4KVGB

Crystal structure of riam ra-ph domains in complex with gtp bound rap1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
260
structure length
246
Chain Sequence
MKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Rap1 in complex with RIAM reveals specificity determinants and recruitment mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related protein Rap-1A
total genus 78
structure length 246
sequence length 260
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
B PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4kvgB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kvgB01
1GUAB 2HJ8A 3KUDB 2DLWA 3ONSA 4II3B 2HTHB 2FCNA 3DVGX 5J17A 2MBOA 1TJ6A 1AQCA 4HB3B 4EZKA 3AI5A 2WX1A 3QWMA 4A3PA 3PHXB 3N3KB 2GBRA 2DHKA 2CY5A 2G35A 3FM8C 2KTFA 4NPNA 2D3GA 2D10A 3VUYA 1WGDA 4MGIE 5J3YA 4MGKE 2G3QB 2KWVB 2KCJA 3DXDA 4HB2B 3CIKA 4MDKE 2IFSA 2K2JA 4PS8A 2KNBA 3APDA 4OVVA 2MLBA 2ZZPB 4DX8A 5D6JB 3APFA 1RRPB 4NSWA 3P7ZA 3L16A 4G0NB 1P3QU 2JY6A 5LONB 1BT0A 4H8SA 2KUPA 2LJ5A 4JIOU 2LKOA 4RM8A 3R7RA 1PMSA 1UNPA 1V81A 4HATB 2K8BA 2JUOA 1P5TA 3LJ3A 1TZ1A 2LOZA 2LVQA 1RAXA 2RR9A 3PTFC 1WVHA 4MJSA 4W9IA 3SNHA 1UGMA 2MSED 1KLVA 3TO1A 3KZ1A 3PHWB 4NY0A 2RD0A 4TYZA 4Z2NA 2WWZA 4A6KA 1IRSA 3BJIA 5L81A 3ML4A 2PE6B 3A1QB 3D8DA 4BFRA 1RFAA 3A4RA 2DHJA 4WJNA 4HJKA 3RZFA 1IYFA 3VHTC 1KZ7A 2K8HA 2Z59B 3H9DA 1B55A 2FCQA 4IAPA 1WI1A 5JLJB 5FI1A 1LB1A 4JQWC 4GSWA 3WAOA 1X86A 4IOYX 4KAXB 1WR1A 2ZEQA 1TQZA 3ZVRA 1WF9A 4KZCA 4GDKB 4M8NA 4WWPA 4FA6A 1ZC4B 3TL5A 5HKHA 2IO3B 5JP4A 4ZDVA 2ZCCA 4W9KA 5AZGA 5CLLB 4JGHB 3L54A 1H4RA 2W2XC 1QC6A 1W1HA 2UYZB 5KHOA 4BKTA 1WJ1A 3H7PB 3NOBA 4G3XB 2KWCA 2DN6A 5JHHA 5LOPB 1WGUA 2DZIA 4IWPA 3QWZB 4XX5A 3PZDA 3ZO5B 4FJYA 4II2B 5L95C 4I6PA 3W1SC 3VH3B 1Y19B 5D27A 1Z2MA 3B1LX 2CHXA 2NCNA 1XCGA 4KV2A 4EOYA 3VTUA 2MP2A 2XK5B 3ZW3A 1Q67A 2C7MB 2J0MA 2AWTA 2LZ6A 3VH4B 2LI5A 1U4AA 3WANA 1WJUA 2E2XA 3NSUA 2FUHB 1MIXA 4K7SA 4CO7A 3V6EB 4HVBA 1WX9A 2KTRB 4CYEA 5D3YA 3UZTA 1K8RB 2CHWA 2KN5A 4FLHA 4F7GA 2FAZA 2BKRB 4BOZB 3QIJA 2R09A 3RD2A 2KANA 1KZGA 4GN1A 3A9KA 4GIVA 1WG7A 2DYQA 4EKUA 1E8ZA 1NI2A 4ZRKA 1ZKHA 5E6OA 3UGBB 2LVOA 2MDXA 4M8MA 2YS5A 2DENB 3O65B 5E6PA 4DWFA 3PLVA 3N7CA 2DX5A 2NPTA 1BWNA 1TGZB 3PV1A 3L0WB 2EMSA 2RUKB 2GJYA 3SYXA 2K00A 3H7SA 4IFSA 1WJ4A 1E5WA 2PE9A 2CR5A 2M8SA 2KJ6A 2O2VB 2YF0A 2EJ8A 4A5KA 3L10B 3T9LA 2R2OA 3NY5A 1V61A 3V62A 1F9JA 4K17A 5DPTA 4WJ7A 4EZJA 3CF6E 2DYOA 2KXJA 3Q3FA 3TW1A 1ZGUB 2K39A 1J19A 4MGZE 2ELBA 3ZTCA 1I42A 2LOXA 2MBEA 3TVVA 4MGYE 4RMAA 4A6HA 1V9JA 2KD0A 4ASWC 1XODA 2KLGA 3A9JB 2K6DB 2M0XA 3H1UA 3KYDD 4HDQA 4KHOA 1P6SA 3DOWA 4K7UA 2KO3A 4DXAB 1UBIA 2VRRB 5BO4B 2DHIA 4F7UP 1G6JA 3QX1A 3PP2A 1RLFA 2AEHA 3QHTA 4WJOA 2N9PC 2BGFA 1V5UA 2KQSA 3OJ4B 3VQIA 3A9KB 3W1YA 2OQBA 3PG7A 4KSKC 1H10A 4PS7A 2LASA 1P9DU 2UWQA 5AZHA 1L2NA 1WMHB 1WMHA 2YRYA 4I6LB 3O96A 3CSTA 1NDDA 3JSVA 3KRXA 2CRFA 2J0KA 2Z0OA 4XWXA 3ZNGC 4ANVA 1FGZA 1WGQA 2AL3A 4GGQA 4MJSB 3V60A 1EAZA 2XQNM 4ANUA 3L13A 3QJZA 1X1GA 1YIWA 2C60A 3VXWA 4GU2A 2JPHA 5D3VA 4WWNA 2NMBA 3ZNID 2GBMA 4BBNC 4DBGA 2DX1A 3IFWB 2IYBA 2R0DA 4GZUA 1BTKA 1K5DB 1ZC3B 2P0FA 2C9WB 3QARA 2PPHA 1M7RA 4WWOA 5JH5C 3R7QA 1V88A 2ZPNA 1OY2A 2Y8GA 1MG8A 3C0RB 1YQBA 5J3QA 3KYCD 4IM3A 2KDEB 2KK8A 1XX0A 3F5RA 3IVFA 2W2WA 1U29A 3LJUX 3T06A 3VOQA 2L05A 4DK5A 1T0YA 1EO6A 3ZDMC 3K9PB 3EHVA 2Z0EB 4JLCA 4XZ4A 1TTNA 3TIXA 2CAYA 3KY9A 2RPQA 5C79A 2LYDA 2DX5B 2NPTB 5DHFB 5TR5A 4KZ0A 1XKEA 1C1YB 3RUIB 5HE2A 5G2NA 3ML8A 2UVMA 2CKHB 1WH3A 1RJ2A 1V49A 1XD3B 4HXDA 4NJ7A 5CHWA 3ZRCA 2O6VB 2YSZA 5JHAA 1DDWA 2FJLA 1FHOA 4LDTB 4W9FA 2MRPA 3UINB 4AOFA 5DCNA 3ZIMA 1MAIA 3W1SA 2DYBA 1WI0A 3CXBB 3DBLI 2KLCA 2IBIB 5C5BA 4HK2A 4HAUB 1WX7A 3DPDA 4EEWA 1W1DA 2JZ3B 1AARA 3A98B 4JL9A 3VTVA 2K8CA 1WX8A 3PRMB 1SHCA 1WXSA 1OEYJ 3HM3A 3KW5B 2I1JA 2FCSA 2JRIB 3IG3A 2BKFA 3WAPA 2KFKA 2P0HA 1PFJA 2BYVE 4TUUA 1U5GA 3A8PA 2N4FA 3B08A 1E8XA 1UELA 1E8YA 2HE7A 2C7NB 4HAZB 1AWEA 2UZSA 3AJ4A 2OTXA 3TCAA 2YLMA 4FJZA 4WAAA 2ROZB 3WAMA 2RLOA 4B95A 2L1CA 1WZ0A 1P3RA 2AL6A 3ULCA 2P8VA 2MBBB 3M3JA 4HAVB 4LCDE 1WM2A 2NBUA 4I6NB 2LG1A 3L17A 1ZM0A 2DKQA 3ULBA 3VTWA 2PEAA 1FHXA 4HCPB 2COFA 4RM9A 1WE7A 4B6WA 1NU2A 2IO0B 2JT4B 4MK0A 2KZRA 1X1MA 2CY4A 1PQSA 2NS5A 3ENEA 3PPAA 1E7VA 1WIAA 4WQOB 3RULA 4IC7B 1GJZA 3HM6X 5CHVC 3GZNI 2MFQA 3DQVA 2YS1A 4C0AA 1E90A 1WY8A 1MK7B 4KSLC 2PZ1A 3M95A 2M17A 3CMMB 5KQ4A 2MKRA 3JW0X 3VDZA 2W2XD 1X1FA 3WA0A 1BAKA 4DDGD 3ML9A 3P2BA 2COAA 2FIFA 5D94A 2L0TA 2D2QA 1OTRB 2ASQA 2N7DA 1V5TA 2ZVNA 3GOEA 3JVZX 4HB4B 3GYOA 3ZDTA 2DAJA 4AP4C 4K1RB 2J59M 3N32A 4NAWB 4BBNF 2JXXA 2LWPA 2OOBB 1LW3A 4KVGB 3S2AA 4HB0B 1FXTB 3UIOB 5J18A 1R4MI 2HD5B 2KJRA 2RSGA 2N7EA 3OAWA 1S3SG 5EFXA 5DPSA 4DDID 2LRWA 1FGYA 1ISNA 2DFKA 1LQBA 2AYOB 1WM3A 2KGXB 3ECIA 2BF8B 2A5UA 4AUQC 2MQJA 4GB9A 3PSEB 3Q3JA 1SE9A 2Y8FA 4PYZA 4TKNA 1HE8A 4HWIB 3M1IB 1WRDB 2JWZA 3NZUA 2L00B 5D2MB 3VIAA 2C7HA 3AXCA 5D3XA 3SV1A 4CHMA 4HPLB 3VUXA 1TBEA 5KHQA 4HAWB 1EF1A 3VFKA 1S1QB 2DYMA 2B3AA 3BINA 2K25A 2GBJA 4AJWA 2ZPYA 3A33B 1WGHA 1Y8RC 3B0AA 2M38A 2GBNA 3RCPA 2KVRA 2LVPA 3KUCB 5IAAC 1TXDA 2LXCA 2V4LA 2W9NA 3ZLZA 4ZRJA 5D3WA 5GMVA 2Q13A 1GC7A 3JYUA 1X11A 2ZVOA 1U27A 3PRPB 4IM0A 2D11A 3TJPA 1WGRA 3A9JA 2UZRA 1WJ6A 4IW0A 3D32A 1WJMA 5C1ZA 2D9WA 2MBHA 3OLMD 3I3TB 2ROVA 2BCJA 1WXMA 4K2OA 1J8CA 2KC2A 3PREA 3OANA 1E7UA 1GNUA 1YX5B 1VD2A 1Z87A 1LFDA 3RYTA 3F0WA 4PS3A 2YT1A 3VAWA 1MIZB 5GOWB 3VUWA 1K5GB 4GDKA 2VSZA 4LJOB 3KUZA 3PS6A 4F7ZA 4FJVB 2O2VA 4GOCA 3X23A 3DXEA 2IYDB 5DPRA 2H7EA 4MM3A 3V61A 2JP2A 1EVHA 3PT2B 1WZ3A 1E8WA 1WYWB 2QKMA 3MPXA 4BBKA 4PNKA 2MP2B 2O6VD 1FB8A 1Q1OA 3MDBC 2ADZA 2GCJA 2MX2A 3K9OB 4LDTD 1NTVA 5AEKB 3V5WA 1UBQA 3DVGY 4G11A 2LGDA 4Z2MB 4AWJA 3PRZA 4FULA 1FHWA 2COCA 2D07B 2KHWB 1M94A 2R2QA 2MWSB 2DKPA 3H6NA 3OJ3A 4NJ6A 1I2HA 3SD5A 2CHZA 3CSFA 1XD4A 4KDLB 4CHKA 1P1AA 3PGEA 4GDLB 1R4NI 1WXAA 2C5LC 1V86A 2IO2B 2N9XA 2RSUA 2DZKA 3QQ8B 3QK0A 4OVUA 4L6EA 4DHJD 3WIMA 4DHZE 1J0GA 1I35A 1A5RA 5DIFB 3DBHI 1ZSQA 4PQ0A 3EFUA 4KHBB 2N9EB 1WXVA 2BPSA 2V76A 3PSCA 4ICVA 1I7AA 2CS4A 2G4SA 2KDBA 2X18A 5HE3A 4MEMA 4GMXB 5D7GA 3DCGA 2ELAA 2WDTB 1ZVRA 2QKLA 1C3TA 1KJTA 3LDZE 3V6CB 5C16A 4WJPA 4Y94A 4A20A 1FOEA 3UF8A 2BYEA 2DYNA 3HQCA 2G45B 3DBRI 2RNRB 1CMXB 3FEHA 4MT7A 2YS3A 5KCVA 1Q5WB 1UD7A 1YD8U 2DZMA 1P0RA 2ZCBA 5EDSA 4YL8A 4J6IA 2Z0QA 2KOXA 3ZVVA 2Y5BB 5JZEB 2M1MA 3DXCA 4GPTB 4IM2A 4ANWA 1DYNA 4KHAA 5DI9B 3WYFB 1U5EA 2IO1B 4K81A 1WE6A 2KQ7A 3PVLA 2LRUA 3QC8B 4W9EA 4IWOA 1U5FA 2REXA 2J7QB 3N30A 4NQLB 2OJRA 2I5CA 2DAFA 2MWNB 4ICUA 2JZZA 2GS0A 1PLSA 3A1QA 2LXAA 4YONA 3UQAA 2IY1B 2KFKB 2D9ZA 2CU1A 2GCLA 2I1KA 3KH0A 2LULA 4FHKA 2LGYA 4NAWA 3IBEA 4FN2A 1V89A 5J3TA 2V1YA 3P6AA 3SO6A 3MHSD 3SHQA 5J2RA 2BWES 2NR2A 1V5OA 2IY0B 2EKEC 3PVUA 2LUEA 5G55A 3VVWB 4TQ0A 3M63B 2NBVB 2VRWB 1XQQA 2JF5A 2XEWA 3A4SC 2RGNB 2DZJA 1SIFA 4ZYNA 3EECA 1OGWA 4BKGA 1KI1B 2D9VA 4IG7B 1NBFC 5LXHA 2L3ZA 2KC1A 4M0WB 4FHJA 4EFOA 2L8JA 3D8FA 1UZXB 4ANXA 2EC1A 1V5MA 3FSSA 2GMIC 3MJWA 3RT3B 2Z0DB 2WYQA 1N3HA 2HTHA 3RCZA 4EZLA 2M14A 2BYFA 2KX3A 4KDIC 2D9YA 1KM7A 4KIKA 3KSYA 4DX90 1NTYA 1D3ZA 4W9JA 3KRWA 2L2IA 2KTRA 2PJHA 1H8CA 4GMVA 1YX6B 3EC8A 4EMOA 2BWFA 2KFJA 3U8ZA 2L0FA 3ODOA 2N1WA 4NQKE 1UPRA 1OEYA 5HE0A 1WJNA 2MCNB 4E3CA 1Y5OA 3U30A 1OQNA 5IA7A 2GBKA 2CODA 1LM8B 1P98A 3TBLD 4CHJA 4IUMB 3ZTDA 3HIZA 1M7EA 4A6FB 3TMPB 4A6FA 4MH0E 3R66C 2EMTA 3QBVB 1J0WA 4XC2A 5CLQB 1V6EA 4FADA 3UQBA 2ZJDA 3NHEB 1U2BA 3ZNZB 3ALBA 2MA9B 2Z0PA 3MTNB 1XT9B 2NZ8B 5C5BB 4F8CB 3AU4A 3PVWA 4N9F4 4D0NB 2FNJB 1W1GA 5JHGA 2KX0A 2ZNVB 1MK9B 4MSQB 4PYUA 3X0WA 3JSVB 5HE1A 5E6NA 1Q0WB 4F7HA 3QAQA 1UNRA 1UH6A 4BOSC 1QQGA 4NNJB 3G9WA 3UIPB 1UPQA 4W9GA 2DHZA 2GOWA 4A3OA 3WALA 2FCMA 3BY4B 4EUTA 4E74A 2KDFB 2FIDA 4BVUC 4P7IA 3HHMA 4MELA 4B9KA 3ZUNA 2MBQA 1WR6E 3SDLC 3ODXA 4HLEA 4GXBA 2DTCA 3HW2B 3ZKJC 2K1FA 2K6QA 5LLIA 4BKSA 5DH9B 4K2PA 1KOTA 2LD9A 4DHJB 2RGFA 4HCNB 4AJYB 2L7RA 2J0JA 4HAYB 4HPMB 3PEGA 2G4DB 4DHZB 1GC6A 2KJHB 2KKCA 2V3SA 3AU5A 4TQ1A 5DHAB 2D4QA 3IHPC 1EUVB 4X57B 3L08A 2LGXA 1MPHA 2N0YA 1SGHA 4IWQA 1JRUA 3DVNU 5CHFA 1OMWA 3DDCB 1UEFA 1DDMA 4MY6A 2QHOA 2ZNVC 3APCA 3QA8A 2MW5A 4K7WA 5C23A 2I5FA 2O6VA 3SU8X 2NBWB 3AULA 3TFMA 4W9HA 4URKA 1V5PA 2YVCA 3M62B 1FAOA 3U7DA 1V80A 1Z5SB 5L83A 3QCAA 4EJNA 4ZRIA 1EGXA 2YT0A 1IP9A 3A8QA 2JVCA 2D9XA 2VKIA 5AZFA 4GDLA 2DA0A 3ODWA 3D8EA 1WGYA 1U5DA 5JHBA 4KIKB 3NZSA 2M4NA 4HDOA 2H7DA 4W9DA 1UNQA 1IPGA 4W9CA 5CTRC 2KMCA 3KVFB 4TV3A 1DDVA 2K2UA 3R3MA 4G50A 2L76A 1GG3A 3SUZA 2XK5A 3GYPA 1QZEA 4WJQA 3ZRFA 1WGGA 2A4ZA 3DBSA 5C6RA 2NVUI 4BKSD 5CX3A 4E71A 1ZW7A 2JRHA 2KDIA 3PLUA 4HAXB 4MSMB 5LXIB 1BTNA 4WVFB 1DROA 1OQYA 2N23A 2N1VA 2XBBC 3NS8A 4W9LA 4B6HA 3T8MA 5DPWA 1RRBA 2P0DA 1VCBA 1WFYA 3ZNHB 1MKEA 5FI0A 5KQ1A 3RZWC 5FR6A 4FBJB 3H7PA 4F1SA 1XR0B 1YJ1A 1LXDA 2IZVB 4HHVA 4DBBA 4LJPB 1EF5A 2RVBB 1V2YA 3HK0A 2KMAA 2KWUB 3DVNV 1DBHA 2Y7BA 4WSFA 2WX0A 1X05A 1L7YA
chains in the Genus database with same CATH superfamily
1ESFA 1RYJA 2HJ8A 2RDBC 2HTHB 4P6VF 4CSQA 1DOIA 4EZKA 3AI5A 1MI1A 3N3KB 1TIFA 2CY5A 3NJTA 3AE1B 1EM7A 4A55A 3IAS1 3EUB2 4MGIE 1YN4A 2KWVB 5EE0A 4S0RA 3APDA 2MLBA 1RRPB 3AM9A 2DNFA 2LJ5A 2GB1A 3EA6A 3R7RA 1UNPA 2JSVX 5LG4B 1XLPA 1L6UA 3LJ3A 3NWFA 2AQ2B 1WVHA 1NYRA 4W9IA 3SNHA 2MSED 4M02A 3KZ1A 3PHWB 4JX1C 2RD0A 4A6KA 3BJIA 1ZE3D 2PE6B 1RFAA 4WJNA 3RZFA 3H9DA 1B55A 1WI1A 4QXAB 1WR1A 3ZVRA 1WF9A 1T6BX 4GDKB 1ZC4B 3TL5A 4ZDVA 4W9KA 1SSNA 3I9V1 2UYZB 3A58A 4AQ7A 1XLNA 4IWPA 3C8YA 5L95C 4FJYA 4II2B 4I6PA 5IOIA 3VH3B 4C56C 1Z2MA 1V1PA 4KHBA 1A70A 3ZW3A 2J0MA 2LI5A 4CO7A 1WX9A 5D3YA 3L4PA 4F7GA 3AEDB 2BKRB 3DCXA 1OQQA 1NI2A 4ZRKA 1R4NB 2BB5A 2LVOA 2DENB 3O65B 5E6PA 3N7CA 1DOXA 1BWNA 2GLSA 3PV1A 3L0WB 2EMSA 2RUKB 2GJYA 3SYXA 3L10B 4A5KA 3KLSX 2NMQA 1IGCA 1ZGUB 2K39A 2VH1A 4MGZE 1I42A 1XCTL 4MGYE 4DIXA 1V9JA 3NW8A 3OWEB 1XODA 3W2DA 2CJOA 3H1UA 4KHOA 1MFWA 1G6JA 1UBIA 4QJ5B 4F7UP 4WH4A 1HQRD 3C19A 1RLFA 4WJOA 1V5UA 1N60A 2KQSA 1FRDA 3AEGB 2LASA 4RFBA 1WMHA 2D3BA 1VR9A 2YRYA 3CSTA 3JSVA 3ZNGC 4ANVA 2AL3A 1VLBA 1QKZA 4MJSB 4JWUC 1EAZA 2XQNM 4ANUA 4US8A 1YIWA 1WRIA 3ZNID 5I2MA 2ZW1A 3FILB 5JH5C 1ZC3B 4WWOA 1HZ5A 1MJDA 2D5GA 1M7RA 3ZJTA 4HPPA 3R7QA 2ZPNA 1F1HA 1PDXA 2WXRA 1WWTA 4OW0A 1XX0A 1U29A 3T06A 3ZDMC 1EO6A 4XZ4A 1KH0A 3DWMA 2CAYA 2PLPA 1JMLA 2HTME 2WXIA 2RPQA 2DX5B 2ZW0A 1V49A 2O6VB 2FJLA 3UINB 2IGDA 3W1SA 1WI0A 3CXBB 2KLCA 4HK2A 1AN8A 3ZGZA 2JZ3B 1AARA 3A98B 1UNSA 1OEYJ 2I1JA 1I4GA 2JRIB 3IG3A 4KGRA 3Q3OC 1IBXB 2WXJA 1UELA 1PFDA 1E8YA 2HE7A 3H8HA 2YLMA 4FJZA 4WAAA 3Q8EA 2P8VA 1PYWD 3L17A 3VTWA 2PEAA 4HCPB 2COFA 4KGTA 3AEAB 3PPAA 1PQSA 2NS5A 4ZRPA 3RULA 1GJZA 1GPXA 4OVZA 3DQVA 1YJJA 3BVZA 3CMMB 3JW0X 1X1FA 3WA0A 5D3DA 2COAA 2FUG1 3GOEA 5C2TB 4NAWB 4BBNF 2LWPA 3UIOB 1FXTB 1TS2A 3OAWA 5EFXA 1FGYA 1ISNA 2DFKA 2BF8B 2MQJA 3Q3JA 4JE3B 1SE9A 3TUOA 4HWIB 1M4VA 5D2MB 3AXCA 5D3XA 2DYMA 2B3AA 2GBJA 3A33B 3AN1A 3J9CA 3KUCB 2KVRA 3ZJVA 2LXCA 2V4LA 4ZRJA 2Q13A 3PZ7A 1GC7A 2ZVOA 3TJPA 1WGRA 4MACA 2UZRA 5C1ZA 2D9WA 5H92C 3I3TB 4RCOA 1WXMA 4K2OA 4MH8A 1E7UA 1Z87A 3RYTA 4PS3A 2YT1A 1QQRA 4F7ZA 2VSZA 4LJOB 1V1OA 3X23A 3DXEA 3V61A 1WZ3A 2MP2B 2KIEA 4LDTD 1KF6B 5FR3A 1NTVA 3SEBA 1FHWA 1KOTA 1I4XA 2D07B 1M94A 4NJ6A 1L0XB 2PW9A 1T0RC 4GDLB 5JZEB 2IO2B 2N9XA 2RSUA 1I35A 4OVUA 4DHJD 1J0GA 1RWSA 4KHBB 2N9EB 1YN5A 5IO9A 2J4XA 4ICVA 3PSCA 3AE3B 1JWAD 1N5XA 2KDBA 3BK2A 2X18A 2OEDA 4NJCA 3DCGA 2ELAA 3FVCA 1JQ4A 2QKLA 1C3TA 4Y94A 2XNAC 3IT4B 1UWMA 1CMXB 4MT7A 2DZMA 1UD7A 1FCCC 5EDSA 2Z0QA 2LEKA 2M1MA 1JWBD 4GPTB 1E6EB 4KHAA 1U5EA 3PVLA 1J7CA 3I63C 2OJRA 2JZPA 2MWNB 2D9ZA 4HSIA 2CU1A 2I1KA 3DBLB 3KH0A 4NAWA 3RNBC 5J3TA 5J2RA 3MHSD 5G55A 2NBVB 2JF5A 2RGNB 4A90A 2DZJA 1XF5L 1VZ7A 3DBHB 2WS3B 2D9VA 2JX5A 1NBFC 5LXHA 1F0ZA 4BZAA 1UZXB 3MJWA 1ACCA 2INNE 3KSYA 3KRWA 2PJHA 2GUMA 3EC8A 4NQKE 2N1WA 2MCNB 4E3CA 5HE0A 1Y5OA 2LGSA 5IA7A 2GBKA 2CODA 4CHJA 2BB6A 4IUMB 4MH0E 3R66C 2EMTA 4HEA1 3LYYA 2MA9B 1ZUD2 2RRFA 2FNJB 1W1GA 5JHGA 3X0WA 1UWXA 4BOSC 1UNRA 1IUEA 3UIPB 4CQNA 3Q8BA 3BY4B 2KDFB 4BVUC 3HHMA 4ZYSA 1WR6E 4GXBA 4LLGM 3HW2B 2K6QA 2W54A 4KX6B 4K2PA 1TS3A 2PKOA 2RGFA 4AJYB 3PEGA 2WU5B 1J7BA 4X57B 3SR6A 3AEEB 2WGSA 2EKIA 1OQRA 3APCA 4HJGE 1C4CA 4XE0A 2O6VA 2Y5PA 2N9KA 4W9HA 3M62B 1FRRA 1D6EC 1V80A 3QCAA 4RNAA 4EJNA 4YWGG 1EGXA 3CIRB 4D2KA 2JVCA 1T3QA 4GDLA 3W5VB 3ODWA 1TKYA 4A6QA 1U5DA 1N63A 3GE8C 4W9DA 1UNQA 1IPGA 5CTRC 3R3MA 4G50A 1GG3A 3R2TA 3GYPA 2QIEB 4RGMA 5C6RA 2NVUI 2D3CA 1ZYIA 2JRHA 2INDC 2KDIA 3PLUA 4MSMB 3U4EG 4WVFB 4XDDA 5EE1A 1WFYA 4FBJB 2FBWB 3NVYA 2KUQA 3B2FA 3H7PA 4F1SA 1XXGA 3VDZA 4HHVA 2WDRB 1V2YA 3FKYA 1DBHA 2WX0A 2QHOA 1L7YA 3T3OA 1EU4A 1GUAB 3KUDB 4P1BC 3ONSA 4II3B 3E56A 3DHGC 2FCNA 4HB3B 3P42A 3QWMA 3PHXB 2R2YA 2G35A 3FM8C 2D10A 3VUYA 3RI7C 2G3QB 1NENB 2KCJA 3DXDA 4MDKE 2K2JA 3VR9B 2KNBA 1T77A 3MP9A 3APFA 4NSWA 2VH2A 1KFYB 2JY6A 4H8SA 2KUPA 2LKOA 4RM8A 2ON8A 2GI9A 2RR9A 4P16A 5IN7A 1FCLA 1KLVA 4XGAB 4NY0A 4Z2NA 1IRSA 4BFRA 1HA5A 2DHJA 4HJKA 4REZA 3VHTC 1KZ7A 2Z59B 4PK1A 2K22A 2FCQA 1LB1A 2MJ3A 3RNAC 4IOYX 1TQZA 4M8NA 3NG0A 5JP4A 3RPFC 2ZCCA 4LNNA 1WJ1A 1E9MA 2DN6A 5JHHA 2KWCA 3IXSA 4ARIA 3W1SC 3RN9C 4EOYA 1Q67A 2AWTA 5BMHA 3P1MA 1WJUA 2E2XA 3TEYA 4CYEA 1K8RB 2KN5A 3SFDB 2FAZA 1SIJA 2E6XA 2KANA 2H88B 1WG7A 5E6OA 2MDXA 3U7ZA 2YS5A 4DWFA 2DX5A 1TGZB 2K00A 3U52E 1E5WA 3NY5A 3HRDD 1V61A 5AUIA 4K17A 2WXFA 3CF6E 1TZOA 3Q3FA 3TW1A 2KT7A 2JXTA 2MBEA 4A6HA 1L6VA 2KD0A 1CZPA 3A9JB 2M0XA 1K51A 1P7EA 5M4YB 2KO3A 5BO4B 2DHIA 3BK1A 1SJED 5IRSA 2BGFA 3VQIA 3A9KB 2OQBA 5AZHA 1WMHB 4L1RA 3MFGA 3O96A 2CRFA 4XWXA 1L4ZB 1CQVA 2J52A 1WGQA 2WP9B 4GGQA 2LMCA 1B1ZA 3I57A 5D3VA 4DBGA 4BBNC 5LNK1 2DX1A 2IYBA 2PPHA 5BYQA 3NS1A 1KLUD 2KDEB 1E0ZA 4RGNA 3V3XA 1ZXHA 3LJUX 3N20C 3W5UB 3K9PB 2Z0EB 1DYQA 1V97A 5C79A 5DHFB 2GRIA 4KZ0A 3RUIB 2UVMA 2Z4DA 1WH3A 1YOVB 4Q2JA 1DDWA 1LO5D 5DCNA 3ZIMA 5BMIA 2PMVA 4RF1A 2IBIB 5C5BA 5D3IB 4HAUB 1WX7A 3DPDA 1W1DA 4KGSA 4JL9A 2K8CA 3HM3A 3KW5B 2K49A 2FCSA 4JWSC 1PFJA 4TUUA 4C7YA 1WSPA 4RF0A 2V3NA 4HAZB 2UZSA 2OTXA 3BYYB 3WAMA 2RLOA 4D6WA 1P3RA 4LCDE 2NBUA 4I6NB 2LG1A 1N61A 1ZM0A 4RM9A 1WE7A 4P1CC 4B6WA 1NU2A 4MK0A 5H8YE 1E7VA 4HRSA 1C78A 3GZNI 4MM3B 1TT5B 4IOIE 3N9YC 2PZ1A 3M95A 5KQ4A 2W2XD 4DDGD 3ML9A 1I4HA 2FIFA 2HDEA 2L0TA 2D2QA 2AX5A 3ZDTA 4N59A 2JXXA 2OOBB 4KVGB 1OFFA 5J18A 1R4MI 2KJRA 2RSGA 2N7EA 2WHIA 1YN3A 3RNGC 1WM3A 3PSEB 4M0WA 2Y8FA 3M1IB 1SE3A 2JWZA 3NZUA 3VUXA 4CHMA 1EU3A 3MC9A 2RDGA 3AE7B 4ZHOA 2K25A 4N58A 1WGHA 1Y8RC 1YNTE 5IAAC 4NZLB 4LNKA 1WJ6A 2MBHA 3OLMD 2ROVA 1J8CA 3AEFB 3PREA 1D5ZC 3PS6A 4FJVB 3ETRA 2H7EA 3R8BA 4RGTA 1QT9A 1E8WA 3MPXA 4BBKA 4PNKA 2O6VD 3MDBC 1UBQA 2K0PA 3DVGY 4GLSC 4Z2MB 2COCA 2R2QA 2DKPA 3OJ3A 1HTQA 1VRAB 2R61A 3CWIA 2DZKA 1QF6A 1TS4A 3WIMA 4DHZE 1DGJA 3EFUA 4M01A 5C3JB 2V76A 2CS4A 5HE3A 5AUKA 1PUTA 4GMXB 1FXIA 3AE2B 1FEHA 4DXGA 3LDZE 3V6CB 1NVID 3UF8A 3HQCA 2G45B 2B76B 2W82A 3Q14C 5KCVA 2ZCBA 4S17A 2Y5BB 4IM2A 3AE8B 1ZXIA 1ZOYB 1DYNA 2WNMA 4IWOA 1U5FA 2REXA 3N30A 2JZZA 2WXOA 3A1QA 2KFKB 2GCLA 1WGKA 2LULA 2LGYA 3IBEA 2BS4B 2NR2A 1TKEA 1V5OA 2IY0B 2PIAA 2RMMA 4TQ0A 3LB8C 2XEWA 1XQQA 3URYA 5GXGB 4ZYNA 1ZDVA 1OGWA 1SF0A 4BKGA 2L3ZA 1XLOA 2WLBA 4ANXA 4K3CA 3FSSA 3RT3B 2Z0DB 3RCZA 4EZLA 2M14A 1V8CA 4KKJA 1BMLC 5IKCM 2BYFA 2M19A 4KDIC 4W9JA 2K3UA 2BWFA 2MHJA 1UPRA 1OEYA 2K5PA 1OQNA 3ZYYX 2QC8A 1M7EA 1WXQA 3TMPB 3BVGA 1V6EA 3NHEB 4HKQA 2Z0PA 4FXCA 4N9F4 4JPSA 1QLBB 4LNFA 1FFUA 2LFIA 2ZNVB 1MK9B 1SBBB 3QAQA 2DHZA 3WALA 4E74A 4OZAA 4C4VB 4MELA 4B9KA 4HLEA 4OZBA 2BBCA 3TSSA 2WXHA 5LLIA 3AMZA 2LD9A 4DHJB 5JXVA 4WQMA 2L7RA 4XDCA 4HPMB 2N0SB 2G4DB 3RNCC 3AU5A 4TQ1A 1FFVA 2N9LA 3HVZA 1MPHA 1SGHA 1TS5A 1UEFA 1DDMA 2ZNVC 5C23A 3DWGC 2PVGC 2NBWB 1V5PA 1FAOA 3U7DA 2YT0A 1IP9A 5EE3A 3NWDA 2DA0A 3TEZA 1WGYA 5BMGA 2MJDA 2M4NA 2QCZA 4HDOA 2H7DA 1R4MB 2KMCA 4PT5A 1DDVA 3SUZA 2XK5A 1CJEA 1TKGA 4WJQA 3LXFA 4C80A 5LXIB 4HAXB 5I2SA 2BS2B 1BTNA 2WXQA 1OQYA 2N23A 2XBBC 3NS8A 4W9LA 4DQOC 3NVWA 1VCBA 5KQ1A 5FI0A 3RZWC 4LNOA 2IJ0A 2V4IB 2IZVB 1P7FA 3ZJUA 1EF5A 1T5XD 3DVNV 2JU6X 2Y7BA 4A8XC 2W9NA 4WSFA 3JYUA 1XO3A 4RGOS 4HROA 1AW7A 2VZKD 2QJLA 2MBOA 1AQCA 1STEA 5IP4D 4A3PA 3RNFC 4YTPB 3U2SC 2DHKA 2K9XA 2JYEA 5J3YA 3IT6B 2QMTA 4PS8A 2IFSA 2KYWA 1EWCA 2EELA 5D6JB 2QILA 1BT0A 2Y3AA 5BYSA 1PMSA 3UI3A 1P5TA 1I4RA 2E3TA 1E10A 2LVQA 3PTFC 1UGMA 4NAMA 5L81A 3ML4A 1C79A 3D8DA 3A4RA 3OG5A 2K8HA 5TSSA 5FI1A 4JQWC 1X86A 3ZVVA 2IO3B 3L54A 1QC6A 1W1HA 2KAJA 3U12A 2I2YA 4C00A 2DZIA 3PZDA 1KRHA 1K53A 2N7JA 3B1LX 1I7HA 2NCNA 1XCGA 3VTUA 2IGHA 2XK5B 2C7MB 5FKAC 1MIXA 3V6EB 2KTRB 3O13A 1K52A 4BOZB 3KWVA 3RD2A 3A9KA 1E8ZA 5T8IA 2WQYB 1TYGB 4K3BA 1WJ4A 4XX5A 2CR5A 2O2VB 2KJ6A 5BYRA 2YF0A 2R2OA 3V62A 4EZJA 2DYOA 3RFZB 1J19A 2ELBA 2AQ3B 3ZTCA 3TVVA 4RMAA 3ZXRA 3KYDD 4OT1A 4ACFA 3QX1A 2KACA 3QHTA 2N9PC 4B0EA 3GZNB 4KSKC 3OHMB 4PS7A 1VZ6A 4WIPA 2UWQA 1L2NA 1ET9A 4I6LB 2NBVA 3HIEA 5HKHA 2J0KA 3WCQA 1FGZA 4QJ3B 3V60A 1X1GA 4DXFA 3VXWA 4GU2A 4TSSA 2JPHA 4WWNA 2NMBA 3B77A 1JALA 2R0DA 1BTKA 1K5DB 1OY2A 2Y8GA 3KYCD 4ZHPA 1YQBA 1UUPA 3KQ4A 1QOBA 2UU7A 3VOQA 2L05A 3P4PB 1T0YA 3ZXVA 4JLCA 1TTNA 1MG4A 2Z59A 3KY9A 2NPTB 2LYDA 1XKEA 2KR0A 1ROEA 5G2NA 3ML8A 1XD3B 1RJ2A 2SEBD 4HXDA 2HJ1A 4W9FA 1DOYA 4AOFA 5EE9A 1MAIA 1HZ6A 2DYBA 1FD6A 2KIGA 3AB5A 1WX8A 3DHIC 1L5PA 2KFKA 2BYVE 2L1AA 2K8EA 1E8XA 5I4DA 4LK0M 2AQ1B 3P4RB 1B9RA 1TJEA 1WZ0A 2AL6A 1IYFA 3ULCA 3N1XC 2MBBB 4HAVB 1I4PA 1WM2A 2INPE 1ZDXA 2DKQA 3ULBA 1JWSD 1GOZA 2KZRA 1X1MA 2CY4A 1F2RI 1ZP0B 4WQOB 2DLBA 4IC7B 3HM6X 5CHVC 2MFQA 4C0AA 1MK7B 4KSLC 1GB1A 2DBYA 2L83A 2M17A 2MKRA 2BTEA 1NEKB 5FK9C 1BAKA 4QJ4B 4O1NA 2ASQA 2ZVNA 1A5RA 1C76A 2DAJA 3GYOA 4AP4C 1TY2A 3S2AA 4GOUA 2ONQA 5DPSA 4DDID 2LRWA 2Z8LA 2AYOB 2KGXB 1NYQA 3AEBB 4PYZA 4TKNA 1HE8A 3AECB 1TY0A 4OZCA 3VIAA 4HPLB 2X8XX 4L1BA 5KHQA 4HAWB 1EF1A 2ZPYA 1QILA 2M38A 2GBNA 1V1PB 5D3WA 4RH6A 2NTTA 2INCC 1U27A 3SFEB 3D32A 3FC4A 2BCJA 2KC2A 1YX5B 3VUWA 1MIZB 2WXLA 1BXTA 4GOCA 2O2VA 2IYDB 4YSXB 4MM3A 2IDYA 2LHEA 2JP2A 1EVHA 3PT2B 2QKMA 1T0QC 1Q1OA 2MX2A 3K9OB 5AEKB 2GCJA 3V5WA 3BWUD 3T3NA 2LGDA 3EFCA 2YEPB 3HSAA 1RFKA 2CHZA 4N6EB 1XD4A 4CHKA 1P1AA 1R4NI 3QK0A 4KZCA 1V86A 2QEJC 3QQ8B 4L2YA 4L6EA 4QAYA 1WXVA 2BPSA 3NRZA 4MEMA 5D7GA 2FE8A 1KJTA 1C4PA 1F2RC 5C16A 4A20A 1QOFA 4B0MA 2DYNA 3DBRI 2YS3A 1YD8U 1P0RA 4J6IA 1VZ8A 3VH4B 5DI9B 3WYFB 2KQ7A 4W9EA 2KQ4X 2J7QB 4NQLB 2DAFA 2IPKD 1QOGA 2GS0A 2LXAA 4A9AA 2MJEA 1JWMD 4FHKA 2Z14A 3P6AA 3VVWB 3A4SC 2RDHA 3RMKC 5G5HA 4YTMB 1SIFA 2TSSA 1AYFA 2ACZB 4EFOA 3D8FA 4XWWA 2WYQA 3BIID 2KX3A 3AE9B 4DX90 2L2IA 4MT5A 1YX6B 2KFJA 3ODOA 2W3RA 3AH7A 2J53A 1F77A 2KDMA 3B9JA 3TBLD 3HIZA 4A6FB 3QBVB 2X38A 1J0WA 5CLQB 2ZJDA 1U2BA 1RM6C 3ALBA 3MJ5A 1D5MC 1K50A 4F8CB 3PVWA 4MSQB 1KTKA 1N6ZA 5E6NA 1UH6A 4NNJB 3G9WA 5HG2A 4ITKA 1UPQA 4EUTA 1FNVA 3ZUNA 4YTNB 3SDLC 4AS1A 2WXMA 2VZKB 3ZKJC 2K1FA 4BKSA 1FNUA 4HCNB 2G1EA 2W55A 2RPVA 2KJHB 2KKCA 2V3SA 3L08A 2LGXA 1JRUA 3V05A 2WDVB 1L0VB 4LNIA 1OMWA 4GDKA 5CHFA 1IGDA 5DPWA 4K7WA 3TFMA 1Z5SB 3PZ8A 3MHZA 4GNKB 2D9XA 4KIKB 1L4DB 4W9CA 4TV3A 1N5WA 2K2UA 2CU3A 2L76A 2V9HA 2MH7A 3Q6BA 1QZEA 1WGGA 2A4ZA 3DBSA 4E71A 5CX3A 1CK1A 1Y56A 2N1VA 1Q10A 2KMMA 3Q2AC 4B6HA 2P0DA 1MKEA 2JQRB 3NVVA 3VRBB 2BW2A 2I38A 1YJ1A 4LJPB 4ZOHC 3VRAB 1F52A 2IO0B 1YQ4B 2G9HD 2DLWA 1T0SC 3BZDB 3DVGX 5J17A 1TJ6A 2WX1A 2GBRA 3FAHA 2KTFA 4NPNA 2D3GA 1WGDA 3B2GA 4MGKE 4HB2B 3CIKA 2KN4A 1MHHE 4OVVA 2ZZPB 4DX8A 4US9A 4G0NB 3L16A 3P7ZA 2LUMA 1P3QU 4JIOU 5LONB 1V81A 4HATB 2K8BA 1WYGA 2JUOA 2KVZA 1ET6A 4OHJA 1TZ1A 2LOZA 2Q5WD 1RAXA 4TMAB 1SXTA 4MJSA 2BYTA 3TO1A 4C7ZA 4H2AA 4TYZA 2WWZA 3P4SB 1XEEA 3A1QB 4UDUC 4IAPA 5JLJB 4GSWA 3WAOA 4KAXB 2H89B 4WWPA 4FA6A 4L23A 4EE2A 2WXKA 5AZGA 5CLLB 4JGHB 1JCKB 1SE2A 1H4RA 2W2XC 3MC0B 3AE6B 5KHOA 4BKTA 3H7PB 3NOBA 4G3XB 5LOPB 4USAA 3ZQ4A 1WGUA 3HVDA 3QWZB 4YT0B 3FILA 3GB1A 3ZO5B 1Y19B 5D27A 2CHXA 4KV2A 3NUHB 2MP2A 1N62A 2LZ6A 3WANA 1U4AA 2Y5CA 2FUHB 3NSUA 3Q8AA 4K7SA 1YMHE 4HVBA 3I5JC 2WXGA 4FLHA 3UZTA 2CHWA 2R09A 3QIJA 2ICIA 1SEBD 1KZGA 4GN1A 4GIVA 4LTUA 2DYQA 4EKUA 1ZKHA 3UGBB 2YEPF 4M8MA 1C9FA 3PLVA 2NPTA 3H7SA 4IFSA 2PE9A 3T9LA 2M8SA 2EJ8A 2BQQA 2JYTA 1F9JA 2NTSA 5DPTA 4WJ7A 2WDQB 2KXJA 2LOXA 4ASWC 1JROA 2KLGA 2K6DB 3AV8A 4HDQA 2WXNA 1P6SA 3DOWA 1XCQL 4YSZB 4K7UA 4ZRQA 4DXAB 2VRRB 1HXYD 3PP2A 2AEHA 3OJ4B 2PVOD 3W1YA 3PG7A 1H10A 1P9DU 3P63A 1SE4A 1FMAD 3GE3C 1NDDA 3KRXA 2Z0OA 1FIQA 1D4BA 3L13A 3QJZA 1YQ3B 2C60A 2GBMA 3NWAA 3IFWB 4GZUA 2C9WB 3QARA 2P0FA 1V88A 1XLQA 1MG8A 3C0RB 1KLGD 5J3QA 1MHXA 4IM3A 3ABVB 2KK8A 3F5RA 3IVFA 2W2WA 1L0YB 4DK5A 3GP7A 3EHVA 3TIXA 5TR5A 1C1YB 5HE2A 2CKHB 4NJ7A 4WAFA 3ZRCA 5CHWA 2YSZA 5JHAA 1FHOA 2BVCA 4LDTB 2MRPA 3DBLI 4ARCA 1PGBA 4EEWA 2J42A 3VTVA 4XWTA 3PRMB 1SHCA 1WXSA 2LGIA 4OSNA 2BKFA 3WAPA 3Q8FA 2P0HA 4IDIA 1U5GA 3A8PA 2N4FA 3GS2A 3B08A 4HKZE 3BVMA 2C7NB 3PO0A 1MPEA 1AWEA 1BUIC 3AJ4A 3TCAA 4B95A 2ROZB 2L1CA 4BAXA 3M3JA 1FO4A 3KWLA 3NVZA 1FHXA 1VDVA 2JT4B 5G5GA 2D3AA 3ENEA 2WU2B 1WIAA 2L32A 4WWMA 3N1ZC 2YS1A 1E90A 1WY8A 1ZPSA 3RNEC 1C77A 1FM0D 3HUIA 3P2BA 5D94A 2L52A 5MPOA 3DBRB 1NI3A 1OTRB 2N7DA 1V5TA 3JVZX 5HHDG 4M00A 4HB4B 2V0GA 4K1RB 2J59M 3N32A 1LW3A 3BYTB 4HB0B 3VR8B 2HD5B 2WXPA 3Q3MC 1S3SG 2DWQA 2M0AA 2OHFA 1LQBA 3ECIA 2A5UA 4AUQC 1LGRA 4GB9A 2YT2A 1WRDB 2Z13A 2L00B 2CJNA 2KWDA 2C7HA 3SV1A 1TBEA 3VFKA 3NZ3A 1S1QB 3BINA 4AJWA 3B0AA 3RCPA 3E9SA 2LVPA 4XYCA 1TXDA 3ZLZA 5GMVA 1C4AA 1X11A 3PRPB 4IM0A 2D11A 3A9JA 4IW0A 1WJMA 5HI1A 1PGAA 5HFYA 3OANA 2QDFA 1GNUA 1VD2A 1LFDA 3F0WA 3VAWA 5GOWB 1K5GB 3KUZA 2LJIA 1PGXA 2ZKMX 5DPRA 1MI0A 3TEXA 2SAKA 1FB8A 2ADZA 1FPYA 3AE4B 4AWJA 4G11A 3PRZA 4FULA 2KHWB 3SD5A 2MWSB 3H6NA 1I2HA 1JW9D 3CSFA 4KDLB 3PGEA 1WXAA 2C5LC 2M56B 5DIFB 3DBHI 1ZSQA 4PQ0A 1IBXA 1SB3C 1I7AA 2G4SA 1JRPA 2WDTB 1YJIA 1ZVRA 2W3SA 3W9CB 2BS3B 4WJPA 1FOEA 2V3PA 2BYEA 2RNRB 3FEHA 1Q5WB 4YL8A 2KOXA 3DXCA 4ANWA 2OJWA 5L83A 1D5XC 3IAM1 2IO1B 4K81A 1WE6A 2XN9C 2LRUA 3QC8B 4C4VA 2I5CA 4ICUA 1PLSA 4YONA 3UQAA 2IY1B 5E6JA 4FN2A 1V89A 2V1YA 3SO6A 2FJUB 2BWES 4R3DA 2LUEA 2EKEC 3PVUA 3M63B 2VRWB 3EECA 1KI1B 1E7PB 4IG7B 3DHHC 1HTOA 1ENFA 3N1YC 2KC1A 4M0WB 4FHJA 2L8JA 2EC1A 1V5MA 2GMIC 1N3HA 2HTHA 3TEWA 2D9YA 1KM7A 4KIKA 1SJHD 1NTYA 1D3ZA 4KKIA 2KTRA 1H8CA 4GMVA 4EMOA 3U8ZA 2L0FA 1WJNA 3MC8A 3U30A 1LM8B 1P98A 2IGGA 3ZTDA 1FNWA 4A6FA 4XC2A 4FADA 3ZNZB 1UGJA 3MTNB 3Q3NC 1XT9B 2NZ8B 5C5BB 3AU4A 4D0NB 2KX0A 4PYUA 3JSVB 5HE1A 1Q0WB 4F7HA 1QQGA 4W9GA 2PTLA 4A3OA 2GOWA 1AWDA 2FCMA 1JWUD 2FIDA 4P7IA 2MBQA 3ODXA 1J7AA 2DTCA 3Q69A 3AE5B 5DH9B 4YXDB 2J0JA 4HAYB 2MEKA 4DHZB 1GC6A 5DHAB 2D4QA 3IHPC 1EUVB 2BT6A 2N0YA 4IWQA 3EGRA 3DVNU 3UQBA 1UF0A 3DDCB 4MY6A 1MVKA 3QA8A 2MW5A 3SU8X 2I5FA 3AULA 3P4QB 1HEZE 4URKA 2YVCA 1R7SA 4ZRIA 1FXAA 3A8QA 1I4QA 2VKIA 5AZFA 3D8EA 5JHBA 3NZSA 3KVFB 2JWUA 3Q8CA 4J3OD 1QOAA 1GB4A 3ZRFA 3R2IA 1VJKA 4BKSD 1ZW7A 2LHDA 4IKGA 4WURA 1DROA 3T8MA 2QSDA 1RRBA 3ZNHB 5FR6A 1EWYC 1XR0B 1LXDA 4DBBA 4YSYB 2RVBB 3HK0A 2KMAA 2KWUB 3SHQA 1WYWB 1GAQB 1X05A 2ZEQA
chains in the Genus database with same CATH topology
1GUAB 2HJ8A 3KUDB 2DLWA 3ONSA 4II3B 2HTHB 2FCNA 3DVGX 5J17A 2MBOA 1TJ6A 1AQCA 4HB3B 4EZKA 3AI5A 2WX1A 3QWMA 4A3PA 3PHXB 3N3KB 2GBRA 2DHKA 2CY5A 2G35A 3FM8C 2KTFA 4NPNA 2D3GA 2D10A 3VUYA 1WGDA 4MGIE 5J3YA 4MGKE 2G3QB 2KWVB 2KCJA 3DXDA 4HB2B 3CIKA 4MDKE 2IFSA 2K2JA 4PS8A 2KNBA 3APDA 4OVVA 2MLBA 2ZZPB 4DX8A 5D6JB 3APFA 1RRPB 4NSWA 3P7ZA 3L16A 4G0NB 1P3QU 2JY6A 5LONB 1BT0A 4H8SA 2KUPA 2LJ5A 4JIOU 2LKOA 4RM8A 3R7RA 1PMSA 1UNPA 1V81A 4HATB 2K8BA 2JUOA 1P5TA 3LJ3A 1TZ1A 2LOZA 2LVQA 1RAXA 2RR9A 3PTFC 1WVHA 4MJSA 4W9IA 3SNHA 1UGMA 2MSED 1KLVA 3TO1A 3KZ1A 3PHWB 4NY0A 2RD0A 4TYZA 4Z2NA 2WWZA 4A6KA 1IRSA 3BJIA 5L81A 3ML4A 2PE6B 3A1QB 3D8DA 4BFRA 1RFAA 3A4RA 2DHJA 4WJNA 4HJKA 3RZFA 1IYFA 3VHTC 1KZ7A 2K8HA 2Z59B 3H9DA 1B55A 2FCQA 4IAPA 1WI1A 5JLJB 5FI1A 1LB1A 4JQWC 4GSWA 3WAOA 1X86A 4IOYX 4KAXB 1WR1A 2ZEQA 1TQZA 3ZVRA 1WF9A 4KZCA 4GDKB 4M8NA 4WWPA 4FA6A 1ZC4B 3TL5A 5HKHA 2IO3B 5JP4A 4ZDVA 2ZCCA 4W9KA 5AZGA 5CLLB 4JGHB 3L54A 1H4RA 2W2XC 1QC6A 1W1HA 2UYZB 5KHOA 4BKTA 1WJ1A 3H7PB 3NOBA 4G3XB 2KWCA 2DN6A 5JHHA 5LOPB 1WGUA 2DZIA 4IWPA 3QWZB 4XX5A 3PZDA 3ZO5B 4FJYA 4II2B 5L95C 4I6PA 3W1SC 3VH3B 1Y19B 5D27A 1Z2MA 3B1LX 2CHXA 2NCNA 1XCGA 4KV2A 4EOYA 3VTUA 2MP2A 2XK5B 3ZW3A 1Q67A 2C7MB 2J0MA 2AWTA 2LZ6A 3VH4B 2LI5A 1U4AA 3WANA 1WJUA 2E2XA 3NSUA 2FUHB 1MIXA 4K7SA 4CO7A 3V6EB 4HVBA 1WX9A 2KTRB 4CYEA 5D3YA 3UZTA 1K8RB 2CHWA 2KN5A 4FLHA 4F7GA 2FAZA 2BKRB 4BOZB 3QIJA 2R09A 3RD2A 2KANA 1KZGA 4GN1A 3A9KA 4GIVA 1WG7A 2DYQA 4EKUA 1E8ZA 1NI2A 4ZRKA 1ZKHA 5E6OA 3UGBB 2LVOA 2MDXA 4M8MA 2YS5A 2DENB 3O65B 5E6PA 4DWFA 3PLVA 3N7CA 2DX5A 2NPTA 1BWNA 1TGZB 3PV1A 3L0WB 2EMSA 2RUKB 2GJYA 3SYXA 2K00A 3H7SA 4IFSA 1WJ4A 1E5WA 2PE9A 2CR5A 2M8SA 2KJ6A 2O2VB 2YF0A 2EJ8A 4A5KA 3L10B 3T9LA 2R2OA 3NY5A 1V61A 3V62A 1F9JA 4K17A 5DPTA 4WJ7A 4EZJA 3CF6E 2DYOA 2KXJA 3Q3FA 3TW1A 1ZGUB 2K39A 1J19A 4MGZE 2ELBA 3ZTCA 1I42A 2LOXA 2MBEA 3TVVA 4MGYE 4RMAA 4A6HA 1V9JA 2KD0A 4ASWC 1XODA 2KLGA 3A9JB 2K6DB 2M0XA 3H1UA 3KYDD 4HDQA 4KHOA 1P6SA 3DOWA 4K7UA 2KO3A 4DXAB 1UBIA 2VRRB 5BO4B 2DHIA 4F7UP 1G6JA 3QX1A 3PP2A 1RLFA 2AEHA 3QHTA 4WJOA 2N9PC 2BGFA 1V5UA 2KQSA 3OJ4B 3VQIA 3A9KB 3W1YA 2OQBA 3PG7A 4KSKC 1H10A 4PS7A 2LASA 1P9DU 2UWQA 5AZHA 1L2NA 1WMHB 1WMHA 2YRYA 4I6LB 3O96A 3CSTA 1NDDA 3JSVA 3KRXA 2CRFA 2J0KA 2Z0OA 4XWXA 3ZNGC 4ANVA 1FGZA 1WGQA 2AL3A 4GGQA 4MJSB 3V60A 1EAZA 2XQNM 4ANUA 3L13A 3QJZA 1X1GA 1YIWA 2C60A 3VXWA 4GU2A 2JPHA 5D3VA 4WWNA 2NMBA 3ZNID 2GBMA 4BBNC 4DBGA 2DX1A 3IFWB 2IYBA 2R0DA 4GZUA 1BTKA 1K5DB 1ZC3B 2P0FA 2C9WB 3QARA 2PPHA 1M7RA 4WWOA 5JH5C 3R7QA 1V88A 2ZPNA 1OY2A 2Y8GA 1MG8A 3C0RB 1YQBA 5J3QA 3KYCD 4IM3A 2KDEB 2KK8A 1XX0A 3F5RA 3IVFA 2W2WA 1U29A 3LJUX 3T06A 3VOQA 2L05A 4DK5A 1T0YA 1EO6A 3ZDMC 3K9PB 3EHVA 2Z0EB 4JLCA 4XZ4A 1TTNA 3TIXA 2CAYA 3KY9A 2RPQA 5C79A 2LYDA 2DX5B 2NPTB 5DHFB 5TR5A 4KZ0A 1XKEA 1C1YB 3RUIB 5HE2A 5G2NA 3ML8A 2UVMA 2CKHB 1WH3A 1RJ2A 1V49A 1XD3B 4HXDA 4NJ7A 5CHWA 3ZRCA 2O6VB 2YSZA 5JHAA 1DDWA 2FJLA 1FHOA 4LDTB 4W9FA 2MRPA 3UINB 4AOFA 5DCNA 3ZIMA 1MAIA 3W1SA 2DYBA 1WI0A 3CXBB 3DBLI 2KLCA 2IBIB 5C5BA 4HK2A 4HAUB 1WX7A 3DPDA 4EEWA 1W1DA 2JZ3B 1AARA 3A98B 4JL9A 3VTVA 2K8CA 1WX8A 3PRMB 1SHCA 1WXSA 1OEYJ 3HM3A 3KW5B 2I1JA 2FCSA 2JRIB 3IG3A 2BKFA 3WAPA 2KFKA 2P0HA 1PFJA 2BYVE 4TUUA 1U5GA 3A8PA 2N4FA 3B08A 1E8XA 1UELA 1E8YA 2HE7A 2C7NB 4HAZB 1AWEA 2UZSA 3AJ4A 2OTXA 3TCAA 2YLMA 4FJZA 4WAAA 2ROZB 3WAMA 2RLOA 4B95A 2L1CA 1WZ0A 1P3RA 2AL6A 3ULCA 2P8VA 2MBBB 3M3JA 4HAVB 4LCDE 1WM2A 2NBUA 4I6NB 2LG1A 3L17A 1ZM0A 2DKQA 3ULBA 3VTWA 2PEAA 1FHXA 4HCPB 2COFA 4RM9A 1WE7A 4B6WA 1NU2A 2IO0B 2JT4B 4MK0A 2KZRA 1X1MA 2CY4A 1PQSA 2NS5A 3ENEA 3PPAA 1E7VA 1WIAA 4WQOB 3RULA 4IC7B 1GJZA 3HM6X 5CHVC 3GZNI 2MFQA 3DQVA 2YS1A 4C0AA 1E90A 1WY8A 1MK7B 4KSLC 2PZ1A 3M95A 2M17A 3CMMB 5KQ4A 2MKRA 3JW0X 3VDZA 2W2XD 1X1FA 3WA0A 1BAKA 4DDGD 3ML9A 3P2BA 2COAA 2FIFA 5D94A 2L0TA 2D2QA 1OTRB 2ASQA 2N7DA 1V5TA 2ZVNA 3GOEA 3JVZX 4HB4B 3GYOA 3ZDTA 2DAJA 4AP4C 4K1RB 2J59M 3N32A 4NAWB 4BBNF 2JXXA 2LWPA 2OOBB 1LW3A 4KVGB 3S2AA 4HB0B 1FXTB 3UIOB 5J18A 1R4MI 2HD5B 2KJRA 2RSGA 2N7EA 3OAWA 1S3SG 5EFXA 5DPSA 4DDID 2LRWA 1FGYA 1ISNA 2DFKA 1LQBA 2AYOB 1WM3A 2KGXB 3ECIA 2BF8B 2A5UA 4AUQC 2MQJA 4GB9A 3PSEB 3Q3JA 1SE9A 2Y8FA 4PYZA 4TKNA 1HE8A 4HWIB 3M1IB 1WRDB 2JWZA 3NZUA 2L00B 5D2MB 3VIAA 2C7HA 3AXCA 5D3XA 3SV1A 4CHMA 4HPLB 3VUXA 1TBEA 5KHQA 4HAWB 1EF1A 3VFKA 1S1QB 2DYMA 2B3AA 3BINA 2K25A 2GBJA 4AJWA 2ZPYA 3A33B 1WGHA 1Y8RC 3B0AA 2M38A 2GBNA 3RCPA 2KVRA 2LVPA 3KUCB 5IAAC 1TXDA 2LXCA 2V4LA 2W9NA 3ZLZA 4ZRJA 5D3WA 5GMVA 2Q13A 1GC7A 3JYUA 1X11A 2ZVOA 1U27A 3PRPB 4IM0A 2D11A 3TJPA 1WGRA 3A9JA 2UZRA 1WJ6A 4IW0A 3D32A 1WJMA 5C1ZA 2D9WA 2MBHA 3OLMD 3I3TB 2ROVA 2BCJA 1WXMA 4K2OA 1J8CA 2KC2A 3PREA 3OANA 1E7UA 1GNUA 1YX5B 1VD2A 1Z87A 1LFDA 3RYTA 3F0WA 4PS3A 2YT1A 3VAWA 1MIZB 5GOWB 3VUWA 1K5GB 4GDKA 2VSZA 4LJOB 3KUZA 3PS6A 4F7ZA 4FJVB 2O2VA 4GOCA 3X23A 3DXEA 2IYDB 5DPRA 2H7EA 4MM3A 3V61A 2JP2A 1EVHA 3PT2B 1WZ3A 1E8WA 1WYWB 2QKMA 3MPXA 4BBKA 4PNKA 2MP2B 2O6VD 1FB8A 1Q1OA 3MDBC 2ADZA 2GCJA 2MX2A 3K9OB 4LDTD 1NTVA 5AEKB 3V5WA 1UBQA 3DVGY 4G11A 2LGDA 4Z2MB 4AWJA 3PRZA 4FULA 1FHWA 2COCA 2D07B 2KHWB 1M94A 2R2QA 2MWSB 2DKPA 3H6NA 3OJ3A 4NJ6A 1I2HA 3SD5A 2CHZA 3CSFA 1XD4A 4KDLB 4CHKA 1P1AA 3PGEA 4GDLB 1R4NI 1WXAA 2C5LC 1V86A 2IO2B 2N9XA 2RSUA 2DZKA 3QQ8B 3QK0A 4OVUA 4L6EA 4DHJD 3WIMA 4DHZE 1J0GA 1I35A 1A5RA 5DIFB 3DBHI 1ZSQA 4PQ0A 3EFUA 4KHBB 2N9EB 1WXVA 2BPSA 2V76A 3PSCA 4ICVA 1I7AA 2CS4A 2G4SA 2KDBA 2X18A 5HE3A 4MEMA 4GMXB 5D7GA 3DCGA 2ELAA 2WDTB 1ZVRA 2QKLA 1C3TA 1KJTA 3LDZE 3V6CB 5C16A 4WJPA 4Y94A 4A20A 1FOEA 3UF8A 2BYEA 2DYNA 3HQCA 2G45B 3DBRI 2RNRB 1CMXB 3FEHA 4MT7A 2YS3A 5KCVA 1Q5WB 1UD7A 1YD8U 2DZMA 1P0RA 2ZCBA 5EDSA 4YL8A 4J6IA 2Z0QA 2KOXA 3ZVVA 2Y5BB 5JZEB 2M1MA 3DXCA 4GPTB 4IM2A 4ANWA 1DYNA 4KHAA 5DI9B 3WYFB 1U5EA 2IO1B 4K81A 1WE6A 2KQ7A 3PVLA 2LRUA 3QC8B 4W9EA 4IWOA 1U5FA 2REXA 2J7QB 3N30A 4NQLB 2OJRA 2I5CA 2DAFA 2MWNB 4ICUA 2JZZA 2GS0A 1PLSA 3A1QA 2LXAA 4YONA 3UQAA 2IY1B 2KFKB 2D9ZA 2CU1A 2GCLA 2I1KA 3KH0A 2LULA 4FHKA 2LGYA 4NAWA 3IBEA 4FN2A 1V89A 5J3TA 2V1YA 3P6AA 3SO6A 3MHSD 3SHQA 5J2RA 2BWES 2NR2A 1V5OA 2IY0B 2EKEC 3PVUA 2LUEA 5G55A 3VVWB 4TQ0A 3M63B 2NBVB 2VRWB 1XQQA 2JF5A 2XEWA 3A4SC 2RGNB 2DZJA 1SIFA 4ZYNA 3EECA 1OGWA 4BKGA 1KI1B 2D9VA 4IG7B 1NBFC 5LXHA 2L3ZA 2KC1A 4M0WB 4FHJA 4EFOA 2L8JA 3D8FA 1UZXB 4ANXA 2EC1A 1V5MA 3FSSA 2GMIC 3MJWA 3RT3B 2Z0DB 2WYQA 1N3HA 2HTHA 3RCZA 4EZLA 2M14A 2BYFA 2KX3A 4KDIC 2D9YA 1KM7A 4KIKA 3KSYA 4DX90 1NTYA 1D3ZA 4W9JA 3KRWA 2L2IA 2KTRA 2PJHA 1H8CA 4GMVA 1YX6B 3EC8A 4EMOA 2BWFA 2KFJA 3U8ZA 2L0FA 3ODOA 2N1WA 4NQKE 1UPRA 1OEYA 5HE0A 1WJNA 2MCNB 4E3CA 1Y5OA 3U30A 1OQNA 5IA7A 2GBKA 2CODA 1LM8B 1P98A 3TBLD 4CHJA 4IUMB 3ZTDA 3HIZA 1M7EA 4A6FB 3TMPB 4A6FA 4MH0E 3R66C 2EMTA 3QBVB 1J0WA 4XC2A 5CLQB 1V6EA 4FADA 3UQBA 2ZJDA 3NHEB 1U2BA 3ZNZB 3ALBA 2MA9B 2Z0PA 3MTNB 1XT9B 2NZ8B 5C5BB 4F8CB 3AU4A 3PVWA 4N9F4 4D0NB 2FNJB 1W1GA 5JHGA 2KX0A 2ZNVB 1MK9B 4MSQB 4PYUA 3X0WA 3JSVB 5HE1A 5E6NA 1Q0WB 4F7HA 3QAQA 1UNRA 1UH6A 4BOSC 1QQGA 4NNJB 3G9WA 3UIPB 1UPQA 4W9GA 2DHZA 2GOWA 4A3OA 3WALA 2FCMA 3BY4B 4EUTA 4E74A 2KDFB 2FIDA 4BVUC 4P7IA 3HHMA 4MELA 4B9KA 3ZUNA 2MBQA 1WR6E 3SDLC 3ODXA 4HLEA 4GXBA 2DTCA 3HW2B 3ZKJC 2K1FA 2K6QA 5LLIA 4BKSA 5DH9B 4K2PA 1KOTA 2LD9A 4DHJB 2RGFA 4HCNB 4AJYB 2L7RA 2J0JA 4HAYB 4HPMB 3PEGA 2G4DB 4DHZB 1GC6A 2KJHB 2KKCA 2V3SA 3AU5A 4TQ1A 5DHAB 2D4QA 3IHPC 1EUVB 4X57B 3L08A 2LGXA 1MPHA 2N0YA 1SGHA 4IWQA 1JRUA 3DVNU 5CHFA 1OMWA 3DDCB 1UEFA 1DDMA 4MY6A 2QHOA 2ZNVC 3APCA 3QA8A 2MW5A 4K7WA 5C23A 2I5FA 2O6VA 3SU8X 2NBWB 3AULA 3TFMA 4W9HA 4URKA 1V5PA 2YVCA 3M62B 1FAOA 3U7DA 1V80A 1Z5SB 5L83A 3QCAA 4EJNA 4ZRIA 1EGXA 2YT0A 1IP9A 3A8QA 2JVCA 2D9XA 2VKIA 5AZFA 4GDLA 2DA0A 3ODWA 3D8EA 1WGYA 1U5DA 5JHBA 4KIKB 3NZSA 2M4NA 4HDOA 2H7DA 4W9DA 1UNQA 1IPGA 4W9CA 5CTRC 2KMCA 3KVFB 4TV3A 1DDVA 2K2UA 3R3MA 4G50A 2L76A 1GG3A 3SUZA 2XK5A 3GYPA 1QZEA 4WJQA 3ZRFA 1WGGA 2A4ZA 3DBSA 5C6RA 2NVUI 4BKSD 5CX3A 4E71A 1ZW7A 2JRHA 2KDIA 3PLUA 4HAXB 4MSMB 5LXIB 1BTNA 4WVFB 1DROA 1OQYA 2N23A 2N1VA 2XBBC 3NS8A 4W9LA 4B6HA 3T8MA 5DPWA 1RRBA 2P0DA 1VCBA 1WFYA 3ZNHB 1MKEA 5FI0A 5KQ1A 3RZWC 5FR6A 4FBJB 3H7PA 4F1SA 1XR0B 1YJ1A 1LXDA 2IZVB 4HHVA 4DBBA 4LJPB 1EF5A 2RVBB 1V2YA 3HK0A 2KMAA 2KWUB 3DVNV 1DBHA 2Y7BA 4WSFA 2WX0A 1X05A 1L7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUA B;  2HJ8 A;  3KUD B;  2DLW A;  3ONS A;  4II3 B;  2HTH B;  2FCN A;  3DVG X;  5J17 A;  2MBO A;  1TJ6 A;  1AQC A;  4HB3 B;  4EZK A;  3AI5 A;  2WX1 A;  3QWM A;  4A3P A;  3PHX B;  3N3K B;  2GBR A;  2DHK A;  2CY5 A;  2G35 A;  3FM8 C;  2KTF A;  4NPN A;  2D3G A;  2D10 A;  3VUY A;  1WGD A;  4MGI E;  5J3Y A;  4MGK E;  2G3Q B;  2KWV B;  2KCJ A;  3DXD A;  4HB2 B;  3CIK A;  4MDK E;  2IFS A;  2K2J A;  4PS8 A;  2KNB A;  3APD A;  4OVV A;  2MLB A;  2ZZP B;  4DX8 A;  5D6J B;  3APF A;  1RRP B;  4NSW A;  3P7Z A;  3L16 A;  4G0N B;  1P3Q U;  2JY6 A;  5LON B;  1BT0 A;  4H8S A;  2KUP A;  2LJ5 A;  4JIO U;  2LKO A;  4RM8 A;  3R7R A;  1PMS A;  1UNP A;  1V81 A;  4HAT B;  2K8B A;  2JUO A;  1P5T A;  3LJ3 A;  1TZ1 A;  2LOZ A;  2LVQ A;  1RAX A;  2RR9 A;  3PTF C;  1WVH A;  4MJS A;  4W9I A;  3SNH A;  1UGM A;  2MSE D;  1KLV A;  3TO1 A;  3KZ1 A;  3PHW B;  4NY0 A;  2RD0 A;  4TYZ A;  4Z2N A;  2WWZ A;  4A6K A;  1IRS A;  3BJI A;  5L81 A;  3ML4 A;  2PE6 B;  3A1Q B;  3D8D A;  4BFR A;  1RFA A;  3A4R A;  2DHJ A;  4WJN A;  4HJK A;  3RZF A;  1IYF A;  3VHT C;  1KZ7 A;  2K8H A;  2Z59 B;  3H9D A;  1B55 A;  2FCQ A;  4IAP A;  1WI1 A;  5JLJ B;  5FI1 A;  1LB1 A;  4JQW C;  4GSW A;  3WAO A;  1X86 A;  4IOY X;  4KAX B;  1WR1 A;  2ZEQ A;  1TQZ A;  3ZVR A;  1WF9 A;  4KZC A;  4GDK B;  4M8N A;  4WWP A;  4FA6 A;  1ZC4 B;  3TL5 A;  5HKH A;  2IO3 B;  5JP4 A;  4ZDV A;  2ZCC A;  4W9K A;  5AZG A;  5CLL B;  4JGH B;  3L54 A;  1H4R A;  2W2X C;  1QC6 A;  1W1H A;  2UYZ B;  5KHO A;  4BKT A;  1WJ1 A;  3H7P B;  3NOB A;  4G3X B;  2KWC A;  2DN6 A;  5JHH A;  5LOP B;  1WGU A;  2DZI A;  4IWP A;  3QWZ B;  4XX5 A;  3PZD A;  3ZO5 B;  4FJY A;  4II2 B;  5L95 C;  4I6P A;  3W1S C;  3VH3 B;  1Y19 B;  5D27 A;  1Z2M A;  3B1L X;  2CHX A;  2NCN A;  1XCG A;  4KV2 A;  4EOY A;  3VTU A;  2MP2 A;  2XK5 B;  3ZW3 A;  1Q67 A;  2C7M B;  2J0M A;  2AWT A;  2LZ6 A;  3VH4 B;  2LI5 A;  1U4A A;  3WAN A;  1WJU A;  2E2X A;  3NSU A;  2FUH B;  1MIX A;  4K7S A;  4CO7 A;  3V6E B;  4HVB A;  1WX9 A;  2KTR B;  4CYE A;  5D3Y A;  3UZT A;  1K8R B;  2CHW A;  2KN5 A;  4FLH A;  4F7G A;  2FAZ A;  2BKR B;  4BOZ B;  3QIJ A;  2R09 A;  3RD2 A;  2KAN A;  1KZG A;  4GN1 A;  3A9K A;  4GIV A;  1WG7 A;  2DYQ A;  4EKU A;  1E8Z A;  1NI2 A;  4ZRK A;  1ZKH A;  5E6O A;  3UGB B;  2LVO A;  2MDX A;  4M8M A;  2YS5 A;  2DEN B;  3O65 B;  5E6P A;  4DWF A;  3PLV A;  3N7C A;  2DX5 A;  2NPT A;  1BWN A;  1TGZ B;  3PV1 A;  3L0W B;  2EMS A;  2RUK B;  2GJY A;  3SYX A;  2K00 A;  3H7S A;  4IFS A;  1WJ4 A;  1E5W A;  2PE9 A;  2CR5 A;  2M8S A;  2KJ6 A;  2O2V B;  2YF0 A;  2EJ8 A;  4A5K A;  3L10 B;  3T9L A;  2R2O A;  3NY5 A;  1V61 A;  3V62 A;  1F9J A;  4K17 A;  5DPT A;  4WJ7 A;  4EZJ A;  3CF6 E;  2DYO A;  2KXJ A;  3Q3F A;  3TW1 A;  1ZGU B;  2K39 A;  1J19 A;  4MGZ E;  2ELB A;  3ZTC A;  1I42 A;  2LOX A;  2MBE A;  3TVV A;  4MGY E;  4RMA A;  4A6H A;  1V9J A;  2KD0 A;  4ASW C;  1XOD A;  2KLG A;  3A9J B;  2K6D B;  2M0X A;  3H1U A;  3KYD D;  4HDQ A;  4KHO A;  1P6S A;  3DOW A;  4K7U A;  2KO3 A;  4DXA B;  1UBI A;  2VRR B;  5BO4 B;  2DHI A;  4F7U P;  1G6J A;  3QX1 A;  3PP2 A;  1RLF A;  2AEH A;  3QHT A;  4WJO A;  2N9P C;  2BGF A;  1V5U A;  2KQS A;  3OJ4 B;  3VQI A;  3A9K B;  3W1Y A;  2OQB A;  3PG7 A;  4KSK C;  1H10 A;  4PS7 A;  2LAS A;  1P9D U;  2UWQ A;  5AZH A;  1L2N A;  1WMH B;  1WMH A;  2YRY A;  4I6L B;  3O96 A;  3CST A;  1NDD A;  3JSV A;  3KRX A;  2CRF A;  2J0K A;  2Z0O A;  4XWX A;  3ZNG C;  4ANV A;  1FGZ A;  1WGQ A;  2AL3 A;  4GGQ A;  4MJS B;  3V60 A;  1EAZ A;  2XQN M;  4ANU A;  3L13 A;  3QJZ A;  1X1G A;  1YIW A;  2C60 A;  3VXW A;  4GU2 A;  2JPH A;  5D3V A;  4WWN A;  2NMB A;  3ZNI D;  2GBM A;  4BBN C;  4DBG A;  2DX1 A;  3IFW B;  2IYB A;  2R0D A;  4GZU A;  1BTK A;  1K5D B;  1ZC3 B;  2P0F A;  2C9W B;  3QAR A;  2PPH A;  1M7R A;  4WWO A;  5JH5 C;  3R7Q A;  1V88 A;  2ZPN A;  1OY2 A;  2Y8G A;  1MG8 A;  3C0R B;  1YQB A;  5J3Q A;  3KYC D;  4IM3 A;  2KDE B;  2KK8 A;  1XX0 A;  3F5R A;  3IVF A;  2W2W A;  1U29 A;  3LJU X;  3T06 A;  3VOQ A;  2L05 A;  4DK5 A;  1T0Y A;  1EO6 A;  3ZDM C;  3K9P B;  3EHV A;  2Z0E B;  4JLC A;  4XZ4 A;  1TTN A;  3TIX A;  2CAY A;  3KY9 A;  2RPQ A;  5C79 A;  2LYD A;  2DX5 B;  2NPT B;  5DHF B;  5TR5 A;  4KZ0 A;  1XKE A;  1C1Y B;  3RUI B;  5HE2 A;  5G2N A;  3ML8 A;  2UVM A;  2CKH B;  1WH3 A;  1RJ2 A;  1V49 A;  1XD3 B;  4HXD A;  4NJ7 A;  5CHW A;  3ZRC A;  2O6V B;  2YSZ A;  5JHA A;  1DDW A;  2FJL A;  1FHO A;  4LDT B;  4W9F A;  2MRP A;  3UIN B;  4AOF A;  5DCN A;  3ZIM A;  1MAI A;  3W1S A;  2DYB A;  1WI0 A;  3CXB B;  3DBL I;  2KLC A;  2IBI B;  5C5B A;  4HK2 A;  4HAU B;  1WX7 A;  3DPD A;  4EEW A;  1W1D A;  2JZ3 B;  1AAR A;  3A98 B;  4JL9 A;  3VTV A;  2K8C A;  1WX8 A;  3PRM B;  1SHC A;  1WXS A;  1OEY J;  3HM3 A;  3KW5 B;  2I1J A;  2FCS A;  2JRI B;  3IG3 A;  2BKF A;  3WAP A;  2KFK A;  2P0H A;  1PFJ A;  2BYV E;  4TUU A;  1U5G A;  3A8P A;  2N4F A;  3B08 A;  1E8X A;  1UEL A;  1E8Y A;  2HE7 A;  2C7N B;  4HAZ B;  1AWE A;  2UZS A;  3AJ4 A;  2OTX A;  3TCA A;  2YLM A;  4FJZ A;  4WAA A;  2ROZ B;  3WAM A;  2RLO A;  4B95 A;  2L1C A;  1WZ0 A;  1P3R A;  2AL6 A;  3ULC A;  2P8V A;  2MBB B;  3M3J A;  4HAV B;  4LCD E;  1WM2 A;  2NBU A;  4I6N B;  2LG1 A;  3L17 A;  1ZM0 A;  2DKQ A;  3ULB A;  3VTW A;  2PEA A;  1FHX A;  4HCP B;  2COF A;  4RM9 A;  1WE7 A;  4B6W A;  1NU2 A;  2IO0 B;  2JT4 B;  4MK0 A;  2KZR A;  1X1M A;  2CY4 A;  1PQS A;  2NS5 A;  3ENE A;  3PPA A;  1E7V A;  1WIA A;  4WQO B;  3RUL A;  4IC7 B;  1GJZ A;  3HM6 X;  5CHV C;  3GZN I;  2MFQ A;  3DQV A;  2YS1 A;  4C0A A;  1E90 A;  1WY8 A;  1MK7 B;  4KSL C;  2PZ1 A;  3M95 A;  2M17 A;  3CMM B;  5KQ4 A;  2MKR A;  3JW0 X;  3VDZ A;  2W2X D;  1X1F A;  3WA0 A;  1BAK A;  4DDG D;  3ML9 A;  3P2B A;  2COA A;  2FIF A;  5D94 A;  2L0T A;  2D2Q A;  1OTR B;  2ASQ A;  2N7D A;  1V5T A;  2ZVN A;  3GOE A;  3JVZ X;  4HB4 B;  3GYO A;  3ZDT A;  2DAJ A;  4AP4 C;  4K1R B;  2J59 M;  3N32 A;  4NAW B;  4BBN F;  2JXX A;  2LWP A;  2OOB B;  1LW3 A;  4KVG B;  3S2A A;  4HB0 B;  1FXT B;  3UIO B;  5J18 A;  1R4M I;  2HD5 B;  2KJR A;  2RSG A;  2N7E A;  3OAW A;  1S3S G;  5EFX A;  5DPS A;  4DDI D;  2LRW A;  1FGY A;  1ISN A;  2DFK A;  1LQB A;  2AYO B;  1WM3 A;  2KGX B;  3ECI A;  2BF8 B;  2A5U A;  4AUQ C;  2MQJ A;  4GB9 A;  3PSE B;  3Q3J A;  1SE9 A;  2Y8F A;  4PYZ A;  4TKN A;  1HE8 A;  4HWI B;  3M1I B;  1WRD B;  2JWZ A;  3NZU A;  2L00 B;  5D2M B;  3VIA A;  2C7H A;  3AXC A;  5D3X A;  3SV1 A;  4CHM A;  4HPL B;  3VUX A;  1TBE A;  5KHQ A;  4HAW B;  1EF1 A;  3VFK A;  1S1Q B;  2DYM A;  2B3A A;  3BIN A;  2K25 A;  2GBJ A;  4AJW A;  2ZPY A;  3A33 B;  1WGH A;  1Y8R C;  3B0A A;  2M38 A;  2GBN A;  3RCP A;  2KVR A;  2LVP A;  3KUC B;  5IAA C;  1TXD A;  2LXC A;  2V4L A;  2W9N A;  3ZLZ A;  4ZRJ A;  5D3W A;  5GMV A;  2Q13 A;  1GC7 A;  3JYU A;  1X11 A;  2ZVO A;  1U27 A;  3PRP B;  4IM0 A;  2D11 A;  3TJP A;  1WGR A;  3A9J A;  2UZR A;  1WJ6 A;  4IW0 A;  3D32 A;  1WJM A;  5C1Z A;  2D9W A;  2MBH A;  3OLM D;  3I3T B;  2ROV A;  2BCJ A;  1WXM A;  4K2O A;  1J8C A;  2KC2 A;  3PRE A;  3OAN A;  1E7U A;  1GNU A;  1YX5 B;  1VD2 A;  1Z87 A;  1LFD A;  3RYT A;  3F0W A;  4PS3 A;  2YT1 A;  3VAW A;  1MIZ B;  5GOW B;  3VUW A;  1K5G B;  4GDK A;  2VSZ A;  4LJO B;  3KUZ A;  3PS6 A;  4F7Z A;  4FJV B;  2O2V A;  4GOC A;  3X23 A;  3DXE A;  2IYD B;  5DPR A;  2H7E A;  4MM3 A;  3V61 A;  2JP2 A;  1EVH A;  3PT2 B;  1WZ3 A;  1E8W A;  1WYW B;  2QKM A;  3MPX A;  4BBK A;  4PNK A;  2MP2 B;  2O6V D;  1FB8 A;  1Q1O A;  3MDB C;  2ADZ A;  2GCJ A;  2MX2 A;  3K9O B;  4LDT D;  1NTV A;  5AEK B;  3V5W A;  1UBQ A;  3DVG Y;  4G11 A;  2LGD A;  4Z2M B;  4AWJ A;  3PRZ A;  4FUL A;  1FHW A;  2COC A;  2D07 B;  2KHW B;  1M94 A;  2R2Q A;  2MWS B;  2DKP A;  3H6N A;  3OJ3 A;  4NJ6 A;  1I2H A;  3SD5 A;  2CHZ A;  3CSF A;  1XD4 A;  4KDL B;  4CHK A;  1P1A A;  3PGE A;  4GDL B;  1R4N I;  1WXA A;  2C5L C;  1V86 A;  2IO2 B;  2N9X A;  2RSU A;  2DZK A;  3QQ8 B;  3QK0 A;  4OVU A;  4L6E A;  4DHJ D;  3WIM A;  4DHZ E;  1J0G A;  1I35 A;  1A5R A;  5DIF B;  3DBH I;  1ZSQ A;  4PQ0 A;  3EFU A;  4KHB B;  2N9E B;  1WXV A;  2BPS A;  2V76 A;  3PSC A;  4ICV A;  1I7A A;  2CS4 A;  2G4S A;  2KDB A;  2X18 A;  5HE3 A;  4MEM A;  4GMX B;  5D7G A;  3DCG A;  2ELA A;  2WDT B;  1ZVR A;  2QKL A;  1C3T A;  1KJT A;  3LDZ E;  3V6C B;  5C16 A;  4WJP A;  4Y94 A;  4A20 A;  1FOE A;  3UF8 A;  2BYE A;  2DYN A;  3HQC A;  2G45 B;  3DBR I;  2RNR B;  1CMX B;  3FEH A;  4MT7 A;  2YS3 A;  5KCV A;  1Q5W B;  1UD7 A;  1YD8 U;  2DZM A;  1P0R A;  2ZCB A;  5EDS A;  4YL8 A;  4J6I A;  2Z0Q A;  2KOX A;  3ZVV A;  2Y5B B;  5JZE B;  2M1M A;  3DXC A;  4GPT B;  4IM2 A;  4ANW A;  1DYN A;  4KHA A;  5DI9 B;  3WYF B;  1U5E A;  2IO1 B;  4K81 A;  1WE6 A;  2KQ7 A;  3PVL A;  2LRU A;  3QC8 B;  4W9E A;  4IWO A;  1U5F A;  2REX A;  2J7Q B;  3N30 A;  4NQL B;  2OJR A;  2I5C A;  2DAF A;  2MWN B;  4ICU A;  2JZZ A;  2GS0 A;  1PLS A;  3A1Q A;  2LXA A;  4YON A;  3UQA A;  2IY1 B;  2KFK B;  2D9Z A;  2CU1 A;  2GCL A;  2I1K A;  3KH0 A;  2LUL A;  4FHK A;  2LGY A;  4NAW A;  3IBE A;  4FN2 A;  1V89 A;  5J3T A;  2V1Y A;  3P6A A;  3SO6 A;  3MHS D;  3SHQ A;  5J2R A;  2BWE S;  2NR2 A;  1V5O A;  2IY0 B;  2EKE C;  3PVU A;  2LUE A;  5G55 A;  3VVW B;  4TQ0 A;  3M63 B;  2NBV B;  2VRW B;  1XQQ A;  2JF5 A;  2XEW A;  3A4S C;  2RGN B;  2DZJ A;  1SIF A;  4ZYN A;  3EEC A;  1OGW A;  4BKG A;  1KI1 B;  2D9V A;  4IG7 B;  1NBF C;  5LXH A;  2L3Z A;  2KC1 A;  4M0W B;  4FHJ A;  4EFO A;  2L8J A;  3D8F A;  1UZX B;  4ANX A;  2EC1 A;  1V5M A;  3FSS A;  2GMI C;  3MJW A;  3RT3 B;  2Z0D B;  2WYQ A;  1N3H A;  2HTH A;  3RCZ A;  4EZL A;  2M14 A;  2BYF A;  2KX3 A;  4KDI C;  2D9Y A;  1KM7 A;  4KIK A;  3KSY A;  4DX9 0;  1NTY A;  1D3Z A;  4W9J A;  3KRW A;  2L2I A;  2KTR A;  2PJH A;  1H8C A;  4GMV A;  1YX6 B;  3EC8 A;  4EMO A;  2BWF A;  2KFJ A;  3U8Z A;  2L0F A;  3ODO A;  2N1W A;  4NQK E;  1UPR A;  1OEY A;  5HE0 A;  1WJN A;  2MCN B;  4E3C A;  1Y5O A;  3U30 A;  1OQN A;  5IA7 A;  2GBK A;  2COD A;  1LM8 B;  1P98 A;  3TBL D;  4CHJ A;  4IUM B;  3ZTD A;  3HIZ A;  1M7E A;  4A6F B;  3TMP B;  4A6F A;  4MH0 E;  3R66 C;  2EMT A;  3QBV B;  1J0W A;  4XC2 A;  5CLQ B;  1V6E A;  4FAD A;  3UQB A;  2ZJD A;  3NHE B;  1U2B A;  3ZNZ B;  3ALB A;  2MA9 B;  2Z0P A;  3MTN B;  1XT9 B;  2NZ8 B;  5C5B B;  4F8C B;  3AU4 A;  3PVW A;  4N9F 4;  4D0N B;  2FNJ B;  1W1G A;  5JHG A;  2KX0 A;  2ZNV B;  1MK9 B;  4MSQ B;  4PYU A;  3X0W A;  3JSV B;  5HE1 A;  5E6N A;  1Q0W B;  4F7H A;  3QAQ A;  1UNR A;  1UH6 A;  4BOS C;  1QQG A;  4NNJ B;  3G9W A;  3UIP B;  1UPQ A;  4W9G A;  2DHZ A;  2GOW A;  4A3O A;  3WAL A;  2FCM A;  3BY4 B;  4EUT A;  4E74 A;  2KDF B;  2FID A;  4BVU C;  4P7I A;  3HHM A;  4MEL A;  4B9K A;  3ZUN A;  2MBQ A;  1WR6 E;  3SDL C;  3ODX A;  4HLE A;  4GXB A;  2DTC A;  3HW2 B;  3ZKJ C;  2K1F A;  2K6Q A;  5LLI A;  4BKS A;  5DH9 B;  4K2P A;  1KOT A;  2LD9 A;  4DHJ B;  2RGF A;  4HCN B;  4AJY B;  2L7R A;  2J0J A;  4HAY B;  4HPM B;  3PEG A;  2G4D B;  4DHZ B;  1GC6 A;  2KJH B;  2KKC A;  2V3S A;  3AU5 A;  4TQ1 A;  5DHA B;  2D4Q A;  3IHP C;  1EUV B;  4X57 B;  3L08 A;  2LGX A;  1MPH A;  2N0Y A;  1SGH A;  4IWQ A;  1JRU A;  3DVN U;  5CHF A;  1OMW A;  3DDC B;  1UEF A;  1DDM A;  4MY6 A;  2QHO A;  2ZNV C;  3APC A;  3QA8 A;  2MW5 A;  4K7W A;  5C23 A;  2I5F A;  2O6V A;  3SU8 X;  2NBW B;  3AUL A;  3TFM A;  4W9H A;  4URK A;  1V5P A;  2YVC A;  3M62 B;  1FAO A;  3U7D A;  1V80 A;  1Z5S B;  5L83 A;  3QCA A;  4EJN A;  4ZRI A;  1EGX A;  2YT0 A;  1IP9 A;  3A8Q A;  2JVC A;  2D9X A;  2VKI A;  5AZF A;  4GDL A;  2DA0 A;  3ODW A;  3D8E A;  1WGY A;  1U5D A;  5JHB A;  4KIK B;  3NZS A;  2M4N A;  4HDO A;  2H7D A;  4W9D A;  1UNQ A;  1IPG A;  4W9C A;  5CTR C;  2KMC A;  3KVF B;  4TV3 A;  1DDV A;  2K2U A;  3R3M A;  4G50 A;  2L76 A;  1GG3 A;  3SUZ A;  2XK5 A;  3GYP A;  1QZE A;  4WJQ A;  3ZRF A;  1WGG A;  2A4Z A;  3DBS A;  5C6R A;  2NVU I;  4BKS D;  5CX3 A;  4E71 A;  1ZW7 A;  2JRH A;  2KDI A;  3PLU A;  4HAX B;  4MSM B;  5LXI B;  1BTN A;  4WVF B;  1DRO A;  1OQY A;  2N23 A;  2N1V A;  2XBB C;  3NS8 A;  4W9L A;  4B6H A;  3T8M A;  5DPW A;  1RRB A;  2P0D A;  1VCB A;  1WFY A;  3ZNH B;  1MKE A;  5FI0 A;  5KQ1 A;  3RZW C;  5FR6 A;  4FBJ B;  3H7P A;  4F1S A;  1XR0 B;  1YJ1 A;  1LXD A;  2IZV B;  4HHV A;  4DBB A;  4LJP B;  1EF5 A;  2RVB B;  1V2Y A;  3HK0 A;  2KMA A;  2KWU B;  3DVN V;  1DBH A;  2Y7B A;  4WSF A;  2WX0 A;  1X05 A;  1L7Y A; 
#chains in the Genus database with same CATH topology
 1ESF A;  1RYJ A;  2HJ8 A;  2RDB C;  2HTH B;  4P6V F;  4CSQ A;  1DOI A;  4EZK A;  3AI5 A;  1MI1 A;  3N3K B;  1TIF A;  2CY5 A;  3NJT A;  3AE1 B;  1EM7 A;  4A55 A;  3IAS 1;  3EUB 2;  4MGI E;  1YN4 A;  2KWV B;  5EE0 A;  4S0R A;  3APD A;  2MLB A;  1RRP B;  3AM9 A;  2DNF A;  2LJ5 A;  2GB1 A;  3EA6 A;  3R7R A;  1UNP A;  2JSV X;  5LG4 B;  1XLP A;  1L6U A;  3LJ3 A;  3NWF A;  2AQ2 B;  1WVH A;  1NYR A;  4W9I A;  3SNH A;  2MSE D;  4M02 A;  3KZ1 A;  3PHW B;  4JX1 C;  2RD0 A;  4A6K A;  3BJI A;  1ZE3 D;  2PE6 B;  1RFA A;  4WJN A;  3RZF A;  3H9D A;  1B55 A;  1WI1 A;  4QXA B;  1WR1 A;  3ZVR A;  1WF9 A;  1T6B X;  4GDK B;  1ZC4 B;  3TL5 A;  4ZDV A;  4W9K A;  1SSN A;  3I9V 1;  2UYZ B;  3A58 A;  4AQ7 A;  1XLN A;  4IWP A;  3C8Y A;  5L95 C;  4FJY A;  4II2 B;  4I6P A;  5IOI A;  3VH3 B;  4C56 C;  1Z2M A;  1V1P A;  4KHB A;  1A70 A;  3ZW3 A;  2J0M A;  2LI5 A;  4CO7 A;  1WX9 A;  5D3Y A;  3L4P A;  4F7G A;  3AED B;  2BKR B;  3DCX A;  1OQQ A;  1NI2 A;  4ZRK A;  1R4N B;  2BB5 A;  2LVO A;  2DEN B;  3O65 B;  5E6P A;  3N7C A;  1DOX A;  1BWN A;  2GLS A;  3PV1 A;  3L0W B;  2EMS A;  2RUK B;  2GJY A;  3SYX A;  3L10 B;  4A5K A;  3KLS X;  2NMQ A;  1IGC A;  1ZGU B;  2K39 A;  2VH1 A;  4MGZ E;  1I42 A;  1XCT L;  4MGY E;  4DIX A;  1V9J A;  3NW8 A;  3OWE B;  1XOD A;  3W2D A;  2CJO A;  3H1U A;  4KHO A;  1MFW A;  1G6J A;  1UBI A;  4QJ5 B;  4F7U P;  4WH4 A;  1HQR D;  3C19 A;  1RLF A;  4WJO A;  1V5U A;  1N60 A;  2KQS A;  1FRD A;  3AEG B;  2LAS A;  4RFB A;  1WMH A;  2D3B A;  1VR9 A;  2YRY A;  3CST A;  3JSV A;  3ZNG C;  4ANV A;  2AL3 A;  1VLB A;  1QKZ A;  4MJS B;  4JWU C;  1EAZ A;  2XQN M;  4ANU A;  4US8 A;  1YIW A;  1WRI A;  3ZNI D;  5I2M A;  2ZW1 A;  3FIL B;  5JH5 C;  1ZC3 B;  4WWO A;  1HZ5 A;  1MJD A;  2D5G A;  1M7R A;  3ZJT A;  4HPP A;  3R7Q A;  2ZPN A;  1F1H A;  1PDX A;  2WXR A;  1WWT A;  4OW0 A;  1XX0 A;  1U29 A;  3T06 A;  3ZDM C;  1EO6 A;  4XZ4 A;  1KH0 A;  3DWM A;  2CAY A;  2PLP A;  1JML A;  2HTM E;  2WXI A;  2RPQ A;  2DX5 B;  2ZW0 A;  1V49 A;  2O6V B;  2FJL A;  3UIN B;  2IGD A;  3W1S A;  1WI0 A;  3CXB B;  2KLC A;  4HK2 A;  1AN8 A;  3ZGZ A;  2JZ3 B;  1AAR A;  3A98 B;  1UNS A;  1OEY J;  2I1J A;  1I4G A;  2JRI B;  3IG3 A;  4KGR A;  3Q3O C;  1IBX B;  2WXJ A;  1UEL A;  1PFD A;  1E8Y A;  2HE7 A;  3H8H A;  2YLM A;  4FJZ A;  4WAA A;  3Q8E A;  2P8V A;  1PYW D;  3L17 A;  3VTW A;  2PEA A;  4HCP B;  2COF A;  4KGT A;  3AEA B;  3PPA A;  1PQS A;  2NS5 A;  4ZRP A;  3RUL A;  1GJZ A;  1GPX A;  4OVZ A;  3DQV A;  1YJJ A;  3BVZ A;  3CMM B;  3JW0 X;  1X1F A;  3WA0 A;  5D3D A;  2COA A;  2FUG 1;  3GOE A;  5C2T B;  4NAW B;  4BBN F;  2LWP A;  3UIO B;  1FXT B;  1TS2 A;  3OAW A;  5EFX A;  1FGY A;  1ISN A;  2DFK A;  2BF8 B;  2MQJ A;  3Q3J A;  4JE3 B;  1SE9 A;  3TUO A;  4HWI B;  1M4V A;  5D2M B;  3AXC A;  5D3X A;  2DYM A;  2B3A A;  2GBJ A;  3A33 B;  3AN1 A;  3J9C A;  3KUC B;  2KVR A;  3ZJV A;  2LXC A;  2V4L A;  4ZRJ A;  2Q13 A;  3PZ7 A;  1GC7 A;  2ZVO A;  3TJP A;  1WGR A;  4MAC A;  2UZR A;  5C1Z A;  2D9W A;  5H92 C;  3I3T B;  4RCO A;  1WXM A;  4K2O A;  4MH8 A;  1E7U A;  1Z87 A;  3RYT A;  4PS3 A;  2YT1 A;  1QQR A;  4F7Z A;  2VSZ A;  4LJO B;  1V1O A;  3X23 A;  3DXE A;  3V61 A;  1WZ3 A;  2MP2 B;  2KIE A;  4LDT D;  1KF6 B;  5FR3 A;  1NTV A;  3SEB A;  1FHW A;  1KOT A;  1I4X A;  2D07 B;  1M94 A;  4NJ6 A;  1L0X B;  2PW9 A;  1T0R C;  4GDL B;  5JZE B;  2IO2 B;  2N9X A;  2RSU A;  1I35 A;  4OVU A;  4DHJ D;  1J0G A;  1RWS A;  4KHB B;  2N9E B;  1YN5 A;  5IO9 A;  2J4X A;  4ICV A;  3PSC A;  3AE3 B;  1JWA D;  1N5X A;  2KDB A;  3BK2 A;  2X18 A;  2OED A;  4NJC A;  3DCG A;  2ELA A;  3FVC A;  1JQ4 A;  2QKL A;  1C3T A;  4Y94 A;  2XNA C;  3IT4 B;  1UWM A;  1CMX B;  4MT7 A;  2DZM A;  1UD7 A;  1FCC C;  5EDS A;  2Z0Q A;  2LEK A;  2M1M A;  1JWB D;  4GPT B;  1E6E B;  4KHA A;  1U5E A;  3PVL A;  1J7C A;  3I63 C;  2OJR A;  2JZP A;  2MWN B;  2D9Z A;  4HSI A;  2CU1 A;  2I1K A;  3DBL B;  3KH0 A;  4NAW A;  3RNB C;  5J3T A;  5J2R A;  3MHS D;  5G55 A;  2NBV B;  2JF5 A;  2RGN B;  4A90 A;  2DZJ A;  1XF5 L;  1VZ7 A;  3DBH B;  2WS3 B;  2D9V A;  2JX5 A;  1NBF C;  5LXH A;  1F0Z A;  4BZA A;  1UZX B;  3MJW A;  1ACC A;  2INN E;  3KSY A;  3KRW A;  2PJH A;  2GUM A;  3EC8 A;  4NQK E;  2N1W A;  2MCN B;  4E3C A;  5HE0 A;  1Y5O A;  2LGS A;  5IA7 A;  2GBK A;  2COD A;  4CHJ A;  2BB6 A;  4IUM B;  4MH0 E;  3R66 C;  2EMT A;  4HEA 1;  3LYY A;  2MA9 B;  1ZUD 2;  2RRF A;  2FNJ B;  1W1G A;  5JHG A;  3X0W A;  1UWX A;  4BOS C;  1UNR A;  1IUE A;  3UIP B;  4CQN A;  3Q8B A;  3BY4 B;  2KDF B;  4BVU C;  3HHM A;  4ZYS A;  1WR6 E;  4GXB A;  4LLG M;  3HW2 B;  2K6Q A;  2W54 A;  4KX6 B;  4K2P A;  1TS3 A;  2PKO A;  2RGF A;  4AJY B;  3PEG A;  2WU5 B;  1J7B A;  4X57 B;  3SR6 A;  3AEE B;  2WGS A;  2EKI A;  1OQR A;  3APC A;  4HJG E;  1C4C A;  4XE0 A;  2O6V A;  2Y5P A;  2N9K A;  4W9H A;  3M62 B;  1FRR A;  1D6E C;  1V80 A;  3QCA A;  4RNA A;  4EJN A;  4YWG G;  1EGX A;  3CIR B;  4D2K A;  2JVC A;  1T3Q A;  4GDL A;  3W5V B;  3ODW A;  1TKY A;  4A6Q A;  1U5D A;  1N63 A;  3GE8 C;  4W9D A;  1UNQ A;  1IPG A;  5CTR C;  3R3M A;  4G50 A;  1GG3 A;  3R2T A;  3GYP A;  2QIE B;  4RGM A;  5C6R A;  2NVU I;  2D3C A;  1ZYI A;  2JRH A;  2IND C;  2KDI A;  3PLU A;  4MSM B;  3U4E G;  4WVF B;  4XDD A;  5EE1 A;  1WFY A;  4FBJ B;  2FBW B;  3NVY A;  2KUQ A;  3B2F A;  3H7P A;  4F1S A;  1XXG A;  3VDZ A;  4HHV A;  2WDR B;  1V2Y A;  3FKY A;  1DBH A;  2WX0 A;  2QHO A;  1L7Y A;  3T3O A;  1EU4 A;  1GUA B;  3KUD B;  4P1B C;  3ONS A;  4II3 B;  3E56 A;  3DHG C;  2FCN A;  4HB3 B;  3P42 A;  3QWM A;  3PHX B;  2R2Y A;  2G35 A;  3FM8 C;  2D10 A;  3VUY A;  3RI7 C;  2G3Q B;  1NEN B;  2KCJ A;  3DXD A;  4MDK E;  2K2J A;  3VR9 B;  2KNB A;  1T77 A;  3MP9 A;  3APF A;  4NSW A;  2VH2 A;  1KFY B;  2JY6 A;  4H8S A;  2KUP A;  2LKO A;  4RM8 A;  2ON8 A;  2GI9 A;  2RR9 A;  4P16 A;  5IN7 A;  1FCL A;  1KLV A;  4XGA B;  4NY0 A;  4Z2N A;  1IRS A;  4BFR A;  1HA5 A;  2DHJ A;  4HJK A;  4REZ A;  3VHT C;  1KZ7 A;  2Z59 B;  4PK1 A;  2K22 A;  2FCQ A;  1LB1 A;  2MJ3 A;  3RNA C;  4IOY X;  1TQZ A;  4M8N A;  3NG0 A;  5JP4 A;  3RPF C;  2ZCC A;  4LNN A;  1WJ1 A;  1E9M A;  2DN6 A;  5JHH A;  2KWC A;  3IXS A;  4ARI A;  3W1S C;  3RN9 C;  4EOY A;  1Q67 A;  2AWT A;  5BMH A;  3P1M A;  1WJU A;  2E2X A;  3TEY A;  4CYE A;  1K8R B;  2KN5 A;  3SFD B;  2FAZ A;  1SIJ A;  2E6X A;  2KAN A;  2H88 B;  1WG7 A;  5E6O A;  2MDX A;  3U7Z A;  2YS5 A;  4DWF A;  2DX5 A;  1TGZ B;  2K00 A;  3U52 E;  1E5W A;  3NY5 A;  3HRD D;  1V61 A;  5AUI A;  4K17 A;  2WXF A;  3CF6 E;  1TZO A;  3Q3F A;  3TW1 A;  2KT7 A;  2JXT A;  2MBE A;  4A6H A;  1L6V A;  2KD0 A;  1CZP A;  3A9J B;  2M0X A;  1K51 A;  1P7E A;  5M4Y B;  2KO3 A;  5BO4 B;  2DHI A;  3BK1 A;  1SJE D;  5IRS A;  2BGF A;  3VQI A;  3A9K B;  2OQB A;  5AZH A;  1WMH B;  4L1R A;  3MFG A;  3O96 A;  2CRF A;  4XWX A;  1L4Z B;  1CQV A;  2J52 A;  1WGQ A;  2WP9 B;  4GGQ A;  2LMC A;  1B1Z A;  3I57 A;  5D3V A;  4DBG A;  4BBN C;  5LNK 1;  2DX1 A;  2IYB A;  2PPH A;  5BYQ A;  3NS1 A;  1KLU D;  2KDE B;  1E0Z A;  4RGN A;  3V3X A;  1ZXH A;  3LJU X;  3N20 C;  3W5U B;  3K9P B;  2Z0E B;  1DYQ A;  1V97 A;  5C79 A;  5DHF B;  2GRI A;  4KZ0 A;  3RUI B;  2UVM A;  2Z4D A;  1WH3 A;  1YOV B;  4Q2J A;  1DDW A;  1LO5 D;  5DCN A;  3ZIM A;  5BMI A;  2PMV A;  4RF1 A;  2IBI B;  5C5B A;  5D3I B;  4HAU B;  1WX7 A;  3DPD A;  1W1D A;  4KGS A;  4JL9 A;  2K8C A;  3HM3 A;  3KW5 B;  2K49 A;  2FCS A;  4JWS C;  1PFJ A;  4TUU A;  4C7Y A;  1WSP A;  4RF0 A;  2V3N A;  4HAZ B;  2UZS A;  2OTX A;  3BYY B;  3WAM A;  2RLO A;  4D6W A;  1P3R A;  4LCD E;  2NBU A;  4I6N B;  2LG1 A;  1N61 A;  1ZM0 A;  4RM9 A;  1WE7 A;  4P1C C;  4B6W A;  1NU2 A;  4MK0 A;  5H8Y E;  1E7V A;  4HRS A;  1C78 A;  3GZN I;  4MM3 B;  1TT5 B;  4IOI E;  3N9Y C;  2PZ1 A;  3M95 A;  5KQ4 A;  2W2X D;  4DDG D;  3ML9 A;  1I4H A;  2FIF A;  2HDE A;  2L0T A;  2D2Q A;  2AX5 A;  3ZDT A;  4N59 A;  2JXX A;  2OOB B;  4KVG B;  1OFF A;  5J18 A;  1R4M I;  2KJR A;  2RSG A;  2N7E A;  2WHI A;  1YN3 A;  3RNG C;  1WM3 A;  3PSE B;  4M0W A;  2Y8F A;  3M1I B;  1SE3 A;  2JWZ A;  3NZU A;  3VUX A;  4CHM A;  1EU3 A;  3MC9 A;  2RDG A;  3AE7 B;  4ZHO A;  2K25 A;  4N58 A;  1WGH A;  1Y8R C;  1YNT E;  5IAA C;  4NZL B;  4LNK A;  1WJ6 A;  2MBH A;  3OLM D;  2ROV A;  1J8C A;  3AEF B;  3PRE A;  1D5Z C;  3PS6 A;  4FJV B;  3ETR A;  2H7E A;  3R8B A;  4RGT A;  1QT9 A;  1E8W A;  3MPX A;  4BBK A;  4PNK A;  2O6V D;  3MDB C;  1UBQ A;  2K0P A;  3DVG Y;  4GLS C;  4Z2M B;  2COC A;  2R2Q A;  2DKP A;  3OJ3 A;  1HTQ A;  1VRA B;  2R61 A;  3CWI A;  2DZK A;  1QF6 A;  1TS4 A;  3WIM A;  4DHZ E;  1DGJ A;  3EFU A;  4M01 A;  5C3J B;  2V76 A;  2CS4 A;  5HE3 A;  5AUK A;  1PUT A;  4GMX B;  1FXI A;  3AE2 B;  1FEH A;  4DXG A;  3LDZ E;  3V6C B;  1NVI D;  3UF8 A;  3HQC A;  2G45 B;  2B76 B;  2W82 A;  3Q14 C;  5KCV A;  2ZCB A;  4S17 A;  2Y5B B;  4IM2 A;  3AE8 B;  1ZXI A;  1ZOY B;  1DYN A;  2WNM A;  4IWO A;  1U5F A;  2REX A;  3N30 A;  2JZZ A;  2WXO A;  3A1Q A;  2KFK B;  2GCL A;  1WGK A;  2LUL A;  2LGY A;  3IBE A;  2BS4 B;  2NR2 A;  1TKE A;  1V5O A;  2IY0 B;  2PIA A;  2RMM A;  4TQ0 A;  3LB8 C;  2XEW A;  1XQQ A;  3URY A;  5GXG B;  4ZYN A;  1ZDV A;  1OGW A;  1SF0 A;  4BKG A;  2L3Z A;  1XLO A;  2WLB A;  4ANX A;  4K3C A;  3FSS A;  3RT3 B;  2Z0D B;  3RCZ A;  4EZL A;  2M14 A;  1V8C A;  4KKJ A;  1BML C;  5IKC M;  2BYF A;  2M19 A;  4KDI C;  4W9J A;  2K3U A;  2BWF A;  2MHJ A;  1UPR A;  1OEY A;  2K5P A;  1OQN A;  3ZYY X;  2QC8 A;  1M7E A;  1WXQ A;  3TMP B;  3BVG A;  1V6E A;  3NHE B;  4HKQ A;  2Z0P A;  4FXC A;  4N9F 4;  4JPS A;  1QLB B;  4LNF A;  1FFU A;  2LFI A;  2ZNV B;  1MK9 B;  1SBB B;  3QAQ A;  2DHZ A;  3WAL A;  4E74 A;  4OZA A;  4C4V B;  4MEL A;  4B9K A;  4HLE A;  4OZB A;  2BBC A;  3TSS A;  2WXH A;  5LLI A;  3AMZ A;  2LD9 A;  4DHJ B;  5JXV A;  4WQM A;  2L7R A;  4XDC A;  4HPM B;  2N0S B;  2G4D B;  3RNC C;  3AU5 A;  4TQ1 A;  1FFV A;  2N9L A;  3HVZ A;  1MPH A;  1SGH A;  1TS5 A;  1UEF A;  1DDM A;  2ZNV C;  5C23 A;  3DWG C;  2PVG C;  2NBW B;  1V5P A;  1FAO A;  3U7D A;  2YT0 A;  1IP9 A;  5EE3 A;  3NWD A;  2DA0 A;  3TEZ A;  1WGY A;  5BMG A;  2MJD A;  2M4N A;  2QCZ A;  4HDO A;  2H7D A;  1R4M B;  2KMC A;  4PT5 A;  1DDV A;  3SUZ A;  2XK5 A;  1CJE A;  1TKG A;  4WJQ A;  3LXF A;  4C80 A;  5LXI B;  4HAX B;  5I2S A;  2BS2 B;  1BTN A;  2WXQ A;  1OQY A;  2N23 A;  2XBB C;  3NS8 A;  4W9L A;  4DQO C;  3NVW A;  1VCB A;  5KQ1 A;  5FI0 A;  3RZW C;  4LNO A;  2IJ0 A;  2V4I B;  2IZV B;  1P7F A;  3ZJU A;  1EF5 A;  1T5X D;  3DVN V;  2JU6 X;  2Y7B A;  4A8X C;  2W9N A;  4WSF A;  3JYU A;  1XO3 A;  4RGO S;  4HRO A;  1AW7 A;  2VZK D;  2QJL A;  2MBO A;  1AQC A;  1STE A;  5IP4 D;  4A3P A;  3RNF C;  4YTP B;  3U2S C;  2DHK A;  2K9X A;  2JYE A;  5J3Y A;  3IT6 B;  2QMT A;  4PS8 A;  2IFS A;  2KYW A;  1EWC A;  2EEL A;  5D6J B;  2QIL A;  1BT0 A;  2Y3A A;  5BYS A;  1PMS A;  3UI3 A;  1P5T A;  1I4R A;  2E3T A;  1E10 A;  2LVQ A;  3PTF C;  1UGM A;  4NAM A;  5L81 A;  3ML4 A;  1C79 A;  3D8D A;  3A4R A;  3OG5 A;  2K8H A;  5TSS A;  5FI1 A;  4JQW C;  1X86 A;  3ZVV A;  2IO3 B;  3L54 A;  1QC6 A;  1W1H A;  2KAJ A;  3U12 A;  2I2Y A;  4C00 A;  2DZI A;  3PZD A;  1KRH A;  1K53 A;  2N7J A;  3B1L X;  1I7H A;  2NCN A;  1XCG A;  3VTU A;  2IGH A;  2XK5 B;  2C7M B;  5FKA C;  1MIX A;  3V6E B;  2KTR B;  3O13 A;  1K52 A;  4BOZ B;  3KWV A;  3RD2 A;  3A9K A;  1E8Z A;  5T8I A;  2WQY B;  1TYG B;  4K3B A;  1WJ4 A;  4XX5 A;  2CR5 A;  2O2V B;  2KJ6 A;  5BYR A;  2YF0 A;  2R2O A;  3V62 A;  4EZJ A;  2DYO A;  3RFZ B;  1J19 A;  2ELB A;  2AQ3 B;  3ZTC A;  3TVV A;  4RMA A;  3ZXR A;  3KYD D;  4OT1 A;  4ACF A;  3QX1 A;  2KAC A;  3QHT A;  2N9P C;  4B0E A;  3GZN B;  4KSK C;  3OHM B;  4PS7 A;  1VZ6 A;  4WIP A;  2UWQ A;  1L2N A;  1ET9 A;  4I6L B;  2NBV A;  3HIE A;  5HKH A;  2J0K A;  3WCQ A;  1FGZ A;  4QJ3 B;  3V60 A;  1X1G A;  4DXF A;  3VXW A;  4GU2 A;  4TSS A;  2JPH A;  4WWN A;  2NMB A;  3B77 A;  1JAL A;  2R0D A;  1BTK A;  1K5D B;  1OY2 A;  2Y8G A;  3KYC D;  4ZHP A;  1YQB A;  1UUP A;  3KQ4 A;  1QOB A;  2UU7 A;  3VOQ A;  2L05 A;  3P4P B;  1T0Y A;  3ZXV A;  4JLC A;  1TTN A;  1MG4 A;  2Z59 A;  3KY9 A;  2NPT B;  2LYD A;  1XKE A;  2KR0 A;  1ROE A;  5G2N A;  3ML8 A;  1XD3 B;  1RJ2 A;  2SEB D;  4HXD A;  2HJ1 A;  4W9F A;  1DOY A;  4AOF A;  5EE9 A;  1MAI A;  1HZ6 A;  2DYB A;  1FD6 A;  2KIG A;  3AB5 A;  1WX8 A;  3DHI C;  1L5P A;  2KFK A;  2BYV E;  2L1A A;  2K8E A;  1E8X A;  5I4D A;  4LK0 M;  2AQ1 B;  3P4R B;  1B9R A;  1TJE A;  1WZ0 A;  2AL6 A;  1IYF A;  3ULC A;  3N1X C;  2MBB B;  4HAV B;  1I4P A;  1WM2 A;  2INP E;  1ZDX A;  2DKQ A;  3ULB A;  1JWS D;  1GOZ A;  2KZR A;  1X1M A;  2CY4 A;  1F2R I;  1ZP0 B;  4WQO B;  2DLB A;  4IC7 B;  3HM6 X;  5CHV C;  2MFQ A;  4C0A A;  1MK7 B;  4KSL C;  1GB1 A;  2DBY A;  2L83 A;  2M17 A;  2MKR A;  2BTE A;  1NEK B;  5FK9 C;  1BAK A;  4QJ4 B;  4O1N A;  2ASQ A;  2ZVN A;  1A5R A;  1C76 A;  2DAJ A;  3GYO A;  4AP4 C;  1TY2 A;  3S2A A;  4GOU A;  2ONQ A;  5DPS A;  4DDI D;  2LRW A;  2Z8L A;  2AYO B;  2KGX B;  1NYQ A;  3AEB B;  4PYZ A;  4TKN A;  1HE8 A;  3AEC B;  1TY0 A;  4OZC A;  3VIA A;  4HPL B;  2X8X X;  4L1B A;  5KHQ A;  4HAW B;  1EF1 A;  2ZPY A;  1QIL A;  2M38 A;  2GBN A;  1V1P B;  5D3W A;  4RH6 A;  2NTT A;  2INC C;  1U27 A;  3SFE B;  3D32 A;  3FC4 A;  2BCJ A;  2KC2 A;  1YX5 B;  3VUW A;  1MIZ B;  2WXL A;  1BXT A;  4GOC A;  2O2V A;  2IYD B;  4YSX B;  4MM3 A;  2IDY A;  2LHE A;  2JP2 A;  1EVH A;  3PT2 B;  2QKM A;  1T0Q C;  1Q1O A;  2MX2 A;  3K9O B;  5AEK B;  2GCJ A;  3V5W A;  3BWU D;  3T3N A;  2LGD A;  3EFC A;  2YEP B;  3HSA A;  1RFK A;  2CHZ A;  4N6E B;  1XD4 A;  4CHK A;  1P1A A;  1R4N I;  3QK0 A;  4KZC A;  1V86 A;  2QEJ C;  3QQ8 B;  4L2Y A;  4L6E A;  4QAY A;  1WXV A;  2BPS A;  3NRZ A;  4MEM A;  5D7G A;  2FE8 A;  1KJT A;  1C4P A;  1F2R C;  5C16 A;  4A20 A;  1QOF A;  4B0M A;  2DYN A;  3DBR I;  2YS3 A;  1YD8 U;  1P0R A;  4J6I A;  1VZ8 A;  3VH4 B;  5DI9 B;  3WYF B;  2KQ7 A;  4W9E A;  2KQ4 X;  2J7Q B;  4NQL B;  2DAF A;  2IPK D;  1QOG A;  2GS0 A;  2LXA A;  4A9A A;  2MJE A;  1JWM D;  4FHK A;  2Z14 A;  3P6A A;  3VVW B;  3A4S C;  2RDH A;  3RMK C;  5G5H A;  4YTM B;  1SIF A;  2TSS A;  1AYF A;  2ACZ B;  4EFO A;  3D8F A;  4XWW A;  2WYQ A;  3BII D;  2KX3 A;  3AE9 B;  4DX9 0;  2L2I A;  4MT5 A;  1YX6 B;  2KFJ A;  3ODO A;  2W3R A;  3AH7 A;  2J53 A;  1F77 A;  2KDM A;  3B9J A;  3TBL D;  3HIZ A;  4A6F B;  3QBV B;  2X38 A;  1J0W A;  5CLQ B;  2ZJD A;  1U2B A;  1RM6 C;  3ALB A;  3MJ5 A;  1D5M C;  1K50 A;  4F8C B;  3PVW A;  4MSQ B;  1KTK A;  1N6Z A;  5E6N A;  1UH6 A;  4NNJ B;  3G9W A;  5HG2 A;  4ITK A;  1UPQ A;  4EUT A;  1FNV A;  3ZUN A;  4YTN B;  3SDL C;  4AS1 A;  2WXM A;  2VZK B;  3ZKJ C;  2K1F A;  4BKS A;  1FNU A;  4HCN B;  2G1E A;  2W55 A;  2RPV A;  2KJH B;  2KKC A;  2V3S A;  3L08 A;  2LGX A;  1JRU A;  3V05 A;  2WDV B;  1L0V B;  4LNI A;  1OMW A;  4GDK A;  5CHF A;  1IGD A;  5DPW A;  4K7W A;  3TFM A;  1Z5S B;  3PZ8 A;  3MHZ A;  4GNK B;  2D9X A;  4KIK B;  1L4D B;  4W9C A;  4TV3 A;  1N5W A;  2K2U A;  2CU3 A;  2L76 A;  2V9H A;  2MH7 A;  3Q6B A;  1QZE A;  1WGG A;  2A4Z A;  3DBS A;  4E71 A;  5CX3 A;  1CK1 A;  1Y56 A;  2N1V A;  1Q10 A;  2KMM A;  3Q2A C;  4B6H A;  2P0D A;  1MKE A;  2JQR B;  3NVV A;  3VRB B;  2BW2 A;  2I38 A;  1YJ1 A;  4LJP B;  4ZOH C;  3VRA B;  1F52 A;  2IO0 B;  1YQ4 B;  2G9H D;  2DLW A;  1T0S C;  3BZD B;  3DVG X;  5J17 A;  1TJ6 A;  2WX1 A;  2GBR A;  3FAH A;  2KTF A;  4NPN A;  2D3G A;  1WGD A;  3B2G A;  4MGK E;  4HB2 B;  3CIK A;  2KN4 A;  1MHH E;  4OVV A;  2ZZP B;  4DX8 A;  4US9 A;  4G0N B;  3L16 A;  3P7Z A;  2LUM A;  1P3Q U;  4JIO U;  5LON B;  1V81 A;  4HAT B;  2K8B A;  1WYG A;  2JUO A;  2KVZ A;  1ET6 A;  4OHJ A;  1TZ1 A;  2LOZ A;  2Q5W D;  1RAX A;  4TMA B;  1SXT A;  4MJS A;  2BYT A;  3TO1 A;  4C7Z A;  4H2A A;  4TYZ A;  2WWZ A;  3P4S B;  1XEE A;  3A1Q B;  4UDU C;  4IAP A;  5JLJ B;  4GSW A;  3WAO A;  4KAX B;  2H89 B;  4WWP A;  4FA6 A;  4L23 A;  4EE2 A;  2WXK A;  5AZG A;  5CLL B;  4JGH B;  1JCK B;  1SE2 A;  1H4R A;  2W2X C;  3MC0 B;  3AE6 B;  5KHO A;  4BKT A;  3H7P B;  3NOB A;  4G3X B;  5LOP B;  4USA A;  3ZQ4 A;  1WGU A;  3HVD A;  3QWZ B;  4YT0 B;  3FIL A;  3GB1 A;  3ZO5 B;  1Y19 B;  5D27 A;  2CHX A;  4KV2 A;  3NUH B;  2MP2 A;  1N62 A;  2LZ6 A;  3WAN A;  1U4A A;  2Y5C A;  2FUH B;  3NSU A;  3Q8A A;  4K7S A;  1YMH E;  4HVB A;  3I5J C;  2WXG A;  4FLH A;  3UZT A;  2CHW A;  2R09 A;  3QIJ A;  2ICI A;  1SEB D;  1KZG A;  4GN1 A;  4GIV A;  4LTU A;  2DYQ A;  4EKU A;  1ZKH A;  3UGB B;  2YEP F;  4M8M A;  1C9F A;  3PLV A;  2NPT A;  3H7S A;  4IFS A;  2PE9 A;  3T9L A;  2M8S A;  2EJ8 A;  2BQQ A;  2JYT A;  1F9J A;  2NTS A;  5DPT A;  4WJ7 A;  2WDQ B;  2KXJ A;  2LOX A;  4ASW C;  1JRO A;  2KLG A;  2K6D B;  3AV8 A;  4HDQ A;  2WXN A;  1P6S A;  3DOW A;  1XCQ L;  4YSZ B;  4K7U A;  4ZRQ A;  4DXA B;  2VRR B;  1HXY D;  3PP2 A;  2AEH A;  3OJ4 B;  2PVO D;  3W1Y A;  3PG7 A;  1H10 A;  1P9D U;  3P63 A;  1SE4 A;  1FMA D;  3GE3 C;  1NDD A;  3KRX A;  2Z0O A;  1FIQ A;  1D4B A;  3L13 A;  3QJZ A;  1YQ3 B;  2C60 A;  2GBM A;  3NWA A;  3IFW B;  4GZU A;  2C9W B;  3QAR A;  2P0F A;  1V88 A;  1XLQ A;  1MG8 A;  3C0R B;  1KLG D;  5J3Q A;  1MHX A;  4IM3 A;  3ABV B;  2KK8 A;  3F5R A;  3IVF A;  2W2W A;  1L0Y B;  4DK5 A;  3GP7 A;  3EHV A;  3TIX A;  5TR5 A;  1C1Y B;  5HE2 A;  2CKH B;  4NJ7 A;  4WAF A;  3ZRC A;  5CHW A;  2YSZ A;  5JHA A;  1FHO A;  2BVC A;  4LDT B;  2MRP A;  3DBL I;  4ARC A;  1PGB A;  4EEW A;  2J42 A;  3VTV A;  4XWT A;  3PRM B;  1SHC A;  1WXS A;  2LGI A;  4OSN A;  2BKF A;  3WAP A;  3Q8F A;  2P0H A;  4IDI A;  1U5G A;  3A8P A;  2N4F A;  3GS2 A;  3B08 A;  4HKZ E;  3BVM A;  2C7N B;  3PO0 A;  1MPE A;  1AWE A;  1BUI C;  3AJ4 A;  3TCA A;  4B95 A;  2ROZ B;  2L1C A;  4BAX A;  3M3J A;  1FO4 A;  3KWL A;  3NVZ A;  1FHX A;  1VDV A;  2JT4 B;  5G5G A;  2D3A A;  3ENE A;  2WU2 B;  1WIA A;  2L32 A;  4WWM A;  3N1Z C;  2YS1 A;  1E90 A;  1WY8 A;  1ZPS A;  3RNE C;  1C77 A;  1FM0 D;  3HUI A;  3P2B A;  5D94 A;  2L52 A;  5MPO A;  3DBR B;  1NI3 A;  1OTR B;  2N7D A;  1V5T A;  3JVZ X;  5HHD G;  4M00 A;  4HB4 B;  2V0G A;  4K1R B;  2J59 M;  3N32 A;  1LW3 A;  3BYT B;  4HB0 B;  3VR8 B;  2HD5 B;  2WXP A;  3Q3M C;  1S3S G;  2DWQ A;  2M0A A;  2OHF A;  1LQB A;  3ECI A;  2A5U A;  4AUQ C;  1LGR A;  4GB9 A;  2YT2 A;  1WRD B;  2Z13 A;  2L00 B;  2CJN A;  2KWD A;  2C7H A;  3SV1 A;  1TBE A;  3VFK A;  3NZ3 A;  1S1Q B;  3BIN A;  4AJW A;  3B0A A;  3RCP A;  3E9S A;  2LVP A;  4XYC A;  1TXD A;  3ZLZ A;  5GMV A;  1C4A A;  1X11 A;  3PRP B;  4IM0 A;  2D11 A;  3A9J A;  4IW0 A;  1WJM A;  5HI1 A;  1PGA A;  5HFY A;  3OAN A;  2QDF A;  1GNU A;  1VD2 A;  1LFD A;  3F0W A;  3VAW A;  5GOW B;  1K5G B;  3KUZ A;  2LJI A;  1PGX A;  2ZKM X;  5DPR A;  1MI0 A;  3TEX A;  2SAK A;  1FB8 A;  2ADZ A;  1FPY A;  3AE4 B;  4AWJ A;  4G11 A;  3PRZ A;  4FUL A;  2KHW B;  3SD5 A;  2MWS B;  3H6N A;  1I2H A;  1JW9 D;  3CSF A;  4KDL B;  3PGE A;  1WXA A;  2C5L C;  2M56 B;  5DIF B;  3DBH I;  1ZSQ A;  4PQ0 A;  1IBX A;  1SB3 C;  1I7A A;  2G4S A;  1JRP A;  2WDT B;  1YJI A;  1ZVR A;  2W3S A;  3W9C B;  2BS3 B;  4WJP A;  1FOE A;  2V3P A;  2BYE A;  2RNR B;  3FEH A;  1Q5W B;  4YL8 A;  2KOX A;  3DXC A;  4ANW A;  2OJW A;  5L83 A;  1D5X C;  3IAM 1;  2IO1 B;  4K81 A;  1WE6 A;  2XN9 C;  2LRU A;  3QC8 B;  4C4V A;  2I5C A;  4ICU A;  1PLS A;  4YON A;  3UQA A;  2IY1 B;  5E6J A;  4FN2 A;  1V89 A;  2V1Y A;  3SO6 A;  2FJU B;  2BWE S;  4R3D A;  2LUE A;  2EKE C;  3PVU A;  3M63 B;  2VRW B;  3EEC A;  1KI1 B;  1E7P B;  4IG7 B;  3DHH C;  1HTO A;  1ENF A;  3N1Y C;  2KC1 A;  4M0W B;  4FHJ A;  2L8J A;  2EC1 A;  1V5M A;  2GMI C;  1N3H A;  2HTH A;  3TEW A;  2D9Y A;  1KM7 A;  4KIK A;  1SJH D;  1NTY A;  1D3Z A;  4KKI A;  2KTR A;  1H8C A;  4GMV A;  4EMO A;  3U8Z A;  2L0F A;  1WJN A;  3MC8 A;  3U30 A;  1LM8 B;  1P98 A;  2IGG A;  3ZTD A;  1FNW A;  4A6F A;  4XC2 A;  4FAD A;  3ZNZ B;  1UGJ A;  3MTN B;  3Q3N C;  1XT9 B;  2NZ8 B;  5C5B B;  3AU4 A;  4D0N B;  2KX0 A;  4PYU A;  3JSV B;  5HE1 A;  1Q0W B;  4F7H A;  1QQG A;  4W9G A;  2PTL A;  4A3O A;  2GOW A;  1AWD A;  2FCM A;  1JWU D;  2FID A;  4P7I A;  2MBQ A;  3ODX A;  1J7A A;  2DTC A;  3Q69 A;  3AE5 B;  5DH9 B;  4YXD B;  2J0J A;  4HAY B;  2MEK A;  4DHZ B;  1GC6 A;  5DHA B;  2D4Q A;  3IHP C;  1EUV B;  2BT6 A;  2N0Y A;  4IWQ A;  3EGR A;  3DVN U;  3UQB A;  1UF0 A;  3DDC B;  4MY6 A;  1MVK A;  3QA8 A;  2MW5 A;  3SU8 X;  2I5F A;  3AUL A;  3P4Q B;  1HEZ E;  4URK A;  2YVC A;  1R7S A;  4ZRI A;  1FXA A;  3A8Q A;  1I4Q A;  2VKI A;  5AZF A;  3D8E A;  5JHB A;  3NZS A;  3KVF B;  2JWU A;  3Q8C A;  4J3O D;  1QOA A;  1GB4 A;  3ZRF A;  3R2I A;  1VJK A;  4BKS D;  1ZW7 A;  2LHD A;  4IKG A;  4WUR A;  1DRO A;  3T8M A;  2QSD A;  1RRB A;  3ZNH B;  5FR6 A;  1EWY C;  1XR0 B;  1LXD A;  4DBB A;  4YSY B;  2RVB B;  3HK0 A;  2KMA A;  2KWU B;  3SHQ A;  1WYW B;  1GAQ B;  1X05 A;  2ZEQ A; 
#chains in the Genus database with same CATH homology
 1GUA B;  2HJ8 A;  3KUD B;  2DLW A;  3ONS A;  4II3 B;  2HTH B;  2FCN A;  3DVG X;  5J17 A;  2MBO A;  1TJ6 A;  1AQC A;  4HB3 B;  4EZK A;  3AI5 A;  2WX1 A;  3QWM A;  4A3P A;  3PHX B;  3N3K B;  2GBR A;  2DHK A;  2CY5 A;  2G35 A;  3FM8 C;  2KTF A;  4NPN A;  2D3G A;  2D10 A;  3VUY A;  1WGD A;  4MGI E;  5J3Y A;  4MGK E;  2G3Q B;  2KWV B;  2KCJ A;  3DXD A;  4HB2 B;  3CIK A;  4MDK E;  2IFS A;  2K2J A;  4PS8 A;  2KNB A;  3APD A;  4OVV A;  2MLB A;  2ZZP B;  4DX8 A;  5D6J B;  3APF A;  1RRP B;  4NSW A;  3P7Z A;  3L16 A;  4G0N B;  1P3Q U;  2JY6 A;  5LON B;  1BT0 A;  4H8S A;  2KUP A;  2LJ5 A;  4JIO U;  2LKO A;  4RM8 A;  3R7R A;  1PMS A;  1UNP A;  1V81 A;  4HAT B;  2K8B A;  2JUO A;  1P5T A;  3LJ3 A;  1TZ1 A;  2LOZ A;  2LVQ A;  1RAX A;  2RR9 A;  3PTF C;  1WVH A;  4MJS A;  4W9I A;  3SNH A;  1UGM A;  2MSE D;  1KLV A;  3TO1 A;  3KZ1 A;  3PHW B;  4NY0 A;  2RD0 A;  4TYZ A;  4Z2N A;  2WWZ A;  4A6K A;  1IRS A;  3BJI A;  5L81 A;  3ML4 A;  2PE6 B;  3A1Q B;  3D8D A;  4BFR A;  1RFA A;  3A4R A;  2DHJ A;  4WJN A;  4HJK A;  3RZF A;  1IYF A;  3VHT C;  1KZ7 A;  2K8H A;  2Z59 B;  3H9D A;  1B55 A;  2FCQ A;  4IAP A;  1WI1 A;  5JLJ B;  5FI1 A;  1LB1 A;  4JQW C;  4GSW A;  3WAO A;  1X86 A;  4IOY X;  4KAX B;  1WR1 A;  2ZEQ A;  1TQZ A;  3ZVR A;  1WF9 A;  4KZC A;  4GDK B;  4M8N A;  4WWP A;  4FA6 A;  1ZC4 B;  3TL5 A;  5HKH A;  2IO3 B;  5JP4 A;  4ZDV A;  2ZCC A;  4W9K A;  5AZG A;  5CLL B;  4JGH B;  3L54 A;  1H4R A;  2W2X C;  1QC6 A;  1W1H A;  2UYZ B;  5KHO A;  4BKT A;  1WJ1 A;  3H7P B;  3NOB A;  4G3X B;  2KWC A;  2DN6 A;  5JHH A;  5LOP B;  1WGU A;  2DZI A;  4IWP A;  3QWZ B;  4XX5 A;  3PZD A;  3ZO5 B;  4FJY A;  4II2 B;  5L95 C;  4I6P A;  3W1S C;  3VH3 B;  1Y19 B;  5D27 A;  1Z2M A;  3B1L X;  2CHX A;  2NCN A;  1XCG A;  4KV2 A;  4EOY A;  3VTU A;  2MP2 A;  2XK5 B;  3ZW3 A;  1Q67 A;  2C7M B;  2J0M A;  2AWT A;  2LZ6 A;  3VH4 B;  2LI5 A;  1U4A A;  3WAN A;  1WJU A;  2E2X A;  3NSU A;  2FUH B;  1MIX A;  4K7S A;  4CO7 A;  3V6E B;  4HVB A;  1WX9 A;  2KTR B;  4CYE A;  5D3Y A;  3UZT A;  1K8R B;  2CHW A;  2KN5 A;  4FLH A;  4F7G A;  2FAZ A;  2BKR B;  4BOZ B;  3QIJ A;  2R09 A;  3RD2 A;  2KAN A;  1KZG A;  4GN1 A;  3A9K A;  4GIV A;  1WG7 A;  2DYQ A;  4EKU A;  1E8Z A;  1NI2 A;  4ZRK A;  1ZKH A;  5E6O A;  3UGB B;  2LVO A;  2MDX A;  4M8M A;  2YS5 A;  2DEN B;  3O65 B;  5E6P A;  4DWF A;  3PLV A;  3N7C A;  2DX5 A;  2NPT A;  1BWN A;  1TGZ B;  3PV1 A;  3L0W B;  2EMS A;  2RUK B;  2GJY A;  3SYX A;  2K00 A;  3H7S A;  4IFS A;  1WJ4 A;  1E5W A;  2PE9 A;  2CR5 A;  2M8S A;  2KJ6 A;  2O2V B;  2YF0 A;  2EJ8 A;  4A5K A;  3L10 B;  3T9L A;  2R2O A;  3NY5 A;  1V61 A;  3V62 A;  1F9J A;  4K17 A;  5DPT A;  4WJ7 A;  4EZJ A;  3CF6 E;  2DYO A;  2KXJ A;  3Q3F A;  3TW1 A;  1ZGU B;  2K39 A;  1J19 A;  4MGZ E;  2ELB A;  3ZTC A;  1I42 A;  2LOX A;  2MBE A;  3TVV A;  4MGY E;  4RMA A;  4A6H A;  1V9J A;  2KD0 A;  4ASW C;  1XOD A;  2KLG A;  3A9J B;  2K6D B;  2M0X A;  3H1U A;  3KYD D;  4HDQ A;  4KHO A;  1P6S A;  3DOW A;  4K7U A;  2KO3 A;  4DXA B;  1UBI A;  2VRR B;  5BO4 B;  2DHI A;  4F7U P;  1G6J A;  3QX1 A;  3PP2 A;  1RLF A;  2AEH A;  3QHT A;  4WJO A;  2N9P C;  2BGF A;  1V5U A;  2KQS A;  3OJ4 B;  3VQI A;  3A9K B;  3W1Y A;  2OQB A;  3PG7 A;  4KSK C;  1H10 A;  4PS7 A;  2LAS A;  1P9D U;  2UWQ A;  5AZH A;  1L2N A;  1WMH B;  1WMH A;  2YRY A;  4I6L B;  3O96 A;  3CST A;  1NDD A;  3JSV A;  3KRX A;  2CRF A;  2J0K A;  2Z0O A;  4XWX A;  3ZNG C;  4ANV A;  1FGZ A;  1WGQ A;  2AL3 A;  4GGQ A;  4MJS B;  3V60 A;  1EAZ A;  2XQN M;  4ANU A;  3L13 A;  3QJZ A;  1X1G A;  1YIW A;  2C60 A;  3VXW A;  4GU2 A;  2JPH A;  5D3V A;  4WWN A;  2NMB A;  3ZNI D;  2GBM A;  4BBN C;  4DBG A;  2DX1 A;  3IFW B;  2IYB A;  2R0D A;  4GZU A;  1BTK A;  1K5D B;  1ZC3 B;  2P0F A;  2C9W B;  3QAR A;  2PPH A;  1M7R A;  4WWO A;  5JH5 C;  3R7Q A;  1V88 A;  2ZPN A;  1OY2 A;  2Y8G A;  1MG8 A;  3C0R B;  1YQB A;  5J3Q A;  3KYC D;  4IM3 A;  2KDE B;  2KK8 A;  1XX0 A;  3F5R A;  3IVF A;  2W2W A;  1U29 A;  3LJU X;  3T06 A;  3VOQ A;  2L05 A;  4DK5 A;  1T0Y A;  1EO6 A;  3ZDM C;  3K9P B;  3EHV A;  2Z0E B;  4JLC A;  4XZ4 A;  1TTN A;  3TIX A;  2CAY A;  3KY9 A;  2RPQ A;  5C79 A;  2LYD A;  2DX5 B;  2NPT B;  5DHF B;  5TR5 A;  4KZ0 A;  1XKE A;  1C1Y B;  3RUI B;  5HE2 A;  5G2N A;  3ML8 A;  2UVM A;  2CKH B;  1WH3 A;  1RJ2 A;  1V49 A;  1XD3 B;  4HXD A;  4NJ7 A;  5CHW A;  3ZRC A;  2O6V B;  2YSZ A;  5JHA A;  1DDW A;  2FJL A;  1FHO A;  4LDT B;  4W9F A;  2MRP A;  3UIN B;  4AOF A;  5DCN A;  3ZIM A;  1MAI A;  3W1S A;  2DYB A;  1WI0 A;  3CXB B;  3DBL I;  2KLC A;  2IBI B;  5C5B A;  4HK2 A;  4HAU B;  1WX7 A;  3DPD A;  4EEW A;  1W1D A;  2JZ3 B;  1AAR A;  3A98 B;  4JL9 A;  3VTV A;  2K8C A;  1WX8 A;  3PRM B;  1SHC A;  1WXS A;  1OEY J;  3HM3 A;  3KW5 B;  2I1J A;  2FCS A;  2JRI B;  3IG3 A;  2BKF A;  3WAP A;  2KFK A;  2P0H A;  1PFJ A;  2BYV E;  4TUU A;  1U5G A;  3A8P A;  2N4F A;  3B08 A;  1E8X A;  1UEL A;  1E8Y A;  2HE7 A;  2C7N B;  4HAZ B;  1AWE A;  2UZS A;  3AJ4 A;  2OTX A;  3TCA A;  2YLM A;  4FJZ A;  4WAA A;  2ROZ B;  3WAM A;  2RLO A;  4B95 A;  2L1C A;  1WZ0 A;  1P3R A;  2AL6 A;  3ULC A;  2P8V A;  2MBB B;  3M3J A;  4HAV B;  4LCD E;  1WM2 A;  2NBU A;  4I6N B;  2LG1 A;  3L17 A;  1ZM0 A;  2DKQ A;  3ULB A;  3VTW A;  2PEA A;  1FHX A;  4HCP B;  2COF A;  4RM9 A;  1WE7 A;  4B6W A;  1NU2 A;  2IO0 B;  2JT4 B;  4MK0 A;  2KZR A;  1X1M A;  2CY4 A;  1PQS A;  2NS5 A;  3ENE A;  3PPA A;  1E7V A;  1WIA A;  4WQO B;  3RUL A;  4IC7 B;  1GJZ A;  3HM6 X;  5CHV C;  3GZN I;  2MFQ A;  3DQV A;  2YS1 A;  4C0A A;  1E90 A;  1WY8 A;  1MK7 B;  4KSL C;  2PZ1 A;  3M95 A;  2M17 A;  3CMM B;  5KQ4 A;  2MKR A;  3JW0 X;  3VDZ A;  2W2X D;  1X1F A;  3WA0 A;  1BAK A;  4DDG D;  3ML9 A;  3P2B A;  2COA A;  2FIF A;  5D94 A;  2L0T A;  2D2Q A;  1OTR B;  2ASQ A;  2N7D A;  1V5T A;  2ZVN A;  3GOE A;  3JVZ X;  4HB4 B;  3GYO A;  3ZDT A;  2DAJ A;  4AP4 C;  4K1R B;  2J59 M;  3N32 A;  4NAW B;  4BBN F;  2JXX A;  2LWP A;  2OOB B;  1LW3 A;  4KVG B;  3S2A A;  4HB0 B;  1FXT B;  3UIO B;  5J18 A;  1R4M I;  2HD5 B;  2KJR A;  2RSG A;  2N7E A;  3OAW A;  1S3S G;  5EFX A;  5DPS A;  4DDI D;  2LRW A;  1FGY A;  1ISN A;  2DFK A;  1LQB A;  2AYO B;  1WM3 A;  2KGX B;  3ECI A;  2BF8 B;  2A5U A;  4AUQ C;  2MQJ A;  4GB9 A;  3PSE B;  3Q3J A;  1SE9 A;  2Y8F A;  4PYZ A;  4TKN A;  1HE8 A;  4HWI B;  3M1I B;  1WRD B;  2JWZ A;  3NZU A;  2L00 B;  5D2M B;  3VIA A;  2C7H A;  3AXC A;  5D3X A;  3SV1 A;  4CHM A;  4HPL B;  3VUX A;  1TBE A;  5KHQ A;  4HAW B;  1EF1 A;  3VFK A;  1S1Q B;  2DYM A;  2B3A A;  3BIN A;  2K25 A;  2GBJ A;  4AJW A;  2ZPY A;  3A33 B;  1WGH A;  1Y8R C;  3B0A A;  2M38 A;  2GBN A;  3RCP A;  2KVR A;  2LVP A;  3KUC B;  5IAA C;  1TXD A;  2LXC A;  2V4L A;  2W9N A;  3ZLZ A;  4ZRJ A;  5D3W A;  5GMV A;  2Q13 A;  1GC7 A;  3JYU A;  1X11 A;  2ZVO A;  1U27 A;  3PRP B;  4IM0 A;  2D11 A;  3TJP A;  1WGR A;  3A9J A;  2UZR A;  1WJ6 A;  4IW0 A;  3D32 A;  1WJM A;  5C1Z A;  2D9W A;  2MBH A;  3OLM D;  3I3T B;  2ROV A;  2BCJ A;  1WXM A;  4K2O A;  1J8C A;  2KC2 A;  3PRE A;  3OAN A;  1E7U A;  1GNU A;  1YX5 B;  1VD2 A;  1Z87 A;  1LFD A;  3RYT A;  3F0W A;  4PS3 A;  2YT1 A;  3VAW A;  1MIZ B;  5GOW B;  3VUW A;  1K5G B;  4GDK A;  2VSZ A;  4LJO B;  3KUZ A;  3PS6 A;  4F7Z A;  4FJV B;  2O2V A;  4GOC A;  3X23 A;  3DXE A;  2IYD B;  5DPR A;  2H7E A;  4MM3 A;  3V61 A;  2JP2 A;  1EVH A;  3PT2 B;  1WZ3 A;  1E8W A;  1WYW B;  2QKM A;  3MPX A;  4BBK A;  4PNK A;  2MP2 B;  2O6V D;  1FB8 A;  1Q1O A;  3MDB C;  2ADZ A;  2GCJ A;  2MX2 A;  3K9O B;  4LDT D;  1NTV A;  5AEK B;  3V5W A;  1UBQ A;  3DVG Y;  4G11 A;  2LGD A;  4Z2M B;  4AWJ A;  3PRZ A;  4FUL A;  1FHW A;  2COC A;  2D07 B;  2KHW B;  1M94 A;  2R2Q A;  2MWS B;  2DKP A;  3H6N A;  3OJ3 A;  4NJ6 A;  1I2H A;  3SD5 A;  2CHZ A;  3CSF A;  1XD4 A;  4KDL B;  4CHK A;  1P1A A;  3PGE A;  4GDL B;  1R4N I;  1WXA A;  2C5L C;  1V86 A;  2IO2 B;  2N9X A;  2RSU A;  2DZK A;  3QQ8 B;  3QK0 A;  4OVU A;  4L6E A;  4DHJ D;  3WIM A;  4DHZ E;  1J0G A;  1I35 A;  1A5R A;  5DIF B;  3DBH I;  1ZSQ A;  4PQ0 A;  3EFU A;  4KHB B;  2N9E B;  1WXV A;  2BPS A;  2V76 A;  3PSC A;  4ICV A;  1I7A A;  2CS4 A;  2G4S A;  2KDB A;  2X18 A;  5HE3 A;  4MEM A;  4GMX B;  5D7G A;  3DCG A;  2ELA A;  2WDT B;  1ZVR A;  2QKL A;  1C3T A;  1KJT A;  3LDZ E;  3V6C B;  5C16 A;  4WJP A;  4Y94 A;  4A20 A;  1FOE A;  3UF8 A;  2BYE A;  2DYN A;  3HQC A;  2G45 B;  3DBR I;  2RNR B;  1CMX B;  3FEH A;  4MT7 A;  2YS3 A;  5KCV A;  1Q5W B;  1UD7 A;  1YD8 U;  2DZM A;  1P0R A;  2ZCB A;  5EDS A;  4YL8 A;  4J6I A;  2Z0Q A;  2KOX A;  3ZVV A;  2Y5B B;  5JZE B;  2M1M A;  3DXC A;  4GPT B;  4IM2 A;  4ANW A;  1DYN A;  4KHA A;  5DI9 B;  3WYF B;  1U5E A;  2IO1 B;  4K81 A;  1WE6 A;  2KQ7 A;  3PVL A;  2LRU A;  3QC8 B;  4W9E A;  4IWO A;  1U5F A;  2REX A;  2J7Q B;  3N30 A;  4NQL B;  2OJR A;  2I5C A;  2DAF A;  2MWN B;  4ICU A;  2JZZ A;  2GS0 A;  1PLS A;  3A1Q A;  2LXA A;  4YON A;  3UQA A;  2IY1 B;  2KFK B;  2D9Z A;  2CU1 A;  2GCL A;  2I1K A;  3KH0 A;  2LUL A;  4FHK A;  2LGY A;  4NAW A;  3IBE A;  4FN2 A;  1V89 A;  5J3T A;  2V1Y A;  3P6A A;  3SO6 A;  3MHS D;  3SHQ A;  5J2R A;  2BWE S;  2NR2 A;  1V5O A;  2IY0 B;  2EKE C;  3PVU A;  2LUE A;  5G55 A;  3VVW B;  4TQ0 A;  3M63 B;  2NBV B;  2VRW B;  1XQQ A;  2JF5 A;  2XEW A;  3A4S C;  2RGN B;  2DZJ A;  1SIF A;  4ZYN A;  3EEC A;  1OGW A;  4BKG A;  1KI1 B;  2D9V A;  4IG7 B;  1NBF C;  5LXH A;  2L3Z A;  2KC1 A;  4M0W B;  4FHJ A;  4EFO A;  2L8J A;  3D8F A;  1UZX B;  4ANX A;  2EC1 A;  1V5M A;  3FSS A;  2GMI C;  3MJW A;  3RT3 B;  2Z0D B;  2WYQ A;  1N3H A;  2HTH A;  3RCZ A;  4EZL A;  2M14 A;  2BYF A;  2KX3 A;  4KDI C;  2D9Y A;  1KM7 A;  4KIK A;  3KSY A;  4DX9 0;  1NTY A;  1D3Z A;  4W9J A;  3KRW A;  2L2I A;  2KTR A;  2PJH A;  1H8C A;  4GMV A;  1YX6 B;  3EC8 A;  4EMO A;  2BWF A;  2KFJ A;  3U8Z A;  2L0F A;  3ODO A;  2N1W A;  4NQK E;  1UPR A;  1OEY A;  5HE0 A;  1WJN A;  2MCN B;  4E3C A;  1Y5O A;  3U30 A;  1OQN A;  5IA7 A;  2GBK A;  2COD A;  1LM8 B;  1P98 A;  3TBL D;  4CHJ A;  4IUM B;  3ZTD A;  3HIZ A;  1M7E A;  4A6F B;  3TMP B;  4A6F A;  4MH0 E;  3R66 C;  2EMT A;  3QBV B;  1J0W A;  4XC2 A;  5CLQ B;  1V6E A;  4FAD A;  3UQB A;  2ZJD A;  3NHE B;  1U2B A;  3ZNZ B;  3ALB A;  2MA9 B;  2Z0P A;  3MTN B;  1XT9 B;  2NZ8 B;  5C5B B;  4F8C B;  3AU4 A;  3PVW A;  4N9F 4;  4D0N B;  2FNJ B;  1W1G A;  5JHG A;  2KX0 A;  2ZNV B;  1MK9 B;  4MSQ B;  4PYU A;  3X0W A;  3JSV B;  5HE1 A;  5E6N A;  1Q0W B;  4F7H A;  3QAQ A;  1UNR A;  1UH6 A;  4BOS C;  1QQG A;  4NNJ B;  3G9W A;  3UIP B;  1UPQ A;  4W9G A;  2DHZ A;  2GOW A;  4A3O A;  3WAL A;  2FCM A;  3BY4 B;  4EUT A;  4E74 A;  2KDF B;  2FID A;  4BVU C;  4P7I A;  3HHM A;  4MEL A;  4B9K A;  3ZUN A;  2MBQ A;  1WR6 E;  3SDL C;  3ODX A;  4HLE A;  4GXB A;  2DTC A;  3HW2 B;  3ZKJ C;  2K1F A;  2K6Q A;  5LLI A;  4BKS A;  5DH9 B;  4K2P A;  1KOT A;  2LD9 A;  4DHJ B;  2RGF A;  4HCN B;  4AJY B;  2L7R A;  2J0J A;  4HAY B;  4HPM B;  3PEG A;  2G4D B;  4DHZ B;  1GC6 A;  2KJH B;  2KKC A;  2V3S A;  3AU5 A;  4TQ1 A;  5DHA B;  2D4Q A;  3IHP C;  1EUV B;  4X57 B;  3L08 A;  2LGX A;  1MPH A;  2N0Y A;  1SGH A;  4IWQ A;  1JRU A;  3DVN U;  5CHF A;  1OMW A;  3DDC B;  1UEF A;  1DDM A;  4MY6 A;  2QHO A;  2ZNV C;  3APC A;  3QA8 A;  2MW5 A;  4K7W A;  5C23 A;  2I5F A;  2O6V A;  3SU8 X;  2NBW B;  3AUL A;  3TFM A;  4W9H A;  4URK A;  1V5P A;  2YVC A;  3M62 B;  1FAO A;  3U7D A;  1V80 A;  1Z5S B;  5L83 A;  3QCA A;  4EJN A;  4ZRI A;  1EGX A;  2YT0 A;  1IP9 A;  3A8Q A;  2JVC A;  2D9X A;  2VKI A;  5AZF A;  4GDL A;  2DA0 A;  3ODW A;  3D8E A;  1WGY A;  1U5D A;  5JHB A;  4KIK B;  3NZS A;  2M4N A;  4HDO A;  2H7D A;  4W9D A;  1UNQ A;  1IPG A;  4W9C A;  5CTR C;  2KMC A;  3KVF B;  4TV3 A;  1DDV A;  2K2U A;  3R3M A;  4G50 A;  2L76 A;  1GG3 A;  3SUZ A;  2XK5 A;  3GYP A;  1QZE A;  4WJQ A;  3ZRF A;  1WGG A;  2A4Z A;  3DBS A;  5C6R A;  2NVU I;  4BKS D;  5CX3 A;  4E71 A;  1ZW7 A;  2JRH A;  2KDI A;  3PLU A;  4HAX B;  4MSM B;  5LXI B;  1BTN A;  4WVF B;  1DRO A;  1OQY A;  2N23 A;  2N1V A;  2XBB C;  3NS8 A;  4W9L A;  4B6H A;  3T8M A;  5DPW A;  1RRB A;  2P0D A;  1VCB A;  1WFY A;  3ZNH B;  1MKE A;  5FI0 A;  5KQ1 A;  3RZW C;  5FR6 A;  4FBJ B;  3H7P A;  4F1S A;  1XR0 B;  1YJ1 A;  1LXD A;  2IZV B;  4HHV A;  4DBB A;  4LJP B;  1EF5 A;  2RVB B;  1V2Y A;  3HK0 A;  2KMA A;  2KWU B;  3DVN V;  1DBH A;  2Y7B A;  4WSF A;  2WX0 A;  1X05 A;  1L7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...