JA 2ZSEA 4ZEMA 1BCSA 2PGIA 4M3NA 2DPHA 2WU8A 4LC1A 3CW2A 1B73A 1WXFA 4K0RA 2DH6A 3W5JA 3USZA 1OT5A 4YUAA 3KR9A 1DO2A 4C30A 5AW2A 1GSAA 1YMVA 4RPJA 2Q5IA 3G5UA 5GPBA 1NG9A 4KC0A 1BQ4A 3AMVA 3KLOA 1XF9A 3P2MA 4JD5A 1R4AA 4MRAA 5FUWA 3V4LA 4BEVA 4G0MA 1HE3A 2OWDA 3NTVA 1ZH8A 1QO0D 1A04A 3NETA 3BHIA 1MQSA 4NCJA 4DL9A 5IAOA 3D6FA 1L1QA 1SULA 1AUPA 2E4YA 4FR2A 3V4VB 3O82A 2OO5C 2NZWA 4CRWB 4H1WA 2W2KB 4L85A 3NBUA 1YB5A 2C54A 2O5RA 4IGKA 4B3JA 2IUUA 3D3NA 5DIZA 1SKMA 1QORA 3KTFA 2DFDA 2J8ZA 4OPMA 3LUPA 1YJQA 3OZEA 3QPAA 4JU8A 1BXGA 4PW0A 5BPHA 1E5TA 1J5PA 1E2GA 4BNTA 1HEIA 5KTMA 3LY8A 2IA5A 3F98A 2RGGA 2XI4A 2KI5A 2C9YA 3AKYA 4BASA 3JCZA 5ADVA 1AN9A 4UVEA 3TOSA 1OF1A 3HRHA 1E1YA 2ZTLA 3BZBA 4UJ3A 3U3ZA 5L4NA 1EK2A 4QUJA 4ALLA 4XJVA 2IHBA 3HA3A 3THWA 1RZ3A 1ANKA 1R0LA 4BO2A 5IC6A 1L5NA 3N74A 3GB9A 2CNDA 1RJDA 1JG4A 3K6KA 4K9NA 3SR3A 1YASA 3RBAA 3Q41A 2QR5A 3HDYA 3WO1A 3G9UA 4D0LB 3JU3A 3OIDA 2NUTA 2JIZA 2WMOB 3PDWA 3Q72A 3HKEB 4X1KB 5JCJD 2P2SA 3U37A 3IOYA 5KSYA 5IT9A 2BKEA 3JD2A 3C3YA 2PD4A 3LBNA 3BC1A 1SIUA 2GPYA 4P08A 5JSQA 3DAOA 1XAIA 2GFQA 3PXEA 1CR2A 3DMRA 2O23A 4NJEA 1T3ZA 4KH0A 2CHFA 4R98A 1II9A 1LZKA 4GVPA 5DYTA 2CZGA 4QELA 1BDMA 2LKCA 2X7JA 1V6SA 4RIEA 2O8BB 1CNEA 1MV5A 2Y2UA 1RS0A 4WEOA 3SLGA 3AL2A 3TRDA 1GM5A 1GSHA 2ZUVA 1Z25A 2UYGA 5AHRA 3TK1A 1C0PA 4OQEA 4AJIA 3WLSA 6NULA 5HP4A 4JC4A 2C1ZA 1Z0JA 2OO5A 5KYNA 3ENQA 5AVTA 4ASUA 4BMNA 1EU1A 3HA5A 2R00C 2Y71A 3R75A 3U5TA 2VPYA 5DYNA 4PZZA 4C3VA 4B73A 3SC3A 2DR0A 4PYJA 1L4LA 4WADA 2GPWA 5KOJA 3EDMA 5JWOA 2NPOA 2KPOA 2NYRA 4R2HA 1AS0A 3RAGA 5FUMA 1Q77A 3OKFA 1CT9A 1NSTA 3PFBA 4FFPA 1X74A 3WLNA 3ZWQA 3LQYA 2IYEA 1N2EA 3EVNA 5JHHB 5DNCA 5B5SA 1K9VF 2XCTB 3M49A 5I6DA 3DMNA 4IDOA 2VYQA 5FI5A 4L8VA 2GASA 1C9JA 1MFZA 1M0SA 1XXHA 2I4TA 4K6FA 4YRKA 3FNBA 4Z4FA 5TQVA 1GYQA 5L6LB 3AKZA 4JLUA 2XGJA 1ODKA 3IODA 4WN9A 2FWAA 3VNBA 3TR0A 2AN3A 2HWKA 2GD1O 4A6XA 4QEZA 4RPKA 1DP4A 5HOEA 5HF6A 4LZJA 2DQ4A 2PT6A 3WB0A 4C0XA 1DHRA 2QZ4A 1SXPA 1I7DA 2G0NA 4LWPA 2ZYWX 2VT7A 3G02A 3LP8A 4HAIA 1MJGM 2JZOA 4W7IA 3OLYA 3V5NA 2X8WA 1H85A 5AVYA 3S5UA 5KB3A 2DHQA 1J8YF 4X92A 4TS1A 4JI3B 3S2EA 4PEVA 3TI7A 2FEMA 2UVPA 1HSOA 4Z1MD 5DP1A 2D3WA 4JNCA 3N0WA 1HQKA 5JH7A 2X5JO 1FYXA 3BDIA 1GR1A 5EMLA 4OLBA 2H85A 2ISCA 2F00A 1LA2A 2ORIA 1Z6XA 2R87A 4PLCA 1GL9B 5LL6P 3JTEA 5JROA 3ND5A 5JV5A 1JHMA 2FW6A 3SXJA 3EUFA 3KR2A 2WHPA 5HIIA 1ODSA 5G02A 1OMOA 4JQYA 2XJ4A 3ENVA 1AMUA 5KS2A 1G8JA 1AKNA 1YB7A 5BVGB 2O5EA 3KHTA 2HMSA 4MA4A 1QKKA 3K9BA 3Q2KA 2H31A 3QTBA 4CLRA 4MQFA 2KHZA 1F5NA 4UU7A 2XODA 8OHMA 1OFVA 3SHVA 1E1CB 1TCCA 3SICE 3IFSA 1FXWA 3EARA 1UOPA 3EJWA 1JU9A 3A9SA 3SQLA 2B6HA 1NJ5A 3QA9A 2HJVA 4HSEA 3R7WB 4M4SA 1HDEA 4YPVA 5JEDA 3HCEA 1X2BA 4N0MA 4OJNA 2CYCA 2IYRA 3BB4A 5JCJA 3QK7A 1M33A 4OYYA 4UVDA 4QTXA 1UDAA 1QRDA 1PR1A 1B6RA 2NO7A 2YC2C 3IAUA 1U5CA 3O93A 5CRIA 4Z2YA 1RBZA 2UZ1A 3DOFA 1BQ3A 4EW3A 4Z1MA 1NN1A 4KRYA 1YBVA 2C8JA 4I7EA 4RF4A 1NOKA 4B79A 2QD3A 1BCSB 4IO0A 4QDJA 4P2BA 1WUKS 3H75A 5IN4A 4XCXA 4ZKEA 1K66A 1P2TA 1Z5ZA 2BCEA 1VCIA 4O0LA 2E49A 3VAZA 4KIJA 2QSJA 1Y9AA 3MLBA 3I23A 3W79A 2A1IA 1D0VA 1Q20A 2JDIA 3PDUA 4BCCA 4X90A 1ZI9A 4EY4A 4DARA 3NWPA 3QKSB 4GBGA 4Y6QA 1K92A 3DQQA 3M82A 5JJ5A 1A8HA 3IEPA 2UU9B 5KQMA 2HWXA 1R4ZA 3OOYA 2JFBA 1N8KA 1V8DA 3FFWA 2I4LA 1FRNA 2XNHA 1JEJA 1ZCFA 2PRKA 2R5WA 5EJFA 1I4DD 5ESDA 2QTFA 5LB4A 3TSZA 3EXG2 4R3NA 3I9FA 2QRNA 3A2NA 3WYGA 1QGUA 1GNRA 3FCSB 3SC4A 1AZWA 4ZZ1A 3FCOA 4F9TA 1WQ4A 4YP6A 4IHQA 1BX1A 4UREA 3RS8A 2EX4A 3SC2B 1BD3A 2WWYA 1GY8A 2JCYA 1RFLA 2BFCB 1DXQA 3OOJA 4M1WA 4NONA 1WLSA 1AV7A 2PZMA 3ZI7A 2HHJA 1BGWA 3F6RA 4M6WB 1JIXA 4D46A 4JMPA 3X2EA 4AJOA 1L5SA 3E3AA 1FRZA 1JSCA 3KPJA 1UEJA 3PNOA 3GOQA 5CLQA 1QGAA 5EFZA 5EWLA 3CPSA 1EVQA 4F3CA 1QMPA 3DAFA 3L0OA 2OQIA 2R6CA 1KHTA 4WN3A 4YS6A 5E95A 1VXRA 2BHNA 1FYEA 1E2UA 1YGPA 1IBCA 3MW8A 4IDGA 3N2GB 4TWIA 2FMHA 3DBRB 2QVBA 3WK8A 4DC0A 4YT8A 2WYUA 3EX7C 1QU3A 4L51A 1XZMA 3H6HA 3IVRA 1P75A 3Q8KA 2HO5A 4BXOA 4OQLA 3SI7A 1EX6A 2FRDC 1M1ZA 4MKXA 1JZTA 3QWHA 1PL7A 3L0ZA 4NU6A 1KKUA 1YQDA 4O4HA 2BMEA 4XFKA 3RYCB 3KJZA 3Q40A 5HPYB 4XI9A 4ZQIA 3TIFA 5I45A 1ENOA 5FI3A 3CXUA 3D5TA 1OASA 1IDN1 3FVTA 4DDHA 3K2QA 3F5FA 1P5ZB 4AVYA 2X8BA 4JUAA 4GG1A 1WXXA 4X6YA 3EG9A 2DHCA 3IHKA 4HC4A 2G8NA 4AY5A 4CUJA 2XTAA 3KG2A 2AZTA 1MVOA 1TTQB 1HT0A 1D1QA 4OU4A 2ZREA 1QIEA 1MB3A 1LWNA 1T0PA 2GFIA 4LK3A 5LP1A 2I54A 4LYFA 4NS1A 2PN1A 4E7PA 1XRNA 5KU7A 1XFDA 2Z08A 2EQAA 4OHBA 4QVGA 1EFPB 1RAGA 1M75A 2XMZA 3VKWA 4Y1RA 1O8CA 2BUAA 2NSJA 2AS0A 3Q88A 3Q0IA 2M6LA 4DV6B 1WO8A 2LW7A 4TROA 3REFA 2FDRA 3CR8A 3MWEA 2KMLA 2C0CA 2GNAA 2ICAA 2ZJ7A 1QUFA 4KBGA 1G16A 1H2EA 5I5EA 3E9EA 5I01A 3SOPA 1BU8A 2HU5A 3AF4A 4B6SA 2VPTA 4KWEA 1ARZA 3ZCPA 1BZYA 5JU6A 1WXEA 4MYUA 3G2JA 1HA3A 4ARVA 3R0JA 1G2IA 1F12A 3ELWA 1KDYA 3GDWA 1UC8A 4YWJA 1JHPA 4OYLA 5FP0A 5C1PA 1VP9A 4I4IA 1XSEA 3R0XA 3A9RA 3MSCA 1IWPB 2CWDA 4TWJA 3S27A 4FUQA 2IU4A 1NP7A 4LRXA 1KC3A 1CETA 3JZFA 1DJLA 2AFIA 4URFA 2J67A 3HB0A 1BN7A 4WSOA 5A9RA 1MX1A 1Q22A 4KWCA 2WBLC 4WV3A 4U5QA 4DJFC 3AL3A 4KRGA 3DTYA 4FDTA 1E4YA 1RYNA 4L27A 1N2BA 4MV3A 3RREA 1UXJA 4CLRB 4D9CA 1QOQB 4B6FA 1S8FA 8GPBA 4BX8A 5JMTA 4LNHA 1NQWA 4B32A 1GADO 1E1CA 1ZG3A 2JEZA 3BH6A 5B1DA 3V7WA 3PPWA 1RXUA 1S3SA 2H57A 3R0VA 4GMDA 4JROA 3EBOA 2ZP1A 4PFQA 2BSAA 1Q15A 2G7ZA 2E1RA 5AVQA 5CB0A 3PUIA 1DAMA 3NEAA 5INTA 2GYYA 4LRSB 2JNWA 4P92A 3S7TA 4Q7MB 1RP1A 2W6PA 1PR3A 2WP0A 4NG5A 4NESA 5ALTA 3KV1A 4PAOA 1KXZA 1HLDA 3QVJA 5DTQA 2CHGA 3H1TA 4BB0A 4X65B 4PRKA 5FOTA 3RUFA 3VZBA 3WIUA 3MJ4A 1RRFA 2HQRA 4ROSA 1Q19A 1M1UA 4WLUA 2O14A 3ZI0A 2CF5A 2REBA 3ELBA 3FD8A 5KSWB 5IF3A 5JT1A 1F9AA 3TLGB 4ITRC 3DM9B 2Q07A 2X6QA 1M74A 1ORDA 1FVHA 3SMVA 1K98A 4ETIA 4PSUA 1HPLA 2XOKA 2PL3A 4ZU6X 2XD4A 4UAJA 1UR5A 2XLCA 2XMPA 4UCXA 4KIWA 4RPHA 1SU7A 3F5DA 1P9NA 4O4HB 1KK3A 1UKVY 1YMUA 5ALEA 4OY3A 4YRAA 1C7JA 2CMDA 5TPWB 4QRDA 3WXMA 4O2BF 1WF3A 4ED9A 3ED1A 3TLCA 4B4DA 3IQEA 1KORA 1P7YA 1CP2A 1OU0A 2WM2A 4FPXA 4KVGA 4LSZA 4CL2A 4IW3B 1M10A 2JJ1A 1NMXA 3DZDA 4H3VA 4PNZA 4MW1A 2HSJA 9MHTA 2YJ3A 2DPYA 4TSFD 3KWMA 4FDUA 5FDFA 3MT0A 4XOUA 2AF4C 2OCPA 2EGGA 4A2PA 1I3OA 1K7CA 4HGRA 2FHSA 5DW3A 2XMSA 1C3JA 1JN0A 2FMKA 3GZTB 3CH5A 4ZHQF 2GNOA 3WMGA 3IESA 3JQ9C 1EFPA 2QN6A 4ZI5A 4M6WA 4ZDWA 4H1TA 1KEEA 3MUOA 1OA0A 1E9AA 1FX0A 4DIDA 2IHUA 2NO0A 4HF7A 4RD3A 3MWDA 2LIVA 1QVWA 5LLDA 1P2GA 3F4KA 1SIWA 2MIIA 4B48A 4QDKA 4Y3UA 3KSBC 4W5NA 2XF8A 4WT7A 1UH5A 2VAVA 4L5CA 2YBDA 5TQJA 4BHTA 4DM3A 2BKLA 4HNTA 3E8MA 1DZ3A 1P1HA 1IOVA 1UMDB 1UIRA 5CH3A 4CTKA 2ATVA 4LGVA 3U7RA 1DLIA 4MPDA 2IBSA 2GN2A 3IDQA 2HXYA 2XNKA 5C0OE 3AZQA 2I4NA 3PJEA 4FMBB 3B53X 1G4HA 4TKZA 1FTYA 4BMCA 1NMYA 3CEPB 1U2ZA 2GK6A 2VATA 1J5EB 2JIMA 5J1SB 2FW8A 2D2XA 2V9ZA 4Q1FA 1JBEA 4TLLB 3GJZA 5G4KA 4NG4A 3R5XA 5FWYB 1R15A 1T8PA 2G0AA 1YHYA 4JUBA 2PCLA 1PJLA 1HYHA 4MWGA 5C53B 3IEXA 3WTBA 3PWKA 4GE3A 4DLUA 1C3LA 4F4UA 3EOZA 2XRFA 4EHKA 1QJCA 2AX3A 2GN8A 2ZJFA 4HXYA 3V55A 3AQIA 5EXXA 5BSUA 3H5VA 4MGIR 3MQFA 4UCQA 2JLZA 5CJPA 5HGJA 3A32A 1A5TA 1Z5GA 1I4EB 5E7JA 2BFMA 3NBQA 1QZUA 5JSYA 4ENTA 3LVRE 1OWOA 1PIWA 1CY8A 2Y05A 5BV1A 2HJSA 1SVOA 3FWYA 2QTVA 3HL0A 4Q7EA 3L7IA 4MH0R 1TJ5A 4PRZA 3FF1A 4HAWA 5EMJA 4MR8B 2YS7A 3K31A 1J1UA 4BO6A 3E5NA 5CG2A 4HRVA 3D6TB 2R60A 3F67A 3OM0A 2H8KA 2LR0A 4WJKB 3PE6A 4LMRA 4UM5A 1A9XA 2DH5A 2ZK7A 1EGAA 4R16A 2IWHA 1XMXA 1U80A 4RH0A 2RHCA 1OB5A 2QQEA 3OX1A 2A3RA 3QWAA 3I37X 5G0SA 4Y6RA 1ISSA 1P0MA 1XTRA 1JQLB 4BMOB 3U6BA 5EP3A 5B37A 3WRXA 1EAMA 4E3ZA 2QVCA 2I6XA 2QENA 2VH2A 3GFSA 4IDQA 1L5GB 4LPKA 1ODJA 3N28A 1T2AA 1QFMA 3VBEA 1OAAA 4NP6A 1NXPA 2PSEA 3GEPA 5GONA 4EPRA 4RMNA 2H2HA 1E6KA 2VHWA 3JWGA 4W5WA 4G9GA 4OUDB 1VDMA 1Q5PA 3DMHA 3QEMA 4MCIA 4MLCA 4H6WA 4BQIA 2ZKLA 1F06A 1RQRA 2O1SA 3RS2A 1DKOA 2IYUA 2A57A 3KYDB 4A1FA 3DO5A 2QAIA 5CDFE 5I3ZA 4NBNA 7YASA 5EE5B 1X15A 4JBNA 5I4KA 1LSSA 3R3SA 4ER6A 1KEPA 2ZRBA 1Z06A 2HF2A 4OKSA 4EFKA 4NDZA 4DBVO 2VTVA 4Q4JA 3E8XA 4BRUA 4FXPA 4U6SA 1MO4A 1KIAA 1JFSA 1TL7C 4IH4A 3V00A 2EZTA 3A4VA 1JIQA 4LYYA 2XVAA 4H6VA 3QNUA 2FQXA 4IV0A 1K5DA 1V4BA 4J3FA 2MWMA 4LQLA 2H29A 3OY2A 2R5FA 4N0PA 4PQRA 5BSMA 1GV0A 1UOQA 2DWUA 3FFBA 1H2WA 2HWUA 1DAOA 2I2CA 3C5WP 4FZVA 4J7XA 2AJ8A 4R8RA 4TV9A 2XZOA 5EWMB 4RY0A 3VNUA 2KBEA 3MNFA 4XDZA 2H2AA 1DTEA 4GLBA 2FMUA 1MT3A 3PUJA 2ZRQA 3KKKA 3KT6A 5AHOA 4EK9A 3FLMA 4V1CA 5F7XA 5HKKA 3L7AA 4JX8A 2NT3A 2WTXA 1YRHA 5K51A 2NUAA 1DBWA 2V74B 1QYCA 3ZXXA 3I34X 4AC9A 1OIWA 1FSFA 2R97A 2JFHA 2YWXA 5KVAA 3CHYA 3ZHBA 1BXRB 3RC2A 5EMHA 3BKXA 2WMDA 5JNLA 2GM9A 1H4VB 2HPHA 2G1JA 2YJ6A 3B36A 3EUEA 5AXCA 2M6KA 5BUCA 2A1TS 5FNVF 4HWSA 5JPIA 4XXHA 5A0TA 1KY5A 2HA6A 3OZCA 5CFNA 4A4DA 4MA0A 1U9YA 3MCZA 1QRUA 5G3ZA 2X5KO 2ZE6A 4BFLA 1U3DA 5FWYA 4P33A 3HZRA 4CODB 1U0RA 2AI1A 4R83A 1ZNZA 3W4IA 4ETMA 2LDBA 1GGMA 3G5AA 4HO1X 5DNAA 4K9SA 4UTNA 2Y1EA 3NYWA 2AG6A 3THXB 1RJ9A 4GI2A 2JD1A 3ASUA 3URMA 2X4DA 5FLKA 3SJCA 4MTLA 3AIOA 3ONEA 4PHHA 4UCWA 1UK6A 2R1VA 5E1BA 1JKFA 2JLRA 2QOEA 1GQOA 4FQ8A 3OZRA 5T4BA 2NMVA 4YJFB 1AA6A 3KU4A 4V38A 1CVRA 1LEHA 1X7DA 3PC4A 3WL8A 1QHHA 2JLBA 3L8ZA 5KKNB 5FLYA 4F9FA 4F1KA 2WTUA 1PNQA 3HBLA 3VGJA 4LA4A 3VISA 4MR9B 1CPYA 4PYRA 3U5ZB 1YF3A 2PUBA 2QMUA 4FS3A 3SBEA 1W44A 3QMVA 2ZT8A 2QT0A 1PNVA 1RHKA 2CEAA 3CPJB 3CA8A 3H99A 4LBVA 5DM4A 3ZNPA 4JYAB 1TAUA 1GYRA 5B7QA 2BFEB 2C9ZA 5H4GA 1W1WA 4M8NE 5DTMA 2GRUA 3UANA 5L6MB 3W3AD 3VNVA 3R5KA 1CRQA 4GPAA 4LHVA 2K2QB 4W1QA 3SJZA 3I04M 3QYJA 1KI6B 4JQCA 1VRCA 3L7NA 1HV8A 2QQ5A 4KFUA 1U3TA 2AIRA 2CMFA 4LXTA 4Z4QA 4RZ2A 3HJAA 3QGMA 4XM2A 4CEIA 4MWEA 1ID1A 1K6XA 4MDEA 1RQ2A 1I9GA 1ZUNA 2R7MA 3QMWA 2MSKA 2BMFA 2QE7D 3NKLA 2AMFA 3OD5A 3A6FA 2G09A 4Y2QA 3H9QA 1HTWA 1JHOA 3IBTA 2VYNA 3K05A 4PAWA 3E53A 3A28A 1KI1A 1VSUA 4KQ2A 2PBFA 1BVHA 1JT2A 2VWPA 5E4TA 2XZLA 1SVKA 2QLLA 2XITA 1QLWA 1PL6A 2VHTA 3QJGA 3GJ7A 4JT2A 5BN3A 2IT1A 1X77A 4L50A 5F2NA 1NR7A 5IJ0A 3EH1A 2W7TA 3RVDA 3BWYA 1CW2B 2W6NA 3A10A 4Q4JB 1MDFA 3UFBA 1UM8A 3DOEA 3H9JA 1T5TA 2J09A 2QTLA 4GKVA 3N58A 3SFTA 3CLRD 4E2FA 2QLFA 4JWTA 3EZFA 4EHDA 3OQ1A 1H6DA 3PQ4A 1FZTA 1CDEA 1TVMA 2YWGA 4EGQA 1ISRA 4UU8A 4XWTA 1JILA 1NW9B 1A8SA 3OQJA 4LWQA 4RXUA 1ZA1A 1JBQA 3MINA 1E7QA 1SXHA 10MHA 1V4NA 5EQTA 4BBJA 1H4QA 2IYNA 4LYJA 2Q3JA 1MEEA 1WZNA 3RRXA 1GPAA 3IBFA 3L3BA 3R09A 4H17A 4LWZA 1G3QA 4M0MA 4DA7A 2Q6OA 3AI2A 3NM6B 4ZOAA 5JG7A 1MO2A 2QLMA 3UOWA 4FFMA 1IAQA 3A1FA 5TPZA 2RGDA 2PMBA 4C1BA 1FP7A 5DULA 4UNNA 4BNUA 1P7WA 2FJ0A 3ZGLA 4X85A 4Q4HA 3QJ5A 1C8VB 1SU4A 4GQIA 5K20A 1GUBA 3ICVA 2YYSA 2XVZA 1X3SA 1PG0A 2YY6A 4JJKA 5IU6A 2F1HA 3ZU6A 2AVDA 3HBAA 1RE0A 1P8AA 1NW7A 4MV9A 5IP5A 2IYZA 3ZHYA 2ZT7A 4H9GA 1E99A 3PXXA 5CTAA 2GCEA 1XTPA 2BP7B 2YVQA 3OOEA 3QFSA 2ZUUA 4GMFA 6ABPA 1CEXA 2X9LA 1X39A 4CKBB 2IXGA 1TUGA 3DAYA 2BGIA 1OGYA 4KQXA 4Q1EA 5LNK6 2XB4A 4UVIA 1IMJA 5E6SB 4A0SA 1E3QA 1FU7A 2P3LA 2VTDA 4RQTA 4E5VA 3W7VA 5EZQA 4CIBA 4GT1A 1Z6TA 4L8WB 4ND7A 3UA4A 3H2JA 2QRPA 4RQAA 5ILOA 3EZ6A 4OFXA 1JKXA 3TOZA 3OM8A 4CHTA 3RKRA 1Q0TA 1VKHA 4IIJB 4IM7A 4F9EA 1NF8A 1RQNA 3LRXA 1K63A 1Z2NX 4JJIA 1NLFA 1T2UA 1P19A 3I5UA 1NRXA 1LVHA 2NAFA 5EJ8A 1JR6A 3E2MA 2ATIA 4KODA 2CLKB 3FKSA 2PL5A 4HNGA 2Q3BA 5BMOA 3IV6A 4ZD6A 3GXBA 1FFXA 5ERXA 5CDUA 3FOFC 1PV1A 1R18A 5F2KA 1QB8A 3EEOA 2O2HA 1Z18A 3K0HA 1CY2A 1L4UA 3BHNA 2ENUA 3G2IA 3H97A 1E1RD 3ITKA 5IVIA 2FOXA 2M9MA 3IQHX 1O6CA 1UFQA 3ZWOA 4WOBA 4CR8A 1JWLA 5DK6A 3DPSA 6GPBA 5CT6A 5DW0A 1OZGA 1YQ9A 1HFKA 2ZBDA 2PX8A 1EFLA 1ILEA 3BEDA 4Y2XA 3AU8A 1S2OA 1HK7A 5IW8A 3PJGA 2J0UA 3JD3A 3X1DA 5JQGA 1B15A 4YP7A 2QVLA 4ZJYA 2O8FB 3H9GA 5T6BA 3Q8XB 1DO8A 3ANXA 5E4FA 3FPSA 4GOOD 4NCXA 2ZDQA 4Q3KA 2AK2A 3L8FA 4NL4H 1SKQA 3U40A 4EUFA 1DQZA 5HRCA 3UA3A 4JC0A 2Q3LA 3V1NA 3K1AB 1Z4IA 1JAHA 1V47A 2C2MA 4C07A 4AKIA 1YHZA 5BUZA 3MWFA 1U9IA 4IGFA 2WE8A 3LJKA 2IYSA 4PG4A 3HSYA 4LJKA 1L7EA 1F17A 4I2VA 3U4CA 4Z0PA 1A9SA 2IDKA 2ZI3A 2W42A 2YUTA 3SYKA 2J87A 4N5NA 3M4JA 1U1CA 2Q2QA 3RQIA 1E2HA 1SD2A 3DBLA 3LF2A 1CUGA 2PWZA 3MCVA 2GN1A 3ZU3A 1E5LA 3DZHA 3K30A 4BAZA 2YH2A 2QRGA 4NV0A 1QKIA 4CM5A 5J2UA 2JVIA 2C94A 5KU1A 2RKBA 4I5GA 3GGPA 2D74A 3HZHA 2R00A 3GC6A 4HAOA 4MW6A 1MC4A 5CVDA 3O2NA 3E0QA 3OZWA 3TCNA 1J00A 2QSYA 4BVKA 1L8QA 1S4MA 3GGCA 5K3SA 1YS6A 2V5UA 5I9BA 3AFMA 1QE3A 1P91A 3DUFB 4NAVA 4UM7A 1KAQA 2PTGA 5ICEA 4OOEA 2TMGA 3R7LA 1NYLA 2ZZNA 2EW1A 4P4UA 1TOAA 2UYHA 3KOZA 3ZUPA 1W6RA 4DA6A 1Z12A 3BA1A 1PJ2A 3A05A 4N82A 4CR7A 1PNOA 2WJWA 1PO7A 4WX2B 5EERA 3VV2A 2YFHA 4M0LA 2PG3A 3HFGA 4P4LA 4ZVOA 1E2IA 1SBTA 2PFKA 5IUJC 5JWRA 5EIAA 4UPDA 2BFBB 3O4FA 4K88A 1ZWLA 2VKQA 3ZWPA 3UHFA 2HDWA 3FOCA 5J5VA 1BRTA 1E3DA 1OZHA 1W2WB 3KQVA 2O20A 1A8IA 2EEPA 4K26A 1LF0A 3DDNA 3OEHA 4EI7A 3D8HA 1A1VA 1ZNYA 2ZBGA 3FRJA 4BKMA 1N33B 2XW6A 4WUVA 5IM4F 2AVNA 3A11A 1LY1A 3IKVA 2WT4A 2VHYA 4NULA 2WSYB 4EWLA 1ZH6A 4BUZA 2WTBA 4RLQA 3FFTA 3V1MA 2NSHA 5BWCA 5AOAA 4EA9A 1Y4UA 4M89A 3CONA 5CFZA 1AHIA 1VL6A 3SKYA 5KYYB 4OM8A 1PFYA 3OJLA 3VPCA 4F2DA 4N7RA 3X0DA 2VNHA 4R2WA 3CLRC 4DNPA 1JA0A 1VECA 1ZK3A 3ONFA 3PENA 3SFVA 4PN3A 2RAUA 3TNYA 3NTOA 4J0FA 3PQDA 3RT9A 4RZXA 1GUAA 2QLTA 1E1QA 4BU0A 3PNPA 1NBHA 4MDHA 1T8UA 4IH9A 1BXZA 4KL8S 4ZIRB 5AXBA 1BKDR 3BICA 2A33A 5CB4A 4BP1A 3CUVA 2HRZA 2HKIA 4PBTA 5D1NA 4B6JA 1ADJA 4FN5A 3QELB 4Q3AA 5F23A 2VTBB 5JW6A 1I5RA 1GTL1 5HZMA 1NVKA 1B2LA 2EARA 1PT7A 5DCWA 1ODFA 2EWMA 4FFBA 2X5XA 5E38A 5LM3A 1F60A 1FK8A 3EIOA 3MPUA 5FWAA 1I33A 1I30A 4FR5A 3OJWA 4EG7A 1JEYA 5K8IA 2V7XA 3RRYA 4UTRA 2X9QA 1RR6A 1MIOA 2EP7A 1CJCA 3VQTA 3TGWA 1YQUA 2ZZMA 3BMXA 2YNMC 2IOFA 1OU4A 3D4BA 1UMKA 4S12A 4UBKA 4UEWA 2KLHA 1R27A 2CCJA 4KWIA 3OUZA 2NSDA 4MQ6A 4IPTA 1OLSA 2YDXA 1BKYA 1M83A 4RS3A 3UG7A 4UC0A 1PF7E 2VDRB 1AKVA 3E7FA 3KDAA 2FLWA 2EW8A 2R68A 4N7JA 5DLDA 1E1DA 2PH5A 1S01A 1SVIA 2VNIA 3HXOA 3B3AA 4F5DA 4UQPA 5T3UA 1SCDA 1TZJA 2NV0A 3U6KA 2IZ0A 1QS0B 4UCFA 5BNZA 4BKQA 5K99A 2GEVA 2FZCA 2NQ2C 3N59A 4G8JA 2VI5A 4BVHA 2C2WA 5F77A 1KMMA 4M36A 4ZZIA 1JPVA 1ZN8A 3EFHA 5AM5A 5GJBA 5JCXA 1GR0A 4F9GA 5KYGA 1UMCB 3OPYA 4JUIA 1TZCA 3PKZA 4A3SA 3NDBB 2C2GA 2F4NA 1GFWA 3LQ1A 1KPHA 4KWTA 5JJIA 2BM9A 4PG7A 2QRMA 3ZK9A 2PKQP 3CEAA 4AMZA 3K0BA 3KIPA 1G64A 4XM0A 1QZZA 1JYSA 1ZXLA 3GOHA 3Q3HA 3KQLA 4HGYA 3SXPA 3QKIA 1EWKA 3C7TA 1EP3B 2DFTA 2QQFA 5EXEA 2I4OA 1YFJA 4DLPA 1HDYA 1E79D 3CX3A 3V80A 1ULZA 3O74A 1X1QA 4UDYX 5GINE 2QF7A 3NBMA 5FO1A 4AW9A 1W5EA 5LMNB 4GI5A 3LCRA 5FL3A 2QP3A 2ZUDA 5CX4A 4LRWA 1M2GA 2FSSA 2ZTMA 1R6AA 1YK0A 3P9QA 3TJZA 4TV8A 2FI1A 2BEWB 3IP5A 3M34A 4MEBA 4YJ3F 5F4ZA 1XQVA 4NCBA 3ZK8A 1Y80A 3RU2A 2QRQA 4DMGA 4ZYLA 4MDFA 1VCNA 2AOWA 1YJBA 2B2CA 1KAMA 1OQAA 2VDWB 3OZSA 3QSGA 5C1DA 3U09A 2HCFA 1EGHA 3AJ9A 5EHXA 1E77A 3ACBA 2H4HA 3IRVA 3CKMA 2F8SA 2UYYA 3W2HA 3FUCA 2P6PA 3O7MA 4ZU3A 3NWJA 1ATZA 5IHXA 1S1MA 1DUIA 3AVVA 4YNBA 4N03A 2HF9A 3W7BA 1QCYA 1YACA 1TO2E 1GQQA 3CG0A 2WHPB 2CDAA 4S1OA 4CCYA 2ZIXB 4PYIA 5EZ6B 1QUEA 3S3TA 4C1NA 3L77A 1E2MA 3LUFA 1DVRA 4MKGA 2Q0QA 4AJKA 4XX0B 2GEJA 3N05A 3DF7A 2XKKA 5IRCD 4MVJA 2P2DA 4BVEA 1NV8A 1ZR4A 2HPVA 1NP6A 1PJBA 1TLTA 4IOJA 5H7XA 3GLHA 1OA1A 1CUSA 2HX1A 5HA5A 3VTFA 5BSWA 1XELA 3B5JA 1RWXA 3K9HA 4I4TB 2VF8A 4JI6B 3IBGA 2QRVB 4DCCA 1IXYA 2H5IA 3GJYA 4KK3A 1HYBA 4L16A 4TYWA 4XM1A 1CUZA 1QG6A 4HUQB 1KYIA 2E1PA 1E6WA 3HP1A 1Y33E 3D1JA 4BGVA 4BZQA 1QYIA 3ZDCA 1GG2A 2HHLA 1SD5A 4LZZA 4EY6A 1ZK2A 3CZRA 3LT0A 5CNJA 4ZV4A 3Q7TA 4R1OA 1TLFA 1L0BA 4Q00A 5DGDA 4YV2A 2IP1A 3LV8A 4E09A 2IKSA 2FEAA 3QVKA 1XWIA 1NVXQ 3FBGA 3KAKA 2N42A 4BPRA 3GUHA 2BDEA 3F2IA 3GZ4A 3JSAA 1JHDA 2MR5A 3WYNA 1IZ0A 3ZY4A 4OEHA 3PUWA 1C5KA 2Q3DA 3NDIA 1R6DA 4GR4A 4RD0A 2OV1A 4YJGA 3A6KA 3OEYA 3G8BA 4TT8A 5FRDA 1N7GA 2QROA 2P4HX 1BO6A 2EU8A 3D7LA 3LG2A 3BMQA 4GQAA 4XR9A 2VYCA 5AOVA 1XPJA 3TTYA 4EEKA 4ENSA 4PO8A 1QHNA 3WHLA 1TUIA 3TW0A 4J0KA 4G1VA 2ZETA 1Q14A 2RFLA 3IUSA 2AOUA 3QVLA 3ROMA 4FBLA 1KO4A 1H8HA 5FBQB 2XLBA 2Z5GA 3VNAA 4W1SA 1XHEA 2PX4A 3ROEA 3T1TA 1Y6JA 4BO9A 2OGZA 1WQ1R 2INGX 3L1KA 1F51E 3CW9A 4BQPA 4MWSA 2P9ZA 4J0JA 3TAHA 2JZCA 3MCWA 3M6FA 4RTQA 3T5GA 2VPXA 4CM9D 4JJ8A 4DYDA 4G37A 4DVGA 4DDVA 4JLWA 2IS6A 1Y82A 2W00A 2B83A 1Y3IA 2ZW9A 3BH0A 5ALXA 5FCDA 5T3YA 4URZR 3VHXA 2IEAA 4C0LA 2X6TA 1RNLA 3JWJA 1DCKA 1T3SA 4M0PA 3PYXA 1OI2A 4FYPA 4LTNA 1GPMA 2B6NA 2GO7A 1YUNA 2O1WA 4G4IA 4TXLA 4U6QA 4OF4A 4X8OA 5EG5A 3CUEF 1RPAA 2OCDA 1X7WA 3PGKA 5LCXA 3WSTA 4EJSB 2YWCA 2XT6A 1QH9A 2OMKA 4AQ7A 2I34A 3CG4A 3VDNB 5C8ZA 1L5OA 5CW2A 1ZGAA 4TV8B 1CE8B 3P2IA 1N5IA 2RI0A 4O4LB 2OSVA 5FOWA 2MCFA 3U0VA 3UENA 3V8NA 4YV0A 3GUYA 4HAUA 1BXGB 4G8BA 1DWOA 1G8SA 1G66A 1KI6A 1X8KA 2QM7A 2QDKA 2HUNA 3DKKA 2XYRA 3JASB 3JZDA 1E59A 3L6EA 2I2DA 2ERYA 3MCAA 1U6IA 4F3RA 2G76A 4XDHA 2FP4A 2N46A 3ABZA 3FHLA 4WKBA 5AM4A 4AL4A 2HF7A 3NB0A 3ZX5A 2HU2A 3FAZA 5FJJA 5H9WA 3LGAA 2KWIA 1ZJZA 2WF5A 3CN9A 2B1IA 3QKRB 4P2GA 4DCUA 3N86A 5LQKA 1QBGA 3TR5A 3DC7A 3SC6A 4I9UA 3ID6C 4MMYB 4RVFA 4S2UA 1PNRA 1DC6A 4UHDA 4J75A 4W5JA 1FTWA 3TKAA 1H5UA 3BJRA 2DTEA 4RK0A 4ZQBA 4W8OA 5EYPB 5J40A 3KUXA 2A9FA 4OI1A 3TX2A 1CY4A 5IZCC 4M49A 4L5AA 1U3WA 3OQNA 4BAUA 1W73A 2D1SA 3ZNNA 1AHPA 1YU9A 4GPEA 3GJRA 4E4RA 4ZCTA 2GJ9A 4M87A 2VQEB 3AEZA 1EEXB 3H4IA 4M99A 1R88A 1ICEA 3SWWA 2QYSA 2V6MA 4HTFB 2WIDA 1YC2A 4IMJB 1II8B 4G41A 1NJ2A 4NY1A 2VOEA 1JHUA 5TSDA 2RI1A 1Y34E 3NHSA 2B1JA 1S7CA 4UUOA 1JHAA 4F84A 1Y1RA 3UPTA 1CQPA 1NT2A 2XNDD 3AILA 4BP8A 3ORFA 2WSIA 1T26A 2VYVD 5E7IA 1SHUX 2PX6A 4RPGA 4KFCA 4EUSA 3PUHA 3S1SA 2BFPA 4I8DA 4DUYB 3NM4A 2R6DA 4UW9A 2QM3A 5GJVC 1H23A 4J07A 1DKPA 3M1YA 2XOEA 4L8FA 1IVSA 2ZQZA 4E32A 4D4MA 3PEEA 1V5WA 2PYDA 3L4BC 1V1JA 2GBFA 1AGRA 1KY4A 3SR4A 5C4MA 4MUFA 2H7YA 2AQKA 3KSUA 2W70A 5HW0A 1VSBA 3H18A 4JR0A 4QUGA 4BCBA 4BCDA 4DA8A 1W30A 3F3SA 5DASA 2CCGA 4AJ2A 5B4TA 2XDAA 4MRSA 1WB9A 1VHDA 1PQ4A 4JGBA 1ZGHA 5I7VA 4NF2A 3HCAA 3BD9A 2AFIB 1AKMA 3K4PA 1HXHA 3EA5A 2I3GA 4J4TA 4DMKA 4O2BB 3DHYA 3VOBA 2PKCA 5KSOA 4BKUA 4RSGA 2ECKA 2HK8A 4IJKA 2ZSKA 2FUG6 2QTNA 2L0XA 3NPMA 1T9KA 3EASA 3G88A 4RDHA 4ARIA 4LF4B 4NBLA 4WRRA 1JZSA 4LXUA 3OCYA 5JNRA 3DL2A 2HXGA 1XALA 1IK4A 2WJ6A 4FFNA 2QV0A 4YCJA 2VKTA 4QA9A 3DUWA 4WBNB 2Q62A 5FWNA 1OYVA 1XEWX 2G72A 1BE0A 2E6UX 4PX2A 2F90A 1K6EA 2AN4A 3E1KA 3U62A 3FCUB 4CKEA 1JGTA 1EP1B 4FYWA 4FMCF 2FPIB 2FEOA 2OCGA 1T4GA 3DE3X 4GRIA 4QOIA 2J59A 1C0EA 2GN0A 3FPCA 3R24A 5LBUA 1P7CA 3TG8A 2XCLA 4YCNA 4TLAA 1CE8A 4QYXA 1VIYA 5AHKA 3HCCA 2IYTA 2O5CA 3SHOA 1T0BA 3L92A 4QODA 1LFAA 5EZ5A 1GZUA 4I1RA 4LHWA 3SZOA 2AXNA 2MJLA 3T1VA 1J6UA 1E9DA 2A7QA 2W8ZA 4LDQA 3TLGA 2GHIA 4J0DA 3O1HB 3PTLA 3R44A 1QVZA 4FZRA 2GH1A 1Y8QA 4KPGA 4ALKA 2Y93A 3CX8A 3ZCQA 2J0QA 3AEQB 1G5IA 1JA1A 1SBHA 1UBJS 4JEMA 4X8MA 1W0KA 4ZT5A 3RS0A 3HYLA 1PBNA 3L2OB 4R1MA 4EF5A 2PX3A 3PNVA 4KXLA 3K6SB 3K09C 3B89A 5F9HA 3KD2A 3A6HA 1ECJA 2FXVA 1XGKA 5EPUA 4JQZA 5P8WA 2REQA 4J9VA 3RRNA 4W5RA 3I52A 4MJ7A 1HDGO 2OAQ1 1GD1O 2P2YA 4WCDA 2OR3A 1QIGA 1ONNA 4WD3A 2W4IA 2Y4OA 5F1KA 1PRYA 5FPPA 1DIAA 1T15A 3S2FA 1FIUA 4ZVMA 4QJIA 2ZXUA 2OKGA 4HTFA 1T6YA 1YSCA 2ODTX 2HA2A 3C8MA 5JLAA 2VR1A 3HB5X 5DNYB 3VR5A 1RYZA 4B3SB 2YW2A 2XRMA 1IN4A 3CNOA 4HLQB 3DDUA 2AW5A 4YMLA 3QQPA 4YRBA 3IE1A 3K1YA 4J3JA 1NUQA 2IPLA 3ZD9A 3P19A 2JGJA 3SE0A 3KT3A 5KTYA 4KKVA 3CE6A 2GN9A 2ZRNA 2XYVA 5FKJA 5JMWA 5C8XA 1TM1E 4K5QA 4V0RA 4BQSA 4BGEA 1OYWA 4BVJA 1LDGA 1RKXA 4HNHA 1CJUC 4Q3CA 5ALHA 1JLLB 2QIPA 1KJIA 5KCZA 5HFJA 4I99A 2ODQA 1ONSA 1ZA2A 1UJ4A 2RHRA 2JJQA 4QDTA 2P91A 3TWOA 3WG9A 1I7PA 4MUYA 2WJYA 5GZ3A 4AUMA 2BFCA 2P9EA 2E6KA 1RAHA 4J49A 1SZDA 4C2BA 1XRRA 2QZPA 3NIGB 4RHCA 3I05A 1H0SA 3PLRA 1H2XA 2YOGA 2W0SA 3HA7A 3W8DA 1L5HB 3CLSC 1MAUA 1V16B 1BU5A 1V7PC 4JLVA 5FAXA 2XMGA 4J1QA 5C3UA 3U39A 3UJDA 1J70A 1ULSA 2CK3D 1C3EA 3IAM1 4L74A 4E08A 4J7CA 2J3HA 1RJGA 4MYRA 1WPQA 3N2YA 2A78A 3PD1A 3O5AA 4C20A 5IM5A 1PG5A 1XCLA 2LCIA 1ZFNA 1U3CA 3N2GA 4S2EA 2VZLA 1GPWB 4FD2A 5ANRB 4PYOA 3UH1A 1OC2A 2WKRA 3BWVA 4DY6A 5A3QA 1ETHA 4MR8A 3VPDA 4MRNA 1DAKA 2QGNA 1EK0A 3PWTA 4AYTA 1N8NA 1P29A 3G2HA 5DLYA 2K7FA 4WLVA 2VHCA 1UQTA 1G291 2R5NA 4YGYA 2HM7A 3AFGA 1RXIA 2VJBA 3EULA 2JFWA 4N8DA 4LEIA 4HGNA 5DHAA 3C45A 1ODCA 1Z88A 4XYBA 5ALSA 4B8YA 2BMAA 3N9IA 2QK4A 3LC7O 3GUVA 3T7IA 1BC5A 3QKWA 1JR3A 3REOA 3EZLA 3HSKA 5CU7A 1Z17A 3ZWAA 5NULA 4IQ4A 3UNXA 1HF3A 3HYRA 4L8YA 4KQEA 4C2TA 1P81A 4H0CA 5CG1A 2J33A 3KQWA 3MAAC 1X86B 1XRSB 3RSGA 4Y9TA 1TF2A 1QV6A 2D5LA 1W46A 1NRWA 1ADYA 1YRQA 4LXIA 1TO1E 4HDRA 3DZKA 3ESXA 1OXUA 3BTUA 3R5JA 3UK7A 2FZVA 1CUEA 2OYSA 3H2KA 3V2HA 1H6BA 3S1AB 5HKBA 1DRWA 3HN7A 1XZQA 1CUJA 1U8AA 5B1EA 1QYRA 3TTUA 1D2NA 2EBWA 1KS2A 4UXIA 3BERA 2CJPA 1LDMA 3MB8A 5CJ2A 5ICMA 4L72A 2WKQA 3NXSA 4FNGA 2W2QA 4Q4LA 4RA9B 4ZAZA 4GLJA 1YS4A 1KZYC 4JS0A 4OQDA 4IILA 4WDRA 4BB9A 4C29A 3WL3A 5HZGA 4R84A 3H2HA 1SQFA 5KJ6A 2BEUB 4YECA 4L28A 1RQXA 4QUKA 2WKSA 2RBGA 4Y6LA 4LVCA 1DCTA 3NV7A 1U0SY 1V8FA 4FLFA 4A2WA 1YVPA 2FSVC 3P45A 1T9HA 2BFDB 5FB3A 3IJEB 1X80B 4ZN6A 2Y68A 4WGFA 2B98A 1OSNA 1U9CA 2H2IA 4I2NA 2MMGA 1CD5A 3A1EA 2FW0A 1XB2A 2RCNA 2XV1A 2ZSAA 3C6ZA 3STXA 3WGKA 4JXKA 4H4EA 5FEMA 1CWUA 4N0DA 3ZWXA 1ZRSA 2NX2A 1ONPA 3LHKA 3ZDRA 2XBLA 2PGJA 4RL4A 3V1TC 3UWOA 3X1ZA 1OXMA 3DLTA 2H5JA 3WNQA 1GTVA 4G5QA 4MTCA 4R8KA 5LOVA 3ASZA 1IUPA 1R10A 2XHEA 5AVJA 2YNMA 4KKXB 2ZJ3A 4L15A 2FKAA 1PZMA 1YR7A 2WSSD 5LNK1 3DC2A 3FNGA 3IUEA 4AIIA 1X1CA 1C7ZA 5KTKA 3RBZA 3ZVKA 2YDYA 1TQ2A 4Y67A 2I3AA 4CG3A 3IEMA 1RZRD 3W0LB 5BQ3A 2HQ1A 3FPEA 4MQ5A 3VGPA 1ZS9A 1TVKB 1CRWG 3P4YA 3HKBA 4GLLA 5K8LA 4P0QB 4MQMA 4NJOA 3K4QA 4RY9A 5ECWA 1YDHA 1BJTA 1FFWA 1GQFA 2L69A 1GPH1 4K6MA 2MMCA 4YRLA 1ZUWA 3NG1A 4ZRNA 4CDRA 4QQNA 3K72B 1FP2A 2ZRMA 3ZWKA 1V3QE 1E3LA 1W4LA 2V8BA 5JHGB 1C0LA 4IDDA 2WOOA 1SQ0A 1QK3A 3GBSA 3ZY5A 2W2OA 2HLPA 8ABPA 2P9JA 3V8PA 2FMIA 3TD6A 4ILKA 1K7FB 1WXIA 1PTJA 3FCXA 2KB0A 3FNQA 1GKKA 2YHUA 3HP4A 4N0QA 4UUAA 1XKLA 2Z6AA 4PLWA 1I6LA 2I6UA 1J42A 4CIWA 4OYRA 4WK6A 3SQMA 2DLCX 5A06A 3A1UA 4XCVA 4W5TA 4F3KA 2GCPA 5BQPA 2WTMA 3QVMA 4IIEA 1NBME 1IJBA 5CB6A 2K5UA 1N3LA 3WI7A 2IPMA 2O3SA 3EXAA 1ECFA 4CV0A 5IBPA 2HAEA 2H3HA 5E2IA 1PZNA 2HZBA 2XA2A 2BHTA 2UDPA 4B3MB 2QNIA 3GMIA 3OEED 4N1AA 4WOJA 4ZCLA 1JH9A 2PNJA 3OO1A 1MF7A 1W4AA 4NYJR 1H6CA 1SG0A 1IJFA 4B6GA 1JIIA 4X0EA 2I5PO 4DEVA 1MQ8B 3RF6A 4Q1AA 4ZWNA 3NR2A 4KIFA 1AKWA 3RHSA 1TUBB 4JI7B 1KRHA 4DLVA 4EJFA 3WDSA 3EXEB 4R68A 4H7HA 1TZMA 3NC0C 2D62A 2YFYA 4QQ8A 4UBLA 5ICFA 5JO9A 4EQZA 2VJCA 2B8WA 3GT0A 1REQA 3B5EA 2FPPB 2O8BA 3N8GA 2A3NA 5H83A 1P3Y1 4NK4A 1IEVA 1YA4A 3V8VA 4RH1A 3FTNA 3T61A 2WIGA 3NDJA 1KFBB 2XA9A 4GMXA 2VA9A 4PZEA 4NQRA 5FBZA 4H6XA 1V39A 4QUAA 1OB2A 3PNYA 5EY5B 3OLWA 3QP9A 1GHTA 4RHXA 1EVEA 4WUTA 3TZKA 5IF9A 1X9IA 2BHRA 2GARA 3BWXA 4G97A 4MP3A 2E4ZA 3JQ6A 2FX2A 3RC3A 1G9XA 2W2LD 1XX6A 5BSGA 2H1WA 3PK0A 3PX2A 1OW3B 1RQGA 3JALB 5AKKA 1XC7A 1X7ZA 2CE2X 4OL0A 3ZIAA 4UTXA 3F8TA 1AVTA 1GGHA 4E70A 3LUJA 2P0AA 3I12A 1VMEA 5H1YA 4WWHA 1VE9A 4IBOA 3O2QB 1PW7A 4MLPA 1L1RA 2FU5C 3L0SA 4OATA 3F97A 1TZ2A 4QXPA 4EX6A 5JCOC 1XPRA 2P9GA 3OOHA 2AX4A 1SKYB 3WL4A 1QHEA 1LSOA 2ZRPA 3GVPA 1FOEB 1PWEA 5JQGB 3CCCA 2CEKA 5U4QA 2OXCA 1S4QA 2ADOA 2AD5A 3I83A 4INOA 4A7PA 5JJBA 3EY4A 1UXHA 1Z0ZA 1ZZEA 3SXUA 4F3YA 5IM4A 3B85A 4I81A 1SZJG 3DNMA 2ZM5A 4HDRB 1R4NB 5DN6D 3PLAE 4NC9A 4KBFA 3AINA 3DULA 4K05A 5F2OA 3HDJA 3PXBA 4P0TA 1DRVA 1MRNA 2P5UA 5E6SA 2ZUTA 3U3KA 4RK6A 4QT4A 3NU1A 1T43A 4CT5A 2P1RA 1P6UA 1QK5A 3NVDA 2B4QA 3DDWA 4WK4B 3PWSA 1MOZA 1SQ5A 3I4CA 2E89A 4XQ9A 1EESA 1JPUA 3CN7A 4EGAA 2K87A 4C0BA 2ZCVA 5FLXA 1UFRA 3MELA 1NI4B 5ABPA 1I1OA 2LBPA 1J8FA 3WMWA 2BN4A 1Q3TA 3HJGA 2QTZA 2CNNA 2ECQA 1HZZA 2J6IA 3RVPA 4JCCA 1UF9A 1A72A 3UUEA 1XZKA 3M2PA 4OJYA 3N3AC 1IVYA 5K6AA 4RKRA 1XV5A 3K70C 4TMFA 3F71A 4IUYA 4DJJA 1C4WA 1GZ5A 5HE9A 2DG2A 2J31A 5TMDA 3RTCA 4O3MA 1XQ1A 3IH5A 2BJHA 4AICA 1VDZA 2WTEA 5HMLA 1NUHA 2V3WA 5EE9A 2Y67A 5TLSA 3EK2A 3PS9A 2H00A 3V2IA 1UANA 2XOXA 4ZQGA 3UWPA 3TMYA 4R6XA 4GDMA 2WF6A 2GF0A 2WYIA 2J0UB 1IPHA 2QTHA 3KR0A 5T4FA 5K1ZA 1G20E 3O4JA 3L18A 2C98A 2ZRCA 3W8NA 4F86A 1JJ7A 1JP7A 1ZC3A 2BFBA 1APBA 2J3QA 4C7OB 2VHXA 2CYAA 4AWXA 1VLZA 3DWGA 1R8YA 2C04A 1A9OA 2GSDA 1QDUA 3FX2A 2B20A 2WWGA 1E8MA 3KQQA 4JB3A 4EJ6A 2W8BB 3A9CA 4QXMA 4NX2A 4BL5A 1X7HA 2EFDB 1TUEA 3UHAA 3HKBB 3HRKA 4O33A 3RG2A 3KFLA 3KVNA 1MZVA 1PGPA 3ZOZA 4V0QA 5JY1A 1YJCA 3VHQA 4PZLA 4CLEA 5FJIA 3GLSA 4UDXX 5BQOA 1UZNA 3MS4A 3VR1A 4GPTA 2C61A 1N5KA 3KQNA 1IE3A 1XEXA 1MC5A 3L49A 2V6GA 1EGMB 2DUWA 2X14A 3QVTA 5HS6A 4BEBA 5JI2E 5LLTA 1ZR2A 2I33A 5IZCA 4A0QA 1O9HA 3DDHA 4HDMA 2YZNA 1G3RA 2H9IA 1G41A 1QIDA 3VTZA 2XAAA 2YYZA 5JAPA 2GLXA 4OLAA 2NW6A 3GEDA 4ZP1A 4UDNA 1DWQA 4B7UA 2VDQB 1R50A 5HUQA 1IXKA 2BBWA 3AXTA 3SCZA 2CB0A 4EZBA 1DTWB 2PBRA 4G5XA 2P35A 5EHZA 4CN9A 3EFOA 1NUSA 2ZOSA 4G0XA 1KSGA 3H86A 3S44A 2RD2A 2H6EA 1WMDA 3ESCA 4NATA 2FUNB 1PGNA 2GZ3A 2UUAB 2CGEA 3SXUB 3QSYA 3OOWA 2ZVPX 3GBVA 5B6PA 4JP1A 1YZLA 4MPPA 4AS2A 2CC2A 4LJYA 4JB0A 5EHIA 2ISSD 2BM0A 2GPAA 2BEVA 1U28A 4JGIA 1O95C 5GQSA 4AF7A 5FTLA 1Z6QA 3E6AA 1TYEB 3KBBA 1G5HA 1TIKA 1J20A 3K8OE 4UHEA 4UUMA 1IG0A 2CXOA 2JLSA 5IKOA 1I7QB 1QFZA 1Y1TA 4EDFA 1C0IA 4Q3OA 3PIDA 2Z56A 4V0OA 2G1KA 1BQEA 2ROQA 2EKBA 2VEOA 3AHJA 3EB9A 3W6OA 4C21A 2VYND 2LUOA 1K5PA 3TRFA 3GQBA 3T5MA 4YT4A 5BYJA 1RZRA 4BIIA 3PUXA 3IA2A 4NZZA 4EELA 3NTLA 1PJSA 1GTZA 4I1SA 4X00A 4ESEA 4QDOA 5BNFA 3OZ7A 3PR3A 1JEDA 3NP7A 4ML3A 3WYBA 4EKYA 1L5RA 2ADFA 5JFTA 5M34A 4UBIA 2GTPA 1FDTA 2IX3A 1TJNA 2L82A 1JQJC 1ZM4A 3KSRA 1OPXA 1WWKA 4L3OA 5CFOA 3ZV6A 2VUIB 1YE5A 2RGEA 3E3NA 4HXFB 4XQGA 2P79A 3BQNB 2WUGA 1VQ1A 3RRMA 1CR4A 3KPUA 4JJEA 1M8FA 2DBVO 3PGLA 1DQPA 1UT6A 2C07A 3Q7QA 3AIKA 1X1RA 1BAPA 1Q7CA 1MG5A 2IPXA 2NZUG 3QMMA 4ND8A 4N47A 3VC3A 3LTNC 1DB3A 1FFGA 1P2FA 4TQUS 4K81B 1UPXA 2VDUE 3DBIA 4FLMA 1KJ9A 3TL3A 4D0SA 1F38A 4DMRA 1XTVA 2Q4RA 3JQ9A 1CJSA 1TMOA 2R62A 2Q0HA 1YR8A 2QYOA 3GRYA 3Q6MA 4KDCA 1Z0SA 3M6UA 1HLGA 2AMJA 1GU1A 1GZSA 5K2MA 3USCS 4JFRA 5FX2A 2W90A 2AT1A 5A71A 4BC0A 6LDHA 6Q21A 4R6WA 3C3PA 3DZCA 2QVZX 3GMDA 4D56A 1JDNA 3BM5A 1USKA 4B3BA 5KC9A 3OSZA 4KR2A 5HOQA 1N5MA 4TWBA 3V4RA 1WVGA 1N7JA 1U2DC 3ODGA 5CDYA 3PNMA 4KSYA 2D3TA 1VBMA 1PGQA 1T36B 3KFVA 2NUTB 5HJ2A 2FR8A 3BK7A 1XR3A 3BMOA 3GEMA 1PZGA 1G3MA 5T4EA 4DXAA 2CZQA 1E9SA 2QU7A 4F7DA 1BWQA 4L4UA 4MYTA 1QP0A 2P1DA 3TAXA 2IH2A 5EZYF 2QW1A 5TVGA 3NCHA 4XWOA 1E1MA 2AD1A 2W93A 1I4LD 3CSDA 4X60A 2ZIUB 2IHZA 1QGDA 4TRJA 5B3JA 5DVZA 3LOQA 4AO8A 4C4TA 4FC7A 3PZBA 3F9CA 4F72A 3QFHA 1JR4A 2I2FA 3CZMA 1UK9A 4L5BA 1Y3FE 1R0YA 1THMA 3CBQA 1MGPA 5A0FA 1FRVA 2WHRA 2WJVA 1QE5A 4FZ3A 4GBJA 3EUAA 3OCZA 3W5AA 2Q3CA 4U2GA 3RH0A 4QU8A 4CV3A 1U3VA 4PBSA 3PRKE 3TKYA 2AFHE 1EUYA 1ZWKA 1TJ3A 5AO9A 5KNBD 4OXKA 4YMWA 3JYNA 4MUHA 3UMBA 1G6OA 4ZXPA 4RTMA 1TDJA 2I6SA 2PS0A 2DBYA 3RIHA 3O8BA 2ZSIA 3MN1A 3RBXA 1U8XX 3M2TA 2NYVA 4UNIA 3GPDG 3RHZA 3RTGA 5I9IA 1O4WA 4OB8A 5TXGA 3KB2A 3E27A 3LA6A 1FMCA 2P78A 4EFMA 4G0YA 2L17A 1KVRA 2QN1A 3WIBA 2G04A 4IOLA 1O89A 2QUJA 2ZI5A 3MS2A 4FINA 1YI1A 1Y4DE 3OQHA 1YNOA 2ZIWB 3N2KA 1DEXA 2CLFB 2VC2B 5IYZF 3I9MA 1H3EA 4J0QA 3HU5A 5JR3A 2YN0A 1QX3A 4AYXA 4S0XA 4WCVA 3I6ZA 2XCOA 1G8PA 3R3UA 1US8A 2WE7A 1JHRA 1HLFA 4OJKA 4QUEA 3F6PA 4B1FA 1F6WA 1MW9X 1Q12A 4HGPA 4ACBA 2OZPA 3QWIA 2D5BA 4RQBA 1DC8A 4BNJA 1YGYA 3K1AA 4RA9A 3UVEA 1LSJA 1XIVA 3LW7A 4HRYA 4U2FA 1W76A 3IOEA 1QFYA 1LI4A 1M8JA 2OHJA 3ML1A 1WMEA 3G7SA 4TUYF 3BWMA 1JALA 3T3GA 3WNBA 1Y9DA 1ADCA 4C7BA 2JFOA 1SH7A 5KAPA 5JH7B 2RHLA 3I39X 1Y81A 3P5BA 4TRRA 4RHTA 5JJCA 4K9PA 1H2AS 5TS2A 4V2UA 4CGYA 3SZ3A 4JOCA 5C5IA 5M7EA 3DZFA 4OA5A 4U1RA 3SSNA 5CCXA 2G1UA 1JQDA 4TTVA 3DYVA 4J1TA 1WDKA 1P4AA 1AG9A 3EF3A 1IATA 3LS2A 3QLVA 3I62A 1PX0A 1RWMA 2H1VA 2EYQA 2WG2A 1NNEA 2VZ8A 2ZVDA 4DBZA 1U2PA 3ZE6A 4PONA 1FUKA 2B7BA 3FDFA 3T9CA 4NZNA 4Q9IA 2O8DB 2G6TA 5CVEA 1H5NA 5K3EA 1PWHA 5JWHA 4V1CI 2QORA 4FFLA 4CNBA 5KC8A 2G1AA 4B7XA 2V9CA 1DUVG 1D2CA 2MYUA 2DFKB 5BW6B 4Q34A 4N76A 3EQ2A 1YS2X 1TT5A 2YHBA 4GGMX 4DQDA 5AVZA 1HDIA 3HJBA 3PICA 3C5CA 1JSRA 3C6MA 5HFNA 4NKRA 2QM8A 1UJMA 3BGDA 3HY4A 3I58A 4GUAA 4KGZA 4RSHA 3AJ8A 3ROZA 5ITSA 3JPWA 1BE6A 3G8DA 3H16A 1R16A 4AN1A 1LBQA 2XAUA 3TB4A 4JYCA 4S35A 2Y9PB 2FG7C 5DBGA 3KB6A 3G0OA 3KSMA 2BH9A 3AUJB 4ZVRA 3QW4B 1R3DA 1DOHA 4N48A 4CM6A 1ZVKA 2QTVB 3MTAA 2KS6A 3HA2A 4DVJA 2ZXFA 3RYFB 4HT3B 1UBOS 4O4IF 5J43A 3OOSA 4CL0A 4Y9RA 1E1QD 3FPJA 4OGFA 2FQYA 4Y0VA 3ROKA 2CBXA 1EZZA 4AJHA 3BULA 4XD7A 4ESHA 1LI7A 3WVNA 3FI9A 3HJUA 2V65A 3L8EA 4YAKA 5ISMA 521PA 1OXXK 4EJSA 3ROXA 1L3IA 2X3UA 1PWZA 2J5QA 5HR5A 1S2MA 1NDHA 3B6EA 3FZYA 3QU7A 3SU8A 2QR3A 2QTBA 1LK7A 4IQGA 1S89A 1P3DA 2C3YA 2ODWA 4X20A 4ZO4A 5C34B 5HFAA 1HMPA 1ML3A 1W9HA 3ZCTA 4H35A 1EQAA 3WYCA 4CMIB 1JHYA 3A2KA 4DZZA 1MAVA 4BE9A 4IX9A 2BV3A 1JDZA 4IHAA 4J76A 4DPMA 1QG2A 2J6HA 4HQNA 4KAAA 1Z83A 3G6WA 3AXSA 4TS9A 4DV7B 3IHTA 3VYTB 4JR1A 1WVIA 4N40A 5DISB 1YFKA 3WKEA 4H18A 4UM9B 5JDIA 5I48A 1VZ3A 3CO5A 5FTWA 1JEYB 1T36A 4I55F 1NXWA 2PBZA 1W35A 1DXOA 1LB1B 3UH0A 4K1LA 5KZMB 1FDWA 3WKAA 3IMCA 3IPXA 3NHFA 4O2BA 4TZKA 2YWFA 4EMTA 1PZFA 8ADHA 3LX4A 4L02A 3VKHA 2D1FA 4RCYA 2O0HA 3KKEA 3LU1A 2ESRA 2X8JB 4JELA 5FHRA 3U7HB 2O50A 3ZGOA 1XWFA 4IINA 2H2DA 2VCYA 2PUDA 2J0VA 3ME5A 4ANFA 1Z9BA 5A3RA 1KYZA 4OHFA 1SJ9A 1XNHA 4GX0A 5LUAA 1DMRA 1XEAA 4OMFG 4A8JC 4ERXA 5CNKA 3NVKI 4OKNA 3RVKA 3V1UA 4N5HX 1T25A 2PLRA 5CBKA 4D8UA 1BHSA 2FR1A 4JGGA 4X95A 4MW2A 3RVBA 1T34A 4FJ1A 4QPZA 3IELA 4Z0HO 1PCXA 4YAGA 1NQTA 2IIQA 1Y5MA 4HWRA 2FPXA 5E8RA 3FWHA 2GN6A 3BQMB 2OYCA 4ZVVA 5FI1B 3BFKA 2V54A 2OLJA 3L84A 5LZ5A 4BLPA 3WADA 1VKRA 4HN2A 3OG9A 3DT9A 2HQOA 2CUNA 1A76A 4A0FA 1VHJA 4GXRA 1YRYE 4GKJB 1AO3A 1VL2A 1R8XA 3EMBA 1P4RA 2P65A 1NXQA 3ODPA 4ZYVA 2DQYA 3IR7A 4YRMA 3MHTA 1W1IA 1Y8RA 3CLUD 2RE8A 4G36A 2ZCUA 1N6KA 4TTAA 1IEWA 1YRWA 1IBMB 1S0UA 3QKUA 2COKA 2FZGA 3HQ4O 3BAZA 3NHYA 3UIEA 4MPRA 3W34A 2BKXA 3ZWVA 4DXHA 3U16A 5D86A 1D5WA 2WYVA 1CB7A 3NBYC 3U4DA 1X42A 3EPJA 4GI3A 1BDHA 1CRPA 4XWAA 3HKCB 4UPVA 4NPHA 1BEEA 3IP7A 3SQNA 5J47A 3W2FA 1Y6RA 3KXKA 3LXMA 5IKXA 3TDNA 4C0WA 3OAAD 4C08A 1ISGA 2F3PA 4NNOA 1IHOA 3MBIA 1NLMA 1XN1A 2OCYC 3I1JA 3N6VA 5ALIA 4ZI7F 2UUCB 5CYFA 2IIVA 5FA6A 4FM9A 4W6ZA 4WW0A 4KZPA 2G82A 1OXKB 4TT3D 5E3HA 1C0KA 3ORYA 1AK2A 1JR3D 1K68A 4LGCA 1LCIA 3TBHA 1AE1A 2YNMD 1BJRE 2EJTA 4K7JA 4E6PA 3HFRA 2C3OA 2WF7A 4G5YA 4PINA 3LTEA 5GAJA 1RYFA 2WJZB 5GJWC 1U5BB 5BVHA 5JVDB 3OWHA 3CIOA 4G1UC 4FCCA 4H4DA 2JGRA 3GGOA 3FYUB 4ZJPA 5CXXA 1N8TA 4FEYA 1BGXT 1GRNA 3UHOA 3GCWA 1UWKA 3HN6A 2X13A 5AR1A 3TH5A 2OGTA 1Z2DA 3DNFA 2WWVD 3UUFA 4ZDJA 1SZCA 2F48A 1RMQA 4ALMA 3QNMA 3B9BA 2JJ2D 2XVYA 4UHJA 4CF4A 1L9XA 5COAA 2QRVA 3HXKA 4PSVA 4ZFNA 1DFIA 3LW8A 3PPXA 3ZKWA 2CYBA 5FOSA 2DT5A 3DW1X 4IV8A 3UK0A 1R64A 2XGGA 1L7MA 1CUVA 2FWJA 4TLBA 5A6VA 5BSEA 5JXIA 1ZOLA 3O4HA 5L3ZA 1VIDA 2AG8A 4RZHA 1ZIPA 2WG1A 4O8CA 2PUFA 4JR2A 2A5DA 2D06A 3H6GA 1WZ2A 4MS1A 4IJMA 1C1YA 5E6UA 4AJLA 4EKGA 4J0GA 3OSUA 1H2YA 1CJBA 5HYVA 1LTKA 1E2PA 4WPGA 1KJ8A 1XVVA 3K4HA 1KMQA 1CRLA 1KBQA 1OFGA 3OPYI 4LOIA 2WJPA 1AUVA 1QVVA 3A4IA 1GU7A 2W6CX 2XMCA 3D3QA 1QCCA 1XDWA 2Y1XA 4LHEA 4N3CA 3ZHUA 3KPYA 1R5JA 1DV1A 2F9MA 3FNFA 3QVWA 4WI1A 4DMHA 4DZRA 4F56A 4KBYA 5IAAA 5IVHA 2DLDA 4F4CA 1K6IA 1MT0A 4YQFA 2H51A 4MVJP 5A6SA 4LZOA 4BJ5A 4KIUA 3WZLA 4RWZA 5IABA 2G88A 3UAYA 1K9SA 2WLTA 1SUEA 1S3IA 3D0RA 3FZQA 2YV5A 3LD9A 1MGOA 2XTJA 3AP2A 2VIIA 1BEUB 3V1LA 2P11A 5BN4B 2F67A 3MIZA 5EXDA 4EO7A 4ZO9A 1JLLA 3Q15C 2X1MA 4GX1A 3QEBZ 5ECGC 1XZEA 4M9RA 3E5MA 2C5EA 3RUIA 2K2WA 3WLKX 3FZGA 4NDNE 5MGBA 3OTHA 1W9MA 6REQB 1NM5C 2Z2KA 2NVOA 2P30A 3WWYA 4WNYA 4YP9A 1RXCA 3DV2A 1ZH4A 2BP7A 2GBLC 1S1CA 2XUFA 3G0IA 1NVGA 1NMQA 7GPBA 4DKJA 5F3RA 3FPHA 3RAPR 4OOFA 4DCSA 5ALNA 4YCDA 3HKCA 3OT1A 2Y66A 5ALYA 5KREA 3L5OA 1GAXA 4D9MA 3ZJUA 2IYFA 4E33A 1E6CA 1HDCA 1F8UA 5AW0A 3PXUA 5AM3A 2RHWA 1JHZA 4GP9A 1ZQ9A