4KVGB

Crystal structure of riam ra-ph domains in complex with gtp bound rap1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
260
structure length
246
Chain Sequence
MKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDNYQRAVARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Rap1 in complex with RIAM reveals specificity determinants and recruitment mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-related protein Rap-1A
total genus 78
structure length 246
sequence length 260
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00169 PH PH domain
B PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4kvgB02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4kvgB01
1GC7A 1Z87A 5L81A 2DHZA 3DPDA 4MGIE 4ICUA 4E3CA 1BAKA 3A33B 4MJSA 2N0YA 2REXA 3M1IB 2OQBA 2HD5B 3A1QA 4HVBA 2KGXB 3JYUA 4DHJD 2Q13A 4NQKE 3AU4A 2YF0A 2M17A 2LG1A 4GPTB 3TCAA 1WGDA 3OANA 2ZEQA 3ENEA 4M0WB 1ZW7A 4H8SA 3ZNHB 4WAAA 3CSFA 4BOZB 2QKMA 1ZSQA 1LQBA 1ZC3B 1WVHA 4KHOA 1MKEA 5LONB 2BF8B 3IFWB 3AI5A 3Q3JA 4PYZA 2JUOA 5LLIA 4W9LA 2CY4A 3CXBB 3WYFB 1DDMA 1DROA 2A5UA 2BWFA 5CX3A 2KD0A 1XCGA 1NTYA 1XODA 2KLGA 3CMMB 4IWPA 5E6PA 4LCDE 3SU8X 1WI0A 2IYBA 2ZJDA 1C3TA 2PE9A 1XX0A 1WFYA 2KANA 4LDTD 1Q5WB 4URKA 4ANVA 2V3SA 3PT2B 4GGQA 3ZTCA 1B55A 3PP2A 2KLCA 5D6JB 2CS4A 3DDCB 4GB9A 4NSWA 2NCNA 3O96A 2C7HA 2Y8FA 2AL6A 2IY0B 3R7QA 3HHMA 1PMSA 4TKNA 3PG7A 1V2YA 4P7IA 5CLQB 2FIDA 3RULA 4Z2NA 2RR9A 3PV1A 1MG8A 2ADZA 2I1JA 1KLVA 1V61A 4F8CB 2BYVE 2K25A 3IG3A 3ULCA 4NJ7A 4TUUA 5IA7A 1X86A 4WJ7A 1I7AA 1TTNA 4II3B 2DYNA 3WALA 5DPWA 5BO4B 5G2NA 3VH3B 2DAFA 1EAZA 5KQ4A 4HHVA 2K1FA 2COFA 4KAXB 2L00B 2RPQA 2CR5A 2OOBB 4PYUA 3QWZB 2IY1B 4BKGA 4BOSC 2UWQA 2KNBA 3A1QB 2AEHA 2DZKA 4EOYA 3PHXB 1WGUA 1H10A 3QQ8B 1V49A 3N32A 1E5WA 1V5MA 2ZNVB 1X11A 4G3XB 1WZ0A 3V61A 3VFKA 1KOTA 3APCA 2CODA 4IAPA 3M63B 3SD5A 2LJ5A 1YIWA 2KWUB 5J2RA 2DENB 4NAWB 3VTUA 3HQCA 5CHWA 5G55A 2FCSA 2O6VD 3VVWB 2YSZA 4AOFA 2KVRA 3V60A 2GCJA 2C7MB 1U5GA 5FR6A 2K2UA 3ZNZB 2COCA 1X1GA 5D3XA 2LASA 2G4SA 3QIJA 3V62A 4F7GA 3W1SA 1J19A 2UYZB 2RSGA 1E8YA 4TV3A 4WJPA 2FIFA 2V76A 3JVZX 4FHJA 4HAXB 1OGWA 2G35A 3DVNU 3O65B 1BWNA 3GOEA 1QZEA 4B6WA 4ANWA 3PLUA 1WZ3A 3QCAA 3U7DA 2LD9A 3ALBA 3PREA 2Y7BA 4MM3A 4NPNA 4DHZB 5L83A 4ZRIA 2DYBA 1X05A 1RAXA 3TL5A 1WMHA 4AWJA 4HB3B 5L95C 4DDGD 2RGNB 1WX7A 3RZFA 5HE1A 1SE9A 2KWVB 2EJ8A 1PLSA 1UELA 2Z0DB 2Z0EB 4G50A 1P3RA 4W9GA 3ZKJC 3QX1A 1QC6A 2KFKB 5TR5A 3ZO5B 4A20A 2LVQA 2N9EB 3DXEA 4YONA 2XK5A 3SO6A 1UBIA 2LVOA 3T9LA 4EFOA 4IC7B 3MPXA 3PEGA 1V6EA 2KOXA 3MTNB 1E8XA 4W9JA 1WI1A 1OEYJ 1WYWB 4RM8A 4I6PA 1XD3B 4BBNF 4MELA 3PPAA 4GSWA 4MH0E 1GJZA 4PQ0A 2NR2A 1ZKHA 4A5KA 2JRHA 3NZUA 4XWXA 4W9FA 5EDSA 1H8CA 2ASQA 3RYTA 4IW0A 3QA8A 4HLEA 1WJUA 1P5TA 2MRPA 3KYCD 4F7ZA 4XC2A 2EC1A 1R4NI 4JIOU 5JZEB 4K7WA 3R66C 4KHBB 3K9OB 2CY5A 1W1HA 1TGZB 2R2QA 1JRUA 3X23A 2G3QB 2Z0PA 4WWPA 3S2AA 3W1YA 2LULA 5D2MB 5AZFA 1NI2A 4KDLB 3PVWA 2N1WA 2CRFA 1PQSA 3A9JB 3JSVA 1K5GB 2D10A 2MKRA 2DN6A 1P9DU 4W9KA 1U29A 2CAYA 4B9KA 1FXTB 2IBIB 2KTRB 2W9NA 2D9YA 2LOZA 3KUZA 3N3KB 3VTWA 4A3OA 1ZC4B 2M4NA 3Q3FA 4PNKA 3A98B 2RGFA 2ZNVC 2WDTB 1Y8RC 5C6RA 4TQ0A 2DYMA 5LOPB 3OLMD 2BYEA 4W9CA 3QBVB 1IRSA 1NU2A 3ML8A 5GMVA 5J17A 4ASWC 1WH3A 2ZVNA 1LFDA 2O6VA 2GCLA 2XK5B 2D9WA 2I1KA 3ML4A 3LJ3A 4TQ1A 2LGXA 2R09A 3IHPC 3L16A 1S1QB 4GIVA 2BGFA 3DVNV 3C0RB 4W9EA 2M14A 3P7ZA 2HJ8A 1TQZA 3N30A 2BCJA 3WA0A 2Z59B 2DYOA 2PE6B 4IUMB 2I5FA 3A4SC 2W2WA 5AEKB 5HE0A 5KQ1A 4EMOA 3V6EB 2LYDA 3EECA 2FAZA 5DIFB 1MK9B 1P6SA 3TFMA 3LJUX 2GMIC 2KN5A 2KTFA 2KDIA 4DHJB 3KZ1A 1WGYA 5D3YA 2P0DA 2LVPA 2LRUA 3KUCB 5C16A 3EC8A 1Z2MA 3VHTC 2YT0A 1WM3A 2RD0A 1AWEA 2YS1A 4GXBA 1EO6A 4GMVA 3M62B 5KCVA 2D9VA 2AL3A 4IG7B 3PSEB 4GDLA 4FN2A 3TJPA 1X1FA 1J0GA 2J0KA 3ZNGC 3EFUA 3ODWA 1Q1OA 4K7SA 1SIFA 5DPSA 3WAMA 4JGHB 1W1DA 2K6DB 4WQOB 3ZRCA 2FNJB 1FHOA 1CMXB 5C79A 4TYZA 2L0FA 1OQNA 1QQGA 2BKRB 2NZ8B 1WIAA 1P0RA 3APDA 3UQBA 5LXHA 3B1LX 2KO3A 5JH5C 1FGYA 2HTHA 1YJ1A 4OVUA 2PZ1A 1G6JA 2FCQA 3VOQA 1V5PA 5J3YA 2K8CA 2EMTA 1EGXA 4B95A 1WJMA 3VUWA 4MGYE 3DCGA 2DHJA 3WAPA 1MAIA 2DA0A 4KIKB 5IAAC 2QKLA 1I35A 3SUZA 2PEAA 3GYOA 1XR0B 4I6LB 3DVGY 3VQIA 4KDIC 1XD4A 3A9KB 1WM2A 3R7RA 2K8BA 4KV2A 2LWPA 2KHWB 2BYFA 5JHAA 1UNPA 2K39A 3PVUA 2JT4B 1SHCA 2L3ZA 2MP2B 2N23A 4HAWB 3TO1A 2NBVB 1RRBA 3DQVA 4KZ0A 3QJZA 4HPLB 1NTVA 3GYPA 1X1MA 1DDWA 1WGGA 3L10B 1WX8A 1RJ2A 2YS5A 2P0FA 2RUKB 5D3VA 1D3ZA 1UEFA 2DKQA 3D8DA 4RMAA 1WX9A 1WR6E 3VDZA 3VUXA 4WJNA 1P3QU 5HE2A 2KX0A 1V86A 2N9XA 5J3QA 2EMSA 2LGDA 2LUEA 2HTHB 2HE7A 2VSZA 4MY6A 1IPGA 4BVUC 2X18A 2DTCA 1WJ4A 1YX5B 4KHAA 2GBNA 3ZDTA 1XKEA 4C0AA 3TIXA 1UGMA 3AJ4A 3P6AA 4WVFB 2D07B 2KFKA 2LXAA 3M3JA 3ONSA 4II2B 1WGQA 5DPRA 4EUTA 1ISNA 2YT1A 3T06A 3KH0A 2M0XA 1E8WA 4CHJA 1LM8B 3MDBC 2LZ6A 4K2PA 3UZTA 4GDLB 4KSKC 4MSQB 1GG3A 1RFAA 4K1RB 2WX0A 2KDBA 3TBLD 4F1SA 1GC6A 2MW5A 1ZM0A 3NY5A 3ULBA 4PS3A 1YD8U 1UBQA 3H1UA 5CLLB 3QHTA 4BKSD 2UVMA 4A6HA 3PGEA 2JRIB 1FGZA 4DXAB 2KMCA 2C60A 4FA6A 2KMAA 3NZSA 1LXDA 4DWFA 4HATB 3RCPA 2XBBC 4MK0A 4PS7A 3AU5A 1DDVA 1V88A 2XQNM 4IOYX 2L8JA 4M8MA 4W9HA 2R0DA 3RT3B 5D7GA 3L0WB 5AZHA 2D4QA 1IP9A 5C1ZA 2FCMA 4GDKA 5J3TA 3KY9A 2BPSA 4NNJB 2KXJA 4GZUA 2KJHB 1PFJA 4F7UP 2KJRA 3IBEA 2M38A 1WRDB 2DX5B 4XZ4A 2G45B 2RSUA 3VH4B 3P2BA 1LB1A 5KHQA 1UPRA 5GOWB 3DOWA 2B3AA 2MDXA 1Q0WB 2IO2B 3TW1A 1E90A 2CHWA 2IFSA 2KKCA 2MA9B 4EKUA 1ZGUB 4GMXB 1NBFC 2DZIA 3SHQA 5DHFB 3VTVA 2WX1A 2DKPA 2KQ7A 1WGHA 1W1GA 4MGZE 1V5OA 4I6NB 5AZGA 3NS8A 1V5TA 2KTRA 3PRMB 2YVCA 2OJRA 2J59M 4IM2A 4N9F4 1KJTA 5LXIB 1T0YA 2LI5A 2MWSB 2JY6A 4MSMB 1WE6A 2JZZA 4J6IA 1FOEA 3A8QA 3X0WA 1KM7A 4JLCA 3F5RA 3ZVVA 1VCBA 3N7CA 3W1SC 1A5RA 1IYFA 2VRWB 4L6EA 1U5FA 4HAZB 2IYDB 5DH9B 1Z5SB 3DBLI 2DFKA 1TZ1A 3HM3A 3NHEB 4FBJB 1Y5OA 2KZRA 2M8SA 3BY4B 3H9DA 3PRPB 1U4AA 4FJYA 3QWMA 2M1MA 3HW2B 4BBNC 2DAJA 4DX8A 2D9ZA 3IVFA 2BWES 2DHKA 2G4DB 4PS8A 5HE3A 4WWOA 1I2HA 4IFSA 1DYNA 2AWTA 2ZCBA 2K6QA 4GDKB 1WJ1A 1M94A 2YLMA 5CHFA 2N7DA 2H7EA 2MWNB 2YS3A 1DBHA 3KUDB 3ZIMA 2NPTB 4HB4B 3ZVRA 1UD7A 3L08A 3FSSA 4FHKA 2JP2A 4LJOB 1TJ6A 1M7EA 3DXCA 2DLWA 1V9JA 2D3GA 2MBEA 2MSED 4HK2A 3OJ4B 4HAYB 4WJOA 1FHXA 1ZVRA 2NBWB 4A6KA 3SDLC 1N3HA 2EKEC 4Z2MB 2IO3B 4FLHA 2I5CA 4BKSA 2IO1B 3ML9A 4CHMA 1UNQA 2MX2A 2GBRA 1K5DB 3D8FA 2WWZA 3CSTA 3UINB 3VUYA 3WAOA 1MK7B 2MBQA 3A8PA 1FAOA 2GS0A 3KSYA 3ODOA 2J0MA 3B0AA 5CTRC 4MJSB 1YQBA 1GUAB 3ZLZA 5JLJB 2CU1A 4WJQA 2DYQA 3GZNI 3KVFB 3D32A 4A3PA 5DCNA 1Y19B 4DX90 3DBHI 3M95A 4MGKE 2GOWA 4A6FA 4DDID 4HB2B 3LDZE 3H7SA 3U30A 1WGRA 2DX5A 4EJNA 1E8ZA 5DPTA 3PSCA 5C5BA 4FULA 4KSLC 1YX6B 3VIAA 3VXWA 2D9XA 4BBKA 3H7PA 3MHSD 1V80A 4FADA 2GBJA 4HXDA 2Y8GA 3A4RA 2C5LC 3OAWA 2P0HA 3BINA 4X57B 2MQJA 2K00A 2O2VA 2GJYA 2KWCA 4AJYB 3U8ZA 3RUIB 4F7HA 2PJHA 4HDQA 1U5EA 2N7EA 2NBUA 3MJWA 1V5UA 2JVCA 1HE8A 2KK8A 1NDDA 3F0WA 1RLFA 2J0JA 1UZXB 3DVGX 2OTXA 3H6NA 3I3TB 2RVBB 2UZRA 2KDFB 2NVUI 1RRPB 3WANA 2JF5A 4KIKA 5HKHA 3UQAA 2KCJA 1MIXA 2A4ZA 5FI1A 4HAVB 2LGYA 1XT9B 1WY8A 2WYQA 4B6HA 4IM3A 2NS5A 1KZ7A 2W2XC 5D3WA 2MCNB 3UIPB 3UIOB 1U5DA 3VAWA 3ZRFA 4ANXA 4DBBA 1EF5A 4D0NB 4IWQA 1MIZB 5KHOA 2ZCCA 2KUPA 2KC1A 2KFJA 2L76A 3JW0X 4MDKE 1EUVB 2N9PC 4M8NA 2NMBA 4RM9A 5D94A 3UGBB 4EEWA 4CYEA 4OVVA 2L1CA 1R4MI 1KI1B 1E7VA 1F9JA 3D8EA 1L7YA 4HCNB 3ECIA 1BT0A 4ZDVA 1U2BA 3L54A 5FI0A 2FJLA 1BTKA 2ELAA 4NY0A 5JHHA 1WE7A 2FUHB 2KX3A 3PS6A 3FEHA 4JL9A 1OTRB 1WXAA 3BJIA 1OQYA 1WXSA 3R3MA 1TBEA 4GU2A 2K8HA 1WJ6A 3A9JA 3HM6X 3JSVB 3WIMA 4E74A 2C9WB 2CHXA 4LDTB 4XX5A 5JP4A 2KDEB 3A9KA 3UF8A 4G11A 3AXCA 4LJPB 5DHAB 3TMPB 4ANUA 4NQLB 3KW5B 1P98A 2K2JA 3KYDD 3L17A 4NJ6A 1FHWA 4HCPB 2MBHA 1SGHA 4WSFA 2N1VA 2KQSA 5CHVC 2GBMA 2VKIA 2O6VB 3OJ3A 4ZRJA 2VRRB 4EZJA 2RNRB 2ZPNA 3QK0A 4IWOA 4HWIB 1WJNA 2IZVB 2LRWA 2MBOA 3PVLA 2QHOA 2XEWA 5E6NA 4A6FB 5C23A 2Y5BB 4JQWC 4EZKA 3L13A 2ZZPB 4HJKA 2L2IA 4DK5A 1LW3A 3DBRI 4ZYNA 1GNUA 1S3SG 1UH6A 3PZDA 2JWZA 3NSUA 3PTFC 4MT7A 4G0NB 1MPHA 4DBGA 3HIZA 4AJWA 2MP2A 2YRYA 2JPHA 2J7QB 4ICVA 1KZGA 1OEYA 3QAQA 4DHZE 4CHKA 2L0TA 1EVHA 4EZLA 2UZSA 2E2XA 2FCNA 2V1YA 4K17A 3SNHA 3QC8B 2DX1A 3AULA 5JHGA 4AP4C 2AYOB 3ZTDA 2W2XD 3PHWB 4HAUB 2NPTA 4GOCA 1WXMA 4YL8A 1C1YB 1U27A 2D11A 1V89A 2N4FA 2DZMA 4KVGB 1J8CA 2DZJA 5JHBA 4BFRA 1XQQA 1EF1A 3RZWC 3V6CB 3ZDMC 5EFXA 1Q67A 2MBBB 5DI9B 4HB0B 1WF9A 3ZW3A 2L7RA 3TVVA 4MEMA 2H7DA 4GN1A 4FJZA 2R2OA 4K2OA 3V5WA 3HK0A 5D27A 1WR1A 2JXXA 2JZ3B 3DBSA 3B08A 2RLOA 3QARA 4NAWA 1OMWA 2ROZB 2Z0OA 4IM0A 1UNRA 2GBKA 1FB8A 4KZCA 3RD2A 4FJVB 4ZRKA 1WMHB 2PPHA 1TXDA 4W9IA 2BKFA 3RCZA 2V4LA 1L2NA 1BTNA 1H4RA 1I42A 4K81A 2COAA 3G9WA 1AQCA 2CHZA 2LXCA 3PLVA 1VD2A 3PRZA 4W9DA 4BKTA 4CO7A 1WXVA 3SYXA 4E71A 3EHVA 2ZVOA 1P1AA 3SV1A 2DHIA 2C7NB 1UPQA 1WG7A 2O2VB 3DXDA 1OY2A 3FM8C 3NOBA 2MLBA 3APFA 1V81A 1E7UA 3ODXA 3KRWA 2D2QA 2LOXA 3H7PB 5J18A 2ZPYA 5C5BB 2KJ6A 4HPMB 1J0WA 2Z0QA 1K8RB 5E6OA 1AARA 4WWNA 1M7RA 2KC2A 3CF6E 3T8MA 2P8VA 2MFQA 3KRXA 3ZUNA 2IO0B 2LKOA 4AUQC 3K9PB 3CIKA 4Y94A 2L05A 4K7UA 2CKHB 3ZNID 4HDOA 2ELBA 2ROVA
chains in the Genus database with same CATH superfamily
2DHZA 4E3CA 4P1CC 3A33B 2GRIA 4HVBA 1K53A 1T3QA 3AU4A 1WGDA 3TCAA 3OANA 1ZW7A 3IFWB 1ZC3B 4KHOA 4ITKA 3NS1A 4YSYB 3SR6A 4W9LA 3R8BA 2J53A 5CX3A 2KD0A 1XCGA 4IWPA 1EU3A 4M01A 5BMIA 1C3TA 1IBXA 2PE9A 1HZ5A 4ANVA 4GGQA 3ZTCA 1GAQB 1NVID 1PGXA 4DXFA 2C7HA 3FILB 2AL6A 2BT6A 3PG7A 1V2YA 2WXMA 4KGSA 4EE2A 1FD6A 4RF0A 2ADZA 1KLVA 2BYVE 2DYNA 4C56C 2L00B 4TMAB 3Q3OC 4YTPB 1HXYD 1YJJA 2IY1B 2UWQA 3A1QB 3PHXB 1WGUA 4ZOHC 1DYQA 2ZNVB 3N1XC 1KOTA 1YIWA 2DENB 1UGJA 2GLSA 4P16A 2FCSA 3VVWB 3B77A 2YSZA 2UU7A 3V60A 1SEBD 3I57A 2GCJA 1XLPA 5TSSA 2K2UA 5BYQA 1X1GA 2LASA 4IOIE 4F7GA 2VH2A 3URYA 1E8YA 3N9YC 1YJIA 4HAXB 1OGWA 1UUPA 1BWNA 1QZEA 3PLUA 3QCAA 3U7DA 3PREA 2Y7BA 3IXSA 1ET9A 4ZRIA 2DYBA 1WX7A 1N61A 5HE1A 1D5MC 1ZDVA 1UELA 2Z0DB 4RGOS 3ZKJC 1P3RA 1K50A 3QX1A 3ZO5B 2LVQA 3AE4B 5BMHA 4YONA 1XLOA 2LVOA 1VZ6A 3MPXA 3MTNB 1QQRA 4RM8A 2D5GA 1YMHE 3R2TA 4BBNF 4MELA 5EDSA 4A5KA 2JRHA 2ASQA 3RYTA 4IW0A 4HLEA 1SE2A 3DBLB 5LG4B 4XC2A 4K7WA 3SEBA 4A90A 3W1YA 2R2QA 3S2AA 2G3QB 2Z0PA 2Z8LA 3A9JB 1PQSA 2DN6A 5HKHA 2JQRB 2IBIB 5AUKA 2M4NA 1JWAD 4PNKA 3A98B 2QIEB 2WDTB 4QAYA 5LOPB 4LNIA 3OLMD 1FXIA 3ML8A 4LLGM 5IP4D 2ZVNA 1LFDA 2O6VA 2GCLA 3NZ3A 1F1HA 3LJ3A 4XGAB 1S1QB 2BGFA 3DVNV 1IGCA 4W9EA 3P7ZA 1TQZA 1FM0D 3UQAA 2PE6B 4YTNB 2I5FA 2W2WA 3U52E 2FAZA 5DIFB 4AQ7A 3AH7A 3LJUX 2GMIC 1KF6B 1R4NB 1JWMD 5D3YA 2LRUA 3KUCB 4L1BA 5JXVA 2YT0A 1WM3A 2RD0A 1AWEA 2PW9A 1T0RC 1EO6A 4IG7B 3TJPA 1SJHD 4JPSA 4RGTA 2J0KA 1QT9A 3ODWA 1Q1OA 4K7SA 1SIFA 4WQOB 3ZRCA 5HFYA 2KQ4X 5C79A 4TYZA 3EA6A 3SFEB 4DQOC 1HEZE 1F52A 2HTHA 3J9CA 2K8CA 2RDBC 4GOUA 5IAAC 2QKLA 1I35A 2H88B 1XR0B 1FMAD 2AQ2B 1JALA 1FFUA 2KHWB 1N6ZA 1SHCA 2RPVA 3DQVA 1RRBA 1NTVA 1WX8A 2P0FA 5D3VA 1UEFA 1WX9A 1WR6E 4WJNA 1F77A 4ZHOA 1P3QU 3L4PA 1VZ7A 4RFBA 2LGDA 2EMSA 2HTHB 2HE7A 2VSZA 4MY6A 1IPGA 2KN4A 1YX5B 4JWUC 1UGMA 4WVFB 2D07B 2KFKA 2LXAA 2YT1A 1EM7A 1E8WA 1LM8B 3UZTA 2WX0A 1ZE3D 1GC6A 5BYRA 3RPFC 3AECB 4PS3A 1OFFA 1UBQA 3H1UA 3QHTA 4BKSD 4A6HA 1KRHA 4FA6A 2XBBC 3W1SC 1IP9A 1TKYA 1WXQA 3KY9A 1PFJA 1LO5D 2DX5B 3VH4B 4N6EB 3P2BA 1YN5A 5GOWB 1MI0A 2RMMA 1ZPSA 2MA9B 2IFSA 5DHFB 2CJOA 2WX1A 3VTVA 4MGZE 1WGHA 4I6NB 2Y5PA 5AZGA 1T0YA 2MWSB 3AN1A 2JY6A 3AE5B 1WE6A 2Y5CA 1FOEA 2VZKB 3A8QA 3X0WA 3BVMA 1VCBA 3N7CA 1SXTA 2YEPB 1J7CA 1Z5SB 2DFKA 2K8EA 3H9DA 2ACZB 4DX8A 3IVFA 3AE1B 1V97A 2G4DB 1TKEA 5HE3A 2ZCBA 2K6QA 1M94A 4HKZE 3AB5A 1I4XA 2N7DA 2H7EA 2L83A 3KUDB 2NPTB 3ZVRA 3FSSA 4LJOB 2DLWA 5T8IA 1V1PA 1E7PB 3RNCC 1BXTA 1QOAA 1N3HA 2EKEC 2QCZA 1UNQA 2GBRA 2WWZA 2MBQA 1JWUD 3ODOA 2AQ1B 1ESFA 4MJSB 4M02A 2CU1A 3DWGC 4A3PA 3GZNI 5DCNA 3DBHI 4OSNA 4HB2B 3H7SA 4EJNA 2YEPF 4FULA 1YX6B 3MHSD 1DOXA 2GBJA 2C5LC 2V3NA 2MQJA 4AJYB 3RUIB 2YT2A 2N7EA 2PTLA 3AE6B 3F0WA 2RVBB 2NVUI 3WANA 1MIXA 5D3DA 4WIPA 2LGYA 3NVZA 2NS5A 2W2XC 1N63A 1EF5A 4B6WA 2ZCCA 2KUPA 2KC1A 2KFJA 3JW0X 3UGBB 2HJ1A 1ET6A 1KI1B 1E7VA 1L7YA 3ECIA 2LUMA 5EE0A 4IM2A 5JHHA 4JL9A 2N0SB 1C79A 1OQYA 5FKAC 3RMKC 3R3MA 2AX5A 3HM6X 1XXGA 2WXKA 2CHXA 4XX5A 3A9KA 3AXCA 1FCLA 3TMPB 3L17A 4HCPB 2MBHA 1SGHA 3OJ3A 2ONQA 1STEA 1WJNA 2LRWA 3PVLA 5E6NA 2Y5BB 4JQWC 2PKOA 3WCQA 1LW3A 3DBRI 3AE7B 2WGSA 1TS4A 4KGRA 2JPHA 1TS2A 3QAQA 4CHKA 3FKYA 1SB3C 2UZSA 2V1YA 4K17A 3SNHA 2DX1A 5JHGA 4AP4C 1L5PA 1TS5A 2AYOB 1DGJA 3AE2B 3NVWA 3IAS1 1UWXA 4JE3B 4HROA 1V89A 2DZMA 1J8CA 2K49A 2FE8A 1EF1A 3W5UB 5EFXA 2SAKA 5DI9B 1WF9A 1YOVB 2JZPA 3PZ7A 4MEMA 2H7DA 4FJZA 4K2OA 5D27A 1WR1A 2WXOA 3U2SC 1OMWA 2MJDA 1FB8A 2BS3B 2QMTA 3RD2A 4AS1A 4FJVB 4MT5A 1TXDA 1J7AA 2VZKD 2CHZA 3G9WA 3SYXA 1UPQA 1C76A 3NOBA 2MLBA 3ODXA 2KYWA 2I38A 1I4PA 3TSSA 4CSQA 2KJ6A 4PT5A 4HPMB 1XF5L 4PK1A 4WWNA 2MFQA 2M19A 1ACCA 4AUQC 3Q8EA 4K7UA 2CKHB 3DPDA 4ICUA 3AEFB 4MJSA 2N0YA 4HEA1 2HD5B 2W55A 3SFDB 2LG1A 4WAAA 2DNFA 2QKMA 2BF8B 2A5UA 1DROA 2BWFA 3MFGA 4A9AA 3CMMB 1XODA 2KLGA 2IYBA 1FIQA 1WFYA 1SF0A 4URKA 3PT2B 1C4PA 3PP2A 2L32A 3DDCB 5CLQB 4Z2NA 3AM9A 1C4CA 1VDVA 2XN9C 1CQVA 5G2NA 3VH3B 2K1FA 2COFA 2RPQA 2CR5A 3QWZB 4BKGA 2K3UA 1SIJA 2KNBA 2AEHA 4EOYA 4WAFA 1V49A 3N32A 4G3XB 3V61A 2KR0A 2CODA 1P7EA 2LJ5A 2QSDA 2M56B 1PGAA 2KVRA 5FR6A 1U5GA 3HUIA 2G4SA 3QIJA 3V62A 3W1SA 2INCC 3OWEB 2RSGA 2V76A 4FHJA 3DVNU 3O65B 1WZ3A 3ALBA 1MG4A 3TL5A 1RAXA 3NWFA 4HB3B 2QJLA 1SE9A 4B0EA 1PLSA 4A20A 1QILA 3H8HA 2WS3B 3DXEA 4BAXA 1UBIA 3R2IA 3PEGA 1V6EA 3FILA 2KOXA 4W9JA 1WI1A 1OEYJ 2ZW1A 1YN3A 4I6PA 1XD3B 3PPAA 1BMLC 4PQ0A 1ZKHA 4RF1A 1H8CA 4US8A 1NYQA 3QA8A 1P5TA 1WYGA 2MRPA 2INNE 3R66C 4IKGA 1TGZB 1JRUA 3X23A 4HPPA 4WWPA 2LULA 4KDLB 2N1WA 2CRFA 1K5GB 5BMGA 3KUZA 2D9YA 2LOZA 3N3KB 3NRZA 1EWCA 4YT0B 2ZNVC 1Y8RC 5C6RA 4TQ0A 3RI7C 2DYMA 3HVZA 5J17A 2BYEA 2WXNA 4ASWC 1WH3A 4OVZA 2LGXA 2R09A 3IHPC 1TS3A 1FNUA 2BCJA 3WA0A 1EU4A 2DYOA 2Z59B 4IUMB 5AEKB 3TFMA 1AW7A 2D3CA 2K9XA 3DHHC 2KDIA 1N5XA 1WGYA 3VHTC 5C16A 1Z2MA 2Y3AA 1SBBB 2YS1A 2AL3A 1TIFA 1X1FA 3ZNGC 5H8YE 3WAMA 4JGHB 4D6WA 1W1DA 2FNJB 2L0FA 3MP9A 1QQGA 2KO3A 1R4MB 1FGYA 1YJ1A 2FCQA 4MH8A 5J3YA 2J4XA 4B95A 1WJMA 3VUWA 3DCGA 1MAIA 1MFWA 2PEAA 3GYOA 1JWSD 3VQIA 3A9KB 1WSPA 2LWPA 5FK9C 3DHGC 5JHAA 1FCCC 4HPLB 3GYPA 2V9HA 1WGGA 2YS5A 1NENB 2RUKB 3D8DA 1TYGB 4RMAA 3VDZA 5HE2A 5IKCM 1V86A 2N9XA 2X18A 2NMQA 3T3NA 3LXFA 1XKEA 3P6AA 4II2B 1ISNA 1PYWD 3KH0A 4W9KA 3ZJUA 3MDBC 4GDLB 4K2PA 4KSKC 4MSQB 4F1SA 1GG3A 3TBLD 2JYEA 2X38A 3C19A 1YD8U 5CLLB 1T0SC 3IAM1 2UVMA 3PGEA 1FGZA 2KMCA 2KMAA 3NZSA 2LGIA 5EE9A 3KQ4A 3AU5A 2XQNM 4M8MA 4IOYX 3RT3B 2XNAC 3L0WB 2D4QA 2FCMA 4GDKA 5H92C 2ON8A 1JROA 2KJHB 2KJRA 2J42A 2M38A 1WRDB 3IBEA 3MJ5A 2G45B 3DOWA 2MDXA 1Q0WB 1NI3A 1E90A 2CHWA 4UDUC 3SHQA 3OG5A 2KQ7A 2V0GA 4DIXA 1V5OA 3PRMB 1V5TA 2J59M 2LI5A 1E10A 2Z4DA 2CU3A 4YWGG 4JLCA 3F5RA 4L6EA 2IGDA 3DWMA 3I9V1 2KZRA 3EGRA 4DXGA 4BBNC 1V1OA 2D9ZA 2BWES 2DHKA 1DYNA 2AWTA 4GDKB 1WJ1A 5CHFA 2WLBA 5GXGB 3KLSX 3ETRA 1M7EA 2JX5A 2MBEA 3BYYB 3OJ4B 2J52A 2NBWB 4A6KA 1TJEA 3SDLC 4J3OD 4RNAA 4Z2MB 2IO3B 2LEKA 4BKSA 2Z13A 5IN7A 3ML9A 1Q10A 2MX2A 1D5ZC 3NJTA 1K5DB 3FC4A 3UINB 3CSTA 3VUYA 3WAOA 3AE3B 3A8PA 1FAOA 2J0MA 5CTRC 1GUAB 2LMCA 3ZLZA 5JLJB 5G5GA 2HTME 2DYQA 5EE3A 3HRDD 3TEWA 1Y19B 2GOWA 2K5PA 3NVYA 1WGRA 2DX5A 3BK1A 3VXWA 2D9XA 3H7PA 4HXDA 3HIEA 2Y8GA 3A4RA 4BKTA 2P0HA 3BINA 2RDGA 2K00A 2KWCA 4XDDA 4RH6A 2JVCA 4REZA 1NDDA 1UZXB 3DVGX 2J0JA 3M95A 2LHEA 3NW8A 4HAVB 1KLUD 2WYQA 4A6QA 1KZ7A 3UIPB 4ANXA 1FRRA 4EEWA 2N9PC 3FAHA 4RM9A 2NMBA 1D5XC 3ZXRA 2B76B 3D8EA 2WDVB 4ZDVA 1U2BA 3L54A 1BTKA 4NY0A 1WE7A 2FUHB 3PS6A 2WXGA 3BJIA 1WXSA 2WDQB 1YQ3B 3BVZA 3IT4B 3N20C 4S17A 4NJCA 3W5VB 3A9JA 5I4DA 2WXHA 5JP4A 1ZDXA 3UF8A 5DHAB 4NQLB 4GNKB 3KW5B 2K2JA 2N1VA 1WWTA 2O6VB 3E9SA 1FXAA 4IWOA 2IZVB 2MBOA 2XEWA 2N9LA 3L13A 2KVZA 1S3SG 1UH6A 3PZDA 3PTFC 1E6EB 4K3BA 3HIZA 4AJWA 3U4EG 5E6JA 1WGKA 1KZGA 4RCOA 2KIEA 4EZLA 1L0VB 2FCNA 3QC8B 1ZOYB 5IO9A 2W2XD 2ZW0A 1JRPA 1MHXA 1C4AA 1QOFA 2WU5B 4YL8A 3KWVA 2N4FA 5JHBA 4BFRA 1MI1A 4HB0B 2L7RA 3TVVA 4GN1A 4M0WB 3Q8BA 4I6LB 3V5WA 3DBSA 3HK0A 3NWAA 4L23A 3VRAB 4C4VB 2RLOA 2ROZB 2Z0OA 1PFDA 1UNRA 2TSSA 4W9IA 2PPHA 3CIRB 3GE3C 2V4LA 1H4RA 1MHHE 2COAA 4W9DA 1VD2A 1M4VA 1YQ4B 2IJ0A 3SV1A 2DHIA 2C7NB 5IRSA 1OY2A 1V81A 2D2QA 5J18A 2ZPYA 4NAMA 3T8MA 3CF6E 2P8VA 3KRXA 3K9PB 3CIKA 1XCQL 4HDOA 3I5JC 1GC7A 1Z87A 1IUEA 2OQBA 3A1QA 4HJGE 1GB1A 2Q13A 4NQKE 4ZRPA 2YF0A 2W3SA 2FBWB 2ZEQA 3ENEA 2BBCA 4M00A 3ZNHB 4BOZB 3CSFA 1ZSQA 1MKEA 3Q3JA 3AI5A 1V1PB 4PYZA 4WQMA 1J7BA 3LB8C 1DDMA 4XWTA 3P4SB 2QEJC 3MC9A 3SU8X 5E6PA 4LCDE 1WI0A 1FO4A 2KANA 4LDTD 1Q5WB 5D6JB 4N58A 4GB9A 2L1AA 4NSWA 2NCNA 3O96A 2AQ3B 2Y8FA 2IY0B 3VRBB 3HHMA 3Q69A 4TKNA 1T0QC 3ZJTA 3PV1A 1MG8A 2I1JA 2BW2A 3ULCA 2BS2B 4NJ7A 5IA7A 3WALA 4WJ7A 1NEKB 5G5HA 5BO4B 3GP7A 3BVGA 1EAZA 5KQ4A 4HHVA 4KAXB 2BTEA 1KFYB 2OOBB 3P1MA 4P1BC 4BOSC 4LK0M 2E3TA 3QQ8B 3IT6B 1H10A 1E5WA 1V5MA 3APCA 3M63B 2KWUB 5J2RA 4NAWB 1K51A 5G55A 2C7MB 2DBYA 1JMLA 1J19A 2UYZB 2IPKD 1UNSA 4USAA 3Q6BA 4TV3A 1FNWA 2FIFA 3ZJVA 4ANWA 1UWMA 4NPNA 1X05A 1WMHA 1KTKA 3ZQ4A 5L95C 2Z59A 2RGNB 2Z0EB 4C4VA 1QC6A 2KFKB 5TR5A 2GB1A 2XK5A 3SO6A 1R7SA 4EFOA 4IC7B 1CZPA 1WYWB 2WP9B 1GJZA 2OHFA 4W9FA 2INPE 3Q14C 4O1NA 4OZAA 4MACA 4F7ZA 4D2KA 4WWMA 1R4NI 2W82A 2CY5A 1W1HA 1AYFA 2M0AA 1WRIA 5AZFA 3JSVA 2WXQA 2D10A 2MKRA 1P9DU 1FXTB 3VTWA 1JQ4A 2JU6X 1ZC4B 2WXIA 3BWUD 3Q3FA 4YSZB 2RGFA 3W9CB 1A70A 1IRSA 2I1KA 4TQ1A 5I2SA 3C0RB 1CK1A 2M14A 3U12A 2LGSA 3N30A 1GOZA 3A4SC 5HE0A 4EMOA 3V6EB 2LYDA 2Z14A 1TZOA 2KTFA 3KZ1A 3CWIA 4B9KA 2P0DA 4FXCA 4WURA 3RN9C 4GMVA 1QOGA 3M62B 2WXJA 3PSEB 3U7ZA 1J0GA 3EFCA 4HRSA 4K3CA 2GUMA 1CMXB 2BKRB 3TEYA 2NZ8B 1WIAA 1P0RA 3UQBA 3B1LX 5JH5C 1G6JA 2EMTA 1EGXA 1VZ8A 2KUQA 2DHJA 1I7HA 2DA0A 5LNK1 1C77A 3DVGY 1K52A 3AE8B 1UNPA 4HAWB 4KZ0A 1X1MA 1XLNA 3AE9B 3VUXA 2KX0A 5J3QA 4BVUC 4XWWA 4ARCA 2DTCA 1WJ4A 4ZYSA 3ZDTA 2DLBA 4C0AA 3TIXA 4JX1C 3M3JA 3ONSA 4EUTA 3T06A 4CHJA 1FPYA 2KIGA 2LZ6A 3MC0B 4RGNA 1RFAA 4K1RB 3OHMB 1PUTA 2MW5A 2WXLA 1ZM0A 3ULBA 2LJIA 4DXAB 1LXDA 1HZ6A 4MK0A 5D7GA 5AZHA 4YSXB 2N7JA 4L1RA 2PLPA 2BPSA 2NTTA 2RSUA 3UI3A 2B3AA 2KKCA 4EKUA 4GMXB 1NBFC 1I4QA 3NS8A 2KTRA 2YVCA 4N9F4 1KJTA 4MSMB 2JZZA 4J6IA 4S0RA 1KM7A 2H89B 2WXRA 2VRWB 1U5FA 4HAZB 1OQQA 2IYDB 5DH9B 3DBLI 2WXFA 3HM3A 1Y5OA 2M8SA 3PRPB 4LNNA 1U4AA 2JSVX 4FJYA 2WQYB 2M1MA 1F2RI 4WWOA 1CJEA 1HTQA 1I2HA 4IFSA 1ZP0B 3BIID 3V05A 4LNKA 1N62A 2YLMA 2MWNB 1DBHA 1PGBA 3L08A 1T5XD 1TJ6A 1QF6A 2WHIA 1V9JA 2D3GA 2R2YA 3NWDA 1HTOA 2QDFA 2PMVA 4HAYB 3MC8A 1FHXA 3TUOA 4YXDB 3VR8B 4OHJA 3D8FA 1MK7B 3KSYA 2GI9A 2LHDA 3B0AA 4C7YA 2DWQA 4HKQA 1FRDA 4L2YA 3GS2A 4WJQA 3HVDA 4C00A 3D32A 4MGKE 4DX90 4A6FA 2K0PA 3U30A 4ZHPA 1E8ZA 5DPTA 5C5BA 4KSLC 2MH7A 3VIAA 4BBKA 1L6UA 2FJUB 2KACA 5HI1A 1D4BA 3OAWA 4X57B 2O2VA 2GJYA 3I63C 3U8ZA 1ENFA 2PJHA 3DCXA 1U5EA 1RM6C 2W54A 1MVKA 4BZAA 2KK8A 1RLFA 3H6NA 2UZRA 2IDYA 2I2YA 1RRPB 2JF5A 4KIKA 5FI1A 1WY8A 4B6HA 2MCNB 3VAWA 3ZRFA 1U5DA 3AEGB 4D0NB 2ICIA 4M0WA 2L76A 3V3XA 1EUVB 3B2FA 5D94A 1ROEA 2BYTA 4CYEA 4OVVA 1R4MI 1F9JA 1PDXA 2V4IB 4HCNB 1JWBD 1BT0A 3PZ8A 3FEHA 1WXAA 1TY0A 3E56A 4GU2A 2K8HA 4E74A 1F2RC 2KDEB 1RYJA 4G11A 4LJPB 3GZNB 1AWDA 1P98A 3KYDD 4NJ6A 1FHWA 5CHVC 2JYTA 2WXPA 3GE8C 2VRRB 4EZJA 5C23A 4EZKA 3GB1A 2ZZPB 2L2IA 4ZYNA 1GNUA 4Q2JA 1FFVA 2JWZA 3NSUA 4MT7A 4KX6B 1MPHA 4LNFA 4DBGA 2NBVA 4XE0A 2J7QB 1TT5B 4ICVA 4DHZE 2BVCA 2KAJA 3AULA 4LTUA 3P42A 2G9HD 3ZTDA 3PHWB 4HAUB 3B9JA 4HSIA 1C1YB 1U27A 2D11A 2DZJA 3RZWC 3ZDMC 2MBBB 2D3BA 4DHZB 2R2OA 4NAWA 5C3JB 3QARA 2K22A 4IM0A 2GBKA 4KZCA 4KKIA 2BKFA 4OZBA 1B1ZA 2MJEA 4K81A 2LXCA 3PLVA 4CO7A 3RNGC 1VRAB 2ZVOA 1WG7A 1ZYIA 3FM8C 1E9MA 4KHBA 3P4PB 1E7UA 1QKZA 3KRWA 2LOXA 1T6BX 5C5BB 5E6OA 1K8RB 1AARA 1M7RA 2KC2A 2IO0B 3ZXVA 4Y94A 3ZNID 3RNEC 1VR9A 2ELBA 2ROVA 5L81A 4MGIE 1F0ZA 2LFIA 1BAKA 2REXA 4IDIA 3M1IB 2IGHA 2KGXB 3JYUA 4DHJD 2OJWA 1HA5A 2M17A 4GPTB 5DPWA 4H8SA 2SEBD 1LQBA 5LONB 1WVHA 3HSAA 5LLIA 2JUOA 1XEEA 2CY4A 3CXBB 3WYFB 1P7FA 2PVGC 1NTYA 3TEZA 1GPXA 2ZJDA 1XX0A 3W2DA 3NUHB 2V3SA 1I4RA 1B55A 2KLCA 2CS4A 3R7QA 1PMSA 1B9RA 3RULA 4P7IA 2FIDA 1Y56A 2RR9A 3BK2A 1V61A 4F8CB 3AEDB 3T3OA 2K25A 3IG3A 2R61A 4TUUA 1X86A 1TTNA 1I7AA 2N9KA 4II3B 2DAFA 3N1ZC 1ZXHA 1JCKB 4PYUA 2ZKMX 2QILA 1SE4A 1I4GA 1YN4A 3AEEB 1L6VA 1X11A 3N1YC 1WZ0A 2MHJA 3VFKA 4IAPA 3SD5A 3VTUA 3HQCA 1HQRD 5CHWA 1L4DB 2O6VD 1SSNA 4AOFA 2IGGA 1ZXIA 3ZNZB 2COCA 1C78A 5D3XA 2EELA 4QXAB 2OEDA 4WJPA 3JVZX 2G35A 4XYCA 2W3RA 3GOEA 4P6VF 2LD9A 4MM3A 3P4QB 5L83A 4AWJA 4DDGD 3RZFA 2KWVB 1NYRA 2EJ8A 3C8YA 4W9GA 4G50A 3ZYYX 2KMMA 2N9EB 2V3PA 1E8XA 3FVCA 1IBXB 4GSWA 4MH0E 2QC8A 2NR2A 3NZUA 1E0ZA 1JW9D 4XWXA 2X8XX 3A58A 1WJUA 3KYCD 2EC1A 4JIOU 5JZEB 4KHBB 3K9OB 4ZRQA 5D2MB 1NI2A 3PVWA 3Q8CA 1L2NA 2MEKA 3P63A 1U29A 2CAYA 2KTRB 2W9NA 3AV8A 1KH0A 4C7ZA 3DBHB 3AEAB 3AMZA 4W9CA 3QBVB 1NU2A 5GMVA 2PIAA 2XK5B 2D9WA 1AN8A 3ML4A 4GLSC 4XDCA 4GIVA 3L16A 4CQNA 1RWSA 2HJ8A 3EUB2 5I2MA 2HDEA 2NTSA 5KQ1A 3EECA 1MK9B 1P6SA 2KDMA 3ZGZA 2KN5A 2FUG1 4DHJB 2LVPA 3EC8A 4GXBA 5KCVA 2D9VA 4GDLA 4FN2A 3DHIC 3EFUA 3MHZA 4WH4A 1BUIC 5DPSA 1L0XB 2K6DB 1FHOA 1OQNA 5EE1A 1T77A 3APDA 2L52A 4OVUA 2PZ1A 5C2TB 3VOQA 1V5PA 3TEXA 4MGYE 3RNAC 3WAPA 5IOIA 2BS4B 4KIKB 3SUZA 2E6XA 1XLQA 1XD4A 1WM2A 3R7RA 2K8BA 4KV2A 1DOYA 4LNOA 2BYFA 2K39A 3PVUA 2JT4B 2MP2B 2L3ZA 1XO3A 2N23A 3TO1A 3T9LA 2NBVB 1N5WA 3QJZA 1DDWA 3L10B 1RJ2A 3RNBC 1D3ZA 2DKQA 2LUEA 2GBNA 4KHAA 3BZDB 3AJ4A 4KDIC 2WU2B 1WGQA 5DPRA 1UF0A 4TSSA 2M0XA 1QLBB 2KDBA 2WNMA 3RFZB 4KGTA 2Q5WD 3NY5A 4ACFA 4MM3B 2BQQA 2JWUA 5M4YB 2JRIB 2C60A 3Q3NC 3P4RB 4DWFA 4HATB 3RCPA 4PS7A 1DDVA 1V88A 2L8JA 4W9HA 2R0DA 5J3TA 4ARIA 3NVVA 4NNJB 2KXJA 4GZUA 2VH1A 4F7UP 5KHQA 1LB1A 1UPRA 2IO2B 3AEBB 3TW1A 1ZGUB 2DZIA 2DKPA 1W1GA 1GB4A 2G1EA 2OJRA 1DOIA 5LXIB 3Q2AC 1D6EC 3ABVB 1IGDA 3ZVVA 1IYFA 1A5RA 2MJ3A 1TZ1A 3NHEB 5LXHA 2BB5A 4FBJB 3BY4B 3Q8FA 3QWMA 3HW2B 1SJED 2DAJA 4N59A 4PS8A 1XCTL 2YS3A 3ZIMA 1MPEA 4HB4B 1UD7A 4FHKA 2JP2A 1C9FA 3DXCA 4A8XC 2MSED 4HK2A 1VJKA 2D3AA 4WJOA 1ZVRA 1LGRA 4FLHA 2I5CA 2IO1B 2PVOD 4CHMA 4B0MA 5AUIA 2GS0A 2JXTA 1KLGD 5HG2A 1YQBA 3KVFB 3BYTB 4DDID 2RRFA 1OQRA 3VR9B 3LDZE 4QJ5B 3PSCA 5MPOA 4C80A 4YTMB 1V80A 4FADA 1I4HA 3Q8AA 5HHDG 4F7HA 4QJ4B 4HDQA 3MJWA 2NBUA 4RGMA 2KWDA 1V5UA 1HE8A 3I3TB 2OTXA 2KCJA 2A4ZA 1XT9B 4E71A 4IM3A 3UIOB 5D3WA 1VLBA 3O13A 4DBBA 4IWQA 1MIZB 5KHOA 2BB6A 4M8NA 4MDKE 1RFKA 2L1CA 3KWLA 4US9A 1L4ZB 5FI0A 2FJLA 2ELAA 2KX3A 1OTRB 1TBEA 1WJ6A 3JSVB 3WIMA 2C9WB 4LDTB 4ANUA 5FR3A 2INDC 4WSFA 2KQSA 2GBMA 2VKIA 4ZRJA 2RNRB 2ZPNA 2KT7A 3QK0A 5BYSA 4HWIB 4A3OA 2QHOA 4A6FB 3RNFC 4HJKA 4DK5A 4G0NB 3Q3MC 4R3DA 2MP2A 2YRYA 5D3IB 3LYYA 1QOBA 1OEYA 4OZCA 2L0TA 1EVHA 1FEHA 2E2XA 4H2AA 1SE3A 2EKIA 1ZUD2 3NG0A 1MJDA 1V8CA 1TKGA 2NPTA 4GOCA 1WXMA 4KVGB 2RDHA 1XQQA 1FNVA 3V6CB 1Q67A 3ZW3A 2JXXA 2JZ3B 3B08A 1EWYC 3B2GA 4JWSC 4KKJA 1L0YB 4ZRKA 1WMHB 3RCZA 1TY2A 1BTNA 1I42A 1YNTE 1AQCA 3PRZA 1WXVA 3EHVA 1P1AA 4XZ4A 1N60A 2O2VB 3DXDA 4A55A 3APFA 4QJ3B 2WDRB 3H7PB 3DBRB 2CJNA 1J0WA 2Z0QA 5C1ZA 3PO0A 2LKOA 4OT1A 2L05A 4NZLB 2KDFB 3ZUNA 2DZKA 4OW0A
chains in the Genus database with same CATH topology
1GC7A 1Z87A 5L81A 2DHZA 3DPDA 4MGIE 4ICUA 4E3CA 1BAKA 3A33B 4MJSA 2N0YA 2REXA 3M1IB 2OQBA 2HD5B 3A1QA 4HVBA 2KGXB 3JYUA 4DHJD 2Q13A 4NQKE 3AU4A 2YF0A 2M17A 2LG1A 4GPTB 3TCAA 1WGDA 3OANA 2ZEQA 3ENEA 4M0WB 1ZW7A 4H8SA 3ZNHB 4WAAA 3CSFA 4BOZB 2QKMA 1ZSQA 1LQBA 1ZC3B 1WVHA 4KHOA 1MKEA 5LONB 2BF8B 3IFWB 3AI5A 3Q3JA 4PYZA 2JUOA 5LLIA 4W9LA 2CY4A 3CXBB 3WYFB 1DDMA 1DROA 2A5UA 2BWFA 5CX3A 2KD0A 1XCGA 1NTYA 1XODA 2KLGA 3CMMB 4IWPA 5E6PA 4LCDE 3SU8X 1WI0A 2IYBA 2ZJDA 1C3TA 2PE9A 1XX0A 1WFYA 2KANA 4LDTD 1Q5WB 4URKA 4ANVA 2V3SA 3PT2B 4GGQA 3ZTCA 1B55A 3PP2A 2KLCA 5D6JB 2CS4A 3DDCB 4GB9A 4NSWA 2NCNA 3O96A 2C7HA 2Y8FA 2AL6A 2IY0B 3R7QA 3HHMA 1PMSA 4TKNA 3PG7A 1V2YA 4P7IA 5CLQB 2FIDA 3RULA 4Z2NA 2RR9A 3PV1A 1MG8A 2ADZA 2I1JA 1KLVA 1V61A 4F8CB 2BYVE 2K25A 3IG3A 3ULCA 4NJ7A 4TUUA 5IA7A 1X86A 4WJ7A 1I7AA 1TTNA 4II3B 2DYNA 3WALA 5DPWA 5BO4B 5G2NA 3VH3B 2DAFA 1EAZA 5KQ4A 4HHVA 2K1FA 2COFA 4KAXB 2L00B 2RPQA 2CR5A 2OOBB 4PYUA 3QWZB 2IY1B 4BKGA 4BOSC 2UWQA 2KNBA 3A1QB 2AEHA 2DZKA 4EOYA 3PHXB 1WGUA 1H10A 3QQ8B 1V49A 3N32A 1E5WA 1V5MA 2ZNVB 1X11A 4G3XB 1WZ0A 3V61A 3VFKA 1KOTA 3APCA 2CODA 4IAPA 3M63B 3SD5A 2LJ5A 1YIWA 2KWUB 5J2RA 2DENB 4NAWB 3VTUA 3HQCA 5CHWA 5G55A 2FCSA 2O6VD 3VVWB 2YSZA 4AOFA 2KVRA 3V60A 2GCJA 2C7MB 1U5GA 5FR6A 2K2UA 3ZNZB 2COCA 1X1GA 5D3XA 2LASA 2G4SA 3QIJA 3V62A 4F7GA 3W1SA 1J19A 2UYZB 2RSGA 1E8YA 4TV3A 4WJPA 2FIFA 2V76A 3JVZX 4FHJA 4HAXB 1OGWA 2G35A 3DVNU 3O65B 1BWNA 3GOEA 1QZEA 4B6WA 4ANWA 3PLUA 1WZ3A 3QCAA 3U7DA 2LD9A 3ALBA 3PREA 2Y7BA 4MM3A 4NPNA 4DHZB 5L83A 4ZRIA 2DYBA 1X05A 1RAXA 3TL5A 1WMHA 4AWJA 4HB3B 5L95C 4DDGD 2RGNB 1WX7A 3RZFA 5HE1A 1SE9A 2KWVB 2EJ8A 1PLSA 1UELA 2Z0DB 2Z0EB 4G50A 1P3RA 4W9GA 3ZKJC 3QX1A 1QC6A 2KFKB 5TR5A 3ZO5B 4A20A 2LVQA 2N9EB 3DXEA 4YONA 2XK5A 3SO6A 1UBIA 2LVOA 3T9LA 4EFOA 4IC7B 3MPXA 3PEGA 1V6EA 2KOXA 3MTNB 1E8XA 4W9JA 1WI1A 1OEYJ 1WYWB 4RM8A 4I6PA 1XD3B 4BBNF 4MELA 3PPAA 4GSWA 4MH0E 1GJZA 4PQ0A 2NR2A 1ZKHA 4A5KA 2JRHA 3NZUA 4XWXA 4W9FA 5EDSA 1H8CA 2ASQA 3RYTA 4IW0A 3QA8A 4HLEA 1WJUA 1P5TA 2MRPA 3KYCD 4F7ZA 4XC2A 2EC1A 1R4NI 4JIOU 5JZEB 4K7WA 3R66C 4KHBB 3K9OB 2CY5A 1W1HA 1TGZB 2R2QA 1JRUA 3X23A 2G3QB 2Z0PA 4WWPA 3S2AA 3W1YA 2LULA 5D2MB 5AZFA 1NI2A 4KDLB 3PVWA 2N1WA 2CRFA 1PQSA 3A9JB 3JSVA 1K5GB 2D10A 2MKRA 2DN6A 1P9DU 4W9KA 1U29A 2CAYA 4B9KA 1FXTB 2IBIB 2KTRB 2W9NA 2D9YA 2LOZA 3KUZA 3N3KB 3VTWA 4A3OA 1ZC4B 2M4NA 3Q3FA 4PNKA 3A98B 2RGFA 2ZNVC 2WDTB 1Y8RC 5C6RA 4TQ0A 2DYMA 5LOPB 3OLMD 2BYEA 4W9CA 3QBVB 1IRSA 1NU2A 3ML8A 5GMVA 5J17A 4ASWC 1WH3A 2ZVNA 1LFDA 2O6VA 2GCLA 2XK5B 2D9WA 2I1KA 3ML4A 3LJ3A 4TQ1A 2LGXA 2R09A 3IHPC 3L16A 1S1QB 4GIVA 2BGFA 3DVNV 3C0RB 4W9EA 2M14A 3P7ZA 2HJ8A 1TQZA 3N30A 2BCJA 3WA0A 2Z59B 2DYOA 2PE6B 4IUMB 2I5FA 3A4SC 2W2WA 5AEKB 5HE0A 5KQ1A 4EMOA 3V6EB 2LYDA 3EECA 2FAZA 5DIFB 1MK9B 1P6SA 3TFMA 3LJUX 2GMIC 2KN5A 2KTFA 2KDIA 4DHJB 3KZ1A 1WGYA 5D3YA 2P0DA 2LVPA 2LRUA 3KUCB 5C16A 3EC8A 1Z2MA 3VHTC 2YT0A 1WM3A 2RD0A 1AWEA 2YS1A 4GXBA 1EO6A 4GMVA 3M62B 5KCVA 2D9VA 2AL3A 4IG7B 3PSEB 4GDLA 4FN2A 3TJPA 1X1FA 1J0GA 2J0KA 3ZNGC 3EFUA 3ODWA 1Q1OA 4K7SA 1SIFA 5DPSA 3WAMA 4JGHB 1W1DA 2K6DB 4WQOB 3ZRCA 2FNJB 1FHOA 1CMXB 5C79A 4TYZA 2L0FA 1OQNA 1QQGA 2BKRB 2NZ8B 1WIAA 1P0RA 3APDA 3UQBA 5LXHA 3B1LX 2KO3A 5JH5C 1FGYA 2HTHA 1YJ1A 4OVUA 2PZ1A 1G6JA 2FCQA 3VOQA 1V5PA 5J3YA 2K8CA 2EMTA 1EGXA 4B95A 1WJMA 3VUWA 4MGYE 3DCGA 2DHJA 3WAPA 1MAIA 2DA0A 4KIKB 5IAAC 2QKLA 1I35A 3SUZA 2PEAA 3GYOA 1XR0B 4I6LB 3DVGY 3VQIA 4KDIC 1XD4A 3A9KB 1WM2A 3R7RA 2K8BA 4KV2A 2LWPA 2KHWB 2BYFA 5JHAA 1UNPA 2K39A 3PVUA 2JT4B 1SHCA 2L3ZA 2MP2B 2N23A 4HAWB 3TO1A 2NBVB 1RRBA 3DQVA 4KZ0A 3QJZA 4HPLB 1NTVA 3GYPA 1X1MA 1DDWA 1WGGA 3L10B 1WX8A 1RJ2A 2YS5A 2P0FA 2RUKB 5D3VA 1D3ZA 1UEFA 2DKQA 3D8DA 4RMAA 1WX9A 1WR6E 3VDZA 3VUXA 4WJNA 1P3QU 5HE2A 2KX0A 1V86A 2N9XA 5J3QA 2EMSA 2LGDA 2LUEA 2HTHB 2HE7A 2VSZA 4MY6A 1IPGA 4BVUC 2X18A 2DTCA 1WJ4A 1YX5B 4KHAA 2GBNA 3ZDTA 1XKEA 4C0AA 3TIXA 1UGMA 3AJ4A 3P6AA 4WVFB 2D07B 2KFKA 2LXAA 3M3JA 3ONSA 4II2B 1WGQA 5DPRA 4EUTA 1ISNA 2YT1A 3T06A 3KH0A 2M0XA 1E8WA 4CHJA 1LM8B 3MDBC 2LZ6A 4K2PA 3UZTA 4GDLB 4KSKC 4MSQB 1GG3A 1RFAA 4K1RB 2WX0A 2KDBA 3TBLD 4F1SA 1GC6A 2MW5A 1ZM0A 3NY5A 3ULBA 4PS3A 1YD8U 1UBQA 3H1UA 5CLLB 3QHTA 4BKSD 2UVMA 4A6HA 3PGEA 2JRIB 1FGZA 4DXAB 2KMCA 2C60A 4FA6A 2KMAA 3NZSA 1LXDA 4DWFA 4HATB 3RCPA 2XBBC 4MK0A 4PS7A 3AU5A 1DDVA 1V88A 2XQNM 4IOYX 2L8JA 4M8MA 4W9HA 2R0DA 3RT3B 5D7GA 3L0WB 5AZHA 2D4QA 1IP9A 5C1ZA 2FCMA 4GDKA 5J3TA 3KY9A 2BPSA 4NNJB 2KXJA 4GZUA 2KJHB 1PFJA 4F7UP 2KJRA 3IBEA 2M38A 1WRDB 2DX5B 4XZ4A 2G45B 2RSUA 3VH4B 3P2BA 1LB1A 5KHQA 1UPRA 5GOWB 3DOWA 2B3AA 2MDXA 1Q0WB 2IO2B 3TW1A 1E90A 2CHWA 2IFSA 2KKCA 2MA9B 4EKUA 1ZGUB 4GMXB 1NBFC 2DZIA 3SHQA 5DHFB 3VTVA 2WX1A 2DKPA 2KQ7A 1WGHA 1W1GA 4MGZE 1V5OA 4I6NB 5AZGA 3NS8A 1V5TA 2KTRA 3PRMB 2YVCA 2OJRA 2J59M 4IM2A 4N9F4 1KJTA 5LXIB 1T0YA 2LI5A 2MWSB 2JY6A 4MSMB 1WE6A 2JZZA 4J6IA 1FOEA 3A8QA 3X0WA 1KM7A 4JLCA 3F5RA 3ZVVA 1VCBA 3N7CA 3W1SC 1A5RA 1IYFA 2VRWB 4L6EA 1U5FA 4HAZB 2IYDB 5DH9B 1Z5SB 3DBLI 2DFKA 1TZ1A 3HM3A 3NHEB 4FBJB 1Y5OA 2KZRA 2M8SA 3BY4B 3H9DA 3PRPB 1U4AA 4FJYA 3QWMA 2M1MA 3HW2B 4BBNC 2DAJA 4DX8A 2D9ZA 3IVFA 2BWES 2DHKA 2G4DB 4PS8A 5HE3A 4WWOA 1I2HA 4IFSA 1DYNA 2AWTA 2ZCBA 2K6QA 4GDKB 1WJ1A 1M94A 2YLMA 5CHFA 2N7DA 2H7EA 2MWNB 2YS3A 1DBHA 3KUDB 3ZIMA 2NPTB 4HB4B 3ZVRA 1UD7A 3L08A 3FSSA 4FHKA 2JP2A 4LJOB 1TJ6A 1M7EA 3DXCA 2DLWA 1V9JA 2D3GA 2MBEA 2MSED 4HK2A 3OJ4B 4HAYB 4WJOA 1FHXA 1ZVRA 2NBWB 4A6KA 3SDLC 1N3HA 2EKEC 4Z2MB 2IO3B 4FLHA 2I5CA 4BKSA 2IO1B 3ML9A 4CHMA 1UNQA 2MX2A 2GBRA 1K5DB 3D8FA 2WWZA 3CSTA 3UINB 3VUYA 3WAOA 1MK7B 2MBQA 3A8PA 1FAOA 2GS0A 3KSYA 3ODOA 2J0MA 3B0AA 5CTRC 4MJSB 1YQBA 1GUAB 3ZLZA 5JLJB 2CU1A 4WJQA 2DYQA 3GZNI 3KVFB 3D32A 4A3PA 5DCNA 1Y19B 4DX90 3DBHI 3M95A 4MGKE 2GOWA 4A6FA 4DDID 4HB2B 3LDZE 3H7SA 3U30A 1WGRA 2DX5A 4EJNA 1E8ZA 5DPTA 3PSCA 5C5BA 4FULA 4KSLC 1YX6B 3VIAA 3VXWA 2D9XA 4BBKA 3H7PA 3MHSD 1V80A 4FADA 2GBJA 4HXDA 2Y8GA 3A4RA 2C5LC 3OAWA 2P0HA 3BINA 4X57B 2MQJA 2K00A 2O2VA 2GJYA 2KWCA 4AJYB 3U8ZA 3RUIB 4F7HA 2PJHA 4HDQA 1U5EA 2N7EA 2NBUA 3MJWA 1V5UA 2JVCA 1HE8A 2KK8A 1NDDA 3F0WA 1RLFA 2J0JA 1UZXB 3DVGX 2OTXA 3H6NA 3I3TB 2RVBB 2UZRA 2KDFB 2NVUI 1RRPB 3WANA 2JF5A 4KIKA 5HKHA 3UQAA 2KCJA 1MIXA 2A4ZA 5FI1A 4HAVB 2LGYA 1XT9B 1WY8A 2WYQA 4B6HA 4IM3A 2NS5A 1KZ7A 2W2XC 5D3WA 2MCNB 3UIPB 3UIOB 1U5DA 3VAWA 3ZRFA 4ANXA 4DBBA 1EF5A 4D0NB 4IWQA 1MIZB 5KHOA 2ZCCA 2KUPA 2KC1A 2KFJA 2L76A 3JW0X 4MDKE 1EUVB 2N9PC 4M8NA 2NMBA 4RM9A 5D94A 3UGBB 4EEWA 4CYEA 4OVVA 2L1CA 1R4MI 1KI1B 1E7VA 1F9JA 3D8EA 1L7YA 4HCNB 3ECIA 1BT0A 4ZDVA 1U2BA 3L54A 5FI0A 2FJLA 1BTKA 2ELAA 4NY0A 5JHHA 1WE7A 2FUHB 2KX3A 3PS6A 3FEHA 4JL9A 1OTRB 1WXAA 3BJIA 1OQYA 1WXSA 3R3MA 1TBEA 4GU2A 2K8HA 1WJ6A 3A9JA 3HM6X 3JSVB 3WIMA 4E74A 2C9WB 2CHXA 4LDTB 4XX5A 5JP4A 2KDEB 3A9KA 3UF8A 4G11A 3AXCA 4LJPB 5DHAB 3TMPB 4ANUA 4NQLB 3KW5B 1P98A 2K2JA 3KYDD 3L17A 4NJ6A 1FHWA 4HCPB 2MBHA 1SGHA 4WSFA 2N1VA 2KQSA 5CHVC 2GBMA 2VKIA 2O6VB 3OJ3A 4ZRJA 2VRRB 4EZJA 2RNRB 2ZPNA 3QK0A 4IWOA 4HWIB 1WJNA 2IZVB 2LRWA 2MBOA 3PVLA 2QHOA 2XEWA 5E6NA 4A6FB 5C23A 2Y5BB 4JQWC 4EZKA 3L13A 2ZZPB 4HJKA 2L2IA 4DK5A 1LW3A 3DBRI 4ZYNA 1GNUA 1S3SG 1UH6A 3PZDA 2JWZA 3NSUA 3PTFC 4MT7A 4G0NB 1MPHA 4DBGA 3HIZA 4AJWA 2MP2A 2YRYA 2JPHA 2J7QB 4ICVA 1KZGA 1OEYA 3QAQA 4DHZE 4CHKA 2L0TA 1EVHA 4EZLA 2UZSA 2E2XA 2FCNA 2V1YA 4K17A 3SNHA 3QC8B 2DX1A 3AULA 5JHGA 4AP4C 2AYOB 3ZTDA 2W2XD 3PHWB 4HAUB 2NPTA 4GOCA 1WXMA 4YL8A 1C1YB 1U27A 2D11A 1V89A 2N4FA 2DZMA 4KVGB 1J8CA 2DZJA 5JHBA 4BFRA 1XQQA 1EF1A 3RZWC 3V6CB 3ZDMC 5EFXA 1Q67A 2MBBB 5DI9B 4HB0B 1WF9A 3ZW3A 2L7RA 3TVVA 4MEMA 2H7DA 4GN1A 4FJZA 2R2OA 4K2OA 3V5WA 3HK0A 5D27A 1WR1A 2JXXA 2JZ3B 3DBSA 3B08A 2RLOA 3QARA 4NAWA 1OMWA 2ROZB 2Z0OA 4IM0A 1UNRA 2GBKA 1FB8A 4KZCA 3RD2A 4FJVB 4ZRKA 1WMHB 2PPHA 1TXDA 4W9IA 2BKFA 3RCZA 2V4LA 1L2NA 1BTNA 1H4RA 1I42A 4K81A 2COAA 3G9WA 1AQCA 2CHZA 2LXCA 3PLVA 1VD2A 3PRZA 4W9DA 4BKTA 4CO7A 1WXVA 3SYXA 4E71A 3EHVA 2ZVOA 1P1AA 3SV1A 2DHIA 2C7NB 1UPQA 1WG7A 2O2VB 3DXDA 1OY2A 3FM8C 3NOBA 2MLBA 3APFA 1V81A 1E7UA 3ODXA 3KRWA 2D2QA 2LOXA 3H7PB 5J18A 2ZPYA 5C5BB 2KJ6A 4HPMB 1J0WA 2Z0QA 1K8RB 5E6OA 1AARA 4WWNA 1M7RA 2KC2A 3CF6E 3T8MA 2P8VA 2MFQA 3KRXA 3ZUNA 2IO0B 2LKOA 4AUQC 3K9PB 3CIKA 4Y94A 2L05A 4K7UA 2CKHB 3ZNID 4HDOA 2ELBA 2ROVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC7 A;  1Z87 A;  5L81 A;  2DHZ A;  3DPD A;  4MGI E;  4ICU A;  4E3C A;  1BAK A;  3A33 B;  4MJS A;  2N0Y A;  2REX A;  3M1I B;  2OQB A;  2HD5 B;  3A1Q A;  4HVB A;  2KGX B;  3JYU A;  4DHJ D;  2Q13 A;  4NQK E;  3AU4 A;  2YF0 A;  2M17 A;  2LG1 A;  4GPT B;  3TCA A;  1WGD A;  3OAN A;  2ZEQ A;  3ENE A;  4M0W B;  1ZW7 A;  4H8S A;  3ZNH B;  4WAA A;  3CSF A;  4BOZ B;  2QKM A;  1ZSQ A;  1LQB A;  1ZC3 B;  1WVH A;  4KHO A;  1MKE A;  5LON B;  2BF8 B;  3IFW B;  3AI5 A;  3Q3J A;  4PYZ A;  2JUO A;  5LLI A;  4W9L A;  2CY4 A;  3CXB B;  3WYF B;  1DDM A;  1DRO A;  2A5U A;  2BWF A;  5CX3 A;  2KD0 A;  1XCG A;  1NTY A;  1XOD A;  2KLG A;  3CMM B;  4IWP A;  5E6P A;  4LCD E;  3SU8 X;  1WI0 A;  2IYB A;  2ZJD A;  1C3T A;  2PE9 A;  1XX0 A;  1WFY A;  2KAN A;  4LDT D;  1Q5W B;  4URK A;  4ANV A;  2V3S A;  3PT2 B;  4GGQ A;  3ZTC A;  1B55 A;  3PP2 A;  2KLC A;  5D6J B;  2CS4 A;  3DDC B;  4GB9 A;  4NSW A;  2NCN A;  3O96 A;  2C7H A;  2Y8F A;  2AL6 A;  2IY0 B;  3R7Q A;  3HHM A;  1PMS A;  4TKN A;  3PG7 A;  1V2Y A;  4P7I A;  5CLQ B;  2FID A;  3RUL A;  4Z2N A;  2RR9 A;  3PV1 A;  1MG8 A;  2ADZ A;  2I1J A;  1KLV A;  1V61 A;  4F8C B;  2BYV E;  2K25 A;  3IG3 A;  3ULC A;  4NJ7 A;  4TUU A;  5IA7 A;  1X86 A;  4WJ7 A;  1I7A A;  1TTN A;  4II3 B;  2DYN A;  3WAL A;  5DPW A;  5BO4 B;  5G2N A;  3VH3 B;  2DAF A;  1EAZ A;  5KQ4 A;  4HHV A;  2K1F A;  2COF A;  4KAX B;  2L00 B;  2RPQ A;  2CR5 A;  2OOB B;  4PYU A;  3QWZ B;  2IY1 B;  4BKG A;  4BOS C;  2UWQ A;  2KNB A;  3A1Q B;  2AEH A;  2DZK A;  4EOY A;  3PHX B;  1WGU A;  1H10 A;  3QQ8 B;  1V49 A;  3N32 A;  1E5W A;  1V5M A;  2ZNV B;  1X11 A;  4G3X B;  1WZ0 A;  3V61 A;  3VFK A;  1KOT A;  3APC A;  2COD A;  4IAP A;  3M63 B;  3SD5 A;  2LJ5 A;  1YIW A;  2KWU B;  5J2R A;  2DEN B;  4NAW B;  3VTU A;  3HQC A;  5CHW A;  5G55 A;  2FCS A;  2O6V D;  3VVW B;  2YSZ A;  4AOF A;  2KVR A;  3V60 A;  2GCJ A;  2C7M B;  1U5G A;  5FR6 A;  2K2U A;  3ZNZ B;  2COC A;  1X1G A;  5D3X A;  2LAS A;  2G4S A;  3QIJ A;  3V62 A;  4F7G A;  3W1S A;  1J19 A;  2UYZ B;  2RSG A;  1E8Y A;  4TV3 A;  4WJP A;  2FIF A;  2V76 A;  3JVZ X;  4FHJ A;  4HAX B;  1OGW A;  2G35 A;  3DVN U;  3O65 B;  1BWN A;  3GOE A;  1QZE A;  4B6W A;  4ANW A;  3PLU A;  1WZ3 A;  3QCA A;  3U7D A;  2LD9 A;  3ALB A;  3PRE A;  2Y7B A;  4MM3 A;  4NPN A;  4DHZ B;  5L83 A;  4ZRI A;  2DYB A;  1X05 A;  1RAX A;  3TL5 A;  1WMH A;  4AWJ A;  4HB3 B;  5L95 C;  4DDG D;  2RGN B;  1WX7 A;  3RZF A;  5HE1 A;  1SE9 A;  2KWV B;  2EJ8 A;  1PLS A;  1UEL A;  2Z0D B;  2Z0E B;  4G50 A;  1P3R A;  4W9G A;  3ZKJ C;  3QX1 A;  1QC6 A;  2KFK B;  5TR5 A;  3ZO5 B;  4A20 A;  2LVQ A;  2N9E B;  3DXE A;  4YON A;  2XK5 A;  3SO6 A;  1UBI A;  2LVO A;  3T9L A;  4EFO A;  4IC7 B;  3MPX A;  3PEG A;  1V6E A;  2KOX A;  3MTN B;  1E8X A;  4W9J A;  1WI1 A;  1OEY J;  1WYW B;  4RM8 A;  4I6P A;  1XD3 B;  4BBN F;  4MEL A;  3PPA A;  4GSW A;  4MH0 E;  1GJZ A;  4PQ0 A;  2NR2 A;  1ZKH A;  4A5K A;  2JRH A;  3NZU A;  4XWX A;  4W9F A;  5EDS A;  1H8C A;  2ASQ A;  3RYT A;  4IW0 A;  3QA8 A;  4HLE A;  1WJU A;  1P5T A;  2MRP A;  3KYC D;  4F7Z A;  4XC2 A;  2EC1 A;  1R4N I;  4JIO U;  5JZE B;  4K7W A;  3R66 C;  4KHB B;  3K9O B;  2CY5 A;  1W1H A;  1TGZ B;  2R2Q A;  1JRU A;  3X23 A;  2G3Q B;  2Z0P A;  4WWP A;  3S2A A;  3W1Y A;  2LUL A;  5D2M B;  5AZF A;  1NI2 A;  4KDL B;  3PVW A;  2N1W A;  2CRF A;  1PQS A;  3A9J B;  3JSV A;  1K5G B;  2D10 A;  2MKR A;  2DN6 A;  1P9D U;  4W9K A;  1U29 A;  2CAY A;  4B9K A;  1FXT B;  2IBI B;  2KTR B;  2W9N A;  2D9Y A;  2LOZ A;  3KUZ A;  3N3K B;  3VTW A;  4A3O A;  1ZC4 B;  2M4N A;  3Q3F A;  4PNK A;  3A98 B;  2RGF A;  2ZNV C;  2WDT B;  1Y8R C;  5C6R A;  4TQ0 A;  2DYM A;  5LOP B;  3OLM D;  2BYE A;  4W9C A;  3QBV B;  1IRS A;  1NU2 A;  3ML8 A;  5GMV A;  5J17 A;  4ASW C;  1WH3 A;  2ZVN A;  1LFD A;  2O6V A;  2GCL A;  2XK5 B;  2D9W A;  2I1K A;  3ML4 A;  3LJ3 A;  4TQ1 A;  2LGX A;  2R09 A;  3IHP C;  3L16 A;  1S1Q B;  4GIV A;  2BGF A;  3DVN V;  3C0R B;  4W9E A;  2M14 A;  3P7Z A;  2HJ8 A;  1TQZ A;  3N30 A;  2BCJ A;  3WA0 A;  2Z59 B;  2DYO A;  2PE6 B;  4IUM B;  2I5F A;  3A4S C;  2W2W A;  5AEK B;  5HE0 A;  5KQ1 A;  4EMO A;  3V6E B;  2LYD A;  3EEC A;  2FAZ A;  5DIF B;  1MK9 B;  1P6S A;  3TFM A;  3LJU X;  2GMI C;  2KN5 A;  2KTF A;  2KDI A;  4DHJ B;  3KZ1 A;  1WGY A;  5D3Y A;  2P0D A;  2LVP A;  2LRU A;  3KUC B;  5C16 A;  3EC8 A;  1Z2M A;  3VHT C;  2YT0 A;  1WM3 A;  2RD0 A;  1AWE A;  2YS1 A;  4GXB A;  1EO6 A;  4GMV A;  3M62 B;  5KCV A;  2D9V A;  2AL3 A;  4IG7 B;  3PSE B;  4GDL A;  4FN2 A;  3TJP A;  1X1F A;  1J0G A;  2J0K A;  3ZNG C;  3EFU A;  3ODW A;  1Q1O A;  4K7S A;  1SIF A;  5DPS A;  3WAM A;  4JGH B;  1W1D A;  2K6D B;  4WQO B;  3ZRC A;  2FNJ B;  1FHO A;  1CMX B;  5C79 A;  4TYZ A;  2L0F A;  1OQN A;  1QQG A;  2BKR B;  2NZ8 B;  1WIA A;  1P0R A;  3APD A;  3UQB A;  5LXH A;  3B1L X;  2KO3 A;  5JH5 C;  1FGY A;  2HTH A;  1YJ1 A;  4OVU A;  2PZ1 A;  1G6J A;  2FCQ A;  3VOQ A;  1V5P A;  5J3Y A;  2K8C A;  2EMT A;  1EGX A;  4B95 A;  1WJM A;  3VUW A;  4MGY E;  3DCG A;  2DHJ A;  3WAP A;  1MAI A;  2DA0 A;  4KIK B;  5IAA C;  2QKL A;  1I35 A;  3SUZ A;  2PEA A;  3GYO A;  1XR0 B;  4I6L B;  3DVG Y;  3VQI A;  4KDI C;  1XD4 A;  3A9K B;  1WM2 A;  3R7R A;  2K8B A;  4KV2 A;  2LWP A;  2KHW B;  2BYF A;  5JHA A;  1UNP A;  2K39 A;  3PVU A;  2JT4 B;  1SHC A;  2L3Z A;  2MP2 B;  2N23 A;  4HAW B;  3TO1 A;  2NBV B;  1RRB A;  3DQV A;  4KZ0 A;  3QJZ A;  4HPL B;  1NTV A;  3GYP A;  1X1M A;  1DDW A;  1WGG A;  3L10 B;  1WX8 A;  1RJ2 A;  2YS5 A;  2P0F A;  2RUK B;  5D3V A;  1D3Z A;  1UEF A;  2DKQ A;  3D8D A;  4RMA A;  1WX9 A;  1WR6 E;  3VDZ A;  3VUX A;  4WJN A;  1P3Q U;  5HE2 A;  2KX0 A;  1V86 A;  2N9X A;  5J3Q A;  2EMS A;  2LGD A;  2LUE A;  2HTH B;  2HE7 A;  2VSZ A;  4MY6 A;  1IPG A;  4BVU C;  2X18 A;  2DTC A;  1WJ4 A;  1YX5 B;  4KHA A;  2GBN A;  3ZDT A;  1XKE A;  4C0A A;  3TIX A;  1UGM A;  3AJ4 A;  3P6A A;  4WVF B;  2D07 B;  2KFK A;  2LXA A;  3M3J A;  3ONS A;  4II2 B;  1WGQ A;  5DPR A;  4EUT A;  1ISN A;  2YT1 A;  3T06 A;  3KH0 A;  2M0X A;  1E8W A;  4CHJ A;  1LM8 B;  3MDB C;  2LZ6 A;  4K2P A;  3UZT A;  4GDL B;  4KSK C;  4MSQ B;  1GG3 A;  1RFA A;  4K1R B;  2WX0 A;  2KDB A;  3TBL D;  4F1S A;  1GC6 A;  2MW5 A;  1ZM0 A;  3NY5 A;  3ULB A;  4PS3 A;  1YD8 U;  1UBQ A;  3H1U A;  5CLL B;  3QHT A;  4BKS D;  2UVM A;  4A6H A;  3PGE A;  2JRI B;  1FGZ A;  4DXA B;  2KMC A;  2C60 A;  4FA6 A;  2KMA A;  3NZS A;  1LXD A;  4DWF A;  4HAT B;  3RCP A;  2XBB C;  4MK0 A;  4PS7 A;  3AU5 A;  1DDV A;  1V88 A;  2XQN M;  4IOY X;  2L8J A;  4M8M A;  4W9H A;  2R0D A;  3RT3 B;  5D7G A;  3L0W B;  5AZH A;  2D4Q A;  1IP9 A;  5C1Z A;  2FCM A;  4GDK A;  5J3T A;  3KY9 A;  2BPS A;  4NNJ B;  2KXJ A;  4GZU A;  2KJH B;  1PFJ A;  4F7U P;  2KJR A;  3IBE A;  2M38 A;  1WRD B;  2DX5 B;  4XZ4 A;  2G45 B;  2RSU A;  3VH4 B;  3P2B A;  1LB1 A;  5KHQ A;  1UPR A;  5GOW B;  3DOW A;  2B3A A;  2MDX A;  1Q0W B;  2IO2 B;  3TW1 A;  1E90 A;  2CHW A;  2IFS A;  2KKC A;  2MA9 B;  4EKU A;  1ZGU B;  4GMX B;  1NBF C;  2DZI A;  3SHQ A;  5DHF B;  3VTV A;  2WX1 A;  2DKP A;  2KQ7 A;  1WGH A;  1W1G A;  4MGZ E;  1V5O A;  4I6N B;  5AZG A;  3NS8 A;  1V5T A;  2KTR A;  3PRM B;  2YVC A;  2OJR A;  2J59 M;  4IM2 A;  4N9F 4;  1KJT A;  5LXI B;  1T0Y A;  2LI5 A;  2MWS B;  2JY6 A;  4MSM B;  1WE6 A;  2JZZ A;  4J6I A;  1FOE A;  3A8Q A;  3X0W A;  1KM7 A;  4JLC A;  3F5R A;  3ZVV A;  1VCB A;  3N7C A;  3W1S C;  1A5R A;  1IYF A;  2VRW B;  4L6E A;  1U5F A;  4HAZ B;  2IYD B;  5DH9 B;  1Z5S B;  3DBL I;  2DFK A;  1TZ1 A;  3HM3 A;  3NHE B;  4FBJ B;  1Y5O A;  2KZR A;  2M8S A;  3BY4 B;  3H9D A;  3PRP B;  1U4A A;  4FJY A;  3QWM A;  2M1M A;  3HW2 B;  4BBN C;  2DAJ A;  4DX8 A;  2D9Z A;  3IVF A;  2BWE S;  2DHK A;  2G4D B;  4PS8 A;  5HE3 A;  4WWO A;  1I2H A;  4IFS A;  1DYN A;  2AWT A;  2ZCB A;  2K6Q A;  4GDK B;  1WJ1 A;  1M94 A;  2YLM A;  5CHF A;  2N7D A;  2H7E A;  2MWN B;  2YS3 A;  1DBH A;  3KUD B;  3ZIM A;  2NPT B;  4HB4 B;  3ZVR A;  1UD7 A;  3L08 A;  3FSS A;  4FHK A;  2JP2 A;  4LJO B;  1TJ6 A;  1M7E A;  3DXC A;  2DLW A;  1V9J A;  2D3G A;  2MBE A;  2MSE D;  4HK2 A;  3OJ4 B;  4HAY B;  4WJO A;  1FHX A;  1ZVR A;  2NBW B;  4A6K A;  3SDL C;  1N3H A;  2EKE C;  4Z2M B;  2IO3 B;  4FLH A;  2I5C A;  4BKS A;  2IO1 B;  3ML9 A;  4CHM A;  1UNQ A;  2MX2 A;  2GBR A;  1K5D B;  3D8F A;  2WWZ A;  3CST A;  3UIN B;  3VUY A;  3WAO A;  1MK7 B;  2MBQ A;  3A8P A;  1FAO A;  2GS0 A;  3KSY A;  3ODO A;  2J0M A;  3B0A A;  5CTR C;  4MJS B;  1YQB A;  1GUA B;  3ZLZ A;  5JLJ B;  2CU1 A;  4WJQ A;  2DYQ A;  3GZN I;  3KVF B;  3D32 A;  4A3P A;  5DCN A;  1Y19 B;  4DX9 0;  3DBH I;  3M95 A;  4MGK E;  2GOW A;  4A6F A;  4DDI D;  4HB2 B;  3LDZ E;  3H7S A;  3U30 A;  1WGR A;  2DX5 A;  4EJN A;  1E8Z A;  5DPT A;  3PSC A;  5C5B A;  4FUL A;  4KSL C;  1YX6 B;  3VIA A;  3VXW A;  2D9X A;  4BBK A;  3H7P A;  3MHS D;  1V80 A;  4FAD A;  2GBJ A;  4HXD A;  2Y8G A;  3A4R A;  2C5L C;  3OAW A;  2P0H A;  3BIN A;  4X57 B;  2MQJ A;  2K00 A;  2O2V A;  2GJY A;  2KWC A;  4AJY B;  3U8Z A;  3RUI B;  4F7H A;  2PJH A;  4HDQ A;  1U5E A;  2N7E A;  2NBU A;  3MJW A;  1V5U A;  2JVC A;  1HE8 A;  2KK8 A;  1NDD A;  3F0W A;  1RLF A;  2J0J A;  1UZX B;  3DVG X;  2OTX A;  3H6N A;  3I3T B;  2RVB B;  2UZR A;  2KDF B;  2NVU I;  1RRP B;  3WAN A;  2JF5 A;  4KIK A;  5HKH A;  3UQA A;  2KCJ A;  1MIX A;  2A4Z A;  5FI1 A;  4HAV B;  2LGY A;  1XT9 B;  1WY8 A;  2WYQ A;  4B6H A;  4IM3 A;  2NS5 A;  1KZ7 A;  2W2X C;  5D3W A;  2MCN B;  3UIP B;  3UIO B;  1U5D A;  3VAW A;  3ZRF A;  4ANX A;  4DBB A;  1EF5 A;  4D0N B;  4IWQ A;  1MIZ B;  5KHO A;  2ZCC A;  2KUP A;  2KC1 A;  2KFJ A;  2L76 A;  3JW0 X;  4MDK E;  1EUV B;  2N9P C;  4M8N A;  2NMB A;  4RM9 A;  5D94 A;  3UGB B;  4EEW A;  4CYE A;  4OVV A;  2L1C A;  1R4M I;  1KI1 B;  1E7V A;  1F9J A;  3D8E A;  1L7Y A;  4HCN B;  3ECI A;  1BT0 A;  4ZDV A;  1U2B A;  3L54 A;  5FI0 A;  2FJL A;  1BTK A;  2ELA A;  4NY0 A;  5JHH A;  1WE7 A;  2FUH B;  2KX3 A;  3PS6 A;  3FEH A;  4JL9 A;  1OTR B;  1WXA A;  3BJI A;  1OQY A;  1WXS A;  3R3M A;  1TBE A;  4GU2 A;  2K8H A;  1WJ6 A;  3A9J A;  3HM6 X;  3JSV B;  3WIM A;  4E74 A;  2C9W B;  2CHX A;  4LDT B;  4XX5 A;  5JP4 A;  2KDE B;  3A9K A;  3UF8 A;  4G11 A;  3AXC A;  4LJP B;  5DHA B;  3TMP B;  4ANU A;  4NQL B;  3KW5 B;  1P98 A;  2K2J A;  3KYD D;  3L17 A;  4NJ6 A;  1FHW A;  4HCP B;  2MBH A;  1SGH A;  4WSF A;  2N1V A;  2KQS A;  5CHV C;  2GBM A;  2VKI A;  2O6V B;  3OJ3 A;  4ZRJ A;  2VRR B;  4EZJ A;  2RNR B;  2ZPN A;  3QK0 A;  4IWO A;  4HWI B;  1WJN A;  2IZV B;  2LRW A;  2MBO A;  3PVL A;  2QHO A;  2XEW A;  5E6N A;  4A6F B;  5C23 A;  2Y5B B;  4JQW C;  4EZK A;  3L13 A;  2ZZP B;  4HJK A;  2L2I A;  4DK5 A;  1LW3 A;  3DBR I;  4ZYN A;  1GNU A;  1S3S G;  1UH6 A;  3PZD A;  2JWZ A;  3NSU A;  3PTF C;  4MT7 A;  4G0N B;  1MPH A;  4DBG A;  3HIZ A;  4AJW A;  2MP2 A;  2YRY A;  2JPH A;  2J7Q B;  4ICV A;  1KZG A;  1OEY A;  3QAQ A;  4DHZ E;  4CHK A;  2L0T A;  1EVH A;  4EZL A;  2UZS A;  2E2X A;  2FCN A;  2V1Y A;  4K17 A;  3SNH A;  3QC8 B;  2DX1 A;  3AUL A;  5JHG A;  4AP4 C;  2AYO B;  3ZTD A;  2W2X D;  3PHW B;  4HAU B;  2NPT A;  4GOC A;  1WXM A;  4YL8 A;  1C1Y B;  1U27 A;  2D11 A;  1V89 A;  2N4F A;  2DZM A;  4KVG B;  1J8C A;  2DZJ A;  5JHB A;  4BFR A;  1XQQ A;  1EF1 A;  3RZW C;  3V6C B;  3ZDM C;  5EFX A;  1Q67 A;  2MBB B;  5DI9 B;  4HB0 B;  1WF9 A;  3ZW3 A;  2L7R A;  3TVV A;  4MEM A;  2H7D A;  4GN1 A;  4FJZ A;  2R2O A;  4K2O A;  3V5W A;  3HK0 A;  5D27 A;  1WR1 A;  2JXX A;  2JZ3 B;  3DBS A;  3B08 A;  2RLO A;  3QAR A;  4NAW A;  1OMW A;  2ROZ B;  2Z0O A;  4IM0 A;  1UNR A;  2GBK A;  1FB8 A;  4KZC A;  3RD2 A;  4FJV B;  4ZRK A;  1WMH B;  2PPH A;  1TXD A;  4W9I A;  2BKF A;  3RCZ A;  2V4L A;  1L2N A;  1BTN A;  1H4R A;  1I42 A;  4K81 A;  2COA A;  3G9W A;  1AQC A;  2CHZ A;  2LXC A;  3PLV A;  1VD2 A;  3PRZ A;  4W9D A;  4BKT A;  4CO7 A;  1WXV A;  3SYX A;  4E71 A;  3EHV A;  2ZVO A;  1P1A A;  3SV1 A;  2DHI A;  2C7N B;  1UPQ A;  1WG7 A;  2O2V B;  3DXD A;  1OY2 A;  3FM8 C;  3NOB A;  2MLB A;  3APF A;  1V81 A;  1E7U A;  3ODX A;  3KRW A;  2D2Q A;  2LOX A;  3H7P B;  5J18 A;  2ZPY A;  5C5B B;  2KJ6 A;  4HPM B;  1J0W A;  2Z0Q A;  1K8R B;  5E6O A;  1AAR A;  4WWN A;  1M7R A;  2KC2 A;  3CF6 E;  3T8M A;  2P8V A;  2MFQ A;  3KRX A;  3ZUN A;  2IO0 B;  2LKO A;  4AUQ C;  3K9P B;  3CIK A;  4Y94 A;  2L05 A;  4K7U A;  2CKH B;  3ZNI D;  4HDO A;  2ELB A;  2ROV A; 
#chains in the Genus database with same CATH topology
 2DHZ A;  4E3C A;  4P1C C;  3A33 B;  2GRI A;  4HVB A;  1K53 A;  1T3Q A;  3AU4 A;  1WGD A;  3TCA A;  3OAN A;  1ZW7 A;  3IFW B;  1ZC3 B;  4KHO A;  4ITK A;  3NS1 A;  4YSY B;  3SR6 A;  4W9L A;  3R8B A;  2J53 A;  5CX3 A;  2KD0 A;  1XCG A;  4IWP A;  1EU3 A;  4M01 A;  5BMI A;  1C3T A;  1IBX A;  2PE9 A;  1HZ5 A;  4ANV A;  4GGQ A;  3ZTC A;  1GAQ B;  1NVI D;  1PGX A;  4DXF A;  2C7H A;  3FIL B;  2AL6 A;  2BT6 A;  3PG7 A;  1V2Y A;  2WXM A;  4KGS A;  4EE2 A;  1FD6 A;  4RF0 A;  2ADZ A;  1KLV A;  2BYV E;  2DYN A;  4C56 C;  2L00 B;  4TMA B;  3Q3O C;  4YTP B;  1HXY D;  1YJJ A;  2IY1 B;  2UWQ A;  3A1Q B;  3PHX B;  1WGU A;  4ZOH C;  1DYQ A;  2ZNV B;  3N1X C;  1KOT A;  1YIW A;  2DEN B;  1UGJ A;  2GLS A;  4P16 A;  2FCS A;  3VVW B;  3B77 A;  2YSZ A;  2UU7 A;  3V60 A;  1SEB D;  3I57 A;  2GCJ A;  1XLP A;  5TSS A;  2K2U A;  5BYQ A;  1X1G A;  2LAS A;  4IOI E;  4F7G A;  2VH2 A;  3URY A;  1E8Y A;  3N9Y C;  1YJI A;  4HAX B;  1OGW A;  1UUP A;  1BWN A;  1QZE A;  3PLU A;  3QCA A;  3U7D A;  3PRE A;  2Y7B A;  3IXS A;  1ET9 A;  4ZRI A;  2DYB A;  1WX7 A;  1N61 A;  5HE1 A;  1D5M C;  1ZDV A;  1UEL A;  2Z0D B;  4RGO S;  3ZKJ C;  1P3R A;  1K50 A;  3QX1 A;  3ZO5 B;  2LVQ A;  3AE4 B;  5BMH A;  4YON A;  1XLO A;  2LVO A;  1VZ6 A;  3MPX A;  3MTN B;  1QQR A;  4RM8 A;  2D5G A;  1YMH E;  3R2T A;  4BBN F;  4MEL A;  5EDS A;  4A5K A;  2JRH A;  2ASQ A;  3RYT A;  4IW0 A;  4HLE A;  1SE2 A;  3DBL B;  5LG4 B;  4XC2 A;  4K7W A;  3SEB A;  4A90 A;  3W1Y A;  2R2Q A;  3S2A A;  2G3Q B;  2Z0P A;  2Z8L A;  3A9J B;  1PQS A;  2DN6 A;  5HKH A;  2JQR B;  2IBI B;  5AUK A;  2M4N A;  1JWA D;  4PNK A;  3A98 B;  2QIE B;  2WDT B;  4QAY A;  5LOP B;  4LNI A;  3OLM D;  1FXI A;  3ML8 A;  4LLG M;  5IP4 D;  2ZVN A;  1LFD A;  2O6V A;  2GCL A;  3NZ3 A;  1F1H A;  3LJ3 A;  4XGA B;  1S1Q B;  2BGF A;  3DVN V;  1IGC A;  4W9E A;  3P7Z A;  1TQZ A;  1FM0 D;  3UQA A;  2PE6 B;  4YTN B;  2I5F A;  2W2W A;  3U52 E;  2FAZ A;  5DIF B;  4AQ7 A;  3AH7 A;  3LJU X;  2GMI C;  1KF6 B;  1R4N B;  1JWM D;  5D3Y A;  2LRU A;  3KUC B;  4L1B A;  5JXV A;  2YT0 A;  1WM3 A;  2RD0 A;  1AWE A;  2PW9 A;  1T0R C;  1EO6 A;  4IG7 B;  3TJP A;  1SJH D;  4JPS A;  4RGT A;  2J0K A;  1QT9 A;  3ODW A;  1Q1O A;  4K7S A;  1SIF A;  4WQO B;  3ZRC A;  5HFY A;  2KQ4 X;  5C79 A;  4TYZ A;  3EA6 A;  3SFE B;  4DQO C;  1HEZ E;  1F52 A;  2HTH A;  3J9C A;  2K8C A;  2RDB C;  4GOU A;  5IAA C;  2QKL A;  1I35 A;  2H88 B;  1XR0 B;  1FMA D;  2AQ2 B;  1JAL A;  1FFU A;  2KHW B;  1N6Z A;  1SHC A;  2RPV A;  3DQV A;  1RRB A;  1NTV A;  1WX8 A;  2P0F A;  5D3V A;  1UEF A;  1WX9 A;  1WR6 E;  4WJN A;  1F77 A;  4ZHO A;  1P3Q U;  3L4P A;  1VZ7 A;  4RFB A;  2LGD A;  2EMS A;  2HTH B;  2HE7 A;  2VSZ A;  4MY6 A;  1IPG A;  2KN4 A;  1YX5 B;  4JWU C;  1UGM A;  4WVF B;  2D07 B;  2KFK A;  2LXA A;  2YT1 A;  1EM7 A;  1E8W A;  1LM8 B;  3UZT A;  2WX0 A;  1ZE3 D;  1GC6 A;  5BYR A;  3RPF C;  3AEC B;  4PS3 A;  1OFF A;  1UBQ A;  3H1U A;  3QHT A;  4BKS D;  4A6H A;  1KRH A;  4FA6 A;  2XBB C;  3W1S C;  1IP9 A;  1TKY A;  1WXQ A;  3KY9 A;  1PFJ A;  1LO5 D;  2DX5 B;  3VH4 B;  4N6E B;  3P2B A;  1YN5 A;  5GOW B;  1MI0 A;  2RMM A;  1ZPS A;  2MA9 B;  2IFS A;  5DHF B;  2CJO A;  2WX1 A;  3VTV A;  4MGZ E;  1WGH A;  4I6N B;  2Y5P A;  5AZG A;  1T0Y A;  2MWS B;  3AN1 A;  2JY6 A;  3AE5 B;  1WE6 A;  2Y5C A;  1FOE A;  2VZK B;  3A8Q A;  3X0W A;  3BVM A;  1VCB A;  3N7C A;  1SXT A;  2YEP B;  1J7C A;  1Z5S B;  2DFK A;  2K8E A;  3H9D A;  2ACZ B;  4DX8 A;  3IVF A;  3AE1 B;  1V97 A;  2G4D B;  1TKE A;  5HE3 A;  2ZCB A;  2K6Q A;  1M94 A;  4HKZ E;  3AB5 A;  1I4X A;  2N7D A;  2H7E A;  2L83 A;  3KUD B;  2NPT B;  3ZVR A;  3FSS A;  4LJO B;  2DLW A;  5T8I A;  1V1P A;  1E7P B;  3RNC C;  1BXT A;  1QOA A;  1N3H A;  2EKE C;  2QCZ A;  1UNQ A;  2GBR A;  2WWZ A;  2MBQ A;  1JWU D;  3ODO A;  2AQ1 B;  1ESF A;  4MJS B;  4M02 A;  2CU1 A;  3DWG C;  4A3P A;  3GZN I;  5DCN A;  3DBH I;  4OSN A;  4HB2 B;  3H7S A;  4EJN A;  2YEP F;  4FUL A;  1YX6 B;  3MHS D;  1DOX A;  2GBJ A;  2C5L C;  2V3N A;  2MQJ A;  4AJY B;  3RUI B;  2YT2 A;  2N7E A;  2PTL A;  3AE6 B;  3F0W A;  2RVB B;  2NVU I;  3WAN A;  1MIX A;  5D3D A;  4WIP A;  2LGY A;  3NVZ A;  2NS5 A;  2W2X C;  1N63 A;  1EF5 A;  4B6W A;  2ZCC A;  2KUP A;  2KC1 A;  2KFJ A;  3JW0 X;  3UGB B;  2HJ1 A;  1ET6 A;  1KI1 B;  1E7V A;  1L7Y A;  3ECI A;  2LUM A;  5EE0 A;  4IM2 A;  5JHH A;  4JL9 A;  2N0S B;  1C79 A;  1OQY A;  5FKA C;  3RMK C;  3R3M A;  2AX5 A;  3HM6 X;  1XXG A;  2WXK A;  2CHX A;  4XX5 A;  3A9K A;  3AXC A;  1FCL A;  3TMP B;  3L17 A;  4HCP B;  2MBH A;  1SGH A;  3OJ3 A;  2ONQ A;  1STE A;  1WJN A;  2LRW A;  3PVL A;  5E6N A;  2Y5B B;  4JQW C;  2PKO A;  3WCQ A;  1LW3 A;  3DBR I;  3AE7 B;  2WGS A;  1TS4 A;  4KGR A;  2JPH A;  1TS2 A;  3QAQ A;  4CHK A;  3FKY A;  1SB3 C;  2UZS A;  2V1Y A;  4K17 A;  3SNH A;  2DX1 A;  5JHG A;  4AP4 C;  1L5P A;  1TS5 A;  2AYO B;  1DGJ A;  3AE2 B;  3NVW A;  3IAS 1;  1UWX A;  4JE3 B;  4HRO A;  1V89 A;  2DZM A;  1J8C A;  2K49 A;  2FE8 A;  1EF1 A;  3W5U B;  5EFX A;  2SAK A;  5DI9 B;  1WF9 A;  1YOV B;  2JZP A;  3PZ7 A;  4MEM A;  2H7D A;  4FJZ A;  4K2O A;  5D27 A;  1WR1 A;  2WXO A;  3U2S C;  1OMW A;  2MJD A;  1FB8 A;  2BS3 B;  2QMT A;  3RD2 A;  4AS1 A;  4FJV B;  4MT5 A;  1TXD A;  1J7A A;  2VZK D;  2CHZ A;  3G9W A;  3SYX A;  1UPQ A;  1C76 A;  3NOB A;  2MLB A;  3ODX A;  2KYW A;  2I38 A;  1I4P A;  3TSS A;  4CSQ A;  2KJ6 A;  4PT5 A;  4HPM B;  1XF5 L;  4PK1 A;  4WWN A;  2MFQ A;  2M19 A;  1ACC A;  4AUQ C;  3Q8E A;  4K7U A;  2CKH B;  3DPD A;  4ICU A;  3AEF B;  4MJS A;  2N0Y A;  4HEA 1;  2HD5 B;  2W55 A;  3SFD B;  2LG1 A;  4WAA A;  2DNF A;  2QKM A;  2BF8 B;  2A5U A;  1DRO A;  2BWF A;  3MFG A;  4A9A A;  3CMM B;  1XOD A;  2KLG A;  2IYB A;  1FIQ A;  1WFY A;  1SF0 A;  4URK A;  3PT2 B;  1C4P A;  3PP2 A;  2L32 A;  3DDC B;  5CLQ B;  4Z2N A;  3AM9 A;  1C4C A;  1VDV A;  2XN9 C;  1CQV A;  5G2N A;  3VH3 B;  2K1F A;  2COF A;  2RPQ A;  2CR5 A;  3QWZ B;  4BKG A;  2K3U A;  1SIJ A;  2KNB A;  2AEH A;  4EOY A;  4WAF A;  1V49 A;  3N32 A;  4G3X B;  3V61 A;  2KR0 A;  2COD A;  1P7E A;  2LJ5 A;  2QSD A;  2M56 B;  1PGA A;  2KVR A;  5FR6 A;  1U5G A;  3HUI A;  2G4S A;  3QIJ A;  3V62 A;  3W1S A;  2INC C;  3OWE B;  2RSG A;  2V76 A;  4FHJ A;  3DVN U;  3O65 B;  1WZ3 A;  3ALB A;  1MG4 A;  3TL5 A;  1RAX A;  3NWF A;  4HB3 B;  2QJL A;  1SE9 A;  4B0E A;  1PLS A;  4A20 A;  1QIL A;  3H8H A;  2WS3 B;  3DXE A;  4BAX A;  1UBI A;  3R2I A;  3PEG A;  1V6E A;  3FIL A;  2KOX A;  4W9J A;  1WI1 A;  1OEY J;  2ZW1 A;  1YN3 A;  4I6P A;  1XD3 B;  3PPA A;  1BML C;  4PQ0 A;  1ZKH A;  4RF1 A;  1H8C A;  4US8 A;  1NYQ A;  3QA8 A;  1P5T A;  1WYG A;  2MRP A;  2INN E;  3R66 C;  4IKG A;  1TGZ B;  1JRU A;  3X23 A;  4HPP A;  4WWP A;  2LUL A;  4KDL B;  2N1W A;  2CRF A;  1K5G B;  5BMG A;  3KUZ A;  2D9Y A;  2LOZ A;  3N3K B;  3NRZ A;  1EWC A;  4YT0 B;  2ZNV C;  1Y8R C;  5C6R A;  4TQ0 A;  3RI7 C;  2DYM A;  3HVZ A;  5J17 A;  2BYE A;  2WXN A;  4ASW C;  1WH3 A;  4OVZ A;  2LGX A;  2R09 A;  3IHP C;  1TS3 A;  1FNU A;  2BCJ A;  3WA0 A;  1EU4 A;  2DYO A;  2Z59 B;  4IUM B;  5AEK B;  3TFM A;  1AW7 A;  2D3C A;  2K9X A;  3DHH C;  2KDI A;  1N5X A;  1WGY A;  3VHT C;  5C16 A;  1Z2M A;  2Y3A A;  1SBB B;  2YS1 A;  2AL3 A;  1TIF A;  1X1F A;  3ZNG C;  5H8Y E;  3WAM A;  4JGH B;  4D6W A;  1W1D A;  2FNJ B;  2L0F A;  3MP9 A;  1QQG A;  2KO3 A;  1R4M B;  1FGY A;  1YJ1 A;  2FCQ A;  4MH8 A;  5J3Y A;  2J4X A;  4B95 A;  1WJM A;  3VUW A;  3DCG A;  1MAI A;  1MFW A;  2PEA A;  3GYO A;  1JWS D;  3VQI A;  3A9K B;  1WSP A;  2LWP A;  5FK9 C;  3DHG C;  5JHA A;  1FCC C;  4HPL B;  3GYP A;  2V9H A;  1WGG A;  2YS5 A;  1NEN B;  2RUK B;  3D8D A;  1TYG B;  4RMA A;  3VDZ A;  5HE2 A;  5IKC M;  1V86 A;  2N9X A;  2X18 A;  2NMQ A;  3T3N A;  3LXF A;  1XKE A;  3P6A A;  4II2 B;  1ISN A;  1PYW D;  3KH0 A;  4W9K A;  3ZJU A;  3MDB C;  4GDL B;  4K2P A;  4KSK C;  4MSQ B;  4F1S A;  1GG3 A;  3TBL D;  2JYE A;  2X38 A;  3C19 A;  1YD8 U;  5CLL B;  1T0S C;  3IAM 1;  2UVM A;  3PGE A;  1FGZ A;  2KMC A;  2KMA A;  3NZS A;  2LGI A;  5EE9 A;  3KQ4 A;  3AU5 A;  2XQN M;  4M8M A;  4IOY X;  3RT3 B;  2XNA C;  3L0W B;  2D4Q A;  2FCM A;  4GDK A;  5H92 C;  2ON8 A;  1JRO A;  2KJH B;  2KJR A;  2J42 A;  2M38 A;  1WRD B;  3IBE A;  3MJ5 A;  2G45 B;  3DOW A;  2MDX A;  1Q0W B;  1NI3 A;  1E90 A;  2CHW A;  4UDU C;  3SHQ A;  3OG5 A;  2KQ7 A;  2V0G A;  4DIX A;  1V5O A;  3PRM B;  1V5T A;  2J59 M;  2LI5 A;  1E10 A;  2Z4D A;  2CU3 A;  4YWG G;  4JLC A;  3F5R A;  4L6E A;  2IGD A;  3DWM A;  3I9V 1;  2KZR A;  3EGR A;  4DXG A;  4BBN C;  1V1O A;  2D9Z A;  2BWE S;  2DHK A;  1DYN A;  2AWT A;  4GDK B;  1WJ1 A;  5CHF A;  2WLB A;  5GXG B;  3KLS X;  3ETR A;  1M7E A;  2JX5 A;  2MBE A;  3BYY B;  3OJ4 B;  2J52 A;  2NBW B;  4A6K A;  1TJE A;  3SDL C;  4J3O D;  4RNA A;  4Z2M B;  2IO3 B;  2LEK A;  4BKS A;  2Z13 A;  5IN7 A;  3ML9 A;  1Q10 A;  2MX2 A;  1D5Z C;  3NJT A;  1K5D B;  3FC4 A;  3UIN B;  3CST A;  3VUY A;  3WAO A;  3AE3 B;  3A8P A;  1FAO A;  2J0M A;  5CTR C;  1GUA B;  2LMC A;  3ZLZ A;  5JLJ B;  5G5G A;  2HTM E;  2DYQ A;  5EE3 A;  3HRD D;  3TEW A;  1Y19 B;  2GOW A;  2K5P A;  3NVY A;  1WGR A;  2DX5 A;  3BK1 A;  3VXW A;  2D9X A;  3H7P A;  4HXD A;  3HIE A;  2Y8G A;  3A4R A;  4BKT A;  2P0H A;  3BIN A;  2RDG A;  2K00 A;  2KWC A;  4XDD A;  4RH6 A;  2JVC A;  4REZ A;  1NDD A;  1UZX B;  3DVG X;  2J0J A;  3M95 A;  2LHE A;  3NW8 A;  4HAV B;  1KLU D;  2WYQ A;  4A6Q A;  1KZ7 A;  3UIP B;  4ANX A;  1FRR A;  4EEW A;  2N9P C;  3FAH A;  4RM9 A;  2NMB A;  1D5X C;  3ZXR A;  2B76 B;  3D8E A;  2WDV B;  4ZDV A;  1U2B A;  3L54 A;  1BTK A;  4NY0 A;  1WE7 A;  2FUH B;  3PS6 A;  2WXG A;  3BJI A;  1WXS A;  2WDQ B;  1YQ3 B;  3BVZ A;  3IT4 B;  3N20 C;  4S17 A;  4NJC A;  3W5V B;  3A9J A;  5I4D A;  2WXH A;  5JP4 A;  1ZDX A;  3UF8 A;  5DHA B;  4NQL B;  4GNK B;  3KW5 B;  2K2J A;  2N1V A;  1WWT A;  2O6V B;  3E9S A;  1FXA A;  4IWO A;  2IZV B;  2MBO A;  2XEW A;  2N9L A;  3L13 A;  2KVZ A;  1S3S G;  1UH6 A;  3PZD A;  3PTF C;  1E6E B;  4K3B A;  3HIZ A;  4AJW A;  3U4E G;  5E6J A;  1WGK A;  1KZG A;  4RCO A;  2KIE A;  4EZL A;  1L0V B;  2FCN A;  3QC8 B;  1ZOY B;  5IO9 A;  2W2X D;  2ZW0 A;  1JRP A;  1MHX A;  1C4A A;  1QOF A;  2WU5 B;  4YL8 A;  3KWV A;  2N4F A;  5JHB A;  4BFR A;  1MI1 A;  4HB0 B;  2L7R A;  3TVV A;  4GN1 A;  4M0W B;  3Q8B A;  4I6L B;  3V5W A;  3DBS A;  3HK0 A;  3NWA A;  4L23 A;  3VRA B;  4C4V B;  2RLO A;  2ROZ B;  2Z0O A;  1PFD A;  1UNR A;  2TSS A;  4W9I A;  2PPH A;  3CIR B;  3GE3 C;  2V4L A;  1H4R A;  1MHH E;  2COA A;  4W9D A;  1VD2 A;  1M4V A;  1YQ4 B;  2IJ0 A;  3SV1 A;  2DHI A;  2C7N B;  5IRS A;  1OY2 A;  1V81 A;  2D2Q A;  5J18 A;  2ZPY A;  4NAM A;  3T8M A;  3CF6 E;  2P8V A;  3KRX A;  3K9P B;  3CIK A;  1XCQ L;  4HDO A;  3I5J C;  1GC7 A;  1Z87 A;  1IUE A;  2OQB A;  3A1Q A;  4HJG E;  1GB1 A;  2Q13 A;  4NQK E;  4ZRP A;  2YF0 A;  2W3S A;  2FBW B;  2ZEQ A;  3ENE A;  2BBC A;  4M00 A;  3ZNH B;  4BOZ B;  3CSF A;  1ZSQ A;  1MKE A;  3Q3J A;  3AI5 A;  1V1P B;  4PYZ A;  4WQM A;  1J7B A;  3LB8 C;  1DDM A;  4XWT A;  3P4S B;  2QEJ C;  3MC9 A;  3SU8 X;  5E6P A;  4LCD E;  1WI0 A;  1FO4 A;  2KAN A;  4LDT D;  1Q5W B;  5D6J B;  4N58 A;  4GB9 A;  2L1A A;  4NSW A;  2NCN A;  3O96 A;  2AQ3 B;  2Y8F A;  2IY0 B;  3VRB B;  3HHM A;  3Q69 A;  4TKN A;  1T0Q C;  3ZJT A;  3PV1 A;  1MG8 A;  2I1J A;  2BW2 A;  3ULC A;  2BS2 B;  4NJ7 A;  5IA7 A;  3WAL A;  4WJ7 A;  1NEK B;  5G5H A;  5BO4 B;  3GP7 A;  3BVG A;  1EAZ A;  5KQ4 A;  4HHV A;  4KAX B;  2BTE A;  1KFY B;  2OOB B;  3P1M A;  4P1B C;  4BOS C;  4LK0 M;  2E3T A;  3QQ8 B;  3IT6 B;  1H10 A;  1E5W A;  1V5M A;  3APC A;  3M63 B;  2KWU B;  5J2R A;  4NAW B;  1K51 A;  5G55 A;  2C7M B;  2DBY A;  1JML A;  1J19 A;  2UYZ B;  2IPK D;  1UNS A;  4USA A;  3Q6B A;  4TV3 A;  1FNW A;  2FIF A;  3ZJV A;  4ANW A;  1UWM A;  4NPN A;  1X05 A;  1WMH A;  1KTK A;  3ZQ4 A;  5L95 C;  2Z59 A;  2RGN B;  2Z0E B;  4C4V A;  1QC6 A;  2KFK B;  5TR5 A;  2GB1 A;  2XK5 A;  3SO6 A;  1R7S A;  4EFO A;  4IC7 B;  1CZP A;  1WYW B;  2WP9 B;  1GJZ A;  2OHF A;  4W9F A;  2INP E;  3Q14 C;  4O1N A;  4OZA A;  4MAC A;  4F7Z A;  4D2K A;  4WWM A;  1R4N I;  2W82 A;  2CY5 A;  1W1H A;  1AYF A;  2M0A A;  1WRI A;  5AZF A;  3JSV A;  2WXQ A;  2D10 A;  2MKR A;  1P9D U;  1FXT B;  3VTW A;  1JQ4 A;  2JU6 X;  1ZC4 B;  2WXI A;  3BWU D;  3Q3F A;  4YSZ B;  2RGF A;  3W9C B;  1A70 A;  1IRS A;  2I1K A;  4TQ1 A;  5I2S A;  3C0R B;  1CK1 A;  2M14 A;  3U12 A;  2LGS A;  3N30 A;  1GOZ A;  3A4S C;  5HE0 A;  4EMO A;  3V6E B;  2LYD A;  2Z14 A;  1TZO A;  2KTF A;  3KZ1 A;  3CWI A;  4B9K A;  2P0D A;  4FXC A;  4WUR A;  3RN9 C;  4GMV A;  1QOG A;  3M62 B;  2WXJ A;  3PSE B;  3U7Z A;  1J0G A;  3EFC A;  4HRS A;  4K3C A;  2GUM A;  1CMX B;  2BKR B;  3TEY A;  2NZ8 B;  1WIA A;  1P0R A;  3UQB A;  3B1L X;  5JH5 C;  1G6J A;  2EMT A;  1EGX A;  1VZ8 A;  2KUQ A;  2DHJ A;  1I7H A;  2DA0 A;  5LNK 1;  1C77 A;  3DVG Y;  1K52 A;  3AE8 B;  1UNP A;  4HAW B;  4KZ0 A;  1X1M A;  1XLN A;  3AE9 B;  3VUX A;  2KX0 A;  5J3Q A;  4BVU C;  4XWW A;  4ARC A;  2DTC A;  1WJ4 A;  4ZYS A;  3ZDT A;  2DLB A;  4C0A A;  3TIX A;  4JX1 C;  3M3J A;  3ONS A;  4EUT A;  3T06 A;  4CHJ A;  1FPY A;  2KIG A;  2LZ6 A;  3MC0 B;  4RGN A;  1RFA A;  4K1R B;  3OHM B;  1PUT A;  2MW5 A;  2WXL A;  1ZM0 A;  3ULB A;  2LJI A;  4DXA B;  1LXD A;  1HZ6 A;  4MK0 A;  5D7G A;  5AZH A;  4YSX B;  2N7J A;  4L1R A;  2PLP A;  2BPS A;  2NTT A;  2RSU A;  3UI3 A;  2B3A A;  2KKC A;  4EKU A;  4GMX B;  1NBF C;  1I4Q A;  3NS8 A;  2KTR A;  2YVC A;  4N9F 4;  1KJT A;  4MSM B;  2JZZ A;  4J6I A;  4S0R A;  1KM7 A;  2H89 B;  2WXR A;  2VRW B;  1U5F A;  4HAZ B;  1OQQ A;  2IYD B;  5DH9 B;  3DBL I;  2WXF A;  3HM3 A;  1Y5O A;  2M8S A;  3PRP B;  4LNN A;  1U4A A;  2JSV X;  4FJY A;  2WQY B;  2M1M A;  1F2R I;  4WWO A;  1CJE A;  1HTQ A;  1I2H A;  4IFS A;  1ZP0 B;  3BII D;  3V05 A;  4LNK A;  1N62 A;  2YLM A;  2MWN B;  1DBH A;  1PGB A;  3L08 A;  1T5X D;  1TJ6 A;  1QF6 A;  2WHI A;  1V9J A;  2D3G A;  2R2Y A;  3NWD A;  1HTO A;  2QDF A;  2PMV A;  4HAY B;  3MC8 A;  1FHX A;  3TUO A;  4YXD B;  3VR8 B;  4OHJ A;  3D8F A;  1MK7 B;  3KSY A;  2GI9 A;  2LHD A;  3B0A A;  4C7Y A;  2DWQ A;  4HKQ A;  1FRD A;  4L2Y A;  3GS2 A;  4WJQ A;  3HVD A;  4C00 A;  3D32 A;  4MGK E;  4DX9 0;  4A6F A;  2K0P A;  3U30 A;  4ZHP A;  1E8Z A;  5DPT A;  5C5B A;  4KSL C;  2MH7 A;  3VIA A;  4BBK A;  1L6U A;  2FJU B;  2KAC A;  5HI1 A;  1D4B A;  3OAW A;  4X57 B;  2O2V A;  2GJY A;  3I63 C;  3U8Z A;  1ENF A;  2PJH A;  3DCX A;  1U5E A;  1RM6 C;  2W54 A;  1MVK A;  4BZA A;  2KK8 A;  1RLF A;  3H6N A;  2UZR A;  2IDY A;  2I2Y A;  1RRP B;  2JF5 A;  4KIK A;  5FI1 A;  1WY8 A;  4B6H A;  2MCN B;  3VAW A;  3ZRF A;  1U5D A;  3AEG B;  4D0N B;  2ICI A;  4M0W A;  2L76 A;  3V3X A;  1EUV B;  3B2F A;  5D94 A;  1ROE A;  2BYT A;  4CYE A;  4OVV A;  1R4M I;  1F9J A;  1PDX A;  2V4I B;  4HCN B;  1JWB D;  1BT0 A;  3PZ8 A;  3FEH A;  1WXA A;  1TY0 A;  3E56 A;  4GU2 A;  2K8H A;  4E74 A;  1F2R C;  2KDE B;  1RYJ A;  4G11 A;  4LJP B;  3GZN B;  1AWD A;  1P98 A;  3KYD D;  4NJ6 A;  1FHW A;  5CHV C;  2JYT A;  2WXP A;  3GE8 C;  2VRR B;  4EZJ A;  5C23 A;  4EZK A;  3GB1 A;  2ZZP B;  2L2I A;  4ZYN A;  1GNU A;  4Q2J A;  1FFV A;  2JWZ A;  3NSU A;  4MT7 A;  4KX6 B;  1MPH A;  4LNF A;  4DBG A;  2NBV A;  4XE0 A;  2J7Q B;  1TT5 B;  4ICV A;  4DHZ E;  2BVC A;  2KAJ A;  3AUL A;  4LTU A;  3P42 A;  2G9H D;  3ZTD A;  3PHW B;  4HAU B;  3B9J A;  4HSI A;  1C1Y B;  1U27 A;  2D11 A;  2DZJ A;  3RZW C;  3ZDM C;  2MBB B;  2D3B A;  4DHZ B;  2R2O A;  4NAW A;  5C3J B;  3QAR A;  2K22 A;  4IM0 A;  2GBK A;  4KZC A;  4KKI A;  2BKF A;  4OZB A;  1B1Z A;  2MJE A;  4K81 A;  2LXC A;  3PLV A;  4CO7 A;  3RNG C;  1VRA B;  2ZVO A;  1WG7 A;  1ZYI A;  3FM8 C;  1E9M A;  4KHB A;  3P4P B;  1E7U A;  1QKZ A;  3KRW A;  2LOX A;  1T6B X;  5C5B B;  5E6O A;  1K8R B;  1AAR A;  1M7R A;  2KC2 A;  2IO0 B;  3ZXV A;  4Y94 A;  3ZNI D;  3RNE C;  1VR9 A;  2ELB A;  2ROV A;  5L81 A;  4MGI E;  1F0Z A;  2LFI A;  1BAK A;  2REX A;  4IDI A;  3M1I B;  2IGH A;  2KGX B;  3JYU A;  4DHJ D;  2OJW A;  1HA5 A;  2M17 A;  4GPT B;  5DPW A;  4H8S A;  2SEB D;  1LQB A;  5LON B;  1WVH A;  3HSA A;  5LLI A;  2JUO A;  1XEE A;  2CY4 A;  3CXB B;  3WYF B;  1P7F A;  2PVG C;  1NTY A;  3TEZ A;  1GPX A;  2ZJD A;  1XX0 A;  3W2D A;  3NUH B;  2V3S A;  1I4R A;  1B55 A;  2KLC A;  2CS4 A;  3R7Q A;  1PMS A;  1B9R A;  3RUL A;  4P7I A;  2FID A;  1Y56 A;  2RR9 A;  3BK2 A;  1V61 A;  4F8C B;  3AED B;  3T3O A;  2K25 A;  3IG3 A;  2R61 A;  4TUU A;  1X86 A;  1TTN A;  1I7A A;  2N9K A;  4II3 B;  2DAF A;  3N1Z C;  1ZXH A;  1JCK B;  4PYU A;  2ZKM X;  2QIL A;  1SE4 A;  1I4G A;  1YN4 A;  3AEE B;  1L6V A;  1X11 A;  3N1Y C;  1WZ0 A;  2MHJ A;  3VFK A;  4IAP A;  3SD5 A;  3VTU A;  3HQC A;  1HQR D;  5CHW A;  1L4D B;  2O6V D;  1SSN A;  4AOF A;  2IGG A;  1ZXI A;  3ZNZ B;  2COC A;  1C78 A;  5D3X A;  2EEL A;  4QXA B;  2OED A;  4WJP A;  3JVZ X;  2G35 A;  4XYC A;  2W3R A;  3GOE A;  4P6V F;  2LD9 A;  4MM3 A;  3P4Q B;  5L83 A;  4AWJ A;  4DDG D;  3RZF A;  2KWV B;  1NYR A;  2EJ8 A;  3C8Y A;  4W9G A;  4G50 A;  3ZYY X;  2KMM A;  2N9E B;  2V3P A;  1E8X A;  3FVC A;  1IBX B;  4GSW A;  4MH0 E;  2QC8 A;  2NR2 A;  3NZU A;  1E0Z A;  1JW9 D;  4XWX A;  2X8X X;  3A58 A;  1WJU A;  3KYC D;  2EC1 A;  4JIO U;  5JZE B;  4KHB B;  3K9O B;  4ZRQ A;  5D2M B;  1NI2 A;  3PVW A;  3Q8C A;  1L2N A;  2MEK A;  3P63 A;  1U29 A;  2CAY A;  2KTR B;  2W9N A;  3AV8 A;  1KH0 A;  4C7Z A;  3DBH B;  3AEA B;  3AMZ A;  4W9C A;  3QBV B;  1NU2 A;  5GMV A;  2PIA A;  2XK5 B;  2D9W A;  1AN8 A;  3ML4 A;  4GLS C;  4XDC A;  4GIV A;  3L16 A;  4CQN A;  1RWS A;  2HJ8 A;  3EUB 2;  5I2M A;  2HDE A;  2NTS A;  5KQ1 A;  3EEC A;  1MK9 B;  1P6S A;  2KDM A;  3ZGZ A;  2KN5 A;  2FUG 1;  4DHJ B;  2LVP A;  3EC8 A;  4GXB A;  5KCV A;  2D9V A;  4GDL A;  4FN2 A;  3DHI C;  3EFU A;  3MHZ A;  4WH4 A;  1BUI C;  5DPS A;  1L0X B;  2K6D B;  1FHO A;  1OQN A;  5EE1 A;  1T77 A;  3APD A;  2L52 A;  4OVU A;  2PZ1 A;  5C2T B;  3VOQ A;  1V5P A;  3TEX A;  4MGY E;  3RNA C;  3WAP A;  5IOI A;  2BS4 B;  4KIK B;  3SUZ A;  2E6X A;  1XLQ A;  1XD4 A;  1WM2 A;  3R7R A;  2K8B A;  4KV2 A;  1DOY A;  4LNO A;  2BYF A;  2K39 A;  3PVU A;  2JT4 B;  2MP2 B;  2L3Z A;  1XO3 A;  2N23 A;  3TO1 A;  3T9L A;  2NBV B;  1N5W A;  3QJZ A;  1DDW A;  3L10 B;  1RJ2 A;  3RNB C;  1D3Z A;  2DKQ A;  2LUE A;  2GBN A;  4KHA A;  3BZD B;  3AJ4 A;  4KDI C;  2WU2 B;  1WGQ A;  5DPR A;  1UF0 A;  4TSS A;  2M0X A;  1QLB B;  2KDB A;  2WNM A;  3RFZ B;  4KGT A;  2Q5W D;  3NY5 A;  4ACF A;  4MM3 B;  2BQQ A;  2JWU A;  5M4Y B;  2JRI B;  2C60 A;  3Q3N C;  3P4R B;  4DWF A;  4HAT B;  3RCP A;  4PS7 A;  1DDV A;  1V88 A;  2L8J A;  4W9H A;  2R0D A;  5J3T A;  4ARI A;  3NVV A;  4NNJ B;  2KXJ A;  4GZU A;  2VH1 A;  4F7U P;  5KHQ A;  1LB1 A;  1UPR A;  2IO2 B;  3AEB B;  3TW1 A;  1ZGU B;  2DZI A;  2DKP A;  1W1G A;  1GB4 A;  2G1E A;  2OJR A;  1DOI A;  5LXI B;  3Q2A C;  1D6E C;  3ABV B;  1IGD A;  3ZVV A;  1IYF A;  1A5R A;  2MJ3 A;  1TZ1 A;  3NHE B;  5LXH A;  2BB5 A;  4FBJ B;  3BY4 B;  3Q8F A;  3QWM A;  3HW2 B;  1SJE D;  2DAJ A;  4N59 A;  4PS8 A;  1XCT L;  2YS3 A;  3ZIM A;  1MPE A;  4HB4 B;  1UD7 A;  4FHK A;  2JP2 A;  1C9F A;  3DXC A;  4A8X C;  2MSE D;  4HK2 A;  1VJK A;  2D3A A;  4WJO A;  1ZVR A;  1LGR A;  4FLH A;  2I5C A;  2IO1 B;  2PVO D;  4CHM A;  4B0M A;  5AUI A;  2GS0 A;  2JXT A;  1KLG D;  5HG2 A;  1YQB A;  3KVF B;  3BYT B;  4DDI D;  2RRF A;  1OQR A;  3VR9 B;  3LDZ E;  4QJ5 B;  3PSC A;  5MPO A;  4C80 A;  4YTM B;  1V80 A;  4FAD A;  1I4H A;  3Q8A A;  5HHD G;  4F7H A;  4QJ4 B;  4HDQ A;  3MJW A;  2NBU A;  4RGM A;  2KWD A;  1V5U A;  1HE8 A;  3I3T B;  2OTX A;  2KCJ A;  2A4Z A;  1XT9 B;  4E71 A;  4IM3 A;  3UIO B;  5D3W A;  1VLB A;  3O13 A;  4DBB A;  4IWQ A;  1MIZ B;  5KHO A;  2BB6 A;  4M8N A;  4MDK E;  1RFK A;  2L1C A;  3KWL A;  4US9 A;  1L4Z B;  5FI0 A;  2FJL A;  2ELA A;  2KX3 A;  1OTR B;  1TBE A;  1WJ6 A;  3JSV B;  3WIM A;  2C9W B;  4LDT B;  4ANU A;  5FR3 A;  2IND C;  4WSF A;  2KQS A;  2GBM A;  2VKI A;  4ZRJ A;  2RNR B;  2ZPN A;  2KT7 A;  3QK0 A;  5BYS A;  4HWI B;  4A3O A;  2QHO A;  4A6F B;  3RNF C;  4HJK A;  4DK5 A;  4G0N B;  3Q3M C;  4R3D A;  2MP2 A;  2YRY A;  5D3I B;  3LYY A;  1QOB A;  1OEY A;  4OZC A;  2L0T A;  1EVH A;  1FEH A;  2E2X A;  4H2A A;  1SE3 A;  2EKI A;  1ZUD 2;  3NG0 A;  1MJD A;  1V8C A;  1TKG A;  2NPT A;  4GOC A;  1WXM A;  4KVG B;  2RDH A;  1XQQ A;  1FNV A;  3V6C B;  1Q67 A;  3ZW3 A;  2JXX A;  2JZ3 B;  3B08 A;  1EWY C;  3B2G A;  4JWS C;  4KKJ A;  1L0Y B;  4ZRK A;  1WMH B;  3RCZ A;  1TY2 A;  1BTN A;  1I42 A;  1YNT E;  1AQC A;  3PRZ A;  1WXV A;  3EHV A;  1P1A A;  4XZ4 A;  1N60 A;  2O2V B;  3DXD A;  4A55 A;  3APF A;  4QJ3 B;  2WDR B;  3H7P B;  3DBR B;  2CJN A;  1J0W A;  2Z0Q A;  5C1Z A;  3PO0 A;  2LKO A;  4OT1 A;  2L05 A;  4NZL B;  2KDF B;  3ZUN A;  2DZK A;  4OW0 A; 
#chains in the Genus database with same CATH homology
 1GC7 A;  1Z87 A;  5L81 A;  2DHZ A;  3DPD A;  4MGI E;  4ICU A;  4E3C A;  1BAK A;  3A33 B;  4MJS A;  2N0Y A;  2REX A;  3M1I B;  2OQB A;  2HD5 B;  3A1Q A;  4HVB A;  2KGX B;  3JYU A;  4DHJ D;  2Q13 A;  4NQK E;  3AU4 A;  2YF0 A;  2M17 A;  2LG1 A;  4GPT B;  3TCA A;  1WGD A;  3OAN A;  2ZEQ A;  3ENE A;  4M0W B;  1ZW7 A;  4H8S A;  3ZNH B;  4WAA A;  3CSF A;  4BOZ B;  2QKM A;  1ZSQ A;  1LQB A;  1ZC3 B;  1WVH A;  4KHO A;  1MKE A;  5LON B;  2BF8 B;  3IFW B;  3AI5 A;  3Q3J A;  4PYZ A;  2JUO A;  5LLI A;  4W9L A;  2CY4 A;  3CXB B;  3WYF B;  1DDM A;  1DRO A;  2A5U A;  2BWF A;  5CX3 A;  2KD0 A;  1XCG A;  1NTY A;  1XOD A;  2KLG A;  3CMM B;  4IWP A;  5E6P A;  4LCD E;  3SU8 X;  1WI0 A;  2IYB A;  2ZJD A;  1C3T A;  2PE9 A;  1XX0 A;  1WFY A;  2KAN A;  4LDT D;  1Q5W B;  4URK A;  4ANV A;  2V3S A;  3PT2 B;  4GGQ A;  3ZTC A;  1B55 A;  3PP2 A;  2KLC A;  5D6J B;  2CS4 A;  3DDC B;  4GB9 A;  4NSW A;  2NCN A;  3O96 A;  2C7H A;  2Y8F A;  2AL6 A;  2IY0 B;  3R7Q A;  3HHM A;  1PMS A;  4TKN A;  3PG7 A;  1V2Y A;  4P7I A;  5CLQ B;  2FID A;  3RUL A;  4Z2N A;  2RR9 A;  3PV1 A;  1MG8 A;  2ADZ A;  2I1J A;  1KLV A;  1V61 A;  4F8C B;  2BYV E;  2K25 A;  3IG3 A;  3ULC A;  4NJ7 A;  4TUU A;  5IA7 A;  1X86 A;  4WJ7 A;  1I7A A;  1TTN A;  4II3 B;  2DYN A;  3WAL A;  5DPW A;  5BO4 B;  5G2N A;  3VH3 B;  2DAF A;  1EAZ A;  5KQ4 A;  4HHV A;  2K1F A;  2COF A;  4KAX B;  2L00 B;  2RPQ A;  2CR5 A;  2OOB B;  4PYU A;  3QWZ B;  2IY1 B;  4BKG A;  4BOS C;  2UWQ A;  2KNB A;  3A1Q B;  2AEH A;  2DZK A;  4EOY A;  3PHX B;  1WGU A;  1H10 A;  3QQ8 B;  1V49 A;  3N32 A;  1E5W A;  1V5M A;  2ZNV B;  1X11 A;  4G3X B;  1WZ0 A;  3V61 A;  3VFK A;  1KOT A;  3APC A;  2COD A;  4IAP A;  3M63 B;  3SD5 A;  2LJ5 A;  1YIW A;  2KWU B;  5J2R A;  2DEN B;  4NAW B;  3VTU A;  3HQC A;  5CHW A;  5G55 A;  2FCS A;  2O6V D;  3VVW B;  2YSZ A;  4AOF A;  2KVR A;  3V60 A;  2GCJ A;  2C7M B;  1U5G A;  5FR6 A;  2K2U A;  3ZNZ B;  2COC A;  1X1G A;  5D3X A;  2LAS A;  2G4S A;  3QIJ A;  3V62 A;  4F7G A;  3W1S A;  1J19 A;  2UYZ B;  2RSG A;  1E8Y A;  4TV3 A;  4WJP A;  2FIF A;  2V76 A;  3JVZ X;  4FHJ A;  4HAX B;  1OGW A;  2G35 A;  3DVN U;  3O65 B;  1BWN A;  3GOE A;  1QZE A;  4B6W A;  4ANW A;  3PLU A;  1WZ3 A;  3QCA A;  3U7D A;  2LD9 A;  3ALB A;  3PRE A;  2Y7B A;  4MM3 A;  4NPN A;  4DHZ B;  5L83 A;  4ZRI A;  2DYB A;  1X05 A;  1RAX A;  3TL5 A;  1WMH A;  4AWJ A;  4HB3 B;  5L95 C;  4DDG D;  2RGN B;  1WX7 A;  3RZF A;  5HE1 A;  1SE9 A;  2KWV B;  2EJ8 A;  1PLS A;  1UEL A;  2Z0D B;  2Z0E B;  4G50 A;  1P3R A;  4W9G A;  3ZKJ C;  3QX1 A;  1QC6 A;  2KFK B;  5TR5 A;  3ZO5 B;  4A20 A;  2LVQ A;  2N9E B;  3DXE A;  4YON A;  2XK5 A;  3SO6 A;  1UBI A;  2LVO A;  3T9L A;  4EFO A;  4IC7 B;  3MPX A;  3PEG A;  1V6E A;  2KOX A;  3MTN B;  1E8X A;  4W9J A;  1WI1 A;  1OEY J;  1WYW B;  4RM8 A;  4I6P A;  1XD3 B;  4BBN F;  4MEL A;  3PPA A;  4GSW A;  4MH0 E;  1GJZ A;  4PQ0 A;  2NR2 A;  1ZKH A;  4A5K A;  2JRH A;  3NZU A;  4XWX A;  4W9F A;  5EDS A;  1H8C A;  2ASQ A;  3RYT A;  4IW0 A;  3QA8 A;  4HLE A;  1WJU A;  1P5T A;  2MRP A;  3KYC D;  4F7Z A;  4XC2 A;  2EC1 A;  1R4N I;  4JIO U;  5JZE B;  4K7W A;  3R66 C;  4KHB B;  3K9O B;  2CY5 A;  1W1H A;  1TGZ B;  2R2Q A;  1JRU A;  3X23 A;  2G3Q B;  2Z0P A;  4WWP A;  3S2A A;  3W1Y A;  2LUL A;  5D2M B;  5AZF A;  1NI2 A;  4KDL B;  3PVW A;  2N1W A;  2CRF A;  1PQS A;  3A9J B;  3JSV A;  1K5G B;  2D10 A;  2MKR A;  2DN6 A;  1P9D U;  4W9K A;  1U29 A;  2CAY A;  4B9K A;  1FXT B;  2IBI B;  2KTR B;  2W9N A;  2D9Y A;  2LOZ A;  3KUZ A;  3N3K B;  3VTW A;  4A3O A;  1ZC4 B;  2M4N A;  3Q3F A;  4PNK A;  3A98 B;  2RGF A;  2ZNV C;  2WDT B;  1Y8R C;  5C6R A;  4TQ0 A;  2DYM A;  5LOP B;  3OLM D;  2BYE A;  4W9C A;  3QBV B;  1IRS A;  1NU2 A;  3ML8 A;  5GMV A;  5J17 A;  4ASW C;  1WH3 A;  2ZVN A;  1LFD A;  2O6V A;  2GCL A;  2XK5 B;  2D9W A;  2I1K A;  3ML4 A;  3LJ3 A;  4TQ1 A;  2LGX A;  2R09 A;  3IHP C;  3L16 A;  1S1Q B;  4GIV A;  2BGF A;  3DVN V;  3C0R B;  4W9E A;  2M14 A;  3P7Z A;  2HJ8 A;  1TQZ A;  3N30 A;  2BCJ A;  3WA0 A;  2Z59 B;  2DYO A;  2PE6 B;  4IUM B;  2I5F A;  3A4S C;  2W2W A;  5AEK B;  5HE0 A;  5KQ1 A;  4EMO A;  3V6E B;  2LYD A;  3EEC A;  2FAZ A;  5DIF B;  1MK9 B;  1P6S A;  3TFM A;  3LJU X;  2GMI C;  2KN5 A;  2KTF A;  2KDI A;  4DHJ B;  3KZ1 A;  1WGY A;  5D3Y A;  2P0D A;  2LVP A;  2LRU A;  3KUC B;  5C16 A;  3EC8 A;  1Z2M A;  3VHT C;  2YT0 A;  1WM3 A;  2RD0 A;  1AWE A;  2YS1 A;  4GXB A;  1EO6 A;  4GMV A;  3M62 B;  5KCV A;  2D9V A;  2AL3 A;  4IG7 B;  3PSE B;  4GDL A;  4FN2 A;  3TJP A;  1X1F A;  1J0G A;  2J0K A;  3ZNG C;  3EFU A;  3ODW A;  1Q1O A;  4K7S A;  1SIF A;  5DPS A;  3WAM A;  4JGH B;  1W1D A;  2K6D B;  4WQO B;  3ZRC A;  2FNJ B;  1FHO A;  1CMX B;  5C79 A;  4TYZ A;  2L0F A;  1OQN A;  1QQG A;  2BKR B;  2NZ8 B;  1WIA A;  1P0R A;  3APD A;  3UQB A;  5LXH A;  3B1L X;  2KO3 A;  5JH5 C;  1FGY A;  2HTH A;  1YJ1 A;  4OVU A;  2PZ1 A;  1G6J A;  2FCQ A;  3VOQ A;  1V5P A;  5J3Y A;  2K8C A;  2EMT A;  1EGX A;  4B95 A;  1WJM A;  3VUW A;  4MGY E;  3DCG A;  2DHJ A;  3WAP A;  1MAI A;  2DA0 A;  4KIK B;  5IAA C;  2QKL A;  1I35 A;  3SUZ A;  2PEA A;  3GYO A;  1XR0 B;  4I6L B;  3DVG Y;  3VQI A;  4KDI C;  1XD4 A;  3A9K B;  1WM2 A;  3R7R A;  2K8B A;  4KV2 A;  2LWP A;  2KHW B;  2BYF A;  5JHA A;  1UNP A;  2K39 A;  3PVU A;  2JT4 B;  1SHC A;  2L3Z A;  2MP2 B;  2N23 A;  4HAW B;  3TO1 A;  2NBV B;  1RRB A;  3DQV A;  4KZ0 A;  3QJZ A;  4HPL B;  1NTV A;  3GYP A;  1X1M A;  1DDW A;  1WGG A;  3L10 B;  1WX8 A;  1RJ2 A;  2YS5 A;  2P0F A;  2RUK B;  5D3V A;  1D3Z A;  1UEF A;  2DKQ A;  3D8D A;  4RMA A;  1WX9 A;  1WR6 E;  3VDZ A;  3VUX A;  4WJN A;  1P3Q U;  5HE2 A;  2KX0 A;  1V86 A;  2N9X A;  5J3Q A;  2EMS A;  2LGD A;  2LUE A;  2HTH B;  2HE7 A;  2VSZ A;  4MY6 A;  1IPG A;  4BVU C;  2X18 A;  2DTC A;  1WJ4 A;  1YX5 B;  4KHA A;  2GBN A;  3ZDT A;  1XKE A;  4C0A A;  3TIX A;  1UGM A;  3AJ4 A;  3P6A A;  4WVF B;  2D07 B;  2KFK A;  2LXA A;  3M3J A;  3ONS A;  4II2 B;  1WGQ A;  5DPR A;  4EUT A;  1ISN A;  2YT1 A;  3T06 A;  3KH0 A;  2M0X A;  1E8W A;  4CHJ A;  1LM8 B;  3MDB C;  2LZ6 A;  4K2P A;  3UZT A;  4GDL B;  4KSK C;  4MSQ B;  1GG3 A;  1RFA A;  4K1R B;  2WX0 A;  2KDB A;  3TBL D;  4F1S A;  1GC6 A;  2MW5 A;  1ZM0 A;  3NY5 A;  3ULB A;  4PS3 A;  1YD8 U;  1UBQ A;  3H1U A;  5CLL B;  3QHT A;  4BKS D;  2UVM A;  4A6H A;  3PGE A;  2JRI B;  1FGZ A;  4DXA B;  2KMC A;  2C60 A;  4FA6 A;  2KMA A;  3NZS A;  1LXD A;  4DWF A;  4HAT B;  3RCP A;  2XBB C;  4MK0 A;  4PS7 A;  3AU5 A;  1DDV A;  1V88 A;  2XQN M;  4IOY X;  2L8J A;  4M8M A;  4W9H A;  2R0D A;  3RT3 B;  5D7G A;  3L0W B;  5AZH A;  2D4Q A;  1IP9 A;  5C1Z A;  2FCM A;  4GDK A;  5J3T A;  3KY9 A;  2BPS A;  4NNJ B;  2KXJ A;  4GZU A;  2KJH B;  1PFJ A;  4F7U P;  2KJR A;  3IBE A;  2M38 A;  1WRD B;  2DX5 B;  4XZ4 A;  2G45 B;  2RSU A;  3VH4 B;  3P2B A;  1LB1 A;  5KHQ A;  1UPR A;  5GOW B;  3DOW A;  2B3A A;  2MDX A;  1Q0W B;  2IO2 B;  3TW1 A;  1E90 A;  2CHW A;  2IFS A;  2KKC A;  2MA9 B;  4EKU A;  1ZGU B;  4GMX B;  1NBF C;  2DZI A;  3SHQ A;  5DHF B;  3VTV A;  2WX1 A;  2DKP A;  2KQ7 A;  1WGH A;  1W1G A;  4MGZ E;  1V5O A;  4I6N B;  5AZG A;  3NS8 A;  1V5T A;  2KTR A;  3PRM B;  2YVC A;  2OJR A;  2J59 M;  4IM2 A;  4N9F 4;  1KJT A;  5LXI B;  1T0Y A;  2LI5 A;  2MWS B;  2JY6 A;  4MSM B;  1WE6 A;  2JZZ A;  4J6I A;  1FOE A;  3A8Q A;  3X0W A;  1KM7 A;  4JLC A;  3F5R A;  3ZVV A;  1VCB A;  3N7C A;  3W1S C;  1A5R A;  1IYF A;  2VRW B;  4L6E A;  1U5F A;  4HAZ B;  2IYD B;  5DH9 B;  1Z5S B;  3DBL I;  2DFK A;  1TZ1 A;  3HM3 A;  3NHE B;  4FBJ B;  1Y5O A;  2KZR A;  2M8S A;  3BY4 B;  3H9D A;  3PRP B;  1U4A A;  4FJY A;  3QWM A;  2M1M A;  3HW2 B;  4BBN C;  2DAJ A;  4DX8 A;  2D9Z A;  3IVF A;  2BWE S;  2DHK A;  2G4D B;  4PS8 A;  5HE3 A;  4WWO A;  1I2H A;  4IFS A;  1DYN A;  2AWT A;  2ZCB A;  2K6Q A;  4GDK B;  1WJ1 A;  1M94 A;  2YLM A;  5CHF A;  2N7D A;  2H7E A;  2MWN B;  2YS3 A;  1DBH A;  3KUD B;  3ZIM A;  2NPT B;  4HB4 B;  3ZVR A;  1UD7 A;  3L08 A;  3FSS A;  4FHK A;  2JP2 A;  4LJO B;  1TJ6 A;  1M7E A;  3DXC A;  2DLW A;  1V9J A;  2D3G A;  2MBE A;  2MSE D;  4HK2 A;  3OJ4 B;  4HAY B;  4WJO A;  1FHX A;  1ZVR A;  2NBW B;  4A6K A;  3SDL C;  1N3H A;  2EKE C;  4Z2M B;  2IO3 B;  4FLH A;  2I5C A;  4BKS A;  2IO1 B;  3ML9 A;  4CHM A;  1UNQ A;  2MX2 A;  2GBR A;  1K5D B;  3D8F A;  2WWZ A;  3CST A;  3UIN B;  3VUY A;  3WAO A;  1MK7 B;  2MBQ A;  3A8P A;  1FAO A;  2GS0 A;  3KSY A;  3ODO A;  2J0M A;  3B0A A;  5CTR C;  4MJS B;  1YQB A;  1GUA B;  3ZLZ A;  5JLJ B;  2CU1 A;  4WJQ A;  2DYQ A;  3GZN I;  3KVF B;  3D32 A;  4A3P A;  5DCN A;  1Y19 B;  4DX9 0;  3DBH I;  3M95 A;  4MGK E;  2GOW A;  4A6F A;  4DDI D;  4HB2 B;  3LDZ E;  3H7S A;  3U30 A;  1WGR A;  2DX5 A;  4EJN A;  1E8Z A;  5DPT A;  3PSC A;  5C5B A;  4FUL A;  4KSL C;  1YX6 B;  3VIA A;  3VXW A;  2D9X A;  4BBK A;  3H7P A;  3MHS D;  1V80 A;  4FAD A;  2GBJ A;  4HXD A;  2Y8G A;  3A4R A;  2C5L C;  3OAW A;  2P0H A;  3BIN A;  4X57 B;  2MQJ A;  2K00 A;  2O2V A;  2GJY A;  2KWC A;  4AJY B;  3U8Z A;  3RUI B;  4F7H A;  2PJH A;  4HDQ A;  1U5E A;  2N7E A;  2NBU A;  3MJW A;  1V5U A;  2JVC A;  1HE8 A;  2KK8 A;  1NDD A;  3F0W A;  1RLF A;  2J0J A;  1UZX B;  3DVG X;  2OTX A;  3H6N A;  3I3T B;  2RVB B;  2UZR A;  2KDF B;  2NVU I;  1RRP B;  3WAN A;  2JF5 A;  4KIK A;  5HKH A;  3UQA A;  2KCJ A;  1MIX A;  2A4Z A;  5FI1 A;  4HAV B;  2LGY A;  1XT9 B;  1WY8 A;  2WYQ A;  4B6H A;  4IM3 A;  2NS5 A;  1KZ7 A;  2W2X C;  5D3W A;  2MCN B;  3UIP B;  3UIO B;  1U5D A;  3VAW A;  3ZRF A;  4ANX A;  4DBB A;  1EF5 A;  4D0N B;  4IWQ A;  1MIZ B;  5KHO A;  2ZCC A;  2KUP A;  2KC1 A;  2KFJ A;  2L76 A;  3JW0 X;  4MDK E;  1EUV B;  2N9P C;  4M8N A;  2NMB A;  4RM9 A;  5D94 A;  3UGB B;  4EEW A;  4CYE A;  4OVV A;  2L1C A;  1R4M I;  1KI1 B;  1E7V A;  1F9J A;  3D8E A;  1L7Y A;  4HCN B;  3ECI A;  1BT0 A;  4ZDV A;  1U2B A;  3L54 A;  5FI0 A;  2FJL A;  1BTK A;  2ELA A;  4NY0 A;  5JHH A;  1WE7 A;  2FUH B;  2KX3 A;  3PS6 A;  3FEH A;  4JL9 A;  1OTR B;  1WXA A;  3BJI A;  1OQY A;  1WXS A;  3R3M A;  1TBE A;  4GU2 A;  2K8H A;  1WJ6 A;  3A9J A;  3HM6 X;  3JSV B;  3WIM A;  4E74 A;  2C9W B;  2CHX A;  4LDT B;  4XX5 A;  5JP4 A;  2KDE B;  3A9K A;  3UF8 A;  4G11 A;  3AXC A;  4LJP B;  5DHA B;  3TMP B;  4ANU A;  4NQL B;  3KW5 B;  1P98 A;  2K2J A;  3KYD D;  3L17 A;  4NJ6 A;  1FHW A;  4HCP B;  2MBH A;  1SGH A;  4WSF A;  2N1V A;  2KQS A;  5CHV C;  2GBM A;  2VKI A;  2O6V B;  3OJ3 A;  4ZRJ A;  2VRR B;  4EZJ A;  2RNR B;  2ZPN A;  3QK0 A;  4IWO A;  4HWI B;  1WJN A;  2IZV B;  2LRW A;  2MBO A;  3PVL A;  2QHO A;  2XEW A;  5E6N A;  4A6F B;  5C23 A;  2Y5B B;  4JQW C;  4EZK A;  3L13 A;  2ZZP B;  4HJK A;  2L2I A;  4DK5 A;  1LW3 A;  3DBR I;  4ZYN A;  1GNU A;  1S3S G;  1UH6 A;  3PZD A;  2JWZ A;  3NSU A;  3PTF C;  4MT7 A;  4G0N B;  1MPH A;  4DBG A;  3HIZ A;  4AJW A;  2MP2 A;  2YRY A;  2JPH A;  2J7Q B;  4ICV A;  1KZG A;  1OEY A;  3QAQ A;  4DHZ E;  4CHK A;  2L0T A;  1EVH A;  4EZL A;  2UZS A;  2E2X A;  2FCN A;  2V1Y A;  4K17 A;  3SNH A;  3QC8 B;  2DX1 A;  3AUL A;  5JHG A;  4AP4 C;  2AYO B;  3ZTD A;  2W2X D;  3PHW B;  4HAU B;  2NPT A;  4GOC A;  1WXM A;  4YL8 A;  1C1Y B;  1U27 A;  2D11 A;  1V89 A;  2N4F A;  2DZM A;  4KVG B;  1J8C A;  2DZJ A;  5JHB A;  4BFR A;  1XQQ A;  1EF1 A;  3RZW C;  3V6C B;  3ZDM C;  5EFX A;  1Q67 A;  2MBB B;  5DI9 B;  4HB0 B;  1WF9 A;  3ZW3 A;  2L7R A;  3TVV A;  4MEM A;  2H7D A;  4GN1 A;  4FJZ A;  2R2O A;  4K2O A;  3V5W A;  3HK0 A;  5D27 A;  1WR1 A;  2JXX A;  2JZ3 B;  3DBS A;  3B08 A;  2RLO A;  3QAR A;  4NAW A;  1OMW A;  2ROZ B;  2Z0O A;  4IM0 A;  1UNR A;  2GBK A;  1FB8 A;  4KZC A;  3RD2 A;  4FJV B;  4ZRK A;  1WMH B;  2PPH A;  1TXD A;  4W9I A;  2BKF A;  3RCZ A;  2V4L A;  1L2N A;  1BTN A;  1H4R A;  1I42 A;  4K81 A;  2COA A;  3G9W A;  1AQC A;  2CHZ A;  2LXC A;  3PLV A;  1VD2 A;  3PRZ A;  4W9D A;  4BKT A;  4CO7 A;  1WXV A;  3SYX A;  4E71 A;  3EHV A;  2ZVO A;  1P1A A;  3SV1 A;  2DHI A;  2C7N B;  1UPQ A;  1WG7 A;  2O2V B;  3DXD A;  1OY2 A;  3FM8 C;  3NOB A;  2MLB A;  3APF A;  1V81 A;  1E7U A;  3ODX A;  3KRW A;  2D2Q A;  2LOX A;  3H7P B;  5J18 A;  2ZPY A;  5C5B B;  2KJ6 A;  4HPM B;  1J0W A;  2Z0Q A;  1K8R B;  5E6O A;  1AAR A;  4WWN A;  1M7R A;  2KC2 A;  3CF6 E;  3T8M A;  2P8V A;  2MFQ A;  3KRX A;  3ZUN A;  2IO0 B;  2LKO A;  4AUQ C;  3K9P B;  3CIK A;  4Y94 A;  2L05 A;  4K7U A;  2CKH B;  3ZNI D;  4HDO A;  2ELB A;  2ROV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...