4KVGB

Crystal structure of riam ra-ph domains in complex with gtp bound rap1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
260
structure length
246
Chain Sequence
b'MKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1A
publication title The structure of Rap1 in complex with RIAM reveals specificity determinants and recruitment mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 78
structure length 246
sequence length 260
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
B PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4kvgB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kvgB01
4HVBA 2PZ1A 4Z2NA 1WJ4A 2L2IA 2J0JA 3PV1A 3L54A 3T06A 1JRUA 2CRFA 1N3HA 3A33B 2A5UA 3ZO5B 3F5RA 4K1RB 1EF1A 2KC2A 1FHWA 1L2NA 3BJIA 1P9DU 1UNQA 2LXCA 3O65B 1OQYA 5G55A 4II2B 5C1ZA 2WX1A 4FBJB 1TGZB 3A98B 5HE1A 1UBIA 3N32A 4B6HA 2YT0A 4RM9A 3SHQA 4DBBA 4HJKA 3HQCA 4GMVA 5FI1A 3DXCA 4B95A 1M7RA 2A4ZA 3IFWB 2MX2A 4W9HA 3EHVA 2LASA 2GBKA 3PLUA 3ZDMC 3W1SC 4KVGB 4WWNA 2IO2B 1WJ1A 3B08A 2J59M 3DCGA 2CHXA 3VUXA 2Y8FA 3N3KB 2D9WA 4LDTD 2AL3A 2GBJA 2LGDA 1H4RA 3HM6X 1C1YB 1KZ7A 3WIMA 2IO1B 4B9KA 3UIOB 2O2VB 4XC2A 2JZ3B 5CHFA 1SGHA 1WGYA 2C9WB 5AEKB 1DROA 4W9DA 1E8XA 3VTUA 2ZCBA 5HE0A 1WE7A 3PSEB 4KV2A 4GDLB 3R66C 4LCDE 4KSKC 2RUKB 1B55A 2BPSA 5CLQB 4HWIB 2MFQA 2K1FA 1EF5A 5L81A 1IRSA 4EOYA 2BKRB 1V49A 2MWSB 4W9CA 2Z0EB 3DQVA 2AYOB 1VCBA 3R7QA 1NBFC 2IY0B 4K2PA 2DHJA 2Z59B 5GMVA 2Y5BB 2D07B 3PVWA 2KN5A 3QIJA 3PP2A 1WE6A 4HXDA 1P0RA 3DBLI 1AQCA 4K7SA 1WGUA 2VKIA 5C5BA 4GN1A 2G4SA 2XQNM 5HE3A 3D32A 3A9JB 1Q5WB 2C7MB 2JRIB 2C7NB 3DXDA 2R09A 1MG8A 2M17A 4WQOB 3A8QA 3ZRCA 1DDWA 5DIFB 1UPQA 2YT1A 3HM3A 5GOWB 2COCA 4IWQA 3DVGX 1GC6A 3QWMA 4MH0E 2JPHA 3DBHI 2L0FA 2FCSA 5J18A 1V86A 4HB4B 1V61A 4HB0B 3VUWA 1DBHA 4MGYE 1WJUA 3SV1A 4DHJD 3T8MA 3AJ4A 4IM2A 2CU1A 2YVCA 2KFJA 5E6OA 3ULBA 2PJHA 3VHTC 2MLBA 3SUZA 5D3YA 2UVMA 5LONB 3DVNV 3OANA 2DYQA 3DXEA 2Z0OA 4DXAB 2KDFB 3ZNHB 1Q1OA 1H10A 2D9YA 2GBNA 2W2WA 2DYNA 2NBVB 4HDOA 2IYDB 1WMHA 2FNJB 4NQKE 1MK7B 4GZUA 3SNHA 3ZTCA 4XWXA 2KQSA 3FSSA 3NY5A 3DVGY 1J0WA 1U5GA 4ZDVA 3PTFC 4CYEA 3DOWA 4TYZA 4NY0A 3IHPC 3PRPB 5JHGA 2ZZPB 4P7IA 4BOSC 3CIKA 2P0FA 2N4FA 5CLLB 2LVQA 1WX7A 1MPHA 3NS8A 2OQBA 3ULCA 3RYTA 1WJMA 5D3WA 1X05A 2M8SA 2LJ5A 4I6LB 4LDTB 1V89A 3QHTA 2DAJA 4DBGA 1PLSA 2LULA 2V1YA 2I5CA 4HAZB 4FULA 2AWTA 1AWEA 3L08A 2DHIA 1WFYA 4WAAA 2O2VA 1OTRB 2DA0A 1VD2A 2M14A 2ELAA 2BWFA 2N9EB 3MDBC 1NI2A 2D9XA 3F0WA 2PPHA 4WWPA 1V9JA 2M1MA 4EUTA 5C16A 2BKFA 2C60A 3ZTDA 2DX1A 1PQSA 2NMBA 5J3TA 2ZCCA 2KDBA 4GDLA 2DX5B 2KX3A 1K5DB 2KWVB 4GDKB 4ANWA 5D7GA 2L3ZA 2FAZA 3PVLA 4IAPA 2XK5B 1WXSA 2YLMA 2J0KA 2WX0A 2GJYA 1YJ1A 5LXHA 1HE8A 3A8PA 3RCZA 1BAKA 1J0GA 2LI5A 4URKA 5KQ1A 2OOBB 1DYNA 3OAWA 2ASQA 1OY2A 3TJPA 4A6HA 4JL9A 4F7UP 4BKTA 2EMTA 2MBBB 4K81A 1OMWA 3QWZB 4F7ZA 1ZW7A 1WVHA 3A9JA 3N7CA 2YSZA 4HCPB 3ZVRA 3MHSD 4EZLA 5JP4A 2ADZA 1XQQA 1U5EA 1TQZA 1TZ1A 4AJWA 1XR0B 1NDDA 2W2XC 1KM7A 3ODXA 3KYDD 3D8FA 4IG7B 4WJPA 2CR5A 2NBWB 5BO4B 2DKPA 2RR9A 1KI1B 2FCQA 1FGZA 3S2AA 2M0XA 3VDZA 3KUDB 4MSMB 3WANA 3APFA 4IWOA 1LQBA 2V3SA 2P0DA 3LJ3A 5JLJB 1EUVB 3T9LA 2COAA 2BWES 2HTHB 3TBLD 1D3ZA 2DTCA 3A4SC 1C3TA 4TKNA 4II3B 4KZCA 2JT4B 3D8DA 2K2JA 2DZMA 1DDMA 4RM8A 4AWJA 1EVHA 3OLMD 2BYEA 1S1QB 5EFXA 4AJYB 3JW0X 5DPRA 1I7AA 4F1SA 3TO1A 3WALA 5C23A 1A5RA 3QBVB 2FIDA 1WM3A 3A9KB 1V81A 2QHOA 2GCJA 3V6CB 1OEYJ 1M7EA 2FCMA 1ISNA 2N0YA 4NSWA 2G35A 1EAZA 4EFOA 4G11A 4PS8A 5AZHA 5HKHA 1UEFA 4NJ6A 2VSZA 3KRXA 2XEWA 1RRBA 4DX90 3K9PB 4GPTB 3EFUA 2ZNVC 1Z87A 3UF8A 1UZXB 2EC1A 1ZGUB 1RRPB 3DDCB 2K8HA 4NPNA 2KVRA 2AL6A 3ZNID 4IM0A 2MWNB 1F9JA 1V5TA 4NNJB 1Y8RC 2LWPA 4YL8A 2LGXA 3PVUA 1E8ZA 4MM3A 3VQIA 3CMMB 2LGYA 3VH4B 2MBEA 1Y19B 2KTRB 4KAXB 1IPGA 4M8MA 4CHMA 1MIZB 2LYDA 2D3GA 3ZLZA 1YIWA 2Z0QA 4JIOU 2IBIB 2D11A 5HE2A 4CHKA 2IY1B 4KDIC 5DHAB 4IW0A 3QARA 4ZRKA 4MGKE 3CSFA 3JYUA 1ZC4B 3WA0A 4GDKA 2PE9A 4OVVA 3ECIA 3L16A 4D0NB 5E6NA 5DH9B 2XK5A 1V5UA 4HK2A 4MEMA 1X1FA 4HPMB 3M95A 4IOYX 4GSWA 2RLOA 3PHWB 2UYZB 2EJ8A 3V5WA 2C7HA 2VRRB 4WSFA 3PZDA 2LRUA 1W1DA 1U2BA 3PHXB 3L17A 2KFKB 2OJRA 3ZNGC 3LDZE 1U5DA 1YQBA 1WJNA 2KWCA 2J7QB 1MK9B 1W1HA 5L95C 2I1JA 4TQ0A 3H6NA 2LOXA 3KRWA 4ANVA 5EDSA 2NZ8B 2JWZA 4M0WB 5D3XA 3TMPB 2RSGA 1E7UA 2N7DA 1UGMA 3VIAA 1WGRA 1K8RB 1P5TA 1UPRA 2GBMA 1V5PA 1FHXA 4MJSB 3NZUA 4BVUC 3VAWA 3AI5A 2WYQA 1XD3B 1KLVA 4BBNC 3ZUNA 2KTFA 4A6KA 5DPSA 1AARA 4HAWB 2HTHA 3RCPA 4PYUA 2GMIC 1SIFA 4YONA 2K6DB 1TBEA 4IWPA 2YS1A 1J8CA 3RT3B 4WVFB 1WF9A 3ALBA 2LKOA 4ICVA 4KDLB 4BBKA 4EZKA 3PRZA 1X1MA 2KOXA 1ZSQA 3PEGA 5DCNA 4A5KA 2N9PC 4DK5A 3RZWC 4FN2A 2E2XA 4XZ4A 3A9KA 3APDA 1SE9A 2CHZA 3V62A 3HIZA 1Y5OA 1DDVA 3V61A 4BKGA 3L0WB 2RSUA 2ZEQA 1WH3A 4TUUA 2EKEC 1XT9B 1TTNA 4E71A 2JZZA 1KOTA 4DDID 1WGQA 3VOQA 3AU4A 3ML4A 2MKRA 2MSED 1OQNA 1WRDB 4DDGD 1Z2MA 2LXAA 3BY4B 3L13A 4K7UA 3ODWA 2DHKA 4PQ0A 2KCJA 4WJNA 1Z5SB 2VRWB 4JLCA 5CX3A 3MTNB 4HAYB 3VVWB 5J2RA 2ROVA 1OEYA 3KSYA 2QKMA 5FI0A 2KANA 3RUIB 3RD2A 4ANXA 1GUAB 2Z0DB 2KTRA 1LB1A 2G45B 2D9ZA 4ZYNA 2H7EA 3N30A 4HATB 1P1AA 1WM2A 1U27A 4FA6A 2KK8A 2DENB 3W1YA 3SD5A 4MY6A 3KVFB 2L8JA 3U8ZA 2MP2B 4HCNB 3CF6E 2K8BA 2RPQA 3MPXA 3DBRI 3CSTA 4E3CA 2KMAA 2JXXA 2B3AA 3VTVA 4I6NB 2D2QA 1UH6A 2UWQA 2MW5A 4PS7A 1EGXA 3IBEA 2P8VA 3Q3FA 5D27A 4MSQB 3KYCD 4X57B 1WR1A 3M1IB 3CXBB 2KHWB 1CMXB 4W9LA 4A6FB 1FAOA 4EKUA 1X11A 4FJZA 2EMSA 4EMOA 3QAQA 5FR6A 4KIKB 3H9DA 1ZVRA 2RGNB 4MGZE 5C79A 2MBQA 2ELBA 3H7SA 1WXAA 2WDTB 1SHCA 1RJ2A 4EZJA 4CHJA 2BGFA 2KC1A 3WAOA 1WI0A 4GMXB 3PLVA 5J3QA 2V4LA 1BT0A 1GC7A 1MIXA 3ODOA 3B1LX 3QQ8B 5J3YA 2KJRA 3NSUA 4G50A 3HHMA 1UELA 1WYWB 1GNUA 2KGXB 4B6WA 4DWFA 2D9VA 4BBNF 2V76A 4DX8A 1ZC3B 4JQWC 3G9WA 4G3XB 5LXIB 2XBBC 4W9FA 3Q3JA 5JHAA 3PT2B 2DYOA 1KJTA 4CO7A 2KJHB 1PFJA 3VH3B 4GU2A 1IYFA 1WXVA 1FOEA 3JVZX 2O6VB 1WX8A 1R4NI 4NAWB 3TL5A 1XCGA 2K25A 2CY4A 2MA9B 2WWZA 2L05A 3GZNI 3P2BA 1BWNA 2N1WA 4H8SA 5DPWA 2DAFA 4PS3A 3UQBA 1V88A 2MDXA 4WJOA 2UZSA 1OGWA 3ZRFA 4FHKA 3AULA 5DI9B 1P3RA 2GS0A 4MGIE 4RMAA 4DHZB 2HE7A 5JHHA 3UQAA 3QK0A 3TVVA 3HW2B 4BFRA 2N23A 2MQJA 3PGEA 2JY6A 2L1CA 3M63B 2KXJA 4KHBB 3GOEA 1V2YA 4MDKE 4KHOA 3R3MA 2IO3B 2J0MA 1NU2A 4ZRIA 2NVUI 2KWUB 2DN6A 1WI1A 3EECA 2BCJA 3P6AA 2RD0A 5CTRC 4HAVB 3O96A 1WMHB 1GJZA 2Z0PA 4F7GA 4A3PA 2DHZA 4TV3A 3ZW3A 4HDQA 3PPAA 3UINB 3B0AA 1PMSA 2KNBA 2I1KA 2MP2A 2NS5A 1XD4A 1R4MI 1TJ6A 1I42A 1LXDA 3M3JA 3M62B 4N9F4 2LG1A 2K00A 2YS5A 1QQGA 2BYVE 5LOPB 1WGGA 1FGYA 3C0RB 4XX5A 1J19A 3TIXA 2KLCA 4ICUA 3QC8B 1T0YA 2DX5A 4WJ7A 4K2OA 4GOCA 1FHOA 1Q67A 4M8NA 2ZNVB 4HPLB 3TFMA 3IVFA 4A6FA 1GG3A 1L7YA 2BYFA 2CKHB 3QX1A 1YD8U 4FHJA 2KD0A 3A1QB 5G2NA 4E74A 2BF8B 1U29A 3ML8A 3UIPB 1FXTB 4TQ1A 4KIKA 4FADA 2PE6B 3QCAA 3KUCB 1P6SA 1P3QU 1X86A 4KSLC 2DZIA 5JHBA 3APCA 4G0NB 4PNKA 5CHVC 1G6JA 1BTKA 4FJVB 3U7DA 4AOFA 2FCNA 5LLIA 1UBQA 2CAYA 2DYMA 3D8EA 5DHFB 2IFSA 3PREA 2IO0B 4MELA 4HLEA 1WJ6A 4EEWA 2L76A 2N7EA 1P98A 2KJ6A 4BOZB 2KUPA 5E6PA 3GYOA 4W9GA 5L83A 1LW3A 4PYZA 1Q0WB 5KQ4A 2K6QA 3NOBA 1E5WA 1E8YA 1WY8A 4ZRJA 4GIVA 2O6VA 1YX6B 4NAWA 2JUOA 2QKLA 3UZTA 5C6RA 2MBOA 2G3QB 2JRHA 5IA7A 1NTYA 2MCNB 4HB2B 2R2OA 5KHQA 2K2UA 2RGFA 1NTVA 3AU5A 2KQ7A 2CS4A 1I2HA 3ENEA 1V5OA 2RVBB 4IUMB 2P0HA 3RZFA 3I3TB 1M94A 4FLHA 2LUEA 2LRWA 3RULA 2DLWA 3P7ZA 1WGHA 3ZDTA 1MKEA 2L7RA 1I35A 2O6VD 3JSVB 5D2MB 1LM8B 4GXBA 3ONSA 3KZ1A 1KZGA 2K39A 3V60A 2IYBA 4HB3B 3SDLC 2N9XA 3PS6A 1U5FA 2W2XD 2FIFA 2HD5B 3GYPA 2NPTB 1E90A 2L0TA 2Y8GA 5D3VA 3VUYA 2KLGA 3ML9A 5IAAC 4KZ0A 4I6PA 2REXA 3H7PB 3EC8A 4Y94A 5AZFA 2LD9A 3PSCA 3OJ4B 3WAMA 2GCLA 3U30A 2LZ6A 2N1VA 2CY5A 2KKCA 2H7DA 1E8WA 2LOZA 4ANUA 1X1GA 1QZEA 1V6EA 4ASWC 3PG7A 2YF0A 2C5LC 4C0AA 3WAPA 2ZPNA 1RFAA 4Z2MB 1WG7A 3HK0A 3PRMB 5DPTA 2RNRB 1UNRA 4HAXB 2HJ8A 3KY9A 3QA8A 1RLFA 3NZSA 3FM8C 1YX5B 2GOWA 2DKQA 1LFDA 3ZKJC 2DZJA 1WZ0A 2FJLA 1RAXA 3AXCA 2KZRA 2GBRA 5KHOA 4IFSA 4F7HA 1XODA 1WGDA 5TR5A 3SO6A 1V80A 4K7WA 5JZEB 2IZVB 3UGBB 2Y7BA 1UNPA 4WJQA 1W1GA 1U4AA 3KH0A 5J17A 3LJUX 2KO3A 1E7VA 2R2QA 3A1QA 4MK0A 3X0WA 3TW1A 3TCAA 1ZKHA 2X18A 1FB8A 2MBHA 3IG3A 3OJ3A 1UD7A 4NQLB 3W1SA 2KFKA 3MJWA 3V6EB 5JH5C 5D6JB 1MAIA 4A20A 2K8CA 3KW5B 2NCNA 2M38A 1WZ3A 2Q13A 4J6IA 3ZNZB 2YS3A 2G4DB 3SU8X 3VFKA 3FEHA 3X23A 1WX9A 4IM3A 2MRPA 2ROZB 2KDEB 2UZRA 5CHWA 2W9NA 1WIAA 3DBSA 4L6EA 2JVCA 4LJOB 3K9OB 4HHVA 3KUZA 4MJSA 2KMCA 2JF5A 4WWOA 4GGQA 4W9IA 1H8CA 2DFKA 2AEHA 4MT7A 4OVUA 3L10B 1WXMA 1ZM0A 2I5FA 2PEAA 3SYXA 2ZJDA 1XKEA 2NR2A 2JP2A 4K17A 3A4RA 3R7RA 1BTNA 4EJNA 2LVOA 3ZIMA 2ZPYA 4FJYA 3VXWA 4F8CB 1QC6A 2ZVOA 2DYBA 5C5BB 4A3OA 2D4QA 2KDIA 3JSVA 2M4NA 3QJZA 1TXDA 5KCVA 4AUQC 4DHJB 4W9JA 2OTXA 1V5MA 2DZKA 3NHEB 4BKSA 2D10A 3DPDA 2L00B 4W9KA 1WR6E 2YRYA 4IC7B 2FUHB 4KHAA 5D94A 3ZVVA 4HAUB 2LVPA 5AZGA 3WYFB 1S3SG 2CHWA 2R0DA 3BINA 4W9EA 2ZVNA 4JGHB 4LJPB 3VTWA 2NPTA 1IP9A 2COFA 4GB9A 2CODA 2KX0A 3H7PA 2NBUA 3H1UA 3DVNU 4AP4C 4DHZE 1EO6A 4NJ7A 4BKSD 1K5GB 1XX0A
chains in the Genus database with same CATH superfamily
2DWQA 3P42A 4HVBA 1EM7A 2PZ1A 2RRFA 4C7YA 2JWUA 5IRSA 4Z2NA 3NVZA 5M4YB 1WJ4A 2QCZA 2L2IA 3NG0A 4RFBA 2J0JA 3PV1A 3L54A 3T06A 1JRUA 2CRFA 3T3NA 1N3HA 2KYWA 3A33B 1HTQA 2A5UA 3ZO5B 5C2TB 3E56A 2AQ3B 3F5RA 4K1RB 1EF1A 2E3TA 2KC2A 2XN9C 1FHWA 1L2NA 3BJIA 1P9DU 1UNQA 2LXCA 3O65B 1OQYA 5G55A 3E9SA 4II2B 5C1ZA 2WX1A 1QOBA 4FBJB 1TGZB 3A98B 1ROEA 5HE1A 5JXVA 3N20C 1UBIA 1FNUA 3U7ZA 3ZXVA 4A90A 3N32A 4B6HA 2YT0A 4RM9A 1A70A 3SHQA 4DBBA 5MPOA 2BS2B 2PVGC 4HJKA 3AE1B 3IT4B 1J7CA 1FNVA 3HQCA 4GMVA 5FI1A 3DXCA 1EWYC 3NW8A 4B95A 1M7RA 2A4ZA 4L1RA 2V9HA 3IFWB 2MX2A 4W9HA 3EHVA 2LASA 2GBKA 1L6UA 2YEPF 3PZ8A 2CJNA 3P4RB 3PLUA 3ZDMC 3W1SC 3AE5B 4KVGB 2WP9B 1TJEA 4WWNA 2IO2B 1WJ1A 1FNWA 1JWMD 3B08A 2J59M 3AE6B 2CHXA 3DCGA 3VUXA 3MC9A 2Y8FA 3N3KB 4A55A 2D9WA 4LDTD 2AL3A 1ZYIA 2GBJA 4LNFA 5C3JB 1VRAB 4A9AA 2LGDA 1H4RA 1PUTA 1ENFA 1YN3A 1QF6A 2N9LA 3HM6X 1C1YB 3AB5A 1KZ7A 3WIMA 2IO1B 3P4QB 4B9KA 3UIOB 3W9CB 3DCXA 2O2VB 4XC2A 1XXGA 2JZ3B 5CHFA 1SGHA 2JYTA 1WGYA 2C9WB 5AEKB 1DROA 2RMMA 4W9DA 1E8XA 2TSSA 4JPSA 3VTUA 2ZCBA 5HE0A 1WE7A 1SE4A 3PSEB 4KV2A 4GDLB 3R66C 4LCDE 4KSKC 2RUKB 3BK2A 1B55A 2BPSA 5CLQB 4HWIB 2MFQA 2K1FA 3IXSA 1EF5A 1RWSA 5L81A 1IRSA 2D5GA 1TS2A 4EOYA 1MHHE 2BKRB 4ACFA 1V49A 2MWSB 4W9CA 2Z0EB 3DQVA 2AYOB 1VCBA 3R7QA 2DNFA 1NBFC 5GXGB 4YXDB 2IY0B 4K2PA 2DHJA 2Z59B 1KRHA 4JWSC 2Y5BB 5GMVA 1GB4A 2D07B 3PVWA 2KN5A 3QIJA 4A8XC 3PP2A 1WE6A 3MC0B 4HXDA 1P0RA 3DBLI 1AQCA 4K7SA 1WGUA 2VKIA 1ET6A 1YJJA 2GRIA 2R2YA 5C5BA 1QLBB 4GN1A 2G4SA 2XQNM 5HE3A 4ZOHC 3D32A 5EE9A 3A9JB 1PFDA 1C4AA 1Q5WB 2C7MB 2JRIB 2G9HD 4M01A 2C7NB 3DXDA 2R09A 1MG8A 2M17A 1FO4A 4WQOB 3A8QA 3ZRCA 1DDWA 5DIFB 1UPQA 2YT1A 3ZQ4A 3HM3A 5GOWB 1VZ8A 1ZDXA 2COCA 4IWQA 4YWGG 3DVGX 1GC6A 3QWMA 4MH0E 4HRSA 2JPHA 3DBHI 2L0FA 2FCSA 1SEBD 5J18A 1V1OA 1V86A 4HB4B 1V61A 4HB0B 3VUWA 1DBHA 1XCTL 2VZKD 3AEGB 4MGYE 1WJUA 1UNSA 4CQNA 2WXNA 5EE0A 3N1ZC 3ZYYX 4TSSA 1R7SA 2J4XA 3SV1A 4DHJD 1N6ZA 3T8MA 3AJ4A 4IM2A 2LHDA 2CU1A 4D2KA 2YVCA 4JE3B 4S17A 2KFJA 5E6OA 3BWUD 3ULBA 2PJHA 3VHTC 3AH7A 3BZDB 1ZDVA 2MLBA 3SUZA 1UGJA 5D3YA 2HJ1A 2UVMA 3TEWA 1EU4A 4MT5A 5LONB 4HKQA 3DVNV 3OANA 2DYQA 3DXEA 5HHDG 2J52A 4YTMB 2Z0OA 4DXAB 2KDFB 1I4HA 4WH4A 3ZNHB 1FEHA 2NMQA 3BIID 3I57A 1Q1OA 1H10A 2D9YA 2V3PA 2GBNA 4YSXB 2W2WA 2DYNA 2NBVB 1MFWA 4RGMA 2K22A 4HDOA 3Q3NC 1SJED 2IYDB 1WMHA 2FNJB 4NQKE 4LTUA 2BYTA 1MK7B 4GZUA 3SNHA 1GOZA 3ZTCA 4XWXA 2KQSA 3EA6A 3FSSA 3NY5A 3DVGY 1YOVB 4ARCA 1KLGD 1J0WA 3LB8C 1U5GA 4P1BC 4ZDVA 3PTFC 1JALA 4CYEA 3DOWA 4TYZA 4NY0A 1FFVA 3IHPC 3PRPB 4RH6A 5JHGA 3Q14C 2ZZPB 2GI9A 1SF0A 4P7IA 4BOSC 3CIKA 2P0FA 2N4FA 5CLLB 4NZLB 2LVQA 1WX7A 1JMLA 1MPHA 3NS8A 2OQBA 3ULCA 3RYTA 1GB1A 1WJMA 5D3WA 5AUKA 1WXQA 1X05A 2M8SA 2LJ5A 2WHIA 1V8CA 4I6LB 1F1HA 3AV8A 4LDTB 4LLGM 1V89A 3IT6B 2QILA 3N1XC 2WXJA 3QHTA 2DAJA 4DBGA 1PLSA 4KGSA 2LULA 2V1YA 2I5CA 4HAZB 4FULA 2AWTA 3NWDA 3HVDA 4MM3B 1AWEA 1J7AA 3L08A 2DHIA 4K3BA 1WFYA 1CJEA 4OT1A 2D3AA 4P1CC 4WAAA 2O2VA 1OTRB 2DA0A 1VD2A 2M14A 2ELAA 2BWFA 2IDYA 2N9EB 3MDBC 1NI2A 2K0PA 3GP7A 2D9XA 2PPHA 3F0WA 1OFFA 1VJKA 1V9JA 4WWPA 2M1MA 4EUTA 5C16A 2BKFA 2PTLA 2C60A 3Q3MC 3ZTDA 2DX1A 1PQSA 2NMBA 5J3TA 2ZCCA 2KDBA 4GDLA 2DX5B 2KX3A 2WXKA 2G1EA 1K5DB 2KWVB 3BK1A 4GDKB 4ANWA 5D7GA 2INDC 3RNCC 1ESFA 2L3ZA 2FAZA 3PVLA 4IAPA 2XK5B 2WXIA 4XYCA 1SIJA 1WXSA 5AUIA 2YLMA 2J0KA 2WX0A 2GJYA 2Z59A 1YJ1A 2Z8LA 5LXHA 3GB1A 1HE8A 1IBXB 3A8PA 2WLBA 4YSYB 3RCZA 1VLBA 1BAKA 1J0GA 2LI5A 4URKA 5KQ1A 2OOBB 1DYNA 1FMAD 1HXYD 3WCQA 3OAWA 2ASQA 2SEBD 1OY2A 2MJDA 5HI1A 3TJPA 4A6HA 4JL9A 4IKGA 4F7UP 4BKTA 2EMTA 2MBBB 4YTNB 4K81A 1OMWA 3QWZB 4F7ZA 1ZW7A 2WS3B 1WVHA 3A9JA 3N7CA 2YSZA 1WSPA 4HCPB 4WWMA 3ZVRA 4C4VB 4TMAB 2WGSA 1WWTA 3MHSD 4EZLA 5JP4A 2ADZA 3L4PA 1XQQA 1U5EA 1TQZA 1UF0A 1TZ1A 4AJWA 1XR0B 1NDDA 2N0SB 2L52A 2W2XC 1KM7A 3RNBC 3NZ3A 2L1AA 4L1BA 2DBYA 3ODXA 5T8IA 3KYDD 3D8FA 4IG7B 4WJPA 2CR5A 2NBWB 1SSNA 5BO4B 3P1MA 2DKPA 3RPFC 2J53A 2RR9A 2ZW0A 1KI1B 2PIAA 2FCQA 2KR0A 1FGZA 3S2AA 1JWSD 3U52E 1AW7A 4ZHPA 1FXAA 2M0XA 2KAJA 3KUDB 3VDZA 4MSMB 1TY0A 1ET9A 1N62A 3APFA 4IWOA 3WANA 1LQBA 3AE2B 2V3SA 4JWUC 1VDVA 2P0DA 3LJ3A 5JLJB 1N5WA 4IOIE 5I2MA 3NUHB 3HIEA 1EUVB 1V97A 2W82A 3T9LA 2COAA 1C4PA 2BWES 2HTHB 2PVOD 3TBLD 1D3ZA 4C7ZA 2DTCA 4XE0A 3A4SC 1C3TA 4TKNA 4RGNA 4II3B 4KZCA 2JT4B 3D8DA 2K2JA 2DZMA 1DDMA 4RM8A 4AWJA 1EVHA 3OLMD 2BYEA 4GNKB 3NVWA 1S1QB 2RDHA 5EFXA 4AJYB 3JW0X 4N59A 1TYGB 5DPRA 2FJUB 1PGAA 1F2RI 1I7AA 3FILB 2I2YA 5EE3A 4F1SA 3RNGC 2NBVA 4QJ4B 4OZBA 3TO1A 3WALA 5C23A 1A5RA 3TEXA 1GPXA 3QBVB 3I9V1 2KUQA 1Q10A 2FIDA 1WM3A 3P4SB 3A9KB 1V81A 2QHOA 2GCJA 4OW0A 3V6CB 1XLQA 3ZJUA 1OEYJ 1M7EA 2FCMA 1ISNA 2N0YA 4NSWA 1MJDA 2G35A 1EAZA 4EFOA 3Q2AC 4G11A 3C8YA 1KTKA 4PS8A 5AZHA 5HKHA 1UEFA 4NJ6A 1AN8A 3R2TA 2VSZA 2K3UA 2WDRB 3KRXA 4RCOA 3IAM1 3ETRA 2XEWA 1YNTE 1ZXIA 1RRBA 4LNKA 2IPKD 4DX90 3FVCA 3K9PB 4OHJA 4WURA 4GPTB 3EFUA 2ZNVC 1Z87A 3UF8A 1K52A 1UZXB 4DXGA 3DHIC 5EE1A 2EC1A 1ZGUB 2ON8A 1RRPB 3DBRB 3DDCB 2W55A 3AMZA 4NJCA 2K8HA 4NPNA 2KVRA 2AL6A 3ZNID 4IM0A 3RI7C 2MWNB 4DIXA 1F9JA 1V5TA 4NNJB 1Y8RC 2LWPA 4YL8A 2LGXA 3PVUA 1E8ZA 3R2IA 1KH0A 4MM3A 3VQIA 3CMMB 2LGYA 1V1PB 1RFKA 3Q6BA 1CK1A 2MBEA 2NTTA 3VH4B 1Y19B 2KTRB 4KAXB 1IPGA 4M8MA 4CHMA 1QT9A 2MHJA 1MIZB 2CJOA 1L0VB 2LYDA 2D3GA 3MP9A 4XWWA 3ZLZA 1YIWA 2Z0QA 4JIOU 2IBIB 2D11A 2EKIA 1NYRA 3U12A 5HE2A 3MJ5A 4CHKA 2ACZB 3V3XA 4IDIA 2IY1B 3KLSX 5TSSA 4KDIC 5DHAB 4IW0A 3QARA 4ZRKA 2ZKMX 2JXTA 4MGKE 2GB1A 3CSFA 3JYUA 1ZC4B 3LXFA 3WA0A 2EELA 4GDKA 2PE9A 4OVVA 3ECIA 1K50A 3L16A 1KF6B 4D0NB 5E6NA 5DH9B 2XK5A 1V5UA 4HK2A 4MEMA 1X1FA 2BT6A 1RYJA 3C19A 4HPMB 3URYA 3M95A 3DHHC 2JX5A 3ABVB 4IOYX 4GSWA 2RLOA 3PHWB 3SFDB 1IBXA 3N9YC 4RGTA 1AWDA 1FRDA 1UWXA 3HUIA 4WQMA 2UYZB 4ITKA 2EJ8A 3V5WA 2C7HA 2VRRB 5IO9A 2DLBA 4WSFA 3T3OA 3PZDA 2LRUA 1W1DA 3KWVA 1U2BA 3PHXB 3L17A 2KFKB 2OJRA 3ZNGC 3LDZE 1U5DA 1YQBA 1WJNA 2KWCA 2J7QB 1NYQA 2MJ3A 2FE8A 2JSVX 2KQ4X 4Q2JA 1DGJA 1TKYA 1MK9B 2ONQA 1W1HA 4C4VA 5L95C 2I1JA 1ZXHA 4TQ0A 5FK9C 3H6NA 2LOXA 1MVKA 4GOUA 1T6BX 3KRWA 4ANVA 4HEA1 5EDSA 2NZ8B 3P63A 2JWZA 4M0WB 5E6JA 1T77A 5D3XA 3TMPB 2RSGA 1E7UA 2N7DA 1N60A 1CQVA 3OG5A 1R4NB 1UGMA 2KWDA 4ZHOA 3VIAA 1I4QA 1WGRA 1K8RB 1P5TA 1UPRA 3GZNB 2GBMA 1V5PA 1DOYA 4KKIA 2PW9A 1FHXA 4MJSB 3NZUA 3GE8C 4QJ3B 4BVUC 3V05A 3VAWA 3AI5A 3Q8BA 2WYQA 1PDXA 1XD3B 1B9RA 3AEFB 3EUB2 1KLVA 4BBNC 3ZUNA 2LJIA 3OHMB 2KTFA 4A6KA 2IGDA 3W2DA 1FXIA 5DPSA 1AARA 4HAWB 2HTHA 3BYYB 3RCPA 1I7HA 4PYUA 2GMIC 1I4XA 1SIFA 3HSAA 3NJTA 4YONA 2K6DB 1TBEA 4IWPA 4US8A 1YJIA 4QAYA 2YS1A 1J8CA 3RT3B 5BMGA 2WXLA 1XLNA 4WVFB 1WF9A 3NVYA 3ALBA 2LKOA 1D5ZC 4ICVA 1WRIA 4KDLB 1OQQA 2D3CA 4BBKA 4EZKA 3IAS1 2PMVA 3PRZA 4L23A 1X1MA 1NEKB 3AEEB 2KOXA 2OHFA 1ZSQA 3PEGA 3FILA 5DCNA 4A5KA 1QOAA 2N9PC 2QJLA 4DK5A 3RZWC 4FN2A 2E2XA 1ACCA 4XZ4A 4LK0M 1I4GA 3A9KA 3APDA 1SE9A 2CHZA 3V62A 2FBWB 3HIZA 1Y5OA 2LEKA 1DDVA 3V61A 4BKGA 3L0WB 4CSQA 2RSUA 2ZEQA 3EFCA 1WH3A 4TUUA 2EKEC 1E9MA 1XT9B 1TTNA 4E71A 2JZZA 1BUIC 2M56B 1KOTA 1ZP0B 2IGHA 4DDID 1WGQA 4R3DA 3VOQA 4QXAB 2Y3AA 3AU4A 1F52A 3BVGA 3W5VB 3ML4A 1ZPSA 2MKRA 4M02A 4YTPB 2MSED 1OQNA 1WRDB 4DDGD 1Z2MA 2AX5A 3NS1A 3MC8A 2W3SA 5IP4D 1XCQL 2JZPA 1N5XA 2LXAA 1PGXA 3BY4B 2WXQA 2Y5CA 3L13A 4K7UA 3ODWA 2DHKA 4PQ0A 2V0GA 2KCJA 4WJNA 4B0EA 1Z5SB 1R4MB 2VRWB 4JLCA 2VH1A 5CX3A 3Q8AA 3MTNB 4HAYB 3VVWB 1SB3C 2KT7A 3KQ4A 2K8EA 1IGDA 3I63C 5J2RA 2ROVA 1OEYA 5I4DA 3KSYA 2QKMA 5FI0A 2KANA 3RUIB 1V1PA 3RD2A 4ANXA 1GUAB 1JWUD 2Z0DB 2KTRA 2H89B 1QKZA 1QILA 1LB1A 4UDUC 2JU6X 2G45B 2D9ZA 4ZYNA 2H7EA 1UWMA 3N30A 4HATB 1P1AA 1WM2A 2GUMA 1U27A 4FA6A 2KK8A 4K3CA 2DENB 3W1YA 3SD5A 4MY6A 1FFUA 3KVFB 2L8JA 3U8ZA 2MP2B 4HCNB 3CF6E 2K8BA 4NAMA 2RPQA 3MPXA 1CZPA 3DBRI 4HKZE 3CSTA 4E3CA 2KMAA 1TT5B 2JXXA 2B3AA 3VTVA 1DYQA 4I6NB 2D2QA 1UH6A 2UWQA 1YN4A 2MW5A 4OZAA 4PS7A 3VR8B 1EGXA 3IBEA 2P8VA 3Q3FA 5D27A 1HTOA 2ICIA 3KYCD 4MSQB 1FIQA 4X57B 1WR1A 3O13A 3M1IB 5IOIA 5FKAC 1FCCC 1XLOA 2UU7A 3CXBB 4N6EB 2KHWB 1CMXB 4W9LA 4A6FB 1FAOA 1KLUD 5IKCM 1J7BA 1KFYB 4EKUA 1GAQB 1X11A 1NENB 4FJZA 2EMSA 1WYGA 2WXRA 4LNIA 4DXFA 4RF0A 4EMOA 3QAQA 5FR6A 1N61A 2Z14A 4KIKB 4KX6B 3H9DA 2YEPB 1ZVRA 2RGNB 4MGZE 5BYSA 4HROA 5C79A 1E10A 4QJ5B 2MBQA 1JW9D 2ELBA 4M0WA 3H7SA 1WXAA 2WDTB 4C56C 1SHCA 1RJ2A 4EZJA 4CHJA 2E6XA 2BGFA 3PO0A 2KC1A 3WAOA 4KGTA 2WXGA 1WI0A 4GMXB 3PLVA 1LGRA 2Z4DA 5J3QA 5I2SA 2V4LA 1BT0A 1RM6C 1GC7A 1MIXA 3ODOA 3B1LX 2WDVB 3QQ8B 2JYEA 1NI3A 3CWIA 1T3QA 2PLPA 5J3YA 2KJRA 3NSUA 4G50A 3HHMA 1UELA 1WYWB 4USAA 2RDGA 1GNUA 1I4RA 5G5HA 2KGXB 4B6WA 2J42A 4DWFA 2D9VA 4BBNF 3AE3B 2V76A 3DBHB 4DX8A 1ZC3B 4JQWC 2KDMA 3G9WA 3PZ7A 4G3XB 2RPVA 2R61A 2MEKA 5LXIB 2XBBC 4W9FA 3Q3JA 3Q8EA 5JHAA 3PT2B 3Q8FA 2DYOA 1KJTA 4CO7A 2KJHB 1PFJA 3B2GA 3VH3B 4GU2A 1IYFA 3NVVA 1WXVA 1FOEA 1HA5A 3JVZX 2O6VB 1WX8A 1R4NI 4NAWB 3TL5A 1XCGA 2K25A 2CY4A 2MA9B 2WWZA 3TUOA 2BB5A 1FM0D 2L05A 2HTME 3GZNI 2INCC 3P2BA 1BWNA 2N1WA 3KWLA 2AQ1B 4H8SA 5IN7A 5DPWA 3VRBB 2DAFA 4PS3A 2WXPA 3UQBA 1V88A 2MDXA 4WJOA 2W3RA 2UZSA 1E0ZA 1OGWA 3ZRFA 1HZ6A 2QSDA 5BMIA 4O1NA 4FHKA 4WIPA 1OQRA 1F0ZA 3AULA 5DI9B 1P3RA 1STEA 2L83A 2GS0A 2B76B 3ZJVA 2LHEA 4RF1A 2WU5B 4MGIE 3FC4A 4RMAA 3N1YC 3AE9B 4DHZB 2RDBC 2HE7A 5JHHA 3UQAA 3I5JC 1C77A 1LO5D 1NVID 3QK0A 3B9JA 3TVVA 3HW2B 2MJEA 4AQ7A 4BFRA 2N23A 2MQJA 2M0AA 3PGEA 2JY6A 3AN1A 1HZ5A 2L1CA 2W54A 1E6EB 3M63B 2I38A 2KXJA 4MH8A 3SEBA 4KHBB 3GOEA 1V2YA 4MDKE 2M19A 3TEZA 3BVMA 1MG4A 1I4PA 2KACA 4KHOA 3R3MA 2IO3B 2J0MA 1NU2A 2LGSA 1PGBA 1P7FA 4ZRIA 4B0MA 2NVUI 4ZRPA 2HDEA 4C80A 2INPE 2SAKA 2KWUB 2DN6A 3AEDB 2BS4B 1FPYA 1WI1A 2KN4A 3ZGZA 3EECA 2BCJA 3P6AA 2RD0A 5CTRC 4HAVB 3O96A 1WMHB 3AEBB 1TS4A 1GJZA 2Z0PA 4F7GA 4A3PA 1T5XD 2DHZA 4TV3A 3ZW3A 2NTSA 4HDQA 1MI1A 3PPAA 3UINB 3FAHA 2N9KA 2WNMA 3B0AA 4BZAA 1PMSA 3LYYA 1TIFA 2KNBA 2I1KA 2INNE 2MP2A 2NS5A 1XD4A 1R4MI 1IUEA 4D6WA 1TJ6A 1I42A 2XNAC 3HRDD 4PT5A 1LXDA 1BXTA 4OZCA 3M3JA 4OVZA 3M62B 4N9F4 2LG1A 3MFGA 1QOGA 1WGKA 3AM9A 1YQ3B 2K00A 2YS5A 3B77A 1QQGA 1ZE3D 2BYVE 5LOPB 1D4BA 1WGGA 1FGYA 3C0RB 4XX5A 1J19A 2LMCA 3TIXA 2FUG1 1C76A 1BMLC 2KLCA 4ICUA 1D5MC 3QC8B 1T0YA 3RN9C 1TS3A 3VRAB 2DX5A 4WJ7A 4K2OA 4GOCA 1FHOA 4BAXA 1Q67A 4M8NA 2ZNVB 1TS5A 3OWEB 4HPLB 3TFMA 3IVFA 4A6FA 4ZYSA 1GG3A 1L7YA 1TZOA 1ZUD2 2BYFA 2CKHB 3QX1A 1YD8U 4FHJA 2KD0A 4DQOC 3A1QB 5G2NA 4E74A 2BF8B 1U29A 3ML8A 3UIPB 1FXTB 2ZW1A 4TQ1A 4KIKA 3GS2A 4FADA 1ZOYB 2PE6B 2BS3B 1T0QC 2VH2A 3QCAA 3KUCB 1P6SA 1P3QU 1D6EC 1Y56A 3AEAB 1X86A 4KSLC 2WU2B 4FXCA 2DZIA 5JHBA 3APCA 4G0NB 1L4DB 1VR9A 3A58A 1QOFA 4PNKA 2Q5WD 5CHVC 1G6JA 1BTKA 4FJVB 2PKOA 3Q69A 4L2YA 3U7DA 4AOFA 2FCNA 2QMTA 5LLIA 5LG4B 1UBQA 2QDFA 2CAYA 2DYMA 3D8EA 2BW2A 5DHFB 2IFSA 3PREA 4ZRQA 2IO0B 5H8YE 4MELA 4HLEA 1WJ6A 4HPPA 1MPEA 5FR3A 1L4ZB 2L76A 3DWMA 4EEWA 2N7EA 3W5UB 1P98A 2KJ6A 1IGCA 1K51A 4BOZB 4GLSC 2LUMA 2KUPA 1SBBB 4KKJA 1F2RC 1JQ4A 5E6PA 4XDCA 3GYOA 4W9GA 5L83A 1LW3A 1FCLA 4PYZA 1Q0WB 1YMHE 1JWAD 1L0XB 5KQ4A 2K6QA 2WQYB 3NOBA 1E5WA 2IGGA 3UI3A 1E8YA 1WY8A 4ZRJA 4GIVA 2AQ2B 2O6VA 1YX6B 2X8XX 4NAWA 2JUOA 3TEYA 2QKLA 3UZTA 5C6RA 2MBOA 2G3QB 2JRHA 5IA7A 1P7EA 1NTYA 2MCNB 1TKGA 4HB2B 2R2OA 5KHQA 2K2UA 2RGFA 4J3OD 1NTVA 4LNNA 4WAFA 3AU5A 1JROA 2KQ7A 2CS4A 2CU3A 3DWGC 1I2HA 3ENEA 1V5OA 2RVBB 4IUMB 2P0HA 3RNEC 3RZFA 3I3TB 1HQRD 1M94A 2LGIA 4FLHA 1L6VA 1MHXA 2LUEA 2LRWA 3RULA 2DLWA 2Z13A 3P7ZA 1C79A 3ZDTA 1MKEA 1WGHA 2L7RA 1I35A 2O6VD 3JSVB 3VR9B 3NRZA 1JWBD 3Q8CA 4ARIA 5D2MB 1LM8B 5BYRA 3SR6A 4EE2A 4M00A 4GXBA 3ONSA 3KZ1A 1KZGA 1JCKB 2V4IB 2K39A 3V60A 3ZJTA 2IYBA 4HB3B 2BQQA 3FKYA 3SDLC 2H88B 3RNAC 2N9XA 3PS6A 1U5FA 2IJ0A 2KMMA 4KHBA 2W2XD 2FIFA 3EGRA 1M4VA 2HD5B 2JQRB 3NWAA 1EWCA 1FD6A 3GYPA 4HSIA 2NPTB 1E90A 3AE4B 2L0TA 3H8HA 2Y8GA 5D3VA 1TKEA 1XF5L 2WXOA 3VUYA 2KLGA 3ML9A 5IAAC 4KZ0A 4I6PA 2REXA 4H2AA 3H7PB 3EC8A 4Y94A 5AZFA 2LD9A 3PSCA 3HVZA 3OJ4B 3WAMA 2GCLA 1JRPA 1MI0A 1VZ7A 3SFEB 3U30A 1EU3A 3TSSA 2LZ6A 2N1VA 2CY5A 2KKCA 2BB6A 2H7DA 1E8WA 2LOZA 4ANUA 1X1GA 1QZEA 1V6EA 4ASWC 1SXTA 3PG7A 4AS1A 2YF0A 1N63A 2C5LC 2K9XA 4C0AA 3WAPA 3ZXRA 5LNK1 2ZPNA 1RFAA 4Z2MB 1WG7A 3HK0A 3PRMB 5DPTA 2RNRB 1UNRA 1D5XC 3U4EG 1SE3A 5HFYA 4HAXB 2HJ8A 3KY9A 3QA8A 2KVZA 1RLFA 2WXHA 1DOIA 3AE7B 3NZSA 3FM8C 1YX5B 2GOWA 2DKQA 1C78A 1LFDA 3ZKJC 2DZJA 1AYFA 1WZ0A 1TY2A 2FJLA 1RAXA 3J9CA 3AXCA 2KZRA 3DHGC 2GBRA 5KHOA 4IFSA 4F7HA 1XODA 1WGDA 5TR5A 3SO6A 3RFZB 1V80A 4K7WA 1XO3A 1SE2A 5BYQA 5JZEB 2IZVB 3UGBB 2GLSA 2K5PA 2Y7BA 1UNPA 4WJQA 1W1GA 1U4AA 3KH0A 5J17A 3LJUX 1L0YB 2QIEB 2KO3A 1E7VA 4C00A 2R2QA 3A1QA 4MK0A 2OJWA 3BYTB 3BVZA 3X0WA 3TW1A 3TCAA 1ZKHA 2X18A 1FB8A 4MACA 4HJGE 2MBHA 1XEEA 4KGRA 3IG3A 3OJ3A 1UD7A 2X38A 4NQLB 1C4CA 3W1SA 2KFKA 3MJWA 3V6EB 5D3IB 2K49A 4REZA 2V3NA 5JH5C 5D6JB 2BVCA 1MAIA 4A20A 2K8CA 3KW5B 2NCNA 2M38A 1WZ3A 2Q13A 4J6IA 3ZNZB 2YS3A 5BMHA 2G4DB 3SU8X 3VFKA 3FEHA 2BTEA 3X23A 1WX9A 4RNAA 4IM3A 2QEJC 2MRPA 2ROZB 4JX1C 2MH7A 3DBLB 2KDEB 2UZRA 5CHWA 1PYWD 4OSNA 2W9NA 1DOXA 1WIAA 3DBSA 4L6EA 2JVCA 4LJOB 1HEZE 1T0SC 4PK1A 3K9OB 4HHVA 3KUZA 3GE3C 3RNFC 2WXFA 4MJSA 2KMCA 4YSZB 2JF5A 4WWOA 4GGQA 4W9IA 1H8CA 3R8BA 2DFKA 2AEHA 4MT7A 4OVUA 4XDDA 3CIRB 1WXMA 3L10B 1ZM0A 2OEDA 1UUPA 1E7PB 2I5FA 2PEAA 3SYXA 2ZJDA 5H92C 1XKEA 2NR2A 2JP2A 4K17A 3A4RA 3R7RA 1BTNA 2KIGA 2LFIA 1T0RC 4EJNA 4US9A 2LVOA 3ZIMA 2ZPYA 4XGAB 4FJYA 3VXWA 4F8CB 2KIEA 4YT0B 1QC6A 2ZVOA 2DYBA 5C5BB 1QQRA 4A3OA 3AE8B 2D4QA 1F77A 2VZKB 2KDIA 2WXMA 2Y5PA 3JSVA 3MHZA 2L32A 2M4NA 3QJZA 1TXDA 5KCVA 1B1ZA 2N7JA 4AUQC 1K53A 2QC8A 5HG2A 4DHJB 1C9FA 1XLPA 4W9JA 2OTXA 3RMKC 4LNOA 1YQ4B 4RGOS 1V5MA 3NWFA 2DZKA 3NHEB 4BKSA 2D10A 3DPDA 2L00B 4XWTA 1L5PA 4W9KA 1WR6E 2YRYA 4IC7B 4S0RA 2FUHB 4KHAA 5D94A 3ZVVA 4HAUB 2LVPA 5AZGA 3WYFB 1S3SG 2CHWA 2YT2A 2BBCA 4A6QA 2R0DA 3BINA 1SJHD 4W9EA 2ZVNA 4JGHB 4LJPB 3VTWA 2NPTA 1IP9A 2D3BA 2COFA 4GB9A 3Q3OC 4P16A 2CODA 2KX0A 3H7PA 2NBUA 3H1UA 3B2FA 3DVNU 3U2SC 4AP4C 4DHZE 1EO6A 1FRRA 4NJ7A 5D3DA 1YN5A 1VZ6A 5G5GA 2WDQB 3P4PB 4BKSD 4N58A 4P6VF 1K5GB 3AECB 1XX0A
chains in the Genus database with same CATH topology
4HVBA 2PZ1A 4Z2NA 1WJ4A 2L2IA 2J0JA 3PV1A 3L54A 3T06A 1JRUA 2CRFA 1N3HA 3A33B 2A5UA 3ZO5B 3F5RA 4K1RB 1EF1A 2KC2A 1FHWA 1L2NA 3BJIA 1P9DU 1UNQA 2LXCA 3O65B 1OQYA 5G55A 4II2B 5C1ZA 2WX1A 4FBJB 1TGZB 3A98B 5HE1A 1UBIA 3N32A 4B6HA 2YT0A 4RM9A 3SHQA 4DBBA 4HJKA 3HQCA 4GMVA 5FI1A 3DXCA 4B95A 1M7RA 2A4ZA 3IFWB 2MX2A 4W9HA 3EHVA 2LASA 2GBKA 3PLUA 3ZDMC 3W1SC 4KVGB 4WWNA 2IO2B 1WJ1A 3B08A 2J59M 3DCGA 2CHXA 3VUXA 2Y8FA 3N3KB 2D9WA 4LDTD 2AL3A 2GBJA 2LGDA 1H4RA 3HM6X 1C1YB 1KZ7A 3WIMA 2IO1B 4B9KA 3UIOB 2O2VB 4XC2A 2JZ3B 5CHFA 1SGHA 1WGYA 2C9WB 5AEKB 1DROA 4W9DA 1E8XA 3VTUA 2ZCBA 5HE0A 1WE7A 3PSEB 4KV2A 4GDLB 3R66C 4LCDE 4KSKC 2RUKB 1B55A 2BPSA 5CLQB 4HWIB 2MFQA 2K1FA 1EF5A 5L81A 1IRSA 4EOYA 2BKRB 1V49A 2MWSB 4W9CA 2Z0EB 3DQVA 2AYOB 1VCBA 3R7QA 1NBFC 2IY0B 4K2PA 2DHJA 2Z59B 5GMVA 2Y5BB 2D07B 3PVWA 2KN5A 3QIJA 3PP2A 1WE6A 4HXDA 1P0RA 3DBLI 1AQCA 4K7SA 1WGUA 2VKIA 5C5BA 4GN1A 2G4SA 2XQNM 5HE3A 3D32A 3A9JB 1Q5WB 2C7MB 2JRIB 2C7NB 3DXDA 2R09A 1MG8A 2M17A 4WQOB 3A8QA 3ZRCA 1DDWA 5DIFB 1UPQA 2YT1A 3HM3A 5GOWB 2COCA 4IWQA 3DVGX 1GC6A 3QWMA 4MH0E 2JPHA 3DBHI 2L0FA 2FCSA 5J18A 1V86A 4HB4B 1V61A 4HB0B 3VUWA 1DBHA 4MGYE 1WJUA 3SV1A 4DHJD 3T8MA 3AJ4A 4IM2A 2CU1A 2YVCA 2KFJA 5E6OA 3ULBA 2PJHA 3VHTC 2MLBA 3SUZA 5D3YA 2UVMA 5LONB 3DVNV 3OANA 2DYQA 3DXEA 2Z0OA 4DXAB 2KDFB 3ZNHB 1Q1OA 1H10A 2D9YA 2GBNA 2W2WA 2DYNA 2NBVB 4HDOA 2IYDB 1WMHA 2FNJB 4NQKE 1MK7B 4GZUA 3SNHA 3ZTCA 4XWXA 2KQSA 3FSSA 3NY5A 3DVGY 1J0WA 1U5GA 4ZDVA 3PTFC 4CYEA 3DOWA 4TYZA 4NY0A 3IHPC 3PRPB 5JHGA 2ZZPB 4P7IA 4BOSC 3CIKA 2P0FA 2N4FA 5CLLB 2LVQA 1WX7A 1MPHA 3NS8A 2OQBA 3ULCA 3RYTA 1WJMA 5D3WA 1X05A 2M8SA 2LJ5A 4I6LB 4LDTB 1V89A 3QHTA 2DAJA 4DBGA 1PLSA 2LULA 2V1YA 2I5CA 4HAZB 4FULA 2AWTA 1AWEA 3L08A 2DHIA 1WFYA 4WAAA 2O2VA 1OTRB 2DA0A 1VD2A 2M14A 2ELAA 2BWFA 2N9EB 3MDBC 1NI2A 2D9XA 3F0WA 2PPHA 4WWPA 1V9JA 2M1MA 4EUTA 5C16A 2BKFA 2C60A 3ZTDA 2DX1A 1PQSA 2NMBA 5J3TA 2ZCCA 2KDBA 4GDLA 2DX5B 2KX3A 1K5DB 2KWVB 4GDKB 4ANWA 5D7GA 2L3ZA 2FAZA 3PVLA 4IAPA 2XK5B 1WXSA 2YLMA 2J0KA 2WX0A 2GJYA 1YJ1A 5LXHA 1HE8A 3A8PA 3RCZA 1BAKA 1J0GA 2LI5A 4URKA 5KQ1A 2OOBB 1DYNA 3OAWA 2ASQA 1OY2A 3TJPA 4A6HA 4JL9A 4F7UP 4BKTA 2EMTA 2MBBB 4K81A 1OMWA 3QWZB 4F7ZA 1ZW7A 1WVHA 3A9JA 3N7CA 2YSZA 4HCPB 3ZVRA 3MHSD 4EZLA 5JP4A 2ADZA 1XQQA 1U5EA 1TQZA 1TZ1A 4AJWA 1XR0B 1NDDA 2W2XC 1KM7A 3ODXA 3KYDD 3D8FA 4IG7B 4WJPA 2CR5A 2NBWB 5BO4B 2DKPA 2RR9A 1KI1B 2FCQA 1FGZA 3S2AA 2M0XA 3VDZA 3KUDB 4MSMB 3WANA 3APFA 4IWOA 1LQBA 2V3SA 2P0DA 3LJ3A 5JLJB 1EUVB 3T9LA 2COAA 2BWES 2HTHB 3TBLD 1D3ZA 2DTCA 3A4SC 1C3TA 4TKNA 4II3B 4KZCA 2JT4B 3D8DA 2K2JA 2DZMA 1DDMA 4RM8A 4AWJA 1EVHA 3OLMD 2BYEA 1S1QB 5EFXA 4AJYB 3JW0X 5DPRA 1I7AA 4F1SA 3TO1A 3WALA 5C23A 1A5RA 3QBVB 2FIDA 1WM3A 3A9KB 1V81A 2QHOA 2GCJA 3V6CB 1OEYJ 1M7EA 2FCMA 1ISNA 2N0YA 4NSWA 2G35A 1EAZA 4EFOA 4G11A 4PS8A 5AZHA 5HKHA 1UEFA 4NJ6A 2VSZA 3KRXA 2XEWA 1RRBA 4DX90 3K9PB 4GPTB 3EFUA 2ZNVC 1Z87A 3UF8A 1UZXB 2EC1A 1ZGUB 1RRPB 3DDCB 2K8HA 4NPNA 2KVRA 2AL6A 3ZNID 4IM0A 2MWNB 1F9JA 1V5TA 4NNJB 1Y8RC 2LWPA 4YL8A 2LGXA 3PVUA 1E8ZA 4MM3A 3VQIA 3CMMB 2LGYA 3VH4B 2MBEA 1Y19B 2KTRB 4KAXB 1IPGA 4M8MA 4CHMA 1MIZB 2LYDA 2D3GA 3ZLZA 1YIWA 2Z0QA 4JIOU 2IBIB 2D11A 5HE2A 4CHKA 2IY1B 4KDIC 5DHAB 4IW0A 3QARA 4ZRKA 4MGKE 3CSFA 3JYUA 1ZC4B 3WA0A 4GDKA 2PE9A 4OVVA 3ECIA 3L16A 4D0NB 5E6NA 5DH9B 2XK5A 1V5UA 4HK2A 4MEMA 1X1FA 4HPMB 3M95A 4IOYX 4GSWA 2RLOA 3PHWB 2UYZB 2EJ8A 3V5WA 2C7HA 2VRRB 4WSFA 3PZDA 2LRUA 1W1DA 1U2BA 3PHXB 3L17A 2KFKB 2OJRA 3ZNGC 3LDZE 1U5DA 1YQBA 1WJNA 2KWCA 2J7QB 1MK9B 1W1HA 5L95C 2I1JA 4TQ0A 3H6NA 2LOXA 3KRWA 4ANVA 5EDSA 2NZ8B 2JWZA 4M0WB 5D3XA 3TMPB 2RSGA 1E7UA 2N7DA 1UGMA 3VIAA 1WGRA 1K8RB 1P5TA 1UPRA 2GBMA 1V5PA 1FHXA 4MJSB 3NZUA 4BVUC 3VAWA 3AI5A 2WYQA 1XD3B 1KLVA 4BBNC 3ZUNA 2KTFA 4A6KA 5DPSA 1AARA 4HAWB 2HTHA 3RCPA 4PYUA 2GMIC 1SIFA 4YONA 2K6DB 1TBEA 4IWPA 2YS1A 1J8CA 3RT3B 4WVFB 1WF9A 3ALBA 2LKOA 4ICVA 4KDLB 4BBKA 4EZKA 3PRZA 1X1MA 2KOXA 1ZSQA 3PEGA 5DCNA 4A5KA 2N9PC 4DK5A 3RZWC 4FN2A 2E2XA 4XZ4A 3A9KA 3APDA 1SE9A 2CHZA 3V62A 3HIZA 1Y5OA 1DDVA 3V61A 4BKGA 3L0WB 2RSUA 2ZEQA 1WH3A 4TUUA 2EKEC 1XT9B 1TTNA 4E71A 2JZZA 1KOTA 4DDID 1WGQA 3VOQA 3AU4A 3ML4A 2MKRA 2MSED 1OQNA 1WRDB 4DDGD 1Z2MA 2LXAA 3BY4B 3L13A 4K7UA 3ODWA 2DHKA 4PQ0A 2KCJA 4WJNA 1Z5SB 2VRWB 4JLCA 5CX3A 3MTNB 4HAYB 3VVWB 5J2RA 2ROVA 1OEYA 3KSYA 2QKMA 5FI0A 2KANA 3RUIB 3RD2A 4ANXA 1GUAB 2Z0DB 2KTRA 1LB1A 2G45B 2D9ZA 4ZYNA 2H7EA 3N30A 4HATB 1P1AA 1WM2A 1U27A 4FA6A 2KK8A 2DENB 3W1YA 3SD5A 4MY6A 3KVFB 2L8JA 3U8ZA 2MP2B 4HCNB 3CF6E 2K8BA 2RPQA 3MPXA 3DBRI 3CSTA 4E3CA 2KMAA 2JXXA 2B3AA 3VTVA 4I6NB 2D2QA 1UH6A 2UWQA 2MW5A 4PS7A 1EGXA 3IBEA 2P8VA 3Q3FA 5D27A 4MSQB 3KYCD 4X57B 1WR1A 3M1IB 3CXBB 2KHWB 1CMXB 4W9LA 4A6FB 1FAOA 4EKUA 1X11A 4FJZA 2EMSA 4EMOA 3QAQA 5FR6A 4KIKB 3H9DA 1ZVRA 2RGNB 4MGZE 5C79A 2MBQA 2ELBA 3H7SA 1WXAA 2WDTB 1SHCA 1RJ2A 4EZJA 4CHJA 2BGFA 2KC1A 3WAOA 1WI0A 4GMXB 3PLVA 5J3QA 2V4LA 1BT0A 1GC7A 1MIXA 3ODOA 3B1LX 3QQ8B 5J3YA 2KJRA 3NSUA 4G50A 3HHMA 1UELA 1WYWB 1GNUA 2KGXB 4B6WA 4DWFA 2D9VA 4BBNF 2V76A 4DX8A 1ZC3B 4JQWC 3G9WA 4G3XB 5LXIB 2XBBC 4W9FA 3Q3JA 5JHAA 3PT2B 2DYOA 1KJTA 4CO7A 2KJHB 1PFJA 3VH3B 4GU2A 1IYFA 1WXVA 1FOEA 3JVZX 2O6VB 1WX8A 1R4NI 4NAWB 3TL5A 1XCGA 2K25A 2CY4A 2MA9B 2WWZA 2L05A 3GZNI 3P2BA 1BWNA 2N1WA 4H8SA 5DPWA 2DAFA 4PS3A 3UQBA 1V88A 2MDXA 4WJOA 2UZSA 1OGWA 3ZRFA 4FHKA 3AULA 5DI9B 1P3RA 2GS0A 4MGIE 4RMAA 4DHZB 2HE7A 5JHHA 3UQAA 3QK0A 3TVVA 3HW2B 4BFRA 2N23A 2MQJA 3PGEA 2JY6A 2L1CA 3M63B 2KXJA 4KHBB 3GOEA 1V2YA 4MDKE 4KHOA 3R3MA 2IO3B 2J0MA 1NU2A 4ZRIA 2NVUI 2KWUB 2DN6A 1WI1A 3EECA 2BCJA 3P6AA 2RD0A 5CTRC 4HAVB 3O96A 1WMHB 1GJZA 2Z0PA 4F7GA 4A3PA 2DHZA 4TV3A 3ZW3A 4HDQA 3PPAA 3UINB 3B0AA 1PMSA 2KNBA 2I1KA 2MP2A 2NS5A 1XD4A 1R4MI 1TJ6A 1I42A 1LXDA 3M3JA 3M62B 4N9F4 2LG1A 2K00A 2YS5A 1QQGA 2BYVE 5LOPB 1WGGA 1FGYA 3C0RB 4XX5A 1J19A 3TIXA 2KLCA 4ICUA 3QC8B 1T0YA 2DX5A 4WJ7A 4K2OA 4GOCA 1FHOA 1Q67A 4M8NA 2ZNVB 4HPLB 3TFMA 3IVFA 4A6FA 1GG3A 1L7YA 2BYFA 2CKHB 3QX1A 1YD8U 4FHJA 2KD0A 3A1QB 5G2NA 4E74A 2BF8B 1U29A 3ML8A 3UIPB 1FXTB 4TQ1A 4KIKA 4FADA 2PE6B 3QCAA 3KUCB 1P6SA 1P3QU 1X86A 4KSLC 2DZIA 5JHBA 3APCA 4G0NB 4PNKA 5CHVC 1G6JA 1BTKA 4FJVB 3U7DA 4AOFA 2FCNA 5LLIA 1UBQA 2CAYA 2DYMA 3D8EA 5DHFB 2IFSA 3PREA 2IO0B 4MELA 4HLEA 1WJ6A 4EEWA 2L76A 2N7EA 1P98A 2KJ6A 4BOZB 2KUPA 5E6PA 3GYOA 4W9GA 5L83A 1LW3A 4PYZA 1Q0WB 5KQ4A 2K6QA 3NOBA 1E5WA 1E8YA 1WY8A 4ZRJA 4GIVA 2O6VA 1YX6B 4NAWA 2JUOA 2QKLA 3UZTA 5C6RA 2MBOA 2G3QB 2JRHA 5IA7A 1NTYA 2MCNB 4HB2B 2R2OA 5KHQA 2K2UA 2RGFA 1NTVA 3AU5A 2KQ7A 2CS4A 1I2HA 3ENEA 1V5OA 2RVBB 4IUMB 2P0HA 3RZFA 3I3TB 1M94A 4FLHA 2LUEA 2LRWA 3RULA 2DLWA 3P7ZA 1WGHA 3ZDTA 1MKEA 2L7RA 1I35A 2O6VD 3JSVB 5D2MB 1LM8B 4GXBA 3ONSA 3KZ1A 1KZGA 2K39A 3V60A 2IYBA 4HB3B 3SDLC 2N9XA 3PS6A 1U5FA 2W2XD 2FIFA 2HD5B 3GYPA 2NPTB 1E90A 2L0TA 2Y8GA 5D3VA 3VUYA 2KLGA 3ML9A 5IAAC 4KZ0A 4I6PA 2REXA 3H7PB 3EC8A 4Y94A 5AZFA 2LD9A 3PSCA 3OJ4B 3WAMA 2GCLA 3U30A 2LZ6A 2N1VA 2CY5A 2KKCA 2H7DA 1E8WA 2LOZA 4ANUA 1X1GA 1QZEA 1V6EA 4ASWC 3PG7A 2YF0A 2C5LC 4C0AA 3WAPA 2ZPNA 1RFAA 4Z2MB 1WG7A 3HK0A 3PRMB 5DPTA 2RNRB 1UNRA 4HAXB 2HJ8A 3KY9A 3QA8A 1RLFA 3NZSA 3FM8C 1YX5B 2GOWA 2DKQA 1LFDA 3ZKJC 2DZJA 1WZ0A 2FJLA 1RAXA 3AXCA 2KZRA 2GBRA 5KHOA 4IFSA 4F7HA 1XODA 1WGDA 5TR5A 3SO6A 1V80A 4K7WA 5JZEB 2IZVB 3UGBB 2Y7BA 1UNPA 4WJQA 1W1GA 1U4AA 3KH0A 5J17A 3LJUX 2KO3A 1E7VA 2R2QA 3A1QA 4MK0A 3X0WA 3TW1A 3TCAA 1ZKHA 2X18A 1FB8A 2MBHA 3IG3A 3OJ3A 1UD7A 4NQLB 3W1SA 2KFKA 3MJWA 3V6EB 5JH5C 5D6JB 1MAIA 4A20A 2K8CA 3KW5B 2NCNA 2M38A 1WZ3A 2Q13A 4J6IA 3ZNZB 2YS3A 2G4DB 3SU8X 3VFKA 3FEHA 3X23A 1WX9A 4IM3A 2MRPA 2ROZB 2KDEB 2UZRA 5CHWA 2W9NA 1WIAA 3DBSA 4L6EA 2JVCA 4LJOB 3K9OB 4HHVA 3KUZA 4MJSA 2KMCA 2JF5A 4WWOA 4GGQA 4W9IA 1H8CA 2DFKA 2AEHA 4MT7A 4OVUA 3L10B 1WXMA 1ZM0A 2I5FA 2PEAA 3SYXA 2ZJDA 1XKEA 2NR2A 2JP2A 4K17A 3A4RA 3R7RA 1BTNA 4EJNA 2LVOA 3ZIMA 2ZPYA 4FJYA 3VXWA 4F8CB 1QC6A 2ZVOA 2DYBA 5C5BB 4A3OA 2D4QA 2KDIA 3JSVA 2M4NA 3QJZA 1TXDA 5KCVA 4AUQC 4DHJB 4W9JA 2OTXA 1V5MA 2DZKA 3NHEB 4BKSA 2D10A 3DPDA 2L00B 4W9KA 1WR6E 2YRYA 4IC7B 2FUHB 4KHAA 5D94A 3ZVVA 4HAUB 2LVPA 5AZGA 3WYFB 1S3SG 2CHWA 2R0DA 3BINA 4W9EA 2ZVNA 4JGHB 4LJPB 3VTWA 2NPTA 1IP9A 2COFA 4GB9A 2CODA 2KX0A 3H7PA 2NBUA 3H1UA 3DVNU 4AP4C 4DHZE 1EO6A 4NJ7A 4BKSD 1K5GB 1XX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVB A;  2PZ1 A;  4Z2N A;  1WJ4 A;  2L2I A;  2J0J A;  3PV1 A;  3L54 A;  3T06 A;  1JRU A;  2CRF A;  1N3H A;  3A33 B;  2A5U A;  3ZO5 B;  3F5R A;  4K1R B;  1EF1 A;  2KC2 A;  1FHW A;  1L2N A;  3BJI A;  1P9D U;  1UNQ A;  2LXC A;  3O65 B;  1OQY A;  5G55 A;  4II2 B;  5C1Z A;  2WX1 A;  4FBJ B;  1TGZ B;  3A98 B;  5HE1 A;  1UBI A;  3N32 A;  4B6H A;  2YT0 A;  4RM9 A;  3SHQ A;  4DBB A;  4HJK A;  3HQC A;  4GMV A;  5FI1 A;  3DXC A;  4B95 A;  1M7R A;  2A4Z A;  3IFW B;  2MX2 A;  4W9H A;  3EHV A;  2LAS A;  2GBK A;  3PLU A;  3ZDM C;  3W1S C;  4KVG B;  4WWN A;  2IO2 B;  1WJ1 A;  3B08 A;  2J59 M;  3DCG A;  2CHX A;  3VUX A;  2Y8F A;  3N3K B;  2D9W A;  4LDT D;  2AL3 A;  2GBJ A;  2LGD A;  1H4R A;  3HM6 X;  1C1Y B;  1KZ7 A;  3WIM A;  2IO1 B;  4B9K A;  3UIO B;  2O2V B;  4XC2 A;  2JZ3 B;  5CHF A;  1SGH A;  1WGY A;  2C9W B;  5AEK B;  1DRO A;  4W9D A;  1E8X A;  3VTU A;  2ZCB A;  5HE0 A;  1WE7 A;  3PSE B;  4KV2 A;  4GDL B;  3R66 C;  4LCD E;  4KSK C;  2RUK B;  1B55 A;  2BPS A;  5CLQ B;  4HWI B;  2MFQ A;  2K1F A;  1EF5 A;  5L81 A;  1IRS A;  4EOY A;  2BKR B;  1V49 A;  2MWS B;  4W9C A;  2Z0E B;  3DQV A;  2AYO B;  1VCB A;  3R7Q A;  1NBF C;  2IY0 B;  4K2P A;  2DHJ A;  2Z59 B;  5GMV A;  2Y5B B;  2D07 B;  3PVW A;  2KN5 A;  3QIJ A;  3PP2 A;  1WE6 A;  4HXD A;  1P0R A;  3DBL I;  1AQC A;  4K7S A;  1WGU A;  2VKI A;  5C5B A;  4GN1 A;  2G4S A;  2XQN M;  5HE3 A;  3D32 A;  3A9J B;  1Q5W B;  2C7M B;  2JRI B;  2C7N B;  3DXD A;  2R09 A;  1MG8 A;  2M17 A;  4WQO B;  3A8Q A;  3ZRC A;  1DDW A;  5DIF B;  1UPQ A;  2YT1 A;  3HM3 A;  5GOW B;  2COC A;  4IWQ A;  3DVG X;  1GC6 A;  3QWM A;  4MH0 E;  2JPH A;  3DBH I;  2L0F A;  2FCS A;  5J18 A;  1V86 A;  4HB4 B;  1V61 A;  4HB0 B;  3VUW A;  1DBH A;  4MGY E;  1WJU A;  3SV1 A;  4DHJ D;  3T8M A;  3AJ4 A;  4IM2 A;  2CU1 A;  2YVC A;  2KFJ A;  5E6O A;  3ULB A;  2PJH A;  3VHT C;  2MLB A;  3SUZ A;  5D3Y A;  2UVM A;  5LON B;  3DVN V;  3OAN A;  2DYQ A;  3DXE A;  2Z0O A;  4DXA B;  2KDF B;  3ZNH B;  1Q1O A;  1H10 A;  2D9Y A;  2GBN A;  2W2W A;  2DYN A;  2NBV B;  4HDO A;  2IYD B;  1WMH A;  2FNJ B;  4NQK E;  1MK7 B;  4GZU A;  3SNH A;  3ZTC A;  4XWX A;  2KQS A;  3FSS A;  3NY5 A;  3DVG Y;  1J0W A;  1U5G A;  4ZDV A;  3PTF C;  4CYE A;  3DOW A;  4TYZ A;  4NY0 A;  3IHP C;  3PRP B;  5JHG A;  2ZZP B;  4P7I A;  4BOS C;  3CIK A;  2P0F A;  2N4F A;  5CLL B;  2LVQ A;  1WX7 A;  1MPH A;  3NS8 A;  2OQB A;  3ULC A;  3RYT A;  1WJM A;  5D3W A;  1X05 A;  2M8S A;  2LJ5 A;  4I6L B;  4LDT B;  1V89 A;  3QHT A;  2DAJ A;  4DBG A;  1PLS A;  2LUL A;  2V1Y A;  2I5C A;  4HAZ B;  4FUL A;  2AWT A;  1AWE A;  3L08 A;  2DHI A;  1WFY A;  4WAA A;  2O2V A;  1OTR B;  2DA0 A;  1VD2 A;  2M14 A;  2ELA A;  2BWF A;  2N9E B;  3MDB C;  1NI2 A;  2D9X A;  3F0W A;  2PPH A;  4WWP A;  1V9J A;  2M1M A;  4EUT A;  5C16 A;  2BKF A;  2C60 A;  3ZTD A;  2DX1 A;  1PQS A;  2NMB A;  5J3T A;  2ZCC A;  2KDB A;  4GDL A;  2DX5 B;  2KX3 A;  1K5D B;  2KWV B;  4GDK B;  4ANW A;  5D7G A;  2L3Z A;  2FAZ A;  3PVL A;  4IAP A;  2XK5 B;  1WXS A;  2YLM A;  2J0K A;  2WX0 A;  2GJY A;  1YJ1 A;  5LXH A;  1HE8 A;  3A8P A;  3RCZ A;  1BAK A;  1J0G A;  2LI5 A;  4URK A;  5KQ1 A;  2OOB B;  1DYN A;  3OAW A;  2ASQ A;  1OY2 A;  3TJP A;  4A6H A;  4JL9 A;  4F7U P;  4BKT A;  2EMT A;  2MBB B;  4K81 A;  1OMW A;  3QWZ B;  4F7Z A;  1ZW7 A;  1WVH A;  3A9J A;  3N7C A;  2YSZ A;  4HCP B;  3ZVR A;  3MHS D;  4EZL A;  5JP4 A;  2ADZ A;  1XQQ A;  1U5E A;  1TQZ A;  1TZ1 A;  4AJW A;  1XR0 B;  1NDD A;  2W2X C;  1KM7 A;  3ODX A;  3KYD D;  3D8F A;  4IG7 B;  4WJP A;  2CR5 A;  2NBW B;  5BO4 B;  2DKP A;  2RR9 A;  1KI1 B;  2FCQ A;  1FGZ A;  3S2A A;  2M0X A;  3VDZ A;  3KUD B;  4MSM B;  3WAN A;  3APF A;  4IWO A;  1LQB A;  2V3S A;  2P0D A;  3LJ3 A;  5JLJ B;  1EUV B;  3T9L A;  2COA A;  2BWE S;  2HTH B;  3TBL D;  1D3Z A;  2DTC A;  3A4S C;  1C3T A;  4TKN A;  4II3 B;  4KZC A;  2JT4 B;  3D8D A;  2K2J A;  2DZM A;  1DDM A;  4RM8 A;  4AWJ A;  1EVH A;  3OLM D;  2BYE A;  1S1Q B;  5EFX A;  4AJY B;  3JW0 X;  5DPR A;  1I7A A;  4F1S A;  3TO1 A;  3WAL A;  5C23 A;  1A5R A;  3QBV B;  2FID A;  1WM3 A;  3A9K B;  1V81 A;  2QHO A;  2GCJ A;  3V6C B;  1OEY J;  1M7E A;  2FCM A;  1ISN A;  2N0Y A;  4NSW A;  2G35 A;  1EAZ A;  4EFO A;  4G11 A;  4PS8 A;  5AZH A;  5HKH A;  1UEF A;  4NJ6 A;  2VSZ A;  3KRX A;  2XEW A;  1RRB A;  4DX9 0;  3K9P B;  4GPT B;  3EFU A;  2ZNV C;  1Z87 A;  3UF8 A;  1UZX B;  2EC1 A;  1ZGU B;  1RRP B;  3DDC B;  2K8H A;  4NPN A;  2KVR A;  2AL6 A;  3ZNI D;  4IM0 A;  2MWN B;  1F9J A;  1V5T A;  4NNJ B;  1Y8R C;  2LWP A;  4YL8 A;  2LGX A;  3PVU A;  1E8Z A;  4MM3 A;  3VQI A;  3CMM B;  2LGY A;  3VH4 B;  2MBE A;  1Y19 B;  2KTR B;  4KAX B;  1IPG A;  4M8M A;  4CHM A;  1MIZ B;  2LYD A;  2D3G A;  3ZLZ A;  1YIW A;  2Z0Q A;  4JIO U;  2IBI B;  2D11 A;  5HE2 A;  4CHK A;  2IY1 B;  4KDI C;  5DHA B;  4IW0 A;  3QAR A;  4ZRK A;  4MGK E;  3CSF A;  3JYU A;  1ZC4 B;  3WA0 A;  4GDK A;  2PE9 A;  4OVV A;  3ECI A;  3L16 A;  4D0N B;  5E6N A;  5DH9 B;  2XK5 A;  1V5U A;  4HK2 A;  4MEM A;  1X1F A;  4HPM B;  3M95 A;  4IOY X;  4GSW A;  2RLO A;  3PHW B;  2UYZ B;  2EJ8 A;  3V5W A;  2C7H A;  2VRR B;  4WSF A;  3PZD A;  2LRU A;  1W1D A;  1U2B A;  3PHX B;  3L17 A;  2KFK B;  2OJR A;  3ZNG C;  3LDZ E;  1U5D A;  1YQB A;  1WJN A;  2KWC A;  2J7Q B;  1MK9 B;  1W1H A;  5L95 C;  2I1J A;  4TQ0 A;  3H6N A;  2LOX A;  3KRW A;  4ANV A;  5EDS A;  2NZ8 B;  2JWZ A;  4M0W B;  5D3X A;  3TMP B;  2RSG A;  1E7U A;  2N7D A;  1UGM A;  3VIA A;  1WGR A;  1K8R B;  1P5T A;  1UPR A;  2GBM A;  1V5P A;  1FHX A;  4MJS B;  3NZU A;  4BVU C;  3VAW A;  3AI5 A;  2WYQ A;  1XD3 B;  1KLV A;  4BBN C;  3ZUN A;  2KTF A;  4A6K A;  5DPS A;  1AAR A;  4HAW B;  2HTH A;  3RCP A;  4PYU A;  2GMI C;  1SIF A;  4YON A;  2K6D B;  1TBE A;  4IWP A;  2YS1 A;  1J8C A;  3RT3 B;  4WVF B;  1WF9 A;  3ALB A;  2LKO A;  4ICV A;  4KDL B;  4BBK A;  4EZK A;  3PRZ A;  1X1M A;  2KOX A;  1ZSQ A;  3PEG A;  5DCN A;  4A5K A;  2N9P C;  4DK5 A;  3RZW C;  4FN2 A;  2E2X A;  4XZ4 A;  3A9K A;  3APD A;  1SE9 A;  2CHZ A;  3V62 A;  3HIZ A;  1Y5O A;  1DDV A;  3V61 A;  4BKG A;  3L0W B;  2RSU A;  2ZEQ A;  1WH3 A;  4TUU A;  2EKE C;  1XT9 B;  1TTN A;  4E71 A;  2JZZ A;  1KOT A;  4DDI D;  1WGQ A;  3VOQ A;  3AU4 A;  3ML4 A;  2MKR A;  2MSE D;  1OQN A;  1WRD B;  4DDG D;  1Z2M A;  2LXA A;  3BY4 B;  3L13 A;  4K7U A;  3ODW A;  2DHK A;  4PQ0 A;  2KCJ A;  4WJN A;  1Z5S B;  2VRW B;  4JLC A;  5CX3 A;  3MTN B;  4HAY B;  3VVW B;  5J2R A;  2ROV A;  1OEY A;  3KSY A;  2QKM A;  5FI0 A;  2KAN A;  3RUI B;  3RD2 A;  4ANX A;  1GUA B;  2Z0D B;  2KTR A;  1LB1 A;  2G45 B;  2D9Z A;  4ZYN A;  2H7E A;  3N30 A;  4HAT B;  1P1A A;  1WM2 A;  1U27 A;  4FA6 A;  2KK8 A;  2DEN B;  3W1Y A;  3SD5 A;  4MY6 A;  3KVF B;  2L8J A;  3U8Z A;  2MP2 B;  4HCN B;  3CF6 E;  2K8B A;  2RPQ A;  3MPX A;  3DBR I;  3CST A;  4E3C A;  2KMA A;  2JXX A;  2B3A A;  3VTV A;  4I6N B;  2D2Q A;  1UH6 A;  2UWQ A;  2MW5 A;  4PS7 A;  1EGX A;  3IBE A;  2P8V A;  3Q3F A;  5D27 A;  4MSQ B;  3KYC D;  4X57 B;  1WR1 A;  3M1I B;  3CXB B;  2KHW B;  1CMX B;  4W9L A;  4A6F B;  1FAO A;  4EKU A;  1X11 A;  4FJZ A;  2EMS A;  4EMO A;  3QAQ A;  5FR6 A;  4KIK B;  3H9D A;  1ZVR A;  2RGN B;  4MGZ E;  5C79 A;  2MBQ A;  2ELB A;  3H7S A;  1WXA A;  2WDT B;  1SHC A;  1RJ2 A;  4EZJ A;  4CHJ A;  2BGF A;  2KC1 A;  3WAO A;  1WI0 A;  4GMX B;  3PLV A;  5J3Q A;  2V4L A;  1BT0 A;  1GC7 A;  1MIX A;  3ODO A;  3B1L X;  3QQ8 B;  5J3Y A;  2KJR A;  3NSU A;  4G50 A;  3HHM A;  1UEL A;  1WYW B;  1GNU A;  2KGX B;  4B6W A;  4DWF A;  2D9V A;  4BBN F;  2V76 A;  4DX8 A;  1ZC3 B;  4JQW C;  3G9W A;  4G3X B;  5LXI B;  2XBB C;  4W9F A;  3Q3J A;  5JHA A;  3PT2 B;  2DYO A;  1KJT A;  4CO7 A;  2KJH B;  1PFJ A;  3VH3 B;  4GU2 A;  1IYF A;  1WXV A;  1FOE A;  3JVZ X;  2O6V B;  1WX8 A;  1R4N I;  4NAW B;  3TL5 A;  1XCG A;  2K25 A;  2CY4 A;  2MA9 B;  2WWZ A;  2L05 A;  3GZN I;  3P2B A;  1BWN A;  2N1W A;  4H8S A;  5DPW A;  2DAF A;  4PS3 A;  3UQB A;  1V88 A;  2MDX A;  4WJO A;  2UZS A;  1OGW A;  3ZRF A;  4FHK A;  3AUL A;  5DI9 B;  1P3R A;  2GS0 A;  4MGI E;  4RMA A;  4DHZ B;  2HE7 A;  5JHH A;  3UQA A;  3QK0 A;  3TVV A;  3HW2 B;  4BFR A;  2N23 A;  2MQJ A;  3PGE A;  2JY6 A;  2L1C A;  3M63 B;  2KXJ A;  4KHB B;  3GOE A;  1V2Y A;  4MDK E;  4KHO A;  3R3M A;  2IO3 B;  2J0M A;  1NU2 A;  4ZRI A;  2NVU I;  2KWU B;  2DN6 A;  1WI1 A;  3EEC A;  2BCJ A;  3P6A A;  2RD0 A;  5CTR C;  4HAV B;  3O96 A;  1WMH B;  1GJZ A;  2Z0P A;  4F7G A;  4A3P A;  2DHZ A;  4TV3 A;  3ZW3 A;  4HDQ A;  3PPA A;  3UIN B;  3B0A A;  1PMS A;  2KNB A;  2I1K A;  2MP2 A;  2NS5 A;  1XD4 A;  1R4M I;  1TJ6 A;  1I42 A;  1LXD A;  3M3J A;  3M62 B;  4N9F 4;  2LG1 A;  2K00 A;  2YS5 A;  1QQG A;  2BYV E;  5LOP B;  1WGG A;  1FGY A;  3C0R B;  4XX5 A;  1J19 A;  3TIX A;  2KLC A;  4ICU A;  3QC8 B;  1T0Y A;  2DX5 A;  4WJ7 A;  4K2O A;  4GOC A;  1FHO A;  1Q67 A;  4M8N A;  2ZNV B;  4HPL B;  3TFM A;  3IVF A;  4A6F A;  1GG3 A;  1L7Y A;  2BYF A;  2CKH B;  3QX1 A;  1YD8 U;  4FHJ A;  2KD0 A;  3A1Q B;  5G2N A;  4E74 A;  2BF8 B;  1U29 A;  3ML8 A;  3UIP B;  1FXT B;  4TQ1 A;  4KIK A;  4FAD A;  2PE6 B;  3QCA A;  3KUC B;  1P6S A;  1P3Q U;  1X86 A;  4KSL C;  2DZI A;  5JHB A;  3APC A;  4G0N B;  4PNK A;  5CHV C;  1G6J A;  1BTK A;  4FJV B;  3U7D A;  4AOF A;  2FCN A;  5LLI A;  1UBQ A;  2CAY A;  2DYM A;  3D8E A;  5DHF B;  2IFS A;  3PRE A;  2IO0 B;  4MEL A;  4HLE A;  1WJ6 A;  4EEW A;  2L76 A;  2N7E A;  1P98 A;  2KJ6 A;  4BOZ B;  2KUP A;  5E6P A;  3GYO A;  4W9G A;  5L83 A;  1LW3 A;  4PYZ A;  1Q0W B;  5KQ4 A;  2K6Q A;  3NOB A;  1E5W A;  1E8Y A;  1WY8 A;  4ZRJ A;  4GIV A;  2O6V A;  1YX6 B;  4NAW A;  2JUO A;  2QKL A;  3UZT A;  5C6R A;  2MBO A;  2G3Q B;  2JRH A;  5IA7 A;  1NTY A;  2MCN B;  4HB2 B;  2R2O A;  5KHQ A;  2K2U A;  2RGF A;  1NTV A;  3AU5 A;  2KQ7 A;  2CS4 A;  1I2H A;  3ENE A;  1V5O A;  2RVB B;  4IUM B;  2P0H A;  3RZF A;  3I3T B;  1M94 A;  4FLH A;  2LUE A;  2LRW A;  3RUL A;  2DLW A;  3P7Z A;  1WGH A;  3ZDT A;  1MKE A;  2L7R A;  1I35 A;  2O6V D;  3JSV B;  5D2M B;  1LM8 B;  4GXB A;  3ONS A;  3KZ1 A;  1KZG A;  2K39 A;  3V60 A;  2IYB A;  4HB3 B;  3SDL C;  2N9X A;  3PS6 A;  1U5F A;  2W2X D;  2FIF A;  2HD5 B;  3GYP A;  2NPT B;  1E90 A;  2L0T A;  2Y8G A;  5D3V A;  3VUY A;  2KLG A;  3ML9 A;  5IAA C;  4KZ0 A;  4I6P A;  2REX A;  3H7P B;  3EC8 A;  4Y94 A;  5AZF A;  2LD9 A;  3PSC A;  3OJ4 B;  3WAM A;  2GCL A;  3U30 A;  2LZ6 A;  2N1V A;  2CY5 A;  2KKC A;  2H7D A;  1E8W A;  2LOZ A;  4ANU A;  1X1G A;  1QZE A;  1V6E A;  4ASW C;  3PG7 A;  2YF0 A;  2C5L C;  4C0A A;  3WAP A;  2ZPN A;  1RFA A;  4Z2M B;  1WG7 A;  3HK0 A;  3PRM B;  5DPT A;  2RNR B;  1UNR A;  4HAX B;  2HJ8 A;  3KY9 A;  3QA8 A;  1RLF A;  3NZS A;  3FM8 C;  1YX5 B;  2GOW A;  2DKQ A;  1LFD A;  3ZKJ C;  2DZJ A;  1WZ0 A;  2FJL A;  1RAX A;  3AXC A;  2KZR A;  2GBR A;  5KHO A;  4IFS A;  4F7H A;  1XOD A;  1WGD A;  5TR5 A;  3SO6 A;  1V80 A;  4K7W A;  5JZE B;  2IZV B;  3UGB B;  2Y7B A;  1UNP A;  4WJQ A;  1W1G A;  1U4A A;  3KH0 A;  5J17 A;  3LJU X;  2KO3 A;  1E7V A;  2R2Q A;  3A1Q A;  4MK0 A;  3X0W A;  3TW1 A;  3TCA A;  1ZKH A;  2X18 A;  1FB8 A;  2MBH A;  3IG3 A;  3OJ3 A;  1UD7 A;  4NQL B;  3W1S A;  2KFK A;  3MJW A;  3V6E B;  5JH5 C;  5D6J B;  1MAI A;  4A20 A;  2K8C A;  3KW5 B;  2NCN A;  2M38 A;  1WZ3 A;  2Q13 A;  4J6I A;  3ZNZ B;  2YS3 A;  2G4D B;  3SU8 X;  3VFK A;  3FEH A;  3X23 A;  1WX9 A;  4IM3 A;  2MRP A;  2ROZ B;  2KDE B;  2UZR A;  5CHW A;  2W9N A;  1WIA A;  3DBS A;  4L6E A;  2JVC A;  4LJO B;  3K9O B;  4HHV A;  3KUZ A;  4MJS A;  2KMC A;  2JF5 A;  4WWO A;  4GGQ A;  4W9I A;  1H8C A;  2DFK A;  2AEH A;  4MT7 A;  4OVU A;  3L10 B;  1WXM A;  1ZM0 A;  2I5F A;  2PEA A;  3SYX A;  2ZJD A;  1XKE A;  2NR2 A;  2JP2 A;  4K17 A;  3A4R A;  3R7R A;  1BTN A;  4EJN A;  2LVO A;  3ZIM A;  2ZPY A;  4FJY A;  3VXW A;  4F8C B;  1QC6 A;  2ZVO A;  2DYB A;  5C5B B;  4A3O A;  2D4Q A;  2KDI A;  3JSV A;  2M4N A;  3QJZ A;  1TXD A;  5KCV A;  4AUQ C;  4DHJ B;  4W9J A;  2OTX A;  1V5M A;  2DZK A;  3NHE B;  4BKS A;  2D10 A;  3DPD A;  2L00 B;  4W9K A;  1WR6 E;  2YRY A;  4IC7 B;  2FUH B;  4KHA A;  5D94 A;  3ZVV A;  4HAU B;  2LVP A;  5AZG A;  3WYF B;  1S3S G;  2CHW A;  2R0D A;  3BIN A;  4W9E A;  2ZVN A;  4JGH B;  4LJP B;  3VTW A;  2NPT A;  1IP9 A;  2COF A;  4GB9 A;  2COD A;  2KX0 A;  3H7P A;  2NBU A;  3H1U A;  3DVN U;  4AP4 C;  4DHZ E;  1EO6 A;  4NJ7 A;  4BKS D;  1K5G B;  1XX0 A; 
#chains in the Genus database with same CATH topology
 2DWQ A;  3P42 A;  4HVB A;  1EM7 A;  2PZ1 A;  2RRF A;  4C7Y A;  2JWU A;  5IRS A;  4Z2N A;  3NVZ A;  5M4Y B;  1WJ4 A;  2QCZ A;  2L2I A;  3NG0 A;  4RFB A;  2J0J A;  3PV1 A;  3L54 A;  3T06 A;  1JRU A;  2CRF A;  3T3N A;  1N3H A;  2KYW A;  3A33 B;  1HTQ A;  2A5U A;  3ZO5 B;  5C2T B;  3E56 A;  2AQ3 B;  3F5R A;  4K1R B;  1EF1 A;  2E3T A;  2KC2 A;  2XN9 C;  1FHW A;  1L2N A;  3BJI A;  1P9D U;  1UNQ A;  2LXC A;  3O65 B;  1OQY A;  5G55 A;  3E9S A;  4II2 B;  5C1Z A;  2WX1 A;  1QOB A;  4FBJ B;  1TGZ B;  3A98 B;  1ROE A;  5HE1 A;  5JXV A;  3N20 C;  1UBI A;  1FNU A;  3U7Z A;  3ZXV A;  4A90 A;  3N32 A;  4B6H A;  2YT0 A;  4RM9 A;  1A70 A;  3SHQ A;  4DBB A;  5MPO A;  2BS2 B;  2PVG C;  4HJK A;  3AE1 B;  3IT4 B;  1J7C A;  1FNV A;  3HQC A;  4GMV A;  5FI1 A;  3DXC A;  1EWY C;  3NW8 A;  4B95 A;  1M7R A;  2A4Z A;  4L1R A;  2V9H A;  3IFW B;  2MX2 A;  4W9H A;  3EHV A;  2LAS A;  2GBK A;  1L6U A;  2YEP F;  3PZ8 A;  2CJN A;  3P4R B;  3PLU A;  3ZDM C;  3W1S C;  3AE5 B;  4KVG B;  2WP9 B;  1TJE A;  4WWN A;  2IO2 B;  1WJ1 A;  1FNW A;  1JWM D;  3B08 A;  2J59 M;  3AE6 B;  2CHX A;  3DCG A;  3VUX A;  3MC9 A;  2Y8F A;  3N3K B;  4A55 A;  2D9W A;  4LDT D;  2AL3 A;  1ZYI A;  2GBJ A;  4LNF A;  5C3J B;  1VRA B;  4A9A A;  2LGD A;  1H4R A;  1PUT A;  1ENF A;  1YN3 A;  1QF6 A;  2N9L A;  3HM6 X;  1C1Y B;  3AB5 A;  1KZ7 A;  3WIM A;  2IO1 B;  3P4Q B;  4B9K A;  3UIO B;  3W9C B;  3DCX A;  2O2V B;  4XC2 A;  1XXG A;  2JZ3 B;  5CHF A;  1SGH A;  2JYT A;  1WGY A;  2C9W B;  5AEK B;  1DRO A;  2RMM A;  4W9D A;  1E8X A;  2TSS A;  4JPS A;  3VTU A;  2ZCB A;  5HE0 A;  1WE7 A;  1SE4 A;  3PSE B;  4KV2 A;  4GDL B;  3R66 C;  4LCD E;  4KSK C;  2RUK B;  3BK2 A;  1B55 A;  2BPS A;  5CLQ B;  4HWI B;  2MFQ A;  2K1F A;  3IXS A;  1EF5 A;  1RWS A;  5L81 A;  1IRS A;  2D5G A;  1TS2 A;  4EOY A;  1MHH E;  2BKR B;  4ACF A;  1V49 A;  2MWS B;  4W9C A;  2Z0E B;  3DQV A;  2AYO B;  1VCB A;  3R7Q A;  2DNF A;  1NBF C;  5GXG B;  4YXD B;  2IY0 B;  4K2P A;  2DHJ A;  2Z59 B;  1KRH A;  4JWS C;  2Y5B B;  5GMV A;  1GB4 A;  2D07 B;  3PVW A;  2KN5 A;  3QIJ A;  4A8X C;  3PP2 A;  1WE6 A;  3MC0 B;  4HXD A;  1P0R A;  3DBL I;  1AQC A;  4K7S A;  1WGU A;  2VKI A;  1ET6 A;  1YJJ A;  2GRI A;  2R2Y A;  5C5B A;  1QLB B;  4GN1 A;  2G4S A;  2XQN M;  5HE3 A;  4ZOH C;  3D32 A;  5EE9 A;  3A9J B;  1PFD A;  1C4A A;  1Q5W B;  2C7M B;  2JRI B;  2G9H D;  4M01 A;  2C7N B;  3DXD A;  2R09 A;  1MG8 A;  2M17 A;  1FO4 A;  4WQO B;  3A8Q A;  3ZRC A;  1DDW A;  5DIF B;  1UPQ A;  2YT1 A;  3ZQ4 A;  3HM3 A;  5GOW B;  1VZ8 A;  1ZDX A;  2COC A;  4IWQ A;  4YWG G;  3DVG X;  1GC6 A;  3QWM A;  4MH0 E;  4HRS A;  2JPH A;  3DBH I;  2L0F A;  2FCS A;  1SEB D;  5J18 A;  1V1O A;  1V86 A;  4HB4 B;  1V61 A;  4HB0 B;  3VUW A;  1DBH A;  1XCT L;  2VZK D;  3AEG B;  4MGY E;  1WJU A;  1UNS A;  4CQN A;  2WXN A;  5EE0 A;  3N1Z C;  3ZYY X;  4TSS A;  1R7S A;  2J4X A;  3SV1 A;  4DHJ D;  1N6Z A;  3T8M A;  3AJ4 A;  4IM2 A;  2LHD A;  2CU1 A;  4D2K A;  2YVC A;  4JE3 B;  4S17 A;  2KFJ A;  5E6O A;  3BWU D;  3ULB A;  2PJH A;  3VHT C;  3AH7 A;  3BZD B;  1ZDV A;  2MLB A;  3SUZ A;  1UGJ A;  5D3Y A;  2HJ1 A;  2UVM A;  3TEW A;  1EU4 A;  4MT5 A;  5LON B;  4HKQ A;  3DVN V;  3OAN A;  2DYQ A;  3DXE A;  5HHD G;  2J52 A;  4YTM B;  2Z0O A;  4DXA B;  2KDF B;  1I4H A;  4WH4 A;  3ZNH B;  1FEH A;  2NMQ A;  3BII D;  3I57 A;  1Q1O A;  1H10 A;  2D9Y A;  2V3P A;  2GBN A;  4YSX B;  2W2W A;  2DYN A;  2NBV B;  1MFW A;  4RGM A;  2K22 A;  4HDO A;  3Q3N C;  1SJE D;  2IYD B;  1WMH A;  2FNJ B;  4NQK E;  4LTU A;  2BYT A;  1MK7 B;  4GZU A;  3SNH A;  1GOZ A;  3ZTC A;  4XWX A;  2KQS A;  3EA6 A;  3FSS A;  3NY5 A;  3DVG Y;  1YOV B;  4ARC A;  1KLG D;  1J0W A;  3LB8 C;  1U5G A;  4P1B C;  4ZDV A;  3PTF C;  1JAL A;  4CYE A;  3DOW A;  4TYZ A;  4NY0 A;  1FFV A;  3IHP C;  3PRP B;  4RH6 A;  5JHG A;  3Q14 C;  2ZZP B;  2GI9 A;  1SF0 A;  4P7I A;  4BOS C;  3CIK A;  2P0F A;  2N4F A;  5CLL B;  4NZL B;  2LVQ A;  1WX7 A;  1JML A;  1MPH A;  3NS8 A;  2OQB A;  3ULC A;  3RYT A;  1GB1 A;  1WJM A;  5D3W A;  5AUK A;  1WXQ A;  1X05 A;  2M8S A;  2LJ5 A;  2WHI A;  1V8C A;  4I6L B;  1F1H A;  3AV8 A;  4LDT B;  4LLG M;  1V89 A;  3IT6 B;  2QIL A;  3N1X C;  2WXJ A;  3QHT A;  2DAJ A;  4DBG A;  1PLS A;  4KGS A;  2LUL A;  2V1Y A;  2I5C A;  4HAZ B;  4FUL A;  2AWT A;  3NWD A;  3HVD A;  4MM3 B;  1AWE A;  1J7A A;  3L08 A;  2DHI A;  4K3B A;  1WFY A;  1CJE A;  4OT1 A;  2D3A A;  4P1C C;  4WAA A;  2O2V A;  1OTR B;  2DA0 A;  1VD2 A;  2M14 A;  2ELA A;  2BWF A;  2IDY A;  2N9E B;  3MDB C;  1NI2 A;  2K0P A;  3GP7 A;  2D9X A;  2PPH A;  3F0W A;  1OFF A;  1VJK A;  1V9J A;  4WWP A;  2M1M A;  4EUT A;  5C16 A;  2BKF A;  2PTL A;  2C60 A;  3Q3M C;  3ZTD A;  2DX1 A;  1PQS A;  2NMB A;  5J3T A;  2ZCC A;  2KDB A;  4GDL A;  2DX5 B;  2KX3 A;  2WXK A;  2G1E A;  1K5D B;  2KWV B;  3BK1 A;  4GDK B;  4ANW A;  5D7G A;  2IND C;  3RNC C;  1ESF A;  2L3Z A;  2FAZ A;  3PVL A;  4IAP A;  2XK5 B;  2WXI A;  4XYC A;  1SIJ A;  1WXS A;  5AUI A;  2YLM A;  2J0K A;  2WX0 A;  2GJY A;  2Z59 A;  1YJ1 A;  2Z8L A;  5LXH A;  3GB1 A;  1HE8 A;  1IBX B;  3A8P A;  2WLB A;  4YSY B;  3RCZ A;  1VLB A;  1BAK A;  1J0G A;  2LI5 A;  4URK A;  5KQ1 A;  2OOB B;  1DYN A;  1FMA D;  1HXY D;  3WCQ A;  3OAW A;  2ASQ A;  2SEB D;  1OY2 A;  2MJD A;  5HI1 A;  3TJP A;  4A6H A;  4JL9 A;  4IKG A;  4F7U P;  4BKT A;  2EMT A;  2MBB B;  4YTN B;  4K81 A;  1OMW A;  3QWZ B;  4F7Z A;  1ZW7 A;  2WS3 B;  1WVH A;  3A9J A;  3N7C A;  2YSZ A;  1WSP A;  4HCP B;  4WWM A;  3ZVR A;  4C4V B;  4TMA B;  2WGS A;  1WWT A;  3MHS D;  4EZL A;  5JP4 A;  2ADZ A;  3L4P A;  1XQQ A;  1U5E A;  1TQZ A;  1UF0 A;  1TZ1 A;  4AJW A;  1XR0 B;  1NDD A;  2N0S B;  2L52 A;  2W2X C;  1KM7 A;  3RNB C;  3NZ3 A;  2L1A A;  4L1B A;  2DBY A;  3ODX A;  5T8I A;  3KYD D;  3D8F A;  4IG7 B;  4WJP A;  2CR5 A;  2NBW B;  1SSN A;  5BO4 B;  3P1M A;  2DKP A;  3RPF C;  2J53 A;  2RR9 A;  2ZW0 A;  1KI1 B;  2PIA A;  2FCQ A;  2KR0 A;  1FGZ A;  3S2A A;  1JWS D;  3U52 E;  1AW7 A;  4ZHP A;  1FXA A;  2M0X A;  2KAJ A;  3KUD B;  3VDZ A;  4MSM B;  1TY0 A;  1ET9 A;  1N62 A;  3APF A;  4IWO A;  3WAN A;  1LQB A;  3AE2 B;  2V3S A;  4JWU C;  1VDV A;  2P0D A;  3LJ3 A;  5JLJ B;  1N5W A;  4IOI E;  5I2M A;  3NUH B;  3HIE A;  1EUV B;  1V97 A;  2W82 A;  3T9L A;  2COA A;  1C4P A;  2BWE S;  2HTH B;  2PVO D;  3TBL D;  1D3Z A;  4C7Z A;  2DTC A;  4XE0 A;  3A4S C;  1C3T A;  4TKN A;  4RGN A;  4II3 B;  4KZC A;  2JT4 B;  3D8D A;  2K2J A;  2DZM A;  1DDM A;  4RM8 A;  4AWJ A;  1EVH A;  3OLM D;  2BYE A;  4GNK B;  3NVW A;  1S1Q B;  2RDH A;  5EFX A;  4AJY B;  3JW0 X;  4N59 A;  1TYG B;  5DPR A;  2FJU B;  1PGA A;  1F2R I;  1I7A A;  3FIL B;  2I2Y A;  5EE3 A;  4F1S A;  3RNG C;  2NBV A;  4QJ4 B;  4OZB A;  3TO1 A;  3WAL A;  5C23 A;  1A5R A;  3TEX A;  1GPX A;  3QBV B;  3I9V 1;  2KUQ A;  1Q10 A;  2FID A;  1WM3 A;  3P4S B;  3A9K B;  1V81 A;  2QHO A;  2GCJ A;  4OW0 A;  3V6C B;  1XLQ A;  3ZJU A;  1OEY J;  1M7E A;  2FCM A;  1ISN A;  2N0Y A;  4NSW A;  1MJD A;  2G35 A;  1EAZ A;  4EFO A;  3Q2A C;  4G11 A;  3C8Y A;  1KTK A;  4PS8 A;  5AZH A;  5HKH A;  1UEF A;  4NJ6 A;  1AN8 A;  3R2T A;  2VSZ A;  2K3U A;  2WDR B;  3KRX A;  4RCO A;  3IAM 1;  3ETR A;  2XEW A;  1YNT E;  1ZXI A;  1RRB A;  4LNK A;  2IPK D;  4DX9 0;  3FVC A;  3K9P B;  4OHJ A;  4WUR A;  4GPT B;  3EFU A;  2ZNV C;  1Z87 A;  3UF8 A;  1K52 A;  1UZX B;  4DXG A;  3DHI C;  5EE1 A;  2EC1 A;  1ZGU B;  2ON8 A;  1RRP B;  3DBR B;  3DDC B;  2W55 A;  3AMZ A;  4NJC A;  2K8H A;  4NPN A;  2KVR A;  2AL6 A;  3ZNI D;  4IM0 A;  3RI7 C;  2MWN B;  4DIX A;  1F9J A;  1V5T A;  4NNJ B;  1Y8R C;  2LWP A;  4YL8 A;  2LGX A;  3PVU A;  1E8Z A;  3R2I A;  1KH0 A;  4MM3 A;  3VQI A;  3CMM B;  2LGY A;  1V1P B;  1RFK A;  3Q6B A;  1CK1 A;  2MBE A;  2NTT A;  3VH4 B;  1Y19 B;  2KTR B;  4KAX B;  1IPG A;  4M8M A;  4CHM A;  1QT9 A;  2MHJ A;  1MIZ B;  2CJO A;  1L0V B;  2LYD A;  2D3G A;  3MP9 A;  4XWW A;  3ZLZ A;  1YIW A;  2Z0Q A;  4JIO U;  2IBI B;  2D11 A;  2EKI A;  1NYR A;  3U12 A;  5HE2 A;  3MJ5 A;  4CHK A;  2ACZ B;  3V3X A;  4IDI A;  2IY1 B;  3KLS X;  5TSS A;  4KDI C;  5DHA B;  4IW0 A;  3QAR A;  4ZRK A;  2ZKM X;  2JXT A;  4MGK E;  2GB1 A;  3CSF A;  3JYU A;  1ZC4 B;  3LXF A;  3WA0 A;  2EEL A;  4GDK A;  2PE9 A;  4OVV A;  3ECI A;  1K50 A;  3L16 A;  1KF6 B;  4D0N B;  5E6N A;  5DH9 B;  2XK5 A;  1V5U A;  4HK2 A;  4MEM A;  1X1F A;  2BT6 A;  1RYJ A;  3C19 A;  4HPM B;  3URY A;  3M95 A;  3DHH C;  2JX5 A;  3ABV B;  4IOY X;  4GSW A;  2RLO A;  3PHW B;  3SFD B;  1IBX A;  3N9Y C;  4RGT A;  1AWD A;  1FRD A;  1UWX A;  3HUI A;  4WQM A;  2UYZ B;  4ITK A;  2EJ8 A;  3V5W A;  2C7H A;  2VRR B;  5IO9 A;  2DLB A;  4WSF A;  3T3O A;  3PZD A;  2LRU A;  1W1D A;  3KWV A;  1U2B A;  3PHX B;  3L17 A;  2KFK B;  2OJR A;  3ZNG C;  3LDZ E;  1U5D A;  1YQB A;  1WJN A;  2KWC A;  2J7Q B;  1NYQ A;  2MJ3 A;  2FE8 A;  2JSV X;  2KQ4 X;  4Q2J A;  1DGJ A;  1TKY A;  1MK9 B;  2ONQ A;  1W1H A;  4C4V A;  5L95 C;  2I1J A;  1ZXH A;  4TQ0 A;  5FK9 C;  3H6N A;  2LOX A;  1MVK A;  4GOU A;  1T6B X;  3KRW A;  4ANV A;  4HEA 1;  5EDS A;  2NZ8 B;  3P63 A;  2JWZ A;  4M0W B;  5E6J A;  1T77 A;  5D3X A;  3TMP B;  2RSG A;  1E7U A;  2N7D A;  1N60 A;  1CQV A;  3OG5 A;  1R4N B;  1UGM A;  2KWD A;  4ZHO A;  3VIA A;  1I4Q A;  1WGR A;  1K8R B;  1P5T A;  1UPR A;  3GZN B;  2GBM A;  1V5P A;  1DOY A;  4KKI A;  2PW9 A;  1FHX A;  4MJS B;  3NZU A;  3GE8 C;  4QJ3 B;  4BVU C;  3V05 A;  3VAW A;  3AI5 A;  3Q8B A;  2WYQ A;  1PDX A;  1XD3 B;  1B9R A;  3AEF B;  3EUB 2;  1KLV A;  4BBN C;  3ZUN A;  2LJI A;  3OHM B;  2KTF A;  4A6K A;  2IGD A;  3W2D A;  1FXI A;  5DPS A;  1AAR A;  4HAW B;  2HTH A;  3BYY B;  3RCP A;  1I7H A;  4PYU A;  2GMI C;  1I4X A;  1SIF A;  3HSA A;  3NJT A;  4YON A;  2K6D B;  1TBE A;  4IWP A;  4US8 A;  1YJI A;  4QAY A;  2YS1 A;  1J8C A;  3RT3 B;  5BMG A;  2WXL A;  1XLN A;  4WVF B;  1WF9 A;  3NVY A;  3ALB A;  2LKO A;  1D5Z C;  4ICV A;  1WRI A;  4KDL B;  1OQQ A;  2D3C A;  4BBK A;  4EZK A;  3IAS 1;  2PMV A;  3PRZ A;  4L23 A;  1X1M A;  1NEK B;  3AEE B;  2KOX A;  2OHF A;  1ZSQ A;  3PEG A;  3FIL A;  5DCN A;  4A5K A;  1QOA A;  2N9P C;  2QJL A;  4DK5 A;  3RZW C;  4FN2 A;  2E2X A;  1ACC A;  4XZ4 A;  4LK0 M;  1I4G A;  3A9K A;  3APD A;  1SE9 A;  2CHZ A;  3V62 A;  2FBW B;  3HIZ A;  1Y5O A;  2LEK A;  1DDV A;  3V61 A;  4BKG A;  3L0W B;  4CSQ A;  2RSU A;  2ZEQ A;  3EFC A;  1WH3 A;  4TUU A;  2EKE C;  1E9M A;  1XT9 B;  1TTN A;  4E71 A;  2JZZ A;  1BUI C;  2M56 B;  1KOT A;  1ZP0 B;  2IGH A;  4DDI D;  1WGQ A;  4R3D A;  3VOQ A;  4QXA B;  2Y3A A;  3AU4 A;  1F52 A;  3BVG A;  3W5V B;  3ML4 A;  1ZPS A;  2MKR A;  4M02 A;  4YTP B;  2MSE D;  1OQN A;  1WRD B;  4DDG D;  1Z2M A;  2AX5 A;  3NS1 A;  3MC8 A;  2W3S A;  5IP4 D;  1XCQ L;  2JZP A;  1N5X A;  2LXA A;  1PGX A;  3BY4 B;  2WXQ A;  2Y5C A;  3L13 A;  4K7U A;  3ODW A;  2DHK A;  4PQ0 A;  2V0G A;  2KCJ A;  4WJN A;  4B0E A;  1Z5S B;  1R4M B;  2VRW B;  4JLC A;  2VH1 A;  5CX3 A;  3Q8A A;  3MTN B;  4HAY B;  3VVW B;  1SB3 C;  2KT7 A;  3KQ4 A;  2K8E A;  1IGD A;  3I63 C;  5J2R A;  2ROV A;  1OEY A;  5I4D A;  3KSY A;  2QKM A;  5FI0 A;  2KAN A;  3RUI B;  1V1P A;  3RD2 A;  4ANX A;  1GUA B;  1JWU D;  2Z0D B;  2KTR A;  2H89 B;  1QKZ A;  1QIL A;  1LB1 A;  4UDU C;  2JU6 X;  2G45 B;  2D9Z A;  4ZYN A;  2H7E A;  1UWM A;  3N30 A;  4HAT B;  1P1A A;  1WM2 A;  2GUM A;  1U27 A;  4FA6 A;  2KK8 A;  4K3C A;  2DEN B;  3W1Y A;  3SD5 A;  4MY6 A;  1FFU A;  3KVF B;  2L8J A;  3U8Z A;  2MP2 B;  4HCN B;  3CF6 E;  2K8B A;  4NAM A;  2RPQ A;  3MPX A;  1CZP A;  3DBR I;  4HKZ E;  3CST A;  4E3C A;  2KMA A;  1TT5 B;  2JXX A;  2B3A A;  3VTV A;  1DYQ A;  4I6N B;  2D2Q A;  1UH6 A;  2UWQ A;  1YN4 A;  2MW5 A;  4OZA A;  4PS7 A;  3VR8 B;  1EGX A;  3IBE A;  2P8V A;  3Q3F A;  5D27 A;  1HTO A;  2ICI A;  3KYC D;  4MSQ B;  1FIQ A;  4X57 B;  1WR1 A;  3O13 A;  3M1I B;  5IOI A;  5FKA C;  1FCC C;  1XLO A;  2UU7 A;  3CXB B;  4N6E B;  2KHW B;  1CMX B;  4W9L A;  4A6F B;  1FAO A;  1KLU D;  5IKC M;  1J7B A;  1KFY B;  4EKU A;  1GAQ B;  1X11 A;  1NEN B;  4FJZ A;  2EMS A;  1WYG A;  2WXR A;  4LNI A;  4DXF A;  4RF0 A;  4EMO A;  3QAQ A;  5FR6 A;  1N61 A;  2Z14 A;  4KIK B;  4KX6 B;  3H9D A;  2YEP B;  1ZVR A;  2RGN B;  4MGZ E;  5BYS A;  4HRO A;  5C79 A;  1E10 A;  4QJ5 B;  2MBQ A;  1JW9 D;  2ELB A;  4M0W A;  3H7S A;  1WXA A;  2WDT B;  4C56 C;  1SHC A;  1RJ2 A;  4EZJ A;  4CHJ A;  2E6X A;  2BGF A;  3PO0 A;  2KC1 A;  3WAO A;  4KGT A;  2WXG A;  1WI0 A;  4GMX B;  3PLV A;  1LGR A;  2Z4D A;  5J3Q A;  5I2S A;  2V4L A;  1BT0 A;  1RM6 C;  1GC7 A;  1MIX A;  3ODO A;  3B1L X;  2WDV B;  3QQ8 B;  2JYE A;  1NI3 A;  3CWI A;  1T3Q A;  2PLP A;  5J3Y A;  2KJR A;  3NSU A;  4G50 A;  3HHM A;  1UEL A;  1WYW B;  4USA A;  2RDG A;  1GNU A;  1I4R A;  5G5H A;  2KGX B;  4B6W A;  2J42 A;  4DWF A;  2D9V A;  4BBN F;  3AE3 B;  2V76 A;  3DBH B;  4DX8 A;  1ZC3 B;  4JQW C;  2KDM A;  3G9W A;  3PZ7 A;  4G3X B;  2RPV A;  2R61 A;  2MEK A;  5LXI B;  2XBB C;  4W9F A;  3Q3J A;  3Q8E A;  5JHA A;  3PT2 B;  3Q8F A;  2DYO A;  1KJT A;  4CO7 A;  2KJH B;  1PFJ A;  3B2G A;  3VH3 B;  4GU2 A;  1IYF A;  3NVV A;  1WXV A;  1FOE A;  1HA5 A;  3JVZ X;  2O6V B;  1WX8 A;  1R4N I;  4NAW B;  3TL5 A;  1XCG A;  2K25 A;  2CY4 A;  2MA9 B;  2WWZ A;  3TUO A;  2BB5 A;  1FM0 D;  2L05 A;  2HTM E;  3GZN I;  2INC C;  3P2B A;  1BWN A;  2N1W A;  3KWL A;  2AQ1 B;  4H8S A;  5IN7 A;  5DPW A;  3VRB B;  2DAF A;  4PS3 A;  2WXP A;  3UQB A;  1V88 A;  2MDX A;  4WJO A;  2W3R A;  2UZS A;  1E0Z A;  1OGW A;  3ZRF A;  1HZ6 A;  2QSD A;  5BMI A;  4O1N A;  4FHK A;  4WIP A;  1OQR A;  1F0Z A;  3AUL A;  5DI9 B;  1P3R A;  1STE A;  2L83 A;  2GS0 A;  2B76 B;  3ZJV A;  2LHE A;  4RF1 A;  2WU5 B;  4MGI E;  3FC4 A;  4RMA A;  3N1Y C;  3AE9 B;  4DHZ B;  2RDB C;  2HE7 A;  5JHH A;  3UQA A;  3I5J C;  1C77 A;  1LO5 D;  1NVI D;  3QK0 A;  3B9J A;  3TVV A;  3HW2 B;  2MJE A;  4AQ7 A;  4BFR A;  2N23 A;  2MQJ A;  2M0A A;  3PGE A;  2JY6 A;  3AN1 A;  1HZ5 A;  2L1C A;  2W54 A;  1E6E B;  3M63 B;  2I38 A;  2KXJ A;  4MH8 A;  3SEB A;  4KHB B;  3GOE A;  1V2Y A;  4MDK E;  2M19 A;  3TEZ A;  3BVM A;  1MG4 A;  1I4P A;  2KAC A;  4KHO A;  3R3M A;  2IO3 B;  2J0M A;  1NU2 A;  2LGS A;  1PGB A;  1P7F A;  4ZRI A;  4B0M A;  2NVU I;  4ZRP A;  2HDE A;  4C80 A;  2INP E;  2SAK A;  2KWU B;  2DN6 A;  3AED B;  2BS4 B;  1FPY A;  1WI1 A;  2KN4 A;  3ZGZ A;  3EEC A;  2BCJ A;  3P6A A;  2RD0 A;  5CTR C;  4HAV B;  3O96 A;  1WMH B;  3AEB B;  1TS4 A;  1GJZ A;  2Z0P A;  4F7G A;  4A3P A;  1T5X D;  2DHZ A;  4TV3 A;  3ZW3 A;  2NTS A;  4HDQ A;  1MI1 A;  3PPA A;  3UIN B;  3FAH A;  2N9K A;  2WNM A;  3B0A A;  4BZA A;  1PMS A;  3LYY A;  1TIF A;  2KNB A;  2I1K A;  2INN E;  2MP2 A;  2NS5 A;  1XD4 A;  1R4M I;  1IUE A;  4D6W A;  1TJ6 A;  1I42 A;  2XNA C;  3HRD D;  4PT5 A;  1LXD A;  1BXT A;  4OZC A;  3M3J A;  4OVZ A;  3M62 B;  4N9F 4;  2LG1 A;  3MFG A;  1QOG A;  1WGK A;  3AM9 A;  1YQ3 B;  2K00 A;  2YS5 A;  3B77 A;  1QQG A;  1ZE3 D;  2BYV E;  5LOP B;  1D4B A;  1WGG A;  1FGY A;  3C0R B;  4XX5 A;  1J19 A;  2LMC A;  3TIX A;  2FUG 1;  1C76 A;  1BML C;  2KLC A;  4ICU A;  1D5M C;  3QC8 B;  1T0Y A;  3RN9 C;  1TS3 A;  3VRA B;  2DX5 A;  4WJ7 A;  4K2O A;  4GOC A;  1FHO A;  4BAX A;  1Q67 A;  4M8N A;  2ZNV B;  1TS5 A;  3OWE B;  4HPL B;  3TFM A;  3IVF A;  4A6F A;  4ZYS A;  1GG3 A;  1L7Y A;  1TZO A;  1ZUD 2;  2BYF A;  2CKH B;  3QX1 A;  1YD8 U;  4FHJ A;  2KD0 A;  4DQO C;  3A1Q B;  5G2N A;  4E74 A;  2BF8 B;  1U29 A;  3ML8 A;  3UIP B;  1FXT B;  2ZW1 A;  4TQ1 A;  4KIK A;  3GS2 A;  4FAD A;  1ZOY B;  2PE6 B;  2BS3 B;  1T0Q C;  2VH2 A;  3QCA A;  3KUC B;  1P6S A;  1P3Q U;  1D6E C;  1Y56 A;  3AEA B;  1X86 A;  4KSL C;  2WU2 B;  4FXC A;  2DZI A;  5JHB A;  3APC A;  4G0N B;  1L4D B;  1VR9 A;  3A58 A;  1QOF A;  4PNK A;  2Q5W D;  5CHV C;  1G6J A;  1BTK A;  4FJV B;  2PKO A;  3Q69 A;  4L2Y A;  3U7D A;  4AOF A;  2FCN A;  2QMT A;  5LLI A;  5LG4 B;  1UBQ A;  2QDF A;  2CAY A;  2DYM A;  3D8E A;  2BW2 A;  5DHF B;  2IFS A;  3PRE A;  4ZRQ A;  2IO0 B;  5H8Y E;  4MEL A;  4HLE A;  1WJ6 A;  4HPP A;  1MPE A;  5FR3 A;  1L4Z B;  2L76 A;  3DWM A;  4EEW A;  2N7E A;  3W5U B;  1P98 A;  2KJ6 A;  1IGC A;  1K51 A;  4BOZ B;  4GLS C;  2LUM A;  2KUP A;  1SBB B;  4KKJ A;  1F2R C;  1JQ4 A;  5E6P A;  4XDC A;  3GYO A;  4W9G A;  5L83 A;  1LW3 A;  1FCL A;  4PYZ A;  1Q0W B;  1YMH E;  1JWA D;  1L0X B;  5KQ4 A;  2K6Q A;  2WQY B;  3NOB A;  1E5W A;  2IGG A;  3UI3 A;  1E8Y A;  1WY8 A;  4ZRJ A;  4GIV A;  2AQ2 B;  2O6V A;  1YX6 B;  2X8X X;  4NAW A;  2JUO A;  3TEY A;  2QKL A;  3UZT A;  5C6R A;  2MBO A;  2G3Q B;  2JRH A;  5IA7 A;  1P7E A;  1NTY A;  2MCN B;  1TKG A;  4HB2 B;  2R2O A;  5KHQ A;  2K2U A;  2RGF A;  4J3O D;  1NTV A;  4LNN A;  4WAF A;  3AU5 A;  1JRO A;  2KQ7 A;  2CS4 A;  2CU3 A;  3DWG C;  1I2H A;  3ENE A;  1V5O A;  2RVB B;  4IUM B;  2P0H A;  3RNE C;  3RZF A;  3I3T B;  1HQR D;  1M94 A;  2LGI A;  4FLH A;  1L6V A;  1MHX A;  2LUE A;  2LRW A;  3RUL A;  2DLW A;  2Z13 A;  3P7Z A;  1C79 A;  3ZDT A;  1MKE A;  1WGH A;  2L7R A;  1I35 A;  2O6V D;  3JSV B;  3VR9 B;  3NRZ A;  1JWB D;  3Q8C A;  4ARI A;  5D2M B;  1LM8 B;  5BYR A;  3SR6 A;  4EE2 A;  4M00 A;  4GXB A;  3ONS A;  3KZ1 A;  1KZG A;  1JCK B;  2V4I B;  2K39 A;  3V60 A;  3ZJT A;  2IYB A;  4HB3 B;  2BQQ A;  3FKY A;  3SDL C;  2H88 B;  3RNA C;  2N9X A;  3PS6 A;  1U5F A;  2IJ0 A;  2KMM A;  4KHB A;  2W2X D;  2FIF A;  3EGR A;  1M4V A;  2HD5 B;  2JQR B;  3NWA A;  1EWC A;  1FD6 A;  3GYP A;  4HSI A;  2NPT B;  1E90 A;  3AE4 B;  2L0T A;  3H8H A;  2Y8G A;  5D3V A;  1TKE A;  1XF5 L;  2WXO A;  3VUY A;  2KLG A;  3ML9 A;  5IAA C;  4KZ0 A;  4I6P A;  2REX A;  4H2A A;  3H7P B;  3EC8 A;  4Y94 A;  5AZF A;  2LD9 A;  3PSC A;  3HVZ A;  3OJ4 B;  3WAM A;  2GCL A;  1JRP A;  1MI0 A;  1VZ7 A;  3SFE B;  3U30 A;  1EU3 A;  3TSS A;  2LZ6 A;  2N1V A;  2CY5 A;  2KKC A;  2BB6 A;  2H7D A;  1E8W A;  2LOZ A;  4ANU A;  1X1G A;  1QZE A;  1V6E A;  4ASW C;  1SXT A;  3PG7 A;  4AS1 A;  2YF0 A;  1N63 A;  2C5L C;  2K9X A;  4C0A A;  3WAP A;  3ZXR A;  5LNK 1;  2ZPN A;  1RFA A;  4Z2M B;  1WG7 A;  3HK0 A;  3PRM B;  5DPT A;  2RNR B;  1UNR A;  1D5X C;  3U4E G;  1SE3 A;  5HFY A;  4HAX B;  2HJ8 A;  3KY9 A;  3QA8 A;  2KVZ A;  1RLF A;  2WXH A;  1DOI A;  3AE7 B;  3NZS A;  3FM8 C;  1YX5 B;  2GOW A;  2DKQ A;  1C78 A;  1LFD A;  3ZKJ C;  2DZJ A;  1AYF A;  1WZ0 A;  1TY2 A;  2FJL A;  1RAX A;  3J9C A;  3AXC A;  2KZR A;  3DHG C;  2GBR A;  5KHO A;  4IFS A;  4F7H A;  1XOD A;  1WGD A;  5TR5 A;  3SO6 A;  3RFZ B;  1V80 A;  4K7W A;  1XO3 A;  1SE2 A;  5BYQ A;  5JZE B;  2IZV B;  3UGB B;  2GLS A;  2K5P A;  2Y7B A;  1UNP A;  4WJQ A;  1W1G A;  1U4A A;  3KH0 A;  5J17 A;  3LJU X;  1L0Y B;  2QIE B;  2KO3 A;  1E7V A;  4C00 A;  2R2Q A;  3A1Q A;  4MK0 A;  2OJW A;  3BYT B;  3BVZ A;  3X0W A;  3TW1 A;  3TCA A;  1ZKH A;  2X18 A;  1FB8 A;  4MAC A;  4HJG E;  2MBH A;  1XEE A;  4KGR A;  3IG3 A;  3OJ3 A;  1UD7 A;  2X38 A;  4NQL B;  1C4C A;  3W1S A;  2KFK A;  3MJW A;  3V6E B;  5D3I B;  2K49 A;  4REZ A;  2V3N A;  5JH5 C;  5D6J B;  2BVC A;  1MAI A;  4A20 A;  2K8C A;  3KW5 B;  2NCN A;  2M38 A;  1WZ3 A;  2Q13 A;  4J6I A;  3ZNZ B;  2YS3 A;  5BMH A;  2G4D B;  3SU8 X;  3VFK A;  3FEH A;  2BTE A;  3X23 A;  1WX9 A;  4RNA A;  4IM3 A;  2QEJ C;  2MRP A;  2ROZ B;  4JX1 C;  2MH7 A;  3DBL B;  2KDE B;  2UZR A;  5CHW A;  1PYW D;  4OSN A;  2W9N A;  1DOX A;  1WIA A;  3DBS A;  4L6E A;  2JVC A;  4LJO B;  1HEZ E;  1T0S C;  4PK1 A;  3K9O B;  4HHV A;  3KUZ A;  3GE3 C;  3RNF C;  2WXF A;  4MJS A;  2KMC A;  4YSZ B;  2JF5 A;  4WWO A;  4GGQ A;  4W9I A;  1H8C A;  3R8B A;  2DFK A;  2AEH A;  4MT7 A;  4OVU A;  4XDD A;  3CIR B;  1WXM A;  3L10 B;  1ZM0 A;  2OED A;  1UUP A;  1E7P B;  2I5F A;  2PEA A;  3SYX A;  2ZJD A;  5H92 C;  1XKE A;  2NR2 A;  2JP2 A;  4K17 A;  3A4R A;  3R7R A;  1BTN A;  2KIG A;  2LFI A;  1T0R C;  4EJN A;  4US9 A;  2LVO A;  3ZIM A;  2ZPY A;  4XGA B;  4FJY A;  3VXW A;  4F8C B;  2KIE A;  4YT0 B;  1QC6 A;  2ZVO A;  2DYB A;  5C5B B;  1QQR A;  4A3O A;  3AE8 B;  2D4Q A;  1F77 A;  2VZK B;  2KDI A;  2WXM A;  2Y5P A;  3JSV A;  3MHZ A;  2L32 A;  2M4N A;  3QJZ A;  1TXD A;  5KCV A;  1B1Z A;  2N7J A;  4AUQ C;  1K53 A;  2QC8 A;  5HG2 A;  4DHJ B;  1C9F A;  1XLP A;  4W9J A;  2OTX A;  3RMK C;  4LNO A;  1YQ4 B;  4RGO S;  1V5M A;  3NWF A;  2DZK A;  3NHE B;  4BKS A;  2D10 A;  3DPD A;  2L00 B;  4XWT A;  1L5P A;  4W9K A;  1WR6 E;  2YRY A;  4IC7 B;  4S0R A;  2FUH B;  4KHA A;  5D94 A;  3ZVV A;  4HAU B;  2LVP A;  5AZG A;  3WYF B;  1S3S G;  2CHW A;  2YT2 A;  2BBC A;  4A6Q A;  2R0D A;  3BIN A;  1SJH D;  4W9E A;  2ZVN A;  4JGH B;  4LJP B;  3VTW A;  2NPT A;  1IP9 A;  2D3B A;  2COF A;  4GB9 A;  3Q3O C;  4P16 A;  2COD A;  2KX0 A;  3H7P A;  2NBU A;  3H1U A;  3B2F A;  3DVN U;  3U2S C;  4AP4 C;  4DHZ E;  1EO6 A;  1FRR A;  4NJ7 A;  5D3D A;  1YN5 A;  1VZ6 A;  5G5G A;  2WDQ B;  3P4P B;  4BKS D;  4N58 A;  4P6V F;  1K5G B;  3AEC B;  1XX0 A; 
#chains in the Genus database with same CATH homology
 4HVB A;  2PZ1 A;  4Z2N A;  1WJ4 A;  2L2I A;  2J0J A;  3PV1 A;  3L54 A;  3T06 A;  1JRU A;  2CRF A;  1N3H A;  3A33 B;  2A5U A;  3ZO5 B;  3F5R A;  4K1R B;  1EF1 A;  2KC2 A;  1FHW A;  1L2N A;  3BJI A;  1P9D U;  1UNQ A;  2LXC A;  3O65 B;  1OQY A;  5G55 A;  4II2 B;  5C1Z A;  2WX1 A;  4FBJ B;  1TGZ B;  3A98 B;  5HE1 A;  1UBI A;  3N32 A;  4B6H A;  2YT0 A;  4RM9 A;  3SHQ A;  4DBB A;  4HJK A;  3HQC A;  4GMV A;  5FI1 A;  3DXC A;  4B95 A;  1M7R A;  2A4Z A;  3IFW B;  2MX2 A;  4W9H A;  3EHV A;  2LAS A;  2GBK A;  3PLU A;  3ZDM C;  3W1S C;  4KVG B;  4WWN A;  2IO2 B;  1WJ1 A;  3B08 A;  2J59 M;  3DCG A;  2CHX A;  3VUX A;  2Y8F A;  3N3K B;  2D9W A;  4LDT D;  2AL3 A;  2GBJ A;  2LGD A;  1H4R A;  3HM6 X;  1C1Y B;  1KZ7 A;  3WIM A;  2IO1 B;  4B9K A;  3UIO B;  2O2V B;  4XC2 A;  2JZ3 B;  5CHF A;  1SGH A;  1WGY A;  2C9W B;  5AEK B;  1DRO A;  4W9D A;  1E8X A;  3VTU A;  2ZCB A;  5HE0 A;  1WE7 A;  3PSE B;  4KV2 A;  4GDL B;  3R66 C;  4LCD E;  4KSK C;  2RUK B;  1B55 A;  2BPS A;  5CLQ B;  4HWI B;  2MFQ A;  2K1F A;  1EF5 A;  5L81 A;  1IRS A;  4EOY A;  2BKR B;  1V49 A;  2MWS B;  4W9C A;  2Z0E B;  3DQV A;  2AYO B;  1VCB A;  3R7Q A;  1NBF C;  2IY0 B;  4K2P A;  2DHJ A;  2Z59 B;  5GMV A;  2Y5B B;  2D07 B;  3PVW A;  2KN5 A;  3QIJ A;  3PP2 A;  1WE6 A;  4HXD A;  1P0R A;  3DBL I;  1AQC A;  4K7S A;  1WGU A;  2VKI A;  5C5B A;  4GN1 A;  2G4S A;  2XQN M;  5HE3 A;  3D32 A;  3A9J B;  1Q5W B;  2C7M B;  2JRI B;  2C7N B;  3DXD A;  2R09 A;  1MG8 A;  2M17 A;  4WQO B;  3A8Q A;  3ZRC A;  1DDW A;  5DIF B;  1UPQ A;  2YT1 A;  3HM3 A;  5GOW B;  2COC A;  4IWQ A;  3DVG X;  1GC6 A;  3QWM A;  4MH0 E;  2JPH A;  3DBH I;  2L0F A;  2FCS A;  5J18 A;  1V86 A;  4HB4 B;  1V61 A;  4HB0 B;  3VUW A;  1DBH A;  4MGY E;  1WJU A;  3SV1 A;  4DHJ D;  3T8M A;  3AJ4 A;  4IM2 A;  2CU1 A;  2YVC A;  2KFJ A;  5E6O A;  3ULB A;  2PJH A;  3VHT C;  2MLB A;  3SUZ A;  5D3Y A;  2UVM A;  5LON B;  3DVN V;  3OAN A;  2DYQ A;  3DXE A;  2Z0O A;  4DXA B;  2KDF B;  3ZNH B;  1Q1O A;  1H10 A;  2D9Y A;  2GBN A;  2W2W A;  2DYN A;  2NBV B;  4HDO A;  2IYD B;  1WMH A;  2FNJ B;  4NQK E;  1MK7 B;  4GZU A;  3SNH A;  3ZTC A;  4XWX A;  2KQS A;  3FSS A;  3NY5 A;  3DVG Y;  1J0W A;  1U5G A;  4ZDV A;  3PTF C;  4CYE A;  3DOW A;  4TYZ A;  4NY0 A;  3IHP C;  3PRP B;  5JHG A;  2ZZP B;  4P7I A;  4BOS C;  3CIK A;  2P0F A;  2N4F A;  5CLL B;  2LVQ A;  1WX7 A;  1MPH A;  3NS8 A;  2OQB A;  3ULC A;  3RYT A;  1WJM A;  5D3W A;  1X05 A;  2M8S A;  2LJ5 A;  4I6L B;  4LDT B;  1V89 A;  3QHT A;  2DAJ A;  4DBG A;  1PLS A;  2LUL A;  2V1Y A;  2I5C A;  4HAZ B;  4FUL A;  2AWT A;  1AWE A;  3L08 A;  2DHI A;  1WFY A;  4WAA A;  2O2V A;  1OTR B;  2DA0 A;  1VD2 A;  2M14 A;  2ELA A;  2BWF A;  2N9E B;  3MDB C;  1NI2 A;  2D9X A;  3F0W A;  2PPH A;  4WWP A;  1V9J A;  2M1M A;  4EUT A;  5C16 A;  2BKF A;  2C60 A;  3ZTD A;  2DX1 A;  1PQS A;  2NMB A;  5J3T A;  2ZCC A;  2KDB A;  4GDL A;  2DX5 B;  2KX3 A;  1K5D B;  2KWV B;  4GDK B;  4ANW A;  5D7G A;  2L3Z A;  2FAZ A;  3PVL A;  4IAP A;  2XK5 B;  1WXS A;  2YLM A;  2J0K A;  2WX0 A;  2GJY A;  1YJ1 A;  5LXH A;  1HE8 A;  3A8P A;  3RCZ A;  1BAK A;  1J0G A;  2LI5 A;  4URK A;  5KQ1 A;  2OOB B;  1DYN A;  3OAW A;  2ASQ A;  1OY2 A;  3TJP A;  4A6H A;  4JL9 A;  4F7U P;  4BKT A;  2EMT A;  2MBB B;  4K81 A;  1OMW A;  3QWZ B;  4F7Z A;  1ZW7 A;  1WVH A;  3A9J A;  3N7C A;  2YSZ A;  4HCP B;  3ZVR A;  3MHS D;  4EZL A;  5JP4 A;  2ADZ A;  1XQQ A;  1U5E A;  1TQZ A;  1TZ1 A;  4AJW A;  1XR0 B;  1NDD A;  2W2X C;  1KM7 A;  3ODX A;  3KYD D;  3D8F A;  4IG7 B;  4WJP A;  2CR5 A;  2NBW B;  5BO4 B;  2DKP A;  2RR9 A;  1KI1 B;  2FCQ A;  1FGZ A;  3S2A A;  2M0X A;  3VDZ A;  3KUD B;  4MSM B;  3WAN A;  3APF A;  4IWO A;  1LQB A;  2V3S A;  2P0D A;  3LJ3 A;  5JLJ B;  1EUV B;  3T9L A;  2COA A;  2BWE S;  2HTH B;  3TBL D;  1D3Z A;  2DTC A;  3A4S C;  1C3T A;  4TKN A;  4II3 B;  4KZC A;  2JT4 B;  3D8D A;  2K2J A;  2DZM A;  1DDM A;  4RM8 A;  4AWJ A;  1EVH A;  3OLM D;  2BYE A;  1S1Q B;  5EFX A;  4AJY B;  3JW0 X;  5DPR A;  1I7A A;  4F1S A;  3TO1 A;  3WAL A;  5C23 A;  1A5R A;  3QBV B;  2FID A;  1WM3 A;  3A9K B;  1V81 A;  2QHO A;  2GCJ A;  3V6C B;  1OEY J;  1M7E A;  2FCM A;  1ISN A;  2N0Y A;  4NSW A;  2G35 A;  1EAZ A;  4EFO A;  4G11 A;  4PS8 A;  5AZH A;  5HKH A;  1UEF A;  4NJ6 A;  2VSZ A;  3KRX A;  2XEW A;  1RRB A;  4DX9 0;  3K9P B;  4GPT B;  3EFU A;  2ZNV C;  1Z87 A;  3UF8 A;  1UZX B;  2EC1 A;  1ZGU B;  1RRP B;  3DDC B;  2K8H A;  4NPN A;  2KVR A;  2AL6 A;  3ZNI D;  4IM0 A;  2MWN B;  1F9J A;  1V5T A;  4NNJ B;  1Y8R C;  2LWP A;  4YL8 A;  2LGX A;  3PVU A;  1E8Z A;  4MM3 A;  3VQI A;  3CMM B;  2LGY A;  3VH4 B;  2MBE A;  1Y19 B;  2KTR B;  4KAX B;  1IPG A;  4M8M A;  4CHM A;  1MIZ B;  2LYD A;  2D3G A;  3ZLZ A;  1YIW A;  2Z0Q A;  4JIO U;  2IBI B;  2D11 A;  5HE2 A;  4CHK A;  2IY1 B;  4KDI C;  5DHA B;  4IW0 A;  3QAR A;  4ZRK A;  4MGK E;  3CSF A;  3JYU A;  1ZC4 B;  3WA0 A;  4GDK A;  2PE9 A;  4OVV A;  3ECI A;  3L16 A;  4D0N B;  5E6N A;  5DH9 B;  2XK5 A;  1V5U A;  4HK2 A;  4MEM A;  1X1F A;  4HPM B;  3M95 A;  4IOY X;  4GSW A;  2RLO A;  3PHW B;  2UYZ B;  2EJ8 A;  3V5W A;  2C7H A;  2VRR B;  4WSF A;  3PZD A;  2LRU A;  1W1D A;  1U2B A;  3PHX B;  3L17 A;  2KFK B;  2OJR A;  3ZNG C;  3LDZ E;  1U5D A;  1YQB A;  1WJN A;  2KWC A;  2J7Q B;  1MK9 B;  1W1H A;  5L95 C;  2I1J A;  4TQ0 A;  3H6N A;  2LOX A;  3KRW A;  4ANV A;  5EDS A;  2NZ8 B;  2JWZ A;  4M0W B;  5D3X A;  3TMP B;  2RSG A;  1E7U A;  2N7D A;  1UGM A;  3VIA A;  1WGR A;  1K8R B;  1P5T A;  1UPR A;  2GBM A;  1V5P A;  1FHX A;  4MJS B;  3NZU A;  4BVU C;  3VAW A;  3AI5 A;  2WYQ A;  1XD3 B;  1KLV A;  4BBN C;  3ZUN A;  2KTF A;  4A6K A;  5DPS A;  1AAR A;  4HAW B;  2HTH A;  3RCP A;  4PYU A;  2GMI C;  1SIF A;  4YON A;  2K6D B;  1TBE A;  4IWP A;  2YS1 A;  1J8C A;  3RT3 B;  4WVF B;  1WF9 A;  3ALB A;  2LKO A;  4ICV A;  4KDL B;  4BBK A;  4EZK A;  3PRZ A;  1X1M A;  2KOX A;  1ZSQ A;  3PEG A;  5DCN A;  4A5K A;  2N9P C;  4DK5 A;  3RZW C;  4FN2 A;  2E2X A;  4XZ4 A;  3A9K A;  3APD A;  1SE9 A;  2CHZ A;  3V62 A;  3HIZ A;  1Y5O A;  1DDV A;  3V61 A;  4BKG A;  3L0W B;  2RSU A;  2ZEQ A;  1WH3 A;  4TUU A;  2EKE C;  1XT9 B;  1TTN A;  4E71 A;  2JZZ A;  1KOT A;  4DDI D;  1WGQ A;  3VOQ A;  3AU4 A;  3ML4 A;  2MKR A;  2MSE D;  1OQN A;  1WRD B;  4DDG D;  1Z2M A;  2LXA A;  3BY4 B;  3L13 A;  4K7U A;  3ODW A;  2DHK A;  4PQ0 A;  2KCJ A;  4WJN A;  1Z5S B;  2VRW B;  4JLC A;  5CX3 A;  3MTN B;  4HAY B;  3VVW B;  5J2R A;  2ROV A;  1OEY A;  3KSY A;  2QKM A;  5FI0 A;  2KAN A;  3RUI B;  3RD2 A;  4ANX A;  1GUA B;  2Z0D B;  2KTR A;  1LB1 A;  2G45 B;  2D9Z A;  4ZYN A;  2H7E A;  3N30 A;  4HAT B;  1P1A A;  1WM2 A;  1U27 A;  4FA6 A;  2KK8 A;  2DEN B;  3W1Y A;  3SD5 A;  4MY6 A;  3KVF B;  2L8J A;  3U8Z A;  2MP2 B;  4HCN B;  3CF6 E;  2K8B A;  2RPQ A;  3MPX A;  3DBR I;  3CST A;  4E3C A;  2KMA A;  2JXX A;  2B3A A;  3VTV A;  4I6N B;  2D2Q A;  1UH6 A;  2UWQ A;  2MW5 A;  4PS7 A;  1EGX A;  3IBE A;  2P8V A;  3Q3F A;  5D27 A;  4MSQ B;  3KYC D;  4X57 B;  1WR1 A;  3M1I B;  3CXB B;  2KHW B;  1CMX B;  4W9L A;  4A6F B;  1FAO A;  4EKU A;  1X11 A;  4FJZ A;  2EMS A;  4EMO A;  3QAQ A;  5FR6 A;  4KIK B;  3H9D A;  1ZVR A;  2RGN B;  4MGZ E;  5C79 A;  2MBQ A;  2ELB A;  3H7S A;  1WXA A;  2WDT B;  1SHC A;  1RJ2 A;  4EZJ A;  4CHJ A;  2BGF A;  2KC1 A;  3WAO A;  1WI0 A;  4GMX B;  3PLV A;  5J3Q A;  2V4L A;  1BT0 A;  1GC7 A;  1MIX A;  3ODO A;  3B1L X;  3QQ8 B;  5J3Y A;  2KJR A;  3NSU A;  4G50 A;  3HHM A;  1UEL A;  1WYW B;  1GNU A;  2KGX B;  4B6W A;  4DWF A;  2D9V A;  4BBN F;  2V76 A;  4DX8 A;  1ZC3 B;  4JQW C;  3G9W A;  4G3X B;  5LXI B;  2XBB C;  4W9F A;  3Q3J A;  5JHA A;  3PT2 B;  2DYO A;  1KJT A;  4CO7 A;  2KJH B;  1PFJ A;  3VH3 B;  4GU2 A;  1IYF A;  1WXV A;  1FOE A;  3JVZ X;  2O6V B;  1WX8 A;  1R4N I;  4NAW B;  3TL5 A;  1XCG A;  2K25 A;  2CY4 A;  2MA9 B;  2WWZ A;  2L05 A;  3GZN I;  3P2B A;  1BWN A;  2N1W A;  4H8S A;  5DPW A;  2DAF A;  4PS3 A;  3UQB A;  1V88 A;  2MDX A;  4WJO A;  2UZS A;  1OGW A;  3ZRF A;  4FHK A;  3AUL A;  5DI9 B;  1P3R A;  2GS0 A;  4MGI E;  4RMA A;  4DHZ B;  2HE7 A;  5JHH A;  3UQA A;  3QK0 A;  3TVV A;  3HW2 B;  4BFR A;  2N23 A;  2MQJ A;  3PGE A;  2JY6 A;  2L1C A;  3M63 B;  2KXJ A;  4KHB B;  3GOE A;  1V2Y A;  4MDK E;  4KHO A;  3R3M A;  2IO3 B;  2J0M A;  1NU2 A;  4ZRI A;  2NVU I;  2KWU B;  2DN6 A;  1WI1 A;  3EEC A;  2BCJ A;  3P6A A;  2RD0 A;  5CTR C;  4HAV B;  3O96 A;  1WMH B;  1GJZ A;  2Z0P A;  4F7G A;  4A3P A;  2DHZ A;  4TV3 A;  3ZW3 A;  4HDQ A;  3PPA A;  3UIN B;  3B0A A;  1PMS A;  2KNB A;  2I1K A;  2MP2 A;  2NS5 A;  1XD4 A;  1R4M I;  1TJ6 A;  1I42 A;  1LXD A;  3M3J A;  3M62 B;  4N9F 4;  2LG1 A;  2K00 A;  2YS5 A;  1QQG A;  2BYV E;  5LOP B;  1WGG A;  1FGY A;  3C0R B;  4XX5 A;  1J19 A;  3TIX A;  2KLC A;  4ICU A;  3QC8 B;  1T0Y A;  2DX5 A;  4WJ7 A;  4K2O A;  4GOC A;  1FHO A;  1Q67 A;  4M8N A;  2ZNV B;  4HPL B;  3TFM A;  3IVF A;  4A6F A;  1GG3 A;  1L7Y A;  2BYF A;  2CKH B;  3QX1 A;  1YD8 U;  4FHJ A;  2KD0 A;  3A1Q B;  5G2N A;  4E74 A;  2BF8 B;  1U29 A;  3ML8 A;  3UIP B;  1FXT B;  4TQ1 A;  4KIK A;  4FAD A;  2PE6 B;  3QCA A;  3KUC B;  1P6S A;  1P3Q U;  1X86 A;  4KSL C;  2DZI A;  5JHB A;  3APC A;  4G0N B;  4PNK A;  5CHV C;  1G6J A;  1BTK A;  4FJV B;  3U7D A;  4AOF A;  2FCN A;  5LLI A;  1UBQ A;  2CAY A;  2DYM A;  3D8E A;  5DHF B;  2IFS A;  3PRE A;  2IO0 B;  4MEL A;  4HLE A;  1WJ6 A;  4EEW A;  2L76 A;  2N7E A;  1P98 A;  2KJ6 A;  4BOZ B;  2KUP A;  5E6P A;  3GYO A;  4W9G A;  5L83 A;  1LW3 A;  4PYZ A;  1Q0W B;  5KQ4 A;  2K6Q A;  3NOB A;  1E5W A;  1E8Y A;  1WY8 A;  4ZRJ A;  4GIV A;  2O6V A;  1YX6 B;  4NAW A;  2JUO A;  2QKL A;  3UZT A;  5C6R A;  2MBO A;  2G3Q B;  2JRH A;  5IA7 A;  1NTY A;  2MCN B;  4HB2 B;  2R2O A;  5KHQ A;  2K2U A;  2RGF A;  1NTV A;  3AU5 A;  2KQ7 A;  2CS4 A;  1I2H A;  3ENE A;  1V5O A;  2RVB B;  4IUM B;  2P0H A;  3RZF A;  3I3T B;  1M94 A;  4FLH A;  2LUE A;  2LRW A;  3RUL A;  2DLW A;  3P7Z A;  1WGH A;  3ZDT A;  1MKE A;  2L7R A;  1I35 A;  2O6V D;  3JSV B;  5D2M B;  1LM8 B;  4GXB A;  3ONS A;  3KZ1 A;  1KZG A;  2K39 A;  3V60 A;  2IYB A;  4HB3 B;  3SDL C;  2N9X A;  3PS6 A;  1U5F A;  2W2X D;  2FIF A;  2HD5 B;  3GYP A;  2NPT B;  1E90 A;  2L0T A;  2Y8G A;  5D3V A;  3VUY A;  2KLG A;  3ML9 A;  5IAA C;  4KZ0 A;  4I6P A;  2REX A;  3H7P B;  3EC8 A;  4Y94 A;  5AZF A;  2LD9 A;  3PSC A;  3OJ4 B;  3WAM A;  2GCL A;  3U30 A;  2LZ6 A;  2N1V A;  2CY5 A;  2KKC A;  2H7D A;  1E8W A;  2LOZ A;  4ANU A;  1X1G A;  1QZE A;  1V6E A;  4ASW C;  3PG7 A;  2YF0 A;  2C5L C;  4C0A A;  3WAP A;  2ZPN A;  1RFA A;  4Z2M B;  1WG7 A;  3HK0 A;  3PRM B;  5DPT A;  2RNR B;  1UNR A;  4HAX B;  2HJ8 A;  3KY9 A;  3QA8 A;  1RLF A;  3NZS A;  3FM8 C;  1YX5 B;  2GOW A;  2DKQ A;  1LFD A;  3ZKJ C;  2DZJ A;  1WZ0 A;  2FJL A;  1RAX A;  3AXC A;  2KZR A;  2GBR A;  5KHO A;  4IFS A;  4F7H A;  1XOD A;  1WGD A;  5TR5 A;  3SO6 A;  1V80 A;  4K7W A;  5JZE B;  2IZV B;  3UGB B;  2Y7B A;  1UNP A;  4WJQ A;  1W1G A;  1U4A A;  3KH0 A;  5J17 A;  3LJU X;  2KO3 A;  1E7V A;  2R2Q A;  3A1Q A;  4MK0 A;  3X0W A;  3TW1 A;  3TCA A;  1ZKH A;  2X18 A;  1FB8 A;  2MBH A;  3IG3 A;  3OJ3 A;  1UD7 A;  4NQL B;  3W1S A;  2KFK A;  3MJW A;  3V6E B;  5JH5 C;  5D6J B;  1MAI A;  4A20 A;  2K8C A;  3KW5 B;  2NCN A;  2M38 A;  1WZ3 A;  2Q13 A;  4J6I A;  3ZNZ B;  2YS3 A;  2G4D B;  3SU8 X;  3VFK A;  3FEH A;  3X23 A;  1WX9 A;  4IM3 A;  2MRP A;  2ROZ B;  2KDE B;  2UZR A;  5CHW A;  2W9N A;  1WIA A;  3DBS A;  4L6E A;  2JVC A;  4LJO B;  3K9O B;  4HHV A;  3KUZ A;  4MJS A;  2KMC A;  2JF5 A;  4WWO A;  4GGQ A;  4W9I A;  1H8C A;  2DFK A;  2AEH A;  4MT7 A;  4OVU A;  3L10 B;  1WXM A;  1ZM0 A;  2I5F A;  2PEA A;  3SYX A;  2ZJD A;  1XKE A;  2NR2 A;  2JP2 A;  4K17 A;  3A4R A;  3R7R A;  1BTN A;  4EJN A;  2LVO A;  3ZIM A;  2ZPY A;  4FJY A;  3VXW A;  4F8C B;  1QC6 A;  2ZVO A;  2DYB A;  5C5B B;  4A3O A;  2D4Q A;  2KDI A;  3JSV A;  2M4N A;  3QJZ A;  1TXD A;  5KCV A;  4AUQ C;  4DHJ B;  4W9J A;  2OTX A;  1V5M A;  2DZK A;  3NHE B;  4BKS A;  2D10 A;  3DPD A;  2L00 B;  4W9K A;  1WR6 E;  2YRY A;  4IC7 B;  2FUH B;  4KHA A;  5D94 A;  3ZVV A;  4HAU B;  2LVP A;  5AZG A;  3WYF B;  1S3S G;  2CHW A;  2R0D A;  3BIN A;  4W9E A;  2ZVN A;  4JGH B;  4LJP B;  3VTW A;  2NPT A;  1IP9 A;  2COF A;  4GB9 A;  2COD A;  2KX0 A;  3H7P A;  2NBU A;  3H1U A;  3DVN U;  4AP4 C;  4DHZ E;  1EO6 A;  4NJ7 A;  4BKS D;  1K5G B;  1XX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...