4KVGB

Crystal structure of riam ra-ph domains in complex with gtp bound rap1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
260
structure length
246
Chain Sequence
MKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1A
publication title The structure of Rap1 in complex with RIAM reveals specificity determinants and recruitment mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 78
structure length 246
sequence length 260
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
B PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4kvgB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kvgB01
2DENB 3NZSA 4JGHB 2PE6B 3X0WA 1MPHA 3L10B 3ZNGC 2D2QA 3NY5A 2G35A 4A20A 5KQ1A 1UELA 3H7PA 1L2NA 1W1DA 1X1FA 2IYBA 1V5UA 1P3RA 2MKRA 3VVWB 2A4ZA 3KH0A 2D07B 4FLHA 2N4FA 3HIZA 4FJYA 3L08A 4K1RB 2LYDA 1BTKA 3W1YA 4GSWA 2K8CA 2DA0A 4G50A 4EUTA 2I5FA 1RFAA 5J3QA 3APFA 3NOBA 1E90A 3W1SA 4PNKA 4HB2B 3AU5A 5HE1A 1KLVA 4HAUB 5C1ZA 1BT0A 2UVMA 4LDTD 1G6JA 2DZKA 1S1QB 4GDLA 3V61A 2Z0EB 1V9JA 1MAIA 3NHEB 3V5WA 4MJSA 5J3TA 4TQ0A 1EF5A 3DVGY 2Y8GA 4MY6A 1V86A 1V5TA 2ZNVB 4MSMB 5CHFA 1WF9A 4NQLB 3OAWA 3VFKA 4HXDA 3FEHA 4A6FB 2BCJA 2O2VA 5C23A 4BKGA 5FI1A 3P6AA 1SGHA 2UZRA 1I7AA 3A1QA 1WXVA 2D11A 4DX8A 4H8SA 2EJ8A 4HLEA 2L05A 2COFA 1GG3A 1TBEA 1J8CA 4FHKA 3ZDMC 2Y5BB 1WJ6A 3P2BA 4NJ6A 4MT7A 1UH6A 2W2WA 1AQCA 5DHFB 4KHAA 3PS6A 3ML4A 3ZLZA 2ZVOA 2KQ7A 1EUVB 2XK5A 1C3TA 2RPQA 3QWZB 1AARA 4MGZE 3N32A 1H4RA 4XX5A 2L76A 2NBUA 2KDIA 1UPRA 2MP2B 1MKEA 5D94A 3NS8A 3IVFA 2JZ3B 1SE9A 1V49A 4OVVA 2DZMA 2FCQA 1WX8A 4X57B 2BPSA 3ZRCA 2Z59B 5D6JB 2KTRA 4PS7A 3VH4B 4JIOU 3FM8C 2ELBA 1LB1A 2K2JA 5D3VA 1VD2A 1IP9A 4E74A 5GMVA 4CHKA 2ZZPB 2CODA 2L00B 3RULA 1P9DU 3RD2A 2HTHB 2N9PC 4GMVA 1YIWA 3PHWB 2KX0A 2Z0OA 1U5DA 1MK9B 5KHQA 3PRMB 1IYFA 5C79A 5DH9B 2M1MA 4HAZB 5LLIA 2JUOA 3QC8B 3PVLA 4FHJA 2XQNM 4XWXA 2MRPA 3N3KB 3VTVA 5FI0A 1WJ4A 2XEWA 3S2AA 4HAWB 2NCNA 1AWEA 2DHJA 4HCNB 3DXDA 4II3B 1KZGA 4KAXB 5DI9B 2L2IA 3PG7A 3TJPA 2KN5A 1WRDB 1DROA 3PREA 5IAAC 4EEWA 4BBNC 5TR5A 3ODOA 1H10A 2L7RA 2LGDA 4MSQB 1RAXA 3ZTDA 3ODXA 2RUKB 3DCGA 3R3MA 2LVPA 5BO4B 3VTWA 1GC7A 3KUCB 4IUMB 3QJZA 2MA9B 1T0YA 3DXCA 1EO6A 1WXSA 4WQOB 4JLCA 3ODWA 4W9CA 3C0RB 2IO1B 1B55A 3ML8A 4K7WA 4F7ZA 3T06A 2VKIA 3PV1A 4F7HA 2KLCA 3D8DA 1KM7A 2FIDA 5D2MB 4GU2A 1RRBA 4WJ7A 2DAFA 2WX1A 1WJNA 2GOWA 1BWNA 5CLLB 3N7CA 2ZCBA 4GMXB 1Q5WB 2DX1A 3SO6A 1HE8A 3JVZX 2DKPA 2RVBB 2D9VA 2IBIB 2YS3A 4PYZA 4FULA 2LZ6A 2DHIA 4DX90 2KQSA 4MGKE 1TXDA 2DKQA 1TQZA 2RLOA 4GOCA 4KIKB 2DYQA 3OJ4B 3OLMD 2C7MB 2K6DB 3HM6X 2IO2B 3M63B 3U30A 2KC1A 4EZJA 4G3XB 3PRPB 4AWJA 2L8JA 5HE0A 4ANWA 3APCA 5LOPB 3Q3JA 3SHQA 4MK0A 1WI0A 2D9XA 1XQQA 2WDTB 1U5EA 2IZVB 5AZGA 2EMSA 2O6VD 1ZGUB 4ANVA 3ONSA 2JT4B 2ZPYA 3AJ4A 3R7RA 2LVQA 2NPTB 1V81A 2MBQA 2NBWB 5JHAA 2M0XA 1MG8A 4D0NB 3CIKA 1UNRA 2YT1A 1SIFA 1X05A 2KOXA 3UQAA 1S3SG 3JSVA 1OEYJ 3RZFA 2NR2A 2DZIA 4N9F4 4J6IA 1ZSQA 3VUXA 2IFSA 2LASA 3B0AA 4HHVA 1PMSA 4TYZA 1GC6A 4HWIB 4HAXB 2J0JA 1K5DB 5D3YA 3QHTA 3KYCD 2IO0B 3DBLI 3UGBB 2GBJA 3PVWA 2CU1A 2K1FA 2MCNB 2C60A 4A6HA 2JXXA 3DXEA 2GBMA 4IW0A 4DK5A 1P98A 3H9DA 4B9KA 3BINA 2PEAA 2OTXA 2QKMA 1GJZA 1F9JA 4KVGB 2WWZA 3H7PB 3KRWA 1X1MA 2C5LC 2L0TA 5L95C 3U7DA 4TQ1A 2FJLA 2KCJA 2KFKA 2CRFA 3VUWA 2YLMA 3PLUA 3ZRFA 3CMMB 4WAAA 2NS5A 4IOYX 2GMIC 4GDLB 5DIFB 3ZDTA 2RSUA 4DBGA 2OQBA 4MJSB 5J2RA 1Z2MA 2NMBA 5C6RA 2UYZB 2BWES 2O6VA 1P3QU 2CHWA 2ROZB 2RR9A 4PS8A 1FOEA 4KV2A 1K5GB 4P7IA 1WH3A 1XCGA 1X11A 2O2VB 2V4LA 3MPXA 1LXDA 5JZEB 1YX6B 1PFJA 2BYVE 4NQKE 2J7QB 3ZNHB 3UIOB 3PRZA 2JRIB 1OEYA 1QQGA 3A1QB 3JYUA 4ZRIA 1E8WA 3HK0A 1WJMA 5CTRC 2K39A 2E2XA 5L81A 1WGQA 3QX1A 4JL9A 3KVFB 1WM3A 1M7RA 1YJ1A 3WYFB 2K25A 4Z2MB 2M8SA 2YSZA 1ZC4B 4KDLB 2DHKA 2MWSB 4DHZE 5D27A 1WGYA 3A9JA 2XK5B 2FCNA 3KRXA 3UINB 2LXAA 1PQSA 2YRYA 2COAA 1VCBA 3ZNID 1IPGA 1BTNA 1I2HA 3B08A 1U4AA 3ECIA 2KUPA 1Y5OA 3UF8A 4RM8A 3ZKJC 4K7SA 2LG1A 4PYUA 2GJYA 2R0DA 4LJPB 2KO3A 3SUZA 3N30A 2KJRA 3MJWA 2KTRB 3A33B 4MELA 3EECA 4ICVA 3PVUA 2JY6A 3VQIA 1XR0B 2ZPNA 1EGXA 3V60A 2KWUB 3DBSA 2KD0A 4A5KA 4HJKA 1V89A 4B6WA 3PGEA 3ZVRA 2IY1B 1FHXA 4LDTB 5JHHA 1DDVA 4WWNA 1V5PA 3TVVA 2LULA 2W2XC 2G45B 1L7YA 4DDGD 1W1GA 1Q67A 2MSED 3QQ8B 3K9OB 1U5FA 3QA8A 1P5TA 1WY8A 3CXBB 3BY4B 1EAZA 3KUDB 4XC2A 2AL6A 3SYXA 2COCA 3PHXB 2FAZA 4IWPA 5IA7A 4ZDVA 2KZRA 3GYPA 1P0RA 3W1SC 2N7EA 1R4MI 4HK2A 2ZJDA 4IG7B 1FHWA 2P0DA 1WM2A 1E7UA 2GS0A 3SNHA 4KHOA 1XD4A 4FJZA 5LXIB 2ZEQA 1MK7B 4YL8A 3RUIB 3TIXA 2N0YA 3TFMA 4Z2NA 3EFUA 2MFQA 5EFXA 4FA6A 2MBHA 1WE7A 4IM0A 3QIJA 3F0WA 2LRWA 4F7UP 3MDBC 3O65B 4F1SA 2MDXA 5CLQB 3QCAA 4IWQA 4OVUA 1K8RB 2DHZA 2MX2A 3WA0A 1WFYA 4FJVB 2V76A 2LRUA 1V2YA 4BBKA 1U2BA 2M4NA 2MBEA 3L0WB 3KY9A 2ZNVC 3PT2B 1WXAA 3WAPA 4E3CA 2H7DA 3M1IB 3PP2A 2KK8A 2Z0DB 4DHJD 2P8VA 1UNPA 2AL3A 2J59M 4BOSC 2D9YA 3G9WA 4WJPA 2KJHB 4NJ7A 3PLVA 1UZXB 2I1KA 2RGNB 5D3XA 4BKTA 2GBKA 2LGXA 2LKOA 3L54A 4BOZB 2KTFA 3A4RA 3VDZA 1FHOA 1J0GA 4NY0A 3M95A 4HB0B 2Z0QA 4A6KA 1WGGA 1LW3A 2DYBA 1WR6E 4FBJB 2YT0A 4FADA 1FGYA 1WGDA 2UZSA 1WR1A 4DXAB 4I6NB 4IFSA 1WG7A 2DZJA 1V80A 5FR6A 4W9JA 5LONB 3K9PB 3DVGX 1J19A 3HQCA 4BBNF 3D32A 4YONA 1MIXA 5HE3A 3ZVVA 3JSVB 4XZ4A 4MM3A 3DBHI 4AOFA 3HW2B 2DN6A 2KWCA 3SU8X 2W2XD 3QAQA 3VIAA 4KSLC 5J17A 2JVCA 5EDSA 4II2B 3VTUA 5AEKB 2VRWB 1TZ1A 2MQJA 2DX5A 1DBHA 2UWQA 3NSUA 4DWFA 5CHVC 3RT3B 3RYTA 1XD3B 4M8NA 4CYEA 4GDKA 3VXWA 2VRRB 1N3HA 2YS1A 1LM8B 3VOQA 4W9FA 2Z0PA 3ULBA 4W9KA 1OMWA 1UEFA 3R7QA 1V61A 4WSFA 3DBRI 4PQ0A 4A3OA 2VSZA 4EKUA 2K6QA 5E6PA 4BFRA 3WALA 1FXTB 3TBLD 1C1YB 4MEMA 1ZKHA 2QKLA 4BVUC 2D9WA 3ZNZB 2JWZA 2KFKB 2H7EA 4NNJB 3ZUNA 4Y94A 2V3SA 5KQ4A 4W9HA 1OTRB 2LUEA 4HDOA 3ZW3A 1YQBA 1XT9B 2KNBA 3IHPC 4GB9A 2K8BA 3P7ZA 2JPHA 4FN2A 1EVHA 4W9EA 2EMTA 2LOZA 4M0WB 2QHOA 1SHCA 2BWFA 3CSFA 3KYDD 4BKSD 3TO1A 4HCPB 3MTNB 4IAPA 1KJTA 2FCMA 3WAMA 2C7HA 1V88A 3D8FA 2O6VB 4LJOB 1ZVRA 4KSKC 3M3JA 3OANA 1TTNA 2KANA 3EHVA 2BGFA 3QWMA 2LI5A 1Y8RC 1V5OA 4DHZB 1PLSA 2PPHA 3F5RA 3MHSD 4KZ0A 2NBVB 4IM2A 2JP2A 2KDEB 4EZKA 2RD0A 3L13A 4RM9A 2HJ8A 1FGZA 5CHWA 3I3TB 3UIPB 2CY5A 1Q1OA 1I35A 3L16A 3ZIMA 1TGZB 4DDID 2P0FA 2KMAA 5C5BA 1NDDA 2CY4A 4NAWA 3TL5A 3DOWA 3SD5A 2K2UA 2JF5A 1Z87A 2KWVB 3H1UA 3QARA 3A9JB 2BKRB 2DFKA 5HKHA 5J18A 4ZRJA 1V6EA 1H8CA 1FAOA 2ZCCA 4TUUA 2FIFA 5DPSA 2M14A 3V6EB 2B3AA 4ZRKA 3TW1A 2LD9A 5CX3A 5LXHA 2ASQA 2MLBA 2GBNA 1GUAB 1E7VA 1TJ6A 5DPRA 2R2OA 2KLGA 2A5UA 2MW5A 2I5CA 1P6SA 1OQYA 1NI2A 5E6OA 3Q3FA 3FSSA 2IYDB 3RCZA 4W9LA 1E5WA 4G11A 4EFOA 4A3PA 1FB8A 2LVOA 2KDBA 2GCLA 3CF6E 2REXA 4W9DA 4MGIE 3A9KB 2OOBB 2N1WA 2WYQA 2L3ZA 3CSTA 5J3YA 5E6NA 3B1LX 5G2NA 3WIMA 4BKSA 4JQWC 1KZ7A 4URKA 3JW0X 4TKNA 4K7UA 1WX7A 2L1CA 4IC7B 2OJRA 5AZFA 4M8MA 2PJHA 1ZM0A 2KHWB 4HPLB 1DYNA 2DYOA 3IFWB 1WYWB 3LDZE 4WJOA 4HB4B 2G4SA 4MDKE 4RMAA 4A6FA 1KI1B 3GOEA 3H6NA 3EC8A 3A9KA 2FUHB 3UZTA 3RCPA 2DTCA 3L17A 3A8QA 3BJIA 1WX9A 5JH5C 4HVBA 2AYOB 2N1VA 2C9WB 2LGYA 1WZ0A 1DDMA 3AULA 4EZLA 4WJNA 2X18A 2J0MA 4GPTB 3LJUX 4GXBA 3ZTCA 1QC6A 1UBIA 1WVHA 3R66C 5DHAB 2D9ZA 2ZVNA 3HM3A 4I6PA 4IM3A 2KDFB 2BKFA 3PSCA 1WMHB 2CKHB 4CHJA 3KUZA 2K8HA 4E71A 2RNRB 2MP2A 3KW5B 2EKEC 3AI5A 1NU2A 4G0NB 4ZYNA 4ICUA 2AEHA 4B6HA 1WGHA 2DYNA 2KX3A 4HB3B 4WJQA 1YX5B 1MIZB 3A4SC 3GYOA 2AWTA 2RGFA 2KXJA 4HDQA 1NTYA 2M17A 2N23A 3U8ZA 2IO3B 4MH0E 4DBBA 1WMHA 5JHGA 2CS4A 1U5GA 4WWOA 4HPMB 4KZCA 4KDIC 2V1YA 2W9NA 3DVNU 2HTHA 2ELAA 5JLJB 3D8EA 5D7GA 2BYEA 4L6EA 3SDLC 1WJUA 3QBVB 1UBQA 4TV3A 3IG3A 2Q13A 3PZDA 1W1HA 3SV1A 1DDWA 3PPAA 1NTVA 1XKEA 5GOWB 2J0KA 2KFJA 1WZ3A 4GN1A 1XX0A 2PZ1A 1WE6A 3UQBA 5C16A 1UNQA 5AZHA 4I6LB 4NPNA 1M7EA 3TMPB 2N9EB 4K2OA 4C0AA 2YS5A 3X23A 2HE7A 3LJ3A 2C7NB 2DYMA 2P0HA 4HAVB 1ISNA 1Y19B 1WI1A 1GNUA 4K81A 2CR5A 2DLWA 2GBRA 3ALBA 4GIVA 3O96A 3RZWC 2CHXA 2IY0B 1UGMA 2DX5B 1X86A 3PEGA 2KJ6A 1QZEA 4GDKB 3DPDA 4HATB 3M62B 2BF8B 3APDA 4NSWA 3IBEA 2BYFA 3WANA 3KZ1A 1M94A 5DPTA 4W9GA 2LOXA 2ROVA 2LJ5A 2PE9A 3ZO5B 1E8XA 4K17A 4EOYA 1WIAA 3KSYA 2FNJB 3VH3B 4AP4C 5DPWA 2MWNB 2Y7BA 2R2QA 2YVCA 3A98B 1BAKA 3DQVA 1X1GA 3ENEA 1P1AA 3T8MA 2MBBB 1Z5SB 2Y8FA 5KCVA 3QK0A 1E8ZA 4DHJB 4KIKA 5HE2A 4KHBB 1OQNA 2I1JA 2NVUI 3WAOA 3VAWA 1R4NI 1V5MA 2JRHA 1LFDA 2G3QB 3ULCA 4PS3A 4AJYB 4F8CB 2KMCA 1EF1A 2MBOA 1NBFC 1WXMA 2FCSA 2YF0A 3ML9A 3PSEB 4WWPA 3OJ3A 5G55A 3TCAA 2KKCA 4EMOA 4AJWA 2KVRA 2G4DB 3AXCA 1UD7A 4MGYE 2EC1A 4IWOA 1OGWA 2K00A 2JZZA 1KOTA 2N7DA 2KGXB 4ASWC 3DVNV 3NZUA 1WGUA 1U29A 4F7GA 2NPTA 2DAJA 2CHZA 4B95A 1CMXB 3T9LA 1LQBA 1U27A 3HHMA 4GZUA 4HAYB 2NZ8B 2XBBC 2D10A 2L0FA 1RLFA 4ANUA 1XODA 2LXCA 2M38A 1RJ2A 1I42A 3AU4A 2GCJA 3V62A 3VHTC 2KC2A 2LWPA 5KHOA 1E8YA 2WX0A 3V6CB 5D3WA 5C5BB 2RSGA 4NAWB 1WGRA 2HD5B 1RRPB 1OY2A 1JRUA 2D4QA 5JHBA 4W9IA 2D3GA 2R09A 3GZNI 4GGQA 3DDCB 3H7SA 1D3ZA 5DCNA 1IRSA 1J0WA 2CAYA 4K2PA 1A5RA 1ZW7A 3VUYA 1UPQA 5L83A 1YD8U 3PTFC 2ADZA 4LCDE 4CHMA 1WJ1A 2N9XA 5JP4A 4WVFB 4CO7A 4EJNA 4AUQC 1ZC3B 1Q0WB 3A8PA 4ANXA
chains in the Genus database with same CATH superfamily
2DENB 2OJWA 3NZSA 4JGHB 1TT5B 2PE6B 3X0WA 1MPHA 3L10B 3ZNGC 2KUQA 4XE0A 2D2QA 3NY5A 2G35A 4A20A 3TUOA 2G1EA 5GXGB 5KQ1A 1UELA 3H7PA 1L2NA 1W1DA 3C19A 4AS1A 1X1FA 2IYBA 1V5UA 1P3RA 2MKRA 3VVWB 2A4ZA 3KH0A 2D07B 4FLHA 3AE6B 1K52A 2N4FA 3HIZA 4FJYA 2DBYA 3L08A 4OVZA 4K1RB 2LYDA 1IUEA 3DBRB 1BTKA 2INDC 3W1YA 4GSWA 2K8CA 2DA0A 4G50A 4EUTA 2I5FA 1RFAA 3BK2A 5J3QA 3APFA 3AB5A 3NOBA 4USAA 1E90A 3W1SA 4PNKA 4HB2B 1HQRD 3AU5A 5HE1A 1KLVA 4HAUB 5C1ZA 1BT0A 2UVMA 4YTPB 4LDTD 1G6JA 1I4RA 2DZKA 1S1QB 4GDLA 3V61A 1FXIA 2KIGA 1B1ZA 2Z0EB 3AMZA 1V9JA 1MAIA 3NHEB 3V5WA 4MJSA 5J3TA 1L4ZB 3HVDA 4TQ0A 1EF5A 3DVGY 2Y8GA 2BT6A 1JQ4A 4MY6A 1V86A 1V5TA 1I4PA 2ZNVB 2G9HD 4MSMB 4DXFA 5CHFA 1WF9A 4NQLB 3OAWA 2GI9A 1TY2A 1XXGA 3ZXRA 3VFKA 1I4GA 4HXDA 3FEHA 4A6FB 4ACFA 1ZDVA 2BCJA 2HDEA 2O2VA 3CWIA 2HJ1A 5C23A 4OT1A 4BKGA 5FI1A 1HTQA 4NAMA 3P6AA 1SGHA 3B2GA 2BS4B 2UZRA 1L6UA 2TSSA 1I7AA 2LGSA 3A1QA 3ETRA 3PZ7A 1WXVA 1VLBA 2D11A 4DX8A 3NVVA 4H8SA 2EJ8A 1VDVA 4HLEA 3P4PB 2W3SA 2BYTA 3VRAB 1I4HA 2L05A 1XF5L 2COFA 1GG3A 1TBEA 1J8CA 4FHKA 3ZDMC 2JWUA 2Y5BB 4L2YA 1WJ6A 1QF6A 3P2BA 4NJ6A 2BB6A 4MT7A 1UH6A 2W2WA 1AQCA 5DHFB 4C56C 4KHAA 3PS6A 2PVOD 3ML4A 3ZLZA 1HEZE 2ZVOA 2KQ7A 1EUVB 2XK5A 3Q3NC 1C3TA 2RPQA 2K22A 1AARA 3QWZB 4MGZE 3N32A 1CZPA 1H4RA 1SXTA 4LLGM 4XX5A 2L76A 2NBUA 2KDIA 2N9LA 1UPRA 2XNAC 2MP2B 1MKEA 5D94A 2PW9A 3NS8A 3IVFA 3HIEA 2JZ3B 3EFCA 1VZ7A 3PO0A 1UWXA 1E7PB 1SE9A 1V49A 4OVVA 2DZMA 4C7ZA 2FCQA 3AH7A 3LYYA 1WX8A 4X57B 5IN7A 3MP9A 2BPSA 4R3DA 3ZRCA 2Z59B 2R2YA 1L0VB 5D6JB 2MH7A 1ENFA 4ZRQA 2KTRA 4PS7A 4YT0B 3VH4B 5H8YE 1FCLA 4JIOU 3FM8C 3NRZA 2ELBA 2JSVX 1LB1A 2K2JA 5D3VA 1VD2A 1IP9A 1GB1A 4E74A 1V1PA 5GMVA 4CHKA 2ZZPB 2CODA 2L00B 3RULA 4PK1A 1P9DU 3RD2A 2HTHB 2N9PC 4GMVA 1YIWA 3PHWB 2KX0A 3ABVB 2Z0OA 4EE2A 1U5DA 1UNSA 1MK9B 3Q8CA 5KHQA 3PRMB 2LJIA 1IYFA 1ACCA 5C79A 5DH9B 2M1MA 3AN1A 3IAS1 4HAZB 1KH0A 5LLIA 2JUOA 3QC8B 3PVLA 4FHJA 2IJ0A 2XQNM 1T6BX 4XWXA 2MRPA 3N3KB 2WXLA 3VTVA 5FI0A 1WJ4A 2XEWA 4OHJA 4YSYB 1YN4A 3S2AA 4HAWB 2GRIA 2NCNA 5G5GA 2H88B 1AWEA 2DHJA 4HCNB 3J9CA 3DXDA 4II3B 1KZGA 4KAXB 5DI9B 5D3DA 2L2IA 3PG7A 3TJPA 4HKZE 2KN5A 1WRDB 1DROA 3PREA 5IAAC 4EEWA 4BBNC 5TR5A 3ODOA 4RGTA 1J7AA 1H10A 2L7RA 2SAKA 2LGDA 2WDQB 4MSQB 1RAXA 4KKIA 2E6XA 3ZTDA 3ODXA 1IBXB 2RUKB 3FILB 1QILA 1FFUA 3DCGA 3R3MA 2LVPA 5BO4B 3VTWA 1GC7A 3KUCB 1RWSA 2AX5A 2YEPF 4IUMB 3QJZA 2MA9B 5IRSA 1T0YA 1JWAD 3DXCA 1EO6A 2J52A 1WXSA 4WQOB 1MFWA 2WXMA 2QJLA 2CU3A 4JLCA 3ODWA 4A90A 2WU2B 4W9CA 3C0RB 2IO1B 2J53A 3P4QB 4M01A 1B55A 1FFVA 1CQVA 3ML8A 2K3UA 2D5GA 1DGJA 4K7WA 4F7ZA 3DHHC 1WWTA 3T06A 1WRIA 3LB8C 2VKIA 3PV1A 4F7HA 1ESFA 1YNTE 2KLCA 3AE7B 2Z14A 3BYTB 1FNUA 4KGSA 3D8DA 1KM7A 2QIEB 2JQRB 2FIDA 5D2MB 4GU2A 4XGAB 3MHZA 1RRBA 4WJ7A 2DAFA 4S0RA 1JCKB 2WX1A 1WJNA 2QILA 4M00A 2K0PA 1PGXA 2GOWA 1BWNA 5CLLB 4PT5A 3N7CA 2ZCBA 3RNFC 4OZBA 4OZCA 1YMHE 4KX6B 4WQMA 4GMXB 2RMMA 1Q5WB 2DX1A 3SO6A 1HE8A 3JVZX 2DKPA 2RVBB 3AV8A 1SBBB 2D9VA 3NWFA 2IBIB 2WGSA 2YS3A 3Q3OC 4PYZA 4FULA 3BVMA 2LZ6A 2DHIA 4DX90 2KQSA 4MGKE 1TXDA 1R4MB 3P1MA 2DKQA 2QSDA 1TQZA 2RLOA 4GOCA 3WCQA 2I38A 1FCCC 3NUHB 4KIKB 2DYQA 3N20C 1KLGD 3OJ4B 2D3CA 3OLMD 3U4EG 3UI3A 1E0ZA 2C7MB 1TKGA 2K6DB 3HM6X 2IO2B 3M63B 3U30A 2KC1A 1JALA 3Q3MC 3Q8EA 3PRPB 4G3XB 4AWJA 3ZYYX 4EZJA 2L8JA 5HE0A 2WNMA 3AECB 4ANWA 3APCA 5LOPB 3T3OA 2RDHA 3Q8FA 3Q3JA 3SHQA 4MK0A 1WI0A 1YN5A 2D9XA 2IPKD 1QOBA 4M02A 1XQQA 2WDTB 1U5EA 2IZVB 5AZGA 2EMSA 2O6VD 1ZGUB 3TEZA 1VJKA 4ANVA 1JWBD 2JX5A 1FNWA 3ONSA 4OSNA 2ZPYA 2JT4B 3N1YC 4UDUC 3AJ4A 1MG4A 3R7RA 2LVQA 2NPTB 4ZRPA 1V81A 2MBQA 3TEWA 2NBWB 5JHAA 2M0XA 1SIJA 1MG8A 4D0NB 2W3RA 3CIKA 1UNRA 2YT1A 1SIFA 1SE2A 1X05A 3P63A 1Q10A 3L4PA 1XCQL 1GB4A 4ZOHC 2KOXA 3UQAA 3BIID 3ZJUA 1S3SG 2WXNA 3JSVA 4XDDA 1OEYJ 3RZFA 3N9YC 4WH4A 1ZPSA 2N0SB 2NR2A 2DZIA 3HRDD 4N9F4 4RGMA 4J6IA 1QQRA 3NG0A 2LHEA 2NMQA 1ZSQA 3VUXA 2IFSA 2LASA 1FRRA 3B0AA 4HHVA 4JPSA 5TSSA 1PMSA 4TYZA 1GC6A 4HWIB 4HAXB 2J0JA 1K5DB 4NZLB 1OQRA 5D3YA 3QHTA 2KWDA 3KYCD 5BYQA 2IO0B 3DBLI 3RPFC 3UGBB 3ZGZA 1C4PA 2GBJA 3PVWA 2CU1A 2K1FA 4HEA1 2MCNB 2C60A 4A6HA 2JXXA 4REZA 3DXEA 1E6EB 4LK0M 3RI7C 2GBMA 4IW0A 4DK5A 1P98A 4HPPA 2JYEA 3SEBA 2QDFA 3H9DA 4B9KA 3BINA 2PEAA 2YEPB 1TS3A 2OTXA 3AE9B 2PLPA 3GB1A 2Y3AA 2QEJC 2BBCA 2QKMA 1GJZA 1F9JA 4KVGB 2WWZA 3OWEB 4YWGG 3H7PB 3KRWA 1X1MA 2C5LC 1D5ZC 2L0TA 5L95C 1F1HA 3U7DA 4TQ1A 2FJLA 2KCJA 2KFKA 2CRFA 1T77A 3VUWA 2YLMA 3DBHB 3RNCC 3PLUA 3ZRFA 3CMMB 2KT7A 4WAAA 2NS5A 4IOYX 3AEGB 4C4VA 4JWSC 1GAQB 1YJJA 2GMIC 4GDLB 4LTUA 5DIFB 4M0WA 3ZDTA 3VR9B 2RSUA 4DBGA 2OQBA 4MJSB 5J2RA 1Z2MA 2NMBA 5C6RA 2UYZB 2BWES 2O6VA 1P3QU 2CHWA 2ROZB 2RR9A 1TS4A 5AUKA 1C76A 1TS2A 4PS8A 1FOEA 2ONQA 1RM6C 4KV2A 2AQ1B 1K5GB 4P7IA 1JMLA 1WH3A 1XCGA 4TMAB 1X11A 3HSAA 5I2MA 1AN8A 3V3XA 3RFZB 2O2VB 1TJEA 2V4LA 4LNKA 3MPXA 1LXDA 2NBVA 5JZEB 1YX6B 5BMIA 1V97A 4A55A 1PFJA 2BYVE 4NQKE 2J7QB 1AYFA 1TKEA 3TEYA 3ZNHB 3UIOB 3PRZA 1Y56A 2PMVA 2JRIB 1OEYA 1QQGA 4FXCA 2ZW0A 1L0YB 3A1QB 3JYUA 4ZRIA 1E8WA 3HK0A 1WJMA 2K39A 5CTRC 2E2XA 5L81A 1WGQA 3QX1A 3HVZA 4JL9A 3KVFB 1WM3A 1M7RA 3MC8A 1L6VA 1YJ1A 2KQ4X 3WYFB 4OZAA 2MJ3A 2PVGC 2KN4A 4P1BC 2K25A 1YQ3B 1TS5A 4Z2MB 2M8SA 3KQ4A 3GP7A 2YSZA 2WU5B 1ZC4B 2LGIA 4KDLB 2V3PA 2DHKA 4ITKA 2MWSB 2M56B 4DHZE 5D27A 1WGYA 3A9JA 2XK5B 3AE3B 2FCNA 3KRXA 1NVID 3UINB 2LXAA 3NZ3A 1PQSA 1D6EC 4QJ3B 3W9CB 2WXIA 2YRYA 2COAA 1VCBA 3ZNID 1IPGA 1BTNA 1I2HA 3B08A 1U4AA 3ECIA 2KUPA 1C79A 1FNVA 2RDBC 4LNFA 1L4DB 1Y5OA 2KR0A 3UF8A 4RM8A 3ZKJC 4K7SA 1ZXIA 2LG1A 5HHDG 1IGDA 3FVCA 4PYUA 2GJYA 3IXSA 2R0DA 2OHFA 4LJPB 2KO3A 4L1BA 3SUZA 3MC0B 1EU3A 3N30A 3I57A 2KJRA 2RRFA 3MJWA 2KTRB 1C4CA 3A33B 4MELA 3EECA 4ICVA 3PVUA 2JY6A 3VQIA 4RFBA 1V1OA 1XR0B 1NEKB 2M19A 2ZPNA 1OFFA 1EGXA 1V1PB 1WSPA 2KWUB 3V60A 3NJTA 1D4BA 4HROA 3DBSA 2KD0A 4A5KA 2MJDA 4HJKA 1V89A 1JWSD 1FM0D 1ZXHA 3AE8B 4B6WA 3PGEA 5FKAC 3ZVRA 2IY1B 1FHXA 4LDTB 5JHHA 1DDVA 3AM9A 4WWNA 4Q2JA 1V5PA 3TVVA 2LULA 4A9AA 2W2XC 1BMLC 2G45B 2H89B 2SEBD 1L7YA 4DDGD 1W1GA 3Q6BA 1Q67A 2MSED 3P4SB 4DIXA 3QQ8B 4QXAB 3K9OB 1U5FA 3QA8A 1CJEA 1P5TA 1WY8A 3CXBB 2LEKA 4XDCA 1C4AA 1UWMA 5BYRA 3BY4B 4RF0A 1EAZA 4RGNA 2I2YA 2VZKD 1MI1A 2V9HA 1N5XA 3KUDB 3Q8AA 4XC2A 2AL6A 3SYXA 2COCA 3PHXB 2FAZA 4IWPA 5IA7A 4ZDVA 2KZRA 4US8A 3GYPA 1P0RA 5EE9A 4QAYA 3W1SC 1V8CA 2N7EA 1R4MI 4HK2A 4JX1C 1QOAA 2ZJDA 3ZQ4A 4IG7B 1FHWA 2P0DA 1WM2A 1E7UA 2GS0A 3SNHA 1XO3A 1FXAA 2L83A 4KHOA 2INCC 2ON8A 1XD4A 4FJZA 5LXIB 3Q69A 2ZEQA 1MK7B 4TSSA 2L32A 4YL8A 1T0QC 3RUIB 1XLNA 3TIXA 2V3NA 4P16A 2N0YA 3TFMA 3H8HA 1B9RA 3SFEB 1NI3A 4Z2NA 3EFUA 1ET6A 2MFQA 5EFXA 4FA6A 1T0SC 2MBHA 1WE7A 4IM0A 3QIJA 1XCTL 3F0WA 2LRWA 4F7UP 3MDBC 3O65B 2Z4DA 4F1SA 4ZHOA 2MDXA 5CLQB 3QCAA 3GS2A 4IWQA 4OVUA 1NENB 2B76B 1K8RB 2CJOA 3EGRA 2INPE 4CQNA 2DHZA 2MX2A 3WA0A 1WFYA 2WXKA 4FJVB 5E6JA 2V76A 1UGJA 2LRUA 1V2YA 4MT5A 1N60A 5C3JB 1F52A 1SF0A 4BBKA 1U2BA 2M4NA 2MBEA 3L0WB 3KY9A 5EE1A 2ZNVC 2M0AA 2WXHA 3GE8C 3PT2B 1WXAA 1HA5A 3WAPA 1PFDA 1SSNA 4E3CA 2H7DA 3M1IB 3PP2A 2KK8A 2BB5A 1DOIA 2Z0DB 1RFKA 1EWYC 2D3AA 2J4XA 4DHJD 2P8VA 1UNPA 2AL3A 2J59M 4BOSC 4RCOA 4IKGA 2D9YA 3G9WA 4WJPA 1AWDA 3AE2B 2KJHB 2WXFA 4NJ7A 4S17A 2JU6X 3Q8BA 1TKYA 3PLVA 1UZXB 3I5JC 3IT6B 2I1KA 2RGNB 5D3XA 4BKTA 2GBKA 2LGXA 2LKOA 3NW8A 2XN9C 2R61A 2PTLA 3L54A 3CIRB 4BOZB 1EWCA 2KTFA 2L1AA 1F0ZA 3A4RA 3VDZA 3AEEB 1FHOA 1J0GA 1DYQA 4NY0A 2WXQA 4XWWA 3M95A 4HB0B 1C77A 2Z0QA 2IGGA 2FBWB 5HFYA 4A6KA 1WGGA 1LW3A 1GOZA 2DYBA 4H2AA 1WR6E 1FO4A 1VZ6A 4C80A 2X8XX 4L23A 4FBJB 2YT0A 5BMGA 4FADA 1FGYA 1WGDA 2UZSA 3ZJVA 1WR1A 1HZ6A 4DXAB 2WP9B 4I6NB 3IAM1 4IFSA 1WG7A 3O13A 2DZJA 3MC9A 1V80A 5FR6A 4W9JA 5LONB 3K9PB 1E9MA 3DVGX 1J19A 3HQCA 4BBNF 3D32A 4YONA 3E9SA 1MIXA 5HE3A 4RNAA 3ZVVA 3JSVB 4XZ4A 1UF0A 4MM3A 3DBHI 4AOFA 3HW2B 2DN6A 3EUB2 2KWCA 3SU8X 4QJ5B 2W2XD 3QAQA 3VIAA 4KSLC 1FIQA 2BS2B 2JVCA 5J17A 2W55A 5EDSA 4II2B 3VTUA 4YTMB 5AEKB 2VRWB 1TZ1A 1F77A 4GLSC 2MQJA 1NYQA 2N7JA 2DX5A 1DBHA 2UWQA 3NSUA 4DWFA 5CHVC 3RT3B 3GE3C 3RYTA 1XD3B 3AE5B 3DHIC 4M8NA 4CYEA 4GDKA 3VXWA 2VRRB 1N3HA 2YS1A 1SJED 1LM8B 3VOQA 1D5MC 4W9FA 2Z0PA 3ULBA 1SJHD 4W9KA 1AW7A 1OMWA 4ANXA 1UEFA 3R7QA 1V61A 3RNAC 4WSFA 3DBRI 2KIEA 4PQ0A 2Q5WD 4A3OA 2VSZA 4DQOC 4BZAA 1LGRA 1P7EA 1QLBB 2X38A 4EKUA 2K6QA 5E6PA 4BFRA 3WALA 1FXTB 2BTEA 3W5UB 1QKZA 5C2TB 3TBLD 1C1YB 3DHGC 1YQ4B 4MEMA 4P6VF 2K9XA 1ZKHA 2QKLA 4BVUC 2D9WA 3ZNZB 3ZXVA 2JWZA 2KFKB 2H7EA 4NNJB 3ZUNA 4Y94A 2V3SA 3R2IA 5KQ4A 4W9HA 1OTRB 2LUEA 4KHBA 3LXFA 3Q14C 4HDOA 3ZW3A 4MACA 1YQBA 1XT9B 2KNBA 3IHPC 4N58A 4C4VB 4GB9A 2K8BA 3P7ZA 1F2RC 2JPHA 4FN2A 1EVHA 1GPXA 4P1CC 2QC8A 4W9EA 4L1RA 4D6WA 2EMTA 2LOZA 4M0WB 2QHOA 1SHCA 2BWFA 3CSFA 3KYDD 4BKSD 3SR6A 3TO1A 4HCPB 3MTNB 4IAPA 1JRPA 4C7YA 2NTTA 1KJTA 2FCMA 3NWDA 3WAMA 2C7HA 1V88A 3D8FA 3NVYA 4A8XC 3RNGC 5BMHA 2O6VB 4LJOB 1ZVRA 1IGCA 4KSKC 3M3JA 3OANA 4RH6A 1TTNA 2KANA 3EHVA 3A58A 2BGFA 3QWMA 2LI5A 1Y8RC 2KDMA 5I2SA 1V5OA 4DHZB 2W82A 1PLSA 3SFDB 2PPHA 2V4IB 3F5RA 2AQ3B 5JXVA 3MHSD 4KZ0A 2NBVB 4IM2A 2JP2A 2KDEB 4EZKA 3C8YA 2WDRB 2RD0A 1K51A 3L13A 4N6EB 1SE4A 4RM9A 1FPYA 2DNFA 1JW9D 2HJ8A 1XLOA 1FGZA 2INNE 4A6QA 5BYSA 5CHWA 1ZDXA 3I3TB 3UIPB 2CY5A 3B77A 3AE4B 1Q1OA 1WYGA 1I35A 3L16A 3MFGA 3ZIMA 1TGZB 4DDID 2P0FA 2KMAA 5C5BA 5EE0A 1NDDA 2CY4A 4NAWA 3TL5A 3DOWA 3SD5A 2K2UA 2JF5A 1A70A 2WXJA 1R4NB 1E10A 1Z87A 2KWVB 3H1UA 3QARA 3A9JB 3Q2AC 2BKRB 2DFKA 5HKHA 4US9A 5J18A 4ZRJA 3AEFB 1JWUD 1V6EA 1H8CA 1BUIC 1FAOA 2ZCCA 4TUUA 3KWVA 2FIFA 5DPSA 2M14A 2LHDA 3V05A 3V6EB 1FRDA 2B3AA 4YSXB 5LG4B 4ZRKA 3TW1A 1MPEA 3OHMB 2LD9A 5CX3A 1EU4A 2OEDA 5LXHA 4C00A 2VH1A 2ASQA 2MLBA 2GBNA 1GUAB 1E7VA 1TJ6A 1QT9A 5DPRA 2R2OA 2FE8A 2KLGA 2WQYB 2A5UA 2MW5A 2I5CA 4WURA 1P6SA 1OQYA 1NI2A 5E6OA 3Q3FA 3FSSA 1FEHA 2KMMA 2IYDB 3RCZA 2MJEA 5MPOA 4W9LA 3DBLB 1E5WA 4G11A 3FKYA 4EFOA 4A3PA 1FB8A 2LVOA 2KDBA 4RF1A 2GCLA 3CF6E 3NVWA 4JE3B 2REXA 2WDVB 3OG5A 2ZKMX 4B0MA 4W9DA 5I4DA 4MGIE 3A9KB 2OOBB 2N1WA 1KTKA 4LNNA 3FAHA 2EELA 2WYQA 5HG2A 2L3ZA 1VRAB 2MHJA 3CSTA 5J3YA 4WWMA 1FMAD 5E6NA 3BVZA 3B1LX 1I4QA 5G2NA 1M4VA 3WIMA 4BKSA 4JQWC 1KZ7A 4URKA 3GZNB 3JW0X 3KLSX 4TKNA 5H92C 4K7UA 1WX7A 2L1CA 4IC7B 2WLBA 5D3IB 2RPVA 1F2RI 2OJRA 5AZFA 4M8MA 2PJHA 3MJ5A 1ZM0A 2LMCA 2KHWB 1KF6B 1DYNA 2DYOA 2KACA 1WYWB 3IFWB 3LDZE 4HPLB 4B0EA 4WJOA 1ZE3D 4ZHPA 4HB4B 2KYWA 5FK9C 2G4SA 4MDKE 4RMAA 4K3BA 4A6FA 1KI1B 3GOEA 3H6NA 3EC8A 3A9KA 4IDIA 2FUHB 3UZTA 3RCPA 2DTCA 4KKJA 2IGDA 1QOGA 3L17A 3RN9C 3N1XC 3A8QA 1ZYIA 3BJIA 1WX9A 1HZ5A 5JH5C 2W54A 4HVBA 2QMTA 2AYOB 2N1VA 2Y5CA 2JZPA 2C9WB 2LGYA 1WZ0A 1DDMA 2KAJA 3BWUD 3I9V1 3AULA 4DXGA 4EZLA 4QJ4B 4WJNA 2X18A 3TSSA 2J0MA 1SB3C 4GPTB 3LJUX 4GXBA 5EE3A 4AQ7A 3ZTCA 1QC6A 1UBIA 1FD6A 1WVHA 4KGTA 3R66C 5DHAB 2D9ZA 2WXGA 2ZVNA 3HM3A 4I6PA 4OW0A 1OQQA 1JWMD 4IM3A 2KDFB 2BKFA 1NYRA 3PZ8A 2HTME 3PSCA 1WMHB 1J7CA 2CKHB 4CHJA 3KUZA 2K8HA 4E71A 3DCXA 3P4RB 4YXDB 2RNRB 4WIPA 2MP2A 1N62A 3KW5B 5IKCM 3URYA 2EKEC 1TY0A 3AI5A 3I63C 1NU2A 4G0NB 4ZYNA 4ICUA 2AEHA 1T5XD 4B6HA 1WGHA 5LNK1 1MHXA 2DYNA 2KX3A 4HB3B 1MVKA 2ACZB 4HJGE 4WJQA 5IOIA 4GOUA 1DOXA 1YX5B 1STEA 3T3NA 1MIZB 3A4SC 3GYOA 2AWTA 2Z59A 2RGFA 2KXJA 2AQ2B 5AUIA 4BAXA 4HDQA 1NTYA 1I7HA 1T0RC 2M17A 1SEBD 4ARIA 2N23A 3RNEC 2WHIA 5IP4D 3U8ZA 2IO3B 4MH0E 4LNOA 4DBBA 1WMHA 5JHGA 2CS4A 1U5GA 4WWOA 4GNKB 3NWAA 1ZP0B 4HPMB 1ROEA 4KZCA 2CJNA 4KDIC 4NJCA 2V1YA 2W9NA 3DVNU 2HTHA 2FUG1 2ELAA 3AEAB 5JLJB 3D8EA 1PUTA 2DWQA 5D7GA 2VH2A 2BYEA 1TYGB 4L6EA 3SDLC 1WJUA 5HI1A 3QBVB 1UBQA 4TV3A 3IG3A 1WXQA 1PGAA 2Q13A 3PZDA 1W1HA 3VR8B 3SV1A 3RNBC 2KVZA 1DDWA 4HSIA 3PPAA 1NTVA 1XKEA 5GOWB 2J0KA 2KFJA 1WZ3A 4GN1A 4WAFA 3B9JA 1XX0A 2PZ1A 1WE6A 3UQBA 4RGOS 2K5PA 3N1ZC 5C16A 2BVCA 1UNQA 5AZHA 2GB1A 4I6LB 4NPNA 1M7EA 3TMPB 2VZKB 2N9EB 2K49A 4K2OA 4C0AA 2ICIA 1KLUD 2DLBA 2YT2A 3EA6A 1ZOYB 1K50A 3VRBB 3AEBB 2YS5A 3U12A 3X23A 2NTSA 2HE7A 1ZUD2 3KWLA 1LO5D 3LJ3A 4HKQA 1MJDA 2E3TA 4MH8A 1KRHA 2C7NB 2DYMA 2P0HA 2Z8LA 1IBXA 3FC4A 1XLQA 4HAVB 3FILA 1ISNA 3P42A 4MM3B 1Y19B 2LUMA 1WI1A 1GNUA 4JWUC 2FJUB 4CSQA 3W5VB 4K81A 2CR5A 2DLWA 2JXTA 1UUPA 2GBRA 2IGHA 2WXPA 2ZW1A 3BK1A 1DOYA 2WS3B 1WGKA 3ALBA 1MI0A 4GIVA 3O96A 3RZWC 2J42A 1RYJA 2CHXA 2IY0B 1UGMA 3DWMA 2DX5B 1X86A 3PEGA 2PIAA 2KJ6A 1QZEA 5IO9A 3E56A 1TIFA 4GDKB 1C9FA 3DPDA 4HATB 1ET9A 1YJIA 3M62B 2BF8B 3APDA 2EKIA 2GUMA 4NSWA 3IBEA 5FR3A 1XLPA 2BYFA 3WANA 3KZ1A 1M94A 1EM7A 1C78A 5DPTA 1K53A 4W9GA 2LOXA 2ROVA 3U7ZA 2LJ5A 2PE9A 3ZO5B 1E8XA 4K17A 1QOFA 1XEEA 4EOYA 4D2KA 1WIAA 3KSYA 2FNJB 3W2DA 3VH3B 4AP4C 5DPWA 2MWNB 1N5WA 2Y7BA 2R2QA 3R8BA 3ZJTA 4YSZB 2YVCA 3A98B 3BZDB 2WXRA 1BAKA 2Y5PA 2BQQA 1X1GA 3DQVA 3ENEA 2IDYA 1TZOA 1P1AA 3T8MA 2MBBB 1N6ZA 1Z5SB 2Y8FA 3BVGA 1L0XB 3NS1A 5KCVA 3QK0A 3U2SC 4N59A 1E8ZA 4DHJB 4XWTA 1I4XA 2UU7A 4KIKA 5HE2A 4KHBB 1OQNA 2GLSA 2I1JA 2NVUI 2PKOA 4KGRA 3WAOA 2LFIA 4IOIE 3VAWA 1R4NI 1V5MA 2JRHA 1LFDA 4O1NA 2G3QB 3ULCA 1D5XC 4PS3A 4AJYB 4F8CB 1HXYD 2KMCA 5M4YB 3B2FA 3DWGC 3IT4B 1EF1A 2MBOA 1NBFC 1VR9A 4K3CA 1WXMA 1J7BA 2YF0A 2FCSA 3ML9A 3PSEB 1YN3A 4WWPA 3OJ3A 4XYCA 5G55A 3TCAA 2KKCA 1BXTA 4EMOA 2KVRA 2G4DB 1PGBA 4J3OD 4AJWA 3U52E 3AXCA 1UD7A 3RMKC 4MGYE 2EC1A 2K8EA 1T3QA 4IWOA 1OGWA 3BYYB 2K00A 2JZZA 2D3BA 1KOTA 2N7DA 2KGXB 4ASWC 3DVNV 3NZUA 1WGUA 1N63A 2BS3B 2NPTA 1U29A 4F7GA 1KFYB 2DAJA 2CHZA 4B95A 1CMXB 2N9KA 3T9LA 1LQBA 1U27A 3HHMA 4GZUA 4ZYSA 1L5PA 4HAYB 2NZ8B 1VZ8A 2XBBC 2D10A 2L0FA 1RLFA 4ANUA 3R2TA 1XODA 2LXCA 2QCZA 2M38A 3NVZA 1RJ2A 1P7FA 1I42A 3AU4A 2GCJA 3V62A 3VHTC 3AE1B 2KC2A 2LWPA 5KHOA 1E8YA 2WX0A 4HRSA 3V6CB 5D3WA 2BW2A 5C5BB 2L52A 2V0GA 2RSGA 4NAWB 1R7SA 1CK1A 3HUIA 2MEKA 1YOVB 1WGRA 2HD5B 1RRPB 3AEDB 1OY2A 1JRUA 2D4QA 5JHBA 4W9IA 2D3GA 2R09A 5G5HA 1JROA 1MHHE 3GZNI 3TEXA 4GGQA 2JYTA 3DDCB 3H7SA 1D3ZA 4LNIA 5DCNA 1IRSA 1J0WA 2WXOA 2CAYA 4K2PA 1HTOA 1PDXA 1A5RA 4ARCA 1ZW7A 1UPQA 3VUYA 5L83A 1YD8U 3PTFC 2ADZA 1N61A 1SE3A 2RDGA 4LCDE 4CHMA 5T8IA 1WJ1A 2N9XA 5JP4A 4WVFB 4YTNB 4CO7A 4EJNA 4AUQC 1PYWD 1ZC3B 1Q0WB 3A8PA 2Z13A
chains in the Genus database with same CATH topology
2DENB 3NZSA 4JGHB 2PE6B 3X0WA 1MPHA 3L10B 3ZNGC 2D2QA 3NY5A 2G35A 4A20A 5KQ1A 1UELA 3H7PA 1L2NA 1W1DA 1X1FA 2IYBA 1V5UA 1P3RA 2MKRA 3VVWB 2A4ZA 3KH0A 2D07B 4FLHA 2N4FA 3HIZA 4FJYA 3L08A 4K1RB 2LYDA 1BTKA 3W1YA 4GSWA 2K8CA 2DA0A 4G50A 4EUTA 2I5FA 1RFAA 5J3QA 3APFA 3NOBA 1E90A 3W1SA 4PNKA 4HB2B 3AU5A 5HE1A 1KLVA 4HAUB 5C1ZA 1BT0A 2UVMA 4LDTD 1G6JA 2DZKA 1S1QB 4GDLA 3V61A 2Z0EB 1V9JA 1MAIA 3NHEB 3V5WA 4MJSA 5J3TA 4TQ0A 1EF5A 3DVGY 2Y8GA 4MY6A 1V86A 1V5TA 2ZNVB 4MSMB 5CHFA 1WF9A 4NQLB 3OAWA 3VFKA 4HXDA 3FEHA 4A6FB 2BCJA 2O2VA 5C23A 4BKGA 5FI1A 3P6AA 1SGHA 2UZRA 1I7AA 3A1QA 1WXVA 2D11A 4DX8A 4H8SA 2EJ8A 4HLEA 2L05A 2COFA 1GG3A 1TBEA 1J8CA 4FHKA 3ZDMC 2Y5BB 1WJ6A 3P2BA 4NJ6A 4MT7A 1UH6A 2W2WA 1AQCA 5DHFB 4KHAA 3PS6A 3ML4A 3ZLZA 2ZVOA 2KQ7A 1EUVB 2XK5A 1C3TA 2RPQA 3QWZB 1AARA 4MGZE 3N32A 1H4RA 4XX5A 2L76A 2NBUA 2KDIA 1UPRA 2MP2B 1MKEA 5D94A 3NS8A 3IVFA 2JZ3B 1SE9A 1V49A 4OVVA 2DZMA 2FCQA 1WX8A 4X57B 2BPSA 3ZRCA 2Z59B 5D6JB 2KTRA 4PS7A 3VH4B 4JIOU 3FM8C 2ELBA 1LB1A 2K2JA 5D3VA 1VD2A 1IP9A 4E74A 5GMVA 4CHKA 2ZZPB 2CODA 2L00B 3RULA 1P9DU 3RD2A 2HTHB 2N9PC 4GMVA 1YIWA 3PHWB 2KX0A 2Z0OA 1U5DA 1MK9B 5KHQA 3PRMB 1IYFA 5C79A 5DH9B 2M1MA 4HAZB 5LLIA 2JUOA 3QC8B 3PVLA 4FHJA 2XQNM 4XWXA 2MRPA 3N3KB 3VTVA 5FI0A 1WJ4A 2XEWA 3S2AA 4HAWB 2NCNA 1AWEA 2DHJA 4HCNB 3DXDA 4II3B 1KZGA 4KAXB 5DI9B 2L2IA 3PG7A 3TJPA 2KN5A 1WRDB 1DROA 3PREA 5IAAC 4EEWA 4BBNC 5TR5A 3ODOA 1H10A 2L7RA 2LGDA 4MSQB 1RAXA 3ZTDA 3ODXA 2RUKB 3DCGA 3R3MA 2LVPA 5BO4B 3VTWA 1GC7A 3KUCB 4IUMB 3QJZA 2MA9B 1T0YA 3DXCA 1EO6A 1WXSA 4WQOB 4JLCA 3ODWA 4W9CA 3C0RB 2IO1B 1B55A 3ML8A 4K7WA 4F7ZA 3T06A 2VKIA 3PV1A 4F7HA 2KLCA 3D8DA 1KM7A 2FIDA 5D2MB 4GU2A 1RRBA 4WJ7A 2DAFA 2WX1A 1WJNA 2GOWA 1BWNA 5CLLB 3N7CA 2ZCBA 4GMXB 1Q5WB 2DX1A 3SO6A 1HE8A 3JVZX 2DKPA 2RVBB 2D9VA 2IBIB 2YS3A 4PYZA 4FULA 2LZ6A 2DHIA 4DX90 2KQSA 4MGKE 1TXDA 2DKQA 1TQZA 2RLOA 4GOCA 4KIKB 2DYQA 3OJ4B 3OLMD 2C7MB 2K6DB 3HM6X 2IO2B 3M63B 3U30A 2KC1A 4EZJA 4G3XB 3PRPB 4AWJA 2L8JA 5HE0A 4ANWA 3APCA 5LOPB 3Q3JA 3SHQA 4MK0A 1WI0A 2D9XA 1XQQA 2WDTB 1U5EA 2IZVB 5AZGA 2EMSA 2O6VD 1ZGUB 4ANVA 3ONSA 2JT4B 2ZPYA 3AJ4A 3R7RA 2LVQA 2NPTB 1V81A 2MBQA 2NBWB 5JHAA 2M0XA 1MG8A 4D0NB 3CIKA 1UNRA 2YT1A 1SIFA 1X05A 2KOXA 3UQAA 1S3SG 3JSVA 1OEYJ 3RZFA 2NR2A 2DZIA 4N9F4 4J6IA 1ZSQA 3VUXA 2IFSA 2LASA 3B0AA 4HHVA 1PMSA 4TYZA 1GC6A 4HWIB 4HAXB 2J0JA 1K5DB 5D3YA 3QHTA 3KYCD 2IO0B 3DBLI 3UGBB 2GBJA 3PVWA 2CU1A 2K1FA 2MCNB 2C60A 4A6HA 2JXXA 3DXEA 2GBMA 4IW0A 4DK5A 1P98A 3H9DA 4B9KA 3BINA 2PEAA 2OTXA 2QKMA 1GJZA 1F9JA 4KVGB 2WWZA 3H7PB 3KRWA 1X1MA 2C5LC 2L0TA 5L95C 3U7DA 4TQ1A 2FJLA 2KCJA 2KFKA 2CRFA 3VUWA 2YLMA 3PLUA 3ZRFA 3CMMB 4WAAA 2NS5A 4IOYX 2GMIC 4GDLB 5DIFB 3ZDTA 2RSUA 4DBGA 2OQBA 4MJSB 5J2RA 1Z2MA 2NMBA 5C6RA 2UYZB 2BWES 2O6VA 1P3QU 2CHWA 2ROZB 2RR9A 4PS8A 1FOEA 4KV2A 1K5GB 4P7IA 1WH3A 1XCGA 1X11A 2O2VB 2V4LA 3MPXA 1LXDA 5JZEB 1YX6B 1PFJA 2BYVE 4NQKE 2J7QB 3ZNHB 3UIOB 3PRZA 2JRIB 1OEYA 1QQGA 3A1QB 3JYUA 4ZRIA 1E8WA 3HK0A 1WJMA 5CTRC 2K39A 2E2XA 5L81A 1WGQA 3QX1A 4JL9A 3KVFB 1WM3A 1M7RA 1YJ1A 3WYFB 2K25A 4Z2MB 2M8SA 2YSZA 1ZC4B 4KDLB 2DHKA 2MWSB 4DHZE 5D27A 1WGYA 3A9JA 2XK5B 2FCNA 3KRXA 3UINB 2LXAA 1PQSA 2YRYA 2COAA 1VCBA 3ZNID 1IPGA 1BTNA 1I2HA 3B08A 1U4AA 3ECIA 2KUPA 1Y5OA 3UF8A 4RM8A 3ZKJC 4K7SA 2LG1A 4PYUA 2GJYA 2R0DA 4LJPB 2KO3A 3SUZA 3N30A 2KJRA 3MJWA 2KTRB 3A33B 4MELA 3EECA 4ICVA 3PVUA 2JY6A 3VQIA 1XR0B 2ZPNA 1EGXA 3V60A 2KWUB 3DBSA 2KD0A 4A5KA 4HJKA 1V89A 4B6WA 3PGEA 3ZVRA 2IY1B 1FHXA 4LDTB 5JHHA 1DDVA 4WWNA 1V5PA 3TVVA 2LULA 2W2XC 2G45B 1L7YA 4DDGD 1W1GA 1Q67A 2MSED 3QQ8B 3K9OB 1U5FA 3QA8A 1P5TA 1WY8A 3CXBB 3BY4B 1EAZA 3KUDB 4XC2A 2AL6A 3SYXA 2COCA 3PHXB 2FAZA 4IWPA 5IA7A 4ZDVA 2KZRA 3GYPA 1P0RA 3W1SC 2N7EA 1R4MI 4HK2A 2ZJDA 4IG7B 1FHWA 2P0DA 1WM2A 1E7UA 2GS0A 3SNHA 4KHOA 1XD4A 4FJZA 5LXIB 2ZEQA 1MK7B 4YL8A 3RUIB 3TIXA 2N0YA 3TFMA 4Z2NA 3EFUA 2MFQA 5EFXA 4FA6A 2MBHA 1WE7A 4IM0A 3QIJA 3F0WA 2LRWA 4F7UP 3MDBC 3O65B 4F1SA 2MDXA 5CLQB 3QCAA 4IWQA 4OVUA 1K8RB 2DHZA 2MX2A 3WA0A 1WFYA 4FJVB 2V76A 2LRUA 1V2YA 4BBKA 1U2BA 2M4NA 2MBEA 3L0WB 3KY9A 2ZNVC 3PT2B 1WXAA 3WAPA 4E3CA 2H7DA 3M1IB 3PP2A 2KK8A 2Z0DB 4DHJD 2P8VA 1UNPA 2AL3A 2J59M 4BOSC 2D9YA 3G9WA 4WJPA 2KJHB 4NJ7A 3PLVA 1UZXB 2I1KA 2RGNB 5D3XA 4BKTA 2GBKA 2LGXA 2LKOA 3L54A 4BOZB 2KTFA 3A4RA 3VDZA 1FHOA 1J0GA 4NY0A 3M95A 4HB0B 2Z0QA 4A6KA 1WGGA 1LW3A 2DYBA 1WR6E 4FBJB 2YT0A 4FADA 1FGYA 1WGDA 2UZSA 1WR1A 4DXAB 4I6NB 4IFSA 1WG7A 2DZJA 1V80A 5FR6A 4W9JA 5LONB 3K9PB 3DVGX 1J19A 3HQCA 4BBNF 3D32A 4YONA 1MIXA 5HE3A 3ZVVA 3JSVB 4XZ4A 4MM3A 3DBHI 4AOFA 3HW2B 2DN6A 2KWCA 3SU8X 2W2XD 3QAQA 3VIAA 4KSLC 5J17A 2JVCA 5EDSA 4II2B 3VTUA 5AEKB 2VRWB 1TZ1A 2MQJA 2DX5A 1DBHA 2UWQA 3NSUA 4DWFA 5CHVC 3RT3B 3RYTA 1XD3B 4M8NA 4CYEA 4GDKA 3VXWA 2VRRB 1N3HA 2YS1A 1LM8B 3VOQA 4W9FA 2Z0PA 3ULBA 4W9KA 1OMWA 1UEFA 3R7QA 1V61A 4WSFA 3DBRI 4PQ0A 4A3OA 2VSZA 4EKUA 2K6QA 5E6PA 4BFRA 3WALA 1FXTB 3TBLD 1C1YB 4MEMA 1ZKHA 2QKLA 4BVUC 2D9WA 3ZNZB 2JWZA 2KFKB 2H7EA 4NNJB 3ZUNA 4Y94A 2V3SA 5KQ4A 4W9HA 1OTRB 2LUEA 4HDOA 3ZW3A 1YQBA 1XT9B 2KNBA 3IHPC 4GB9A 2K8BA 3P7ZA 2JPHA 4FN2A 1EVHA 4W9EA 2EMTA 2LOZA 4M0WB 2QHOA 1SHCA 2BWFA 3CSFA 3KYDD 4BKSD 3TO1A 4HCPB 3MTNB 4IAPA 1KJTA 2FCMA 3WAMA 2C7HA 1V88A 3D8FA 2O6VB 4LJOB 1ZVRA 4KSKC 3M3JA 3OANA 1TTNA 2KANA 3EHVA 2BGFA 3QWMA 2LI5A 1Y8RC 1V5OA 4DHZB 1PLSA 2PPHA 3F5RA 3MHSD 4KZ0A 2NBVB 4IM2A 2JP2A 2KDEB 4EZKA 2RD0A 3L13A 4RM9A 2HJ8A 1FGZA 5CHWA 3I3TB 3UIPB 2CY5A 1Q1OA 1I35A 3L16A 3ZIMA 1TGZB 4DDID 2P0FA 2KMAA 5C5BA 1NDDA 2CY4A 4NAWA 3TL5A 3DOWA 3SD5A 2K2UA 2JF5A 1Z87A 2KWVB 3H1UA 3QARA 3A9JB 2BKRB 2DFKA 5HKHA 5J18A 4ZRJA 1V6EA 1H8CA 1FAOA 2ZCCA 4TUUA 2FIFA 5DPSA 2M14A 3V6EB 2B3AA 4ZRKA 3TW1A 2LD9A 5CX3A 5LXHA 2ASQA 2MLBA 2GBNA 1GUAB 1E7VA 1TJ6A 5DPRA 2R2OA 2KLGA 2A5UA 2MW5A 2I5CA 1P6SA 1OQYA 1NI2A 5E6OA 3Q3FA 3FSSA 2IYDB 3RCZA 4W9LA 1E5WA 4G11A 4EFOA 4A3PA 1FB8A 2LVOA 2KDBA 2GCLA 3CF6E 2REXA 4W9DA 4MGIE 3A9KB 2OOBB 2N1WA 2WYQA 2L3ZA 3CSTA 5J3YA 5E6NA 3B1LX 5G2NA 3WIMA 4BKSA 4JQWC 1KZ7A 4URKA 3JW0X 4TKNA 4K7UA 1WX7A 2L1CA 4IC7B 2OJRA 5AZFA 4M8MA 2PJHA 1ZM0A 2KHWB 4HPLB 1DYNA 2DYOA 3IFWB 1WYWB 3LDZE 4WJOA 4HB4B 2G4SA 4MDKE 4RMAA 4A6FA 1KI1B 3GOEA 3H6NA 3EC8A 3A9KA 2FUHB 3UZTA 3RCPA 2DTCA 3L17A 3A8QA 3BJIA 1WX9A 5JH5C 4HVBA 2AYOB 2N1VA 2C9WB 2LGYA 1WZ0A 1DDMA 3AULA 4EZLA 4WJNA 2X18A 2J0MA 4GPTB 3LJUX 4GXBA 3ZTCA 1QC6A 1UBIA 1WVHA 3R66C 5DHAB 2D9ZA 2ZVNA 3HM3A 4I6PA 4IM3A 2KDFB 2BKFA 3PSCA 1WMHB 2CKHB 4CHJA 3KUZA 2K8HA 4E71A 2RNRB 2MP2A 3KW5B 2EKEC 3AI5A 1NU2A 4G0NB 4ZYNA 4ICUA 2AEHA 4B6HA 1WGHA 2DYNA 2KX3A 4HB3B 4WJQA 1YX5B 1MIZB 3A4SC 3GYOA 2AWTA 2RGFA 2KXJA 4HDQA 1NTYA 2M17A 2N23A 3U8ZA 2IO3B 4MH0E 4DBBA 1WMHA 5JHGA 2CS4A 1U5GA 4WWOA 4HPMB 4KZCA 4KDIC 2V1YA 2W9NA 3DVNU 2HTHA 2ELAA 5JLJB 3D8EA 5D7GA 2BYEA 4L6EA 3SDLC 1WJUA 3QBVB 1UBQA 4TV3A 3IG3A 2Q13A 3PZDA 1W1HA 3SV1A 1DDWA 3PPAA 1NTVA 1XKEA 5GOWB 2J0KA 2KFJA 1WZ3A 4GN1A 1XX0A 2PZ1A 1WE6A 3UQBA 5C16A 1UNQA 5AZHA 4I6LB 4NPNA 1M7EA 3TMPB 2N9EB 4K2OA 4C0AA 2YS5A 3X23A 2HE7A 3LJ3A 2C7NB 2DYMA 2P0HA 4HAVB 1ISNA 1Y19B 1WI1A 1GNUA 4K81A 2CR5A 2DLWA 2GBRA 3ALBA 4GIVA 3O96A 3RZWC 2CHXA 2IY0B 1UGMA 2DX5B 1X86A 3PEGA 2KJ6A 1QZEA 4GDKB 3DPDA 4HATB 3M62B 2BF8B 3APDA 4NSWA 3IBEA 2BYFA 3WANA 3KZ1A 1M94A 5DPTA 4W9GA 2LOXA 2ROVA 2LJ5A 2PE9A 3ZO5B 1E8XA 4K17A 4EOYA 1WIAA 3KSYA 2FNJB 3VH3B 4AP4C 5DPWA 2MWNB 2Y7BA 2R2QA 2YVCA 3A98B 1BAKA 3DQVA 1X1GA 3ENEA 1P1AA 3T8MA 2MBBB 1Z5SB 2Y8FA 5KCVA 3QK0A 1E8ZA 4DHJB 4KIKA 5HE2A 4KHBB 1OQNA 2I1JA 2NVUI 3WAOA 3VAWA 1R4NI 1V5MA 2JRHA 1LFDA 2G3QB 3ULCA 4PS3A 4AJYB 4F8CB 2KMCA 1EF1A 2MBOA 1NBFC 1WXMA 2FCSA 2YF0A 3ML9A 3PSEB 4WWPA 3OJ3A 5G55A 3TCAA 2KKCA 4EMOA 4AJWA 2KVRA 2G4DB 3AXCA 1UD7A 4MGYE 2EC1A 4IWOA 1OGWA 2K00A 2JZZA 1KOTA 2N7DA 2KGXB 4ASWC 3DVNV 3NZUA 1WGUA 1U29A 4F7GA 2NPTA 2DAJA 2CHZA 4B95A 1CMXB 3T9LA 1LQBA 1U27A 3HHMA 4GZUA 4HAYB 2NZ8B 2XBBC 2D10A 2L0FA 1RLFA 4ANUA 1XODA 2LXCA 2M38A 1RJ2A 1I42A 3AU4A 2GCJA 3V62A 3VHTC 2KC2A 2LWPA 5KHOA 1E8YA 2WX0A 3V6CB 5D3WA 5C5BB 2RSGA 4NAWB 1WGRA 2HD5B 1RRPB 1OY2A 1JRUA 2D4QA 5JHBA 4W9IA 2D3GA 2R09A 3GZNI 4GGQA 3DDCB 3H7SA 1D3ZA 5DCNA 1IRSA 1J0WA 2CAYA 4K2PA 1A5RA 1ZW7A 3VUYA 1UPQA 5L83A 1YD8U 3PTFC 2ADZA 4LCDE 4CHMA 1WJ1A 2N9XA 5JP4A 4WVFB 4CO7A 4EJNA 4AUQC 1ZC3B 1Q0WB 3A8PA 4ANXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DEN B;  3NZS A;  4JGH B;  2PE6 B;  3X0W A;  1MPH A;  3L10 B;  3ZNG C;  2D2Q A;  3NY5 A;  2G35 A;  4A20 A;  5KQ1 A;  1UEL A;  3H7P A;  1L2N A;  1W1D A;  1X1F A;  2IYB A;  1V5U A;  1P3R A;  2MKR A;  3VVW B;  2A4Z A;  3KH0 A;  2D07 B;  4FLH A;  2N4F A;  3HIZ A;  4FJY A;  3L08 A;  4K1R B;  2LYD A;  1BTK A;  3W1Y A;  4GSW A;  2K8C A;  2DA0 A;  4G50 A;  4EUT A;  2I5F A;  1RFA A;  5J3Q A;  3APF A;  3NOB A;  1E90 A;  3W1S A;  4PNK A;  4HB2 B;  3AU5 A;  5HE1 A;  1KLV A;  4HAU B;  5C1Z A;  1BT0 A;  2UVM A;  4LDT D;  1G6J A;  2DZK A;  1S1Q B;  4GDL A;  3V61 A;  2Z0E B;  1V9J A;  1MAI A;  3NHE B;  3V5W A;  4MJS A;  5J3T A;  4TQ0 A;  1EF5 A;  3DVG Y;  2Y8G A;  4MY6 A;  1V86 A;  1V5T A;  2ZNV B;  4MSM B;  5CHF A;  1WF9 A;  4NQL B;  3OAW A;  3VFK A;  4HXD A;  3FEH A;  4A6F B;  2BCJ A;  2O2V A;  5C23 A;  4BKG A;  5FI1 A;  3P6A A;  1SGH A;  2UZR A;  1I7A A;  3A1Q A;  1WXV A;  2D11 A;  4DX8 A;  4H8S A;  2EJ8 A;  4HLE A;  2L05 A;  2COF A;  1GG3 A;  1TBE A;  1J8C A;  4FHK A;  3ZDM C;  2Y5B B;  1WJ6 A;  3P2B A;  4NJ6 A;  4MT7 A;  1UH6 A;  2W2W A;  1AQC A;  5DHF B;  4KHA A;  3PS6 A;  3ML4 A;  3ZLZ A;  2ZVO A;  2KQ7 A;  1EUV B;  2XK5 A;  1C3T A;  2RPQ A;  3QWZ B;  1AAR A;  4MGZ E;  3N32 A;  1H4R A;  4XX5 A;  2L76 A;  2NBU A;  2KDI A;  1UPR A;  2MP2 B;  1MKE A;  5D94 A;  3NS8 A;  3IVF A;  2JZ3 B;  1SE9 A;  1V49 A;  4OVV A;  2DZM A;  2FCQ A;  1WX8 A;  4X57 B;  2BPS A;  3ZRC A;  2Z59 B;  5D6J B;  2KTR A;  4PS7 A;  3VH4 B;  4JIO U;  3FM8 C;  2ELB A;  1LB1 A;  2K2J A;  5D3V A;  1VD2 A;  1IP9 A;  4E74 A;  5GMV A;  4CHK A;  2ZZP B;  2COD A;  2L00 B;  3RUL A;  1P9D U;  3RD2 A;  2HTH B;  2N9P C;  4GMV A;  1YIW A;  3PHW B;  2KX0 A;  2Z0O A;  1U5D A;  1MK9 B;  5KHQ A;  3PRM B;  1IYF A;  5C79 A;  5DH9 B;  2M1M A;  4HAZ B;  5LLI A;  2JUO A;  3QC8 B;  3PVL A;  4FHJ A;  2XQN M;  4XWX A;  2MRP A;  3N3K B;  3VTV A;  5FI0 A;  1WJ4 A;  2XEW A;  3S2A A;  4HAW B;  2NCN A;  1AWE A;  2DHJ A;  4HCN B;  3DXD A;  4II3 B;  1KZG A;  4KAX B;  5DI9 B;  2L2I A;  3PG7 A;  3TJP A;  2KN5 A;  1WRD B;  1DRO A;  3PRE A;  5IAA C;  4EEW A;  4BBN C;  5TR5 A;  3ODO A;  1H10 A;  2L7R A;  2LGD A;  4MSQ B;  1RAX A;  3ZTD A;  3ODX A;  2RUK B;  3DCG A;  3R3M A;  2LVP A;  5BO4 B;  3VTW A;  1GC7 A;  3KUC B;  4IUM B;  3QJZ A;  2MA9 B;  1T0Y A;  3DXC A;  1EO6 A;  1WXS A;  4WQO B;  4JLC A;  3ODW A;  4W9C A;  3C0R B;  2IO1 B;  1B55 A;  3ML8 A;  4K7W A;  4F7Z A;  3T06 A;  2VKI A;  3PV1 A;  4F7H A;  2KLC A;  3D8D A;  1KM7 A;  2FID A;  5D2M B;  4GU2 A;  1RRB A;  4WJ7 A;  2DAF A;  2WX1 A;  1WJN A;  2GOW A;  1BWN A;  5CLL B;  3N7C A;  2ZCB A;  4GMX B;  1Q5W B;  2DX1 A;  3SO6 A;  1HE8 A;  3JVZ X;  2DKP A;  2RVB B;  2D9V A;  2IBI B;  2YS3 A;  4PYZ A;  4FUL A;  2LZ6 A;  2DHI A;  4DX9 0;  2KQS A;  4MGK E;  1TXD A;  2DKQ A;  1TQZ A;  2RLO A;  4GOC A;  4KIK B;  2DYQ A;  3OJ4 B;  3OLM D;  2C7M B;  2K6D B;  3HM6 X;  2IO2 B;  3M63 B;  3U30 A;  2KC1 A;  4EZJ A;  4G3X B;  3PRP B;  4AWJ A;  2L8J A;  5HE0 A;  4ANW A;  3APC A;  5LOP B;  3Q3J A;  3SHQ A;  4MK0 A;  1WI0 A;  2D9X A;  1XQQ A;  2WDT B;  1U5E A;  2IZV B;  5AZG A;  2EMS A;  2O6V D;  1ZGU B;  4ANV A;  3ONS A;  2JT4 B;  2ZPY A;  3AJ4 A;  3R7R A;  2LVQ A;  2NPT B;  1V81 A;  2MBQ A;  2NBW B;  5JHA A;  2M0X A;  1MG8 A;  4D0N B;  3CIK A;  1UNR A;  2YT1 A;  1SIF A;  1X05 A;  2KOX A;  3UQA A;  1S3S G;  3JSV A;  1OEY J;  3RZF A;  2NR2 A;  2DZI A;  4N9F 4;  4J6I A;  1ZSQ A;  3VUX A;  2IFS A;  2LAS A;  3B0A A;  4HHV A;  1PMS A;  4TYZ A;  1GC6 A;  4HWI B;  4HAX B;  2J0J A;  1K5D B;  5D3Y A;  3QHT A;  3KYC D;  2IO0 B;  3DBL I;  3UGB B;  2GBJ A;  3PVW A;  2CU1 A;  2K1F A;  2MCN B;  2C60 A;  4A6H A;  2JXX A;  3DXE A;  2GBM A;  4IW0 A;  4DK5 A;  1P98 A;  3H9D A;  4B9K A;  3BIN A;  2PEA A;  2OTX A;  2QKM A;  1GJZ A;  1F9J A;  4KVG B;  2WWZ A;  3H7P B;  3KRW A;  1X1M A;  2C5L C;  2L0T A;  5L95 C;  3U7D A;  4TQ1 A;  2FJL A;  2KCJ A;  2KFK A;  2CRF A;  3VUW A;  2YLM A;  3PLU A;  3ZRF A;  3CMM B;  4WAA A;  2NS5 A;  4IOY X;  2GMI C;  4GDL B;  5DIF B;  3ZDT A;  2RSU A;  4DBG A;  2OQB A;  4MJS B;  5J2R A;  1Z2M A;  2NMB A;  5C6R A;  2UYZ B;  2BWE S;  2O6V A;  1P3Q U;  2CHW A;  2ROZ B;  2RR9 A;  4PS8 A;  1FOE A;  4KV2 A;  1K5G B;  4P7I A;  1WH3 A;  1XCG A;  1X11 A;  2O2V B;  2V4L A;  3MPX A;  1LXD A;  5JZE B;  1YX6 B;  1PFJ A;  2BYV E;  4NQK E;  2J7Q B;  3ZNH B;  3UIO B;  3PRZ A;  2JRI B;  1OEY A;  1QQG A;  3A1Q B;  3JYU A;  4ZRI A;  1E8W A;  3HK0 A;  1WJM A;  5CTR C;  2K39 A;  2E2X A;  5L81 A;  1WGQ A;  3QX1 A;  4JL9 A;  3KVF B;  1WM3 A;  1M7R A;  1YJ1 A;  3WYF B;  2K25 A;  4Z2M B;  2M8S A;  2YSZ A;  1ZC4 B;  4KDL B;  2DHK A;  2MWS B;  4DHZ E;  5D27 A;  1WGY A;  3A9J A;  2XK5 B;  2FCN A;  3KRX A;  3UIN B;  2LXA A;  1PQS A;  2YRY A;  2COA A;  1VCB A;  3ZNI D;  1IPG A;  1BTN A;  1I2H A;  3B08 A;  1U4A A;  3ECI A;  2KUP A;  1Y5O A;  3UF8 A;  4RM8 A;  3ZKJ C;  4K7S A;  2LG1 A;  4PYU A;  2GJY A;  2R0D A;  4LJP B;  2KO3 A;  3SUZ A;  3N30 A;  2KJR A;  3MJW A;  2KTR B;  3A33 B;  4MEL A;  3EEC A;  4ICV A;  3PVU A;  2JY6 A;  3VQI A;  1XR0 B;  2ZPN A;  1EGX A;  3V60 A;  2KWU B;  3DBS A;  2KD0 A;  4A5K A;  4HJK A;  1V89 A;  4B6W A;  3PGE A;  3ZVR A;  2IY1 B;  1FHX A;  4LDT B;  5JHH A;  1DDV A;  4WWN A;  1V5P A;  3TVV A;  2LUL A;  2W2X C;  2G45 B;  1L7Y A;  4DDG D;  1W1G A;  1Q67 A;  2MSE D;  3QQ8 B;  3K9O B;  1U5F A;  3QA8 A;  1P5T A;  1WY8 A;  3CXB B;  3BY4 B;  1EAZ A;  3KUD B;  4XC2 A;  2AL6 A;  3SYX A;  2COC A;  3PHX B;  2FAZ A;  4IWP A;  5IA7 A;  4ZDV A;  2KZR A;  3GYP A;  1P0R A;  3W1S C;  2N7E A;  1R4M I;  4HK2 A;  2ZJD A;  4IG7 B;  1FHW A;  2P0D A;  1WM2 A;  1E7U A;  2GS0 A;  3SNH A;  4KHO A;  1XD4 A;  4FJZ A;  5LXI B;  2ZEQ A;  1MK7 B;  4YL8 A;  3RUI B;  3TIX A;  2N0Y A;  3TFM A;  4Z2N A;  3EFU A;  2MFQ A;  5EFX A;  4FA6 A;  2MBH A;  1WE7 A;  4IM0 A;  3QIJ A;  3F0W A;  2LRW A;  4F7U P;  3MDB C;  3O65 B;  4F1S A;  2MDX A;  5CLQ B;  3QCA A;  4IWQ A;  4OVU A;  1K8R B;  2DHZ A;  2MX2 A;  3WA0 A;  1WFY A;  4FJV B;  2V76 A;  2LRU A;  1V2Y A;  4BBK A;  1U2B A;  2M4N A;  2MBE A;  3L0W B;  3KY9 A;  2ZNV C;  3PT2 B;  1WXA A;  3WAP A;  4E3C A;  2H7D A;  3M1I B;  3PP2 A;  2KK8 A;  2Z0D B;  4DHJ D;  2P8V A;  1UNP A;  2AL3 A;  2J59 M;  4BOS C;  2D9Y A;  3G9W A;  4WJP A;  2KJH B;  4NJ7 A;  3PLV A;  1UZX B;  2I1K A;  2RGN B;  5D3X A;  4BKT A;  2GBK A;  2LGX A;  2LKO A;  3L54 A;  4BOZ B;  2KTF A;  3A4R A;  3VDZ A;  1FHO A;  1J0G A;  4NY0 A;  3M95 A;  4HB0 B;  2Z0Q A;  4A6K A;  1WGG A;  1LW3 A;  2DYB A;  1WR6 E;  4FBJ B;  2YT0 A;  4FAD A;  1FGY A;  1WGD A;  2UZS A;  1WR1 A;  4DXA B;  4I6N B;  4IFS A;  1WG7 A;  2DZJ A;  1V80 A;  5FR6 A;  4W9J A;  5LON B;  3K9P B;  3DVG X;  1J19 A;  3HQC A;  4BBN F;  3D32 A;  4YON A;  1MIX A;  5HE3 A;  3ZVV A;  3JSV B;  4XZ4 A;  4MM3 A;  3DBH I;  4AOF A;  3HW2 B;  2DN6 A;  2KWC A;  3SU8 X;  2W2X D;  3QAQ A;  3VIA A;  4KSL C;  5J17 A;  2JVC A;  5EDS A;  4II2 B;  3VTU A;  5AEK B;  2VRW B;  1TZ1 A;  2MQJ A;  2DX5 A;  1DBH A;  2UWQ A;  3NSU A;  4DWF A;  5CHV C;  3RT3 B;  3RYT A;  1XD3 B;  4M8N A;  4CYE A;  4GDK A;  3VXW A;  2VRR B;  1N3H A;  2YS1 A;  1LM8 B;  3VOQ A;  4W9F A;  2Z0P A;  3ULB A;  4W9K A;  1OMW A;  1UEF A;  3R7Q A;  1V61 A;  4WSF A;  3DBR I;  4PQ0 A;  4A3O A;  2VSZ A;  4EKU A;  2K6Q A;  5E6P A;  4BFR A;  3WAL A;  1FXT B;  3TBL D;  1C1Y B;  4MEM A;  1ZKH A;  2QKL A;  4BVU C;  2D9W A;  3ZNZ B;  2JWZ A;  2KFK B;  2H7E A;  4NNJ B;  3ZUN A;  4Y94 A;  2V3S A;  5KQ4 A;  4W9H A;  1OTR B;  2LUE A;  4HDO A;  3ZW3 A;  1YQB A;  1XT9 B;  2KNB A;  3IHP C;  4GB9 A;  2K8B A;  3P7Z A;  2JPH A;  4FN2 A;  1EVH A;  4W9E A;  2EMT A;  2LOZ A;  4M0W B;  2QHO A;  1SHC A;  2BWF A;  3CSF A;  3KYD D;  4BKS D;  3TO1 A;  4HCP B;  3MTN B;  4IAP A;  1KJT A;  2FCM A;  3WAM A;  2C7H A;  1V88 A;  3D8F A;  2O6V B;  4LJO B;  1ZVR A;  4KSK C;  3M3J A;  3OAN A;  1TTN A;  2KAN A;  3EHV A;  2BGF A;  3QWM A;  2LI5 A;  1Y8R C;  1V5O A;  4DHZ B;  1PLS A;  2PPH A;  3F5R A;  3MHS D;  4KZ0 A;  2NBV B;  4IM2 A;  2JP2 A;  2KDE B;  4EZK A;  2RD0 A;  3L13 A;  4RM9 A;  2HJ8 A;  1FGZ A;  5CHW A;  3I3T B;  3UIP B;  2CY5 A;  1Q1O A;  1I35 A;  3L16 A;  3ZIM A;  1TGZ B;  4DDI D;  2P0F A;  2KMA A;  5C5B A;  1NDD A;  2CY4 A;  4NAW A;  3TL5 A;  3DOW A;  3SD5 A;  2K2U A;  2JF5 A;  1Z87 A;  2KWV B;  3H1U A;  3QAR A;  3A9J B;  2BKR B;  2DFK A;  5HKH A;  5J18 A;  4ZRJ A;  1V6E A;  1H8C A;  1FAO A;  2ZCC A;  4TUU A;  2FIF A;  5DPS A;  2M14 A;  3V6E B;  2B3A A;  4ZRK A;  3TW1 A;  2LD9 A;  5CX3 A;  5LXH A;  2ASQ A;  2MLB A;  2GBN A;  1GUA B;  1E7V A;  1TJ6 A;  5DPR A;  2R2O A;  2KLG A;  2A5U A;  2MW5 A;  2I5C A;  1P6S A;  1OQY A;  1NI2 A;  5E6O A;  3Q3F A;  3FSS A;  2IYD B;  3RCZ A;  4W9L A;  1E5W A;  4G11 A;  4EFO A;  4A3P A;  1FB8 A;  2LVO A;  2KDB A;  2GCL A;  3CF6 E;  2REX A;  4W9D A;  4MGI E;  3A9K B;  2OOB B;  2N1W A;  2WYQ A;  2L3Z A;  3CST A;  5J3Y A;  5E6N A;  3B1L X;  5G2N A;  3WIM A;  4BKS A;  4JQW C;  1KZ7 A;  4URK A;  3JW0 X;  4TKN A;  4K7U A;  1WX7 A;  2L1C A;  4IC7 B;  2OJR A;  5AZF A;  4M8M A;  2PJH A;  1ZM0 A;  2KHW B;  4HPL B;  1DYN A;  2DYO A;  3IFW B;  1WYW B;  3LDZ E;  4WJO A;  4HB4 B;  2G4S A;  4MDK E;  4RMA A;  4A6F A;  1KI1 B;  3GOE A;  3H6N A;  3EC8 A;  3A9K A;  2FUH B;  3UZT A;  3RCP A;  2DTC A;  3L17 A;  3A8Q A;  3BJI A;  1WX9 A;  5JH5 C;  4HVB A;  2AYO B;  2N1V A;  2C9W B;  2LGY A;  1WZ0 A;  1DDM A;  3AUL A;  4EZL A;  4WJN A;  2X18 A;  2J0M A;  4GPT B;  3LJU X;  4GXB A;  3ZTC A;  1QC6 A;  1UBI A;  1WVH A;  3R66 C;  5DHA B;  2D9Z A;  2ZVN A;  3HM3 A;  4I6P A;  4IM3 A;  2KDF B;  2BKF A;  3PSC A;  1WMH B;  2CKH B;  4CHJ A;  3KUZ A;  2K8H A;  4E71 A;  2RNR B;  2MP2 A;  3KW5 B;  2EKE C;  3AI5 A;  1NU2 A;  4G0N B;  4ZYN A;  4ICU A;  2AEH A;  4B6H A;  1WGH A;  2DYN A;  2KX3 A;  4HB3 B;  4WJQ A;  1YX5 B;  1MIZ B;  3A4S C;  3GYO A;  2AWT A;  2RGF A;  2KXJ A;  4HDQ A;  1NTY A;  2M17 A;  2N23 A;  3U8Z A;  2IO3 B;  4MH0 E;  4DBB A;  1WMH A;  5JHG A;  2CS4 A;  1U5G A;  4WWO A;  4HPM B;  4KZC A;  4KDI C;  2V1Y A;  2W9N A;  3DVN U;  2HTH A;  2ELA A;  5JLJ B;  3D8E A;  5D7G A;  2BYE A;  4L6E A;  3SDL C;  1WJU A;  3QBV B;  1UBQ A;  4TV3 A;  3IG3 A;  2Q13 A;  3PZD A;  1W1H A;  3SV1 A;  1DDW A;  3PPA A;  1NTV A;  1XKE A;  5GOW B;  2J0K A;  2KFJ A;  1WZ3 A;  4GN1 A;  1XX0 A;  2PZ1 A;  1WE6 A;  3UQB A;  5C16 A;  1UNQ A;  5AZH A;  4I6L B;  4NPN A;  1M7E A;  3TMP B;  2N9E B;  4K2O A;  4C0A A;  2YS5 A;  3X23 A;  2HE7 A;  3LJ3 A;  2C7N B;  2DYM A;  2P0H A;  4HAV B;  1ISN A;  1Y19 B;  1WI1 A;  1GNU A;  4K81 A;  2CR5 A;  2DLW A;  2GBR A;  3ALB A;  4GIV A;  3O96 A;  3RZW C;  2CHX A;  2IY0 B;  1UGM A;  2DX5 B;  1X86 A;  3PEG A;  2KJ6 A;  1QZE A;  4GDK B;  3DPD A;  4HAT B;  3M62 B;  2BF8 B;  3APD A;  4NSW A;  3IBE A;  2BYF A;  3WAN A;  3KZ1 A;  1M94 A;  5DPT A;  4W9G A;  2LOX A;  2ROV A;  2LJ5 A;  2PE9 A;  3ZO5 B;  1E8X A;  4K17 A;  4EOY A;  1WIA A;  3KSY A;  2FNJ B;  3VH3 B;  4AP4 C;  5DPW A;  2MWN B;  2Y7B A;  2R2Q A;  2YVC A;  3A98 B;  1BAK A;  3DQV A;  1X1G A;  3ENE A;  1P1A A;  3T8M A;  2MBB B;  1Z5S B;  2Y8F A;  5KCV A;  3QK0 A;  1E8Z A;  4DHJ B;  4KIK A;  5HE2 A;  4KHB B;  1OQN A;  2I1J A;  2NVU I;  3WAO A;  3VAW A;  1R4N I;  1V5M A;  2JRH A;  1LFD A;  2G3Q B;  3ULC A;  4PS3 A;  4AJY B;  4F8C B;  2KMC A;  1EF1 A;  2MBO A;  1NBF C;  1WXM A;  2FCS A;  2YF0 A;  3ML9 A;  3PSE B;  4WWP A;  3OJ3 A;  5G55 A;  3TCA A;  2KKC A;  4EMO A;  4AJW A;  2KVR A;  2G4D B;  3AXC A;  1UD7 A;  4MGY E;  2EC1 A;  4IWO A;  1OGW A;  2K00 A;  2JZZ A;  1KOT A;  2N7D A;  2KGX B;  4ASW C;  3DVN V;  3NZU A;  1WGU A;  1U29 A;  4F7G A;  2NPT A;  2DAJ A;  2CHZ A;  4B95 A;  1CMX B;  3T9L A;  1LQB A;  1U27 A;  3HHM A;  4GZU A;  4HAY B;  2NZ8 B;  2XBB C;  2D10 A;  2L0F A;  1RLF A;  4ANU A;  1XOD A;  2LXC A;  2M38 A;  1RJ2 A;  1I42 A;  3AU4 A;  2GCJ A;  3V62 A;  3VHT C;  2KC2 A;  2LWP A;  5KHO A;  1E8Y A;  2WX0 A;  3V6C B;  5D3W A;  5C5B B;  2RSG A;  4NAW B;  1WGR A;  2HD5 B;  1RRP B;  1OY2 A;  1JRU A;  2D4Q A;  5JHB A;  4W9I A;  2D3G A;  2R09 A;  3GZN I;  4GGQ A;  3DDC B;  3H7S A;  1D3Z A;  5DCN A;  1IRS A;  1J0W A;  2CAY A;  4K2P A;  1A5R A;  1ZW7 A;  3VUY A;  1UPQ A;  5L83 A;  1YD8 U;  3PTF C;  2ADZ A;  4LCD E;  4CHM A;  1WJ1 A;  2N9X A;  5JP4 A;  4WVF B;  4CO7 A;  4EJN A;  4AUQ C;  1ZC3 B;  1Q0W B;  3A8P A;  4ANX A; 
#chains in the Genus database with same CATH topology
 2DEN B;  2OJW A;  3NZS A;  4JGH B;  1TT5 B;  2PE6 B;  3X0W A;  1MPH A;  3L10 B;  3ZNG C;  2KUQ A;  4XE0 A;  2D2Q A;  3NY5 A;  2G35 A;  4A20 A;  3TUO A;  2G1E A;  5GXG B;  5KQ1 A;  1UEL A;  3H7P A;  1L2N A;  1W1D A;  3C19 A;  4AS1 A;  1X1F A;  2IYB A;  1V5U A;  1P3R A;  2MKR A;  3VVW B;  2A4Z A;  3KH0 A;  2D07 B;  4FLH A;  3AE6 B;  1K52 A;  2N4F A;  3HIZ A;  4FJY A;  2DBY A;  3L08 A;  4OVZ A;  4K1R B;  2LYD A;  1IUE A;  3DBR B;  1BTK A;  2IND C;  3W1Y A;  4GSW A;  2K8C A;  2DA0 A;  4G50 A;  4EUT A;  2I5F A;  1RFA A;  3BK2 A;  5J3Q A;  3APF A;  3AB5 A;  3NOB A;  4USA A;  1E90 A;  3W1S A;  4PNK A;  4HB2 B;  1HQR D;  3AU5 A;  5HE1 A;  1KLV A;  4HAU B;  5C1Z A;  1BT0 A;  2UVM A;  4YTP B;  4LDT D;  1G6J A;  1I4R A;  2DZK A;  1S1Q B;  4GDL A;  3V61 A;  1FXI A;  2KIG A;  1B1Z A;  2Z0E B;  3AMZ A;  1V9J A;  1MAI A;  3NHE B;  3V5W A;  4MJS A;  5J3T A;  1L4Z B;  3HVD A;  4TQ0 A;  1EF5 A;  3DVG Y;  2Y8G A;  2BT6 A;  1JQ4 A;  4MY6 A;  1V86 A;  1V5T A;  1I4P A;  2ZNV B;  2G9H D;  4MSM B;  4DXF A;  5CHF A;  1WF9 A;  4NQL B;  3OAW A;  2GI9 A;  1TY2 A;  1XXG A;  3ZXR A;  3VFK A;  1I4G A;  4HXD A;  3FEH A;  4A6F B;  4ACF A;  1ZDV A;  2BCJ A;  2HDE A;  2O2V A;  3CWI A;  2HJ1 A;  5C23 A;  4OT1 A;  4BKG A;  5FI1 A;  1HTQ A;  4NAM A;  3P6A A;  1SGH A;  3B2G A;  2BS4 B;  2UZR A;  1L6U A;  2TSS A;  1I7A A;  2LGS A;  3A1Q A;  3ETR A;  3PZ7 A;  1WXV A;  1VLB A;  2D11 A;  4DX8 A;  3NVV A;  4H8S A;  2EJ8 A;  1VDV A;  4HLE A;  3P4P B;  2W3S A;  2BYT A;  3VRA B;  1I4H A;  2L05 A;  1XF5 L;  2COF A;  1GG3 A;  1TBE A;  1J8C A;  4FHK A;  3ZDM C;  2JWU A;  2Y5B B;  4L2Y A;  1WJ6 A;  1QF6 A;  3P2B A;  4NJ6 A;  2BB6 A;  4MT7 A;  1UH6 A;  2W2W A;  1AQC A;  5DHF B;  4C56 C;  4KHA A;  3PS6 A;  2PVO D;  3ML4 A;  3ZLZ A;  1HEZ E;  2ZVO A;  2KQ7 A;  1EUV B;  2XK5 A;  3Q3N C;  1C3T A;  2RPQ A;  2K22 A;  1AAR A;  3QWZ B;  4MGZ E;  3N32 A;  1CZP A;  1H4R A;  1SXT A;  4LLG M;  4XX5 A;  2L76 A;  2NBU A;  2KDI A;  2N9L A;  1UPR A;  2XNA C;  2MP2 B;  1MKE A;  5D94 A;  2PW9 A;  3NS8 A;  3IVF A;  3HIE A;  2JZ3 B;  3EFC A;  1VZ7 A;  3PO0 A;  1UWX A;  1E7P B;  1SE9 A;  1V49 A;  4OVV A;  2DZM A;  4C7Z A;  2FCQ A;  3AH7 A;  3LYY A;  1WX8 A;  4X57 B;  5IN7 A;  3MP9 A;  2BPS A;  4R3D A;  3ZRC A;  2Z59 B;  2R2Y A;  1L0V B;  5D6J B;  2MH7 A;  1ENF A;  4ZRQ A;  2KTR A;  4PS7 A;  4YT0 B;  3VH4 B;  5H8Y E;  1FCL A;  4JIO U;  3FM8 C;  3NRZ A;  2ELB A;  2JSV X;  1LB1 A;  2K2J A;  5D3V A;  1VD2 A;  1IP9 A;  1GB1 A;  4E74 A;  1V1P A;  5GMV A;  4CHK A;  2ZZP B;  2COD A;  2L00 B;  3RUL A;  4PK1 A;  1P9D U;  3RD2 A;  2HTH B;  2N9P C;  4GMV A;  1YIW A;  3PHW B;  2KX0 A;  3ABV B;  2Z0O A;  4EE2 A;  1U5D A;  1UNS A;  1MK9 B;  3Q8C A;  5KHQ A;  3PRM B;  2LJI A;  1IYF A;  1ACC A;  5C79 A;  5DH9 B;  2M1M A;  3AN1 A;  3IAS 1;  4HAZ B;  1KH0 A;  5LLI A;  2JUO A;  3QC8 B;  3PVL A;  4FHJ A;  2IJ0 A;  2XQN M;  1T6B X;  4XWX A;  2MRP A;  3N3K B;  2WXL A;  3VTV A;  5FI0 A;  1WJ4 A;  2XEW A;  4OHJ A;  4YSY B;  1YN4 A;  3S2A A;  4HAW B;  2GRI A;  2NCN A;  5G5G A;  2H88 B;  1AWE A;  2DHJ A;  4HCN B;  3J9C A;  3DXD A;  4II3 B;  1KZG A;  4KAX B;  5DI9 B;  5D3D A;  2L2I A;  3PG7 A;  3TJP A;  4HKZ E;  2KN5 A;  1WRD B;  1DRO A;  3PRE A;  5IAA C;  4EEW A;  4BBN C;  5TR5 A;  3ODO A;  4RGT A;  1J7A A;  1H10 A;  2L7R A;  2SAK A;  2LGD A;  2WDQ B;  4MSQ B;  1RAX A;  4KKI A;  2E6X A;  3ZTD A;  3ODX A;  1IBX B;  2RUK B;  3FIL B;  1QIL A;  1FFU A;  3DCG A;  3R3M A;  2LVP A;  5BO4 B;  3VTW A;  1GC7 A;  3KUC B;  1RWS A;  2AX5 A;  2YEP F;  4IUM B;  3QJZ A;  2MA9 B;  5IRS A;  1T0Y A;  1JWA D;  3DXC A;  1EO6 A;  2J52 A;  1WXS A;  4WQO B;  1MFW A;  2WXM A;  2QJL A;  2CU3 A;  4JLC A;  3ODW A;  4A90 A;  2WU2 B;  4W9C A;  3C0R B;  2IO1 B;  2J53 A;  3P4Q B;  4M01 A;  1B55 A;  1FFV A;  1CQV A;  3ML8 A;  2K3U A;  2D5G A;  1DGJ A;  4K7W A;  4F7Z A;  3DHH C;  1WWT A;  3T06 A;  1WRI A;  3LB8 C;  2VKI A;  3PV1 A;  4F7H A;  1ESF A;  1YNT E;  2KLC A;  3AE7 B;  2Z14 A;  3BYT B;  1FNU A;  4KGS A;  3D8D A;  1KM7 A;  2QIE B;  2JQR B;  2FID A;  5D2M B;  4GU2 A;  4XGA B;  3MHZ A;  1RRB A;  4WJ7 A;  2DAF A;  4S0R A;  1JCK B;  2WX1 A;  1WJN A;  2QIL A;  4M00 A;  2K0P A;  1PGX A;  2GOW A;  1BWN A;  5CLL B;  4PT5 A;  3N7C A;  2ZCB A;  3RNF C;  4OZB A;  4OZC A;  1YMH E;  4KX6 B;  4WQM A;  4GMX B;  2RMM A;  1Q5W B;  2DX1 A;  3SO6 A;  1HE8 A;  3JVZ X;  2DKP A;  2RVB B;  3AV8 A;  1SBB B;  2D9V A;  3NWF A;  2IBI B;  2WGS A;  2YS3 A;  3Q3O C;  4PYZ A;  4FUL A;  3BVM A;  2LZ6 A;  2DHI A;  4DX9 0;  2KQS A;  4MGK E;  1TXD A;  1R4M B;  3P1M A;  2DKQ A;  2QSD A;  1TQZ A;  2RLO A;  4GOC A;  3WCQ A;  2I38 A;  1FCC C;  3NUH B;  4KIK B;  2DYQ A;  3N20 C;  1KLG D;  3OJ4 B;  2D3C A;  3OLM D;  3U4E G;  3UI3 A;  1E0Z A;  2C7M B;  1TKG A;  2K6D B;  3HM6 X;  2IO2 B;  3M63 B;  3U30 A;  2KC1 A;  1JAL A;  3Q3M C;  3Q8E A;  3PRP B;  4G3X B;  4AWJ A;  3ZYY X;  4EZJ A;  2L8J A;  5HE0 A;  2WNM A;  3AEC B;  4ANW A;  3APC A;  5LOP B;  3T3O A;  2RDH A;  3Q8F A;  3Q3J A;  3SHQ A;  4MK0 A;  1WI0 A;  1YN5 A;  2D9X A;  2IPK D;  1QOB A;  4M02 A;  1XQQ A;  2WDT B;  1U5E A;  2IZV B;  5AZG A;  2EMS A;  2O6V D;  1ZGU B;  3TEZ A;  1VJK A;  4ANV A;  1JWB D;  2JX5 A;  1FNW A;  3ONS A;  4OSN A;  2ZPY A;  2JT4 B;  3N1Y C;  4UDU C;  3AJ4 A;  1MG4 A;  3R7R A;  2LVQ A;  2NPT B;  4ZRP A;  1V81 A;  2MBQ A;  3TEW A;  2NBW B;  5JHA A;  2M0X A;  1SIJ A;  1MG8 A;  4D0N B;  2W3R A;  3CIK A;  1UNR A;  2YT1 A;  1SIF A;  1SE2 A;  1X05 A;  3P63 A;  1Q10 A;  3L4P A;  1XCQ L;  1GB4 A;  4ZOH C;  2KOX A;  3UQA A;  3BII D;  3ZJU A;  1S3S G;  2WXN A;  3JSV A;  4XDD A;  1OEY J;  3RZF A;  3N9Y C;  4WH4 A;  1ZPS A;  2N0S B;  2NR2 A;  2DZI A;  3HRD D;  4N9F 4;  4RGM A;  4J6I A;  1QQR A;  3NG0 A;  2LHE A;  2NMQ A;  1ZSQ A;  3VUX A;  2IFS A;  2LAS A;  1FRR A;  3B0A A;  4HHV A;  4JPS A;  5TSS A;  1PMS A;  4TYZ A;  1GC6 A;  4HWI B;  4HAX B;  2J0J A;  1K5D B;  4NZL B;  1OQR A;  5D3Y A;  3QHT A;  2KWD A;  3KYC D;  5BYQ A;  2IO0 B;  3DBL I;  3RPF C;  3UGB B;  3ZGZ A;  1C4P A;  2GBJ A;  3PVW A;  2CU1 A;  2K1F A;  4HEA 1;  2MCN B;  2C60 A;  4A6H A;  2JXX A;  4REZ A;  3DXE A;  1E6E B;  4LK0 M;  3RI7 C;  2GBM A;  4IW0 A;  4DK5 A;  1P98 A;  4HPP A;  2JYE A;  3SEB A;  2QDF A;  3H9D A;  4B9K A;  3BIN A;  2PEA A;  2YEP B;  1TS3 A;  2OTX A;  3AE9 B;  2PLP A;  3GB1 A;  2Y3A A;  2QEJ C;  2BBC A;  2QKM A;  1GJZ A;  1F9J A;  4KVG B;  2WWZ A;  3OWE B;  4YWG G;  3H7P B;  3KRW A;  1X1M A;  2C5L C;  1D5Z C;  2L0T A;  5L95 C;  1F1H A;  3U7D A;  4TQ1 A;  2FJL A;  2KCJ A;  2KFK A;  2CRF A;  1T77 A;  3VUW A;  2YLM A;  3DBH B;  3RNC C;  3PLU A;  3ZRF A;  3CMM B;  2KT7 A;  4WAA A;  2NS5 A;  4IOY X;  3AEG B;  4C4V A;  4JWS C;  1GAQ B;  1YJJ A;  2GMI C;  4GDL B;  4LTU A;  5DIF B;  4M0W A;  3ZDT A;  3VR9 B;  2RSU A;  4DBG A;  2OQB A;  4MJS B;  5J2R A;  1Z2M A;  2NMB A;  5C6R A;  2UYZ B;  2BWE S;  2O6V A;  1P3Q U;  2CHW A;  2ROZ B;  2RR9 A;  1TS4 A;  5AUK A;  1C76 A;  1TS2 A;  4PS8 A;  1FOE A;  2ONQ A;  1RM6 C;  4KV2 A;  2AQ1 B;  1K5G B;  4P7I A;  1JML A;  1WH3 A;  1XCG A;  4TMA B;  1X11 A;  3HSA A;  5I2M A;  1AN8 A;  3V3X A;  3RFZ B;  2O2V B;  1TJE A;  2V4L A;  4LNK A;  3MPX A;  1LXD A;  2NBV A;  5JZE B;  1YX6 B;  5BMI A;  1V97 A;  4A55 A;  1PFJ A;  2BYV E;  4NQK E;  2J7Q B;  1AYF A;  1TKE A;  3TEY A;  3ZNH B;  3UIO B;  3PRZ A;  1Y56 A;  2PMV A;  2JRI B;  1OEY A;  1QQG A;  4FXC A;  2ZW0 A;  1L0Y B;  3A1Q B;  3JYU A;  4ZRI A;  1E8W A;  3HK0 A;  1WJM A;  2K39 A;  5CTR C;  2E2X A;  5L81 A;  1WGQ A;  3QX1 A;  3HVZ A;  4JL9 A;  3KVF B;  1WM3 A;  1M7R A;  3MC8 A;  1L6V A;  1YJ1 A;  2KQ4 X;  3WYF B;  4OZA A;  2MJ3 A;  2PVG C;  2KN4 A;  4P1B C;  2K25 A;  1YQ3 B;  1TS5 A;  4Z2M B;  2M8S A;  3KQ4 A;  3GP7 A;  2YSZ A;  2WU5 B;  1ZC4 B;  2LGI A;  4KDL B;  2V3P A;  2DHK A;  4ITK A;  2MWS B;  2M56 B;  4DHZ E;  5D27 A;  1WGY A;  3A9J A;  2XK5 B;  3AE3 B;  2FCN A;  3KRX A;  1NVI D;  3UIN B;  2LXA A;  3NZ3 A;  1PQS A;  1D6E C;  4QJ3 B;  3W9C B;  2WXI A;  2YRY A;  2COA A;  1VCB A;  3ZNI D;  1IPG A;  1BTN A;  1I2H A;  3B08 A;  1U4A A;  3ECI A;  2KUP A;  1C79 A;  1FNV A;  2RDB C;  4LNF A;  1L4D B;  1Y5O A;  2KR0 A;  3UF8 A;  4RM8 A;  3ZKJ C;  4K7S A;  1ZXI A;  2LG1 A;  5HHD G;  1IGD A;  3FVC A;  4PYU A;  2GJY A;  3IXS A;  2R0D A;  2OHF A;  4LJP B;  2KO3 A;  4L1B A;  3SUZ A;  3MC0 B;  1EU3 A;  3N30 A;  3I57 A;  2KJR A;  2RRF A;  3MJW A;  2KTR B;  1C4C A;  3A33 B;  4MEL A;  3EEC A;  4ICV A;  3PVU A;  2JY6 A;  3VQI A;  4RFB A;  1V1O A;  1XR0 B;  1NEK B;  2M19 A;  2ZPN A;  1OFF A;  1EGX A;  1V1P B;  1WSP A;  2KWU B;  3V60 A;  3NJT A;  1D4B A;  4HRO A;  3DBS A;  2KD0 A;  4A5K A;  2MJD A;  4HJK A;  1V89 A;  1JWS D;  1FM0 D;  1ZXH A;  3AE8 B;  4B6W A;  3PGE A;  5FKA C;  3ZVR A;  2IY1 B;  1FHX A;  4LDT B;  5JHH A;  1DDV A;  3AM9 A;  4WWN A;  4Q2J A;  1V5P A;  3TVV A;  2LUL A;  4A9A A;  2W2X C;  1BML C;  2G45 B;  2H89 B;  2SEB D;  1L7Y A;  4DDG D;  1W1G A;  3Q6B A;  1Q67 A;  2MSE D;  3P4S B;  4DIX A;  3QQ8 B;  4QXA B;  3K9O B;  1U5F A;  3QA8 A;  1CJE A;  1P5T A;  1WY8 A;  3CXB B;  2LEK A;  4XDC A;  1C4A A;  1UWM A;  5BYR A;  3BY4 B;  4RF0 A;  1EAZ A;  4RGN A;  2I2Y A;  2VZK D;  1MI1 A;  2V9H A;  1N5X A;  3KUD B;  3Q8A A;  4XC2 A;  2AL6 A;  3SYX A;  2COC A;  3PHX B;  2FAZ A;  4IWP A;  5IA7 A;  4ZDV A;  2KZR A;  4US8 A;  3GYP A;  1P0R A;  5EE9 A;  4QAY A;  3W1S C;  1V8C A;  2N7E A;  1R4M I;  4HK2 A;  4JX1 C;  1QOA A;  2ZJD A;  3ZQ4 A;  4IG7 B;  1FHW A;  2P0D A;  1WM2 A;  1E7U A;  2GS0 A;  3SNH A;  1XO3 A;  1FXA A;  2L83 A;  4KHO A;  2INC C;  2ON8 A;  1XD4 A;  4FJZ A;  5LXI B;  3Q69 A;  2ZEQ A;  1MK7 B;  4TSS A;  2L32 A;  4YL8 A;  1T0Q C;  3RUI B;  1XLN A;  3TIX A;  2V3N A;  4P16 A;  2N0Y A;  3TFM A;  3H8H A;  1B9R A;  3SFE B;  1NI3 A;  4Z2N A;  3EFU A;  1ET6 A;  2MFQ A;  5EFX A;  4FA6 A;  1T0S C;  2MBH A;  1WE7 A;  4IM0 A;  3QIJ A;  1XCT L;  3F0W A;  2LRW A;  4F7U P;  3MDB C;  3O65 B;  2Z4D A;  4F1S A;  4ZHO A;  2MDX A;  5CLQ B;  3QCA A;  3GS2 A;  4IWQ A;  4OVU A;  1NEN B;  2B76 B;  1K8R B;  2CJO A;  3EGR A;  2INP E;  4CQN A;  2DHZ A;  2MX2 A;  3WA0 A;  1WFY A;  2WXK A;  4FJV B;  5E6J A;  2V76 A;  1UGJ A;  2LRU A;  1V2Y A;  4MT5 A;  1N60 A;  5C3J B;  1F52 A;  1SF0 A;  4BBK A;  1U2B A;  2M4N A;  2MBE A;  3L0W B;  3KY9 A;  5EE1 A;  2ZNV C;  2M0A A;  2WXH A;  3GE8 C;  3PT2 B;  1WXA A;  1HA5 A;  3WAP A;  1PFD A;  1SSN A;  4E3C A;  2H7D A;  3M1I B;  3PP2 A;  2KK8 A;  2BB5 A;  1DOI A;  2Z0D B;  1RFK A;  1EWY C;  2D3A A;  2J4X A;  4DHJ D;  2P8V A;  1UNP A;  2AL3 A;  2J59 M;  4BOS C;  4RCO A;  4IKG A;  2D9Y A;  3G9W A;  4WJP A;  1AWD A;  3AE2 B;  2KJH B;  2WXF A;  4NJ7 A;  4S17 A;  2JU6 X;  3Q8B A;  1TKY A;  3PLV A;  1UZX B;  3I5J C;  3IT6 B;  2I1K A;  2RGN B;  5D3X A;  4BKT A;  2GBK A;  2LGX A;  2LKO A;  3NW8 A;  2XN9 C;  2R61 A;  2PTL A;  3L54 A;  3CIR B;  4BOZ B;  1EWC A;  2KTF A;  2L1A A;  1F0Z A;  3A4R A;  3VDZ A;  3AEE B;  1FHO A;  1J0G A;  1DYQ A;  4NY0 A;  2WXQ A;  4XWW A;  3M95 A;  4HB0 B;  1C77 A;  2Z0Q A;  2IGG A;  2FBW B;  5HFY A;  4A6K A;  1WGG A;  1LW3 A;  1GOZ A;  2DYB A;  4H2A A;  1WR6 E;  1FO4 A;  1VZ6 A;  4C80 A;  2X8X X;  4L23 A;  4FBJ B;  2YT0 A;  5BMG A;  4FAD A;  1FGY A;  1WGD A;  2UZS A;  3ZJV A;  1WR1 A;  1HZ6 A;  4DXA B;  2WP9 B;  4I6N B;  3IAM 1;  4IFS A;  1WG7 A;  3O13 A;  2DZJ A;  3MC9 A;  1V80 A;  5FR6 A;  4W9J A;  5LON B;  3K9P B;  1E9M A;  3DVG X;  1J19 A;  3HQC A;  4BBN F;  3D32 A;  4YON A;  3E9S A;  1MIX A;  5HE3 A;  4RNA A;  3ZVV A;  3JSV B;  4XZ4 A;  1UF0 A;  4MM3 A;  3DBH I;  4AOF A;  3HW2 B;  2DN6 A;  3EUB 2;  2KWC A;  3SU8 X;  4QJ5 B;  2W2X D;  3QAQ A;  3VIA A;  4KSL C;  1FIQ A;  2BS2 B;  2JVC A;  5J17 A;  2W55 A;  5EDS A;  4II2 B;  3VTU A;  4YTM B;  5AEK B;  2VRW B;  1TZ1 A;  1F77 A;  4GLS C;  2MQJ A;  1NYQ A;  2N7J A;  2DX5 A;  1DBH A;  2UWQ A;  3NSU A;  4DWF A;  5CHV C;  3RT3 B;  3GE3 C;  3RYT A;  1XD3 B;  3AE5 B;  3DHI C;  4M8N A;  4CYE A;  4GDK A;  3VXW A;  2VRR B;  1N3H A;  2YS1 A;  1SJE D;  1LM8 B;  3VOQ A;  1D5M C;  4W9F A;  2Z0P A;  3ULB A;  1SJH D;  4W9K A;  1AW7 A;  1OMW A;  4ANX A;  1UEF A;  3R7Q A;  1V61 A;  3RNA C;  4WSF A;  3DBR I;  2KIE A;  4PQ0 A;  2Q5W D;  4A3O A;  2VSZ A;  4DQO C;  4BZA A;  1LGR A;  1P7E A;  1QLB B;  2X38 A;  4EKU A;  2K6Q A;  5E6P A;  4BFR A;  3WAL A;  1FXT B;  2BTE A;  3W5U B;  1QKZ A;  5C2T B;  3TBL D;  1C1Y B;  3DHG C;  1YQ4 B;  4MEM A;  4P6V F;  2K9X A;  1ZKH A;  2QKL A;  4BVU C;  2D9W A;  3ZNZ B;  3ZXV A;  2JWZ A;  2KFK B;  2H7E A;  4NNJ B;  3ZUN A;  4Y94 A;  2V3S A;  3R2I A;  5KQ4 A;  4W9H A;  1OTR B;  2LUE A;  4KHB A;  3LXF A;  3Q14 C;  4HDO A;  3ZW3 A;  4MAC A;  1YQB A;  1XT9 B;  2KNB A;  3IHP C;  4N58 A;  4C4V B;  4GB9 A;  2K8B A;  3P7Z A;  1F2R C;  2JPH A;  4FN2 A;  1EVH A;  1GPX A;  4P1C C;  2QC8 A;  4W9E A;  4L1R A;  4D6W A;  2EMT A;  2LOZ A;  4M0W B;  2QHO A;  1SHC A;  2BWF A;  3CSF A;  3KYD D;  4BKS D;  3SR6 A;  3TO1 A;  4HCP B;  3MTN B;  4IAP A;  1JRP A;  4C7Y A;  2NTT A;  1KJT A;  2FCM A;  3NWD A;  3WAM A;  2C7H A;  1V88 A;  3D8F A;  3NVY A;  4A8X C;  3RNG C;  5BMH A;  2O6V B;  4LJO B;  1ZVR A;  1IGC A;  4KSK C;  3M3J A;  3OAN A;  4RH6 A;  1TTN A;  2KAN A;  3EHV A;  3A58 A;  2BGF A;  3QWM A;  2LI5 A;  1Y8R C;  2KDM A;  5I2S A;  1V5O A;  4DHZ B;  2W82 A;  1PLS A;  3SFD B;  2PPH A;  2V4I B;  3F5R A;  2AQ3 B;  5JXV A;  3MHS D;  4KZ0 A;  2NBV B;  4IM2 A;  2JP2 A;  2KDE B;  4EZK A;  3C8Y A;  2WDR B;  2RD0 A;  1K51 A;  3L13 A;  4N6E B;  1SE4 A;  4RM9 A;  1FPY A;  2DNF A;  1JW9 D;  2HJ8 A;  1XLO A;  1FGZ A;  2INN E;  4A6Q A;  5BYS A;  5CHW A;  1ZDX A;  3I3T B;  3UIP B;  2CY5 A;  3B77 A;  3AE4 B;  1Q1O A;  1WYG A;  1I35 A;  3L16 A;  3MFG A;  3ZIM A;  1TGZ B;  4DDI D;  2P0F A;  2KMA A;  5C5B A;  5EE0 A;  1NDD A;  2CY4 A;  4NAW A;  3TL5 A;  3DOW A;  3SD5 A;  2K2U A;  2JF5 A;  1A70 A;  2WXJ A;  1R4N B;  1E10 A;  1Z87 A;  2KWV B;  3H1U A;  3QAR A;  3A9J B;  3Q2A C;  2BKR B;  2DFK A;  5HKH A;  4US9 A;  5J18 A;  4ZRJ A;  3AEF B;  1JWU D;  1V6E A;  1H8C A;  1BUI C;  1FAO A;  2ZCC A;  4TUU A;  3KWV A;  2FIF A;  5DPS A;  2M14 A;  2LHD A;  3V05 A;  3V6E B;  1FRD A;  2B3A A;  4YSX B;  5LG4 B;  4ZRK A;  3TW1 A;  1MPE A;  3OHM B;  2LD9 A;  5CX3 A;  1EU4 A;  2OED A;  5LXH A;  4C00 A;  2VH1 A;  2ASQ A;  2MLB A;  2GBN A;  1GUA B;  1E7V A;  1TJ6 A;  1QT9 A;  5DPR A;  2R2O A;  2FE8 A;  2KLG A;  2WQY B;  2A5U A;  2MW5 A;  2I5C A;  4WUR A;  1P6S A;  1OQY A;  1NI2 A;  5E6O A;  3Q3F A;  3FSS A;  1FEH A;  2KMM A;  2IYD B;  3RCZ A;  2MJE A;  5MPO A;  4W9L A;  3DBL B;  1E5W A;  4G11 A;  3FKY A;  4EFO A;  4A3P A;  1FB8 A;  2LVO A;  2KDB A;  4RF1 A;  2GCL A;  3CF6 E;  3NVW A;  4JE3 B;  2REX A;  2WDV B;  3OG5 A;  2ZKM X;  4B0M A;  4W9D A;  5I4D A;  4MGI E;  3A9K B;  2OOB B;  2N1W A;  1KTK A;  4LNN A;  3FAH A;  2EEL A;  2WYQ A;  5HG2 A;  2L3Z A;  1VRA B;  2MHJ A;  3CST A;  5J3Y A;  4WWM A;  1FMA D;  5E6N A;  3BVZ A;  3B1L X;  1I4Q A;  5G2N A;  1M4V A;  3WIM A;  4BKS A;  4JQW C;  1KZ7 A;  4URK A;  3GZN B;  3JW0 X;  3KLS X;  4TKN A;  5H92 C;  4K7U A;  1WX7 A;  2L1C A;  4IC7 B;  2WLB A;  5D3I B;  2RPV A;  1F2R I;  2OJR A;  5AZF A;  4M8M A;  2PJH A;  3MJ5 A;  1ZM0 A;  2LMC A;  2KHW B;  1KF6 B;  1DYN A;  2DYO A;  2KAC A;  1WYW B;  3IFW B;  3LDZ E;  4HPL B;  4B0E A;  4WJO A;  1ZE3 D;  4ZHP A;  4HB4 B;  2KYW A;  5FK9 C;  2G4S A;  4MDK E;  4RMA A;  4K3B A;  4A6F A;  1KI1 B;  3GOE A;  3H6N A;  3EC8 A;  3A9K A;  4IDI A;  2FUH B;  3UZT A;  3RCP A;  2DTC A;  4KKJ A;  2IGD A;  1QOG A;  3L17 A;  3RN9 C;  3N1X C;  3A8Q A;  1ZYI A;  3BJI A;  1WX9 A;  1HZ5 A;  5JH5 C;  2W54 A;  4HVB A;  2QMT A;  2AYO B;  2N1V A;  2Y5C A;  2JZP A;  2C9W B;  2LGY A;  1WZ0 A;  1DDM A;  2KAJ A;  3BWU D;  3I9V 1;  3AUL A;  4DXG A;  4EZL A;  4QJ4 B;  4WJN A;  2X18 A;  3TSS A;  2J0M A;  1SB3 C;  4GPT B;  3LJU X;  4GXB A;  5EE3 A;  4AQ7 A;  3ZTC A;  1QC6 A;  1UBI A;  1FD6 A;  1WVH A;  4KGT A;  3R66 C;  5DHA B;  2D9Z A;  2WXG A;  2ZVN A;  3HM3 A;  4I6P A;  4OW0 A;  1OQQ A;  1JWM D;  4IM3 A;  2KDF B;  2BKF A;  1NYR A;  3PZ8 A;  2HTM E;  3PSC A;  1WMH B;  1J7C A;  2CKH B;  4CHJ A;  3KUZ A;  2K8H A;  4E71 A;  3DCX A;  3P4R B;  4YXD B;  2RNR B;  4WIP A;  2MP2 A;  1N62 A;  3KW5 B;  5IKC M;  3URY A;  2EKE C;  1TY0 A;  3AI5 A;  3I63 C;  1NU2 A;  4G0N B;  4ZYN A;  4ICU A;  2AEH A;  1T5X D;  4B6H A;  1WGH A;  5LNK 1;  1MHX A;  2DYN A;  2KX3 A;  4HB3 B;  1MVK A;  2ACZ B;  4HJG E;  4WJQ A;  5IOI A;  4GOU A;  1DOX A;  1YX5 B;  1STE A;  3T3N A;  1MIZ B;  3A4S C;  3GYO A;  2AWT A;  2Z59 A;  2RGF A;  2KXJ A;  2AQ2 B;  5AUI A;  4BAX A;  4HDQ A;  1NTY A;  1I7H A;  1T0R C;  2M17 A;  1SEB D;  4ARI A;  2N23 A;  3RNE C;  2WHI A;  5IP4 D;  3U8Z A;  2IO3 B;  4MH0 E;  4LNO A;  4DBB A;  1WMH A;  5JHG A;  2CS4 A;  1U5G A;  4WWO A;  4GNK B;  3NWA A;  1ZP0 B;  4HPM B;  1ROE A;  4KZC A;  2CJN A;  4KDI C;  4NJC A;  2V1Y A;  2W9N A;  3DVN U;  2HTH A;  2FUG 1;  2ELA A;  3AEA B;  5JLJ B;  3D8E A;  1PUT A;  2DWQ A;  5D7G A;  2VH2 A;  2BYE A;  1TYG B;  4L6E A;  3SDL C;  1WJU A;  5HI1 A;  3QBV B;  1UBQ A;  4TV3 A;  3IG3 A;  1WXQ A;  1PGA A;  2Q13 A;  3PZD A;  1W1H A;  3VR8 B;  3SV1 A;  3RNB C;  2KVZ A;  1DDW A;  4HSI A;  3PPA A;  1NTV A;  1XKE A;  5GOW B;  2J0K A;  2KFJ A;  1WZ3 A;  4GN1 A;  4WAF A;  3B9J A;  1XX0 A;  2PZ1 A;  1WE6 A;  3UQB A;  4RGO S;  2K5P A;  3N1Z C;  5C16 A;  2BVC A;  1UNQ A;  5AZH A;  2GB1 A;  4I6L B;  4NPN A;  1M7E A;  3TMP B;  2VZK B;  2N9E B;  2K49 A;  4K2O A;  4C0A A;  2ICI A;  1KLU D;  2DLB A;  2YT2 A;  3EA6 A;  1ZOY B;  1K50 A;  3VRB B;  3AEB B;  2YS5 A;  3U12 A;  3X23 A;  2NTS A;  2HE7 A;  1ZUD 2;  3KWL A;  1LO5 D;  3LJ3 A;  4HKQ A;  1MJD A;  2E3T A;  4MH8 A;  1KRH A;  2C7N B;  2DYM A;  2P0H A;  2Z8L A;  1IBX A;  3FC4 A;  1XLQ A;  4HAV B;  3FIL A;  1ISN A;  3P42 A;  4MM3 B;  1Y19 B;  2LUM A;  1WI1 A;  1GNU A;  4JWU C;  2FJU B;  4CSQ A;  3W5V B;  4K81 A;  2CR5 A;  2DLW A;  2JXT A;  1UUP A;  2GBR A;  2IGH A;  2WXP A;  2ZW1 A;  3BK1 A;  1DOY A;  2WS3 B;  1WGK A;  3ALB A;  1MI0 A;  4GIV A;  3O96 A;  3RZW C;  2J42 A;  1RYJ A;  2CHX A;  2IY0 B;  1UGM A;  3DWM A;  2DX5 B;  1X86 A;  3PEG A;  2PIA A;  2KJ6 A;  1QZE A;  5IO9 A;  3E56 A;  1TIF A;  4GDK B;  1C9F A;  3DPD A;  4HAT B;  1ET9 A;  1YJI A;  3M62 B;  2BF8 B;  3APD A;  2EKI A;  2GUM A;  4NSW A;  3IBE A;  5FR3 A;  1XLP A;  2BYF A;  3WAN A;  3KZ1 A;  1M94 A;  1EM7 A;  1C78 A;  5DPT A;  1K53 A;  4W9G A;  2LOX A;  2ROV A;  3U7Z A;  2LJ5 A;  2PE9 A;  3ZO5 B;  1E8X A;  4K17 A;  1QOF A;  1XEE A;  4EOY A;  4D2K A;  1WIA A;  3KSY A;  2FNJ B;  3W2D A;  3VH3 B;  4AP4 C;  5DPW A;  2MWN B;  1N5W A;  2Y7B A;  2R2Q A;  3R8B A;  3ZJT A;  4YSZ B;  2YVC A;  3A98 B;  3BZD B;  2WXR A;  1BAK A;  2Y5P A;  2BQQ A;  1X1G A;  3DQV A;  3ENE A;  2IDY A;  1TZO A;  1P1A A;  3T8M A;  2MBB B;  1N6Z A;  1Z5S B;  2Y8F A;  3BVG A;  1L0X B;  3NS1 A;  5KCV A;  3QK0 A;  3U2S C;  4N59 A;  1E8Z A;  4DHJ B;  4XWT A;  1I4X A;  2UU7 A;  4KIK A;  5HE2 A;  4KHB B;  1OQN A;  2GLS A;  2I1J A;  2NVU I;  2PKO A;  4KGR A;  3WAO A;  2LFI A;  4IOI E;  3VAW A;  1R4N I;  1V5M A;  2JRH A;  1LFD A;  4O1N A;  2G3Q B;  3ULC A;  1D5X C;  4PS3 A;  4AJY B;  4F8C B;  1HXY D;  2KMC A;  5M4Y B;  3B2F A;  3DWG C;  3IT4 B;  1EF1 A;  2MBO A;  1NBF C;  1VR9 A;  4K3C A;  1WXM A;  1J7B A;  2YF0 A;  2FCS A;  3ML9 A;  3PSE B;  1YN3 A;  4WWP A;  3OJ3 A;  4XYC A;  5G55 A;  3TCA A;  2KKC A;  1BXT A;  4EMO A;  2KVR A;  2G4D B;  1PGB A;  4J3O D;  4AJW A;  3U52 E;  3AXC A;  1UD7 A;  3RMK C;  4MGY E;  2EC1 A;  2K8E A;  1T3Q A;  4IWO A;  1OGW A;  3BYY B;  2K00 A;  2JZZ A;  2D3B A;  1KOT A;  2N7D A;  2KGX B;  4ASW C;  3DVN V;  3NZU A;  1WGU A;  1N63 A;  2BS3 B;  2NPT A;  1U29 A;  4F7G A;  1KFY B;  2DAJ A;  2CHZ A;  4B95 A;  1CMX B;  2N9K A;  3T9L A;  1LQB A;  1U27 A;  3HHM A;  4GZU A;  4ZYS A;  1L5P A;  4HAY B;  2NZ8 B;  1VZ8 A;  2XBB C;  2D10 A;  2L0F A;  1RLF A;  4ANU A;  3R2T A;  1XOD A;  2LXC A;  2QCZ A;  2M38 A;  3NVZ A;  1RJ2 A;  1P7F A;  1I42 A;  3AU4 A;  2GCJ A;  3V62 A;  3VHT C;  3AE1 B;  2KC2 A;  2LWP A;  5KHO A;  1E8Y A;  2WX0 A;  4HRS A;  3V6C B;  5D3W A;  2BW2 A;  5C5B B;  2L52 A;  2V0G A;  2RSG A;  4NAW B;  1R7S A;  1CK1 A;  3HUI A;  2MEK A;  1YOV B;  1WGR A;  2HD5 B;  1RRP B;  3AED B;  1OY2 A;  1JRU A;  2D4Q A;  5JHB A;  4W9I A;  2D3G A;  2R09 A;  5G5H A;  1JRO A;  1MHH E;  3GZN I;  3TEX A;  4GGQ A;  2JYT A;  3DDC B;  3H7S A;  1D3Z A;  4LNI A;  5DCN A;  1IRS A;  1J0W A;  2WXO A;  2CAY A;  4K2P A;  1HTO A;  1PDX A;  1A5R A;  4ARC A;  1ZW7 A;  1UPQ A;  3VUY A;  5L83 A;  1YD8 U;  3PTF C;  2ADZ A;  1N61 A;  1SE3 A;  2RDG A;  4LCD E;  4CHM A;  5T8I A;  1WJ1 A;  2N9X A;  5JP4 A;  4WVF B;  4YTN B;  4CO7 A;  4EJN A;  4AUQ C;  1PYW D;  1ZC3 B;  1Q0W B;  3A8P A;  2Z13 A; 
#chains in the Genus database with same CATH homology
 2DEN B;  3NZS A;  4JGH B;  2PE6 B;  3X0W A;  1MPH A;  3L10 B;  3ZNG C;  2D2Q A;  3NY5 A;  2G35 A;  4A20 A;  5KQ1 A;  1UEL A;  3H7P A;  1L2N A;  1W1D A;  1X1F A;  2IYB A;  1V5U A;  1P3R A;  2MKR A;  3VVW B;  2A4Z A;  3KH0 A;  2D07 B;  4FLH A;  2N4F A;  3HIZ A;  4FJY A;  3L08 A;  4K1R B;  2LYD A;  1BTK A;  3W1Y A;  4GSW A;  2K8C A;  2DA0 A;  4G50 A;  4EUT A;  2I5F A;  1RFA A;  5J3Q A;  3APF A;  3NOB A;  1E90 A;  3W1S A;  4PNK A;  4HB2 B;  3AU5 A;  5HE1 A;  1KLV A;  4HAU B;  5C1Z A;  1BT0 A;  2UVM A;  4LDT D;  1G6J A;  2DZK A;  1S1Q B;  4GDL A;  3V61 A;  2Z0E B;  1V9J A;  1MAI A;  3NHE B;  3V5W A;  4MJS A;  5J3T A;  4TQ0 A;  1EF5 A;  3DVG Y;  2Y8G A;  4MY6 A;  1V86 A;  1V5T A;  2ZNV B;  4MSM B;  5CHF A;  1WF9 A;  4NQL B;  3OAW A;  3VFK A;  4HXD A;  3FEH A;  4A6F B;  2BCJ A;  2O2V A;  5C23 A;  4BKG A;  5FI1 A;  3P6A A;  1SGH A;  2UZR A;  1I7A A;  3A1Q A;  1WXV A;  2D11 A;  4DX8 A;  4H8S A;  2EJ8 A;  4HLE A;  2L05 A;  2COF A;  1GG3 A;  1TBE A;  1J8C A;  4FHK A;  3ZDM C;  2Y5B B;  1WJ6 A;  3P2B A;  4NJ6 A;  4MT7 A;  1UH6 A;  2W2W A;  1AQC A;  5DHF B;  4KHA A;  3PS6 A;  3ML4 A;  3ZLZ A;  2ZVO A;  2KQ7 A;  1EUV B;  2XK5 A;  1C3T A;  2RPQ A;  3QWZ B;  1AAR A;  4MGZ E;  3N32 A;  1H4R A;  4XX5 A;  2L76 A;  2NBU A;  2KDI A;  1UPR A;  2MP2 B;  1MKE A;  5D94 A;  3NS8 A;  3IVF A;  2JZ3 B;  1SE9 A;  1V49 A;  4OVV A;  2DZM A;  2FCQ A;  1WX8 A;  4X57 B;  2BPS A;  3ZRC A;  2Z59 B;  5D6J B;  2KTR A;  4PS7 A;  3VH4 B;  4JIO U;  3FM8 C;  2ELB A;  1LB1 A;  2K2J A;  5D3V A;  1VD2 A;  1IP9 A;  4E74 A;  5GMV A;  4CHK A;  2ZZP B;  2COD A;  2L00 B;  3RUL A;  1P9D U;  3RD2 A;  2HTH B;  2N9P C;  4GMV A;  1YIW A;  3PHW B;  2KX0 A;  2Z0O A;  1U5D A;  1MK9 B;  5KHQ A;  3PRM B;  1IYF A;  5C79 A;  5DH9 B;  2M1M A;  4HAZ B;  5LLI A;  2JUO A;  3QC8 B;  3PVL A;  4FHJ A;  2XQN M;  4XWX A;  2MRP A;  3N3K B;  3VTV A;  5FI0 A;  1WJ4 A;  2XEW A;  3S2A A;  4HAW B;  2NCN A;  1AWE A;  2DHJ A;  4HCN B;  3DXD A;  4II3 B;  1KZG A;  4KAX B;  5DI9 B;  2L2I A;  3PG7 A;  3TJP A;  2KN5 A;  1WRD B;  1DRO A;  3PRE A;  5IAA C;  4EEW A;  4BBN C;  5TR5 A;  3ODO A;  1H10 A;  2L7R A;  2LGD A;  4MSQ B;  1RAX A;  3ZTD A;  3ODX A;  2RUK B;  3DCG A;  3R3M A;  2LVP A;  5BO4 B;  3VTW A;  1GC7 A;  3KUC B;  4IUM B;  3QJZ A;  2MA9 B;  1T0Y A;  3DXC A;  1EO6 A;  1WXS A;  4WQO B;  4JLC A;  3ODW A;  4W9C A;  3C0R B;  2IO1 B;  1B55 A;  3ML8 A;  4K7W A;  4F7Z A;  3T06 A;  2VKI A;  3PV1 A;  4F7H A;  2KLC A;  3D8D A;  1KM7 A;  2FID A;  5D2M B;  4GU2 A;  1RRB A;  4WJ7 A;  2DAF A;  2WX1 A;  1WJN A;  2GOW A;  1BWN A;  5CLL B;  3N7C A;  2ZCB A;  4GMX B;  1Q5W B;  2DX1 A;  3SO6 A;  1HE8 A;  3JVZ X;  2DKP A;  2RVB B;  2D9V A;  2IBI B;  2YS3 A;  4PYZ A;  4FUL A;  2LZ6 A;  2DHI A;  4DX9 0;  2KQS A;  4MGK E;  1TXD A;  2DKQ A;  1TQZ A;  2RLO A;  4GOC A;  4KIK B;  2DYQ A;  3OJ4 B;  3OLM D;  2C7M B;  2K6D B;  3HM6 X;  2IO2 B;  3M63 B;  3U30 A;  2KC1 A;  4EZJ A;  4G3X B;  3PRP B;  4AWJ A;  2L8J A;  5HE0 A;  4ANW A;  3APC A;  5LOP B;  3Q3J A;  3SHQ A;  4MK0 A;  1WI0 A;  2D9X A;  1XQQ A;  2WDT B;  1U5E A;  2IZV B;  5AZG A;  2EMS A;  2O6V D;  1ZGU B;  4ANV A;  3ONS A;  2JT4 B;  2ZPY A;  3AJ4 A;  3R7R A;  2LVQ A;  2NPT B;  1V81 A;  2MBQ A;  2NBW B;  5JHA A;  2M0X A;  1MG8 A;  4D0N B;  3CIK A;  1UNR A;  2YT1 A;  1SIF A;  1X05 A;  2KOX A;  3UQA A;  1S3S G;  3JSV A;  1OEY J;  3RZF A;  2NR2 A;  2DZI A;  4N9F 4;  4J6I A;  1ZSQ A;  3VUX A;  2IFS A;  2LAS A;  3B0A A;  4HHV A;  1PMS A;  4TYZ A;  1GC6 A;  4HWI B;  4HAX B;  2J0J A;  1K5D B;  5D3Y A;  3QHT A;  3KYC D;  2IO0 B;  3DBL I;  3UGB B;  2GBJ A;  3PVW A;  2CU1 A;  2K1F A;  2MCN B;  2C60 A;  4A6H A;  2JXX A;  3DXE A;  2GBM A;  4IW0 A;  4DK5 A;  1P98 A;  3H9D A;  4B9K A;  3BIN A;  2PEA A;  2OTX A;  2QKM A;  1GJZ A;  1F9J A;  4KVG B;  2WWZ A;  3H7P B;  3KRW A;  1X1M A;  2C5L C;  2L0T A;  5L95 C;  3U7D A;  4TQ1 A;  2FJL A;  2KCJ A;  2KFK A;  2CRF A;  3VUW A;  2YLM A;  3PLU A;  3ZRF A;  3CMM B;  4WAA A;  2NS5 A;  4IOY X;  2GMI C;  4GDL B;  5DIF B;  3ZDT A;  2RSU A;  4DBG A;  2OQB A;  4MJS B;  5J2R A;  1Z2M A;  2NMB A;  5C6R A;  2UYZ B;  2BWE S;  2O6V A;  1P3Q U;  2CHW A;  2ROZ B;  2RR9 A;  4PS8 A;  1FOE A;  4KV2 A;  1K5G B;  4P7I A;  1WH3 A;  1XCG A;  1X11 A;  2O2V B;  2V4L A;  3MPX A;  1LXD A;  5JZE B;  1YX6 B;  1PFJ A;  2BYV E;  4NQK E;  2J7Q B;  3ZNH B;  3UIO B;  3PRZ A;  2JRI B;  1OEY A;  1QQG A;  3A1Q B;  3JYU A;  4ZRI A;  1E8W A;  3HK0 A;  1WJM A;  5CTR C;  2K39 A;  2E2X A;  5L81 A;  1WGQ A;  3QX1 A;  4JL9 A;  3KVF B;  1WM3 A;  1M7R A;  1YJ1 A;  3WYF B;  2K25 A;  4Z2M B;  2M8S A;  2YSZ A;  1ZC4 B;  4KDL B;  2DHK A;  2MWS B;  4DHZ E;  5D27 A;  1WGY A;  3A9J A;  2XK5 B;  2FCN A;  3KRX A;  3UIN B;  2LXA A;  1PQS A;  2YRY A;  2COA A;  1VCB A;  3ZNI D;  1IPG A;  1BTN A;  1I2H A;  3B08 A;  1U4A A;  3ECI A;  2KUP A;  1Y5O A;  3UF8 A;  4RM8 A;  3ZKJ C;  4K7S A;  2LG1 A;  4PYU A;  2GJY A;  2R0D A;  4LJP B;  2KO3 A;  3SUZ A;  3N30 A;  2KJR A;  3MJW A;  2KTR B;  3A33 B;  4MEL A;  3EEC A;  4ICV A;  3PVU A;  2JY6 A;  3VQI A;  1XR0 B;  2ZPN A;  1EGX A;  3V60 A;  2KWU B;  3DBS A;  2KD0 A;  4A5K A;  4HJK A;  1V89 A;  4B6W A;  3PGE A;  3ZVR A;  2IY1 B;  1FHX A;  4LDT B;  5JHH A;  1DDV A;  4WWN A;  1V5P A;  3TVV A;  2LUL A;  2W2X C;  2G45 B;  1L7Y A;  4DDG D;  1W1G A;  1Q67 A;  2MSE D;  3QQ8 B;  3K9O B;  1U5F A;  3QA8 A;  1P5T A;  1WY8 A;  3CXB B;  3BY4 B;  1EAZ A;  3KUD B;  4XC2 A;  2AL6 A;  3SYX A;  2COC A;  3PHX B;  2FAZ A;  4IWP A;  5IA7 A;  4ZDV A;  2KZR A;  3GYP A;  1P0R A;  3W1S C;  2N7E A;  1R4M I;  4HK2 A;  2ZJD A;  4IG7 B;  1FHW A;  2P0D A;  1WM2 A;  1E7U A;  2GS0 A;  3SNH A;  4KHO A;  1XD4 A;  4FJZ A;  5LXI B;  2ZEQ A;  1MK7 B;  4YL8 A;  3RUI B;  3TIX A;  2N0Y A;  3TFM A;  4Z2N A;  3EFU A;  2MFQ A;  5EFX A;  4FA6 A;  2MBH A;  1WE7 A;  4IM0 A;  3QIJ A;  3F0W A;  2LRW A;  4F7U P;  3MDB C;  3O65 B;  4F1S A;  2MDX A;  5CLQ B;  3QCA A;  4IWQ A;  4OVU A;  1K8R B;  2DHZ A;  2MX2 A;  3WA0 A;  1WFY A;  4FJV B;  2V76 A;  2LRU A;  1V2Y A;  4BBK A;  1U2B A;  2M4N A;  2MBE A;  3L0W B;  3KY9 A;  2ZNV C;  3PT2 B;  1WXA A;  3WAP A;  4E3C A;  2H7D A;  3M1I B;  3PP2 A;  2KK8 A;  2Z0D B;  4DHJ D;  2P8V A;  1UNP A;  2AL3 A;  2J59 M;  4BOS C;  2D9Y A;  3G9W A;  4WJP A;  2KJH B;  4NJ7 A;  3PLV A;  1UZX B;  2I1K A;  2RGN B;  5D3X A;  4BKT A;  2GBK A;  2LGX A;  2LKO A;  3L54 A;  4BOZ B;  2KTF A;  3A4R A;  3VDZ A;  1FHO A;  1J0G A;  4NY0 A;  3M95 A;  4HB0 B;  2Z0Q A;  4A6K A;  1WGG A;  1LW3 A;  2DYB A;  1WR6 E;  4FBJ B;  2YT0 A;  4FAD A;  1FGY A;  1WGD A;  2UZS A;  1WR1 A;  4DXA B;  4I6N B;  4IFS A;  1WG7 A;  2DZJ A;  1V80 A;  5FR6 A;  4W9J A;  5LON B;  3K9P B;  3DVG X;  1J19 A;  3HQC A;  4BBN F;  3D32 A;  4YON A;  1MIX A;  5HE3 A;  3ZVV A;  3JSV B;  4XZ4 A;  4MM3 A;  3DBH I;  4AOF A;  3HW2 B;  2DN6 A;  2KWC A;  3SU8 X;  2W2X D;  3QAQ A;  3VIA A;  4KSL C;  5J17 A;  2JVC A;  5EDS A;  4II2 B;  3VTU A;  5AEK B;  2VRW B;  1TZ1 A;  2MQJ A;  2DX5 A;  1DBH A;  2UWQ A;  3NSU A;  4DWF A;  5CHV C;  3RT3 B;  3RYT A;  1XD3 B;  4M8N A;  4CYE A;  4GDK A;  3VXW A;  2VRR B;  1N3H A;  2YS1 A;  1LM8 B;  3VOQ A;  4W9F A;  2Z0P A;  3ULB A;  4W9K A;  1OMW A;  1UEF A;  3R7Q A;  1V61 A;  4WSF A;  3DBR I;  4PQ0 A;  4A3O A;  2VSZ A;  4EKU A;  2K6Q A;  5E6P A;  4BFR A;  3WAL A;  1FXT B;  3TBL D;  1C1Y B;  4MEM A;  1ZKH A;  2QKL A;  4BVU C;  2D9W A;  3ZNZ B;  2JWZ A;  2KFK B;  2H7E A;  4NNJ B;  3ZUN A;  4Y94 A;  2V3S A;  5KQ4 A;  4W9H A;  1OTR B;  2LUE A;  4HDO A;  3ZW3 A;  1YQB A;  1XT9 B;  2KNB A;  3IHP C;  4GB9 A;  2K8B A;  3P7Z A;  2JPH A;  4FN2 A;  1EVH A;  4W9E A;  2EMT A;  2LOZ A;  4M0W B;  2QHO A;  1SHC A;  2BWF A;  3CSF A;  3KYD D;  4BKS D;  3TO1 A;  4HCP B;  3MTN B;  4IAP A;  1KJT A;  2FCM A;  3WAM A;  2C7H A;  1V88 A;  3D8F A;  2O6V B;  4LJO B;  1ZVR A;  4KSK C;  3M3J A;  3OAN A;  1TTN A;  2KAN A;  3EHV A;  2BGF A;  3QWM A;  2LI5 A;  1Y8R C;  1V5O A;  4DHZ B;  1PLS A;  2PPH A;  3F5R A;  3MHS D;  4KZ0 A;  2NBV B;  4IM2 A;  2JP2 A;  2KDE B;  4EZK A;  2RD0 A;  3L13 A;  4RM9 A;  2HJ8 A;  1FGZ A;  5CHW A;  3I3T B;  3UIP B;  2CY5 A;  1Q1O A;  1I35 A;  3L16 A;  3ZIM A;  1TGZ B;  4DDI D;  2P0F A;  2KMA A;  5C5B A;  1NDD A;  2CY4 A;  4NAW A;  3TL5 A;  3DOW A;  3SD5 A;  2K2U A;  2JF5 A;  1Z87 A;  2KWV B;  3H1U A;  3QAR A;  3A9J B;  2BKR B;  2DFK A;  5HKH A;  5J18 A;  4ZRJ A;  1V6E A;  1H8C A;  1FAO A;  2ZCC A;  4TUU A;  2FIF A;  5DPS A;  2M14 A;  3V6E B;  2B3A A;  4ZRK A;  3TW1 A;  2LD9 A;  5CX3 A;  5LXH A;  2ASQ A;  2MLB A;  2GBN A;  1GUA B;  1E7V A;  1TJ6 A;  5DPR A;  2R2O A;  2KLG A;  2A5U A;  2MW5 A;  2I5C A;  1P6S A;  1OQY A;  1NI2 A;  5E6O A;  3Q3F A;  3FSS A;  2IYD B;  3RCZ A;  4W9L A;  1E5W A;  4G11 A;  4EFO A;  4A3P A;  1FB8 A;  2LVO A;  2KDB A;  2GCL A;  3CF6 E;  2REX A;  4W9D A;  4MGI E;  3A9K B;  2OOB B;  2N1W A;  2WYQ A;  2L3Z A;  3CST A;  5J3Y A;  5E6N A;  3B1L X;  5G2N A;  3WIM A;  4BKS A;  4JQW C;  1KZ7 A;  4URK A;  3JW0 X;  4TKN A;  4K7U A;  1WX7 A;  2L1C A;  4IC7 B;  2OJR A;  5AZF A;  4M8M A;  2PJH A;  1ZM0 A;  2KHW B;  4HPL B;  1DYN A;  2DYO A;  3IFW B;  1WYW B;  3LDZ E;  4WJO A;  4HB4 B;  2G4S A;  4MDK E;  4RMA A;  4A6F A;  1KI1 B;  3GOE A;  3H6N A;  3EC8 A;  3A9K A;  2FUH B;  3UZT A;  3RCP A;  2DTC A;  3L17 A;  3A8Q A;  3BJI A;  1WX9 A;  5JH5 C;  4HVB A;  2AYO B;  2N1V A;  2C9W B;  2LGY A;  1WZ0 A;  1DDM A;  3AUL A;  4EZL A;  4WJN A;  2X18 A;  2J0M A;  4GPT B;  3LJU X;  4GXB A;  3ZTC A;  1QC6 A;  1UBI A;  1WVH A;  3R66 C;  5DHA B;  2D9Z A;  2ZVN A;  3HM3 A;  4I6P A;  4IM3 A;  2KDF B;  2BKF A;  3PSC A;  1WMH B;  2CKH B;  4CHJ A;  3KUZ A;  2K8H A;  4E71 A;  2RNR B;  2MP2 A;  3KW5 B;  2EKE C;  3AI5 A;  1NU2 A;  4G0N B;  4ZYN A;  4ICU A;  2AEH A;  4B6H A;  1WGH A;  2DYN A;  2KX3 A;  4HB3 B;  4WJQ A;  1YX5 B;  1MIZ B;  3A4S C;  3GYO A;  2AWT A;  2RGF A;  2KXJ A;  4HDQ A;  1NTY A;  2M17 A;  2N23 A;  3U8Z A;  2IO3 B;  4MH0 E;  4DBB A;  1WMH A;  5JHG A;  2CS4 A;  1U5G A;  4WWO A;  4HPM B;  4KZC A;  4KDI C;  2V1Y A;  2W9N A;  3DVN U;  2HTH A;  2ELA A;  5JLJ B;  3D8E A;  5D7G A;  2BYE A;  4L6E A;  3SDL C;  1WJU A;  3QBV B;  1UBQ A;  4TV3 A;  3IG3 A;  2Q13 A;  3PZD A;  1W1H A;  3SV1 A;  1DDW A;  3PPA A;  1NTV A;  1XKE A;  5GOW B;  2J0K A;  2KFJ A;  1WZ3 A;  4GN1 A;  1XX0 A;  2PZ1 A;  1WE6 A;  3UQB A;  5C16 A;  1UNQ A;  5AZH A;  4I6L B;  4NPN A;  1M7E A;  3TMP B;  2N9E B;  4K2O A;  4C0A A;  2YS5 A;  3X23 A;  2HE7 A;  3LJ3 A;  2C7N B;  2DYM A;  2P0H A;  4HAV B;  1ISN A;  1Y19 B;  1WI1 A;  1GNU A;  4K81 A;  2CR5 A;  2DLW A;  2GBR A;  3ALB A;  4GIV A;  3O96 A;  3RZW C;  2CHX A;  2IY0 B;  1UGM A;  2DX5 B;  1X86 A;  3PEG A;  2KJ6 A;  1QZE A;  4GDK B;  3DPD A;  4HAT B;  3M62 B;  2BF8 B;  3APD A;  4NSW A;  3IBE A;  2BYF A;  3WAN A;  3KZ1 A;  1M94 A;  5DPT A;  4W9G A;  2LOX A;  2ROV A;  2LJ5 A;  2PE9 A;  3ZO5 B;  1E8X A;  4K17 A;  4EOY A;  1WIA A;  3KSY A;  2FNJ B;  3VH3 B;  4AP4 C;  5DPW A;  2MWN B;  2Y7B A;  2R2Q A;  2YVC A;  3A98 B;  1BAK A;  3DQV A;  1X1G A;  3ENE A;  1P1A A;  3T8M A;  2MBB B;  1Z5S B;  2Y8F A;  5KCV A;  3QK0 A;  1E8Z A;  4DHJ B;  4KIK A;  5HE2 A;  4KHB B;  1OQN A;  2I1J A;  2NVU I;  3WAO A;  3VAW A;  1R4N I;  1V5M A;  2JRH A;  1LFD A;  2G3Q B;  3ULC A;  4PS3 A;  4AJY B;  4F8C B;  2KMC A;  1EF1 A;  2MBO A;  1NBF C;  1WXM A;  2FCS A;  2YF0 A;  3ML9 A;  3PSE B;  4WWP A;  3OJ3 A;  5G55 A;  3TCA A;  2KKC A;  4EMO A;  4AJW A;  2KVR A;  2G4D B;  3AXC A;  1UD7 A;  4MGY E;  2EC1 A;  4IWO A;  1OGW A;  2K00 A;  2JZZ A;  1KOT A;  2N7D A;  2KGX B;  4ASW C;  3DVN V;  3NZU A;  1WGU A;  1U29 A;  4F7G A;  2NPT A;  2DAJ A;  2CHZ A;  4B95 A;  1CMX B;  3T9L A;  1LQB A;  1U27 A;  3HHM A;  4GZU A;  4HAY B;  2NZ8 B;  2XBB C;  2D10 A;  2L0F A;  1RLF A;  4ANU A;  1XOD A;  2LXC A;  2M38 A;  1RJ2 A;  1I42 A;  3AU4 A;  2GCJ A;  3V62 A;  3VHT C;  2KC2 A;  2LWP A;  5KHO A;  1E8Y A;  2WX0 A;  3V6C B;  5D3W A;  5C5B B;  2RSG A;  4NAW B;  1WGR A;  2HD5 B;  1RRP B;  1OY2 A;  1JRU A;  2D4Q A;  5JHB A;  4W9I A;  2D3G A;  2R09 A;  3GZN I;  4GGQ A;  3DDC B;  3H7S A;  1D3Z A;  5DCN A;  1IRS A;  1J0W A;  2CAY A;  4K2P A;  1A5R A;  1ZW7 A;  3VUY A;  1UPQ A;  5L83 A;  1YD8 U;  3PTF C;  2ADZ A;  4LCD E;  4CHM A;  1WJ1 A;  2N9X A;  5JP4 A;  4WVF B;  4CO7 A;  4EJN A;  4AUQ C;  1ZC3 B;  1Q0W B;  3A8P A;  4ANX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...