4KVGB

Crystal structure of riam ra-ph domains in complex with gtp bound rap1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
260
structure length
246
Chain Sequence
MKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Rap1 in complex with RIAM reveals specificity determinants and recruitment mechanism.
pubmed doi rcsb
molecule keywords Ras-related protein Rap-1A
molecule tags Signaling protein
source organism Homo sapiens
total genus 78
structure length 246
sequence length 260
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
B PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4kvgB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kvgB01
2ZNVB 1KZ7A 5IAAC 2L1CA 2ELBA 2KQSA 4KSKC 4GPTB 1OQYA 2RNRB 3ZDTA 1VD2A 1C1YB 3SYXA 2NCNA 1J19A 4M0WB 2UZSA 1G6JA 2KDBA 4G0NB 2K25A 4AJYB 1TBEA 1WJ1A 2KD0A 3DOWA 1QQGA 3T8MA 2D3GA 4EZLA 1NU2A 2BCJA 5EFXA 4H8SA 3ZO5B 2EKEC 3VH4B 2C9WB 5DI9B 1M94A 2VSZA 2M38A 5CHFA 4BVUC 4PS8A 1V5PA 4OVUA 4A6KA 4F7UP 4GDLB 3PG7A 3QWZB 1UD7A 4IC7B 1RJ2A 1KJTA 3D8EA 2G45B 1V86A 3L10B 2N0YA 2W2XD 4EMOA 2KMAA 2D07B 3HK0A 1V5MA 2L7RA 2NBUA 2DFKA 4JQWC 4K2PA 3WA0A 4MDKE 4IOYX 3DVGX 2Y5BB 4WJQA 3A9KA 5C6RA 2GBNA 3VQIA 3PV1A 3ODOA 3CIKA 5E6NA 3V60A 3I3TB 2FIFA 3UQBA 5D3YA 1WZ3A 1Z2MA 3KW5B 2EC1A 1IYFA 2K00A 4BOSC 1VCBA 4IWQA 3PRMB 1Y5OA 3PS6A 3WAPA 1EGXA 4F7ZA 3PLUA 4MY6A 4PYZA 4NSWA 5JHAA 2LOXA 2CU1A 3MTNB 2PE9A 1PMSA 2YT0A 3QCAA 3PPAA 1AQCA 3PVUA 1MK7B 1UZXB 2PZ1A 1X86A 1WY8A 4DBGA 1TJ6A 3ECIA 5KQ4A 4URKA 4FLHA 2C7MB 2C7HA 3DXCA 2KC2A 2MWSB 1XR0B 3CF6E 4GIVA 2N9EB 4K7SA 1U4AA 4KIKA 2DZIA 3SUZA 2N7EA 3BY4B 2QHOA 2KFKA 4PS3A 4BBKA 2M17A 4A3PA 2E2XA 3R7RA 3ENEA 1DBHA 1KOTA 1TXDA 3JYUA 5LXHA 2CY5A 2DX1A 2DA0A 2ZEQA 4K1RB 2PE6B 1WGQA 5GMVA 3M1IB 1C3TA 1DDVA 3ZKJC 5L95C 4CO7A 4C0AA 5DPRA 3WAOA 1V88A 3A8QA 3ULBA 1WH3A 2AL6A 2LGDA 4D0NB 2L3ZA 3AU4A 2ZCBA 2O6VA 1S3SG 2AYOB 4MH0E 2V76A 3OANA 4IM2A 2KTRB 4HAZB 2NS5A 2CHWA 3VUXA 4HCNB 1XKEA 4G50A 2FNJB 1WG7A 5AZGA 5DPSA 3TCAA 2KQ7A 2DAFA 5AEKB 1QC6A 3IHPC 3QHTA 2GBMA 1MIXA 4DX90 2C5LC 1WM3A 5FR6A 2R0DA 2C60A 2MFQA 4MSQB 4W9CA 4EFOA 3DXDA 4M8NA 1DROA 3R3MA 1GC7A 1ZC4B 2W2XC 4GOCA 1WZ0A 4KZCA 3ONSA 4MJSB 2YS5A 3NSUA 1FGZA 2I5FA 1ZSQA 3ULCA 4DX8A 2Z0DB 2LRUA 1J8CA 1ZM0A 3QJZA 4HLEA 2KX3A 3APCA 2BWFA 2FCNA 5AZHA 4WJOA 3TW1A 2JWZA 4KVGB 4HCPB 1J0GA 3N3KB 2JPHA 1LQBA 2MP2A 1H10A 3U7DA 1V6EA 1WFYA 2KTFA 3JVZX 2CODA 4K2OA 5HE2A 4B95A 2KKCA 1P1AA 1XD4A 4KZ0A 1WI0A 4DHJB 2W2WA 4MT7A 1NI2A 2N7DA 3VTWA 2JZ3B 3ODXA 3JSVA 3WYFB 4W9KA 5LXIB 3A9JA 4W9DA 2MBEA 4FJZA 2FIDA 4BOZB 1MK9B 3CMMB 4W9HA 2BWES 3AU5A 2IYBA 5D3WA 1XQQA 3U8ZA 2KDIA 2BYEA 5EDSA 3CSFA 3SNHA 1WGYA 3ZLZA 1I42A 1E90A 1KLVA 3OLMD 3VH3B 2YRYA 2M8SA 2Y8FA 2DENB 5JHGA 2KC1A 4JIOU 1LB1A 2RGFA 3VHTC 3ZRFA 3A9KB 1WXMA 1TGZB 4ANXA 4W9FA 1FHOA 2KCJA 1Q1OA 2BF8B 2NPTA 4BKSA 1WGGA 2JRIB 2W9NA 3A33B 5CLLB 2MWNB 3SV1A 4LDTB 1YX6B 4II2B 5L83A 5JLJB 3NHEB 1RAXA 2EMSA 3D8DA 1E5WA 4HWIB 2K6DB 4HB2B 3CXBB 3DXEA 5DCNA 2LULA 2ROVA 3VOQA 5FI0A 3QARA 3M3JA 2MLBA 4IM0A 5LOPB 1GJZA 3IBEA 3HHMA 1UBIA 4DK5A 4LJPB 1P3RA 1I35A 1MPHA 2RSUA 2V1YA 2N4FA 4PS7A 1WRDB 2LVQA 1E8XA 2XBBC 1SHCA 1A5RA 2D4QA 2V4LA 4KIKB 3HW2B 3GOEA 2ZPYA 2KFKB 1WJ6A 2MKRA 5FI1A 3ZTCA 2D9VA 3KZ1A 4TUUA 2D9ZA 1BAKA 1P9DU 3ML8A 4F7GA 1Z5SB 3DPDA 2XK5A 1DYNA 3EC8A 1OQNA 4DDID 3VIAA 2C7NB 3F5RA 2D9YA 2OQBA 1EVHA 3A4RA 1UH6A 2GBJA 2MBOA 3VTVA 2RPQA 3KH0A 1ZGUB 1KZGA 4MELA 5D94A 1GUAB 5C1ZA 2O6VB 4BFRA 2Y8GA 2G4SA 1B55A 1AARA 1ZKHA 2D11A 4E74A 4MSMB 3QK0A 4K7WA 2K8BA 2DHZA 2ZNVC 2KK8A 3Q3JA 3ZRCA 5J3YA 2KJ6A 2UVMA 2P0DA 4ANVA 2OOBB 1YJ1A 3S2AA 1WMHA 3ZVRA 2CAYA 4RM8A 3ZW3A 1SE9A 1MKEA 1SGHA 4X57B 2MRPA 4LCDE 4WJNA 1WE7A 2ZVNA 3DDCB 3LJ3A 3X23A 4FHKA 3JW0X 4L6EA 1WX8A 5GOWB 1U5EA 2P0FA 2LGXA 2LXAA 1NDDA 4A6HA 1WXAA 4WWNA 1FAOA 1P5TA 3H9DA 3DVNU 3VXWA 3L17A 1RRPB 4PYUA 3V62A 2MP2B 4A6FA 2MBQA 5J2RA 1E8ZA 1V61A 3VTUA 4IAPA 2DYMA 1GG3A 3ZNHB 3GZNI 3AXCA 5D2MB 2DKQA 4IFSA 3FM8C 1UNQA 1V9JA 3DBLI 4NPNA 3JSVB 2LKOA 2FJLA 1XD3B 2KX0A 3A9JB 3KRWA 3TO1A 3ZVVA 1DDWA 5JP4A 2V3SA 2NZ8B 3TL5A 1V5TA 1H4RA 5KCVA 4DHJD 3IG3A 2CHZA 3P7ZA 2I1JA 4F7HA 1S1QB 2IO0B 2OTXA 4W9EA 1P6SA 4ICUA 3DQVA 2J59M 2KHWB 3IFWB 2KGXB 2Z0PA 4NAWA 1U27A 3EFUA 3LDZE 4NY0A 4HAUB 3BINA 4B6WA 2BKRB 1P0RA 4TQ0A 2J0JA 1Q0WB 4A3OA 1UELA 2IBIB 4FA6A 4HDOA 2NPTB 4EUTA 5CHVC 4EKUA 3PT2B 1NBFC 3L16A 3W1SA 2DHJA 5G2NA 2HJ8A 4IWPA 4G11A 2G4DB 2M14A 4IUMB 3OJ4B 3SO6A 2G35A 2O2VA 1ZC3B 4LDTD 5D27A 2IZVB 4IG7B 2AL3A 2R2OA 3B0AA 4HAYB 4CHJA 4ASWC 1PLSA 2J0KA 2KANA 2IY0B 1QZEA 2ZJDA 3BJIA 5L81A 5CTRC 2KVRA 3O65B 5E6PA 2BGFA 1I2HA 4ANUA 4I6LB 1FOEA 4GB9A 4GMVA 2MBBB 2GJYA 2GBRA 2D9XA 1DDMA 3P6AA 2GBKA 2KMCA 2XK5B 4PNKA 1KM7A 2WX0A 3NY5A 5J17A 1UNPA 4IM3A 4A20A 2DLWA 3V61A 3R66C 2YVCA 4TYZA 4CHMA 2RUKB 4BKGA 2YT1A 3KRXA 2MDXA 5JH5C 2I5CA 4MGIE 2QKMA 1WR6E 1OTRB 2LRWA 3ZDMC 2L0FA 3DBSA 4IWOA 1V5UA 3RD2A 2DZKA 1M7RA 1H8CA 2XQNM 2AEHA 2PPHA 5DHAB 2LXCA 3N30A 3H7PA 4HJKA 3ALBA 2P8VA 3WANA 2K6QA 2NMBA 1E7VA 4EJNA 3ML4A 3VFKA 4KSLC 2NBWB 2IFSA 2LZ6A 2HD5B 4KAXB 1RFAA 2LI5A 2DHIA 1WMHB 5D3VA 2N1WA 5BO4B 3MJWA 3A98B 1PQSA 2ZCCA 5JZEB 3QC8B 5D7GA 3HIZA 1GC6A 2JVCA 2B3AA 3VUWA 2LUEA 1XCGA 3PREA 5C79A 3SU8X 4GMXB 1W1DA 2JY6A 1WJ4A 1BTNA 1R4MI 4W9LA 2NBVB 3PRPB 1U5FA 5G55A 1E8WA 2H7EA 1V81A 1WGUA 3L0WB 3O96A 2R09A 3TJPA 3ZIMA 4N9F4 2KN5A 4EZKA 5HE0A 3A8PA 4B9KA 3GYOA 2KWUB 2N9XA 4A6FB 1BTKA 3RCPA 1OEYJ 2QKLA 1WX9A 4GSWA 3QBVB 4DHZE 4GN1A 1PFJA 2J7QB 3PP2A 2MX2A 1SIFA 3FSSA 5D3XA 5KHOA 4A5KA 2CR5A 2KLCA 4HAVB 3H6NA 2I1KA 3SD5A 5C23A 5AZFA 2M1MA 3NZUA 3UGBB 1WM2A 1U29A 2ZPNA 1Y8RC 3ZNGC 3TFMA 1BWNA 4NAWB 2KDEB 2L8JA 5KHQA 5LONB 3PRZA 4RMAA 3EHVA 2RSGA 2YS3A 4BBNF 1WJNA 2MCNB 1K5DB 1MG8A 3KYCD 2DN6A 3WIMA 4HAWB 2REXA 1X1GA 1V89A 4DHZB 2DHKA 5C5BA 1UPRA 4HB3B 1Y19B 3W1SC 4MGKE 2NR2A 2IO1B 4WAAA 5C16A 4BKSD 3TMPB 2JF5A 2KZRA 5IA7A 2FCSA 3SDLC 2DAJA 4HDQA 3PEGA 5CLQB 3TVVA 2A5UA 2KFJA 5J3TA 1AWEA 2GCLA 1UGMA 2YSZA 1W1GA 4FJYA 2K1FA 2MSED 4NQKE 2PJHA 3NZSA 1YIWA 1UEFA 3RYTA 3T06A 4MK0A 2N23A 4KV2A 4FADA 1EF1A 1BT0A 1WE6A 4KDIC 4WWOA 2LYDA 4K17A 4E71A 5LLIA 1FHWA 3APDA 2DX5A 4XC2A 5JHHA 1WGRA 4ZRIA 4YONA 1UBQA 1LFDA 4HXDA 2KLGA 2KXJA 5E6OA 2N1VA 3RT3B 2Z0QA 2HTHA 4NJ7A 3QX1A 4I6NB 4FN2A 4HK2A 1Z87A 1IPGA 4G3XB 4NQLB 3NOBA 5DH9B 3AJ4A 4W9IA 1K5GB 2ZVOA 3APFA 1I7AA 1L2NA 2AWTA 2KO3A 4AWJA 2R2QA 2BYVE 1OY2A 3L54A 1MAIA 2MBHA 3LJUX 3ODWA 3H7PB 4AP4C 1IP9A 2MQJA 4J6IA 1X1FA 2UYZB 2DTCA 1FB8A 3N32A 2IYDB 2ASQA 3DBHI 1JRUA 2DYBA 4ANWA 2DYOA 2VRWB 2RLOA 5DPTA 2RGNB 1WXSA 2CKHB 1LXDA 1UPQA 2YLMA 3PHXB 4GDKA 2VRRB 4WQOB 2CRFA 2K2UA 1CMXB 2WWZA 4I6PA 2FCQA 4WVFB 1WF9A 2P0HA 4EEWA 4ZRKA 2LVOA 4KHOA 3UIPB 1V5OA 4GXBA 4MGYE 1L7YA 1M7EA 4WWPA 1KI1B 3M63B 1WR1A 3D8FA 3RULA 4BKTA 4FJVB 3B1LX 2COCA 3QA8A 4FBJB 1X05A 2X18A 4OVVA 2FCMA 1WJMA 1FHXA 4E3CA 4KHAA 1WXVA 4HVBA 3A1QA 4AUQC 1TZ1A 3KVFB 3VAWA 3KUDB 1WI1A 2KJHB 3HM6X 4FHJA 1YQBA 2FUHB 4MEMA 3WAMA 4Z2NA 2MA9B 2CS4A 4XWXA 2JUOA 4BBNC 2LGYA 4Y94A 1WJUA 4GU2A 2H7DA 4II3B 3UZTA 4HPLB 1K8RB 3X0WA 3U30A 3N7CA 3CSTA 3HM3A 4KDLB 3ZNZB 1IRSA 2COAA 1RLFA 1X1MA 2MW5A 2DZJA 4B6HA 3UF8A 2UZRA 3KYDD 2IY1B 4HAXB 1ZVRA 2HE7A 1XT9B 2KUPA 3UIOB 3M95A 4TV3A 3DVNV 1V80A 3PZDA 2J0MA 3L08A 1GNUA 3PHWB 2L76A 2BKFA 1TQZA 4AJWA 5C5BB 3OAWA 3PGEA 4HHVA 1X11A 4AOFA 3V6EB 3K9OB 3W1YA 2NVUI 2KJRA 5HE3A 1FXTB 3L13A 2L05A 1WX7A 4WSFA 3RZFA 4P7IA 2IO3B 1MIZB 3QIJA 1EF5A 3F0WA 3ZTDA 2LWPA 2RR9A 2Z0EB 2KDFB 2Q13A 3R7QA 4NNJB 2BYFA 2K8CA 1EO6A 3P2BA 4ZYNA 3ZNID 2UWQA 1U5GA 4M8MA 4KHBB 3RCZA 2LJ5A 3C0RB 5HKHA 4MGZE 2DKPA 2DX5B 2IO2B 3V5WA 2O6VD 4HPMB 4GGQA 3T9LA 4ZDVA 3TIXA 3V6CB 4DDGD 4GDLA 2HTHB 3FEHA 3G9WA 3KSYA 5J3QA 3HQCA 2DYQA 2ADZA 4WJ7A 3PTFC 1RRBA 2DZMA 5KQ1A 3DBRI 4W9JA 2K39A 2GOWA 4XX5A 3A4SC 2ELAA 4TKNA 1EAZA 1UNRA 1OMWA 4JL9A 2A4ZA 3OJ3A 5DPWA 2K2JA 1YD8U 2EJ8A 2VKIA 3QAQA 2D10A 3RZWC 2CHXA 3VUYA 1ISNA 1P98A 4ZRJA 2LOZA 2GCJA 4W9GA 1NTVA 2JXXA 4K81A 5DIFB 1OGWA 1XX0A 4PQ0A 2JRHA 3UQAA 2ROZB 3KY9A 3AI5A 1F9JA 2L2IA 1E8YA 4RM9A 3KUZA 3PLVA 3Q3FA 4EZJA 1Q5WB 2LASA 3DCGA 1V2YA 3ZUNA 2WDTB 1YX5B 3VDZA 3SHQA 4GDKB 4F1SA 2DYNA 2KWCA 3DVGY 2LG1A 2YS1A 1N3HA 4XZ4A 2COFA 2KNBA 3K9PB 1J0WA 1XODA 2PEAA 2ZZPB 1WGDA 2Z59B 3PVLA 1T0YA 5J18A 2D9WA 1WYWB 2M4NA 3GYPA 2L0TA 2RVBB 2JT4B 2WX1A 1D3ZA 2GS0A 2XEWA 4YL8A 2Y7BA 5HE1A 2CY4A 3VVWB 1R4NI 2BPSA 5CHWA 4HB4B 4FULA 5D6JB 3A1QB 1Q67A 4ICVA 4EOYA 5TR5A 3IVFA 3PSCA 1ZW7A 4CYEA 3B08A 1LM8B 2L00B 1LW3A 1HE8A 2GMIC 3ML9A 3WALA 2LVPA 3NS8A 4HB0B 2FAZA 2KOXA 4HATB 2YF0A 1FGYA 3KUCB 3MPXA 5DHFB 2M0XA 3PVWA 2KTRA 4IW0A 3QWMA 1P3QU 1U5DA 3M62B 2WYQA 1WIAA 2O2VB 2JZZA 4DWFA 3MDBC 3EECA 1TTNA 4GZUA 4TQ1A 4NJ6A 4CHKA 1EUVB 1U2BA 3AULA 3UINB 4DXAB 4DBBA 4LJOB 2RD0A 2LD9A 1V49A 2D2QA 3TBLD 5CX3A 3H7SA 2K8HA 3RUIB 1WGHA 4JGHB 4JLCA 2N9PC 1NTYA 2Z0OA 2OJRA 4F8CB 4MM3A 5JHBA 3H1UA 1W1HA 2KWVB 1E7UA 2JP2A 2G3QB 4Z2MB 1WVHA 1OEYA 3PSEB 2EMTA 3QQ8B 4WJPA 3D32A 3MHSD 4K7UA 4MJSA
chains in the Genus database with same CATH superfamily
1J7AA 2ZNVB 1KZ7A 5IAAC 3KLSX 4YTNB 2L1CA 1CQVA 2ELBA 2KQSA 4P1CC 3NVZA 4KSKC 4GPTB 1ESFA 1OQYA 2RNRB 3ZDTA 1VD2A 1C1YB 3SYXA 1T5XD 2BS4B 2NCNA 3U2SC 1J19A 3W5UB 4M0WB 2UZSA 1G6JA 3ZXVA 1KH0A 2KDBA 4G0NB 2K25A 4AJYB 1TBEA 4RCOA 1WJ1A 2KD0A 1T0QC 3DOWA 4C4VA 1QQGA 1D5XC 1SBBB 3T8MA 2RPVA 2D3GA 4EZLA 3MHZA 3AE2B 1NU2A 2BCJA 5EFXA 4H8SA 3ZO5B 2EKEC 2GI9A 4KKJA 3VH4B 2C9WB 5DI9B 1M94A 3MC8A 1C4AA 2VSZA 2EELA 2M38A 5CHFA 1DYQA 4BVUC 4PS8A 1V5PA 4OVUA 4A6KA 1SJHD 4RGNA 2LEKA 4F7UP 2MHJA 4GDLB 3PG7A 3QWZB 1UD7A 4C7YA 3AEGB 4IC7B 1JWMD 2LGSA 3NUHB 1EU4A 1RJ2A 1KJTA 3D8EA 3NVWA 2G45B 4N59A 3PZ7A 1V86A 2DNFA 3L10B 2N0YA 4BAXA 2W2XD 4EMOA 2MEKA 4JX1C 5EE3A 2KMAA 2D07B 3HK0A 3RPFC 2QMTA 1V5MA 2L7RA 4OW0A 2NBUA 2DFKA 1ZPSA 4JQWC 4K2PA 3DHHC 3WA0A 4MDKE 4IOYX 2JXTA 3DVGX 2LJIA 2Y5BB 4WJQA 3A9KA 1FPYA 5C6RA 2GBNA 3VQIA 3ZYYX 3PV1A 3CIKA 3ODOA 5E6NA 2WU5B 3NG0A 3V60A 3I3TB 2FIFA 3UQBA 2M0AA 1TZOA 5D3YA 1WZ3A 1Z2MA 3KW5B 2EC1A 1IYFA 2E3TA 2K00A 4BOSC 1VCBA 4IWQA 1ET9A 3PRMB 3RMKC 1Y5OA 4B0EA 3PS6A 4ZRQA 3WAPA 1EGXA 2WS3B 4F7ZA 4OT1A 3PLUA 4MY6A 4PYZA 4UDUC 4NSWA 1F52A 5JHAA 2LOXA 2CU1A 3MTNB 5I2MA 1XLOA 1C78A 2PE9A 1PMSA 2X38A 2YT0A 4DIXA 1IGDA 3QCAA 3ZGZA 3PPAA 1AQCA 3PVUA 1MK7B 1SE2A 5IKCM 3N1ZC 4LTUA 1UZXB 2PZ1A 1X86A 1WY8A 4DBGA 1TJ6A 3C19A 3ECIA 5KQ4A 1WGKA 4URKA 1CJEA 4FLHA 2C7MB 2C7HA 3N9YC 3DXCA 5BYSA 4MACA 2KC2A 2K8EA 2MWSB 2IGGA 1XR0B 3CF6E 2H89B 4GIVA 1YOVB 1TS2A 2WXHA 2N9EB 4PK1A 5IRSA 1XLPA 4K7SA 1U4AA 4KIKA 2DZIA 3SUZA 2N7EA 3BY4B 2QHOA 2KFKA 4PS3A 3FVCA 1NEKB 4TMAB 1RM6C 4BBKA 4US9A 2M17A 4A3PA 2E2XA 1SF0A 3R7RA 1C77A 3ENEA 4NAMA 1DBHA 1KOTA 1TXDA 3JYUA 5LXHA 2CY5A 2DX1A 2DA0A 5I2SA 2ZEQA 4K1RB 2PE6B 2Y3AA 2JWUA 1WGQA 5GMVA 4JPSA 3M1IB 1C3TA 1DDVA 3ZKJC 5L95C 1A70A 4CO7A 3V05A 3R2TA 4C0AA 5DPRA 4M02A 3WAOA 1V88A 2V9HA 3A8QA 3ULBA 1WH3A 3BVMA 2AL6A 2LGDA 4D0NB 2L3ZA 3AU4A 4YSYB 2ZCBA 2O6VA 1S3SG 2AYOB 4MH0E 2V76A 3OANA 1JWBD 4IM2A 2KTRB 2INCC 4HAZB 5G5GA 2PKOA 2NS5A 4XGAB 2CHWA 1GOZA 2WXKA 3VUXA 2D5GA 4HCNB 1XKEA 1GB4A 4A55A 1F1HA 4G50A 2FNJB 1WG7A 1RYJA 5AZGA 5DPSA 3TCAA 2KQ7A 2DAFA 1ZUD2 1JWUD 2BB6A 5AEKB 1DOYA 2WXNA 3Q8AA 1QC6A 2GUMA 1MHHE 1YJJA 3AECB 3GZNB 3IHPC 1BMLC 3QHTA 2GBMA 3HIEA 1N6ZA 3T3NA 1SB3C 1JWSD 1OQRA 3AEEB 5LG4B 3DBLB 3BYYB 1FO4A 3AE9B 1MIXA 4DX90 2C5LC 1UWXA 1WM3A 2R0DA 5FR6A 2C60A 1MHXA 2MFQA 1CK1A 1ET6A 1PGBA 4MSQB 4W9CA 4EFOA 1WXQA 3DXDA 4M8NA 4MM3B 1DROA 1M4VA 4QAYA 2KDMA 3R3MA 2VH1A 1GC7A 2WXLA 1ZC4B 4RNAA 2W2XC 4GOCA 1WZ0A 4KZCA 3ONSA 1QOBA 4MJSB 2YS5A 1D5MC 1FGZA 2I5FA 3NSUA 1ZSQA 3ULCA 2AQ2B 2OEDA 1AN8A 4DX8A 3RNEC 2Z0DB 3C8YA 2J4XA 2LRUA 3FC4A 1J8CA 1ZM0A 3QJZA 1XF5L 4HLEA 3U4EG 2KX3A 3UI3A 3APCA 2BWFA 2FCNA 5AZHA 4WJOA 3TW1A 2JWZA 3AE6B 4KVGB 4HCPB 1J0GA 3N3KB 4LK0M 2LHEA 3B77A 2JPHA 4N58A 1LQBA 1VDVA 2MP2A 4CSQA 1H10A 4C4VB 3U7DA 1V6EA 4RF0A 1WFYA 2KTFA 3JVZX 4XWTA 1F2RC 2V3PA 4HSIA 2CODA 4K2OA 5HE2A 4B95A 2KKCA 2JQRB 2INDC 3HVDA 1P1AA 1ZP0B 1XD4A 1NYRA 1WI0A 4KZ0A 4DHJB 2W2WA 4MT7A 1NI2A 2N7DA 3VTWA 1C4CA 2QIEB 2JZ3B 3RNAC 3ODXA 1QOAA 3JSVA 1PFDA 3WYFB 4W9KA 5LXIB 3A9JA 1VJKA 4Q2JA 4W9DA 2W3RA 2MBEA 4FJZA 4XDCA 2FIDA 4BOZB 1MK9B 3CMMB 1YN3A 4W9HA 2BWES 3AU5A 2IYBA 5D3WA 2AQ1B 4LNIA 1YJIA 1XQQA 3U8ZA 2KDIA 2BYEA 3O13A 2KVZA 5EDSA 3DCXA 3CSFA 3SNHA 1WGYA 3ZLZA 1I42A 2YEPF 1E90A 3R2IA 1KLVA 3OLMD 3VH3B 2YRYA 2M8SA 2Y8FA 2DENB 5JHGA 2KC1A 4JIOU 1C9FA 1LB1A 2RGFA 3VHTC 2V0GA 3ZRFA 3A9KB 1T0SC 1WXMA 3NS1A 1TGZB 4ANXA 4W9FA 1FHOA 3AEBB 2KCJA 3B9JA 1Q1OA 1V1PA 2BF8B 2NPTA 4BKSA 1WGGA 2JRIB 2W9NA 3A33B 4IDIA 3Q8BA 5CLLB 2DWQA 2MWNB 3SV1A 3TEWA 2L32A 4LDTB 1YX6B 4II2B 4OHJA 5L83A 5JLJB 3NHEB 4JWUC 3AEFB 3RI7C 1RAXA 2EMSA 3D8DA 4AQ7A 1E5WA 4HWIB 2K6DB 4HB2B 3CXBB 3DXEA 1L6UA 5DCNA 2LULA 2ROVA 3HSAA 2WDRB 3VOQA 5FI0A 4REZA 3QARA 1EWCA 3NRZA 3M3JA 1E9MA 2MLBA 4IM0A 3RNGC 5LOPB 1FM0D 2JX5A 1GJZA 2KR0A 4DXFA 3IBEA 3HHMA 1UBIA 1F77A 4DK5A 4LJPB 3Q3MC 1P3RA 1I35A 1MPHA 3RNFC 2RSUA 2R2YA 2V1YA 3OHMB 3OWEB 3W9CB 1I7HA 3EUB2 2N4FA 4PS7A 1I4QA 5FKAC 1WRDB 2LVQA 1E8XA 2I2YA 1FNVA 2XBBC 1SHCA 1A5RA 1KRHA 2D4QA 2V4LA 4KIKB 1SE4A 1D4BA 3HW2B 3GOEA 3KWVA 2ZPYA 1UWMA 2KFKB 2ZW1A 1WJ6A 1P7FA 2MKRA 5FI1A 3ZTCA 2D9VA 2RDHA 2J53A 3KZ1A 4TUUA 2D9ZA 1NI3A 1BAKA 1P9DU 3ML8A 4F7GA 1Z5SB 3DPDA 2XK5A 5BMHA 1DYNA 3VR9B 4WAFA 1AWDA 3EC8A 3AM9A 1OQNA 4DDID 3VIAA 2C7NB 2EKIA 1FCLA 3F5RA 3DHIC 1TJEA 2KACA 2D9YA 2OQBA 1YMHE 1SSNA 2KIEA 1VLBA 1EVHA 3A4RA 1UH6A 2GBJA 1I4GA 2MBOA 3VTVA 1ZOYB 1K51A 2RPQA 3KH0A 4HRSA 1ZGUB 1KZGA 1R4MB 4MELA 1TKYA 5D94A 1GUAB 5C1ZA 3I63C 2O6VB 4BFRA 2Y8GA 2G4SA 1B55A 1AARA 1ZKHA 2D11A 4E74A 5C3JB 3LB8C 4MSMB 3QK0A 2IJ0A 1AYFA 1YN5A 4K7WA 3I57A 2K8BA 2DHZA 2ZNVC 3VRBB 2KK8A 1K52A 1MI1A 3Q3JA 4M00A 3T3OA 3ZRCA 3URYA 1HXYD 2INNE 5J3YA 2KJ6A 2UVMA 2Y5PA 3U7ZA 1CZPA 2P0DA 4ANVA 1WWTA 2OOBB 1YJ1A 3S2AA 1WMHA 3ZVRA 2CAYA 4RM8A 3AE7B 3ZW3A 1SE9A 1YQ3B 1MKEA 1SGHA 4X57B 2MRPA 4ZHPA 4LCDE 1AW7A 1N5WA 4WJNA 1WE7A 2ZVNA 3DDCB 1KFYB 3LJ3A 3GS2A 3X23A 4FHKA 1HTQA 3JW0X 3FILA 4L6EA 1TYGB 1WX8A 1TS4A 1C4PA 2BVCA 5GOWB 1U5EA 2P0FA 2LGXA 2DBYA 5T8IA 2LXAA 1SE3A 2VH2A 2WQYB 5JXVA 2NBVA 1YNTE 1NDDA 3GE8C 4ARCA 4A6HA 1WXAA 4WWNA 1FAOA 1P5TA 3P4PB 2GLSA 1I4PA 1FCCC 3H9DA 1ACCA 3DVNU 3VXWA 3L17A 1RRPB 3NWAA 4OVZA 2YEPB 4PYUA 3V62A 2MP2B 4BZAA 4A6FA 3Q8CA 2MBQA 2LGIA 4YT0B 1FNUA 5J2RA 1E8ZA 1HQRD 1XCTL 1MG4A 4OZAA 4YXDB 1V61A 5TSSA 3VTUA 4IAPA 2DYMA 1GG3A 3ZNHB 3GZNI 4YSZB 3AXCA 1C79A 1WSPA 2GRIA 5D2MB 1QOFA 3Q6BA 3SEBA 2WNMA 2DKQA 4IFSA 3FM8C 1UNQA 1V9JA 3DBLI 4NPNA 3JSVB 2LKOA 2FJLA 1XD3B 3Q8EA 2KX0A 3A9JB 3KRWA 1XEEA 3TO1A 3ZVVA 1J7CA 1DDWA 5JP4A 2V3SA 2NZ8B 3TL5A 1V5TA 3P63A 1H4RA 5KCVA 4DHJD 2LUMA 1K53A 3IG3A 2CHZA 2AX5A 2BB5A 3P7ZA 2I1JA 4F7HA 1S1QB 2IO0B 2PW9A 2OTXA 1FRDA 1P6SA 4W9EA 4ICUA 3DQVA 1T0RC 5EE9A 4IKGA 2J59M 2KHWB 3IFWB 2KGXB 2Z0PA 1FNWA 4K3CA 2PIAA 4NAWA 1U27A 1TS5A 2TSSA 3EFUA 3LDZE 4HJGE 4NY0A 4HAUB 3BINA 4B6WA 2N9KA 4YWGG 2BKRB 1XO3A 1P0RA 4TQ0A 2J0JA 1Q0WB 4A3OA 3AH7A 1MVKA 4KX6B 1UELA 5H8YE 1V1PB 2IBIB 4FA6A 4HDOA 2NPTB 4EUTA 5CHVC 2L1AA 4MH8A 3AE4B 4EKUA 1F2RI 4A8XC 4L1BA 4O1NA 3PT2B 2B76B 1NBFC 3L16A 3W1SA 2DHJA 2WXMA 5G2NA 2BBCA 2WXJA 2HJ8A 4IWPA 3TUOA 4G11A 2G4DB 3J9CA 2M14A 4IUMB 1QILA 1I4HA 3OJ4B 3SO6A 3N20C 2G35A 1N5XA 2O2VA 1ZC3B 4LDTD 5D27A 2IZVB 4IG7B 2AL3A 3P4SB 4YSXB 2R2OA 3B0AA 3ZJTA 1JCKB 4HAYB 4CHJA 4ASWC 1PLSA 2J0KA 2KANA 5IN7A 5BMGA 2IY0B 2JZPA 4S0RA 1QZEA 2ZJDA 3BJIA 5L81A 5CTRC 2KVRA 3O65B 5E6PA 2BGFA 2QSDA 4XE0A 4A9AA 1I2HA 4ANUA 4GNKB 4I6LB 3DBHB 1FOEA 4GB9A 4GMVA 2MBBB 2GJYA 4IOIE 2GBRA 1KLGD 2D9XA 1DDMA 3P6AA 4HPPA 2GBKA 2KMCA 2VZKB 2XK5B 3Q69A 2MJDA 4PNKA 1KM7A 2WX0A 3NY5A 5HI1A 5HFYA 5J17A 1UNPA 4IM3A 1ZE3D 4USAA 4A20A 2DLWA 3V61A 3R66C 2YVCA 4TYZA 4CHMA 2KN4A 2RUKB 4BKGA 4GLSC 2YT1A 3KRXA 4L1RA 2MDXA 5JH5C 4C00A 3V3XA 2I5CA 2M19A 2QKMA 4MGIE 1WR6E 1OTRB 1HEZE 2LRWA 5HG2A 3ZDMC 2BT6A 2L0FA 3I5JC 3DBSA 4IWOA 1V5UA 2QILA 3RD2A 3RFZB 2DZKA 4YTMB 1DOIA 1M7RA 1H8CA 1IGCA 2XQNM 2AEHA 2PPHA 1MJDA 5DHAB 1UGJA 4D6WA 2LXCA 3N30A 4XYCA 5IO9A 3H7PA 4HJKA 2ZW0A 1B1ZA 3ALBA 2P8VA 3WANA 2K6QA 2NMBA 1E7VA 4EJNA 3ML4A 4WH4A 3VFKA 4S17A 3B2FA 4KSLC 4WQOB 2NBWB 2IFSA 5C2TB 2LZ6A 3ABVB 2HD5B 4KAXB 1C76A 1RFAA 2LI5A 2DHIA 1WMHB 5D3VA 3HUIA 4ZYSA 2N1WA 5BO4B 3MJWA 3Q14C 3A98B 1PQSA 1SIJA 2ZCCA 5JZEB 3QC8B 1QT9A 4J3OD 2WXQA 5D7GA 3HIZA 1GC6A 2KIGA 2JVCA 3FILB 3H8HA 2B3AA 3VUWA 2LUEA 1XCGA 1V1OA 3PREA 5C79A 3SU8X 4GMXB 4ZHOA 2KT7A 1W1DA 1GPXA 3N1YC 1IUEA 2JY6A 1WJ4A 1BTNA 1R4MI 2IPKD 4W9LA 1EWYC 2NBVB 3PRPB 4FXCA 1JMLA 1U5FA 3KQ4A 5G55A 1E8WA 3TEZA 2H7EA 1V81A 1WGUA 2K22A 3L0WB 3O96A 2R09A 3TJPA 5I4DA 3ZIMA 4N9F4 2KN5A 2CJNA 3P4QB 4EZKA 1STEA 5HE0A 3MFGA 3A8PA 1HZ6A 4B9KA 4M01A 3GYOA 3N1XC 2KWUB 2N9XA 4A6FB 3ZQ4A 2J42A 1BTKA 2QC8A 3RCPA 5MPOA 1OEYJ 1XXGA 2QKLA 1WX9A 2PVOD 4GSWA 3QBVB 2LFIA 3IAM1 4DHZE 3OG5A 4GN1A 4PT5A 1FMAD 1PFJA 2J7QB 3PP2A 2MX2A 1E7PB 1SIFA 3FSSA 4EE2A 2Z4DA 3BYTB 5D3XA 5KHOA 4A5KA 1YQ4B 3NJTA 2CR5A 2KLCA 4HAVB 3H6NA 2I1KA 3SD5A 5C23A 5BMIA 1L0XB 5AZFA 1TKEA 3RNCC 2RDBC 2M1MA 1YN4A 3NZUA 3GE3C 3UGBB 1KF6B 2XNAC 2GB1A 1HTOA 1WM2A 1QOGA 3NZ3A 1U29A 2ZPNA 3E9SA 1Y8RC 2WHIA 1TY2A 5BYQA 3ZNGC 3TFMA 1L6VA 1BWNA 4NAWB 2KDEB 4OZCA 2L8JA 1FFVA 3U12A 2IGHA 5KHQA 4HKZE 3L4PA 5LONB 4D2KA 4HROA 4AS1A 3PRZA 1J7BA 1HZ5A 4RMAA 3EHVA 2RSGA 2YS3A 5EE0A 4BBNF 1WJNA 3W2DA 4ZOHC 2MCNB 1K5DB 3EFCA 1Y56A 3IAS1 1MG8A 3KYCD 2DN6A 3WIMA 4HAWB 1PYWD 2REXA 2NTSA 1E10A 1X1GA 1V89A 4DHZB 1PDXA 2DHKA 5C5BA 1UPRA 1PGAA 1VZ6A 4HB3B 1Y19B 3W1SC 4MGKE 2NR2A 2IO1B 4WAAA 5C16A 4BKSD 3TMPB 3DBRB 1MI0A 3CIRB 2E6XA 2JF5A 2KZRA 5IA7A 3VR8B 2FCSA 3SDLC 4RGOS 1RWSA 2LMCA 2DAJA 4HDQA 3PEGA 2BS2B 5CLQB 3TVVA 1JWAD 2AQ3B 2A5UA 2KFJA 3BIID 5J3TA 2WDQB 1AWEA 1N60A 1QLBB 2GCLA 3BVZA 1UGMA 3NVVA 2YSZA 3WCQA 1W1GA 1BUIC 4FJYA 2K1FA 2MSED 4NQKE 2PJHA 4XWWA 2HTME 4ZRPA 1WRIA 3NZSA 3B2GA 1YIWA 1UEFA 3RYTA 4L23A 3T06A 4MK0A 2N23A 4KV2A 4FADA 1EF1A 1BT0A 3BK2A 2K5PA 1WE6A 3P42A 4KDIC 4LNKA 4WWOA 2LYDA 4KHBA 4K17A 4E71A 5LLIA 3LYYA 1VR9A 1VZ8A 2ONQA 1FHWA 3APDA 2DX5A 4XC2A 5JHHA 1WGRA 1N62A 4ZRIA 4YONA 1UBQA 1LFDA 4HXDA 2NTTA 1UF0A 1XLQA 2KLGA 2KXJA 1IBXA 5E6OA 2N1VA 3TSSA 3RT3B 2Z0QA 2HTHA 3AB5A 4NJ7A 3QX1A 3VRAB 4RF1A 2Z14A 4FN2A 4I6NB 2JYEA 1FIQA 2FUG1 4HK2A 1Z87A 2WDVB 1IPGA 4G3XB 4NQLB 2MJ3A 1OQQA 2VZKD 2G9HD 3NOBA 4RGTA 5DH9B 3AJ4A 2BW2A 3ETRA 1Q10A 4W9IA 3GB1A 3RNBC 1K5GB 1PUTA 2ZVOA 3NWFA 3APFA 3AV8A 3FAHA 2RRFA 1I4XA 1I7AA 1L2NA 1LO5D 2AWTA 2KO3A 4OZBA 1R4NB 4AWJA 2R2QA 2BYVE 2CU3A 1OY2A 3L54A 2K3UA 1MAIA 2K9XA 2MBHA 3BWUD 3LJUX 2FE8A 3GP7A 3R8BA 3ODWA 3H7PB 4RH6A 4AP4C 1NVID 1IP9A 2WXOA 2MQJA 4J6IA 4QXAB 1X1FA 2UYZB 2DTCA 1FB8A 5AUKA 1FD6A 3N32A 1MPEA 2BS3B 2IYDB 2V4IB 2ASQA 3DBHI 1JRUA 2DYBA 4LNNA 5BYRA 4ANWA 2DYOA 5LNK1 2VRWB 2QJLA 3SFEB 2RLOA 5DPTA 3DWGC 2RGNB 1WXSA 2CKHB 1LXDA 1UPQA 2YLMA 3PHXB 4GDKA 3ZJUA 2VRRB 1ZXHA 2CRFA 2K2UA 4OSNA 1CMXB 2V3NA 2WWZA 3LXFA 4I6PA 2FCQA 4WVFB 1WF9A 2P0HA 4EEWA 4ZRKA 2BYTA 2LVOA 4KHOA 3UIPB 1V5OA 4GXBA 4MGYE 1L7YA 1M7EA 4WWPA 1KI1B 3M63B 2Z59A 1WR1A 1GAQB 3D8FA 5HHDG 2RMMA 2Y5CA 4TSSA 3RULA 4BKTA 4FJVB 2D3CA 4H2AA 3B1LX 4DQOC 4QJ4B 3AE5B 2COCA 1E6EB 3QA8A 4FBJB 1X05A 2X18A 2WLBA 2G1EA 3HRDD 4OVVA 2FCMA 1WJMA 1LGRA 2BQQA 2FBWB 1FHXA 4E3CA 4KHAA 1WXVA 3MC0B 4HVBA 3A1QA 4AUQC 1TZ1A 1KLUD 1V97A 3KVFB 2HDEA 4KGSA 3VAWA 3KUDB 4WQMA 3Q3NC 1K50A 1WI1A 2K49A 2KJHB 2ICIA 3HM6X 4FHJA 1YQBA 2FUHB 4MEMA 3WAMA 3EGRA 4Z2NA 2MA9B 3NWDA 1FEHA 2KQ4X 1I4RA 2N0SB 2CS4A 4XWXA 2JUOA 4BBNC 2PVGC 1B9RA 4YTPB 2LGYA 3BVGA 4Y94A 1WJUA 4GU2A 2JYTA 3AEAB 3MC9A 2BTEA 2H7DA 3MJ5A 4II3B 3UZTA 3AEDB 4HPLB 2WXRA 4C7ZA 1K8RB 4WIPA 3X0WA 3U30A 3N7CA 3W5VB 3CSTA 3HM3A 4KDLB 3ZNZB 1L4DB 1IRSA 2COAA 1RLFA 3IT6B 4CQNA 1XCQL 4P16A 1X1MA 2MW5A 1TS3A 2DZJA 4B6HA 3UF8A 5EE1A 2UZRA 3AE1B 5M4YB 3Q2AC 3P4RB 3EA6A 3AMZA 4C56C 3KYDD 2IY1B 2DLBA 4HAXB 3NVYA 2D3BA 2Z13A 1ZVRA 2HE7A 1XT9B 1L5PA 2KUPA 1E0ZA 3UIOB 3M95A 4TV3A 1VRAB 3DVNV 1V80A 2ZKMX 3PZDA 2J0MA 3L08A 1GNUA 3PHWB 2L76A 1JW9D 2BKFA 1TQZA 1DGJA 4AJWA 5C5BB 3OAWA 3AE8B 1T77A 3PGEA 2RDGA 1PGXA 4NJCA 3ZXRA 5AUIA 2N9LA 4HHVA 1X11A 2KYWA 4AOFA 3V6EB 3K9OB 3W1YA 1VZ7A 2NVUI 2KJRA 5HE3A 1FXTB 2WXPA 4NZLB 3L13A 2PTLA 1OFFA 4C80A 1RFKA 2X8XX 1TKGA 3I9V1 2L05A 4WWMA 1WX7A 3BK1A 4WSFA 3RZFA 4P7IA 4P1BC 2IO3B 4M0WA 3TEYA 1ZDVA 4KGRA 1MIZB 3QIJA 1EF5A 3F0WA 3ZTDA 2LWPA 2SAKA 1UNSA 2RR9A 4QJ3B 2IDYA 2Z0EB 2KDFB 2Q13A 5FR3A 4KKIA 3R7QA 4NNJB 2BYFA 2K8CA 4L2YA 3SFDB 1D6EC 1EO6A 3P2BA 4ZYNA 3ZNID 2UWQA 3IT4B 1U5GA 4M8MA 4KHBB 2Z8LA 3RCZA 2LJ5A 3C0RB 5HKHA 3AN1A 1L4ZB 4MGZE 3IXSA 2DKPA 2DX5B 3HVZA 2IO2B 2JU6X 2D3AA 3V5WA 2O6VD 4HPMB 1L0VB 2W55A 4GGQA 3RN9C 3T9LA 4ZDVA 4JE3B 4DXGA 4ARIA 3TIXA 3V6CB 4DDGD 5H92C 1IBXB 4GDLA 4RGMA 1T3QA 4A6QA 2HTHB 3FEHA 3CWIA 3G9WA 3NW8A 3KSYA 2I38A 1N61A 5G5HA 2KUQA 5J3QA 3HQCA 1T6BX 2DYQA 2H88B 2ADZA 2PMVA 4WJ7A 1RRBA 1FFUA 2DZMA 5KQ1A 1KTKA 3PTFC 2WP9B 1TY0A 3DBRI 3PO0A 4W9JA 2K39A 2GOWA 2QDFA 4XX5A 3A4SC 2ELAA 4TKNA 2YT2A 1EAZA 1MFWA 4ACFA 2W3SA 1UNRA 1SXTA 2XN9C 1OMWA 1SEBD 3TEXA 4JL9A 2A4ZA 3OJ3A 5DPWA 3P1MA 2K2JA 2LHDA 1YD8U 2NMQA 2EJ8A 2VKIA 3QAQA 2D10A 3E56A 3RZWC 2UU7A 2CHXA 3DHGC 2IGDA 1ISNA 1P98A 2R61A 2WXIA 4ZRJA 2LOZA 2GCJA 4W9GA 3VUYA 1NTVA 2JXXA 3Q3OC 4A90A 2L83A 4K81A 5DIFB 1NENB 2JSVX 1OGWA 1XX0A 4PQ0A 3Q8FA 2JRHA 4HKQA 5E6JA 3UQAA 2ROZB 3KY9A 2L52A 3KWLA 3AI5A 1F9JA 2L2IA 1E8YA 4RM9A 3KUZA 3PLVA 3Q3FA 3U52E 5GXGB 4EZJA 1Q5WB 1N63A 2LASA 3DCGA 2KMMA 1V2YA 3ZUNA 2WDTB 1YX5B 4ITKA 4US8A 1ROEA 3VDZA 3SHQA 4GDKB 4F1SA 1F0ZA 2QEJC 1JALA 3PZ8A 1WYGA 2DYNA 2WGSA 2WXGA 2KWCA 1JROA 3DVGY 2LG1A 2YS1A 1N3HA 4XZ4A 2COFA 2KNBA 1HA5A 3K9PB 1J0WA 1XODA 2PEAA 2ZZPB 1WGDA 2Z59B 3PVLA 1T0YA 5J18A 2D9WA 1WYWB 1QF6A 2M4NA 3GYPA 4MT5A 4QJ5B 2MH7A 2L0TA 2RVBB 4GOUA 2JT4B 4R3DA 2WX1A 5D3IB 2W54A 1D3ZA 2GS0A 2XEWA 5IP4D 1EM7A 4YL8A 2Y7BA 5HE1A 2CY4A 3VVWB 1R4NI 4P6VF 2BPSA 5CHWA 1QKZA 4HB4B 4FULA 5D6JB 2MJEA 3A1QB 1Q67A 4ICVA 4EOYA 5TR5A 3IVFA 3SR6A 2INPE 2ON8A 3PSCA 1ZW7A 4CYEA 1FRRA 3B08A 1LM8B 2L00B 3BZDB 1LW3A 1HE8A 1V8CA 2GMIC 4RFBA 3ML9A 3WALA 3A58A 2LVPA 3NS8A 1FXAA 3FKYA 4HB0B 2FAZA 2KAJA 2WXFA 2KOXA 1L0YB 4HATB 4HEA1 2YF0A 1FGYA 1ZYIA 3KUCB 3MPXA 5DHFB 4LNFA 2M0XA 5FK9C 2J52A 3PVWA 1ENFA 2KTRA 4IW0A 3QWMA 1P3QU 5IOIA 1P7EA 1ZXIA 2QCZA 2ACZB 1U5DA 4K3BA 4JWSC 3M62B 2WYQA 3MP9A 1WIAA 2O2VB 1TT5B 2JZZA 4DWFA 3MDBC 3EECA 4LNOA 4LLGM 1TTNA 1D5ZC 1BXTA 4GZUA 4TQ1A 3ZJVA 4NJ6A 2W82A 2PLPA 1XLNA 4CHKA 1EUVB 1U2BA 3AULA 3UINB 4WURA 1JQ4A 4DXAB 4DBBA 4LJOB 2RD0A 2N7JA 2KWDA 3AE3B 2HJ1A 2LD9A 1SJED 1V49A 1TIFA 2D2QA 3TBLD 2SEBD 1NYQA 2WU2B 4N6EB 5CX3A 3H7SA 1QQRA 2K8HA 4KGTA 1WGHA 3RUIB 2M56B 4JGHB 2N9PC 4JLCA 1NTYA 1UUPA 1EU3A 2Z0OA 1GB1A 2OJRA 2OHFA 1R7SA 4XDDA 4F8CB 4MM3A 5JHBA 3DWMA 3H1UA 2FJUB 2CJOA 4B0MA 1W1HA 1FXIA 2KWVB 1E7UA 2JP2A 2G3QB 2OJWA 2Q5WD 4Z2MB 1WVHA 1OEYA 3PSEB 2EMTA 1DOXA 1ZDXA 2K0PA 3QQ8B 4WJPA 3D32A 3MHSD 1JRPA 4K7UA 4MJSA 5D3DA
chains in the Genus database with same CATH topology
2ZNVB 1KZ7A 5IAAC 2L1CA 2ELBA 2KQSA 4KSKC 4GPTB 1OQYA 2RNRB 3ZDTA 1VD2A 1C1YB 3SYXA 2NCNA 1J19A 4M0WB 2UZSA 1G6JA 2KDBA 4G0NB 2K25A 4AJYB 1TBEA 1WJ1A 2KD0A 3DOWA 1QQGA 3T8MA 2D3GA 4EZLA 1NU2A 2BCJA 5EFXA 4H8SA 3ZO5B 2EKEC 3VH4B 2C9WB 5DI9B 1M94A 2VSZA 2M38A 5CHFA 4BVUC 4PS8A 1V5PA 4OVUA 4A6KA 4F7UP 4GDLB 3PG7A 3QWZB 1UD7A 4IC7B 1RJ2A 1KJTA 3D8EA 2G45B 1V86A 3L10B 2N0YA 2W2XD 4EMOA 2KMAA 2D07B 3HK0A 1V5MA 2L7RA 2NBUA 2DFKA 4JQWC 4K2PA 3WA0A 4MDKE 4IOYX 3DVGX 2Y5BB 4WJQA 3A9KA 5C6RA 2GBNA 3VQIA 3PV1A 3ODOA 3CIKA 5E6NA 3V60A 3I3TB 2FIFA 3UQBA 5D3YA 1WZ3A 1Z2MA 3KW5B 2EC1A 1IYFA 2K00A 4BOSC 1VCBA 4IWQA 3PRMB 1Y5OA 3PS6A 3WAPA 1EGXA 4F7ZA 3PLUA 4MY6A 4PYZA 4NSWA 5JHAA 2LOXA 2CU1A 3MTNB 2PE9A 1PMSA 2YT0A 3QCAA 3PPAA 1AQCA 3PVUA 1MK7B 1UZXB 2PZ1A 1X86A 1WY8A 4DBGA 1TJ6A 3ECIA 5KQ4A 4URKA 4FLHA 2C7MB 2C7HA 3DXCA 2KC2A 2MWSB 1XR0B 3CF6E 4GIVA 2N9EB 4K7SA 1U4AA 4KIKA 2DZIA 3SUZA 2N7EA 3BY4B 2QHOA 2KFKA 4PS3A 4BBKA 2M17A 4A3PA 2E2XA 3R7RA 3ENEA 1DBHA 1KOTA 1TXDA 3JYUA 5LXHA 2CY5A 2DX1A 2DA0A 2ZEQA 4K1RB 2PE6B 1WGQA 5GMVA 3M1IB 1C3TA 1DDVA 3ZKJC 5L95C 4CO7A 4C0AA 5DPRA 3WAOA 1V88A 3A8QA 3ULBA 1WH3A 2AL6A 2LGDA 4D0NB 2L3ZA 3AU4A 2ZCBA 2O6VA 1S3SG 2AYOB 4MH0E 2V76A 3OANA 4IM2A 2KTRB 4HAZB 2NS5A 2CHWA 3VUXA 4HCNB 1XKEA 4G50A 2FNJB 1WG7A 5AZGA 5DPSA 3TCAA 2KQ7A 2DAFA 5AEKB 1QC6A 3IHPC 3QHTA 2GBMA 1MIXA 4DX90 2C5LC 1WM3A 5FR6A 2R0DA 2C60A 2MFQA 4MSQB 4W9CA 4EFOA 3DXDA 4M8NA 1DROA 3R3MA 1GC7A 1ZC4B 2W2XC 4GOCA 1WZ0A 4KZCA 3ONSA 4MJSB 2YS5A 3NSUA 1FGZA 2I5FA 1ZSQA 3ULCA 4DX8A 2Z0DB 2LRUA 1J8CA 1ZM0A 3QJZA 4HLEA 2KX3A 3APCA 2BWFA 2FCNA 5AZHA 4WJOA 3TW1A 2JWZA 4KVGB 4HCPB 1J0GA 3N3KB 2JPHA 1LQBA 2MP2A 1H10A 3U7DA 1V6EA 1WFYA 2KTFA 3JVZX 2CODA 4K2OA 5HE2A 4B95A 2KKCA 1P1AA 1XD4A 4KZ0A 1WI0A 4DHJB 2W2WA 4MT7A 1NI2A 2N7DA 3VTWA 2JZ3B 3ODXA 3JSVA 3WYFB 4W9KA 5LXIB 3A9JA 4W9DA 2MBEA 4FJZA 2FIDA 4BOZB 1MK9B 3CMMB 4W9HA 2BWES 3AU5A 2IYBA 5D3WA 1XQQA 3U8ZA 2KDIA 2BYEA 5EDSA 3CSFA 3SNHA 1WGYA 3ZLZA 1I42A 1E90A 1KLVA 3OLMD 3VH3B 2YRYA 2M8SA 2Y8FA 2DENB 5JHGA 2KC1A 4JIOU 1LB1A 2RGFA 3VHTC 3ZRFA 3A9KB 1WXMA 1TGZB 4ANXA 4W9FA 1FHOA 2KCJA 1Q1OA 2BF8B 2NPTA 4BKSA 1WGGA 2JRIB 2W9NA 3A33B 5CLLB 2MWNB 3SV1A 4LDTB 1YX6B 4II2B 5L83A 5JLJB 3NHEB 1RAXA 2EMSA 3D8DA 1E5WA 4HWIB 2K6DB 4HB2B 3CXBB 3DXEA 5DCNA 2LULA 2ROVA 3VOQA 5FI0A 3QARA 3M3JA 2MLBA 4IM0A 5LOPB 1GJZA 3IBEA 3HHMA 1UBIA 4DK5A 4LJPB 1P3RA 1I35A 1MPHA 2RSUA 2V1YA 2N4FA 4PS7A 1WRDB 2LVQA 1E8XA 2XBBC 1SHCA 1A5RA 2D4QA 2V4LA 4KIKB 3HW2B 3GOEA 2ZPYA 2KFKB 1WJ6A 2MKRA 5FI1A 3ZTCA 2D9VA 3KZ1A 4TUUA 2D9ZA 1BAKA 1P9DU 3ML8A 4F7GA 1Z5SB 3DPDA 2XK5A 1DYNA 3EC8A 1OQNA 4DDID 3VIAA 2C7NB 3F5RA 2D9YA 2OQBA 1EVHA 3A4RA 1UH6A 2GBJA 2MBOA 3VTVA 2RPQA 3KH0A 1ZGUB 1KZGA 4MELA 5D94A 1GUAB 5C1ZA 2O6VB 4BFRA 2Y8GA 2G4SA 1B55A 1AARA 1ZKHA 2D11A 4E74A 4MSMB 3QK0A 4K7WA 2K8BA 2DHZA 2ZNVC 2KK8A 3Q3JA 3ZRCA 5J3YA 2KJ6A 2UVMA 2P0DA 4ANVA 2OOBB 1YJ1A 3S2AA 1WMHA 3ZVRA 2CAYA 4RM8A 3ZW3A 1SE9A 1MKEA 1SGHA 4X57B 2MRPA 4LCDE 4WJNA 1WE7A 2ZVNA 3DDCB 3LJ3A 3X23A 4FHKA 3JW0X 4L6EA 1WX8A 5GOWB 1U5EA 2P0FA 2LGXA 2LXAA 1NDDA 4A6HA 1WXAA 4WWNA 1FAOA 1P5TA 3H9DA 3DVNU 3VXWA 3L17A 1RRPB 4PYUA 3V62A 2MP2B 4A6FA 2MBQA 5J2RA 1E8ZA 1V61A 3VTUA 4IAPA 2DYMA 1GG3A 3ZNHB 3GZNI 3AXCA 5D2MB 2DKQA 4IFSA 3FM8C 1UNQA 1V9JA 3DBLI 4NPNA 3JSVB 2LKOA 2FJLA 1XD3B 2KX0A 3A9JB 3KRWA 3TO1A 3ZVVA 1DDWA 5JP4A 2V3SA 2NZ8B 3TL5A 1V5TA 1H4RA 5KCVA 4DHJD 3IG3A 2CHZA 3P7ZA 2I1JA 4F7HA 1S1QB 2IO0B 2OTXA 4W9EA 1P6SA 4ICUA 3DQVA 2J59M 2KHWB 3IFWB 2KGXB 2Z0PA 4NAWA 1U27A 3EFUA 3LDZE 4NY0A 4HAUB 3BINA 4B6WA 2BKRB 1P0RA 4TQ0A 2J0JA 1Q0WB 4A3OA 1UELA 2IBIB 4FA6A 4HDOA 2NPTB 4EUTA 5CHVC 4EKUA 3PT2B 1NBFC 3L16A 3W1SA 2DHJA 5G2NA 2HJ8A 4IWPA 4G11A 2G4DB 2M14A 4IUMB 3OJ4B 3SO6A 2G35A 2O2VA 1ZC3B 4LDTD 5D27A 2IZVB 4IG7B 2AL3A 2R2OA 3B0AA 4HAYB 4CHJA 4ASWC 1PLSA 2J0KA 2KANA 2IY0B 1QZEA 2ZJDA 3BJIA 5L81A 5CTRC 2KVRA 3O65B 5E6PA 2BGFA 1I2HA 4ANUA 4I6LB 1FOEA 4GB9A 4GMVA 2MBBB 2GJYA 2GBRA 2D9XA 1DDMA 3P6AA 2GBKA 2KMCA 2XK5B 4PNKA 1KM7A 2WX0A 3NY5A 5J17A 1UNPA 4IM3A 4A20A 2DLWA 3V61A 3R66C 2YVCA 4TYZA 4CHMA 2RUKB 4BKGA 2YT1A 3KRXA 2MDXA 5JH5C 2I5CA 4MGIE 2QKMA 1WR6E 1OTRB 2LRWA 3ZDMC 2L0FA 3DBSA 4IWOA 1V5UA 3RD2A 2DZKA 1M7RA 1H8CA 2XQNM 2AEHA 2PPHA 5DHAB 2LXCA 3N30A 3H7PA 4HJKA 3ALBA 2P8VA 3WANA 2K6QA 2NMBA 1E7VA 4EJNA 3ML4A 3VFKA 4KSLC 2NBWB 2IFSA 2LZ6A 2HD5B 4KAXB 1RFAA 2LI5A 2DHIA 1WMHB 5D3VA 2N1WA 5BO4B 3MJWA 3A98B 1PQSA 2ZCCA 5JZEB 3QC8B 5D7GA 3HIZA 1GC6A 2JVCA 2B3AA 3VUWA 2LUEA 1XCGA 3PREA 5C79A 3SU8X 4GMXB 1W1DA 2JY6A 1WJ4A 1BTNA 1R4MI 4W9LA 2NBVB 3PRPB 1U5FA 5G55A 1E8WA 2H7EA 1V81A 1WGUA 3L0WB 3O96A 2R09A 3TJPA 3ZIMA 4N9F4 2KN5A 4EZKA 5HE0A 3A8PA 4B9KA 3GYOA 2KWUB 2N9XA 4A6FB 1BTKA 3RCPA 1OEYJ 2QKLA 1WX9A 4GSWA 3QBVB 4DHZE 4GN1A 1PFJA 2J7QB 3PP2A 2MX2A 1SIFA 3FSSA 5D3XA 5KHOA 4A5KA 2CR5A 2KLCA 4HAVB 3H6NA 2I1KA 3SD5A 5C23A 5AZFA 2M1MA 3NZUA 3UGBB 1WM2A 1U29A 2ZPNA 1Y8RC 3ZNGC 3TFMA 1BWNA 4NAWB 2KDEB 2L8JA 5KHQA 5LONB 3PRZA 4RMAA 3EHVA 2RSGA 2YS3A 4BBNF 1WJNA 2MCNB 1K5DB 1MG8A 3KYCD 2DN6A 3WIMA 4HAWB 2REXA 1X1GA 1V89A 4DHZB 2DHKA 5C5BA 1UPRA 4HB3B 1Y19B 3W1SC 4MGKE 2NR2A 2IO1B 4WAAA 5C16A 4BKSD 3TMPB 2JF5A 2KZRA 5IA7A 2FCSA 3SDLC 2DAJA 4HDQA 3PEGA 5CLQB 3TVVA 2A5UA 2KFJA 5J3TA 1AWEA 2GCLA 1UGMA 2YSZA 1W1GA 4FJYA 2K1FA 2MSED 4NQKE 2PJHA 3NZSA 1YIWA 1UEFA 3RYTA 3T06A 4MK0A 2N23A 4KV2A 4FADA 1EF1A 1BT0A 1WE6A 4KDIC 4WWOA 2LYDA 4K17A 4E71A 5LLIA 1FHWA 3APDA 2DX5A 4XC2A 5JHHA 1WGRA 4ZRIA 4YONA 1UBQA 1LFDA 4HXDA 2KLGA 2KXJA 5E6OA 2N1VA 3RT3B 2Z0QA 2HTHA 4NJ7A 3QX1A 4I6NB 4FN2A 4HK2A 1Z87A 1IPGA 4G3XB 4NQLB 3NOBA 5DH9B 3AJ4A 4W9IA 1K5GB 2ZVOA 3APFA 1I7AA 1L2NA 2AWTA 2KO3A 4AWJA 2R2QA 2BYVE 1OY2A 3L54A 1MAIA 2MBHA 3LJUX 3ODWA 3H7PB 4AP4C 1IP9A 2MQJA 4J6IA 1X1FA 2UYZB 2DTCA 1FB8A 3N32A 2IYDB 2ASQA 3DBHI 1JRUA 2DYBA 4ANWA 2DYOA 2VRWB 2RLOA 5DPTA 2RGNB 1WXSA 2CKHB 1LXDA 1UPQA 2YLMA 3PHXB 4GDKA 2VRRB 4WQOB 2CRFA 2K2UA 1CMXB 2WWZA 4I6PA 2FCQA 4WVFB 1WF9A 2P0HA 4EEWA 4ZRKA 2LVOA 4KHOA 3UIPB 1V5OA 4GXBA 4MGYE 1L7YA 1M7EA 4WWPA 1KI1B 3M63B 1WR1A 3D8FA 3RULA 4BKTA 4FJVB 3B1LX 2COCA 3QA8A 4FBJB 1X05A 2X18A 4OVVA 2FCMA 1WJMA 1FHXA 4E3CA 4KHAA 1WXVA 4HVBA 3A1QA 4AUQC 1TZ1A 3KVFB 3VAWA 3KUDB 1WI1A 2KJHB 3HM6X 4FHJA 1YQBA 2FUHB 4MEMA 3WAMA 4Z2NA 2MA9B 2CS4A 4XWXA 2JUOA 4BBNC 2LGYA 4Y94A 1WJUA 4GU2A 2H7DA 4II3B 3UZTA 4HPLB 1K8RB 3X0WA 3U30A 3N7CA 3CSTA 3HM3A 4KDLB 3ZNZB 1IRSA 2COAA 1RLFA 1X1MA 2MW5A 2DZJA 4B6HA 3UF8A 2UZRA 3KYDD 2IY1B 4HAXB 1ZVRA 2HE7A 1XT9B 2KUPA 3UIOB 3M95A 4TV3A 3DVNV 1V80A 3PZDA 2J0MA 3L08A 1GNUA 3PHWB 2L76A 2BKFA 1TQZA 4AJWA 5C5BB 3OAWA 3PGEA 4HHVA 1X11A 4AOFA 3V6EB 3K9OB 3W1YA 2NVUI 2KJRA 5HE3A 1FXTB 3L13A 2L05A 1WX7A 4WSFA 3RZFA 4P7IA 2IO3B 1MIZB 3QIJA 1EF5A 3F0WA 3ZTDA 2LWPA 2RR9A 2Z0EB 2KDFB 2Q13A 3R7QA 4NNJB 2BYFA 2K8CA 1EO6A 3P2BA 4ZYNA 3ZNID 2UWQA 1U5GA 4M8MA 4KHBB 3RCZA 2LJ5A 3C0RB 5HKHA 4MGZE 2DKPA 2DX5B 2IO2B 3V5WA 2O6VD 4HPMB 4GGQA 3T9LA 4ZDVA 3TIXA 3V6CB 4DDGD 4GDLA 2HTHB 3FEHA 3G9WA 3KSYA 5J3QA 3HQCA 2DYQA 2ADZA 4WJ7A 3PTFC 1RRBA 2DZMA 5KQ1A 3DBRI 4W9JA 2K39A 2GOWA 4XX5A 3A4SC 2ELAA 4TKNA 1EAZA 1UNRA 1OMWA 4JL9A 2A4ZA 3OJ3A 5DPWA 2K2JA 1YD8U 2EJ8A 2VKIA 3QAQA 2D10A 3RZWC 2CHXA 3VUYA 1ISNA 1P98A 4ZRJA 2LOZA 2GCJA 4W9GA 1NTVA 2JXXA 4K81A 5DIFB 1OGWA 1XX0A 4PQ0A 2JRHA 3UQAA 2ROZB 3KY9A 3AI5A 1F9JA 2L2IA 1E8YA 4RM9A 3KUZA 3PLVA 3Q3FA 4EZJA 1Q5WB 2LASA 3DCGA 1V2YA 3ZUNA 2WDTB 1YX5B 3VDZA 3SHQA 4GDKB 4F1SA 2DYNA 2KWCA 3DVGY 2LG1A 2YS1A 1N3HA 4XZ4A 2COFA 2KNBA 3K9PB 1J0WA 1XODA 2PEAA 2ZZPB 1WGDA 2Z59B 3PVLA 1T0YA 5J18A 2D9WA 1WYWB 2M4NA 3GYPA 2L0TA 2RVBB 2JT4B 2WX1A 1D3ZA 2GS0A 2XEWA 4YL8A 2Y7BA 5HE1A 2CY4A 3VVWB 1R4NI 2BPSA 5CHWA 4HB4B 4FULA 5D6JB 3A1QB 1Q67A 4ICVA 4EOYA 5TR5A 3IVFA 3PSCA 1ZW7A 4CYEA 3B08A 1LM8B 2L00B 1LW3A 1HE8A 2GMIC 3ML9A 3WALA 2LVPA 3NS8A 4HB0B 2FAZA 2KOXA 4HATB 2YF0A 1FGYA 3KUCB 3MPXA 5DHFB 2M0XA 3PVWA 2KTRA 4IW0A 3QWMA 1P3QU 1U5DA 3M62B 2WYQA 1WIAA 2O2VB 2JZZA 4DWFA 3MDBC 3EECA 1TTNA 4GZUA 4TQ1A 4NJ6A 4CHKA 1EUVB 1U2BA 3AULA 3UINB 4DXAB 4DBBA 4LJOB 2RD0A 2LD9A 1V49A 2D2QA 3TBLD 5CX3A 3H7SA 2K8HA 3RUIB 1WGHA 4JGHB 4JLCA 2N9PC 1NTYA 2Z0OA 2OJRA 4F8CB 4MM3A 5JHBA 3H1UA 1W1HA 2KWVB 1E7UA 2JP2A 2G3QB 4Z2MB 1WVHA 1OEYA 3PSEB 2EMTA 3QQ8B 4WJPA 3D32A 3MHSD 4K7UA 4MJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNV B;  1KZ7 A;  5IAA C;  2L1C A;  2ELB A;  2KQS A;  4KSK C;  4GPT B;  1OQY A;  2RNR B;  3ZDT A;  1VD2 A;  1C1Y B;  3SYX A;  2NCN A;  1J19 A;  4M0W B;  2UZS A;  1G6J A;  2KDB A;  4G0N B;  2K25 A;  4AJY B;  1TBE A;  1WJ1 A;  2KD0 A;  3DOW A;  1QQG A;  3T8M A;  2D3G A;  4EZL A;  1NU2 A;  2BCJ A;  5EFX A;  4H8S A;  3ZO5 B;  2EKE C;  3VH4 B;  2C9W B;  5DI9 B;  1M94 A;  2VSZ A;  2M38 A;  5CHF A;  4BVU C;  4PS8 A;  1V5P A;  4OVU A;  4A6K A;  4F7U P;  4GDL B;  3PG7 A;  3QWZ B;  1UD7 A;  4IC7 B;  1RJ2 A;  1KJT A;  3D8E A;  2G45 B;  1V86 A;  3L10 B;  2N0Y A;  2W2X D;  4EMO A;  2KMA A;  2D07 B;  3HK0 A;  1V5M A;  2L7R A;  2NBU A;  2DFK A;  4JQW C;  4K2P A;  3WA0 A;  4MDK E;  4IOY X;  3DVG X;  2Y5B B;  4WJQ A;  3A9K A;  5C6R A;  2GBN A;  3VQI A;  3PV1 A;  3ODO A;  3CIK A;  5E6N A;  3V60 A;  3I3T B;  2FIF A;  3UQB A;  5D3Y A;  1WZ3 A;  1Z2M A;  3KW5 B;  2EC1 A;  1IYF A;  2K00 A;  4BOS C;  1VCB A;  4IWQ A;  3PRM B;  1Y5O A;  3PS6 A;  3WAP A;  1EGX A;  4F7Z A;  3PLU A;  4MY6 A;  4PYZ A;  4NSW A;  5JHA A;  2LOX A;  2CU1 A;  3MTN B;  2PE9 A;  1PMS A;  2YT0 A;  3QCA A;  3PPA A;  1AQC A;  3PVU A;  1MK7 B;  1UZX B;  2PZ1 A;  1X86 A;  1WY8 A;  4DBG A;  1TJ6 A;  3ECI A;  5KQ4 A;  4URK A;  4FLH A;  2C7M B;  2C7H A;  3DXC A;  2KC2 A;  2MWS B;  1XR0 B;  3CF6 E;  4GIV A;  2N9E B;  4K7S A;  1U4A A;  4KIK A;  2DZI A;  3SUZ A;  2N7E A;  3BY4 B;  2QHO A;  2KFK A;  4PS3 A;  4BBK A;  2M17 A;  4A3P A;  2E2X A;  3R7R A;  3ENE A;  1DBH A;  1KOT A;  1TXD A;  3JYU A;  5LXH A;  2CY5 A;  2DX1 A;  2DA0 A;  2ZEQ A;  4K1R B;  2PE6 B;  1WGQ A;  5GMV A;  3M1I B;  1C3T A;  1DDV A;  3ZKJ C;  5L95 C;  4CO7 A;  4C0A A;  5DPR A;  3WAO A;  1V88 A;  3A8Q A;  3ULB A;  1WH3 A;  2AL6 A;  2LGD A;  4D0N B;  2L3Z A;  3AU4 A;  2ZCB A;  2O6V A;  1S3S G;  2AYO B;  4MH0 E;  2V76 A;  3OAN A;  4IM2 A;  2KTR B;  4HAZ B;  2NS5 A;  2CHW A;  3VUX A;  4HCN B;  1XKE A;  4G50 A;  2FNJ B;  1WG7 A;  5AZG A;  5DPS A;  3TCA A;  2KQ7 A;  2DAF A;  5AEK B;  1QC6 A;  3IHP C;  3QHT A;  2GBM A;  1MIX A;  4DX9 0;  2C5L C;  1WM3 A;  5FR6 A;  2R0D A;  2C60 A;  2MFQ A;  4MSQ B;  4W9C A;  4EFO A;  3DXD A;  4M8N A;  1DRO A;  3R3M A;  1GC7 A;  1ZC4 B;  2W2X C;  4GOC A;  1WZ0 A;  4KZC A;  3ONS A;  4MJS B;  2YS5 A;  3NSU A;  1FGZ A;  2I5F A;  1ZSQ A;  3ULC A;  4DX8 A;  2Z0D B;  2LRU A;  1J8C A;  1ZM0 A;  3QJZ A;  4HLE A;  2KX3 A;  3APC A;  2BWF A;  2FCN A;  5AZH A;  4WJO A;  3TW1 A;  2JWZ A;  4KVG B;  4HCP B;  1J0G A;  3N3K B;  2JPH A;  1LQB A;  2MP2 A;  1H10 A;  3U7D A;  1V6E A;  1WFY A;  2KTF A;  3JVZ X;  2COD A;  4K2O A;  5HE2 A;  4B95 A;  2KKC A;  1P1A A;  1XD4 A;  4KZ0 A;  1WI0 A;  4DHJ B;  2W2W A;  4MT7 A;  1NI2 A;  2N7D A;  3VTW A;  2JZ3 B;  3ODX A;  3JSV A;  3WYF B;  4W9K A;  5LXI B;  3A9J A;  4W9D A;  2MBE A;  4FJZ A;  2FID A;  4BOZ B;  1MK9 B;  3CMM B;  4W9H A;  2BWE S;  3AU5 A;  2IYB A;  5D3W A;  1XQQ A;  3U8Z A;  2KDI A;  2BYE A;  5EDS A;  3CSF A;  3SNH A;  1WGY A;  3ZLZ A;  1I42 A;  1E90 A;  1KLV A;  3OLM D;  3VH3 B;  2YRY A;  2M8S A;  2Y8F A;  2DEN B;  5JHG A;  2KC1 A;  4JIO U;  1LB1 A;  2RGF A;  3VHT C;  3ZRF A;  3A9K B;  1WXM A;  1TGZ B;  4ANX A;  4W9F A;  1FHO A;  2KCJ A;  1Q1O A;  2BF8 B;  2NPT A;  4BKS A;  1WGG A;  2JRI B;  2W9N A;  3A33 B;  5CLL B;  2MWN B;  3SV1 A;  4LDT B;  1YX6 B;  4II2 B;  5L83 A;  5JLJ B;  3NHE B;  1RAX A;  2EMS A;  3D8D A;  1E5W A;  4HWI B;  2K6D B;  4HB2 B;  3CXB B;  3DXE A;  5DCN A;  2LUL A;  2ROV A;  3VOQ A;  5FI0 A;  3QAR A;  3M3J A;  2MLB A;  4IM0 A;  5LOP B;  1GJZ A;  3IBE A;  3HHM A;  1UBI A;  4DK5 A;  4LJP B;  1P3R A;  1I35 A;  1MPH A;  2RSU A;  2V1Y A;  2N4F A;  4PS7 A;  1WRD B;  2LVQ A;  1E8X A;  2XBB C;  1SHC A;  1A5R A;  2D4Q A;  2V4L A;  4KIK B;  3HW2 B;  3GOE A;  2ZPY A;  2KFK B;  1WJ6 A;  2MKR A;  5FI1 A;  3ZTC A;  2D9V A;  3KZ1 A;  4TUU A;  2D9Z A;  1BAK A;  1P9D U;  3ML8 A;  4F7G A;  1Z5S B;  3DPD A;  2XK5 A;  1DYN A;  3EC8 A;  1OQN A;  4DDI D;  3VIA A;  2C7N B;  3F5R A;  2D9Y A;  2OQB A;  1EVH A;  3A4R A;  1UH6 A;  2GBJ A;  2MBO A;  3VTV A;  2RPQ A;  3KH0 A;  1ZGU B;  1KZG A;  4MEL A;  5D94 A;  1GUA B;  5C1Z A;  2O6V B;  4BFR A;  2Y8G A;  2G4S A;  1B55 A;  1AAR A;  1ZKH A;  2D11 A;  4E74 A;  4MSM B;  3QK0 A;  4K7W A;  2K8B A;  2DHZ A;  2ZNV C;  2KK8 A;  3Q3J A;  3ZRC A;  5J3Y A;  2KJ6 A;  2UVM A;  2P0D A;  4ANV A;  2OOB B;  1YJ1 A;  3S2A A;  1WMH A;  3ZVR A;  2CAY A;  4RM8 A;  3ZW3 A;  1SE9 A;  1MKE A;  1SGH A;  4X57 B;  2MRP A;  4LCD E;  4WJN A;  1WE7 A;  2ZVN A;  3DDC B;  3LJ3 A;  3X23 A;  4FHK A;  3JW0 X;  4L6E A;  1WX8 A;  5GOW B;  1U5E A;  2P0F A;  2LGX A;  2LXA A;  1NDD A;  4A6H A;  1WXA A;  4WWN A;  1FAO A;  1P5T A;  3H9D A;  3DVN U;  3VXW A;  3L17 A;  1RRP B;  4PYU A;  3V62 A;  2MP2 B;  4A6F A;  2MBQ A;  5J2R A;  1E8Z A;  1V61 A;  3VTU A;  4IAP A;  2DYM A;  1GG3 A;  3ZNH B;  3GZN I;  3AXC A;  5D2M B;  2DKQ A;  4IFS A;  3FM8 C;  1UNQ A;  1V9J A;  3DBL I;  4NPN A;  3JSV B;  2LKO A;  2FJL A;  1XD3 B;  2KX0 A;  3A9J B;  3KRW A;  3TO1 A;  3ZVV A;  1DDW A;  5JP4 A;  2V3S A;  2NZ8 B;  3TL5 A;  1V5T A;  1H4R A;  5KCV A;  4DHJ D;  3IG3 A;  2CHZ A;  3P7Z A;  2I1J A;  4F7H A;  1S1Q B;  2IO0 B;  2OTX A;  4W9E A;  1P6S A;  4ICU A;  3DQV A;  2J59 M;  2KHW B;  3IFW B;  2KGX B;  2Z0P A;  4NAW A;  1U27 A;  3EFU A;  3LDZ E;  4NY0 A;  4HAU B;  3BIN A;  4B6W A;  2BKR B;  1P0R A;  4TQ0 A;  2J0J A;  1Q0W B;  4A3O A;  1UEL A;  2IBI B;  4FA6 A;  4HDO A;  2NPT B;  4EUT A;  5CHV C;  4EKU A;  3PT2 B;  1NBF C;  3L16 A;  3W1S A;  2DHJ A;  5G2N A;  2HJ8 A;  4IWP A;  4G11 A;  2G4D B;  2M14 A;  4IUM B;  3OJ4 B;  3SO6 A;  2G35 A;  2O2V A;  1ZC3 B;  4LDT D;  5D27 A;  2IZV B;  4IG7 B;  2AL3 A;  2R2O A;  3B0A A;  4HAY B;  4CHJ A;  4ASW C;  1PLS A;  2J0K A;  2KAN A;  2IY0 B;  1QZE A;  2ZJD A;  3BJI A;  5L81 A;  5CTR C;  2KVR A;  3O65 B;  5E6P A;  2BGF A;  1I2H A;  4ANU A;  4I6L B;  1FOE A;  4GB9 A;  4GMV A;  2MBB B;  2GJY A;  2GBR A;  2D9X A;  1DDM A;  3P6A A;  2GBK A;  2KMC A;  2XK5 B;  4PNK A;  1KM7 A;  2WX0 A;  3NY5 A;  5J17 A;  1UNP A;  4IM3 A;  4A20 A;  2DLW A;  3V61 A;  3R66 C;  2YVC A;  4TYZ A;  4CHM A;  2RUK B;  4BKG A;  2YT1 A;  3KRX A;  2MDX A;  5JH5 C;  2I5C A;  4MGI E;  2QKM A;  1WR6 E;  1OTR B;  2LRW A;  3ZDM C;  2L0F A;  3DBS A;  4IWO A;  1V5U A;  3RD2 A;  2DZK A;  1M7R A;  1H8C A;  2XQN M;  2AEH A;  2PPH A;  5DHA B;  2LXC A;  3N30 A;  3H7P A;  4HJK A;  3ALB A;  2P8V A;  3WAN A;  2K6Q A;  2NMB A;  1E7V A;  4EJN A;  3ML4 A;  3VFK A;  4KSL C;  2NBW B;  2IFS A;  2LZ6 A;  2HD5 B;  4KAX B;  1RFA A;  2LI5 A;  2DHI A;  1WMH B;  5D3V A;  2N1W A;  5BO4 B;  3MJW A;  3A98 B;  1PQS A;  2ZCC A;  5JZE B;  3QC8 B;  5D7G A;  3HIZ A;  1GC6 A;  2JVC A;  2B3A A;  3VUW A;  2LUE A;  1XCG A;  3PRE A;  5C79 A;  3SU8 X;  4GMX B;  1W1D A;  2JY6 A;  1WJ4 A;  1BTN A;  1R4M I;  4W9L A;  2NBV B;  3PRP B;  1U5F A;  5G55 A;  1E8W A;  2H7E A;  1V81 A;  1WGU A;  3L0W B;  3O96 A;  2R09 A;  3TJP A;  3ZIM A;  4N9F 4;  2KN5 A;  4EZK A;  5HE0 A;  3A8P A;  4B9K A;  3GYO A;  2KWU B;  2N9X A;  4A6F B;  1BTK A;  3RCP A;  1OEY J;  2QKL A;  1WX9 A;  4GSW A;  3QBV B;  4DHZ E;  4GN1 A;  1PFJ A;  2J7Q B;  3PP2 A;  2MX2 A;  1SIF A;  3FSS A;  5D3X A;  5KHO A;  4A5K A;  2CR5 A;  2KLC A;  4HAV B;  3H6N A;  2I1K A;  3SD5 A;  5C23 A;  5AZF A;  2M1M A;  3NZU A;  3UGB B;  1WM2 A;  1U29 A;  2ZPN A;  1Y8R C;  3ZNG C;  3TFM A;  1BWN A;  4NAW B;  2KDE B;  2L8J A;  5KHQ A;  5LON B;  3PRZ A;  4RMA A;  3EHV A;  2RSG A;  2YS3 A;  4BBN F;  1WJN A;  2MCN B;  1K5D B;  1MG8 A;  3KYC D;  2DN6 A;  3WIM A;  4HAW B;  2REX A;  1X1G A;  1V89 A;  4DHZ B;  2DHK A;  5C5B A;  1UPR A;  4HB3 B;  1Y19 B;  3W1S C;  4MGK E;  2NR2 A;  2IO1 B;  4WAA A;  5C16 A;  4BKS D;  3TMP B;  2JF5 A;  2KZR A;  5IA7 A;  2FCS A;  3SDL C;  2DAJ A;  4HDQ A;  3PEG A;  5CLQ B;  3TVV A;  2A5U A;  2KFJ A;  5J3T A;  1AWE A;  2GCL A;  1UGM A;  2YSZ A;  1W1G A;  4FJY A;  2K1F A;  2MSE D;  4NQK E;  2PJH A;  3NZS A;  1YIW A;  1UEF A;  3RYT A;  3T06 A;  4MK0 A;  2N23 A;  4KV2 A;  4FAD A;  1EF1 A;  1BT0 A;  1WE6 A;  4KDI C;  4WWO A;  2LYD A;  4K17 A;  4E71 A;  5LLI A;  1FHW A;  3APD A;  2DX5 A;  4XC2 A;  5JHH A;  1WGR A;  4ZRI A;  4YON A;  1UBQ A;  1LFD A;  4HXD A;  2KLG A;  2KXJ A;  5E6O A;  2N1V A;  3RT3 B;  2Z0Q A;  2HTH A;  4NJ7 A;  3QX1 A;  4I6N B;  4FN2 A;  4HK2 A;  1Z87 A;  1IPG A;  4G3X B;  4NQL B;  3NOB A;  5DH9 B;  3AJ4 A;  4W9I A;  1K5G B;  2ZVO A;  3APF A;  1I7A A;  1L2N A;  2AWT A;  2KO3 A;  4AWJ A;  2R2Q A;  2BYV E;  1OY2 A;  3L54 A;  1MAI A;  2MBH A;  3LJU X;  3ODW A;  3H7P B;  4AP4 C;  1IP9 A;  2MQJ A;  4J6I A;  1X1F A;  2UYZ B;  2DTC A;  1FB8 A;  3N32 A;  2IYD B;  2ASQ A;  3DBH I;  1JRU A;  2DYB A;  4ANW A;  2DYO A;  2VRW B;  2RLO A;  5DPT A;  2RGN B;  1WXS A;  2CKH B;  1LXD A;  1UPQ A;  2YLM A;  3PHX B;  4GDK A;  2VRR B;  4WQO B;  2CRF A;  2K2U A;  1CMX B;  2WWZ A;  4I6P A;  2FCQ A;  4WVF B;  1WF9 A;  2P0H A;  4EEW A;  4ZRK A;  2LVO A;  4KHO A;  3UIP B;  1V5O A;  4GXB A;  4MGY E;  1L7Y A;  1M7E A;  4WWP A;  1KI1 B;  3M63 B;  1WR1 A;  3D8F A;  3RUL A;  4BKT A;  4FJV B;  3B1L X;  2COC A;  3QA8 A;  4FBJ B;  1X05 A;  2X18 A;  4OVV A;  2FCM A;  1WJM A;  1FHX A;  4E3C A;  4KHA A;  1WXV A;  4HVB A;  3A1Q A;  4AUQ C;  1TZ1 A;  3KVF B;  3VAW A;  3KUD B;  1WI1 A;  2KJH B;  3HM6 X;  4FHJ A;  1YQB A;  2FUH B;  4MEM A;  3WAM A;  4Z2N A;  2MA9 B;  2CS4 A;  4XWX A;  2JUO A;  4BBN C;  2LGY A;  4Y94 A;  1WJU A;  4GU2 A;  2H7D A;  4II3 B;  3UZT A;  4HPL B;  1K8R B;  3X0W A;  3U30 A;  3N7C A;  3CST A;  3HM3 A;  4KDL B;  3ZNZ B;  1IRS A;  2COA A;  1RLF A;  1X1M A;  2MW5 A;  2DZJ A;  4B6H A;  3UF8 A;  2UZR A;  3KYD D;  2IY1 B;  4HAX B;  1ZVR A;  2HE7 A;  1XT9 B;  2KUP A;  3UIO B;  3M95 A;  4TV3 A;  3DVN V;  1V80 A;  3PZD A;  2J0M A;  3L08 A;  1GNU A;  3PHW B;  2L76 A;  2BKF A;  1TQZ A;  4AJW A;  5C5B B;  3OAW A;  3PGE A;  4HHV A;  1X11 A;  4AOF A;  3V6E B;  3K9O B;  3W1Y A;  2NVU I;  2KJR A;  5HE3 A;  1FXT B;  3L13 A;  2L05 A;  1WX7 A;  4WSF A;  3RZF A;  4P7I A;  2IO3 B;  1MIZ B;  3QIJ A;  1EF5 A;  3F0W A;  3ZTD A;  2LWP A;  2RR9 A;  2Z0E B;  2KDF B;  2Q13 A;  3R7Q A;  4NNJ B;  2BYF A;  2K8C A;  1EO6 A;  3P2B A;  4ZYN A;  3ZNI D;  2UWQ A;  1U5G A;  4M8M A;  4KHB B;  3RCZ A;  2LJ5 A;  3C0R B;  5HKH A;  4MGZ E;  2DKP A;  2DX5 B;  2IO2 B;  3V5W A;  2O6V D;  4HPM B;  4GGQ A;  3T9L A;  4ZDV A;  3TIX A;  3V6C B;  4DDG D;  4GDL A;  2HTH B;  3FEH A;  3G9W A;  3KSY A;  5J3Q A;  3HQC A;  2DYQ A;  2ADZ A;  4WJ7 A;  3PTF C;  1RRB A;  2DZM A;  5KQ1 A;  3DBR I;  4W9J A;  2K39 A;  2GOW A;  4XX5 A;  3A4S C;  2ELA A;  4TKN A;  1EAZ A;  1UNR A;  1OMW A;  4JL9 A;  2A4Z A;  3OJ3 A;  5DPW A;  2K2J A;  1YD8 U;  2EJ8 A;  2VKI A;  3QAQ A;  2D10 A;  3RZW C;  2CHX A;  3VUY A;  1ISN A;  1P98 A;  4ZRJ A;  2LOZ A;  2GCJ A;  4W9G A;  1NTV A;  2JXX A;  4K81 A;  5DIF B;  1OGW A;  1XX0 A;  4PQ0 A;  2JRH A;  3UQA A;  2ROZ B;  3KY9 A;  3AI5 A;  1F9J A;  2L2I A;  1E8Y A;  4RM9 A;  3KUZ A;  3PLV A;  3Q3F A;  4EZJ A;  1Q5W B;  2LAS A;  3DCG A;  1V2Y A;  3ZUN A;  2WDT B;  1YX5 B;  3VDZ A;  3SHQ A;  4GDK B;  4F1S A;  2DYN A;  2KWC A;  3DVG Y;  2LG1 A;  2YS1 A;  1N3H A;  4XZ4 A;  2COF A;  2KNB A;  3K9P B;  1J0W A;  1XOD A;  2PEA A;  2ZZP B;  1WGD A;  2Z59 B;  3PVL A;  1T0Y A;  5J18 A;  2D9W A;  1WYW B;  2M4N A;  3GYP A;  2L0T A;  2RVB B;  2JT4 B;  2WX1 A;  1D3Z A;  2GS0 A;  2XEW A;  4YL8 A;  2Y7B A;  5HE1 A;  2CY4 A;  3VVW B;  1R4N I;  2BPS A;  5CHW A;  4HB4 B;  4FUL A;  5D6J B;  3A1Q B;  1Q67 A;  4ICV A;  4EOY A;  5TR5 A;  3IVF A;  3PSC A;  1ZW7 A;  4CYE A;  3B08 A;  1LM8 B;  2L00 B;  1LW3 A;  1HE8 A;  2GMI C;  3ML9 A;  3WAL A;  2LVP A;  3NS8 A;  4HB0 B;  2FAZ A;  2KOX A;  4HAT B;  2YF0 A;  1FGY A;  3KUC B;  3MPX A;  5DHF B;  2M0X A;  3PVW A;  2KTR A;  4IW0 A;  3QWM A;  1P3Q U;  1U5D A;  3M62 B;  2WYQ A;  1WIA A;  2O2V B;  2JZZ A;  4DWF A;  3MDB C;  3EEC A;  1TTN A;  4GZU A;  4TQ1 A;  4NJ6 A;  4CHK A;  1EUV B;  1U2B A;  3AUL A;  3UIN B;  4DXA B;  4DBB A;  4LJO B;  2RD0 A;  2LD9 A;  1V49 A;  2D2Q A;  3TBL D;  5CX3 A;  3H7S A;  2K8H A;  3RUI B;  1WGH A;  4JGH B;  4JLC A;  2N9P C;  1NTY A;  2Z0O A;  2OJR A;  4F8C B;  4MM3 A;  5JHB A;  3H1U A;  1W1H A;  2KWV B;  1E7U A;  2JP2 A;  2G3Q B;  4Z2M B;  1WVH A;  1OEY A;  3PSE B;  2EMT A;  3QQ8 B;  4WJP A;  3D32 A;  3MHS D;  4K7U A;  4MJS A; 
#chains in the Genus database with same CATH topology
 1J7A A;  2ZNV B;  1KZ7 A;  5IAA C;  3KLS X;  4YTN B;  2L1C A;  1CQV A;  2ELB A;  2KQS A;  4P1C C;  3NVZ A;  4KSK C;  4GPT B;  1ESF A;  1OQY A;  2RNR B;  3ZDT A;  1VD2 A;  1C1Y B;  3SYX A;  1T5X D;  2BS4 B;  2NCN A;  3U2S C;  1J19 A;  3W5U B;  4M0W B;  2UZS A;  1G6J A;  3ZXV A;  1KH0 A;  2KDB A;  4G0N B;  2K25 A;  4AJY B;  1TBE A;  4RCO A;  1WJ1 A;  2KD0 A;  1T0Q C;  3DOW A;  4C4V A;  1QQG A;  1D5X C;  1SBB B;  3T8M A;  2RPV A;  2D3G A;  4EZL A;  3MHZ A;  3AE2 B;  1NU2 A;  2BCJ A;  5EFX A;  4H8S A;  3ZO5 B;  2EKE C;  2GI9 A;  4KKJ A;  3VH4 B;  2C9W B;  5DI9 B;  1M94 A;  3MC8 A;  1C4A A;  2VSZ A;  2EEL A;  2M38 A;  5CHF A;  1DYQ A;  4BVU C;  4PS8 A;  1V5P A;  4OVU A;  4A6K A;  1SJH D;  4RGN A;  2LEK A;  4F7U P;  2MHJ A;  4GDL B;  3PG7 A;  3QWZ B;  1UD7 A;  4C7Y A;  3AEG B;  4IC7 B;  1JWM D;  2LGS A;  3NUH B;  1EU4 A;  1RJ2 A;  1KJT A;  3D8E A;  3NVW A;  2G45 B;  4N59 A;  3PZ7 A;  1V86 A;  2DNF A;  3L10 B;  2N0Y A;  4BAX A;  2W2X D;  4EMO A;  2MEK A;  4JX1 C;  5EE3 A;  2KMA A;  2D07 B;  3HK0 A;  3RPF C;  2QMT A;  1V5M A;  2L7R A;  4OW0 A;  2NBU A;  2DFK A;  1ZPS A;  4JQW C;  4K2P A;  3DHH C;  3WA0 A;  4MDK E;  4IOY X;  2JXT A;  3DVG X;  2LJI A;  2Y5B B;  4WJQ A;  3A9K A;  1FPY A;  5C6R A;  2GBN A;  3VQI A;  3ZYY X;  3PV1 A;  3CIK A;  3ODO A;  5E6N A;  2WU5 B;  3NG0 A;  3V60 A;  3I3T B;  2FIF A;  3UQB A;  2M0A A;  1TZO A;  5D3Y A;  1WZ3 A;  1Z2M A;  3KW5 B;  2EC1 A;  1IYF A;  2E3T A;  2K00 A;  4BOS C;  1VCB A;  4IWQ A;  1ET9 A;  3PRM B;  3RMK C;  1Y5O A;  4B0E A;  3PS6 A;  4ZRQ A;  3WAP A;  1EGX A;  2WS3 B;  4F7Z A;  4OT1 A;  3PLU A;  4MY6 A;  4PYZ A;  4UDU C;  4NSW A;  1F52 A;  5JHA A;  2LOX A;  2CU1 A;  3MTN B;  5I2M A;  1XLO A;  1C78 A;  2PE9 A;  1PMS A;  2X38 A;  2YT0 A;  4DIX A;  1IGD A;  3QCA A;  3ZGZ A;  3PPA A;  1AQC A;  3PVU A;  1MK7 B;  1SE2 A;  5IKC M;  3N1Z C;  4LTU A;  1UZX B;  2PZ1 A;  1X86 A;  1WY8 A;  4DBG A;  1TJ6 A;  3C19 A;  3ECI A;  5KQ4 A;  1WGK A;  4URK A;  1CJE A;  4FLH A;  2C7M B;  2C7H A;  3N9Y C;  3DXC A;  5BYS A;  4MAC A;  2KC2 A;  2K8E A;  2MWS B;  2IGG A;  1XR0 B;  3CF6 E;  2H89 B;  4GIV A;  1YOV B;  1TS2 A;  2WXH A;  2N9E B;  4PK1 A;  5IRS A;  1XLP A;  4K7S A;  1U4A A;  4KIK A;  2DZI A;  3SUZ A;  2N7E A;  3BY4 B;  2QHO A;  2KFK A;  4PS3 A;  3FVC A;  1NEK B;  4TMA B;  1RM6 C;  4BBK A;  4US9 A;  2M17 A;  4A3P A;  2E2X A;  1SF0 A;  3R7R A;  1C77 A;  3ENE A;  4NAM A;  1DBH A;  1KOT A;  1TXD A;  3JYU A;  5LXH A;  2CY5 A;  2DX1 A;  2DA0 A;  5I2S A;  2ZEQ A;  4K1R B;  2PE6 B;  2Y3A A;  2JWU A;  1WGQ A;  5GMV A;  4JPS A;  3M1I B;  1C3T A;  1DDV A;  3ZKJ C;  5L95 C;  1A70 A;  4CO7 A;  3V05 A;  3R2T A;  4C0A A;  5DPR A;  4M02 A;  3WAO A;  1V88 A;  2V9H A;  3A8Q A;  3ULB A;  1WH3 A;  3BVM A;  2AL6 A;  2LGD A;  4D0N B;  2L3Z A;  3AU4 A;  4YSY B;  2ZCB A;  2O6V A;  1S3S G;  2AYO B;  4MH0 E;  2V76 A;  3OAN A;  1JWB D;  4IM2 A;  2KTR B;  2INC C;  4HAZ B;  5G5G A;  2PKO A;  2NS5 A;  4XGA B;  2CHW A;  1GOZ A;  2WXK A;  3VUX A;  2D5G A;  4HCN B;  1XKE A;  1GB4 A;  4A55 A;  1F1H A;  4G50 A;  2FNJ B;  1WG7 A;  1RYJ A;  5AZG A;  5DPS A;  3TCA A;  2KQ7 A;  2DAF A;  1ZUD 2;  1JWU D;  2BB6 A;  5AEK B;  1DOY A;  2WXN A;  3Q8A A;  1QC6 A;  2GUM A;  1MHH E;  1YJJ A;  3AEC B;  3GZN B;  3IHP C;  1BML C;  3QHT A;  2GBM A;  3HIE A;  1N6Z A;  3T3N A;  1SB3 C;  1JWS D;  1OQR A;  3AEE B;  5LG4 B;  3DBL B;  3BYY B;  1FO4 A;  3AE9 B;  1MIX A;  4DX9 0;  2C5L C;  1UWX A;  1WM3 A;  2R0D A;  5FR6 A;  2C60 A;  1MHX A;  2MFQ A;  1CK1 A;  1ET6 A;  1PGB A;  4MSQ B;  4W9C A;  4EFO A;  1WXQ A;  3DXD A;  4M8N A;  4MM3 B;  1DRO A;  1M4V A;  4QAY A;  2KDM A;  3R3M A;  2VH1 A;  1GC7 A;  2WXL A;  1ZC4 B;  4RNA A;  2W2X C;  4GOC A;  1WZ0 A;  4KZC A;  3ONS A;  1QOB A;  4MJS B;  2YS5 A;  1D5M C;  1FGZ A;  2I5F A;  3NSU A;  1ZSQ A;  3ULC A;  2AQ2 B;  2OED A;  1AN8 A;  4DX8 A;  3RNE C;  2Z0D B;  3C8Y A;  2J4X A;  2LRU A;  3FC4 A;  1J8C A;  1ZM0 A;  3QJZ A;  1XF5 L;  4HLE A;  3U4E G;  2KX3 A;  3UI3 A;  3APC A;  2BWF A;  2FCN A;  5AZH A;  4WJO A;  3TW1 A;  2JWZ A;  3AE6 B;  4KVG B;  4HCP B;  1J0G A;  3N3K B;  4LK0 M;  2LHE A;  3B77 A;  2JPH A;  4N58 A;  1LQB A;  1VDV A;  2MP2 A;  4CSQ A;  1H10 A;  4C4V B;  3U7D A;  1V6E A;  4RF0 A;  1WFY A;  2KTF A;  3JVZ X;  4XWT A;  1F2R C;  2V3P A;  4HSI A;  2COD A;  4K2O A;  5HE2 A;  4B95 A;  2KKC A;  2JQR B;  2IND C;  3HVD A;  1P1A A;  1ZP0 B;  1XD4 A;  1NYR A;  1WI0 A;  4KZ0 A;  4DHJ B;  2W2W A;  4MT7 A;  1NI2 A;  2N7D A;  3VTW A;  1C4C A;  2QIE B;  2JZ3 B;  3RNA C;  3ODX A;  1QOA A;  3JSV A;  1PFD A;  3WYF B;  4W9K A;  5LXI B;  3A9J A;  1VJK A;  4Q2J A;  4W9D A;  2W3R A;  2MBE A;  4FJZ A;  4XDC A;  2FID A;  4BOZ B;  1MK9 B;  3CMM B;  1YN3 A;  4W9H A;  2BWE S;  3AU5 A;  2IYB A;  5D3W A;  2AQ1 B;  4LNI A;  1YJI A;  1XQQ A;  3U8Z A;  2KDI A;  2BYE A;  3O13 A;  2KVZ A;  5EDS A;  3DCX A;  3CSF A;  3SNH A;  1WGY A;  3ZLZ A;  1I42 A;  2YEP F;  1E90 A;  3R2I A;  1KLV A;  3OLM D;  3VH3 B;  2YRY A;  2M8S A;  2Y8F A;  2DEN B;  5JHG A;  2KC1 A;  4JIO U;  1C9F A;  1LB1 A;  2RGF A;  3VHT C;  2V0G A;  3ZRF A;  3A9K B;  1T0S C;  1WXM A;  3NS1 A;  1TGZ B;  4ANX A;  4W9F A;  1FHO A;  3AEB B;  2KCJ A;  3B9J A;  1Q1O A;  1V1P A;  2BF8 B;  2NPT A;  4BKS A;  1WGG A;  2JRI B;  2W9N A;  3A33 B;  4IDI A;  3Q8B A;  5CLL B;  2DWQ A;  2MWN B;  3SV1 A;  3TEW A;  2L32 A;  4LDT B;  1YX6 B;  4II2 B;  4OHJ A;  5L83 A;  5JLJ B;  3NHE B;  4JWU C;  3AEF B;  3RI7 C;  1RAX A;  2EMS A;  3D8D A;  4AQ7 A;  1E5W A;  4HWI B;  2K6D B;  4HB2 B;  3CXB B;  3DXE A;  1L6U A;  5DCN A;  2LUL A;  2ROV A;  3HSA A;  2WDR B;  3VOQ A;  5FI0 A;  4REZ A;  3QAR A;  1EWC A;  3NRZ A;  3M3J A;  1E9M A;  2MLB A;  4IM0 A;  3RNG C;  5LOP B;  1FM0 D;  2JX5 A;  1GJZ A;  2KR0 A;  4DXF A;  3IBE A;  3HHM A;  1UBI A;  1F77 A;  4DK5 A;  4LJP B;  3Q3M C;  1P3R A;  1I35 A;  1MPH A;  3RNF C;  2RSU A;  2R2Y A;  2V1Y A;  3OHM B;  3OWE B;  3W9C B;  1I7H A;  3EUB 2;  2N4F A;  4PS7 A;  1I4Q A;  5FKA C;  1WRD B;  2LVQ A;  1E8X A;  2I2Y A;  1FNV A;  2XBB C;  1SHC A;  1A5R A;  1KRH A;  2D4Q A;  2V4L A;  4KIK B;  1SE4 A;  1D4B A;  3HW2 B;  3GOE A;  3KWV A;  2ZPY A;  1UWM A;  2KFK B;  2ZW1 A;  1WJ6 A;  1P7F A;  2MKR A;  5FI1 A;  3ZTC A;  2D9V A;  2RDH A;  2J53 A;  3KZ1 A;  4TUU A;  2D9Z A;  1NI3 A;  1BAK A;  1P9D U;  3ML8 A;  4F7G A;  1Z5S B;  3DPD A;  2XK5 A;  5BMH A;  1DYN A;  3VR9 B;  4WAF A;  1AWD A;  3EC8 A;  3AM9 A;  1OQN A;  4DDI D;  3VIA A;  2C7N B;  2EKI A;  1FCL A;  3F5R A;  3DHI C;  1TJE A;  2KAC A;  2D9Y A;  2OQB A;  1YMH E;  1SSN A;  2KIE A;  1VLB A;  1EVH A;  3A4R A;  1UH6 A;  2GBJ A;  1I4G A;  2MBO A;  3VTV A;  1ZOY B;  1K51 A;  2RPQ A;  3KH0 A;  4HRS A;  1ZGU B;  1KZG A;  1R4M B;  4MEL A;  1TKY A;  5D94 A;  1GUA B;  5C1Z A;  3I63 C;  2O6V B;  4BFR A;  2Y8G A;  2G4S A;  1B55 A;  1AAR A;  1ZKH A;  2D11 A;  4E74 A;  5C3J B;  3LB8 C;  4MSM B;  3QK0 A;  2IJ0 A;  1AYF A;  1YN5 A;  4K7W A;  3I57 A;  2K8B A;  2DHZ A;  2ZNV C;  3VRB B;  2KK8 A;  1K52 A;  1MI1 A;  3Q3J A;  4M00 A;  3T3O A;  3ZRC A;  3URY A;  1HXY D;  2INN E;  5J3Y A;  2KJ6 A;  2UVM A;  2Y5P A;  3U7Z A;  1CZP A;  2P0D A;  4ANV A;  1WWT A;  2OOB B;  1YJ1 A;  3S2A A;  1WMH A;  3ZVR A;  2CAY A;  4RM8 A;  3AE7 B;  3ZW3 A;  1SE9 A;  1YQ3 B;  1MKE A;  1SGH A;  4X57 B;  2MRP A;  4ZHP A;  4LCD E;  1AW7 A;  1N5W A;  4WJN A;  1WE7 A;  2ZVN A;  3DDC B;  1KFY B;  3LJ3 A;  3GS2 A;  3X23 A;  4FHK A;  1HTQ A;  3JW0 X;  3FIL A;  4L6E A;  1TYG B;  1WX8 A;  1TS4 A;  1C4P A;  2BVC A;  5GOW B;  1U5E A;  2P0F A;  2LGX A;  2DBY A;  5T8I A;  2LXA A;  1SE3 A;  2VH2 A;  2WQY B;  5JXV A;  2NBV A;  1YNT E;  1NDD A;  3GE8 C;  4ARC A;  4A6H A;  1WXA A;  4WWN A;  1FAO A;  1P5T A;  3P4P B;  2GLS A;  1I4P A;  1FCC C;  3H9D A;  1ACC A;  3DVN U;  3VXW A;  3L17 A;  1RRP B;  3NWA A;  4OVZ A;  2YEP B;  4PYU A;  3V62 A;  2MP2 B;  4BZA A;  4A6F A;  3Q8C A;  2MBQ A;  2LGI A;  4YT0 B;  1FNU A;  5J2R A;  1E8Z A;  1HQR D;  1XCT L;  1MG4 A;  4OZA A;  4YXD B;  1V61 A;  5TSS A;  3VTU A;  4IAP A;  2DYM A;  1GG3 A;  3ZNH B;  3GZN I;  4YSZ B;  3AXC A;  1C79 A;  1WSP A;  2GRI A;  5D2M B;  1QOF A;  3Q6B A;  3SEB A;  2WNM A;  2DKQ A;  4IFS A;  3FM8 C;  1UNQ A;  1V9J A;  3DBL I;  4NPN A;  3JSV B;  2LKO A;  2FJL A;  1XD3 B;  3Q8E A;  2KX0 A;  3A9J B;  3KRW A;  1XEE A;  3TO1 A;  3ZVV A;  1J7C A;  1DDW A;  5JP4 A;  2V3S A;  2NZ8 B;  3TL5 A;  1V5T A;  3P63 A;  1H4R A;  5KCV A;  4DHJ D;  2LUM A;  1K53 A;  3IG3 A;  2CHZ A;  2AX5 A;  2BB5 A;  3P7Z A;  2I1J A;  4F7H A;  1S1Q B;  2IO0 B;  2PW9 A;  2OTX A;  1FRD A;  1P6S A;  4W9E A;  4ICU A;  3DQV A;  1T0R C;  5EE9 A;  4IKG A;  2J59 M;  2KHW B;  3IFW B;  2KGX B;  2Z0P A;  1FNW A;  4K3C A;  2PIA A;  4NAW A;  1U27 A;  1TS5 A;  2TSS A;  3EFU A;  3LDZ E;  4HJG E;  4NY0 A;  4HAU B;  3BIN A;  4B6W A;  2N9K A;  4YWG G;  2BKR B;  1XO3 A;  1P0R A;  4TQ0 A;  2J0J A;  1Q0W B;  4A3O A;  3AH7 A;  1MVK A;  4KX6 B;  1UEL A;  5H8Y E;  1V1P B;  2IBI B;  4FA6 A;  4HDO A;  2NPT B;  4EUT A;  5CHV C;  2L1A A;  4MH8 A;  3AE4 B;  4EKU A;  1F2R I;  4A8X C;  4L1B A;  4O1N A;  3PT2 B;  2B76 B;  1NBF C;  3L16 A;  3W1S A;  2DHJ A;  2WXM A;  5G2N A;  2BBC A;  2WXJ A;  2HJ8 A;  4IWP A;  3TUO A;  4G11 A;  2G4D B;  3J9C A;  2M14 A;  4IUM B;  1QIL A;  1I4H A;  3OJ4 B;  3SO6 A;  3N20 C;  2G35 A;  1N5X A;  2O2V A;  1ZC3 B;  4LDT D;  5D27 A;  2IZV B;  4IG7 B;  2AL3 A;  3P4S B;  4YSX B;  2R2O A;  3B0A A;  3ZJT A;  1JCK B;  4HAY B;  4CHJ A;  4ASW C;  1PLS A;  2J0K A;  2KAN A;  5IN7 A;  5BMG A;  2IY0 B;  2JZP A;  4S0R A;  1QZE A;  2ZJD A;  3BJI A;  5L81 A;  5CTR C;  2KVR A;  3O65 B;  5E6P A;  2BGF A;  2QSD A;  4XE0 A;  4A9A A;  1I2H A;  4ANU A;  4GNK B;  4I6L B;  3DBH B;  1FOE A;  4GB9 A;  4GMV A;  2MBB B;  2GJY A;  4IOI E;  2GBR A;  1KLG D;  2D9X A;  1DDM A;  3P6A A;  4HPP A;  2GBK A;  2KMC A;  2VZK B;  2XK5 B;  3Q69 A;  2MJD A;  4PNK A;  1KM7 A;  2WX0 A;  3NY5 A;  5HI1 A;  5HFY A;  5J17 A;  1UNP A;  4IM3 A;  1ZE3 D;  4USA A;  4A20 A;  2DLW A;  3V61 A;  3R66 C;  2YVC A;  4TYZ A;  4CHM A;  2KN4 A;  2RUK B;  4BKG A;  4GLS C;  2YT1 A;  3KRX A;  4L1R A;  2MDX A;  5JH5 C;  4C00 A;  3V3X A;  2I5C A;  2M19 A;  2QKM A;  4MGI E;  1WR6 E;  1OTR B;  1HEZ E;  2LRW A;  5HG2 A;  3ZDM C;  2BT6 A;  2L0F A;  3I5J C;  3DBS A;  4IWO A;  1V5U A;  2QIL A;  3RD2 A;  3RFZ B;  2DZK A;  4YTM B;  1DOI A;  1M7R A;  1H8C A;  1IGC A;  2XQN M;  2AEH A;  2PPH A;  1MJD A;  5DHA B;  1UGJ A;  4D6W A;  2LXC A;  3N30 A;  4XYC A;  5IO9 A;  3H7P A;  4HJK A;  2ZW0 A;  1B1Z A;  3ALB A;  2P8V A;  3WAN A;  2K6Q A;  2NMB A;  1E7V A;  4EJN A;  3ML4 A;  4WH4 A;  3VFK A;  4S17 A;  3B2F A;  4KSL C;  4WQO B;  2NBW B;  2IFS A;  5C2T B;  2LZ6 A;  3ABV B;  2HD5 B;  4KAX B;  1C76 A;  1RFA A;  2LI5 A;  2DHI A;  1WMH B;  5D3V A;  3HUI A;  4ZYS A;  2N1W A;  5BO4 B;  3MJW A;  3Q14 C;  3A98 B;  1PQS A;  1SIJ A;  2ZCC A;  5JZE B;  3QC8 B;  1QT9 A;  4J3O D;  2WXQ A;  5D7G A;  3HIZ A;  1GC6 A;  2KIG A;  2JVC A;  3FIL B;  3H8H A;  2B3A A;  3VUW A;  2LUE A;  1XCG A;  1V1O A;  3PRE A;  5C79 A;  3SU8 X;  4GMX B;  4ZHO A;  2KT7 A;  1W1D A;  1GPX A;  3N1Y C;  1IUE A;  2JY6 A;  1WJ4 A;  1BTN A;  1R4M I;  2IPK D;  4W9L A;  1EWY C;  2NBV B;  3PRP B;  4FXC A;  1JML A;  1U5F A;  3KQ4 A;  5G55 A;  1E8W A;  3TEZ A;  2H7E A;  1V81 A;  1WGU A;  2K22 A;  3L0W B;  3O96 A;  2R09 A;  3TJP A;  5I4D A;  3ZIM A;  4N9F 4;  2KN5 A;  2CJN A;  3P4Q B;  4EZK A;  1STE A;  5HE0 A;  3MFG A;  3A8P A;  1HZ6 A;  4B9K A;  4M01 A;  3GYO A;  3N1X C;  2KWU B;  2N9X A;  4A6F B;  3ZQ4 A;  2J42 A;  1BTK A;  2QC8 A;  3RCP A;  5MPO A;  1OEY J;  1XXG A;  2QKL A;  1WX9 A;  2PVO D;  4GSW A;  3QBV B;  2LFI A;  3IAM 1;  4DHZ E;  3OG5 A;  4GN1 A;  4PT5 A;  1FMA D;  1PFJ A;  2J7Q B;  3PP2 A;  2MX2 A;  1E7P B;  1SIF A;  3FSS A;  4EE2 A;  2Z4D A;  3BYT B;  5D3X A;  5KHO A;  4A5K A;  1YQ4 B;  3NJT A;  2CR5 A;  2KLC A;  4HAV B;  3H6N A;  2I1K A;  3SD5 A;  5C23 A;  5BMI A;  1L0X B;  5AZF A;  1TKE A;  3RNC C;  2RDB C;  2M1M A;  1YN4 A;  3NZU A;  3GE3 C;  3UGB B;  1KF6 B;  2XNA C;  2GB1 A;  1HTO A;  1WM2 A;  1QOG A;  3NZ3 A;  1U29 A;  2ZPN A;  3E9S A;  1Y8R C;  2WHI A;  1TY2 A;  5BYQ A;  3ZNG C;  3TFM A;  1L6V A;  1BWN A;  4NAW B;  2KDE B;  4OZC A;  2L8J A;  1FFV A;  3U12 A;  2IGH A;  5KHQ A;  4HKZ E;  3L4P A;  5LON B;  4D2K A;  4HRO A;  4AS1 A;  3PRZ A;  1J7B A;  1HZ5 A;  4RMA A;  3EHV A;  2RSG A;  2YS3 A;  5EE0 A;  4BBN F;  1WJN A;  3W2D A;  4ZOH C;  2MCN B;  1K5D B;  3EFC A;  1Y56 A;  3IAS 1;  1MG8 A;  3KYC D;  2DN6 A;  3WIM A;  4HAW B;  1PYW D;  2REX A;  2NTS A;  1E10 A;  1X1G A;  1V89 A;  4DHZ B;  1PDX A;  2DHK A;  5C5B A;  1UPR A;  1PGA A;  1VZ6 A;  4HB3 B;  1Y19 B;  3W1S C;  4MGK E;  2NR2 A;  2IO1 B;  4WAA A;  5C16 A;  4BKS D;  3TMP B;  3DBR B;  1MI0 A;  3CIR B;  2E6X A;  2JF5 A;  2KZR A;  5IA7 A;  3VR8 B;  2FCS A;  3SDL C;  4RGO S;  1RWS A;  2LMC A;  2DAJ A;  4HDQ A;  3PEG A;  2BS2 B;  5CLQ B;  3TVV A;  1JWA D;  2AQ3 B;  2A5U A;  2KFJ A;  3BII D;  5J3T A;  2WDQ B;  1AWE A;  1N60 A;  1QLB B;  2GCL A;  3BVZ A;  1UGM A;  3NVV A;  2YSZ A;  3WCQ A;  1W1G A;  1BUI C;  4FJY A;  2K1F A;  2MSE D;  4NQK E;  2PJH A;  4XWW A;  2HTM E;  4ZRP A;  1WRI A;  3NZS A;  3B2G A;  1YIW A;  1UEF A;  3RYT A;  4L23 A;  3T06 A;  4MK0 A;  2N23 A;  4KV2 A;  4FAD A;  1EF1 A;  1BT0 A;  3BK2 A;  2K5P A;  1WE6 A;  3P42 A;  4KDI C;  4LNK A;  4WWO A;  2LYD A;  4KHB A;  4K17 A;  4E71 A;  5LLI A;  3LYY A;  1VR9 A;  1VZ8 A;  2ONQ A;  1FHW A;  3APD A;  2DX5 A;  4XC2 A;  5JHH A;  1WGR A;  1N62 A;  4ZRI A;  4YON A;  1UBQ A;  1LFD A;  4HXD A;  2NTT A;  1UF0 A;  1XLQ A;  2KLG A;  2KXJ A;  1IBX A;  5E6O A;  2N1V A;  3TSS A;  3RT3 B;  2Z0Q A;  2HTH A;  3AB5 A;  4NJ7 A;  3QX1 A;  3VRA B;  4RF1 A;  2Z14 A;  4FN2 A;  4I6N B;  2JYE A;  1FIQ A;  2FUG 1;  4HK2 A;  1Z87 A;  2WDV B;  1IPG A;  4G3X B;  4NQL B;  2MJ3 A;  1OQQ A;  2VZK D;  2G9H D;  3NOB A;  4RGT A;  5DH9 B;  3AJ4 A;  2BW2 A;  3ETR A;  1Q10 A;  4W9I A;  3GB1 A;  3RNB C;  1K5G B;  1PUT A;  2ZVO A;  3NWF A;  3APF A;  3AV8 A;  3FAH A;  2RRF A;  1I4X A;  1I7A A;  1L2N A;  1LO5 D;  2AWT A;  2KO3 A;  4OZB A;  1R4N B;  4AWJ A;  2R2Q A;  2BYV E;  2CU3 A;  1OY2 A;  3L54 A;  2K3U A;  1MAI A;  2K9X A;  2MBH A;  3BWU D;  3LJU X;  2FE8 A;  3GP7 A;  3R8B A;  3ODW A;  3H7P B;  4RH6 A;  4AP4 C;  1NVI D;  1IP9 A;  2WXO A;  2MQJ A;  4J6I A;  4QXA B;  1X1F A;  2UYZ B;  2DTC A;  1FB8 A;  5AUK A;  1FD6 A;  3N32 A;  1MPE A;  2BS3 B;  2IYD B;  2V4I B;  2ASQ A;  3DBH I;  1JRU A;  2DYB A;  4LNN A;  5BYR A;  4ANW A;  2DYO A;  5LNK 1;  2VRW B;  2QJL A;  3SFE B;  2RLO A;  5DPT A;  3DWG C;  2RGN B;  1WXS A;  2CKH B;  1LXD A;  1UPQ A;  2YLM A;  3PHX B;  4GDK A;  3ZJU A;  2VRR B;  1ZXH A;  2CRF A;  2K2U A;  4OSN A;  1CMX B;  2V3N A;  2WWZ A;  3LXF A;  4I6P A;  2FCQ A;  4WVF B;  1WF9 A;  2P0H A;  4EEW A;  4ZRK A;  2BYT A;  2LVO A;  4KHO A;  3UIP B;  1V5O A;  4GXB A;  4MGY E;  1L7Y A;  1M7E A;  4WWP A;  1KI1 B;  3M63 B;  2Z59 A;  1WR1 A;  1GAQ B;  3D8F A;  5HHD G;  2RMM A;  2Y5C A;  4TSS A;  3RUL A;  4BKT A;  4FJV B;  2D3C A;  4H2A A;  3B1L X;  4DQO C;  4QJ4 B;  3AE5 B;  2COC A;  1E6E B;  3QA8 A;  4FBJ B;  1X05 A;  2X18 A;  2WLB A;  2G1E A;  3HRD D;  4OVV A;  2FCM A;  1WJM A;  1LGR A;  2BQQ A;  2FBW B;  1FHX A;  4E3C A;  4KHA A;  1WXV A;  3MC0 B;  4HVB A;  3A1Q A;  4AUQ C;  1TZ1 A;  1KLU D;  1V97 A;  3KVF B;  2HDE A;  4KGS A;  3VAW A;  3KUD B;  4WQM A;  3Q3N C;  1K50 A;  1WI1 A;  2K49 A;  2KJH B;  2ICI A;  3HM6 X;  4FHJ A;  1YQB A;  2FUH B;  4MEM A;  3WAM A;  3EGR A;  4Z2N A;  2MA9 B;  3NWD A;  1FEH A;  2KQ4 X;  1I4R A;  2N0S B;  2CS4 A;  4XWX A;  2JUO A;  4BBN C;  2PVG C;  1B9R A;  4YTP B;  2LGY A;  3BVG A;  4Y94 A;  1WJU A;  4GU2 A;  2JYT A;  3AEA B;  3MC9 A;  2BTE A;  2H7D A;  3MJ5 A;  4II3 B;  3UZT A;  3AED B;  4HPL B;  2WXR A;  4C7Z A;  1K8R B;  4WIP A;  3X0W A;  3U30 A;  3N7C A;  3W5V B;  3CST A;  3HM3 A;  4KDL B;  3ZNZ B;  1L4D B;  1IRS A;  2COA A;  1RLF A;  3IT6 B;  4CQN A;  1XCQ L;  4P16 A;  1X1M A;  2MW5 A;  1TS3 A;  2DZJ A;  4B6H A;  3UF8 A;  5EE1 A;  2UZR A;  3AE1 B;  5M4Y B;  3Q2A C;  3P4R B;  3EA6 A;  3AMZ A;  4C56 C;  3KYD D;  2IY1 B;  2DLB A;  4HAX B;  3NVY A;  2D3B A;  2Z13 A;  1ZVR A;  2HE7 A;  1XT9 B;  1L5P A;  2KUP A;  1E0Z A;  3UIO B;  3M95 A;  4TV3 A;  1VRA B;  3DVN V;  1V80 A;  2ZKM X;  3PZD A;  2J0M A;  3L08 A;  1GNU A;  3PHW B;  2L76 A;  1JW9 D;  2BKF A;  1TQZ A;  1DGJ A;  4AJW A;  5C5B B;  3OAW A;  3AE8 B;  1T77 A;  3PGE A;  2RDG A;  1PGX A;  4NJC A;  3ZXR A;  5AUI A;  2N9L A;  4HHV A;  1X11 A;  2KYW A;  4AOF A;  3V6E B;  3K9O B;  3W1Y A;  1VZ7 A;  2NVU I;  2KJR A;  5HE3 A;  1FXT B;  2WXP A;  4NZL B;  3L13 A;  2PTL A;  1OFF A;  4C80 A;  1RFK A;  2X8X X;  1TKG A;  3I9V 1;  2L05 A;  4WWM A;  1WX7 A;  3BK1 A;  4WSF A;  3RZF A;  4P7I A;  4P1B C;  2IO3 B;  4M0W A;  3TEY A;  1ZDV A;  4KGR A;  1MIZ B;  3QIJ A;  1EF5 A;  3F0W A;  3ZTD A;  2LWP A;  2SAK A;  1UNS A;  2RR9 A;  4QJ3 B;  2IDY A;  2Z0E B;  2KDF B;  2Q13 A;  5FR3 A;  4KKI A;  3R7Q A;  4NNJ B;  2BYF A;  2K8C A;  4L2Y A;  3SFD B;  1D6E C;  1EO6 A;  3P2B A;  4ZYN A;  3ZNI D;  2UWQ A;  3IT4 B;  1U5G A;  4M8M A;  4KHB B;  2Z8L A;  3RCZ A;  2LJ5 A;  3C0R B;  5HKH A;  3AN1 A;  1L4Z B;  4MGZ E;  3IXS A;  2DKP A;  2DX5 B;  3HVZ A;  2IO2 B;  2JU6 X;  2D3A A;  3V5W A;  2O6V D;  4HPM B;  1L0V B;  2W55 A;  4GGQ A;  3RN9 C;  3T9L A;  4ZDV A;  4JE3 B;  4DXG A;  4ARI A;  3TIX A;  3V6C B;  4DDG D;  5H92 C;  1IBX B;  4GDL A;  4RGM A;  1T3Q A;  4A6Q A;  2HTH B;  3FEH A;  3CWI A;  3G9W A;  3NW8 A;  3KSY A;  2I38 A;  1N61 A;  5G5H A;  2KUQ A;  5J3Q A;  3HQC A;  1T6B X;  2DYQ A;  2H88 B;  2ADZ A;  2PMV A;  4WJ7 A;  1RRB A;  1FFU A;  2DZM A;  5KQ1 A;  1KTK A;  3PTF C;  2WP9 B;  1TY0 A;  3DBR I;  3PO0 A;  4W9J A;  2K39 A;  2GOW A;  2QDF A;  4XX5 A;  3A4S C;  2ELA A;  4TKN A;  2YT2 A;  1EAZ A;  1MFW A;  4ACF A;  2W3S A;  1UNR A;  1SXT A;  2XN9 C;  1OMW A;  1SEB D;  3TEX A;  4JL9 A;  2A4Z A;  3OJ3 A;  5DPW A;  3P1M A;  2K2J A;  2LHD A;  1YD8 U;  2NMQ A;  2EJ8 A;  2VKI A;  3QAQ A;  2D10 A;  3E56 A;  3RZW C;  2UU7 A;  2CHX A;  3DHG C;  2IGD A;  1ISN A;  1P98 A;  2R61 A;  2WXI A;  4ZRJ A;  2LOZ A;  2GCJ A;  4W9G A;  3VUY A;  1NTV A;  2JXX A;  3Q3O C;  4A90 A;  2L83 A;  4K81 A;  5DIF B;  1NEN B;  2JSV X;  1OGW A;  1XX0 A;  4PQ0 A;  3Q8F A;  2JRH A;  4HKQ A;  5E6J A;  3UQA A;  2ROZ B;  3KY9 A;  2L52 A;  3KWL A;  3AI5 A;  1F9J A;  2L2I A;  1E8Y A;  4RM9 A;  3KUZ A;  3PLV A;  3Q3F A;  3U52 E;  5GXG B;  4EZJ A;  1Q5W B;  1N63 A;  2LAS A;  3DCG A;  2KMM A;  1V2Y A;  3ZUN A;  2WDT B;  1YX5 B;  4ITK A;  4US8 A;  1ROE A;  3VDZ A;  3SHQ A;  4GDK B;  4F1S A;  1F0Z A;  2QEJ C;  1JAL A;  3PZ8 A;  1WYG A;  2DYN A;  2WGS A;  2WXG A;  2KWC A;  1JRO A;  3DVG Y;  2LG1 A;  2YS1 A;  1N3H A;  4XZ4 A;  2COF A;  2KNB A;  1HA5 A;  3K9P B;  1J0W A;  1XOD A;  2PEA A;  2ZZP B;  1WGD A;  2Z59 B;  3PVL A;  1T0Y A;  5J18 A;  2D9W A;  1WYW B;  1QF6 A;  2M4N A;  3GYP A;  4MT5 A;  4QJ5 B;  2MH7 A;  2L0T A;  2RVB B;  4GOU A;  2JT4 B;  4R3D A;  2WX1 A;  5D3I B;  2W54 A;  1D3Z A;  2GS0 A;  2XEW A;  5IP4 D;  1EM7 A;  4YL8 A;  2Y7B A;  5HE1 A;  2CY4 A;  3VVW B;  1R4N I;  4P6V F;  2BPS A;  5CHW A;  1QKZ A;  4HB4 B;  4FUL A;  5D6J B;  2MJE A;  3A1Q B;  1Q67 A;  4ICV A;  4EOY A;  5TR5 A;  3IVF A;  3SR6 A;  2INP E;  2ON8 A;  3PSC A;  1ZW7 A;  4CYE A;  1FRR A;  3B08 A;  1LM8 B;  2L00 B;  3BZD B;  1LW3 A;  1HE8 A;  1V8C A;  2GMI C;  4RFB A;  3ML9 A;  3WAL A;  3A58 A;  2LVP A;  3NS8 A;  1FXA A;  3FKY A;  4HB0 B;  2FAZ A;  2KAJ A;  2WXF A;  2KOX A;  1L0Y B;  4HAT B;  4HEA 1;  2YF0 A;  1FGY A;  1ZYI A;  3KUC B;  3MPX A;  5DHF B;  4LNF A;  2M0X A;  5FK9 C;  2J52 A;  3PVW A;  1ENF A;  2KTR A;  4IW0 A;  3QWM A;  1P3Q U;  5IOI A;  1P7E A;  1ZXI A;  2QCZ A;  2ACZ B;  1U5D A;  4K3B A;  4JWS C;  3M62 B;  2WYQ A;  3MP9 A;  1WIA A;  2O2V B;  1TT5 B;  2JZZ A;  4DWF A;  3MDB C;  3EEC A;  4LNO A;  4LLG M;  1TTN A;  1D5Z C;  1BXT A;  4GZU A;  4TQ1 A;  3ZJV A;  4NJ6 A;  2W82 A;  2PLP A;  1XLN A;  4CHK A;  1EUV B;  1U2B A;  3AUL A;  3UIN B;  4WUR A;  1JQ4 A;  4DXA B;  4DBB A;  4LJO B;  2RD0 A;  2N7J A;  2KWD A;  3AE3 B;  2HJ1 A;  2LD9 A;  1SJE D;  1V49 A;  1TIF A;  2D2Q A;  3TBL D;  2SEB D;  1NYQ A;  2WU2 B;  4N6E B;  5CX3 A;  3H7S A;  1QQR A;  2K8H A;  4KGT A;  1WGH A;  3RUI B;  2M56 B;  4JGH B;  2N9P C;  4JLC A;  1NTY A;  1UUP A;  1EU3 A;  2Z0O A;  1GB1 A;  2OJR A;  2OHF A;  1R7S A;  4XDD A;  4F8C B;  4MM3 A;  5JHB A;  3DWM A;  3H1U A;  2FJU B;  2CJO A;  4B0M A;  1W1H A;  1FXI A;  2KWV B;  1E7U A;  2JP2 A;  2G3Q B;  2OJW A;  2Q5W D;  4Z2M B;  1WVH A;  1OEY A;  3PSE B;  2EMT A;  1DOX A;  1ZDX A;  2K0P A;  3QQ8 B;  4WJP A;  3D32 A;  3MHS D;  1JRP A;  4K7U A;  4MJS A;  5D3D A; 
#chains in the Genus database with same CATH homology
 2ZNV B;  1KZ7 A;  5IAA C;  2L1C A;  2ELB A;  2KQS A;  4KSK C;  4GPT B;  1OQY A;  2RNR B;  3ZDT A;  1VD2 A;  1C1Y B;  3SYX A;  2NCN A;  1J19 A;  4M0W B;  2UZS A;  1G6J A;  2KDB A;  4G0N B;  2K25 A;  4AJY B;  1TBE A;  1WJ1 A;  2KD0 A;  3DOW A;  1QQG A;  3T8M A;  2D3G A;  4EZL A;  1NU2 A;  2BCJ A;  5EFX A;  4H8S A;  3ZO5 B;  2EKE C;  3VH4 B;  2C9W B;  5DI9 B;  1M94 A;  2VSZ A;  2M38 A;  5CHF A;  4BVU C;  4PS8 A;  1V5P A;  4OVU A;  4A6K A;  4F7U P;  4GDL B;  3PG7 A;  3QWZ B;  1UD7 A;  4IC7 B;  1RJ2 A;  1KJT A;  3D8E A;  2G45 B;  1V86 A;  3L10 B;  2N0Y A;  2W2X D;  4EMO A;  2KMA A;  2D07 B;  3HK0 A;  1V5M A;  2L7R A;  2NBU A;  2DFK A;  4JQW C;  4K2P A;  3WA0 A;  4MDK E;  4IOY X;  3DVG X;  2Y5B B;  4WJQ A;  3A9K A;  5C6R A;  2GBN A;  3VQI A;  3PV1 A;  3ODO A;  3CIK A;  5E6N A;  3V60 A;  3I3T B;  2FIF A;  3UQB A;  5D3Y A;  1WZ3 A;  1Z2M A;  3KW5 B;  2EC1 A;  1IYF A;  2K00 A;  4BOS C;  1VCB A;  4IWQ A;  3PRM B;  1Y5O A;  3PS6 A;  3WAP A;  1EGX A;  4F7Z A;  3PLU A;  4MY6 A;  4PYZ A;  4NSW A;  5JHA A;  2LOX A;  2CU1 A;  3MTN B;  2PE9 A;  1PMS A;  2YT0 A;  3QCA A;  3PPA A;  1AQC A;  3PVU A;  1MK7 B;  1UZX B;  2PZ1 A;  1X86 A;  1WY8 A;  4DBG A;  1TJ6 A;  3ECI A;  5KQ4 A;  4URK A;  4FLH A;  2C7M B;  2C7H A;  3DXC A;  2KC2 A;  2MWS B;  1XR0 B;  3CF6 E;  4GIV A;  2N9E B;  4K7S A;  1U4A A;  4KIK A;  2DZI A;  3SUZ A;  2N7E A;  3BY4 B;  2QHO A;  2KFK A;  4PS3 A;  4BBK A;  2M17 A;  4A3P A;  2E2X A;  3R7R A;  3ENE A;  1DBH A;  1KOT A;  1TXD A;  3JYU A;  5LXH A;  2CY5 A;  2DX1 A;  2DA0 A;  2ZEQ A;  4K1R B;  2PE6 B;  1WGQ A;  5GMV A;  3M1I B;  1C3T A;  1DDV A;  3ZKJ C;  5L95 C;  4CO7 A;  4C0A A;  5DPR A;  3WAO A;  1V88 A;  3A8Q A;  3ULB A;  1WH3 A;  2AL6 A;  2LGD A;  4D0N B;  2L3Z A;  3AU4 A;  2ZCB A;  2O6V A;  1S3S G;  2AYO B;  4MH0 E;  2V76 A;  3OAN A;  4IM2 A;  2KTR B;  4HAZ B;  2NS5 A;  2CHW A;  3VUX A;  4HCN B;  1XKE A;  4G50 A;  2FNJ B;  1WG7 A;  5AZG A;  5DPS A;  3TCA A;  2KQ7 A;  2DAF A;  5AEK B;  1QC6 A;  3IHP C;  3QHT A;  2GBM A;  1MIX A;  4DX9 0;  2C5L C;  1WM3 A;  5FR6 A;  2R0D A;  2C60 A;  2MFQ A;  4MSQ B;  4W9C A;  4EFO A;  3DXD A;  4M8N A;  1DRO A;  3R3M A;  1GC7 A;  1ZC4 B;  2W2X C;  4GOC A;  1WZ0 A;  4KZC A;  3ONS A;  4MJS B;  2YS5 A;  3NSU A;  1FGZ A;  2I5F A;  1ZSQ A;  3ULC A;  4DX8 A;  2Z0D B;  2LRU A;  1J8C A;  1ZM0 A;  3QJZ A;  4HLE A;  2KX3 A;  3APC A;  2BWF A;  2FCN A;  5AZH A;  4WJO A;  3TW1 A;  2JWZ A;  4KVG B;  4HCP B;  1J0G A;  3N3K B;  2JPH A;  1LQB A;  2MP2 A;  1H10 A;  3U7D A;  1V6E A;  1WFY A;  2KTF A;  3JVZ X;  2COD A;  4K2O A;  5HE2 A;  4B95 A;  2KKC A;  1P1A A;  1XD4 A;  4KZ0 A;  1WI0 A;  4DHJ B;  2W2W A;  4MT7 A;  1NI2 A;  2N7D A;  3VTW A;  2JZ3 B;  3ODX A;  3JSV A;  3WYF B;  4W9K A;  5LXI B;  3A9J A;  4W9D A;  2MBE A;  4FJZ A;  2FID A;  4BOZ B;  1MK9 B;  3CMM B;  4W9H A;  2BWE S;  3AU5 A;  2IYB A;  5D3W A;  1XQQ A;  3U8Z A;  2KDI A;  2BYE A;  5EDS A;  3CSF A;  3SNH A;  1WGY A;  3ZLZ A;  1I42 A;  1E90 A;  1KLV A;  3OLM D;  3VH3 B;  2YRY A;  2M8S A;  2Y8F A;  2DEN B;  5JHG A;  2KC1 A;  4JIO U;  1LB1 A;  2RGF A;  3VHT C;  3ZRF A;  3A9K B;  1WXM A;  1TGZ B;  4ANX A;  4W9F A;  1FHO A;  2KCJ A;  1Q1O A;  2BF8 B;  2NPT A;  4BKS A;  1WGG A;  2JRI B;  2W9N A;  3A33 B;  5CLL B;  2MWN B;  3SV1 A;  4LDT B;  1YX6 B;  4II2 B;  5L83 A;  5JLJ B;  3NHE B;  1RAX A;  2EMS A;  3D8D A;  1E5W A;  4HWI B;  2K6D B;  4HB2 B;  3CXB B;  3DXE A;  5DCN A;  2LUL A;  2ROV A;  3VOQ A;  5FI0 A;  3QAR A;  3M3J A;  2MLB A;  4IM0 A;  5LOP B;  1GJZ A;  3IBE A;  3HHM A;  1UBI A;  4DK5 A;  4LJP B;  1P3R A;  1I35 A;  1MPH A;  2RSU A;  2V1Y A;  2N4F A;  4PS7 A;  1WRD B;  2LVQ A;  1E8X A;  2XBB C;  1SHC A;  1A5R A;  2D4Q A;  2V4L A;  4KIK B;  3HW2 B;  3GOE A;  2ZPY A;  2KFK B;  1WJ6 A;  2MKR A;  5FI1 A;  3ZTC A;  2D9V A;  3KZ1 A;  4TUU A;  2D9Z A;  1BAK A;  1P9D U;  3ML8 A;  4F7G A;  1Z5S B;  3DPD A;  2XK5 A;  1DYN A;  3EC8 A;  1OQN A;  4DDI D;  3VIA A;  2C7N B;  3F5R A;  2D9Y A;  2OQB A;  1EVH A;  3A4R A;  1UH6 A;  2GBJ A;  2MBO A;  3VTV A;  2RPQ A;  3KH0 A;  1ZGU B;  1KZG A;  4MEL A;  5D94 A;  1GUA B;  5C1Z A;  2O6V B;  4BFR A;  2Y8G A;  2G4S A;  1B55 A;  1AAR A;  1ZKH A;  2D11 A;  4E74 A;  4MSM B;  3QK0 A;  4K7W A;  2K8B A;  2DHZ A;  2ZNV C;  2KK8 A;  3Q3J A;  3ZRC A;  5J3Y A;  2KJ6 A;  2UVM A;  2P0D A;  4ANV A;  2OOB B;  1YJ1 A;  3S2A A;  1WMH A;  3ZVR A;  2CAY A;  4RM8 A;  3ZW3 A;  1SE9 A;  1MKE A;  1SGH A;  4X57 B;  2MRP A;  4LCD E;  4WJN A;  1WE7 A;  2ZVN A;  3DDC B;  3LJ3 A;  3X23 A;  4FHK A;  3JW0 X;  4L6E A;  1WX8 A;  5GOW B;  1U5E A;  2P0F A;  2LGX A;  2LXA A;  1NDD A;  4A6H A;  1WXA A;  4WWN A;  1FAO A;  1P5T A;  3H9D A;  3DVN U;  3VXW A;  3L17 A;  1RRP B;  4PYU A;  3V62 A;  2MP2 B;  4A6F A;  2MBQ A;  5J2R A;  1E8Z A;  1V61 A;  3VTU A;  4IAP A;  2DYM A;  1GG3 A;  3ZNH B;  3GZN I;  3AXC A;  5D2M B;  2DKQ A;  4IFS A;  3FM8 C;  1UNQ A;  1V9J A;  3DBL I;  4NPN A;  3JSV B;  2LKO A;  2FJL A;  1XD3 B;  2KX0 A;  3A9J B;  3KRW A;  3TO1 A;  3ZVV A;  1DDW A;  5JP4 A;  2V3S A;  2NZ8 B;  3TL5 A;  1V5T A;  1H4R A;  5KCV A;  4DHJ D;  3IG3 A;  2CHZ A;  3P7Z A;  2I1J A;  4F7H A;  1S1Q B;  2IO0 B;  2OTX A;  4W9E A;  1P6S A;  4ICU A;  3DQV A;  2J59 M;  2KHW B;  3IFW B;  2KGX B;  2Z0P A;  4NAW A;  1U27 A;  3EFU A;  3LDZ E;  4NY0 A;  4HAU B;  3BIN A;  4B6W A;  2BKR B;  1P0R A;  4TQ0 A;  2J0J A;  1Q0W B;  4A3O A;  1UEL A;  2IBI B;  4FA6 A;  4HDO A;  2NPT B;  4EUT A;  5CHV C;  4EKU A;  3PT2 B;  1NBF C;  3L16 A;  3W1S A;  2DHJ A;  5G2N A;  2HJ8 A;  4IWP A;  4G11 A;  2G4D B;  2M14 A;  4IUM B;  3OJ4 B;  3SO6 A;  2G35 A;  2O2V A;  1ZC3 B;  4LDT D;  5D27 A;  2IZV B;  4IG7 B;  2AL3 A;  2R2O A;  3B0A A;  4HAY B;  4CHJ A;  4ASW C;  1PLS A;  2J0K A;  2KAN A;  2IY0 B;  1QZE A;  2ZJD A;  3BJI A;  5L81 A;  5CTR C;  2KVR A;  3O65 B;  5E6P A;  2BGF A;  1I2H A;  4ANU A;  4I6L B;  1FOE A;  4GB9 A;  4GMV A;  2MBB B;  2GJY A;  2GBR A;  2D9X A;  1DDM A;  3P6A A;  2GBK A;  2KMC A;  2XK5 B;  4PNK A;  1KM7 A;  2WX0 A;  3NY5 A;  5J17 A;  1UNP A;  4IM3 A;  4A20 A;  2DLW A;  3V61 A;  3R66 C;  2YVC A;  4TYZ A;  4CHM A;  2RUK B;  4BKG A;  2YT1 A;  3KRX A;  2MDX A;  5JH5 C;  2I5C A;  4MGI E;  2QKM A;  1WR6 E;  1OTR B;  2LRW A;  3ZDM C;  2L0F A;  3DBS A;  4IWO A;  1V5U A;  3RD2 A;  2DZK A;  1M7R A;  1H8C A;  2XQN M;  2AEH A;  2PPH A;  5DHA B;  2LXC A;  3N30 A;  3H7P A;  4HJK A;  3ALB A;  2P8V A;  3WAN A;  2K6Q A;  2NMB A;  1E7V A;  4EJN A;  3ML4 A;  3VFK A;  4KSL C;  2NBW B;  2IFS A;  2LZ6 A;  2HD5 B;  4KAX B;  1RFA A;  2LI5 A;  2DHI A;  1WMH B;  5D3V A;  2N1W A;  5BO4 B;  3MJW A;  3A98 B;  1PQS A;  2ZCC A;  5JZE B;  3QC8 B;  5D7G A;  3HIZ A;  1GC6 A;  2JVC A;  2B3A A;  3VUW A;  2LUE A;  1XCG A;  3PRE A;  5C79 A;  3SU8 X;  4GMX B;  1W1D A;  2JY6 A;  1WJ4 A;  1BTN A;  1R4M I;  4W9L A;  2NBV B;  3PRP B;  1U5F A;  5G55 A;  1E8W A;  2H7E A;  1V81 A;  1WGU A;  3L0W B;  3O96 A;  2R09 A;  3TJP A;  3ZIM A;  4N9F 4;  2KN5 A;  4EZK A;  5HE0 A;  3A8P A;  4B9K A;  3GYO A;  2KWU B;  2N9X A;  4A6F B;  1BTK A;  3RCP A;  1OEY J;  2QKL A;  1WX9 A;  4GSW A;  3QBV B;  4DHZ E;  4GN1 A;  1PFJ A;  2J7Q B;  3PP2 A;  2MX2 A;  1SIF A;  3FSS A;  5D3X A;  5KHO A;  4A5K A;  2CR5 A;  2KLC A;  4HAV B;  3H6N A;  2I1K A;  3SD5 A;  5C23 A;  5AZF A;  2M1M A;  3NZU A;  3UGB B;  1WM2 A;  1U29 A;  2ZPN A;  1Y8R C;  3ZNG C;  3TFM A;  1BWN A;  4NAW B;  2KDE B;  2L8J A;  5KHQ A;  5LON B;  3PRZ A;  4RMA A;  3EHV A;  2RSG A;  2YS3 A;  4BBN F;  1WJN A;  2MCN B;  1K5D B;  1MG8 A;  3KYC D;  2DN6 A;  3WIM A;  4HAW B;  2REX A;  1X1G A;  1V89 A;  4DHZ B;  2DHK A;  5C5B A;  1UPR A;  4HB3 B;  1Y19 B;  3W1S C;  4MGK E;  2NR2 A;  2IO1 B;  4WAA A;  5C16 A;  4BKS D;  3TMP B;  2JF5 A;  2KZR A;  5IA7 A;  2FCS A;  3SDL C;  2DAJ A;  4HDQ A;  3PEG A;  5CLQ B;  3TVV A;  2A5U A;  2KFJ A;  5J3T A;  1AWE A;  2GCL A;  1UGM A;  2YSZ A;  1W1G A;  4FJY A;  2K1F A;  2MSE D;  4NQK E;  2PJH A;  3NZS A;  1YIW A;  1UEF A;  3RYT A;  3T06 A;  4MK0 A;  2N23 A;  4KV2 A;  4FAD A;  1EF1 A;  1BT0 A;  1WE6 A;  4KDI C;  4WWO A;  2LYD A;  4K17 A;  4E71 A;  5LLI A;  1FHW A;  3APD A;  2DX5 A;  4XC2 A;  5JHH A;  1WGR A;  4ZRI A;  4YON A;  1UBQ A;  1LFD A;  4HXD A;  2KLG A;  2KXJ A;  5E6O A;  2N1V A;  3RT3 B;  2Z0Q A;  2HTH A;  4NJ7 A;  3QX1 A;  4I6N B;  4FN2 A;  4HK2 A;  1Z87 A;  1IPG A;  4G3X B;  4NQL B;  3NOB A;  5DH9 B;  3AJ4 A;  4W9I A;  1K5G B;  2ZVO A;  3APF A;  1I7A A;  1L2N A;  2AWT A;  2KO3 A;  4AWJ A;  2R2Q A;  2BYV E;  1OY2 A;  3L54 A;  1MAI A;  2MBH A;  3LJU X;  3ODW A;  3H7P B;  4AP4 C;  1IP9 A;  2MQJ A;  4J6I A;  1X1F A;  2UYZ B;  2DTC A;  1FB8 A;  3N32 A;  2IYD B;  2ASQ A;  3DBH I;  1JRU A;  2DYB A;  4ANW A;  2DYO A;  2VRW B;  2RLO A;  5DPT A;  2RGN B;  1WXS A;  2CKH B;  1LXD A;  1UPQ A;  2YLM A;  3PHX B;  4GDK A;  2VRR B;  4WQO B;  2CRF A;  2K2U A;  1CMX B;  2WWZ A;  4I6P A;  2FCQ A;  4WVF B;  1WF9 A;  2P0H A;  4EEW A;  4ZRK A;  2LVO A;  4KHO A;  3UIP B;  1V5O A;  4GXB A;  4MGY E;  1L7Y A;  1M7E A;  4WWP A;  1KI1 B;  3M63 B;  1WR1 A;  3D8F A;  3RUL A;  4BKT A;  4FJV B;  3B1L X;  2COC A;  3QA8 A;  4FBJ B;  1X05 A;  2X18 A;  4OVV A;  2FCM A;  1WJM A;  1FHX A;  4E3C A;  4KHA A;  1WXV A;  4HVB A;  3A1Q A;  4AUQ C;  1TZ1 A;  3KVF B;  3VAW A;  3KUD B;  1WI1 A;  2KJH B;  3HM6 X;  4FHJ A;  1YQB A;  2FUH B;  4MEM A;  3WAM A;  4Z2N A;  2MA9 B;  2CS4 A;  4XWX A;  2JUO A;  4BBN C;  2LGY A;  4Y94 A;  1WJU A;  4GU2 A;  2H7D A;  4II3 B;  3UZT A;  4HPL B;  1K8R B;  3X0W A;  3U30 A;  3N7C A;  3CST A;  3HM3 A;  4KDL B;  3ZNZ B;  1IRS A;  2COA A;  1RLF A;  1X1M A;  2MW5 A;  2DZJ A;  4B6H A;  3UF8 A;  2UZR A;  3KYD D;  2IY1 B;  4HAX B;  1ZVR A;  2HE7 A;  1XT9 B;  2KUP A;  3UIO B;  3M95 A;  4TV3 A;  3DVN V;  1V80 A;  3PZD A;  2J0M A;  3L08 A;  1GNU A;  3PHW B;  2L76 A;  2BKF A;  1TQZ A;  4AJW A;  5C5B B;  3OAW A;  3PGE A;  4HHV A;  1X11 A;  4AOF A;  3V6E B;  3K9O B;  3W1Y A;  2NVU I;  2KJR A;  5HE3 A;  1FXT B;  3L13 A;  2L05 A;  1WX7 A;  4WSF A;  3RZF A;  4P7I A;  2IO3 B;  1MIZ B;  3QIJ A;  1EF5 A;  3F0W A;  3ZTD A;  2LWP A;  2RR9 A;  2Z0E B;  2KDF B;  2Q13 A;  3R7Q A;  4NNJ B;  2BYF A;  2K8C A;  1EO6 A;  3P2B A;  4ZYN A;  3ZNI D;  2UWQ A;  1U5G A;  4M8M A;  4KHB B;  3RCZ A;  2LJ5 A;  3C0R B;  5HKH A;  4MGZ E;  2DKP A;  2DX5 B;  2IO2 B;  3V5W A;  2O6V D;  4HPM B;  4GGQ A;  3T9L A;  4ZDV A;  3TIX A;  3V6C B;  4DDG D;  4GDL A;  2HTH B;  3FEH A;  3G9W A;  3KSY A;  5J3Q A;  3HQC A;  2DYQ A;  2ADZ A;  4WJ7 A;  3PTF C;  1RRB A;  2DZM A;  5KQ1 A;  3DBR I;  4W9J A;  2K39 A;  2GOW A;  4XX5 A;  3A4S C;  2ELA A;  4TKN A;  1EAZ A;  1UNR A;  1OMW A;  4JL9 A;  2A4Z A;  3OJ3 A;  5DPW A;  2K2J A;  1YD8 U;  2EJ8 A;  2VKI A;  3QAQ A;  2D10 A;  3RZW C;  2CHX A;  3VUY A;  1ISN A;  1P98 A;  4ZRJ A;  2LOZ A;  2GCJ A;  4W9G A;  1NTV A;  2JXX A;  4K81 A;  5DIF B;  1OGW A;  1XX0 A;  4PQ0 A;  2JRH A;  3UQA A;  2ROZ B;  3KY9 A;  3AI5 A;  1F9J A;  2L2I A;  1E8Y A;  4RM9 A;  3KUZ A;  3PLV A;  3Q3F A;  4EZJ A;  1Q5W B;  2LAS A;  3DCG A;  1V2Y A;  3ZUN A;  2WDT B;  1YX5 B;  3VDZ A;  3SHQ A;  4GDK B;  4F1S A;  2DYN A;  2KWC A;  3DVG Y;  2LG1 A;  2YS1 A;  1N3H A;  4XZ4 A;  2COF A;  2KNB A;  3K9P B;  1J0W A;  1XOD A;  2PEA A;  2ZZP B;  1WGD A;  2Z59 B;  3PVL A;  1T0Y A;  5J18 A;  2D9W A;  1WYW B;  2M4N A;  3GYP A;  2L0T A;  2RVB B;  2JT4 B;  2WX1 A;  1D3Z A;  2GS0 A;  2XEW A;  4YL8 A;  2Y7B A;  5HE1 A;  2CY4 A;  3VVW B;  1R4N I;  2BPS A;  5CHW A;  4HB4 B;  4FUL A;  5D6J B;  3A1Q B;  1Q67 A;  4ICV A;  4EOY A;  5TR5 A;  3IVF A;  3PSC A;  1ZW7 A;  4CYE A;  3B08 A;  1LM8 B;  2L00 B;  1LW3 A;  1HE8 A;  2GMI C;  3ML9 A;  3WAL A;  2LVP A;  3NS8 A;  4HB0 B;  2FAZ A;  2KOX A;  4HAT B;  2YF0 A;  1FGY A;  3KUC B;  3MPX A;  5DHF B;  2M0X A;  3PVW A;  2KTR A;  4IW0 A;  3QWM A;  1P3Q U;  1U5D A;  3M62 B;  2WYQ A;  1WIA A;  2O2V B;  2JZZ A;  4DWF A;  3MDB C;  3EEC A;  1TTN A;  4GZU A;  4TQ1 A;  4NJ6 A;  4CHK A;  1EUV B;  1U2B A;  3AUL A;  3UIN B;  4DXA B;  4DBB A;  4LJO B;  2RD0 A;  2LD9 A;  1V49 A;  2D2Q A;  3TBL D;  5CX3 A;  3H7S A;  2K8H A;  3RUI B;  1WGH A;  4JGH B;  4JLC A;  2N9P C;  1NTY A;  2Z0O A;  2OJR A;  4F8C B;  4MM3 A;  5JHB A;  3H1U A;  1W1H A;  2KWV B;  1E7U A;  2JP2 A;  2G3Q B;  4Z2M B;  1WVH A;  1OEY A;  3PSE B;  2EMT A;  3QQ8 B;  4WJP A;  3D32 A;  3MHS D;  4K7U A;  4MJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...